3UN6A

2.0 angstrom crystal structure of ligand binding component of abc-type import system from staphylococcus aureus with zinc bound
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
291
structure length
291
Chain Sequence
QQVIKIGYLPITHSANLMMTKKLLSQYNHPKYKLELVKFNNWPDLMDALNSGRIDGASTLIELAMKSKQKGSNIKAVALGHHEGNVIMGQKGMHLNEFNNNGDDYHFGIPHRYSTHYLLLEELRKQLKIKPGHFSYHEMSPAEMPAALSEHRITGYSVAEPFGALGEKLGKGKTLKHGDDVIPDAYCCVLVLRGELLDQHKDVAQAFVQDYKKSGFKMNDRKQSVDIMTHHFKQSRDVLTQSAAWTSYGDLTIKPSGYQEITTLVKQHHLFNPPAYDDFVEPSLYKEASRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Hypothetical Protein SAOUHSC_00137
publication title 2.0 Angstrom Crystal Structure of Ligand Binding Component of ABC-type Import System from Staphylococcus aureus with Zinc bound.
rcsb
source organism Staphylococcus aureus subsp. aureus
total genus 98
structure length 291
sequence length 291
ec nomenclature
pdb deposition date 2011-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13379 NMT1_2 NMT1-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3un6A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3un6A02
4OFOA 4IY6A 4GVOA 2RKMA 2XX8A 4WEDA 1WVJA 4PFYA 1B3HA 4KPTA 3USDA 3O29A 4EXKA 1H43A 5FTIA 3OXNA 4GXSB 2Q8JA 3FVNA 3CSGA 4G68B 1B32A 2I48A 4OEVA 1IEJA 2UVJA 5B70A 1LAXA 3K6UA 4E0XA 5AA2A 1R9QA 4LUBA 4R6KA 4C0RA 5TP9B 1B2HA 2VGQA 2ONSA 4JDFA 3ZSFA 1Y3NA 3MZ9A 2IA4A 1P99A 4NMYA 1JQFA 1A55A 4Q30B 3KOTA 2DE2A 1XC1A 2Y7IA 2ABHA 4QHQA 1I6AA 3HO7A 1LB8A 3TDJA 1VSOA 1LBBA 3TTRA 2P0SA 2PT2A 3T22A 4JSDA 3SEXA 1A40A 4FJPA 2F36A 2VP1A 5A5XA 1IXHA 3DELB 3T9UA 3OMBA 3VVEA 2LAOA 3OELA 2QS4A 1HSJA 5AA4A 1LLSA 4AB5A 4BDNA 5DT6A 4FIMA 3IL1B 3M3LA 2IEEA 1B05A 2GH9A 3G3IA 4F1YA 3RLFE 1SW2A 2UYFA 2ZXTA 4RPOA 3PUVE 2A5TA 2DWIA 3PU5A 4H65A 3SEYA 4ZECA 4ZE8A 4FEDA 1ZTYA 4ELOA 1MY0A 3QAXA 3MP1A 5FHNA 4F1VA 4PFWA 3SEVA 5I2NA 2O1MA 3BKIB 1WODA 3SEUA 1D4NA 2HFBA 1XHYA 4MH5A 4ND9A 3CI8A 1MM7A 2O68A 4YKKA 1FTLA 4FEBA 3BBRA 3O28A 1D9YA 1DPEA 4R2BA 5FTHA 2AIXA 1B5HA 1PB9A 4BLAA 4QRZA 2OLBA 2NOOA 2ZYKA 2OWSA 3O2AA 5TU0A 3E9XA 4G8NA 4IY5A 3KFMA 4BDMA 4RK9A 1MY2A 4POXA 1B0HA 3TZAA 3RN8A 1USYH 2DE4A 3H6TA 3G7WA 1ZBMA 1PB8A 1TFDA 4RY1A 2O7UA 1LBCA 5ELVA 2ESNA 3O66A 1P1QA 2FNCA 3W9VA 1M5FA 3K00A 3RT8A 3RY3A 2HZLA 3QUJA 3N6UA 4RJZA 3R26A 1URSA 2XHDA 4ONYA 4WXJA 4GLIA 1QUKA 4OHNA 3PD8A 3PMWA 4QSDA 1IQ7A 3T93B 1LAFE 2XXYA 1N04A 4JBZA 4JWOA 5IAIA 1URDA 4BDRA 2O7IA 3PPPA 1NNTA 4MLVA 3CVGA 3MC2A 3FV2A 1B40A 3P7IA 4NF8B 3MPKA 3JZJA 5ITOA 3GBBA 4KYEA 4EXLA 1MPDA 3N6TA 3MW0A 2DOJA 1FQBA 1MY4A 5AA1A 5JTYB 3HV1A 1MPBA 5I59A 1LFGA 5FHOA 1F9BA 4IO6A 3IOUA 4LQ2A 1SDXA 1FCKA 4LZ7A 5L8DA 3LSLA 1B52A 2DQVA 3W9WA 2E0SA 4H67A 2QMWA 2I58A 5ICTA 1UTBA 4YMBA 4IGTA 3T96B 2NWJA 5JK4A 2HAVA 1H45A 2I0CA 1GV8A 1BP5A 4DXBA 1B3LA 2I4BA 3C32A 2RC8A 2DVZA 1LFHA 3ILTB 2HQ0A 1VR5A 2B3FA 4TLMB 3GXAA 3FVKA 2ALUA 1ZIUA 4RNSA 5I56B 3TCGA 3TTLA 3BFUA 4IB2A 4G2ZA 3IJXB 1SQYA 2QMXA 3JV9A 4U22A 1OQHA 1TFAA 1B3FA 4N13A 2RCAA 1IXIA 1QUJA 1Y3QA 1LSTA 3TQWA 2OBGA 4OYVA 5FHMA 4X1BA 2Q88A 4NF6A 4ELQA 5I2NB 4AB6A 3T9XB 5KCJB 3IR1A 3JYRA 1I69A 1Y4TA 1VE4A 4X48A 3VVFA 4ZEKA 1B4HA 4MLQA 1B46A 3R7XA 3SETA 3KJ7A 4IO4A 1N7WA 3TQLA 4YKIA 3UIFA 1ZKBA 2OZZA 4MFIA 3H03A 2F35A 3EHUA 3C31A 3UGWA 3S9LC 1JVXA 5CMKA 2PMSA 1QJMA 1RYXA 5CM6A 3OO7A 4QFOA 1XOCA 1Z7ME 3G3JA 3EF7A 4JWYA 3K2DA 2Z22A 3FXRA 1XVXA 4F18A 2D3IA 2GHAA 3HSTA 1MQHA 2X26A 1ZMGA 4LA9A 5KZTA 1S7YA 3K0VA 1A54A 4QSEA 1XS5A 3PPOA 1H3DA 4R72A 1Y4CA 3E3KA 4DIGA 5DEXB 1BIYA 1IXCA 1N0TA 2O51A 1LB9A 5H8QB 1OIBA 4O3CA 1M5EA 4FATA 3AXFA 3VVDA 3DP4A 5TPAB 1A8FA 1PBQA 1FQEA 2RC9A 4NE4A 5CI5A 1MY1A 4XKRA 4NF5A 3SERA 2UVGA 3M8UA 4C1TA 3PPNA 1ZLQA 4H8JA 1JEVA 3SESA 5KDTB 5F1QA 3LSWA 4QFLA 1MQJA 2F7BA 2F6PA 3O9PA 4XIGQ 2HEUA 1LCFA 5I59B 2AL5A 1TXFA 2OJTA 3TCFA 2PT1A 1JW1A 2WKYA 3VXCA 4OZ9A 1CB6A 4G8MA 4YB5A 3EPEA 3SKPA 4QFKA 2QS1A 4YB7A 3IK6B 3VXBA 1TWYA 2DWJA 3KEIA 2QRYA 4DZ1A 4ZEIA 5ITPA 4NF4A 2OK2A 4I8CA 1M5DA 3TTMA 1DSNA 4XKPA 4I62A 4M1VA 4WKMA 1M5BA 5JEIA 1TT1A 3PUXE 4IO5A 2DSFA 1OQGA 2XXXA 2RINA 3CFXA 2ZNUA 5AE4A 2V3TA 1N3XA 3CFLA 3CRBA 1IXGA 1NL5A 2ZYNA 1A7LA 5CC2A 4LVQA 2THIA 5L9OA 2D21A 3TUSA 1PBPA 3LSFB 3EN3A 3H6VA 3V8XB 1OVBA 1FW0A 1B9JA 1P1NA 5ISUA 4L17A 3VFJA 2XXRA 2QSXA 3VLUA 4JB7A 3Q27A 3UA8A 1QKBA 1R1NA 3FV1A 5B7DA 5H8FA 2ANJA 2KLFA 3V5AA 4N07A 1Y1MA 2Z8FA 3W15C 5J1DA 3ZKLA 4U4SA 4O3BA 2GHBA 5DYHA 1YTVA 3KGCA 4OEUA 1LAHE 4F3SA 4OMBA 5H8NA 4FAJA 3G3KA 3O6IA 1NNFA 4LQ5A 4KHZE 1GTKA 4DXCA 2QL3A 2ZNTA 1LFIA 4THIA 3CG1A 3LUYA 2P1SA 1ZU0A 3PPRA 3K6WA 1BTJA 1Q35A 5EHMA 3GLBA 2H25A 4Z7EA 2V3QA 1SYIA 1B3GA 4EF1A 1ANFA 1S50A 5I58B 3L6GA 2W7YA 3CIJA 3FXUA 3QUFA 4U23A 3A3CA 1PDAA 1YPNA 4DDDA 2Q9TA 3DM0A 4P0IA 5DTBA 1MPCA 1MQDA 1FQAA 3B6QA 3TAJA 3CFZA 3I6VA 4XTCQ 1B7ZA 3FJGA 4YU0A 4EDPA 1R6ZA 3K1MA 3OSRA 4YAHX 3MZBA 2UVHA 3C4MA 1MXWA 2YJPA 2O84X 4Q8RA 5H8HA 2F5XA 3PGFA 2ZYMA 1AMFA 3K6VA 2YLNA 3T9VA 2O1LA 1NH7A 4F3PA 3MVZA 4F31B 1L5TA 4WEPA 3K6XA 3PD9A 3MZ1A 4GD5A 3RTFB 4KI0E 4JSOA 4ELPA 3N94A 3IB2A 1DMBA 4LONB 4PE5B 3PUWE 3MPLA 3Q25A 1QW0A 3H6UA 3TEPA 4RXLA 3O6HA 4GF8A 4ZDMA 3QYTA 3FGSA 3GZGA 4R74A 3TTNA 2Z23A 4Z0IA 4OFJA 3N5LA 5AA3A 3OOAA 2GFEA 1FQFA 1RKMA 2UXAA 4OQOA 4ZZEA 4EQBA 2Q2CA 4N6PA 1YCJA 4NEDA 5L9MA 5AA2B 1PB7A 2DS9A 1EU8A 1Y9UA 4R2FA 1H44A 5CMCA 3LSXA 1FTMA 1O7TA 3MVYA 3QXMA 5HBCA 3S9EA 1ATGA 3RT6B 3S4UA 5IKBA 4QFNA 1OLAA 3T66A 5I2KA 1NH8A 3B6WA 4LZ8A 3DP6A 4R73A 2UYEA 4H8IA 2NVUB 1JVYA 3U94A 3MAMA 3OD7A 4RYAA 4F2QA 5A5XB 1UIVA 1B1XA 1NNPA 1QUIA 3THIA 3U72A 4GOTA 3PPQA 2VHAA 3H3GA 3ZS6A 2QS2A 5AA4B 3IJOB 4EQ9A 4ISUA 4U1ZA 2YPNA 1P1OA 2ZNSA 2Q2AA 1D3KA 1N3WA 1P1UA 2REGA 2V84A 3IO4A 2XXWA 4OERA 2A5TB 1GVCA 2DXRA 4GQOA 3EHSA 2I49A 3OENA 1FQCA 1MRPA 3G3GA 4KQPA 2RF1A 3TODA 3IOVA 1Z7NE 3IOTA 2PYYA 2HZKA 1S9TA 1B51A 3HN0A 1B1HA 2H9BA 3C34A 2XXPA 4IO7A 2XX7A 2XXHA 3TFLA 1IITA 2UVIA 4BDOA 1RYOA 2Y84A 3UN6A 4OETA 3A3UA 1MH3A 3EHTA 5CMMA 4G8HA 3U93A 3LR1A 4JXIA 4P0GA 2CMOA 5H8HB 3H7MA 4H5FA 1LAGE 1XVYA 1OMPA 2OCUA 2QS3A 1JETA 5LOMA 3V89B 3DP8A 4YICA 3TCHA 3MUQA 4X1DA 3UK4A 1AH5A 3IO6A 2P2AA 4GL0A 4PQJA 4KCCA 5EYFA 3FJMA 3Q29A 3KJTA 4GWOA 3OO8A 3S2VA 5AA2D 5EHSA 1DOTA 2R9JA 4YKJA 5DVIA 4EQ7A 3OO6A 5CBRA 2XX9A 2Y7WA 2PBWA 1GGGA 3PUYE 2O6AA 2XD2A 1JW4A 2OWTA 4OFLA 2I3VA 3O97A 1MQGA 4GXAA 1BKAA 4OXVA 1MXVA 4QSCA 1US4A 3VV5A 4RA1A 3K02A 3TELA 1US5A 3RPWA 4R6HA 3ILUB 3B7DA 3A09A 4O3AA 1R9LA 4HW8A 1NFTA 4ZZAA 3K1NA 3K4UA 1B3EA 4HCWA 3HPIA 1OVTA 1QKAA 1UTBB 4F3GA 1A8EA 3U8QA 3MWBA 1YAEA 3ZKKA 5I2KB 4NF8A 5L9SA 2ONKE 3H4ZA 5DVJA 1FTJA 2G29A 2M8CA 4H1XA 3TPAA 4G77A 4G4PA 3VE1B 2CZLA 3S9MC 5JTYA 5F7VA 1SI0A 1Q1KA 2V93A 1POTA 2V25A 1D9VA 3CR9A 1N84A 3M3KA 4F1UA 1EH3A 4K3FA 1SW5A 2DWHA 4X9TA 3MVXA 4C1UA 5K2YA 4OTEA 4EF2A 4DCXA 3U1OA 5I57A 2HCAA 3FZVA 2RC7A 3C36A 3FATA 2AYSA 4PETA 1IUDA 3KG2A 2XXQA 4PFUA 4ZE9A 4LATA 4ECFA 1B6HA 4NF6B 1DTZA 1HSLA 1N76A 1QVSA 3MP8A 3RNNA 4ZEDA 1FQDA 3EQ1A 4DCYA 3DLNA 1AOVA 3FVGA 3KN3A 1BLFA 4F22A 4OENA 1MM6A 4EUOA 2DVCA 2Q89A 2VD2A 3I3VA 3D4CA 3M3FA 3ONMA 4KR5A 4GIZA 5I56A 2PX1A 4H0WA 1JNFA 2I3WA 4LP2B 3KSXA 3RGYA 4UA8A 3PUZE 2H5YA 2NXOA 3TTKA 1B7UA 5BUUA 3H6WA 1FTKA 3MQ9A 1I6QA 4OWDA 3FXQA 2RCBA 4U2RA 3HHFA 3SEWA 4NWCA 2NUVA 4KYDA 2B65A 3LC8A 4OESA 3WAFA 1VFEA 2H99A 2Z8EA 1M5CA 2DP8A 5KCJA 1NNKA 3MBPA 3KSJA 4Q5TA 4KYSA 3N26A 2Y7RA 1IIWA 2Y7PA 1QULA 1SI1A 4GRKA 2F7AA 3FD3A 4IO2A 4ESWA 4ZEFA 1DTGA 3K1PA 4RPNA 1T0KA 3SDFA 3KBRA 4YMAA 2DXYA 4NF5B 4F29A 5CRYA 4ELRA 4XXUA 1CE2A 4PP0A 4POWA 3VLVA 3HHGA 4P11A 2R71A 4GFRA 2HAUA 3L6HA 2E1SA 3Q26A 3ODBA 3GBAA 4PFTA 3RTWB 3C33A 2I6EA 5K2XA 3UORA 5CBSA 3T9HB 3FJ7A 3CG3A 5DEXA 2VD3A 2O69A 4AQ4A 5H8QA 4NF4B 5I84A 1Y3PA 4U4XA 3H06B 4R9FA 5TPAA 3KZGA 1H76A 1WDNA 2F8DA 4KFQA 1MXYA 1O64A 2DYXA 2X7PA 1IZ1A 4TOZA 3TYHA 4R75A 1UTHA 4U21A 4XKQA 2X7QA 1AL3A 5ICQA 2FYIA 5CMBA 5KDTA 1FTOA 3B6TA 4MF3A 2I0BA 1MQIA 3MJNA 4XKNA 3U92A 2XXTA 1MG1A 3V83A 3K01A 1LGBC 3HCQA 1JW5A 2ONRA 4QFPA 1ELJA 3LBSA 2A5SA 3IOWA 1OLCA 4BDLA 3Q28A 1MH4A 3F11A 5I57B 1MY3A 3FVOA 3VLWA 2R6GE 4R6YA 2Y7KA 3RQTA 5H8FB 1EZPA 3C9HA 2F97A 2XXVA 1POY1 3KOSA 4ZS9A 2REJA 3IORA 4H6DA 2VOZA 1B58A 2F6GA 1MXZA 3OEKA 1GR2A 2V3UA 4G68A 4DXUA 2QJEA 5DVFA 4GL8A 4I1DA 1NMUA 4UACA 3PMXA 3PMVA 5H8NB 1B7HA 3MVWA 1KWHA 3FIRA 1EZOA 3RUMA 3VDFA 1J1NA 5TP9A 1XT8A 5BWJA 4TLLB 1B0LA 1Y1ZA 1O63A 2AL4A 1URGA 4FORA 1MXXA 5HPQA 4BDQA 1VFDA 2H4IA 3ECRA 2PVUA 3E4RA 2FA7A 2H98A 3MP6A 2I4CA 1N7XA 1B5JA 4HS7A 3FASA 4DLDA 4YKPA 3QSLA 2F7CA 1HSEA 1MDQA 1UQWA 3G3HA 1SBPA 4TQUQ 3WAEA 1DPPA 3E13X 4F19A 3IAZA 4HTGA 3KN8A 4ESXA 1SD3A 4LZ5A 1P1WA 1SVXB 1SW4A 4H5GA 4HCYA 1ZJLA 1MS7A 3OO9A 4YB6A 1MXUA 2XD3A 3S9NC 3IB0A 1UIUA 4F39A 3OSQA 3I5OA 4FECA 4QF9A 2DWAA 1II5A 2G93A 3CSBA 4M4GA 5I58A 5HM4B 3O6GA 4FE8A 1PC3A 3R6UA 3KN7A 4U1OA 4KD5A 3OEMA 4Q0CA 4ZEBA 1B5IA 4RK2A 1AIVA 3QIMA 2GRVA 2BJJX 2D5WA 2XXIA 4JWXA 1B4ZA 1PEBA 5H8SA 5M2VA 1Y20A 3PV0E 4IO3A 4KCDA 3IB1A 1LCTA 3TKDA 2DE3A 1JEUA 1USYE 3TMGA 1EZ9A 2ZYOA 3D4GA 1I6BA 4F2OA 4NTLA 2XXUA 1UTHB 1NKXA 2HXWA 2F78A 4MBPA 3BFTA 1SW1A 3QK6A 3UP9A 3IX1A 2ZMBA 3C35A 4IGRA 2QPQA 4R9GA 4DE8A 4F3BA 1SYHA 4G68C 2B3BA 3FUZA 1A99A 4I9DA 4YZZA 3G3FA 4E0WA 2Z8DA 4OVJA 1MDP1 4NWDA 2F34A
chains in the Genus database with same CATH superfamily
2WEFA 5FBPA 4OFOA 1FJ9A 2B4LA 2XXKA 4IY6A 4GVOA 2RKMA 2XX8A 4MAGA 4WEDA 1WVJA 4PFYA 1B3HA 4KPTA 3USDA 3O29A 4EXKA 1H43A 1FBDA 5FTIA 3OXNA 4GXSB 2Q8JA 3FVNA 3CSGA 4JVIA 4G68B 5J16A 1IMCA 1B32A 2I48A 4OEVA 1IEJA 2UVJA 5B70A 2Y5KA 1LAXA 2FIXA 3K6UA 4E0XA 5AA2A 1R9QA 4LUBA 1NV5A 4MNIA 4R6KA 4C0RA 5TP9B 1B2HA 2VGQA 2ONSA 4JDFA 3ZSFA 1Y3NA 4NAPA 3MZ9A 2IA4A 1P99A 4NMYA 1JQFA 1BK4A 1A55A 4Q30B 3KOTA 2DE2A 1XC1A 2Y7IA 2ABHA 3MYUA 1I6AA 4QHQA 5F24A 3HO7A 1LB8A 3TDJA 1VSOA 1LBBA 3TTRA 2P0SA 2PT2A 3T22A 4JSDA 3SEXA 1A40A 4FJPA 2F36A 2VP1A 5A5XA 1IXHA 3DELB 3T9UA 4PAIA 3OMBA 1IMDA 3VVEA 2LAOA 3OELA 2QS4A 1HSJA 5AA4A 1LLSA 2WX9A 4PBQA 4AB5A 4BDNA 5DT6A 4FIMA 4OVTA 4I40A 3IL1B 3M3LA 2IEEA 1B05A 2GH9A 3G3IA 4F1YA 3RLFE 1SW2A 2UYFA 2ZXTA 4RPOA 3PUVE 2A5TA 2DWIA 3PU5A 4H65A 3SEYA 4ZECA 4ZE8A 4FEDA 1ZTYA 4ELOA 1MY0A 3QAXA 3MP1A 5FHNA 4F1VA 4PFWA 3SEVA 5I2NA 2CZHA 2O1MA 1KA0A 3BKIB 1WODA 3SEUA 1D4NA 2HFBA 1XHYA 4HXVA 4MH5A 4PBHA 4MIJA 4ND9A 5ET8A 3CI8A 1MM7A 2O68A 4YKKA 1FTLA 4FEBA 3BBRA 3O28A 1D9YA 1DPEA 4R2BA 5FTHA 2AIXA 1B5HA 1PB9A 4BLAA 4QRZA 1SPIA 2OLBA 2NOOA 2ZYKA 2OWSA 3O2AA 5TU0A 1G0IA 3E9XA 4G8NA 4IY5A 3KFMA 4BDMA 4RK9A 1MY2A 4POXA 1B0HA 3TZAA 3RN8A 2QFLA 1USYH 2DE4A 3H6TA 3G7WA 1ZBMA 3D1RA 1PB8A 4P9KA 1TFDA 4RY1A 2O7UA 4PCDA 1LBCA 1YZ0A 5ELVA 1IMEA 2ESNA 3O66A 1P1QA 2FNCA 3W9VA 1M5FA 3K00A 5IZ1A 3RT8A 3RY3A 2HZLA 3QUJA 3N6UA 4RJZA 3R26A 1URSA 2XHDA 4PDDA 4ONYA 4WXJA 4GLIA 4MJOA 1QUKA 5EQ7A 4OHNA 3PD8A 3PMWA 4QSDA 1FBFA 1IQ7A 3T93B 1EYIA 1LAFE 1N04A 2XXYA 4JWOA 4JBZA 2KR0A 5IAIA 1URDA 4BDRA 2O7IA 3PPPA 4N4UA 1NNTA 4MLVA 3CVGA 3MC2A 1NV0A 1DCUA 1B40A 3FV2A 3P7IA 4X04A 4NF8B 3MPKA 3JZJA 5ITOA 3GBBA 4KYEA 4EXLA 1MPDA 3N6TA 3MW0A 2DOJA 1FQBA 1MY4A 5AA1A 4N8GA 5JTYB 4PC9A 3HV1A 1MPBA 5I59A 1LFGA 5FHOA 3LV0A 1F9BA 4IO6A 3IOUA 4LQ2A 1SDXA 1FCKA 5IM2A 4LZ7A 5L8DA 2CZIA 3LSLA 1B52A 2DQVA 3W9WA 5I5PA 2E0SA 4H67A 2QMWA 2I58A 5ICTA 4P1EA 1UTBA 3KC1A 4YMBA 4IGTA 3T96B 2NWJA 5JK4A 2HAVA 1YYZA 1H45A 2I0CA 4FBPA 1GV8A 1BP5A 3T1BA 4DXBA 1B3LA 2I4BA 3C32A 4LN5A 2GQ1A 2RC8A 2DVZA 1LFHA 3ILTB 2HQ0A 1VR5A 2B3FA 4TLMB 3GXAA 3FVKA 2ALUA 1ZIUA 4RNSA 5I56B 3TCGA 2PFZA 3TTLA 3BFUA 4IB2A 4G2ZA 4OVRA 3IJXB 1SQYA 3SZPA 2QMXA 3JV9A 4U22A 1OQHA 1TFAA 1NI9A 1K9YA 1B3FA 4N13A 2RCAA 1IXIA 1QUJA 1Y3QA 5EQAA 1LSTA 3TQWA 2OBGA 4OYVA 1LBYA 3PTYA 2P3NA 5FHMA 2OX3A 4X1BA 2Q88A 4NF6A 4ELQA 5I2NB 2BJIA 4AB6A 4GBWA 3T9XB 5KCJB 3IR1A 3JYRA 1I69A 1FPEA 1Y4TA 3BIGA 1VE4A 1FJ6A 1EYKA 4X48A 3VVFA 4ZEKA 1FBGA 1B4HA 4MLQA 1B46A 3R7XA 2VT5A 2CEYA 4MNPA 3SETA 3KJ7A 4IO4A 1N7WA 3TQLA 4YKIA 3UIFA 4GWSA 1ZKBA 2OZZA 4MFIA 4XEQA 3RPLA 3H03A 2F35A 3EHUA 3C31A 3UGWA 3S9LC 1JVXA 5CMKA 4PF6A 2PMSA 1QJMA 1RYXA 5CM6A 1FPBA 3OO7A 4QFOA 1XOCA 1Z7ME 3G3JA 4P8BA 3EF7A 4JWYA 3K2DA 5I7IA 2Z22A 3FXRA 1XVXA 4F18A 2D3IA 1YXIA 2GHAA 3HSTA 1MQHA 2X26A 1ZMGA 4LA9A 5KZTA 1S7YA 3K0VA 1A54A 4OVQA 4QSEA 1AWBA 5IZ3A 1XS5A 3PPOA 1H3DA 4OANA 4R72A 1Y4CA 3E3KA 4DIGA 5DEXB 1BIYA 1IXCA 1N0TA 2O51A 4PF8A 1LB9A 5H8QB 1OIBA 4O3CA 1M5EA 4FATA 3AXFA 3VVDA 3DP4A 5ESYA 5TPAB 1A8FA 1PBQA 1FQEA 2RC9A 4NE4A 5CI5A 1MY1A 4XKRA 4NF5A 2FHYA 2PCRA 3SERA 2UVGA 3M8UA 4PE3A 4C1TA 4GWUA 3PPNA 1ZLQA 4H8JA 1JEVA 3SESA 5KDTB 5F1QA 4MCOA 3LSWA 4QFLA 1MQJA 2F7BA 3U65A 2F6PA 3O9PA 4JVDA 4XIGQ 2HEUA 1LCFA 5I59B 2AL5A 1TXFA 2OJTA 5T3JA 2PT1A 4OVSA 3TCFA 1JW1A 2WKYA 3VXCA 4OZ9A 5A5LA 1CB6A 4G8MA 4YB5A 3EPEA 3SKPA 4QFKA 2QS1A 4YB7A 3IK6B 3VXBA 1TWYA 2DWJA 3KEIA 2QRYA 4PFIA 4DZ1A 4ZEIA 1DBZA 5ITPA 4NF4A 2OK2A 4I8CA 1M5DA 3TTMA 1DSNA 4XKPA 4I62A 1NUZA 4GX4A 4M1VA 4WKMA 1NV7A 1M5BA 5JEIA 1TT1A 4H46A 3PUXE 4IO5A 2DSFA 1OQGA 2XXXA 2RINA 3CFXA 2ZNUA 5AE4A 2V3TA 1N3XA 3CFLA 3CRBA 1IXGA 1NL5A 2ZYNA 5DW8A 1A7LA 5CC2A 4LVQA 5ET5A 2THIA 5IGAA 5L9OA 2D21A 3TUSA 1PBPA 3LSFB 3EN3A 2ZZVA 3H6VA 3V8XB 1OVBA 1FW0A 1B9JA 1P1NA 5ISUA 4L17A 3VFJA 2XXRA 2QSXA 3VLUA 4P1LA 4JB7A 3Q27A 2PFYA 3UA8A 1QKBA 1R1NA 3FV1A 5B7DA 5H8FA 2ANJA 2KLFA 4O7MA 3V5AA 4N81A 2WYPA 4N07A 2WBDA 1Y1MA 2Z8FA 1LBXA 3W15C 5J1DA 3ZKLA 1FBPA 4U4SA 4O3BA 2GHBA 4N8YA 5DYHA 1YTVA 3KGCA 1VDWA 4NQ8A 4OEUA 1LAHE 4F3SA 5ET7A 4OMBA 4MX6A 5H8NA 4FAJA 3G3KA 3O6IA 1NNFA 4LQ5A 4KHZE 1GTKA 4DXCA 2QL3A 2ZNTA 3RPLB 1LFIA 4THIA 1FBCA 3CG1A 3LUYA 2P1SA 1ZU0A 2MKZA 3PPRA 3K6WA 1BTJA 1Q35A 5EHMA 3GLBA 2H25A 4Z7EA 2V3QA 1SYIA 1B3GA 4EF1A 1ANFA 1S50A 5I58B 4MHFA 3L6GA 2W7YA 3CIJA 3FXUA 3QUFA 4U23A 3A3CA 1PDAA 1YPNA 4DDDA 2Q9TA 3DM0A 5IZ3B 4GWYA 4P0IA 4NG7A 5DTBA 1MPCA 1MQDA 1FQAA 3B6QA 3TAJA 3CFZA 3I6VA 3HFUA 3GYYA 4XTCQ 1B7ZA 3FJGA 4YU0A 4EDPA 1R6ZA 3K1MA 3OSRA 4YAHX 3MZBA 2UVHA 3C4MA 1MXWA 2YJPA 2O84X 4Q8RA 5H8HA 2F5XA 3PGFA 2ZYMA 2XWOA 1AMFA 3K6VA 4N17A 4XFEA 2YLNA 3T9VA 2O1LA 1NH7A 4F3PA 3MVZA 4F31B 1L5TA 4WEPA 1KZ8A 3K6XA 3PD9A 3MZ1A 4HE0A 4GD5A 3RTFB 4KI0E 4JSOA 4ELPA 2L5VA 3N94A 3IB2A 1DMBA 4P56A 4LONB 4PE5B 3PUWE 3MPLA 3Q25A 1QW0A 3H6UA 4PTKA 3TEPA 4RXLA 3T0JA 3O6HA 4GF8A 4ZDMA 3QYTA 3FGSA 3GZGA 1FRPA 4R74A 3TTNA 2Z23A 4Z0IA 4OFJA 5I3SA 3N5LA 5AA3A 3OOAA 2GFEA 1FQFA 1RKMA 2UXAA 4PGPA 2Q74A 3IFCA 4OQOA 4ZZEA 4EQBA 2Q2CA 1QGXA 4N6PA 4MEVA 1YCJA 4NEDA 3E78A 5L9MA 5AA2B 1PB7A 2DS9A 1EU8A 5EQ8A 1Y9UA 4R2FA 1H44A 5CMCA 3LSXA 1FTMA 4MNCA 1O7TA 3MVYA 3QXMA 5HBCA 4NF0A 3S9EA 1ATGA 3RT6B 3S4UA 5IKBA 2QVVA 4QFNA 1OLAA 3T66A 5I2KA 1NH8A 3B6WA 4LZ8A 3DP6A 4R73A 2UYEA 4AS4A 4H8IA 2XWIA 2NVUB 1JVYA 3U94A 2R8TA 3MAMA 3OD7A 4RYAA 3BIHA 4F2QA 5A5XB 1UIVA 1B1XA 1NNPA 1QUIA 3THIA 3U72A 4GOTA 3PPQA 2VHAA 3H3GA 3ZS6A 2QS2A 4KXPA 5AA4B 3ISPA 3IJOB 4EQ9A 4ISUA 4U1ZA 2YPNA 1P1OA 2ZNSA 2Q2AA 1D3KA 1XI6A 4N15A 1N3WA 1P1UA 2REGA 2V84A 3IO4A 4P3LA 2XXWA 4OERA 2A5TB 2WYKA 1GVCA 4DI4B 2DXRA 4GQOA 2Q8MA 3EHSA 2I49A 3OENA 1FQCA 1MRPA 3G3GA 4KQPA 2RF1A 3TODA 3IOVA 1Z7NE 3IOTA 4I3YA 1FPFA 2PYYA 2HZKA 1S9TA 1B51A 3HN0A 1B1HA 1IMFA 2H9BA 2V4CA 3C34A 2XXPA 4IO7A 2XX7A 2XXHA 3TFLA 1IITA 4N6KA 2F3DA 2UVIA 2OWZA 4BDOA 1RYOA 2Y84A 4HE2A 3UN6A 4OETA 3A3UA 1MH3A 3EHTA 3ROJA 5CMMA 4G8HA 3U93A 3LR1A 4JXIA 4P0GA 2CMOA 3CHGA 5H8HB 3H7MA 4H5FA 1LAGE 1XVYA 1OMPA 2OCUA 2QS3A 1JETA 5LOMA 3V89B 3DP8A 4YICA 3TCHA 3MUQA 4X1DA 3UK4A 1K9ZA 1FTAA 1AH5A 3IO6A 2P2AA 4GL0A 2FBPA 4PQJA 4N6DA 4PAFA 4KCCA 5EYFA 3FJMA 3Q29A 1LBVA 3KJTA 4GWOA 3OO8A 3S2VA 2B4MA 5AA2D 5EHSA 1DOTA 2R9JA 4YKJA 5DVIA 5EQ9A 3OO6A 4EQ7A 5CBRA 2XX9A 3EKIA 2Y7WA 2PBWA 1GGGA 1NUXA 2QVUA 1LEVA 3PUYE 2O6AA 4PAKA 2XD2A 1JW4A 2OWTA 1JP4A 4OFLA 2I3VA 3O97A 1MQGA 4GXAA 1BKAA 4OXVA 1MXVA 4QSCA 1US4A 3VV5A 4RA1A 3K02A 3TELA 1US5A 3RPWA 4R6HA 3ILUB 3B7DA 3A09A 4O3AA 1R9LA 4JVCA 4HW8A 1NFTA 4ZZAA 1FPJA 3K1NA 3K4UA 1B3EA 4HCWA 5LTCA 3HPIA 1OVTA 1QKAA 1UTBB 4F3GA 1A8EA 3U8QA 3MWBA 1YAEA 2HHMA 5I2KB 3ZKKA 4NF8A 5L9SA 4NX1A 4G61A 2P3VA 2ONKE 3H4ZA 5DVJA 1FTJA 2G29A 2M8CA 1LBWA 4H1XA 3TPAA 4G77A 4G4PA 3VE1B 2CZLA 3S9MC 1FSAA 5JTYA 5F7VA 1SI0A 1Q1KA 2V93A 1POTA 2XWKA 2V25A 1D9VA 3CR9A 1N84A 3M3KA 2VPNA 4F1UA 1EH3A 4K3FA 2Y5LA 2JJKA 1SW5A 2DWHA 4X9TA 3MVXA 4C1UA 5K2YA 4OTEA 4EF2A 4DCXA 3U1OA 5I57A 2HCAA 4O8MA 4IR8A 3NOHA 4O94A 3FZVA 2RC7A 3C36A 3FATA 2AYSA 4PETA 1IUDA 3KG2A 2XXQA 4PFUA 4ZE9A 5EYHA 4LATA 4ECFA 1B6HA 1CNQA 1NV4A 4NF6B 1DTZA 1HSLA 1N76A 1QVSA 3MP8A 3RNNA 2F3BA 4N91A 4ZEDA 1FQDA 3EQ1A 4DCYA 3DLNA 1AOVA 3FVGA 3KN3A 1BLFA 4HE1A 4F22A 4OENA 3A29A 1MM6A 4EUOA 2DVCA 3B8BA 2Q89A 2VD2A 3I3VA 3D4CA 3M3FA 3ONMA 4KR5A 4GIZA 5I56A 2PX1A 1FPLA 4H0WA 1JNFA 2I3WA 4LP2B 3KSXA 3RGYA 4OA4A 4UA8A 3PUZE 2H5YA 2NXOA 3TTKA 1B7UA 5BUUA 3H6WA 1FTKA 1NV1A 3MQ9A 1I6QA 1IMAA 4QXDA 4OWDA 3FXQA 4XF5A 2RCBA 4U2RA 3HHFA 3SEWA 4NWCA 2NUVA 4KYDA 2B65A 3LC8A 5EYGA 4OESA 3WAFA 1VFEA 2H99A 3QMFA 4O7IA 2Z8EA 1M5CA 2DP8A 5KCJA 1RDXA 1NNKA 3MBPA 3IFAA 3KSJA 4Q5TA 1EYJA 4KYSA 3N26A 2Y7RA 1IIWA 2Y7PA 1QULA 1SI1A 4GRKA 2F7AA 3FD3A 4IO2A 4ESWA 2XA5A 4ZEFA 1DTGA 3K1PA 4RPNA 1T0KA 2FIEA 3SDFA 3KBRA 4YMAA 2DXYA 4NF5B 4F29A 5CRYA 4ELRA 2WBBA 4NN3A 4XXUA 1CE2A 4PP0A 4POWA 3VLVA 3HHGA 4P11A 2R71A 4GFRA 2HAUA 3L6HA 2E1SA 3Q26A 1FPDA 3ODBA 3GBAA 4PFTA 3RTWB 3C33A 2I6EA 3B50A 5K2XA 3UORA 5CBSA 3T9HB 3FJ7A 1IMBA 3CG3A 2QVRA 5DEXA 2VD3A 4GWWA 2O69A 4P47A 4AQ4A 5H8QA 4NF4B 5I84A 1Y3PA 4U4XA 1FBEA 2KQZA 3MSTA 3H06B 4R9FA 5TPAA 3KZGA 1H76A 1FPGA 1WDNA 4NGUA 2F8DA 4KFQA 4PFBA 4AS5A 1MXYA 1O64A 2DYXA 2X7PA 1IZ1A 4TOZA 3TYHA 4R75A 1UTHA 4GX3A 4U21A 4I3EA 4XKQA 2X7QA 1AL3A 5ICQA 2FYIA 5CMBA 5KDTA 1FTOA 3B6TA 4MF3A 4QBAA 2I0BA 1MQIA 2FVZA 3MJNA 4XKNA 3U92A 2XXTA 1MG1A 1FPKA 3V83A 3K01A 1LGBC 3HCQA 1JW5A 2ONRA 4QFPA 1ELJA 3LBSA 2A5SA 4GBVA 3IOWA 1OLCA 4PDHA 4BDLA 3Q28A 1MH4A 1NV3A 3F11A 5I57B 1MY3A 3FVOA 3FBPA 3VLWA 2R6GE 4R6YA 2Y7KA 3RQTA 5H8FB 1EZPA 3C9HA 2F97A 4PGNA 2XXVA 1POY1 3KOSA 4ZS9A 2REJA 3IORA 4H6DA 1INPA 2VOZA 1B58A 1RDZA 2F6GA 1MXZA 3OEKA 1GR2A 4DI3D 2V3UA 4G68A 4DXUA 2QJEA 5DVFA 4GL8A 4I1DA 1NMUA 4GX6A 4UACA 3PMXA 2ZZXA 3LUZA 3PMVA 5H8NB 1B7HA 3MVWA 1KWHA 3FIRA 1EZOA 3RUMA 3VDFA 1J1NA 5TP9A 1XT8A 5BWJA 4TLLB 1B0LA 1Q9DA 1Y1ZA 1O63A 2AL4A 1FPIA 1URGA 4FORA 1MXXA 5HPQA 4BDQA 1VFDA 2H4IA 3ECRA 2PVUA 3E4RA 2FA7A 2H98A 3MP6A 4PFRA 2I4CA 1N7XA 1B5JA 4X8RA 4HS7A 3FASA 5LDZA 4DLDA 5ET6A 4YKPA 3QSLA 2F7CA 1HSEA 1MDQA 1UQWA 3G3HA 1SBPA 4TQUQ 3WAEA 1DPPA 3E13X 4F19A 2CZKA 3IAZA 4HTGA 3KN8A 4ESXA 1SD3A 2HXRA 3FXBA 4LZ5A 1P1WA 1SVXB 1SW4A 1KA1A 4H5GA 4HCYA 1ZJLA 1MS7A 3OO9A 4YB6A 4GWXA 1NV2A 1MXUA 2XD3A 4OVPA 3S9NC 4H45A 3IB0A 1UIUA 4F39A 1NUYA 4MMPA 3OSQA 3I5OA 4FECA 4QF9A 2DWAA 1II5A 1DK4A 2G93A 3CSBA 4M4GA 5I58A 5HM4B 3O6GA 4FE8A 1PC3A 3R6UA 3KN7A 1G0HA 4U1OA 4KD5A 3OEMA 3KC0A 4Q0CA 4ZEBA 1B5IA 3RYDA 4RK2A 1AIVA 4GWZA 3QIMA 2GRVA 2BJJX 2D5WA 2XXIA 4JWXA 1B4ZA 1PEBA 5H8SA 5M2VA 1Y20A 2HPGA 3PV0E 4IO3A 4KCDA 3IB1A 1LCTA 3TKDA 2DE3A 1NUWA 1JEUA 2ZZWA 1USYE 3TMGA 1EZ9A 1FBHA 2ZYOA 4UABA 3D4GA 1I6BA 4F2OA 4NTLA 2XXUA 1UTHB 1NKXA 2HXWA 2F78A 4MBPA 3BFTA 1SW1A 3QK6A 1LBZA 3UP9A 2DDKA 2VPOA 3IX1A 2ZMBA 3C35A 1NV6A 4IGRA 1D9QA 2QPQA 4R9GA 4NHBA 4DE8A 4F3BA 1SYHA 4G68C 2B3BA 3FUZA 2CEXA 1A99A 1RDYA 4I9DA 4YZZA 3E79A 3G3FA 2XWVA 4E0WA 3KBZA 2Z8DA 4OVJA 1MDP1 4NWDA 2F34A 5IZZA
chains in the Genus database with same CATH topology
4OFOA 4IY6A 4GVOA 2RKMA 2XX8A 4WEDA 1WVJA 4PFYA 1B3HA 4KPTA 3USDA 3O29A 4EXKA 1H43A 5FTIA 3OXNA 4GXSB 2Q8JA 3FVNA 3CSGA 4G68B 1B32A 2I48A 4OEVA 1IEJA 2UVJA 5B70A 1LAXA 3K6UA 4E0XA 5AA2A 1R9QA 4LUBA 4R6KA 4C0RA 5TP9B 1B2HA 2VGQA 2ONSA 4JDFA 3ZSFA 1Y3NA 3MZ9A 2IA4A 1P99A 4NMYA 1JQFA 1A55A 4Q30B 3KOTA 2DE2A 1XC1A 2Y7IA 2ABHA 4QHQA 1I6AA 3HO7A 1LB8A 3TDJA 1VSOA 1LBBA 3TTRA 2P0SA 2PT2A 3T22A 4JSDA 3SEXA 1A40A 4FJPA 2F36A 2VP1A 5A5XA 1IXHA 3DELB 3T9UA 3OMBA 3VVEA 2LAOA 3OELA 2QS4A 1HSJA 5AA4A 1LLSA 4AB5A 4BDNA 5DT6A 4FIMA 3IL1B 3M3LA 2IEEA 1B05A 2GH9A 3G3IA 4F1YA 3RLFE 1SW2A 2UYFA 2ZXTA 4RPOA 3PUVE 2A5TA 2DWIA 3PU5A 4H65A 3SEYA 4ZECA 4ZE8A 4FEDA 1ZTYA 4ELOA 1MY0A 3QAXA 3MP1A 5FHNA 4F1VA 4PFWA 3SEVA 5I2NA 2O1MA 3BKIB 1WODA 3SEUA 1D4NA 2HFBA 1XHYA 4MH5A 4ND9A 3CI8A 1MM7A 2O68A 4YKKA 1FTLA 4FEBA 3BBRA 3O28A 1D9YA 1DPEA 4R2BA 5FTHA 2AIXA 1B5HA 1PB9A 4BLAA 4QRZA 2OLBA 2NOOA 2ZYKA 2OWSA 3O2AA 5TU0A 3E9XA 4G8NA 4IY5A 3KFMA 4BDMA 4RK9A 1MY2A 4POXA 1B0HA 3TZAA 3RN8A 1USYH 2DE4A 3H6TA 3G7WA 1ZBMA 1PB8A 1TFDA 4RY1A 2O7UA 1LBCA 5ELVA 2ESNA 3O66A 1P1QA 2FNCA 3W9VA 1M5FA 3K00A 3RT8A 3RY3A 2HZLA 3QUJA 3N6UA 4RJZA 3R26A 1URSA 2XHDA 4ONYA 4WXJA 4GLIA 1QUKA 4OHNA 3PD8A 3PMWA 4QSDA 1IQ7A 3T93B 1LAFE 2XXYA 1N04A 4JBZA 4JWOA 5IAIA 1URDA 4BDRA 2O7IA 3PPPA 1NNTA 4MLVA 3CVGA 3MC2A 3FV2A 1B40A 3P7IA 4NF8B 3MPKA 3JZJA 5ITOA 3GBBA 4KYEA 4EXLA 1MPDA 3N6TA 3MW0A 2DOJA 1FQBA 1MY4A 5AA1A 5JTYB 3HV1A 1MPBA 5I59A 1LFGA 5FHOA 1F9BA 4IO6A 3IOUA 4LQ2A 1SDXA 1FCKA 4LZ7A 5L8DA 3LSLA 1B52A 2DQVA 3W9WA 2E0SA 4H67A 2QMWA 2I58A 5ICTA 1UTBA 4YMBA 4IGTA 3T96B 2NWJA 5JK4A 2HAVA 1H45A 2I0CA 1GV8A 1BP5A 4DXBA 1B3LA 2I4BA 3C32A 2RC8A 2DVZA 1LFHA 3ILTB 2HQ0A 1VR5A 2B3FA 4TLMB 3GXAA 3FVKA 2ALUA 1ZIUA 4RNSA 5I56B 3TCGA 3TTLA 3BFUA 4IB2A 4G2ZA 3IJXB 1SQYA 2QMXA 3JV9A 4U22A 1OQHA 1TFAA 1B3FA 4N13A 2RCAA 1IXIA 1QUJA 1Y3QA 1LSTA 3TQWA 2OBGA 4OYVA 5FHMA 4X1BA 2Q88A 4NF6A 4ELQA 5I2NB 4AB6A 3T9XB 5KCJB 3IR1A 3JYRA 1I69A 1Y4TA 1VE4A 4X48A 3VVFA 4ZEKA 1B4HA 4MLQA 1B46A 3R7XA 3SETA 3KJ7A 4IO4A 1N7WA 3TQLA 4YKIA 3UIFA 1ZKBA 2OZZA 4MFIA 3H03A 2F35A 3EHUA 3C31A 3UGWA 3S9LC 1JVXA 5CMKA 2PMSA 1QJMA 1RYXA 5CM6A 3OO7A 4QFOA 1XOCA 1Z7ME 3G3JA 3EF7A 4JWYA 3K2DA 2Z22A 3FXRA 1XVXA 4F18A 2D3IA 2GHAA 3HSTA 1MQHA 2X26A 1ZMGA 4LA9A 5KZTA 1S7YA 3K0VA 1A54A 4QSEA 1XS5A 3PPOA 1H3DA 4R72A 1Y4CA 3E3KA 4DIGA 5DEXB 1BIYA 1IXCA 1N0TA 2O51A 1LB9A 5H8QB 1OIBA 4O3CA 1M5EA 4FATA 3AXFA 3VVDA 3DP4A 5TPAB 1A8FA 1PBQA 1FQEA 2RC9A 4NE4A 5CI5A 1MY1A 4XKRA 4NF5A 3SERA 2UVGA 3M8UA 4C1TA 3PPNA 1ZLQA 4H8JA 1JEVA 3SESA 5KDTB 5F1QA 3LSWA 4QFLA 1MQJA 2F7BA 2F6PA 3O9PA 4XIGQ 2HEUA 1LCFA 5I59B 2AL5A 1TXFA 2OJTA 3TCFA 2PT1A 1JW1A 2WKYA 3VXCA 4OZ9A 1CB6A 4G8MA 4YB5A 3EPEA 3SKPA 4QFKA 2QS1A 4YB7A 3IK6B 3VXBA 1TWYA 2DWJA 3KEIA 2QRYA 4DZ1A 4ZEIA 5ITPA 4NF4A 2OK2A 4I8CA 1M5DA 3TTMA 1DSNA 4XKPA 4I62A 4M1VA 4WKMA 1M5BA 5JEIA 1TT1A 3PUXE 4IO5A 2DSFA 1OQGA 2XXXA 2RINA 3CFXA 2ZNUA 5AE4A 2V3TA 1N3XA 3CFLA 3CRBA 1IXGA 1NL5A 2ZYNA 1A7LA 5CC2A 4LVQA 2THIA 5L9OA 2D21A 3TUSA 1PBPA 3LSFB 3EN3A 3H6VA 3V8XB 1OVBA 1FW0A 1B9JA 1P1NA 5ISUA 4L17A 3VFJA 2XXRA 2QSXA 3VLUA 4JB7A 3Q27A 3UA8A 1QKBA 1R1NA 3FV1A 5B7DA 5H8FA 2ANJA 2KLFA 3V5AA 4N07A 1Y1MA 2Z8FA 3W15C 5J1DA 3ZKLA 4U4SA 4O3BA 2GHBA 5DYHA 1YTVA 3KGCA 4OEUA 1LAHE 4F3SA 4OMBA 5H8NA 4FAJA 3G3KA 3O6IA 1NNFA 4LQ5A 4KHZE 1GTKA 4DXCA 2QL3A 2ZNTA 1LFIA 4THIA 3CG1A 3LUYA 2P1SA 1ZU0A 3PPRA 3K6WA 1BTJA 1Q35A 5EHMA 3GLBA 2H25A 4Z7EA 2V3QA 1SYIA 1B3GA 4EF1A 1ANFA 1S50A 5I58B 3L6GA 2W7YA 3CIJA 3FXUA 3QUFA 4U23A 3A3CA 1PDAA 1YPNA 4DDDA 2Q9TA 3DM0A 4P0IA 5DTBA 1MPCA 1MQDA 1FQAA 3B6QA 3TAJA 3CFZA 3I6VA 4XTCQ 1B7ZA 3FJGA 4YU0A 4EDPA 1R6ZA 3K1MA 3OSRA 4YAHX 3MZBA 2UVHA 3C4MA 1MXWA 2YJPA 2O84X 4Q8RA 5H8HA 2F5XA 3PGFA 2ZYMA 1AMFA 3K6VA 2YLNA 3T9VA 2O1LA 1NH7A 4F3PA 3MVZA 4F31B 1L5TA 4WEPA 3K6XA 3PD9A 3MZ1A 4GD5A 3RTFB 4KI0E 4JSOA 4ELPA 3N94A 3IB2A 1DMBA 4LONB 4PE5B 3PUWE 3MPLA 3Q25A 1QW0A 3H6UA 3TEPA 4RXLA 3O6HA 4GF8A 4ZDMA 3QYTA 3FGSA 3GZGA 4R74A 3TTNA 2Z23A 4Z0IA 4OFJA 3N5LA 5AA3A 3OOAA 2GFEA 1FQFA 1RKMA 2UXAA 4OQOA 4ZZEA 4EQBA 2Q2CA 4N6PA 1YCJA 4NEDA 5L9MA 5AA2B 1PB7A 2DS9A 1EU8A 1Y9UA 4R2FA 1H44A 5CMCA 3LSXA 1FTMA 1O7TA 3MVYA 3QXMA 5HBCA 3S9EA 1ATGA 3RT6B 3S4UA 5IKBA 4QFNA 1OLAA 3T66A 5I2KA 1NH8A 3B6WA 4LZ8A 3DP6A 4R73A 2UYEA 4H8IA 2NVUB 1JVYA 3U94A 3MAMA 3OD7A 4RYAA 4F2QA 5A5XB 1UIVA 1B1XA 1NNPA 1QUIA 3THIA 3U72A 4GOTA 3PPQA 2VHAA 3H3GA 3ZS6A 2QS2A 5AA4B 3IJOB 4EQ9A 4ISUA 4U1ZA 2YPNA 1P1OA 2ZNSA 2Q2AA 1D3KA 1N3WA 1P1UA 2REGA 2V84A 3IO4A 2XXWA 4OERA 2A5TB 1GVCA 2DXRA 4GQOA 3EHSA 2I49A 3OENA 1FQCA 1MRPA 3G3GA 4KQPA 2RF1A 3TODA 3IOVA 1Z7NE 3IOTA 2PYYA 2HZKA 1S9TA 1B51A 3HN0A 1B1HA 2H9BA 3C34A 2XXPA 4IO7A 2XX7A 2XXHA 3TFLA 1IITA 2UVIA 4BDOA 1RYOA 2Y84A 3UN6A 4OETA 3A3UA 1MH3A 3EHTA 5CMMA 4G8HA 3U93A 3LR1A 4JXIA 4P0GA 2CMOA 5H8HB 3H7MA 4H5FA 1LAGE 1XVYA 1OMPA 2OCUA 2QS3A 1JETA 5LOMA 3V89B 3DP8A 4YICA 3TCHA 3MUQA 4X1DA 3UK4A 1AH5A 3IO6A 2P2AA 4GL0A 4PQJA 4KCCA 5EYFA 3FJMA 3Q29A 3KJTA 4GWOA 3OO8A 3S2VA 5AA2D 5EHSA 1DOTA 2R9JA 4YKJA 5DVIA 4EQ7A 3OO6A 5CBRA 2XX9A 2Y7WA 2PBWA 1GGGA 3PUYE 2O6AA 2XD2A 1JW4A 2OWTA 4OFLA 2I3VA 3O97A 1MQGA 4GXAA 1BKAA 4OXVA 1MXVA 4QSCA 1US4A 3VV5A 4RA1A 3K02A 3TELA 1US5A 3RPWA 4R6HA 3ILUB 3B7DA 3A09A 4O3AA 1R9LA 4HW8A 1NFTA 4ZZAA 3K1NA 3K4UA 1B3EA 4HCWA 3HPIA 1OVTA 1QKAA 1UTBB 4F3GA 1A8EA 3U8QA 3MWBA 1YAEA 3ZKKA 5I2KB 4NF8A 5L9SA 2ONKE 3H4ZA 5DVJA 1FTJA 2G29A 2M8CA 4H1XA 3TPAA 4G77A 4G4PA 3VE1B 2CZLA 3S9MC 5JTYA 5F7VA 1SI0A 1Q1KA 2V93A 1POTA 2V25A 1D9VA 3CR9A 1N84A 3M3KA 4F1UA 1EH3A 4K3FA 1SW5A 2DWHA 4X9TA 3MVXA 4C1UA 5K2YA 4OTEA 4EF2A 4DCXA 3U1OA 5I57A 2HCAA 3FZVA 2RC7A 3C36A 3FATA 2AYSA 4PETA 1IUDA 3KG2A 2XXQA 4PFUA 4ZE9A 4LATA 4ECFA 1B6HA 4NF6B 1DTZA 1HSLA 1N76A 1QVSA 3MP8A 3RNNA 4ZEDA 1FQDA 3EQ1A 4DCYA 3DLNA 1AOVA 3FVGA 3KN3A 1BLFA 4F22A 4OENA 1MM6A 4EUOA 2DVCA 2Q89A 2VD2A 3I3VA 3D4CA 3M3FA 3ONMA 4KR5A 4GIZA 5I56A 2PX1A 4H0WA 1JNFA 2I3WA 4LP2B 3KSXA 3RGYA 4UA8A 3PUZE 2H5YA 2NXOA 3TTKA 1B7UA 5BUUA 3H6WA 1FTKA 3MQ9A 1I6QA 4OWDA 3FXQA 2RCBA 4U2RA 3HHFA 3SEWA 4NWCA 2NUVA 4KYDA 2B65A 3LC8A 4OESA 3WAFA 1VFEA 2H99A 2Z8EA 1M5CA 2DP8A 5KCJA 1NNKA 3MBPA 3KSJA 4Q5TA 4KYSA 3N26A 2Y7RA 1IIWA 2Y7PA 1QULA 1SI1A 4GRKA 2F7AA 3FD3A 4IO2A 4ESWA 4ZEFA 1DTGA 3K1PA 4RPNA 1T0KA 3SDFA 3KBRA 4YMAA 2DXYA 4NF5B 4F29A 5CRYA 4ELRA 4XXUA 1CE2A 4PP0A 4POWA 3VLVA 3HHGA 4P11A 2R71A 4GFRA 2HAUA 3L6HA 2E1SA 3Q26A 3ODBA 3GBAA 4PFTA 3RTWB 3C33A 2I6EA 5K2XA 3UORA 5CBSA 3T9HB 3FJ7A 3CG3A 5DEXA 2VD3A 2O69A 4AQ4A 5H8QA 4NF4B 5I84A 1Y3PA 4U4XA 3H06B 4R9FA 5TPAA 3KZGA 1H76A 1WDNA 2F8DA 4KFQA 1MXYA 1O64A 2DYXA 2X7PA 1IZ1A 4TOZA 3TYHA 4R75A 1UTHA 4U21A 4XKQA 2X7QA 1AL3A 5ICQA 2FYIA 5CMBA 5KDTA 1FTOA 3B6TA 4MF3A 2I0BA 1MQIA 3MJNA 4XKNA 3U92A 2XXTA 1MG1A 3V83A 3K01A 1LGBC 3HCQA 1JW5A 2ONRA 4QFPA 1ELJA 3LBSA 2A5SA 3IOWA 1OLCA 4BDLA 3Q28A 1MH4A 3F11A 5I57B 1MY3A 3FVOA 3VLWA 2R6GE 4R6YA 2Y7KA 3RQTA 5H8FB 1EZPA 3C9HA 2F97A 2XXVA 1POY1 3KOSA 4ZS9A 2REJA 3IORA 4H6DA 2VOZA 1B58A 2F6GA 1MXZA 3OEKA 1GR2A 2V3UA 4G68A 4DXUA 2QJEA 5DVFA 4GL8A 4I1DA 1NMUA 4UACA 3PMXA 3PMVA 5H8NB 1B7HA 3MVWA 1KWHA 3FIRA 1EZOA 3RUMA 3VDFA 1J1NA 5TP9A 1XT8A 5BWJA 4TLLB 1B0LA 1Y1ZA 1O63A 2AL4A 1URGA 4FORA 1MXXA 5HPQA 4BDQA 1VFDA 2H4IA 3ECRA 2PVUA 3E4RA 2FA7A 2H98A 3MP6A 2I4CA 1N7XA 1B5JA 4HS7A 3FASA 4DLDA 4YKPA 3QSLA 2F7CA 1HSEA 1MDQA 1UQWA 3G3HA 1SBPA 4TQUQ 3WAEA 1DPPA 3E13X 4F19A 3IAZA 4HTGA 3KN8A 4ESXA 1SD3A 4LZ5A 1P1WA 1SVXB 1SW4A 4H5GA 4HCYA 1ZJLA 1MS7A 3OO9A 4YB6A 1MXUA 2XD3A 3S9NC 3IB0A 1UIUA 4F39A 3OSQA 3I5OA 4FECA 4QF9A 2DWAA 1II5A 2G93A 3CSBA 4M4GA 5I58A 5HM4B 3O6GA 4FE8A 1PC3A 3R6UA 3KN7A 4U1OA 4KD5A 3OEMA 4Q0CA 4ZEBA 1B5IA 4RK2A 1AIVA 3QIMA 2GRVA 2BJJX 2D5WA 2XXIA 4JWXA 1B4ZA 1PEBA 5H8SA 5M2VA 1Y20A 3PV0E 4IO3A 4KCDA 3IB1A 1LCTA 3TKDA 2DE3A 1JEUA 1USYE 3TMGA 1EZ9A 2ZYOA 3D4GA 1I6BA 4F2OA 4NTLA 2XXUA 1UTHB 1NKXA 2HXWA 2F78A 4MBPA 3BFTA 1SW1A 3QK6A 3UP9A 3IX1A 2ZMBA 3C35A 4IGRA 2QPQA 4R9GA 4DE8A 4F3BA 1SYHA 4G68C 2B3BA 3FUZA 1A99A 4I9DA 4YZZA 3G3FA 4E0WA 2Z8DA 4OVJA 1MDP1 4NWDA 2F34A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OFO A;  4IY6 A;  4GVO A;  2RKM A;  2XX8 A;  4WED A;  1WVJ A;  4PFY A;  1B3H A;  4KPT A;  3USD A;  3O29 A;  4EXK A;  1H43 A;  5FTI A;  3OXN A;  4GXS B;  2Q8J A;  3FVN A;  3CSG A;  4G68 B;  1B32 A;  2I48 A;  4OEV A;  1IEJ A;  2UVJ A;  5B70 A;  1LAX A;  3K6U A;  4E0X A;  5AA2 A;  1R9Q A;  4LUB A;  4R6K A;  4C0R A;  5TP9 B;  1B2H A;  2VGQ A;  2ONS A;  4JDF A;  3ZSF A;  1Y3N A;  3MZ9 A;  2IA4 A;  1P99 A;  4NMY A;  1JQF A;  1A55 A;  4Q30 B;  3KOT A;  2DE2 A;  1XC1 A;  2Y7I A;  2ABH A;  4QHQ A;  1I6A A;  3HO7 A;  1LB8 A;  3TDJ A;  1VSO A;  1LBB A;  3TTR A;  2P0S A;  2PT2 A;  3T22 A;  4JSD A;  3SEX A;  1A40 A;  4FJP A;  2F36 A;  2VP1 A;  5A5X A;  1IXH A;  3DEL B;  3T9U A;  3OMB A;  3VVE A;  2LAO A;  3OEL A;  2QS4 A;  1HSJ A;  5AA4 A;  1LLS A;  4AB5 A;  4BDN A;  5DT6 A;  4FIM A;  3IL1 B;  3M3L A;  2IEE A;  1B05 A;  2GH9 A;  3G3I A;  4F1Y A;  3RLF E;  1SW2 A;  2UYF A;  2ZXT A;  4RPO A;  3PUV E;  2A5T A;  2DWI A;  3PU5 A;  4H65 A;  3SEY A;  4ZEC A;  4ZE8 A;  4FED A;  1ZTY A;  4ELO A;  1MY0 A;  3QAX A;  3MP1 A;  5FHN A;  4F1V A;  4PFW A;  3SEV A;  5I2N A;  2O1M A;  3BKI B;  1WOD A;  3SEU A;  1D4N A;  2HFB A;  1XHY A;  4MH5 A;  4ND9 A;  3CI8 A;  1MM7 A;  2O68 A;  4YKK A;  1FTL A;  4FEB A;  3BBR A;  3O28 A;  1D9Y A;  1DPE A;  4R2B A;  5FTH A;  2AIX A;  1B5H A;  1PB9 A;  4BLA A;  4QRZ A;  2OLB A;  2NOO A;  2ZYK A;  2OWS A;  3O2A A;  5TU0 A;  3E9X A;  4G8N A;  4IY5 A;  3KFM A;  4BDM A;  4RK9 A;  1MY2 A;  4POX A;  1B0H A;  3TZA A;  3RN8 A;  1USY H;  2DE4 A;  3H6T A;  3G7W A;  1ZBM A;  1PB8 A;  1TFD A;  4RY1 A;  2O7U A;  1LBC A;  5ELV A;  2ESN A;  3O66 A;  1P1Q A;  2FNC A;  3W9V A;  1M5F A;  3K00 A;  3RT8 A;  3RY3 A;  2HZL A;  3QUJ A;  3N6U A;  4RJZ A;  3R26 A;  1URS A;  2XHD A;  4ONY A;  4WXJ A;  4GLI A;  1QUK A;  4OHN A;  3PD8 A;  3PMW A;  4QSD A;  1IQ7 A;  3T93 B;  1LAF E;  2XXY A;  1N04 A;  4JBZ A;  4JWO A;  5IAI A;  1URD A;  4BDR A;  2O7I A;  3PPP A;  1NNT A;  4MLV A;  3CVG A;  3MC2 A;  3FV2 A;  1B40 A;  3P7I A;  4NF8 B;  3MPK A;  3JZJ A;  5ITO A;  3GBB A;  4KYE A;  4EXL A;  1MPD A;  3N6T A;  3MW0 A;  2DOJ A;  1FQB A;  1MY4 A;  5AA1 A;  5JTY B;  3HV1 A;  1MPB A;  5I59 A;  1LFG A;  5FHO A;  1F9B A;  4IO6 A;  3IOU A;  4LQ2 A;  1SDX A;  1FCK A;  4LZ7 A;  5L8D A;  3LSL A;  1B52 A;  2DQV A;  3W9W A;  2E0S A;  4H67 A;  2QMW A;  2I58 A;  5ICT A;  1UTB A;  4YMB A;  4IGT A;  3T96 B;  2NWJ A;  5JK4 A;  2HAV A;  1H45 A;  2I0C A;  1GV8 A;  1BP5 A;  4DXB A;  1B3L A;  2I4B A;  3C32 A;  2RC8 A;  2DVZ A;  1LFH A;  3ILT B;  2HQ0 A;  1VR5 A;  2B3F A;  4TLM B;  3GXA A;  3FVK A;  2ALU A;  1ZIU A;  4RNS A;  5I56 B;  3TCG A;  3TTL A;  3BFU A;  4IB2 A;  4G2Z A;  3IJX B;  1SQY A;  2QMX A;  3JV9 A;  4U22 A;  1OQH A;  1TFA A;  1B3F A;  4N13 A;  2RCA A;  1IXI A;  1QUJ A;  1Y3Q A;  1LST A;  3TQW A;  2OBG A;  4OYV A;  5FHM A;  4X1B A;  2Q88 A;  4NF6 A;  4ELQ A;  5I2N B;  4AB6 A;  3T9X B;  5KCJ B;  3IR1 A;  3JYR A;  1I69 A;  1Y4T A;  1VE4 A;  4X48 A;  3VVF A;  4ZEK A;  1B4H A;  4MLQ A;  1B46 A;  3R7X A;  3SET A;  3KJ7 A;  4IO4 A;  1N7W A;  3TQL A;  4YKI A;  3UIF A;  1ZKB A;  2OZZ A;  4MFI A;  3H03 A;  2F35 A;  3EHU A;  3C31 A;  3UGW A;  3S9L C;  1JVX A;  5CMK A;  2PMS A;  1QJM A;  1RYX A;  5CM6 A;  3OO7 A;  4QFO A;  1XOC A;  1Z7M E;  3G3J A;  3EF7 A;  4JWY A;  3K2D A;  2Z22 A;  3FXR A;  1XVX A;  4F18 A;  2D3I A;  2GHA A;  3HST A;  1MQH A;  2X26 A;  1ZMG A;  4LA9 A;  5KZT A;  1S7Y A;  3K0V A;  1A54 A;  4QSE A;  1XS5 A;  3PPO A;  1H3D A;  4R72 A;  1Y4C A;  3E3K A;  4DIG A;  5DEX B;  1BIY A;  1IXC A;  1N0T A;  2O51 A;  1LB9 A;  5H8Q B;  1OIB A;  4O3C A;  1M5E A;  4FAT A;  3AXF A;  3VVD A;  3DP4 A;  5TPA B;  1A8F A;  1PBQ A;  1FQE A;  2RC9 A;  4NE4 A;  5CI5 A;  1MY1 A;  4XKR A;  4NF5 A;  3SER A;  2UVG A;  3M8U A;  4C1T A;  3PPN A;  1ZLQ A;  4H8J A;  1JEV A;  3SES A;  5KDT B;  5F1Q A;  3LSW A;  4QFL A;  1MQJ A;  2F7B A;  2F6P A;  3O9P A;  4XIG Q;  2HEU A;  1LCF A;  5I59 B;  2AL5 A;  1TXF A;  2OJT A;  3TCF A;  2PT1 A;  1JW1 A;  2WKY A;  3VXC A;  4OZ9 A;  1CB6 A;  4G8M A;  4YB5 A;  3EPE A;  3SKP A;  4QFK A;  2QS1 A;  4YB7 A;  3IK6 B;  3VXB A;  1TWY A;  2DWJ A;  3KEI A;  2QRY A;  4DZ1 A;  4ZEI A;  5ITP A;  4NF4 A;  2OK2 A;  4I8C A;  1M5D A;  3TTM A;  1DSN A;  4XKP A;  4I62 A;  4M1V A;  4WKM A;  1M5B A;  5JEI A;  1TT1 A;  3PUX E;  4IO5 A;  2DSF A;  1OQG A;  2XXX A;  2RIN A;  3CFX A;  2ZNU A;  5AE4 A;  2V3T A;  1N3X A;  3CFL A;  3CRB A;  1IXG A;  1NL5 A;  2ZYN A;  1A7L A;  5CC2 A;  4LVQ A;  2THI A;  5L9O A;  2D21 A;  3TUS A;  1PBP A;  3LSF B;  3EN3 A;  3H6V A;  3V8X B;  1OVB A;  1FW0 A;  1B9J A;  1P1N A;  5ISU A;  4L17 A;  3VFJ A;  2XXR A;  2QSX A;  3VLU A;  4JB7 A;  3Q27 A;  3UA8 A;  1QKB A;  1R1N A;  3FV1 A;  5B7D A;  5H8F A;  2ANJ A;  2KLF A;  3V5A A;  4N07 A;  1Y1M A;  2Z8F A;  3W15 C;  5J1D A;  3ZKL A;  4U4S A;  4O3B A;  2GHB A;  5DYH A;  1YTV A;  3KGC A;  4OEU A;  1LAH E;  4F3S A;  4OMB A;  5H8N A;  4FAJ A;  3G3K A;  3O6I A;  1NNF A;  4LQ5 A;  4KHZ E;  1GTK A;  4DXC A;  2QL3 A;  2ZNT A;  1LFI A;  4THI A;  3CG1 A;  3LUY A;  2P1S A;  1ZU0 A;  3PPR A;  3K6W A;  1BTJ A;  1Q35 A;  5EHM A;  3GLB A;  2H25 A;  4Z7E A;  2V3Q A;  1SYI A;  1B3G A;  4EF1 A;  1ANF A;  1S50 A;  5I58 B;  3L6G A;  2W7Y A;  3CIJ A;  3FXU A;  3QUF A;  4U23 A;  3A3C A;  1PDA A;  1YPN A;  4DDD A;  2Q9T A;  3DM0 A;  4P0I A;  5DTB A;  1MPC A;  1MQD A;  1FQA A;  3B6Q A;  3TAJ A;  3CFZ A;  3I6V A;  4XTC Q;  1B7Z A;  3FJG A;  4YU0 A;  4EDP A;  1R6Z A;  3K1M A;  3OSR A;  4YAH X;  3MZB A;  2UVH A;  3C4M A;  1MXW A;  2YJP A;  2O84 X;  4Q8R A;  5H8H A;  2F5X A;  3PGF A;  2ZYM A;  1AMF A;  3K6V A;  2YLN A;  3T9V A;  2O1L A;  1NH7 A;  4F3P A;  3MVZ A;  4F31 B;  1L5T A;  4WEP A;  3K6X A;  3PD9 A;  3MZ1 A;  4GD5 A;  3RTF B;  4KI0 E;  4JSO A;  4ELP A;  3N94 A;  3IB2 A;  1DMB A;  4LON B;  4PE5 B;  3PUW E;  3MPL A;  3Q25 A;  1QW0 A;  3H6U A;  3TEP A;  4RXL A;  3O6H A;  4GF8 A;  4ZDM A;  3QYT A;  3FGS A;  3GZG A;  4R74 A;  3TTN A;  2Z23 A;  4Z0I A;  4OFJ A;  3N5L A;  5AA3 A;  3OOA A;  2GFE A;  1FQF A;  1RKM A;  2UXA A;  4OQO A;  4ZZE A;  4EQB A;  2Q2C A;  4N6P A;  1YCJ A;  4NED A;  5L9M A;  5AA2 B;  1PB7 A;  2DS9 A;  1EU8 A;  1Y9U A;  4R2F A;  1H44 A;  5CMC A;  3LSX A;  1FTM A;  1O7T A;  3MVY A;  3QXM A;  5HBC A;  3S9E A;  1ATG A;  3RT6 B;  3S4U A;  5IKB A;  4QFN A;  1OLA A;  3T66 A;  5I2K A;  1NH8 A;  3B6W A;  4LZ8 A;  3DP6 A;  4R73 A;  2UYE A;  4H8I A;  2NVU B;  1JVY A;  3U94 A;  3MAM A;  3OD7 A;  4RYA A;  4F2Q A;  5A5X B;  1UIV A;  1B1X A;  1NNP A;  1QUI A;  3THI A;  3U72 A;  4GOT A;  3PPQ A;  2VHA A;  3H3G A;  3ZS6 A;  2QS2 A;  5AA4 B;  3IJO B;  4EQ9 A;  4ISU A;  4U1Z A;  2YPN A;  1P1O A;  2ZNS A;  2Q2A A;  1D3K A;  1N3W A;  1P1U A;  2REG A;  2V84 A;  3IO4 A;  2XXW A;  4OER A;  2A5T B;  1GVC A;  2DXR A;  4GQO A;  3EHS A;  2I49 A;  3OEN A;  1FQC A;  1MRP A;  3G3G A;  4KQP A;  2RF1 A;  3TOD A;  3IOV A;  1Z7N E;  3IOT A;  2PYY A;  2HZK A;  1S9T A;  1B51 A;  3HN0 A;  1B1H A;  2H9B A;  3C34 A;  2XXP A;  4IO7 A;  2XX7 A;  2XXH A;  3TFL A;  1IIT A;  2UVI A;  4BDO A;  1RYO A;  2Y84 A;  3UN6 A;  4OET A;  3A3U A;  1MH3 A;  3EHT A;  5CMM A;  4G8H A;  3U93 A;  3LR1 A;  4JXI A;  4P0G A;  2CMO A;  5H8H B;  3H7M A;  4H5F A;  1LAG E;  1XVY A;  1OMP A;  2OCU A;  2QS3 A;  1JET A;  5LOM A;  3V89 B;  3DP8 A;  4YIC A;  3TCH A;  3MUQ A;  4X1D A;  3UK4 A;  1AH5 A;  3IO6 A;  2P2A A;  4GL0 A;  4PQJ A;  4KCC A;  5EYF A;  3FJM A;  3Q29 A;  3KJT A;  4GWO A;  3OO8 A;  3S2V A;  5AA2 D;  5EHS A;  1DOT A;  2R9J A;  4YKJ A;  5DVI A;  4EQ7 A;  3OO6 A;  5CBR A;  2XX9 A;  2Y7W A;  2PBW A;  1GGG A;  3PUY E;  2O6A A;  2XD2 A;  1JW4 A;  2OWT A;  4OFL A;  2I3V A;  3O97 A;  1MQG A;  4GXA A;  1BKA A;  4OXV A;  1MXV A;  4QSC A;  1US4 A;  3VV5 A;  4RA1 A;  3K02 A;  3TEL A;  1US5 A;  3RPW A;  4R6H A;  3ILU B;  3B7D A;  3A09 A;  4O3A A;  1R9L A;  4HW8 A;  1NFT A;  4ZZA A;  3K1N A;  3K4U A;  1B3E A;  4HCW A;  3HPI A;  1OVT A;  1QKA A;  1UTB B;  4F3G A;  1A8E A;  3U8Q A;  3MWB A;  1YAE A;  3ZKK A;  5I2K B;  4NF8 A;  5L9S A;  2ONK E;  3H4Z A;  5DVJ A;  1FTJ A;  2G29 A;  2M8C A;  4H1X A;  3TPA A;  4G77 A;  4G4P A;  3VE1 B;  2CZL A;  3S9M C;  5JTY A;  5F7V A;  1SI0 A;  1Q1K A;  2V93 A;  1POT A;  2V25 A;  1D9V A;  3CR9 A;  1N84 A;  3M3K A;  4F1U A;  1EH3 A;  4K3F A;  1SW5 A;  2DWH A;  4X9T A;  3MVX A;  4C1U A;  5K2Y A;  4OTE A;  4EF2 A;  4DCX A;  3U1O A;  5I57 A;  2HCA A;  3FZV A;  2RC7 A;  3C36 A;  3FAT A;  2AYS A;  4PET A;  1IUD A;  3KG2 A;  2XXQ A;  4PFU A;  4ZE9 A;  4LAT A;  4ECF A;  1B6H A;  4NF6 B;  1DTZ A;  1HSL A;  1N76 A;  1QVS A;  3MP8 A;  3RNN A;  4ZED A;  1FQD A;  3EQ1 A;  4DCY A;  3DLN A;  1AOV A;  3FVG A;  3KN3 A;  1BLF A;  4F22 A;  4OEN A;  1MM6 A;  4EUO A;  2DVC A;  2Q89 A;  2VD2 A;  3I3V A;  3D4C A;  3M3F A;  3ONM A;  4KR5 A;  4GIZ A;  5I56 A;  2PX1 A;  4H0W A;  1JNF A;  2I3W A;  4LP2 B;  3KSX A;  3RGY A;  4UA8 A;  3PUZ E;  2H5Y A;  2NXO A;  3TTK A;  1B7U A;  5BUU A;  3H6W A;  1FTK A;  3MQ9 A;  1I6Q A;  4OWD A;  3FXQ A;  2RCB A;  4U2R A;  3HHF A;  3SEW A;  4NWC A;  2NUV A;  4KYD A;  2B65 A;  3LC8 A;  4OES A;  3WAF A;  1VFE A;  2H99 A;  2Z8E A;  1M5C A;  2DP8 A;  5KCJ A;  1NNK A;  3MBP A;  3KSJ A;  4Q5T A;  4KYS A;  3N26 A;  2Y7R A;  1IIW A;  2Y7P A;  1QUL A;  1SI1 A;  4GRK A;  2F7A A;  3FD3 A;  4IO2 A;  4ESW A;  4ZEF A;  1DTG A;  3K1P A;  4RPN A;  1T0K A;  3SDF A;  3KBR A;  4YMA A;  2DXY A;  4NF5 B;  4F29 A;  5CRY A;  4ELR A;  4XXU A;  1CE2 A;  4PP0 A;  4POW A;  3VLV A;  3HHG A;  4P11 A;  2R71 A;  4GFR A;  2HAU A;  3L6H A;  2E1S A;  3Q26 A;  3ODB A;  3GBA A;  4PFT A;  3RTW B;  3C33 A;  2I6E A;  5K2X A;  3UOR A;  5CBS A;  3T9H B;  3FJ7 A;  3CG3 A;  5DEX A;  2VD3 A;  2O69 A;  4AQ4 A;  5H8Q A;  4NF4 B;  5I84 A;  1Y3P A;  4U4X A;  3H06 B;  4R9F A;  5TPA A;  3KZG A;  1H76 A;  1WDN A;  2F8D A;  4KFQ A;  1MXY A;  1O64 A;  2DYX A;  2X7P A;  1IZ1 A;  4TOZ A;  3TYH A;  4R75 A;  1UTH A;  4U21 A;  4XKQ A;  2X7Q A;  1AL3 A;  5ICQ A;  2FYI A;  5CMB A;  5KDT A;  1FTO A;  3B6T A;  4MF3 A;  2I0B A;  1MQI A;  3MJN A;  4XKN A;  3U92 A;  2XXT A;  1MG1 A;  3V83 A;  3K01 A;  1LGB C;  3HCQ A;  1JW5 A;  2ONR A;  4QFP A;  1ELJ A;  3LBS A;  2A5S A;  3IOW A;  1OLC A;  4BDL A;  3Q28 A;  1MH4 A;  3F11 A;  5I57 B;  1MY3 A;  3FVO A;  3VLW A;  2R6G E;  4R6Y A;  2Y7K A;  3RQT A;  5H8F B;  1EZP A;  3C9H A;  2F97 A;  2XXV A;  1POY 1;  3KOS A;  4ZS9 A;  2REJ A;  3IOR A;  4H6D A;  2VOZ A;  1B58 A;  2F6G A;  1MXZ A;  3OEK A;  1GR2 A;  2V3U A;  4G68 A;  4DXU A;  2QJE A;  5DVF A;  4GL8 A;  4I1D A;  1NMU A;  4UAC A;  3PMX A;  3PMV A;  5H8N B;  1B7H A;  3MVW A;  1KWH A;  3FIR A;  1EZO A;  3RUM A;  3VDF A;  1J1N A;  5TP9 A;  1XT8 A;  5BWJ A;  4TLL B;  1B0L A;  1Y1Z A;  1O63 A;  2AL4 A;  1URG A;  4FOR A;  1MXX A;  5HPQ A;  4BDQ A;  1VFD A;  2H4I A;  3ECR A;  2PVU A;  3E4R A;  2FA7 A;  2H98 A;  3MP6 A;  2I4C A;  1N7X A;  1B5J A;  4HS7 A;  3FAS A;  4DLD A;  4YKP A;  3QSL A;  2F7C A;  1HSE A;  1MDQ A;  1UQW A;  3G3H A;  1SBP A;  4TQU Q;  3WAE A;  1DPP A;  3E13 X;  4F19 A;  3IAZ A;  4HTG A;  3KN8 A;  4ESX A;  1SD3 A;  4LZ5 A;  1P1W A;  1SVX B;  1SW4 A;  4H5G A;  4HCY A;  1ZJL A;  1MS7 A;  3OO9 A;  4YB6 A;  1MXU A;  2XD3 A;  3S9N C;  3IB0 A;  1UIU A;  4F39 A;  3OSQ A;  3I5O A;  4FEC A;  4QF9 A;  2DWA A;  1II5 A;  2G93 A;  3CSB A;  4M4G A;  5I58 A;  5HM4 B;  3O6G A;  4FE8 A;  1PC3 A;  3R6U A;  3KN7 A;  4U1O A;  4KD5 A;  3OEM A;  4Q0C A;  4ZEB A;  1B5I A;  4RK2 A;  1AIV A;  3QIM A;  2GRV A;  2BJJ X;  2D5W A;  2XXI A;  4JWX A;  1B4Z A;  1PEB A;  5H8S A;  5M2V A;  1Y20 A;  3PV0 E;  4IO3 A;  4KCD A;  3IB1 A;  1LCT A;  3TKD A;  2DE3 A;  1JEU A;  1USY E;  3TMG A;  1EZ9 A;  2ZYO A;  3D4G A;  1I6B A;  4F2O A;  4NTL A;  2XXU A;  1UTH B;  1NKX A;  2HXW A;  2F78 A;  4MBP A;  3BFT A;  1SW1 A;  3QK6 A;  3UP9 A;  3IX1 A;  2ZMB A;  3C35 A;  4IGR A;  2QPQ A;  4R9G A;  4DE8 A;  4F3B A;  1SYH A;  4G68 C;  2B3B A;  3FUZ A;  1A99 A;  4I9D A;  4YZZ A;  3G3F A;  4E0W A;  2Z8D A;  4OVJ A;  1MDP 1;  4NWD A;  2F34 A; 
#chains in the Genus database with same CATH topology
 2WEF A;  5FBP A;  4OFO A;  1FJ9 A;  2B4L A;  2XXK A;  4IY6 A;  4GVO A;  2RKM A;  2XX8 A;  4MAG A;  4WED A;  1WVJ A;  4PFY A;  1B3H A;  4KPT A;  3USD A;  3O29 A;  4EXK A;  1H43 A;  1FBD A;  5FTI A;  3OXN A;  4GXS B;  2Q8J A;  3FVN A;  3CSG A;  4JVI A;  4G68 B;  5J16 A;  1IMC A;  1B32 A;  2I48 A;  4OEV A;  1IEJ A;  2UVJ A;  5B70 A;  2Y5K A;  1LAX A;  2FIX A;  3K6U A;  4E0X A;  5AA2 A;  1R9Q A;  4LUB A;  1NV5 A;  4MNI A;  4R6K A;  4C0R A;  5TP9 B;  1B2H A;  2VGQ A;  2ONS A;  4JDF A;  3ZSF A;  1Y3N A;  4NAP A;  3MZ9 A;  2IA4 A;  1P99 A;  4NMY A;  1JQF A;  1BK4 A;  1A55 A;  4Q30 B;  3KOT A;  2DE2 A;  1XC1 A;  2Y7I A;  2ABH A;  3MYU A;  1I6A A;  4QHQ A;  5F24 A;  3HO7 A;  1LB8 A;  3TDJ A;  1VSO A;  1LBB A;  3TTR A;  2P0S A;  2PT2 A;  3T22 A;  4JSD A;  3SEX A;  1A40 A;  4FJP A;  2F36 A;  2VP1 A;  5A5X A;  1IXH A;  3DEL B;  3T9U A;  4PAI A;  3OMB A;  1IMD A;  3VVE A;  2LAO A;  3OEL A;  2QS4 A;  1HSJ A;  5AA4 A;  1LLS A;  2WX9 A;  4PBQ A;  4AB5 A;  4BDN A;  5DT6 A;  4FIM A;  4OVT A;  4I40 A;  3IL1 B;  3M3L A;  2IEE A;  1B05 A;  2GH9 A;  3G3I A;  4F1Y A;  3RLF E;  1SW2 A;  2UYF A;  2ZXT A;  4RPO A;  3PUV E;  2A5T A;  2DWI A;  3PU5 A;  4H65 A;  3SEY A;  4ZEC A;  4ZE8 A;  4FED A;  1ZTY A;  4ELO A;  1MY0 A;  3QAX A;  3MP1 A;  5FHN A;  4F1V A;  4PFW A;  3SEV A;  5I2N A;  2CZH A;  2O1M A;  1KA0 A;  3BKI B;  1WOD A;  3SEU A;  1D4N A;  2HFB A;  1XHY A;  4HXV A;  4MH5 A;  4PBH A;  4MIJ A;  4ND9 A;  5ET8 A;  3CI8 A;  1MM7 A;  2O68 A;  4YKK A;  1FTL A;  4FEB A;  3BBR A;  3O28 A;  1D9Y A;  1DPE A;  4R2B A;  5FTH A;  2AIX A;  1B5H A;  1PB9 A;  4BLA A;  4QRZ A;  1SPI A;  2OLB A;  2NOO A;  2ZYK A;  2OWS A;  3O2A A;  5TU0 A;  1G0I A;  3E9X A;  4G8N A;  4IY5 A;  3KFM A;  4BDM A;  4RK9 A;  1MY2 A;  4POX A;  1B0H A;  3TZA A;  3RN8 A;  2QFL A;  1USY H;  2DE4 A;  3H6T A;  3G7W A;  1ZBM A;  3D1R A;  1PB8 A;  4P9K A;  1TFD A;  4RY1 A;  2O7U A;  4PCD A;  1LBC A;  1YZ0 A;  5ELV A;  1IME A;  2ESN A;  3O66 A;  1P1Q A;  2FNC A;  3W9V A;  1M5F A;  3K00 A;  5IZ1 A;  3RT8 A;  3RY3 A;  2HZL A;  3QUJ A;  3N6U A;  4RJZ A;  3R26 A;  1URS A;  2XHD A;  4PDD A;  4ONY A;  4WXJ A;  4GLI A;  4MJO A;  1QUK A;  5EQ7 A;  4OHN A;  3PD8 A;  3PMW A;  4QSD A;  1FBF A;  1IQ7 A;  3T93 B;  1EYI A;  1LAF E;  1N04 A;  2XXY A;  4JWO A;  4JBZ A;  2KR0 A;  5IAI A;  1URD A;  4BDR A;  2O7I A;  3PPP A;  4N4U A;  1NNT A;  4MLV A;  3CVG A;  3MC2 A;  1NV0 A;  1DCU A;  1B40 A;  3FV2 A;  3P7I A;  4X04 A;  4NF8 B;  3MPK A;  3JZJ A;  5ITO A;  3GBB A;  4KYE A;  4EXL A;  1MPD A;  3N6T A;  3MW0 A;  2DOJ A;  1FQB A;  1MY4 A;  5AA1 A;  4N8G A;  5JTY B;  4PC9 A;  3HV1 A;  1MPB A;  5I59 A;  1LFG A;  5FHO A;  3LV0 A;  1F9B A;  4IO6 A;  3IOU A;  4LQ2 A;  1SDX A;  1FCK A;  5IM2 A;  4LZ7 A;  5L8D A;  2CZI A;  3LSL A;  1B52 A;  2DQV A;  3W9W A;  5I5P A;  2E0S A;  4H67 A;  2QMW A;  2I58 A;  5ICT A;  4P1E A;  1UTB A;  3KC1 A;  4YMB A;  4IGT A;  3T96 B;  2NWJ A;  5JK4 A;  2HAV A;  1YYZ A;  1H45 A;  2I0C A;  4FBP A;  1GV8 A;  1BP5 A;  3T1B A;  4DXB A;  1B3L A;  2I4B A;  3C32 A;  4LN5 A;  2GQ1 A;  2RC8 A;  2DVZ A;  1LFH A;  3ILT B;  2HQ0 A;  1VR5 A;  2B3F A;  4TLM B;  3GXA A;  3FVK A;  2ALU A;  1ZIU A;  4RNS A;  5I56 B;  3TCG A;  2PFZ A;  3TTL A;  3BFU A;  4IB2 A;  4G2Z A;  4OVR A;  3IJX B;  1SQY A;  3SZP A;  2QMX A;  3JV9 A;  4U22 A;  1OQH A;  1TFA A;  1NI9 A;  1K9Y A;  1B3F A;  4N13 A;  2RCA A;  1IXI A;  1QUJ A;  1Y3Q A;  5EQA A;  1LST A;  3TQW A;  2OBG A;  4OYV A;  1LBY A;  3PTY A;  2P3N A;  5FHM A;  2OX3 A;  4X1B A;  2Q88 A;  4NF6 A;  4ELQ A;  5I2N B;  2BJI A;  4AB6 A;  4GBW A;  3T9X B;  5KCJ B;  3IR1 A;  3JYR A;  1I69 A;  1FPE A;  1Y4T A;  3BIG A;  1VE4 A;  1FJ6 A;  1EYK A;  4X48 A;  3VVF A;  4ZEK A;  1FBG A;  1B4H A;  4MLQ A;  1B46 A;  3R7X A;  2VT5 A;  2CEY A;  4MNP A;  3SET A;  3KJ7 A;  4IO4 A;  1N7W A;  3TQL A;  4YKI A;  3UIF A;  4GWS A;  1ZKB A;  2OZZ A;  4MFI A;  4XEQ A;  3RPL A;  3H03 A;  2F35 A;  3EHU A;  3C31 A;  3UGW A;  3S9L C;  1JVX A;  5CMK A;  4PF6 A;  2PMS A;  1QJM A;  1RYX A;  5CM6 A;  1FPB A;  3OO7 A;  4QFO A;  1XOC A;  1Z7M E;  3G3J A;  4P8B A;  3EF7 A;  4JWY A;  3K2D A;  5I7I A;  2Z22 A;  3FXR A;  1XVX A;  4F18 A;  2D3I A;  1YXI A;  2GHA A;  3HST A;  1MQH A;  2X26 A;  1ZMG A;  4LA9 A;  5KZT A;  1S7Y A;  3K0V A;  1A54 A;  4OVQ A;  4QSE A;  1AWB A;  5IZ3 A;  1XS5 A;  3PPO A;  1H3D A;  4OAN A;  4R72 A;  1Y4C A;  3E3K A;  4DIG A;  5DEX B;  1BIY A;  1IXC A;  1N0T A;  2O51 A;  4PF8 A;  1LB9 A;  5H8Q B;  1OIB A;  4O3C A;  1M5E A;  4FAT A;  3AXF A;  3VVD A;  3DP4 A;  5ESY A;  5TPA B;  1A8F A;  1PBQ A;  1FQE A;  2RC9 A;  4NE4 A;  5CI5 A;  1MY1 A;  4XKR A;  4NF5 A;  2FHY A;  2PCR A;  3SER A;  2UVG A;  3M8U A;  4PE3 A;  4C1T A;  4GWU A;  3PPN A;  1ZLQ A;  4H8J A;  1JEV A;  3SES A;  5KDT B;  5F1Q A;  4MCO A;  3LSW A;  4QFL A;  1MQJ A;  2F7B A;  3U65 A;  2F6P A;  3O9P A;  4JVD A;  4XIG Q;  2HEU A;  1LCF A;  5I59 B;  2AL5 A;  1TXF A;  2OJT A;  5T3J A;  2PT1 A;  4OVS A;  3TCF A;  1JW1 A;  2WKY A;  3VXC A;  4OZ9 A;  5A5L A;  1CB6 A;  4G8M A;  4YB5 A;  3EPE A;  3SKP A;  4QFK A;  2QS1 A;  4YB7 A;  3IK6 B;  3VXB A;  1TWY A;  2DWJ A;  3KEI A;  2QRY A;  4PFI A;  4DZ1 A;  4ZEI A;  1DBZ A;  5ITP A;  4NF4 A;  2OK2 A;  4I8C A;  1M5D A;  3TTM A;  1DSN A;  4XKP A;  4I62 A;  1NUZ A;  4GX4 A;  4M1V A;  4WKM A;  1NV7 A;  1M5B A;  5JEI A;  1TT1 A;  4H46 A;  3PUX E;  4IO5 A;  2DSF A;  1OQG A;  2XXX A;  2RIN A;  3CFX A;  2ZNU A;  5AE4 A;  2V3T A;  1N3X A;  3CFL A;  3CRB A;  1IXG A;  1NL5 A;  2ZYN A;  5DW8 A;  1A7L A;  5CC2 A;  4LVQ A;  5ET5 A;  2THI A;  5IGA A;  5L9O A;  2D21 A;  3TUS A;  1PBP A;  3LSF B;  3EN3 A;  2ZZV A;  3H6V A;  3V8X B;  1OVB A;  1FW0 A;  1B9J A;  1P1N A;  5ISU A;  4L17 A;  3VFJ A;  2XXR A;  2QSX A;  3VLU A;  4P1L A;  4JB7 A;  3Q27 A;  2PFY A;  3UA8 A;  1QKB A;  1R1N A;  3FV1 A;  5B7D A;  5H8F A;  2ANJ A;  2KLF A;  4O7M A;  3V5A A;  4N81 A;  2WYP A;  4N07 A;  2WBD A;  1Y1M A;  2Z8F A;  1LBX A;  3W15 C;  5J1D A;  3ZKL A;  1FBP A;  4U4S A;  4O3B A;  2GHB A;  4N8Y A;  5DYH A;  1YTV A;  3KGC A;  1VDW A;  4NQ8 A;  4OEU A;  1LAH E;  4F3S A;  5ET7 A;  4OMB A;  4MX6 A;  5H8N A;  4FAJ A;  3G3K A;  3O6I A;  1NNF A;  4LQ5 A;  4KHZ E;  1GTK A;  4DXC A;  2QL3 A;  2ZNT A;  3RPL B;  1LFI A;  4THI A;  1FBC A;  3CG1 A;  3LUY A;  2P1S A;  1ZU0 A;  2MKZ A;  3PPR A;  3K6W A;  1BTJ A;  1Q35 A;  5EHM A;  3GLB A;  2H25 A;  4Z7E A;  2V3Q A;  1SYI A;  1B3G A;  4EF1 A;  1ANF A;  1S50 A;  5I58 B;  4MHF A;  3L6G A;  2W7Y A;  3CIJ A;  3FXU A;  3QUF A;  4U23 A;  3A3C A;  1PDA A;  1YPN A;  4DDD A;  2Q9T A;  3DM0 A;  5IZ3 B;  4GWY A;  4P0I A;  4NG7 A;  5DTB A;  1MPC A;  1MQD A;  1FQA A;  3B6Q A;  3TAJ A;  3CFZ A;  3I6V A;  3HFU A;  3GYY A;  4XTC Q;  1B7Z A;  3FJG A;  4YU0 A;  4EDP A;  1R6Z A;  3K1M A;  3OSR A;  4YAH X;  3MZB A;  2UVH A;  3C4M A;  1MXW A;  2YJP A;  2O84 X;  4Q8R A;  5H8H A;  2F5X A;  3PGF A;  2ZYM A;  2XWO A;  1AMF A;  3K6V A;  4N17 A;  4XFE A;  2YLN A;  3T9V A;  2O1L A;  1NH7 A;  4F3P A;  3MVZ A;  4F31 B;  1L5T A;  4WEP A;  1KZ8 A;  3K6X A;  3PD9 A;  3MZ1 A;  4HE0 A;  4GD5 A;  3RTF B;  4KI0 E;  4JSO A;  4ELP A;  2L5V A;  3N94 A;  3IB2 A;  1DMB A;  4P56 A;  4LON B;  4PE5 B;  3PUW E;  3MPL A;  3Q25 A;  1QW0 A;  3H6U A;  4PTK A;  3TEP A;  4RXL A;  3T0J A;  3O6H A;  4GF8 A;  4ZDM A;  3QYT A;  3FGS A;  3GZG A;  1FRP A;  4R74 A;  3TTN A;  2Z23 A;  4Z0I A;  4OFJ A;  5I3S A;  3N5L A;  5AA3 A;  3OOA A;  2GFE A;  1FQF A;  1RKM A;  2UXA A;  4PGP A;  2Q74 A;  3IFC A;  4OQO A;  4ZZE A;  4EQB A;  2Q2C A;  1QGX A;  4N6P A;  4MEV A;  1YCJ A;  4NED A;  3E78 A;  5L9M A;  5AA2 B;  1PB7 A;  2DS9 A;  1EU8 A;  5EQ8 A;  1Y9U A;  4R2F A;  1H44 A;  5CMC A;  3LSX A;  1FTM A;  4MNC A;  1O7T A;  3MVY A;  3QXM A;  5HBC A;  4NF0 A;  3S9E A;  1ATG A;  3RT6 B;  3S4U A;  5IKB A;  2QVV A;  4QFN A;  1OLA A;  3T66 A;  5I2K A;  1NH8 A;  3B6W A;  4LZ8 A;  3DP6 A;  4R73 A;  2UYE A;  4AS4 A;  4H8I A;  2XWI A;  2NVU B;  1JVY A;  3U94 A;  2R8T A;  3MAM A;  3OD7 A;  4RYA A;  3BIH A;  4F2Q A;  5A5X B;  1UIV A;  1B1X A;  1NNP A;  1QUI A;  3THI A;  3U72 A;  4GOT A;  3PPQ A;  2VHA A;  3H3G A;  3ZS6 A;  2QS2 A;  4KXP A;  5AA4 B;  3ISP A;  3IJO B;  4EQ9 A;  4ISU A;  4U1Z A;  2YPN A;  1P1O A;  2ZNS A;  2Q2A A;  1D3K A;  1XI6 A;  4N15 A;  1N3W A;  1P1U A;  2REG A;  2V84 A;  3IO4 A;  4P3L A;  2XXW A;  4OER A;  2A5T B;  2WYK A;  1GVC A;  4DI4 B;  2DXR A;  4GQO A;  2Q8M A;  3EHS A;  2I49 A;  3OEN A;  1FQC A;  1MRP A;  3G3G A;  4KQP A;  2RF1 A;  3TOD A;  3IOV A;  1Z7N E;  3IOT A;  4I3Y A;  1FPF A;  2PYY A;  2HZK A;  1S9T A;  1B51 A;  3HN0 A;  1B1H A;  1IMF A;  2H9B A;  2V4C A;  3C34 A;  2XXP A;  4IO7 A;  2XX7 A;  2XXH A;  3TFL A;  1IIT A;  4N6K A;  2F3D A;  2UVI A;  2OWZ A;  4BDO A;  1RYO A;  2Y84 A;  4HE2 A;  3UN6 A;  4OET A;  3A3U A;  1MH3 A;  3EHT A;  3ROJ A;  5CMM A;  4G8H A;  3U93 A;  3LR1 A;  4JXI A;  4P0G A;  2CMO A;  3CHG A;  5H8H B;  3H7M A;  4H5F A;  1LAG E;  1XVY A;  1OMP A;  2OCU A;  2QS3 A;  1JET A;  5LOM A;  3V89 B;  3DP8 A;  4YIC A;  3TCH A;  3MUQ A;  4X1D A;  3UK4 A;  1K9Z A;  1FTA A;  1AH5 A;  3IO6 A;  2P2A A;  4GL0 A;  2FBP A;  4PQJ A;  4N6D A;  4PAF A;  4KCC A;  5EYF A;  3FJM A;  3Q29 A;  1LBV A;  3KJT A;  4GWO A;  3OO8 A;  3S2V A;  2B4M A;  5AA2 D;  5EHS A;  1DOT A;  2R9J A;  4YKJ A;  5DVI A;  5EQ9 A;  3OO6 A;  4EQ7 A;  5CBR A;  2XX9 A;  3EKI A;  2Y7W A;  2PBW A;  1GGG A;  1NUX A;  2QVU A;  1LEV A;  3PUY E;  2O6A A;  4PAK A;  2XD2 A;  1JW4 A;  2OWT A;  1JP4 A;  4OFL A;  2I3V A;  3O97 A;  1MQG A;  4GXA A;  1BKA A;  4OXV A;  1MXV A;  4QSC A;  1US4 A;  3VV5 A;  4RA1 A;  3K02 A;  3TEL A;  1US5 A;  3RPW A;  4R6H A;  3ILU B;  3B7D A;  3A09 A;  4O3A A;  1R9L A;  4JVC A;  4HW8 A;  1NFT A;  4ZZA A;  1FPJ A;  3K1N A;  3K4U A;  1B3E A;  4HCW A;  5LTC A;  3HPI A;  1OVT A;  1QKA A;  1UTB B;  4F3G A;  1A8E A;  3U8Q A;  3MWB A;  1YAE A;  2HHM A;  5I2K B;  3ZKK A;  4NF8 A;  5L9S A;  4NX1 A;  4G61 A;  2P3V A;  2ONK E;  3H4Z A;  5DVJ A;  1FTJ A;  2G29 A;  2M8C A;  1LBW A;  4H1X A;  3TPA A;  4G77 A;  4G4P A;  3VE1 B;  2CZL A;  3S9M C;  1FSA A;  5JTY A;  5F7V A;  1SI0 A;  1Q1K A;  2V93 A;  1POT A;  2XWK A;  2V25 A;  1D9V A;  3CR9 A;  1N84 A;  3M3K A;  2VPN A;  4F1U A;  1EH3 A;  4K3F A;  2Y5L A;  2JJK A;  1SW5 A;  2DWH A;  4X9T A;  3MVX A;  4C1U A;  5K2Y A;  4OTE A;  4EF2 A;  4DCX A;  3U1O A;  5I57 A;  2HCA A;  4O8M A;  4IR8 A;  3NOH A;  4O94 A;  3FZV A;  2RC7 A;  3C36 A;  3FAT A;  2AYS A;  4PET A;  1IUD A;  3KG2 A;  2XXQ A;  4PFU A;  4ZE9 A;  5EYH A;  4LAT A;  4ECF A;  1B6H A;  1CNQ A;  1NV4 A;  4NF6 B;  1DTZ A;  1HSL A;  1N76 A;  1QVS A;  3MP8 A;  3RNN A;  2F3B A;  4N91 A;  4ZED A;  1FQD A;  3EQ1 A;  4DCY A;  3DLN A;  1AOV A;  3FVG A;  3KN3 A;  1BLF A;  4HE1 A;  4F22 A;  4OEN A;  3A29 A;  1MM6 A;  4EUO A;  2DVC A;  3B8B A;  2Q89 A;  2VD2 A;  3I3V A;  3D4C A;  3M3F A;  3ONM A;  4KR5 A;  4GIZ A;  5I56 A;  2PX1 A;  1FPL A;  4H0W A;  1JNF A;  2I3W A;  4LP2 B;  3KSX A;  3RGY A;  4OA4 A;  4UA8 A;  3PUZ E;  2H5Y A;  2NXO A;  3TTK A;  1B7U A;  5BUU A;  3H6W A;  1FTK A;  1NV1 A;  3MQ9 A;  1I6Q A;  1IMA A;  4QXD A;  4OWD A;  3FXQ A;  4XF5 A;  2RCB A;  4U2R A;  3HHF A;  3SEW A;  4NWC A;  2NUV A;  4KYD A;  2B65 A;  3LC8 A;  5EYG A;  4OES A;  3WAF A;  1VFE A;  2H99 A;  3QMF A;  4O7I A;  2Z8E A;  1M5C A;  2DP8 A;  5KCJ A;  1RDX A;  1NNK A;  3MBP A;  3IFA A;  3KSJ A;  4Q5T A;  1EYJ A;  4KYS A;  3N26 A;  2Y7R A;  1IIW A;  2Y7P A;  1QUL A;  1SI1 A;  4GRK A;  2F7A A;  3FD3 A;  4IO2 A;  4ESW A;  2XA5 A;  4ZEF A;  1DTG A;  3K1P A;  4RPN A;  1T0K A;  2FIE A;  3SDF A;  3KBR A;  4YMA A;  2DXY A;  4NF5 B;  4F29 A;  5CRY A;  4ELR A;  2WBB A;  4NN3 A;  4XXU A;  1CE2 A;  4PP0 A;  4POW A;  3VLV A;  3HHG A;  4P11 A;  2R71 A;  4GFR A;  2HAU A;  3L6H A;  2E1S A;  3Q26 A;  1FPD A;  3ODB A;  3GBA A;  4PFT A;  3RTW B;  3C33 A;  2I6E A;  3B50 A;  5K2X A;  3UOR A;  5CBS A;  3T9H B;  3FJ7 A;  1IMB A;  3CG3 A;  2QVR A;  5DEX A;  2VD3 A;  4GWW A;  2O69 A;  4P47 A;  4AQ4 A;  5H8Q A;  4NF4 B;  5I84 A;  1Y3P A;  4U4X A;  1FBE A;  2KQZ A;  3MST A;  3H06 B;  4R9F A;  5TPA A;  3KZG A;  1H76 A;  1FPG A;  1WDN A;  4NGU A;  2F8D A;  4KFQ A;  4PFB A;  4AS5 A;  1MXY A;  1O64 A;  2DYX A;  2X7P A;  1IZ1 A;  4TOZ A;  3TYH A;  4R75 A;  1UTH A;  4GX3 A;  4U21 A;  4I3E A;  4XKQ A;  2X7Q A;  1AL3 A;  5ICQ A;  2FYI A;  5CMB A;  5KDT A;  1FTO A;  3B6T A;  4MF3 A;  4QBA A;  2I0B A;  1MQI A;  2FVZ A;  3MJN A;  4XKN A;  3U92 A;  2XXT A;  1MG1 A;  1FPK A;  3V83 A;  3K01 A;  1LGB C;  3HCQ A;  1JW5 A;  2ONR A;  4QFP A;  1ELJ A;  3LBS A;  2A5S A;  4GBV A;  3IOW A;  1OLC A;  4PDH A;  4BDL A;  3Q28 A;  1MH4 A;  1NV3 A;  3F11 A;  5I57 B;  1MY3 A;  3FVO A;  3FBP A;  3VLW A;  2R6G E;  4R6Y A;  2Y7K A;  3RQT A;  5H8F B;  1EZP A;  3C9H A;  2F97 A;  4PGN A;  2XXV A;  1POY 1;  3KOS A;  4ZS9 A;  2REJ A;  3IOR A;  4H6D A;  1INP A;  2VOZ A;  1B58 A;  1RDZ A;  2F6G A;  1MXZ A;  3OEK A;  1GR2 A;  4DI3 D;  2V3U A;  4G68 A;  4DXU A;  2QJE A;  5DVF A;  4GL8 A;  4I1D A;  1NMU A;  4GX6 A;  4UAC A;  3PMX A;  2ZZX A;  3LUZ A;  3PMV A;  5H8N B;  1B7H A;  3MVW A;  1KWH A;  3FIR A;  1EZO A;  3RUM A;  3VDF A;  1J1N A;  5TP9 A;  1XT8 A;  5BWJ A;  4TLL B;  1B0L A;  1Q9D A;  1Y1Z A;  1O63 A;  2AL4 A;  1FPI A;  1URG A;  4FOR A;  1MXX A;  5HPQ A;  4BDQ A;  1VFD A;  2H4I A;  3ECR A;  2PVU A;  3E4R A;  2FA7 A;  2H98 A;  3MP6 A;  4PFR A;  2I4C A;  1N7X A;  1B5J A;  4X8R A;  4HS7 A;  3FAS A;  5LDZ A;  4DLD A;  5ET6 A;  4YKP A;  3QSL A;  2F7C A;  1HSE A;  1MDQ A;  1UQW A;  3G3H A;  1SBP A;  4TQU Q;  3WAE A;  1DPP A;  3E13 X;  4F19 A;  2CZK A;  3IAZ A;  4HTG A;  3KN8 A;  4ESX A;  1SD3 A;  2HXR A;  3FXB A;  4LZ5 A;  1P1W A;  1SVX B;  1SW4 A;  1KA1 A;  4H5G A;  4HCY A;  1ZJL A;  1MS7 A;  3OO9 A;  4YB6 A;  4GWX A;  1NV2 A;  1MXU A;  2XD3 A;  4OVP A;  3S9N C;  4H45 A;  3IB0 A;  1UIU A;  4F39 A;  1NUY A;  4MMP A;  3OSQ A;  3I5O A;  4FEC A;  4QF9 A;  2DWA A;  1II5 A;  1DK4 A;  2G93 A;  3CSB A;  4M4G A;  5I58 A;  5HM4 B;  3O6G A;  4FE8 A;  1PC3 A;  3R6U A;  3KN7 A;  1G0H A;  4U1O A;  4KD5 A;  3OEM A;  3KC0 A;  4Q0C A;  4ZEB A;  1B5I A;  3RYD A;  4RK2 A;  1AIV A;  4GWZ A;  3QIM A;  2GRV A;  2BJJ X;  2D5W A;  2XXI A;  4JWX A;  1B4Z A;  1PEB A;  5H8S A;  5M2V A;  1Y20 A;  2HPG A;  3PV0 E;  4IO3 A;  4KCD A;  3IB1 A;  1LCT A;  3TKD A;  2DE3 A;  1NUW A;  1JEU A;  2ZZW A;  1USY E;  3TMG A;  1EZ9 A;  1FBH A;  2ZYO A;  4UAB A;  3D4G A;  1I6B A;  4F2O A;  4NTL A;  2XXU A;  1UTH B;  1NKX A;  2HXW A;  2F78 A;  4MBP A;  3BFT A;  1SW1 A;  3QK6 A;  1LBZ A;  3UP9 A;  2DDK A;  2VPO A;  3IX1 A;  2ZMB A;  3C35 A;  1NV6 A;  4IGR A;  1D9Q A;  2QPQ A;  4R9G A;  4NHB A;  4DE8 A;  4F3B A;  1SYH A;  4G68 C;  2B3B A;  3FUZ A;  2CEX A;  1A99 A;  1RDY A;  4I9D A;  4YZZ A;  3E79 A;  3G3F A;  2XWV A;  4E0W A;  3KBZ A;  2Z8D A;  4OVJ A;  1MDP 1;  4NWD A;  2F34 A;  5IZZ A; 
#chains in the Genus database with same CATH homology
 4OFO A;  4IY6 A;  4GVO A;  2RKM A;  2XX8 A;  4WED A;  1WVJ A;  4PFY A;  1B3H A;  4KPT A;  3USD A;  3O29 A;  4EXK A;  1H43 A;  5FTI A;  3OXN A;  4GXS B;  2Q8J A;  3FVN A;  3CSG A;  4G68 B;  1B32 A;  2I48 A;  4OEV A;  1IEJ A;  2UVJ A;  5B70 A;  1LAX A;  3K6U A;  4E0X A;  5AA2 A;  1R9Q A;  4LUB A;  4R6K A;  4C0R A;  5TP9 B;  1B2H A;  2VGQ A;  2ONS A;  4JDF A;  3ZSF A;  1Y3N A;  3MZ9 A;  2IA4 A;  1P99 A;  4NMY A;  1JQF A;  1A55 A;  4Q30 B;  3KOT A;  2DE2 A;  1XC1 A;  2Y7I A;  2ABH A;  4QHQ A;  1I6A A;  3HO7 A;  1LB8 A;  3TDJ A;  1VSO A;  1LBB A;  3TTR A;  2P0S A;  2PT2 A;  3T22 A;  4JSD A;  3SEX A;  1A40 A;  4FJP A;  2F36 A;  2VP1 A;  5A5X A;  1IXH A;  3DEL B;  3T9U A;  3OMB A;  3VVE A;  2LAO A;  3OEL A;  2QS4 A;  1HSJ A;  5AA4 A;  1LLS A;  4AB5 A;  4BDN A;  5DT6 A;  4FIM A;  3IL1 B;  3M3L A;  2IEE A;  1B05 A;  2GH9 A;  3G3I A;  4F1Y A;  3RLF E;  1SW2 A;  2UYF A;  2ZXT A;  4RPO A;  3PUV E;  2A5T A;  2DWI A;  3PU5 A;  4H65 A;  3SEY A;  4ZEC A;  4ZE8 A;  4FED A;  1ZTY A;  4ELO A;  1MY0 A;  3QAX A;  3MP1 A;  5FHN A;  4F1V A;  4PFW A;  3SEV A;  5I2N A;  2O1M A;  3BKI B;  1WOD A;  3SEU A;  1D4N A;  2HFB A;  1XHY A;  4MH5 A;  4ND9 A;  3CI8 A;  1MM7 A;  2O68 A;  4YKK A;  1FTL A;  4FEB A;  3BBR A;  3O28 A;  1D9Y A;  1DPE A;  4R2B A;  5FTH A;  2AIX A;  1B5H A;  1PB9 A;  4BLA A;  4QRZ A;  2OLB A;  2NOO A;  2ZYK A;  2OWS A;  3O2A A;  5TU0 A;  3E9X A;  4G8N A;  4IY5 A;  3KFM A;  4BDM A;  4RK9 A;  1MY2 A;  4POX A;  1B0H A;  3TZA A;  3RN8 A;  1USY H;  2DE4 A;  3H6T A;  3G7W A;  1ZBM A;  1PB8 A;  1TFD A;  4RY1 A;  2O7U A;  1LBC A;  5ELV A;  2ESN A;  3O66 A;  1P1Q A;  2FNC A;  3W9V A;  1M5F A;  3K00 A;  3RT8 A;  3RY3 A;  2HZL A;  3QUJ A;  3N6U A;  4RJZ A;  3R26 A;  1URS A;  2XHD A;  4ONY A;  4WXJ A;  4GLI A;  1QUK A;  4OHN A;  3PD8 A;  3PMW A;  4QSD A;  1IQ7 A;  3T93 B;  1LAF E;  2XXY A;  1N04 A;  4JBZ A;  4JWO A;  5IAI A;  1URD A;  4BDR A;  2O7I A;  3PPP A;  1NNT A;  4MLV A;  3CVG A;  3MC2 A;  3FV2 A;  1B40 A;  3P7I A;  4NF8 B;  3MPK A;  3JZJ A;  5ITO A;  3GBB A;  4KYE A;  4EXL A;  1MPD A;  3N6T A;  3MW0 A;  2DOJ A;  1FQB A;  1MY4 A;  5AA1 A;  5JTY B;  3HV1 A;  1MPB A;  5I59 A;  1LFG A;  5FHO A;  1F9B A;  4IO6 A;  3IOU A;  4LQ2 A;  1SDX A;  1FCK A;  4LZ7 A;  5L8D A;  3LSL A;  1B52 A;  2DQV A;  3W9W A;  2E0S A;  4H67 A;  2QMW A;  2I58 A;  5ICT A;  1UTB A;  4YMB A;  4IGT A;  3T96 B;  2NWJ A;  5JK4 A;  2HAV A;  1H45 A;  2I0C A;  1GV8 A;  1BP5 A;  4DXB A;  1B3L A;  2I4B A;  3C32 A;  2RC8 A;  2DVZ A;  1LFH A;  3ILT B;  2HQ0 A;  1VR5 A;  2B3F A;  4TLM B;  3GXA A;  3FVK A;  2ALU A;  1ZIU A;  4RNS A;  5I56 B;  3TCG A;  3TTL A;  3BFU A;  4IB2 A;  4G2Z A;  3IJX B;  1SQY A;  2QMX A;  3JV9 A;  4U22 A;  1OQH A;  1TFA A;  1B3F A;  4N13 A;  2RCA A;  1IXI A;  1QUJ A;  1Y3Q A;  1LST A;  3TQW A;  2OBG A;  4OYV A;  5FHM A;  4X1B A;  2Q88 A;  4NF6 A;  4ELQ A;  5I2N B;  4AB6 A;  3T9X B;  5KCJ B;  3IR1 A;  3JYR A;  1I69 A;  1Y4T A;  1VE4 A;  4X48 A;  3VVF A;  4ZEK A;  1B4H A;  4MLQ A;  1B46 A;  3R7X A;  3SET A;  3KJ7 A;  4IO4 A;  1N7W A;  3TQL A;  4YKI A;  3UIF A;  1ZKB A;  2OZZ A;  4MFI A;  3H03 A;  2F35 A;  3EHU A;  3C31 A;  3UGW A;  3S9L C;  1JVX A;  5CMK A;  2PMS A;  1QJM A;  1RYX A;  5CM6 A;  3OO7 A;  4QFO A;  1XOC A;  1Z7M E;  3G3J A;  3EF7 A;  4JWY A;  3K2D A;  2Z22 A;  3FXR A;  1XVX A;  4F18 A;  2D3I A;  2GHA A;  3HST A;  1MQH A;  2X26 A;  1ZMG A;  4LA9 A;  5KZT A;  1S7Y A;  3K0V A;  1A54 A;  4QSE A;  1XS5 A;  3PPO A;  1H3D A;  4R72 A;  1Y4C A;  3E3K A;  4DIG A;  5DEX B;  1BIY A;  1IXC A;  1N0T A;  2O51 A;  1LB9 A;  5H8Q B;  1OIB A;  4O3C A;  1M5E A;  4FAT A;  3AXF A;  3VVD A;  3DP4 A;  5TPA B;  1A8F A;  1PBQ A;  1FQE A;  2RC9 A;  4NE4 A;  5CI5 A;  1MY1 A;  4XKR A;  4NF5 A;  3SER A;  2UVG A;  3M8U A;  4C1T A;  3PPN A;  1ZLQ A;  4H8J A;  1JEV A;  3SES A;  5KDT B;  5F1Q A;  3LSW A;  4QFL A;  1MQJ A;  2F7B A;  2F6P A;  3O9P A;  4XIG Q;  2HEU A;  1LCF A;  5I59 B;  2AL5 A;  1TXF A;  2OJT A;  3TCF A;  2PT1 A;  1JW1 A;  2WKY A;  3VXC A;  4OZ9 A;  1CB6 A;  4G8M A;  4YB5 A;  3EPE A;  3SKP A;  4QFK A;  2QS1 A;  4YB7 A;  3IK6 B;  3VXB A;  1TWY A;  2DWJ A;  3KEI A;  2QRY A;  4DZ1 A;  4ZEI A;  5ITP A;  4NF4 A;  2OK2 A;  4I8C A;  1M5D A;  3TTM A;  1DSN A;  4XKP A;  4I62 A;  4M1V A;  4WKM A;  1M5B A;  5JEI A;  1TT1 A;  3PUX E;  4IO5 A;  2DSF A;  1OQG A;  2XXX A;  2RIN A;  3CFX A;  2ZNU A;  5AE4 A;  2V3T A;  1N3X A;  3CFL A;  3CRB A;  1IXG A;  1NL5 A;  2ZYN A;  1A7L A;  5CC2 A;  4LVQ A;  2THI A;  5L9O A;  2D21 A;  3TUS A;  1PBP A;  3LSF B;  3EN3 A;  3H6V A;  3V8X B;  1OVB A;  1FW0 A;  1B9J A;  1P1N A;  5ISU A;  4L17 A;  3VFJ A;  2XXR A;  2QSX A;  3VLU A;  4JB7 A;  3Q27 A;  3UA8 A;  1QKB A;  1R1N A;  3FV1 A;  5B7D A;  5H8F A;  2ANJ A;  2KLF A;  3V5A A;  4N07 A;  1Y1M A;  2Z8F A;  3W15 C;  5J1D A;  3ZKL A;  4U4S A;  4O3B A;  2GHB A;  5DYH A;  1YTV A;  3KGC A;  4OEU A;  1LAH E;  4F3S A;  4OMB A;  5H8N A;  4FAJ A;  3G3K A;  3O6I A;  1NNF A;  4LQ5 A;  4KHZ E;  1GTK A;  4DXC A;  2QL3 A;  2ZNT A;  1LFI A;  4THI A;  3CG1 A;  3LUY A;  2P1S A;  1ZU0 A;  3PPR A;  3K6W A;  1BTJ A;  1Q35 A;  5EHM A;  3GLB A;  2H25 A;  4Z7E A;  2V3Q A;  1SYI A;  1B3G A;  4EF1 A;  1ANF A;  1S50 A;  5I58 B;  3L6G A;  2W7Y A;  3CIJ A;  3FXU A;  3QUF A;  4U23 A;  3A3C A;  1PDA A;  1YPN A;  4DDD A;  2Q9T A;  3DM0 A;  4P0I A;  5DTB A;  1MPC A;  1MQD A;  1FQA A;  3B6Q A;  3TAJ A;  3CFZ A;  3I6V A;  4XTC Q;  1B7Z A;  3FJG A;  4YU0 A;  4EDP A;  1R6Z A;  3K1M A;  3OSR A;  4YAH X;  3MZB A;  2UVH A;  3C4M A;  1MXW A;  2YJP A;  2O84 X;  4Q8R A;  5H8H A;  2F5X A;  3PGF A;  2ZYM A;  1AMF A;  3K6V A;  2YLN A;  3T9V A;  2O1L A;  1NH7 A;  4F3P A;  3MVZ A;  4F31 B;  1L5T A;  4WEP A;  3K6X A;  3PD9 A;  3MZ1 A;  4GD5 A;  3RTF B;  4KI0 E;  4JSO A;  4ELP A;  3N94 A;  3IB2 A;  1DMB A;  4LON B;  4PE5 B;  3PUW E;  3MPL A;  3Q25 A;  1QW0 A;  3H6U A;  3TEP A;  4RXL A;  3O6H A;  4GF8 A;  4ZDM A;  3QYT A;  3FGS A;  3GZG A;  4R74 A;  3TTN A;  2Z23 A;  4Z0I A;  4OFJ A;  3N5L A;  5AA3 A;  3OOA A;  2GFE A;  1FQF A;  1RKM A;  2UXA A;  4OQO A;  4ZZE A;  4EQB A;  2Q2C A;  4N6P A;  1YCJ A;  4NED A;  5L9M A;  5AA2 B;  1PB7 A;  2DS9 A;  1EU8 A;  1Y9U A;  4R2F A;  1H44 A;  5CMC A;  3LSX A;  1FTM A;  1O7T A;  3MVY A;  3QXM A;  5HBC A;  3S9E A;  1ATG A;  3RT6 B;  3S4U A;  5IKB A;  4QFN A;  1OLA A;  3T66 A;  5I2K A;  1NH8 A;  3B6W A;  4LZ8 A;  3DP6 A;  4R73 A;  2UYE A;  4H8I A;  2NVU B;  1JVY A;  3U94 A;  3MAM A;  3OD7 A;  4RYA A;  4F2Q A;  5A5X B;  1UIV A;  1B1X A;  1NNP A;  1QUI A;  3THI A;  3U72 A;  4GOT A;  3PPQ A;  2VHA A;  3H3G A;  3ZS6 A;  2QS2 A;  5AA4 B;  3IJO B;  4EQ9 A;  4ISU A;  4U1Z A;  2YPN A;  1P1O A;  2ZNS A;  2Q2A A;  1D3K A;  1N3W A;  1P1U A;  2REG A;  2V84 A;  3IO4 A;  2XXW A;  4OER A;  2A5T B;  1GVC A;  2DXR A;  4GQO A;  3EHS A;  2I49 A;  3OEN A;  1FQC A;  1MRP A;  3G3G A;  4KQP A;  2RF1 A;  3TOD A;  3IOV A;  1Z7N E;  3IOT A;  2PYY A;  2HZK A;  1S9T A;  1B51 A;  3HN0 A;  1B1H A;  2H9B A;  3C34 A;  2XXP A;  4IO7 A;  2XX7 A;  2XXH A;  3TFL A;  1IIT A;  2UVI A;  4BDO A;  1RYO A;  2Y84 A;  3UN6 A;  4OET A;  3A3U A;  1MH3 A;  3EHT A;  5CMM A;  4G8H A;  3U93 A;  3LR1 A;  4JXI A;  4P0G A;  2CMO A;  5H8H B;  3H7M A;  4H5F A;  1LAG E;  1XVY A;  1OMP A;  2OCU A;  2QS3 A;  1JET A;  5LOM A;  3V89 B;  3DP8 A;  4YIC A;  3TCH A;  3MUQ A;  4X1D A;  3UK4 A;  1AH5 A;  3IO6 A;  2P2A A;  4GL0 A;  4PQJ A;  4KCC A;  5EYF A;  3FJM A;  3Q29 A;  3KJT A;  4GWO A;  3OO8 A;  3S2V A;  5AA2 D;  5EHS A;  1DOT A;  2R9J A;  4YKJ A;  5DVI A;  4EQ7 A;  3OO6 A;  5CBR A;  2XX9 A;  2Y7W A;  2PBW A;  1GGG A;  3PUY E;  2O6A A;  2XD2 A;  1JW4 A;  2OWT A;  4OFL A;  2I3V A;  3O97 A;  1MQG A;  4GXA A;  1BKA A;  4OXV A;  1MXV A;  4QSC A;  1US4 A;  3VV5 A;  4RA1 A;  3K02 A;  3TEL A;  1US5 A;  3RPW A;  4R6H A;  3ILU B;  3B7D A;  3A09 A;  4O3A A;  1R9L A;  4HW8 A;  1NFT A;  4ZZA A;  3K1N A;  3K4U A;  1B3E A;  4HCW A;  3HPI A;  1OVT A;  1QKA A;  1UTB B;  4F3G A;  1A8E A;  3U8Q A;  3MWB A;  1YAE A;  3ZKK A;  5I2K B;  4NF8 A;  5L9S A;  2ONK E;  3H4Z A;  5DVJ A;  1FTJ A;  2G29 A;  2M8C A;  4H1X A;  3TPA A;  4G77 A;  4G4P A;  3VE1 B;  2CZL A;  3S9M C;  5JTY A;  5F7V A;  1SI0 A;  1Q1K A;  2V93 A;  1POT A;  2V25 A;  1D9V A;  3CR9 A;  1N84 A;  3M3K A;  4F1U A;  1EH3 A;  4K3F A;  1SW5 A;  2DWH A;  4X9T A;  3MVX A;  4C1U A;  5K2Y A;  4OTE A;  4EF2 A;  4DCX A;  3U1O A;  5I57 A;  2HCA A;  3FZV A;  2RC7 A;  3C36 A;  3FAT A;  2AYS A;  4PET A;  1IUD A;  3KG2 A;  2XXQ A;  4PFU A;  4ZE9 A;  4LAT A;  4ECF A;  1B6H A;  4NF6 B;  1DTZ A;  1HSL A;  1N76 A;  1QVS A;  3MP8 A;  3RNN A;  4ZED A;  1FQD A;  3EQ1 A;  4DCY A;  3DLN A;  1AOV A;  3FVG A;  3KN3 A;  1BLF A;  4F22 A;  4OEN A;  1MM6 A;  4EUO A;  2DVC A;  2Q89 A;  2VD2 A;  3I3V A;  3D4C A;  3M3F A;  3ONM A;  4KR5 A;  4GIZ A;  5I56 A;  2PX1 A;  4H0W A;  1JNF A;  2I3W A;  4LP2 B;  3KSX A;  3RGY A;  4UA8 A;  3PUZ E;  2H5Y A;  2NXO A;  3TTK A;  1B7U A;  5BUU A;  3H6W A;  1FTK A;  3MQ9 A;  1I6Q A;  4OWD A;  3FXQ A;  2RCB A;  4U2R A;  3HHF A;  3SEW A;  4NWC A;  2NUV A;  4KYD A;  2B65 A;  3LC8 A;  4OES A;  3WAF A;  1VFE A;  2H99 A;  2Z8E A;  1M5C A;  2DP8 A;  5KCJ A;  1NNK A;  3MBP A;  3KSJ A;  4Q5T A;  4KYS A;  3N26 A;  2Y7R A;  1IIW A;  2Y7P A;  1QUL A;  1SI1 A;  4GRK A;  2F7A A;  3FD3 A;  4IO2 A;  4ESW A;  4ZEF A;  1DTG A;  3K1P A;  4RPN A;  1T0K A;  3SDF A;  3KBR A;  4YMA A;  2DXY A;  4NF5 B;  4F29 A;  5CRY A;  4ELR A;  4XXU A;  1CE2 A;  4PP0 A;  4POW A;  3VLV A;  3HHG A;  4P11 A;  2R71 A;  4GFR A;  2HAU A;  3L6H A;  2E1S A;  3Q26 A;  3ODB A;  3GBA A;  4PFT A;  3RTW B;  3C33 A;  2I6E A;  5K2X A;  3UOR A;  5CBS A;  3T9H B;  3FJ7 A;  3CG3 A;  5DEX A;  2VD3 A;  2O69 A;  4AQ4 A;  5H8Q A;  4NF4 B;  5I84 A;  1Y3P A;  4U4X A;  3H06 B;  4R9F A;  5TPA A;  3KZG A;  1H76 A;  1WDN A;  2F8D A;  4KFQ A;  1MXY A;  1O64 A;  2DYX A;  2X7P A;  1IZ1 A;  4TOZ A;  3TYH A;  4R75 A;  1UTH A;  4U21 A;  4XKQ A;  2X7Q A;  1AL3 A;  5ICQ A;  2FYI A;  5CMB A;  5KDT A;  1FTO A;  3B6T A;  4MF3 A;  2I0B A;  1MQI A;  3MJN A;  4XKN A;  3U92 A;  2XXT A;  1MG1 A;  3V83 A;  3K01 A;  1LGB C;  3HCQ A;  1JW5 A;  2ONR A;  4QFP A;  1ELJ A;  3LBS A;  2A5S A;  3IOW A;  1OLC A;  4BDL A;  3Q28 A;  1MH4 A;  3F11 A;  5I57 B;  1MY3 A;  3FVO A;  3VLW A;  2R6G E;  4R6Y A;  2Y7K A;  3RQT A;  5H8F B;  1EZP A;  3C9H A;  2F97 A;  2XXV A;  1POY 1;  3KOS A;  4ZS9 A;  2REJ A;  3IOR A;  4H6D A;  2VOZ A;  1B58 A;  2F6G A;  1MXZ A;  3OEK A;  1GR2 A;  2V3U A;  4G68 A;  4DXU A;  2QJE A;  5DVF A;  4GL8 A;  4I1D A;  1NMU A;  4UAC A;  3PMX A;  3PMV A;  5H8N B;  1B7H A;  3MVW A;  1KWH A;  3FIR A;  1EZO A;  3RUM A;  3VDF A;  1J1N A;  5TP9 A;  1XT8 A;  5BWJ A;  4TLL B;  1B0L A;  1Y1Z A;  1O63 A;  2AL4 A;  1URG A;  4FOR A;  1MXX A;  5HPQ A;  4BDQ A;  1VFD A;  2H4I A;  3ECR A;  2PVU A;  3E4R A;  2FA7 A;  2H98 A;  3MP6 A;  2I4C A;  1N7X A;  1B5J A;  4HS7 A;  3FAS A;  4DLD A;  4YKP A;  3QSL A;  2F7C A;  1HSE A;  1MDQ A;  1UQW A;  3G3H A;  1SBP A;  4TQU Q;  3WAE A;  1DPP A;  3E13 X;  4F19 A;  3IAZ A;  4HTG A;  3KN8 A;  4ESX A;  1SD3 A;  4LZ5 A;  1P1W A;  1SVX B;  1SW4 A;  4H5G A;  4HCY A;  1ZJL A;  1MS7 A;  3OO9 A;  4YB6 A;  1MXU A;  2XD3 A;  3S9N C;  3IB0 A;  1UIU A;  4F39 A;  3OSQ A;  3I5O A;  4FEC A;  4QF9 A;  2DWA A;  1II5 A;  2G93 A;  3CSB A;  4M4G A;  5I58 A;  5HM4 B;  3O6G A;  4FE8 A;  1PC3 A;  3R6U A;  3KN7 A;  4U1O A;  4KD5 A;  3OEM A;  4Q0C A;  4ZEB A;  1B5I A;  4RK2 A;  1AIV A;  3QIM A;  2GRV A;  2BJJ X;  2D5W A;  2XXI A;  4JWX A;  1B4Z A;  1PEB A;  5H8S A;  5M2V A;  1Y20 A;  3PV0 E;  4IO3 A;  4KCD A;  3IB1 A;  1LCT A;  3TKD A;  2DE3 A;  1JEU A;  1USY E;  3TMG A;  1EZ9 A;  2ZYO A;  3D4G A;  1I6B A;  4F2O A;  4NTL A;  2XXU A;  1UTH B;  1NKX A;  2HXW A;  2F78 A;  4MBP A;  3BFT A;  1SW1 A;  3QK6 A;  3UP9 A;  3IX1 A;  2ZMB A;  3C35 A;  4IGR A;  2QPQ A;  4R9G A;  4DE8 A;  4F3B A;  1SYH A;  4G68 C;  2B3B A;  3FUZ A;  1A99 A;  4I9D A;  4YZZ A;  3G3F A;  4E0W A;  2Z8D A;  4OVJ A;  1MDP 1;  4NWD A;  2F34 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...