2HXWA

Crystal structure of peb3 from campylobacter jejuni
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
231
structure length
229
Chain Sequence
DVNLYGPGGPHTALKDIANKYSEKTGVKVNVNFGPQATWFEKAKKDADILFGASDQSALAIASDFGKDFNVSKIKPLYFREAIILTQKGNPLKIKGLKDLANKKVRIVVPEGAGKSNTSGTGVWEDMIGRTQDIKTIQNFRNNIVAFVPNSGSALFAQDQADAWITWIDWSKSNPDIGTAVAIEKDLVVYRTFNVIAKEGASKETQDFIAYLSSKEAKEIFKKYGWREH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Periplasmic binding protein
molecule keywords Major antigenic peptide PEB3
publication title Structural context for protein N-glycosylation in bacteria: The structure of PEB3, an adhesin from Campylobacter jejuni.
pubmed doi rcsb
source organism Campylobacter jejuni
total genus 76
structure length 229
sequence length 231
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13531 SBP_bac_11 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2hxwA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2hxwA02
4RY1A 2DXRA 3B6WA 5LOMA 5F7VA 5F1QA 1MPDA 2ZYOA 3T9VA 3DM0A 2Z22A 2QMWA 4BDLA 2UVJA 4GXSB 4X1DA 4OFOA 4R9GA 3DP6A 1SYIA 2YJPA 1B40A 5CMBA 2F8DA 2B3FA 1P1OA 3FVKA 4U22A 3HHFA 3ECRA 3E3KA 2GH9A 4OFJA 3T22A 3H6VA 4G68B 4U1ZA 2Y7WA 1O63A 4XKRA 1SW2A 3IORA 3HPIA 2OJTA 3FVNA 2DWAA 3O66A 2Y7IA 1QJMA 5H8HB 4OHNA 1YAEA 4OQOA 4DCYA 1NNFA 2XXVA 4F2QA 1N7XA 2GRVA 5HPQA 1IEJA 3I6VA 3E9XA 1URDA 2OK2A 2ONSA 1MXZA 3IL1B 4Q30B 1H44A 4OEVA 3TCFA 1Q1KA 5KZTA 3O97A 1SW5A 2QS1A 1SW4A 3G3JA 4LQ2A 4KD5A 4NWCA 2AYSA 4OMBA 3S9LC 4F2OA 3OXNA 3WAEA 5FTHA 2A5TB 1UIVA 4QF9A 4PFWA 5K2YA 1MQIA 1SI1A 4YB7A 4BDOA 5EYFA 4LVQA 3S9MC 4L17A 4G68A 2UVGA 3ILUB 5ITOA 1MQHA 3GZGA 3N26A 3TMGA 4P0IA 1D3KA 1UTHA 3TPAA 4MLVA 4GOTA 2H9BA 5CRYA 2F5XA 3QSLA 3T66A 1HSEA 5H8HA 1B0HA 4BDMA 4RA1A 4DXCA 3KOTA 2ZYKA 5TP9B 4JSDA 1N04A 4JDFA 1PBPA 3O6IA 3P7IA 3IX1A 1LSTA 3SDFA 1FW0A 3I3VA 3RLFE 5JK4A 2A5TA 1A54A 1PC3A 3TTKA 4YZZA 4DCXA 5EHMA 2F78A 4EXLA 4KCDA 3Q26A 4JWOA 4H6DA 2DWJA 3FIRA 4R75A 5DYHA 3MQ9A 2UYEA 3TODA 1MY3A 3BFUA 3DELB 3MZ9A 2XHDA 5AA3A 4QHQA 3VXCA 2O1LA 4XXUA 4RNSA 1LAXA 4DLDA 1ZIUA 4FATA 5L9MA 4FAJA 1B46A 4IY5A 1DPEA 5TP9A 3A3CA 3LSLA 4QFLA 3S4UA 5CMKA 2XXIA 3ZS6A 4G8HA 2F7BA 1USYH 4P11A 2XD2A 4IGRA 3KN3A 5CC2A 4JXIA 4UACA 4KPTA 2OCUA 1SW1A 3IOTA 5KCJA 2DOJA 1JEVA 1ANFA 2R6GE 2GFEA 2Y7KA 1MY2A 1FTJA 4GD5A 5I56B 2ZNSA 5L9SA 1IZ1A 2RCAA 3CSGA 4FJPA 5ICQA 4ND9A 3EHSA 3TELA 3CR9A 1B05A 3TFLA 4R6HA 3KJTA 3FVOA 4GXAA 1B9JA 4G4PA 2YLNA 1A55A 3EF7A 3ZKLA 2F7AA 5H8QB 1IXHA 4LP2B 1Q35A 2OZZA 1B1XA 1PEBA 2ZMBA 2O6AA 3RNNA 1NH8A 3B7DA 2AL4A 5M2VA 1USYE 2IEEA 3SESA 3TTRA 1B3EA 5I2KB 2Z8DA 3T96B 3A3UA 2ONRA 3IO4A 4BDQA 5I56A 1OLAA 4F3BA 1AL3A 1R9LA 1ZU0A 3DLNA 3MVYA 2O1MA 2XD3A 1YTVA 2REJA 4GRKA 2Q2AA 1MRPA 4U1OA 1EZOA 1TXFA 1VFEA 1R1NA 5H8QA 2NOOA 3BBRA 5FTIA 2V25A 3I5OA 4OXVA 3IJOB 4Q0CA 3Q25A 5AA4A 4AQ4A 2I3WA 5ITPA 2GHBA 5CBRA 5I2KA 3MBPA 2B65A 3TQLA 1RYXA 3PUYE 4JWXA 1ELJA 4NMYA 3FD3A 1I6BA 2VOZA 1QULA 4X48A 5CI5A 2PVUA 3VLVA 3UIFA 1P99A 1TWYA 1M5FA 1B32A 3BKIB 3EN3A 2DVZA 3FGSA 3OSRA 3TAJA 2D3IA 4H65A 1B4ZA 2RINA 5HBCA 3BFTA 1S50A 3G7WA 4FEBA 1PB9A 3W9VA 3G3FA 4EUOA 3MPLA 3TTLA 3KFMA 1DOTA 1CE2A 3MPKA 3TUSA 1LAHE 4DXBA 4C0RA 1JETA 1H45A 1M5DA 4OWDA 4U4SA 1PDAA 3PMVA 4OVJA 1SYHA 4LZ8A 2NUVA 2LAOA 4WXJA 4ZEBA 1YPNA 3VVEA 5A5XA 2V3QA 3KGCA 3RTWB 3SEVA 3H03A 3QUFA 2P1SA 1MY0A 2VD2A 1QKAA 4YMBA 3C35A 4X1BA 1BP5A 1MPCA 1OQGA 4F39A 4M1VA 2XX8A 1MPBA 4PFYA 1MY4A 4ZZAA 1H76A 2O7UA 1QKBA 4G2ZA 3S2VA 1XHYA 3THIA 3N94A 4G77A 2PYYA 1Y3PA 3MVXA 4IGTA 2XXUA 3H6UA 5DEXB 3TTMA 1NNTA 3PMXA 3B6QA 3KZGA 1WDNA 4DE8A 4ELRA 3FXRA 1Z7ME 4PETA 2Q88A 4HTGA 1MH4A 2UXAA 2HAUA 1A99A 1ATGA 4BLAA 4ELQA 3USDA 3DP8A 1MQGA 4GQOA 2RF1A 4F1UA 3U72A 2FYIA 3N6TA 1KWHA 2UVHA 5DTBA 2ONKE 5ELVA 2V3TA 3SKPA 1QUJA 1A8EA 1QVSA 4QSCA 3QK6A 5DEXA 3PGFA 5JTYB 4ZDMA 1A8FA 3QUJA 4H5GA 1MXXA 4ZEDA 4M4GA 4ZEIA 3HN0A 5TPAA 2I0BA 3KG2A 4YB6A 4POXA 3U92A 5CMCA 4QFNA 3QAXA 3VXBA 3OO9A 1UTHB 5HM4B 1MG1A 1HSJA 1H43A 2H99A 1A7LA 3HCQA 4JB7A 2ZYMA 4FEDA 2H25A 3RPWA 3EQ1A 1P1QA 2DVCA 5J1DA 3CFLA 2HZLA 4IO2A 1FQCA 4DDDA 4GIZA 1JW5A 1IXCA 4WEPA 3QIMA 2XX9A 3FJ7A 1LCTA 2XXTA 5JTYA 2RKMA 3OEKA 1B5HA 3PD9A 5K2XA 1B5IA 1LBBA 4ELPA 4WEDA 5IKBA 2PT2A 3C9HA 1J1NA 3C4MA 1RKMA 2HEUA 4FE8A 5B70A 4EDPA 4R2BA 2PT1A 3M3KA 2B3BA 2HAVA 4MLQA 4H67A 1Z7NE 4NF4B 2AL5A 2P2AA 4GFRA 2DE2A 1FTOA 2Q2CA 3IB1A 3IOVA 1QW0A 1VFDA 4RK2A 1TFDA 2ZYNA 4YICA 1GV8A 2VP1A 3MP8A 1AMFA 3OO6A 4YKIA 4R73A 3E13X 3GBAA 3O9PA 1LFIA 3OENA 4ONYA 3AXFA 4OZ9A 3K1PA 3OO8A 5ICTA 2WKYA 3HO7A 4F1YA 3H6WA 4OENA 1Y1MA 5KCJB 1BLFA 1OLCA 3MWBA 2XXYA 4R72A 2QS3A 3DP4A 3TCGA 1SD3A 1NNKA 3S9EA 4ISUA 1PBQA 5CBSA 5I2NB 2DQVA 1FQBA 4H8IA 3GLBA 1Y1ZA 4NF4A 3B6TA 4LZ5A 3JYRA 2E1SA 4MBPA 3S9NC 4RPNA 3VE1B 3CIJA 1FQDA 3PUVE 4NEDA 3K6VA 1I6QA 1PB7A 4H8JA 1MY1A 4Q8RA 1B6HA 2O7IA 4Z7EA 3O29A 4LUBA 2XXWA 5KDTA 4QFOA 1D4NA 4O3CA 2Z8EA 2Y7RA 4MH5A 4GF8A 1EZPA 3IK6B 1B7UA 5I2NA 3KSJA 4XTCQ 3KN8A 1S9TA 2PX1A 3WAFA 2ESNA 1ZMGA 3VLUA 1YCJA 1XVXA 5AA1A 3SEXA 4R74A 1UTBB 3U1OA 3FASA 3MVZA 3F11A 3H06B 1MDQA 4LATA 4NF5A 1GTKA 5FHNA 3CFXA 3CG3A 4N07A 5ISUA 1XS5A 3QYTA 2HXWA 2PMSA 4QFPA 4K3FA 4F19A 1OVBA 4PFUA 2NVUB 1XVYA 1D9VA 2V93A 3TZAA 4EQ9A 5AA4B 5I57A 1MXWA 3GXAA 3U93A 3U94A 3MC2A 2VHAA 3PD8A 1FTLA 1B51A 1MM7A 4EQBA 3V83A 1IXGA 2Z8FA 4KYSA 3CSBA 4H0WA 3IOUA 1N3XA 1UTBA 4I1DA 3FUZA 1JW1A 3IB2A 2PBWA 2QPQA 3FXUA 4IO4A 3MW0A 3CRBA 3M8UA 1H3DA 2O68A 5CMMA 3T9HB 2Q8JA 1VR5A 4YB5A 1D9YA 5DVFA 1HSLA 4ZE8A 1B3FA 2A5SA 3TEPA 1DMBA 5I59A 4I62A 3KEIA 2OLBA 3PPPA 5H8NB 4U2RA 1M5BA 5A5XB 2CMOA 2NXOA 3ZKKA 1IQ7A 3TCHA 3M3FA 4ELOA 3OMBA 4QSDA 4F31B 1B0LA 2DE3A 5BUUA 2THIA 4THIA 4HCWA 4ZE9A 3K02A 3VFJA 1EU8A 4KHZE 2QL3A 4PP0A 3PV0E 4EF1A 2DYXA 3KN7A 2I4CA 4MF3A 3K6WA 4GVOA 1ZLQA 3MJNA 5I58B 5H8NA 1FTMA 3FJGA 3C31A 4XKNA 4Z0IA 4F3GA 1US4A 1B3GA 3Q29A 1NMUA 1AIVA 2RC8A 3K00A 3PPNA 1POY1 1UIUA 3KOSA 1N76A 4DXUA 1LLSA 3Q28A 3UGWA 3L6GA 2X26A 1P1NA 1OQHA 1B7HA 4G8MA 1PB8A 4U4XA 4NE4A 4QSEA 3QXMA 2H5YA 2VD3A 3EPEA 3RY3A 2XXHA 2O84X 5H8FB 4LONB 2I48A 5IAIA 1P1UA 3FV1A 4NTLA 3W9WA 2I58A 1MM6A 1NFTA 3K1NA 1LAGE 4KYEA 3O28A 1A40A 3K2DA 1B58A 5JEIA 3RGYA 3C32A 4GL8A 2X7PA 3V5AA 5I58A 2Q9TA 4JSOA 3PUZE 1JEUA 3K6UA 3SETA 3LSWA 4IO6A 4F3PA 2RC7A 3R7XA 1SVXB 3U8QA 2F6GA 3ODBA 4YKKA 3RT8A 4IO7A 2HFBA 4RJZA 1FQFA 5TPAB 3TKDA 1URGA 1M5CA 3IAZA 1URSA 2R71A 1DTGA 3CI8A 4EQ7A 2X7QA 3MZ1A 3IO6A 3CG1A 2Q89A 3R6UA 5L9OA 3PPRA 5H8FA 3Q27A 4FIMA 3M3LA 2DP8A 3MP6A 3C34A 3KJ7A 3UK4A 2HCAA 3OEMA 1B1HA 5CM6A 4N13A 5EHSA 2XXQA 1UQWA 1II5A 2UVIA 3G3GA 2D21A 4GLIA 1ZKBA 4I9DA 2OWTA 3TDJA 2M8CA 1QUKA 3OOAA 2O69A 4NF8A 1WVJA 4KR5A 2E0SA 4AB5A 3RT6B 4H1XA 3SERA 3ILTB 3EHUA 5I84A 4MFIA 1LCFA 2OWSA 5L8DA 2DS9A 4BDNA 2O51A 3R26A 2H98A 3G3HA 3FATA 4TOZA 4U23A 1S7YA 1N3WA 2ZXTA 2XXXA 1ZBMA 4OTEA 3IJXB 1SDXA 3T9XB 1GGGA 3VV5A 4PFTA 1B4HA 4Q5TA 3PMWA 1POTA 1F9BA 3IR1A 4OEUA 1MH3A 3RQTA 3A09A 5DT6A 1L5TA 4IB2A 2CZLA 1P1WA 4RYAA 4ESWA 4YKJA 1WODA 2QS4A 3H3GA 4LZ7A 1BKAA 3UORA 4YMAA 4RK9A 2V84A 2FA7A 3C33A 4OESA 3D4CA 4HW8A 3JZJA 2I3VA 4OYVA 4FECA 1Y20A 3KBRA 1IXIA 1QUIA 1LFHA 4ZEKA 1Y4TA 3L6HA 2P0SA 1T0KA 3K0VA 1Y4CA 2IA4A 3SEWA 1VE4A 4C1UA 4R6KA 5KDTB 4WKMA 1AH5A 1FTKA 3HV1A 2FNCA 4YU0A 4TLMB 1ZJLA 1NL5A 1B3HA 4XKQA 5DVJA 4TQUQ 4IO5A 3T9UA 1LBCA 4E0WA 3OELA 2HQ0A 3VLWA 1LB8A 3MVWA 4EF2A 5B7DA 2OBGA 4KYDA 2QS2A 3FXQA 3SEUA 3G3KA 2R9JA 3K01A 1JW4A 4NF5B 4R9FA 3MAMA 4POWA 4NF6B 4OETA 3TTNA 4F18A 1B5JA 3MZBA 2DSFA 4LA9A 3SEYA 4ESXA 3PUXE 4E0XA 3C36A 4KI0E 3O6HA 5I57B 4F3SA 4NWDA 4C1TA 3FVGA 3VDFA 3H7MA 4OERA 3FZVA 1NH7A 1MDP1 4IO3A 4QFKA 2I6EA 2VGQA 1EZ9A 4JWYA 1MXUA 1DTZA 2W7YA 1CB6A 1IUDA 1OVTA 4KFQA 4F1VA 1GVCA 4G8NA 1LGBC 3LUYA 2Z23A 3LSFB 4ZZEA 1EH3A 5FHOA 1B3LA 3HSTA 4NF6A 2ABHA 4O3AA 3OO7A 4BDRA 4F22A 3H6TA 1I69A 3T93B 4QRZA 4ECFA 3N5LA 5I59B 1MQJA 4I8CA 1RYOA 1LB9A 3FV2A 3JV9A 3IOWA 1O7TA 3W15C 2DXYA 1DSNA 2ALUA 5AA2D 1JVYA 1N7WA 1XOCA 4O3BA 4UA8A 4YAHX 4RPOA 2DWIA 2XXPA 4FORA 4YKPA 1TFAA 3HHGA 1SQYA 3LR1A 1OIBA 1O64A 3TQWA 4KQPA 2I49A 4R2FA 2ZNUA 3PPQA 5AA2B 2UYFA 4GWOA 3E4RA 1IIWA 1LAFE 3LSXA 4R6YA 4ZS9A 3VVFA 1TT1A 2V3UA 2ZNTA 1US5A 1N84A 3ZSFA 4PQJA 3PPOA 2F35A 2QRYA 3UA8A 1MXVA 3RTFB 1FQEA 1R9QA 2KLFA 2F34A 2G93A 5AE4A 1SBPA 3N6UA 4JBZA 4HCYA 2I0CA 4U21A 2RCBA 2D5WA 2H4IA 3RUMA 3KSXA 2G29A 4LQ5A 1Y3QA 4ZECA 1B7ZA 3LC8A 4H5FA 2F6PA 3O6GA 3UP9A 1AOVA 3RN8A 2F97A 1JNFA 5AA2A 4OFLA 2BJJX 1BTJA 3FJMA 3GBBA 4HS7A 3OSQA 4XIGQ 2DWHA 5H8SA 4N6PA 3IB0A 4TLLB 1NKXA 4XKPA 1VSOA 1XT8A 3V8XB 1Y9UA 4GL0A 4PE5B 4DZ1A 3V89B 1IITA 4EXKA 2QSXA 4IY6A 1N0TA 3MUQA 1OMPA 1R6ZA 3H4ZA 3G3IA 2XX7A 1DPPA 1ZTYA 1FQAA 3CVGA 4F29A 1BIYA 1B2HA 3D4GA 2QJEA 3OD7A 2QMXA 1MQDA 2F7CA 1SI0A 2DE4A 4RXLA 1B52A 3O2AA 2I4BA 5FHMA 3K6XA 3ONMA 1I6AA 1NNPA 1JVXA 3K1MA 2XXRA 4AB6A 4DIGA 4P0GA 4KCCA 3UN6A 2YPNA 3EHTA 2Y7PA 1M5EA 2GHAA 2Y84A 3CFZA 3MP1A 3TYHA 4NF8B 4ZEFA 2ANJA 1XC1A 1MS7A 2RC9A 1JQFA 3LBSA 3VVDA 2F36A 4G68C 2AIXA 2NWJA 3K4UA 4X9TA 1LFGA 5TU0A 2HZKA 1Y3NA 1MXYA 2REGA 3PUWE 3PU5A 5DVIA 1GR2A 1FCKA 5BWJA
chains in the Genus database with same CATH superfamily
4RY1A 2DXRA 3CHGA 3B6WA 5LOMA 5F7VA 5F1QA 5T3JA 1MPDA 2ZYOA 3T9VA 2WX9A 3DM0A 2Z22A 2QMWA 2VPOA 4BDLA 4NX1A 2UVJA 4GXSB 4X1DA 4OFOA 4R9GA 3RYDA 3DP6A 2FIXA 1SYIA 2YJPA 1LBWA 1B40A 5CMBA 2F8DA 4JVDA 4OVTA 4PCDA 2B3FA 1P1OA 3FVKA 4U22A 3HHFA 3ECRA 3E3KA 2GH9A 4OFJA 3T22A 4X04A 4PAFA 3H6VA 4G68B 4U1ZA 2Y7WA 1O63A 4XKRA 2R8TA 1SW2A 4MMPA 1NV6A 4GWZA 2OX3A 3IORA 3HPIA 4I3EA 3HFUA 2OJTA 3FVNA 5IGAA 2DWAA 3O66A 2Y7IA 1QJMA 5H8HB 3MYUA 4OHNA 1YAEA 4OQOA 4DCYA 1NNFA 2XXVA 4F2QA 1N7XA 2GRVA 5HPQA 1IEJA 3I6VA 3E9XA 1URDA 2OK2A 2ONSA 1MXZA 3IL1B 4Q30B 1H44A 4OEVA 3TCFA 2GQ1A 1Q1KA 5KZTA 3O97A 1SW5A 2QS1A 1SW4A 3G3JA 4LQ2A 4KD5A 4NWCA 5J16A 2AYSA 4OMBA 3S9LC 4F2OA 3OXNA 3WAEA 5FTHA 2A5TB 1UIVA 4QF9A 4PFWA 5K2YA 1MQIA 1SI1A 1NI9A 4YB7A 4BDOA 5EYFA 4LVQA 3S9MC 4L17A 4G68A 2UVGA 3ILUB 5ITOA 1MQHA 3GZGA 3N26A 3E79A 3TMGA 4P0IA 1D3KA 1UTHA 3TPAA 1FPBA 4MLVA 4GOTA 2H9BA 5CRYA 2F5XA 3QSLA 3T66A 1HSEA 3B8BA 5H8HA 1B0HA 3A29A 4BDMA 4RA1A 1K9YA 4DXCA 3KOTA 1FPJA 2ZZXA 2ZYKA 5TP9B 4JSDA 4N8YA 1N04A 1RDXA 4JDFA 1PBPA 3O6IA 3P7IA 3IX1A 1LSTA 3SDFA 1FW0A 3I3VA 3RLFE 5JK4A 2A5TA 4MNPA 1A54A 1PC3A 3TTKA 4YZZA 4DCXA 5EHMA 2F78A 4EXLA 4KCDA 3U65A 1EYJA 3LV0A 3Q26A 5EQ8A 4JWOA 1KA1A 4H6DA 4N8GA 2DWJA 3FIRA 1FPDA 4R75A 4P9KA 5DYHA 3MQ9A 4DI4B 1G0HA 5A5LA 2UYEA 3TODA 1MY3A 3BFUA 3DELB 3MZ9A 2XHDA 5AA3A 4QHQA 4NHBA 3VXCA 2O1LA 4XXUA 4RNSA 1LAXA 4NQ8A 4DLDA 1ZIUA 4FATA 3QMFA 5L9MA 4FAJA 1B46A 4IY5A 1DPEA 1DBZA 3A3CA 5TP9A 3LSLA 4QFLA 3S4UA 5CMKA 2XXIA 3ZS6A 1LBXA 4G8HA 4MAGA 2F7BA 4PF8A 1USYH 4P11A 4O94A 4OVSA 2XD2A 1FBDA 3KN3A 4IGRA 5CC2A 4JXIA 4UACA 2VPNA 4KPTA 2OCUA 1SW1A 3IOTA 4HE0A 5KCJA 2DOJA 4MX6A 1K9ZA 1JEVA 1ANFA 2R6GE 2GFEA 2Y7KA 1MY2A 1FTJA 1YZ0A 4GD5A 5I56B 2ZNSA 5L9SA 1IZ1A 4NGUA 2RCAA 4GWSA 3CSGA 4FJPA 5ICQA 4ND9A 3EHSA 3TELA 2QVRA 3CR9A 1B05A 3TFLA 4R6HA 3KJTA 3FVOA 4GXAA 1B9JA 4G4PA 2YLNA 4H45A 5FBPA 1A55A 3EF7A 3ZKLA 2F7AA 5H8QB 1IXHA 1NUYA 4LP2B 1Q35A 2OZZA 1B1XA 1PEBA 2ZMBA 2O6AA 3RNNA 1NH8A 3B7DA 2AL4A 5M2VA 1USYE 2IEEA 3SESA 3TTRA 1B3EA 4GWUA 2Q74A 5I2KB 2Z8DA 3T96B 3FBPA 4PDDA 3A3UA 2ONRA 4O7MA 3IO4A 4BDQA 5I56A 1OLAA 4F3BA 1AL3A 1R9LA 1ZU0A 5ESYA 3DLNA 3MVYA 2O1MA 2XD3A 1YTVA 2REJA 4GRKA 1RDYA 2Q2AA 1MRPA 4U1OA 1EZOA 1KZ8A 1TXFA 1VFEA 1DCUA 1R1NA 5H8QA 1FBPA 2NOOA 3BBRA 5FTIA 2V25A 2F3BA 3I5OA 4OXVA 3IJOB 4Q0CA 1LBYA 4PE3A 3Q25A 5AA4A 5IM2A 4AQ4A 2I3WA 5ITPA 2GHBA 5CBRA 5I2KA 3MBPA 2B65A 3TQLA 1RYXA 4GBWA 3PUYE 4JWXA 1ELJA 4NMYA 4HE2A 4OVQA 3FD3A 1I6BA 2VOZA 1QULA 4X48A 5CI5A 2PVUA 3VLVA 3UIFA 1P99A 1TWYA 1M5FA 1B32A 4PF6A 3BKIB 3EN3A 2DVZA 3FGSA 3OSRA 3TAJA 1NV1A 2D3IA 4H65A 2WBDA 1B4ZA 2RINA 5HBCA 3BFTA 1S50A 3G7WA 4FEBA 1PB9A 4NG7A 3W9VA 3G3FA 4EUOA 3MPLA 1NV4A 3TTLA 3KFMA 1DOTA 4LN5A 1CE2A 3MPKA 3TUSA 1LAHE 4DXBA 4C0RA 1JETA 5EYGA 1H45A 1M5DA 4OWDA 4U4SA 1PDAA 3PMVA 5I7IA 4OVJA 1SYHA 4LZ8A 2NUVA 2LAOA 4WXJA 4ZEBA 1IMAA 1YPNA 3VVEA 4N81A 1LEVA 5A5XA 2V3QA 3KGCA 3RTWB 3SEVA 3H03A 4OVRA 2JJKA 3QUFA 2P1SA 1MY0A 2XWKA 2VD2A 2KR0A 1QKAA 2DDKA 4YMBA 3C35A 4GWXA 4N91A 4X1BA 1BP5A 1FTAA 1MPCA 1OQGA 2VT5A 4F39A 4M1VA 2XX8A 1MPBA 4PFYA 1MY4A 4ZZAA 1H76A 4GX6A 4PAIA 2O7UA 4KXPA 1QKBA 4G2ZA 3S2VA 1XHYA 3THIA 1G0IA 3N94A 4G77A 2PYYA 1Y3PA 3MVXA 4IGTA 2XXUA 3H6UA 5DEXB 3TTMA 1EYKA 1NNTA 1FBFA 3PMXA 3B6QA 3KZGA 4MJOA 1WDNA 3LUZA 4DE8A 4ELRA 3IFCA 3FXRA 1Z7ME 4PETA 2Q88A 4HTGA 1MH4A 4XFEA 2UXAA 2HAUA 1A99A 2FVZA 1ATGA 4BLAA 4ELQA 3USDA 3DP8A 1MQGA 3T0JA 4GQOA 5EYHA 2RF1A 4F1UA 3U72A 2FYIA 3N6TA 1KWHA 2UVHA 5DTBA 2ONKE 4P56A 5ELVA 2XWVA 2V3TA 1FPFA 1NV3A 3SKPA 1QUJA 1A8EA 4OA4A 1QVSA 1FPLA 4GBVA 4PFRA 4QSCA 3QK6A 5DEXA 3PGFA 1NV2A 5JTYB 4ZDMA 1A8FA 3QUJA 3PTYA 4H5GA 1MXXA 4P47A 3BIHA 4ZEDA 4M4GA 4ZEIA 3HN0A 5TPAA 2I0BA 3KG2A 4YB6A 4POXA 3U92A 5CMCA 4QFNA 3QAXA 3VXBA 4X8RA 3SZPA 3OO9A 1FRPA 1UTHB 5HM4B 1MG1A 1HSJA 1H43A 2H99A 1A7LA 3HCQA 4JB7A 2ZYMA 4FEDA 2H25A 3RPWA 3EQ1A 1P1QA 2DVCA 5J1DA 3CFLA 2HZLA 4IO2A 1FQCA 4DDDA 4GIZA 1JW5A 1IXCA 4WEPA 3QIMA 2XX9A 1IMDA 3FJ7A 1LCTA 2XXTA 5JTYA 2RKMA 3OEKA 1B5HA 3PD9A 4PGNA 5ET6A 1B5IA 5K2XA 1LBBA 1VDWA 4ELPA 4WEDA 2FBPA 5IKBA 2PT2A 3C9HA 1J1NA 3C4MA 1RKMA 2HEUA 4FE8A 1NV5A 5B70A 2WYPA 4EDPA 4R2BA 2PT1A 3M3KA 2B3BA 2HAVA 4MLQA 4H67A 1Z7NE 4NF4B 2AL5A 2P2AA 4GFRA 2DE2A 1FTOA 4PC9A 2Q2CA 3IB1A 3IOVA 4MEVA 1QW0A 1VFDA 4RK2A 3KBZA 1TFDA 2ZYNA 3KC1A 4YICA 1GV8A 1FPGA 2VP1A 3MP8A 1AMFA 3OO6A 4YKIA 4R73A 3E13X 3GBAA 3O9PA 1LFIA 3OENA 4ONYA 3AXFA 4OZ9A 1XI6A 5IZZA 1INPA 3K1PA 3OO8A 5ICTA 2WKYA 3HO7A 4F1YA 3H6WA 4OENA 2Y5KA 1Y1MA 3B50A 5KCJB 1BLFA 1OLCA 3MWBA 2XXYA 4R72A 2QS3A 3DP4A 3TCGA 1SD3A 1NNKA 3S9EA 4ISUA 1PBQA 5CBSA 2CZKA 5I2NB 4MIJA 2PCRA 2DQVA 1FQBA 4H8IA 3GLBA 1Y1ZA 4NF4A 3B6TA 4LZ5A 3JYRA 1LBVA 2E1SA 4MBPA 3S9NC 4RPNA 3VE1B 3CIJA 1FQDA 2PFZA 3PUVE 4NEDA 4JVIA 3K6VA 1I6QA 1PB7A 4H8JA 3FXBA 1MY1A 4Q8RA 1B6HA 2O7IA 4Z7EA 3O29A 4LUBA 2XXWA 5KDTA 4P1EA 1IMCA 4OVPA 4QFOA 1D4NA 4O3CA 2Z8EA 2Y7RA 4MH5A 1FPKA 4GF8A 1EZPA 2HPGA 1KA0A 3IK6B 1B7UA 5I2NA 3KSJA 4XTCQ 2MKZA 3KN8A 1S9TA 2PX1A 4MHFA 3WAFA 2ESNA 4PDHA 1ZMGA 3VLUA 1YCJA 1XVXA 5AA1A 3SEXA 4R74A 1UTBB 3U1OA 3FASA 3MVZA 3F11A 3H06B 1MDQA 4LATA 4NF5A 1GTKA 5FHNA 3CFXA 3CG3A 4N07A 1FPIA 5ISUA 1XS5A 3QYTA 4XF5A 2HXWA 2PMSA 4QFPA 2B4LA 1NV7A 4K3FA 4F19A 2ZZWA 1OVBA 4PFUA 2NVUB 1XVYA 1D9VA 5IZ1A 2V93A 2Q8MA 3TZAA 4EQ9A 5AA4B 5I57A 1MXWA 3GXAA 3U93A 3U94A 3MC2A 3T1BA 2VHAA 3PD8A 1FTLA 1B51A 3NOHA 1MM7A 4EQBA 3V83A 1IXGA 2Z8FA 3GYYA 4KYSA 3CSBA 4H0WA 3IOUA 1N3XA 1UTBA 4I1DA 3FUZA 1JW1A 3IB2A 2PBWA 2QPQA 3FXUA 4IO4A 3MW0A 3CRBA 3M8UA 1H3DA 5IZ3A 2O68A 2B4MA 5CMMA 3T9HB 2Q8JA 3E78A 1VR5A 4YB5A 1D9YA 5LTCA 3ROJA 1NUWA 5DVFA 1HSLA 4ZE8A 1B3FA 2A5SA 3TEPA 1DMBA 5I59A 4I62A 3KEIA 2OLBA 3PPPA 5H8NB 4U2RA 4GX4A 1M5BA 5A5XB 2CEYA 2CMOA 2NXOA 3ZKKA 1IQ7A 3TCHA 3M3FA 4IR8A 2L5VA 3OMBA 4ELOA 4QSDA 2F3DA 1SPIA 4F31B 1B0LA 2DE3A 5BUUA 2THIA 4THIA 4HCWA 4ZE9A 3K02A 3VFJA 1EU8A 4KHZE 2QL3A 4PP0A 3PV0E 4EF1A 2DYXA 3KN7A 2I4CA 4MF3A 3K6WA 4GVOA 1ZLQA 1IMEA 3MJNA 5I58B 5F24A 1FTMA 5H8NA 3FJGA 3C31A 4XKNA 4DI3D 4Z0IA 4F3GA 1US4A 1B3GA 3Q29A 1NMUA 1AIVA 2RC8A 3K00A 3PPNA 1POY1 1UIUA 3KOSA 2P3VA 1N76A 4DXUA 1LLSA 3Q28A 3UGWA 3L6GA 2X26A 1P1NA 1OQHA 1B7HA 4G8MA 1FPEA 1PB8A 4U4XA 4NE4A 4QSEA 1Q9DA 3QXMA 2H5YA 2VD3A 3EPEA 3RY3A 2XXHA 2O84X 5H8FB 4LONB 2I48A 2FHYA 5IAIA 4H46A 1P1UA 3FV1A 4NTLA 3W9WA 2I58A 4NN3A 1YYZA 1MM6A 1NFTA 3K1NA 1LAGE 4KYEA 3BIGA 1YXIA 3O28A 1A40A 3K2DA 1B58A 5JEIA 3RGYA 3C32A 4GL8A 2X7PA 3V5AA 5I58A 2Q9TA 4JSOA 3PUZE 1JEUA 3K6UA 3SETA 3LSWA 4IO6A 4F3PA 2RC7A 3R7XA 1SVXB 3U8QA 2F6GA 3ODBA 4YKKA 3RT8A 4IO7A 2HFBA 4RJZA 1FQFA 5TPAB 3TKDA 1URGA 1M5CA 1IMFA 3IAZA 1URSA 2R71A 1DTGA 3CI8A 4EQ7A 4PGPA 2X7QA 3MZ1A 3IO6A 4HE1A 3CG1A 2Q89A 3R6UA 5L9OA 3PPRA 5H8FA 3Q27A 4FIMA 1FBHA 3M3LA 2DP8A 3MP6A 3C34A 3KJ7A 3UK4A 2HCAA 3OEMA 1B1HA 5CM6A 1CNQA 4N13A 5EHSA 2XXQA 1UQWA 1II5A 2UVIA 3G3GA 2D21A 4GLIA 1ZKBA 4I9DA 2OWTA 3TDJA 2M8CA 1QUKA 3OOAA 2O69A 4NF8A 1WVJA 4KR5A 2E0SA 4AB5A 3RT6B 4H1XA 3SERA 1JP4A 3ILTB 3EHUA 5I84A 4I3YA 4MFIA 1LCFA 2OWSA 5L8DA 2DS9A 4BDNA 2O51A 5EQ9A 1IMBA 3R26A 2H98A 3G3HA 3FATA 4TOZA 4U23A 1S7YA 1N3WA 2ZXTA 2XXXA 1ZBMA 4OTEA 4GWWA 3IJXB 1SDXA 3T9XB 1GGGA 3VV5A 4PFTA 1B4HA 4MCOA 4Q5TA 3PMWA 4PFIA 1POTA 1F9BA 3IR1A 4OEUA 2KQZA 1MH3A 4UABA 3RQTA 3A09A 5DT6A 1L5TA 4IB2A 2CZLA 1P1WA 4RYAA 4ESWA 4YKJA 1WODA 2QS4A 3H3GA 4LZ7A 1BKAA 3UORA 4YMAA 4RK9A 4N15A 2V84A 2FA7A 3C33A 4OESA 3D4CA 4HW8A 3JZJA 2I3VA 4MNIA 4N17A 4OYVA 4FECA 1Y20A 3KBRA 2WBBA 1IXIA 1QUIA 1LFHA 3D1RA 4ZEKA 1Y4TA 3L6HA 2P0SA 4GWYA 1T0KA 3K0VA 1Y4CA 2IA4A 3SEWA 1VE4A 4C1UA 4R6KA 5KDTB 5ET8A 2OWZA 4WKMA 1AH5A 1FTKA 3HV1A 1NV0A 2FNCA 1LBZA 4YU0A 4TLMB 1ZJLA 1NL5A 1B3HA 4XKQA 5DVJA 4TQUQ 4IO5A 3T9UA 1LBCA 2XXKA 4E0WA 3OELA 4QBAA 2HQ0A 3VLWA 1LB8A 3MVWA 4EF2A 5B7DA 2OBGA 4KYDA 2QS2A 3FXQA 3SEUA 3G3KA 4P8BA 2R9JA 3K01A 3MSTA 1JW4A 4PBHA 4NF5B 4R9FA 3KC0A 5EQ7A 3MAMA 4POWA 4NF6B 4OETA 3TTNA 4F18A 1B5JA 3MZBA 2DSFA 4LA9A 3SEYA 4ESXA 2CEXA 3PUXE 4E0XA 3C36A 4KI0E 3O6HA 5I57B 4F3SA 2XWOA 4NWDA 4C1TA 3FVGA 5EQAA 3VDFA 3H7MA 4OERA 3FZVA 1D9QA 1NH7A 4AS4A 1MDP1 4IO3A 4N4UA 4QFKA 1EYIA 2I6EA 2VGQA 1EZ9A 4JWYA 1MXUA 5ET5A 1DTZA 2W7YA 1CB6A 2QVUA 1IUDA 1OVTA 4KFQA 4F1VA 1GVCA 4G8NA 1LGBC 4O8MA 3LUYA 2Z23A 3LSFB 1QGXA 4ZZEA 1EH3A 5FHOA 4PTKA 2CZHA 5IZ3B 1B3LA 3HSTA 4NF6A 4GX3A 2ABHA 2XWIA 4O3AA 3OO7A 4BDRA 4F22A 3H6TA 1I69A 3T93B 4QRZA 4ECFA 3N5LA 5I59B 1MQJA 4I8CA 1RYOA 1LB9A 2HHMA 3FV2A 3JV9A 3IOWA 1O7TA 3W15C 2DXYA 1DSNA 2ALUA 5AA2D 1JVYA 1N7WA 1XOCA 4O3BA 4UA8A 4YAHX 4RPOA 2DWIA 2XXPA 4FORA 4YKPA 2WEFA 2FIEA 1TFAA 3HHGA 2CZIA 1SQYA 3LR1A 1OIBA 1O64A 3TQWA 4KQPA 1NUXA 4P3LA 2I49A 4R2FA 2ZNUA 2V4CA 4XEQA 4N6DA 3PPQA 5AA2B 2UYFA 4GWOA 3E4RA 1IIWA 1LAFE 3LSXA 4R6YA 4ZS9A 3VVFA 1TT1A 2V3UA 2ZNTA 1US5A 1N84A 3ZSFA 4PQJA 3PPOA 2F35A 2QRYA 3UA8A 1MXVA 3RTFB 1FQEA 1R9QA 2KLFA 4N6KA 1AWBA 1FSAA 2F34A 2G93A 5AE4A 1SBPA 3N6UA 2ZZVA 4JBZA 4HCYA 2I0CA 4NF0A 4U21A 4AS5A 2RCBA 2D5WA 2H4IA 1FBEA 3RUMA 3KSXA 2G29A 5ET7A 4LQ5A 1Y3QA 4OANA 4ZECA 1B7ZA 3LC8A 4H5FA 2F6PA 3O6GA 3UP9A 1AOVA 2F97A 3RN8A 1JNFA 5AA2A 4G61A 4OFLA 2BJJX 1BTJA 3FJMA 3GBBA 4HXVA 4HS7A 3OSQA 4XIGQ 2DWHA 5H8SA 4N6PA 3IB0A 2P3NA 4TLLB 1BK4A 1NKXA 4XKPA 1VSOA 1XT8A 3RPLB 3V8XB 1Y9UA 4GL0A 4PE5B 4DZ1A 3V89B 1IITA 4EXKA 2QSXA 4IY6A 1N0TA 3MUQA 1OMPA 1R6ZA 3H4ZA 3ISPA 3G3IA 2XX7A 1DPPA 1ZTYA 1FJ9A 2Y5LA 1FQAA 3CVGA 4PAKA 4P1LA 4F29A 1BIYA 1B2HA 3D4GA 1FBCA 2QJEA 3OD7A 2QMXA 1MQDA 2F7CA 1SI0A 2DE4A 4RXLA 4QXDA 1B52A 3O2AA 5LDZA 2I4BA 5FHMA 1NUZA 3K6XA 3ONMA 4I40A 1I6AA 5I5PA 1NNPA 5DW8A 1JVXA 3K1MA 2XXRA 4AB6A 4MNCA 4DIGA 4P0GA 4KCCA 4PBQA 3UN6A 2YPNA 1FJ6A 3EHTA 3RPLA 2Y7PA 1M5EA 2WYKA 2GHAA 4FBPA 2Y84A 4PFBA 3CFZA 3MP1A 3TYHA 2QVVA 4NF8B 4ZEFA 2ANJA 1RDZA 1XC1A 1MS7A 1FBGA 4NAPA 2RC9A 1JQFA 1DK4A 3LBSA 3VVDA 2F36A 4G68C 2AIXA 2NWJA 3IFAA 3EKIA 2BJIA 3K4UA 4X9TA 1LFGA 2XA5A 5TU0A 5I3SA 2HZKA 4O7IA 1Y3NA 1MXYA 4JVCA 2REGA 2PFYA 3PUWE 2HXRA 3PU5A 5DVIA 1GR2A 1FCKA 2QFLA 5BWJA
chains in the Genus database with same CATH topology
4RY1A 2DXRA 3B6WA 5LOMA 5F7VA 5F1QA 1MPDA 2ZYOA 3T9VA 3DM0A 2Z22A 2QMWA 4BDLA 2UVJA 4GXSB 4X1DA 4OFOA 4R9GA 3DP6A 1SYIA 2YJPA 1B40A 5CMBA 2F8DA 2B3FA 1P1OA 3FVKA 4U22A 3HHFA 3ECRA 3E3KA 2GH9A 4OFJA 3T22A 3H6VA 4G68B 4U1ZA 2Y7WA 1O63A 4XKRA 1SW2A 3IORA 3HPIA 2OJTA 3FVNA 2DWAA 3O66A 2Y7IA 1QJMA 5H8HB 4OHNA 1YAEA 4OQOA 4DCYA 1NNFA 2XXVA 4F2QA 1N7XA 2GRVA 5HPQA 1IEJA 3I6VA 3E9XA 1URDA 2OK2A 2ONSA 1MXZA 3IL1B 4Q30B 1H44A 4OEVA 3TCFA 1Q1KA 5KZTA 3O97A 1SW5A 2QS1A 1SW4A 3G3JA 4LQ2A 4KD5A 4NWCA 2AYSA 4OMBA 3S9LC 4F2OA 3OXNA 3WAEA 5FTHA 2A5TB 1UIVA 4QF9A 4PFWA 5K2YA 1MQIA 1SI1A 4YB7A 4BDOA 5EYFA 4LVQA 3S9MC 4L17A 4G68A 2UVGA 3ILUB 5ITOA 1MQHA 3GZGA 3N26A 3TMGA 4P0IA 1D3KA 1UTHA 3TPAA 4MLVA 4GOTA 2H9BA 5CRYA 2F5XA 3QSLA 3T66A 1HSEA 5H8HA 1B0HA 4BDMA 4RA1A 4DXCA 3KOTA 2ZYKA 5TP9B 4JSDA 1N04A 4JDFA 1PBPA 3O6IA 3P7IA 3IX1A 1LSTA 3SDFA 1FW0A 3I3VA 3RLFE 5JK4A 2A5TA 1A54A 1PC3A 3TTKA 4YZZA 4DCXA 5EHMA 2F78A 4EXLA 4KCDA 3Q26A 4JWOA 4H6DA 2DWJA 3FIRA 4R75A 5DYHA 3MQ9A 2UYEA 3TODA 1MY3A 3BFUA 3DELB 3MZ9A 2XHDA 5AA3A 4QHQA 3VXCA 2O1LA 4XXUA 4RNSA 1LAXA 4DLDA 1ZIUA 4FATA 5L9MA 4FAJA 1B46A 4IY5A 1DPEA 5TP9A 3A3CA 3LSLA 4QFLA 3S4UA 5CMKA 2XXIA 3ZS6A 4G8HA 2F7BA 1USYH 4P11A 2XD2A 4IGRA 3KN3A 5CC2A 4JXIA 4UACA 4KPTA 2OCUA 1SW1A 3IOTA 5KCJA 2DOJA 1JEVA 1ANFA 2R6GE 2GFEA 2Y7KA 1MY2A 1FTJA 4GD5A 5I56B 2ZNSA 5L9SA 1IZ1A 2RCAA 3CSGA 4FJPA 5ICQA 4ND9A 3EHSA 3TELA 3CR9A 1B05A 3TFLA 4R6HA 3KJTA 3FVOA 4GXAA 1B9JA 4G4PA 2YLNA 1A55A 3EF7A 3ZKLA 2F7AA 5H8QB 1IXHA 4LP2B 1Q35A 2OZZA 1B1XA 1PEBA 2ZMBA 2O6AA 3RNNA 1NH8A 3B7DA 2AL4A 5M2VA 1USYE 2IEEA 3SESA 3TTRA 1B3EA 5I2KB 2Z8DA 3T96B 3A3UA 2ONRA 3IO4A 4BDQA 5I56A 1OLAA 4F3BA 1AL3A 1R9LA 1ZU0A 3DLNA 3MVYA 2O1MA 2XD3A 1YTVA 2REJA 4GRKA 2Q2AA 1MRPA 4U1OA 1EZOA 1TXFA 1VFEA 1R1NA 5H8QA 2NOOA 3BBRA 5FTIA 2V25A 3I5OA 4OXVA 3IJOB 4Q0CA 3Q25A 5AA4A 4AQ4A 2I3WA 5ITPA 2GHBA 5CBRA 5I2KA 3MBPA 2B65A 3TQLA 1RYXA 3PUYE 4JWXA 1ELJA 4NMYA 3FD3A 1I6BA 2VOZA 1QULA 4X48A 5CI5A 2PVUA 3VLVA 3UIFA 1P99A 1TWYA 1M5FA 1B32A 3BKIB 3EN3A 2DVZA 3FGSA 3OSRA 3TAJA 2D3IA 4H65A 1B4ZA 2RINA 5HBCA 3BFTA 1S50A 3G7WA 4FEBA 1PB9A 3W9VA 3G3FA 4EUOA 3MPLA 3TTLA 3KFMA 1DOTA 1CE2A 3MPKA 3TUSA 1LAHE 4DXBA 4C0RA 1JETA 1H45A 1M5DA 4OWDA 4U4SA 1PDAA 3PMVA 4OVJA 1SYHA 4LZ8A 2NUVA 2LAOA 4WXJA 4ZEBA 1YPNA 3VVEA 5A5XA 2V3QA 3KGCA 3RTWB 3SEVA 3H03A 3QUFA 2P1SA 1MY0A 2VD2A 1QKAA 4YMBA 3C35A 4X1BA 1BP5A 1MPCA 1OQGA 4F39A 4M1VA 2XX8A 1MPBA 4PFYA 1MY4A 4ZZAA 1H76A 2O7UA 1QKBA 4G2ZA 3S2VA 1XHYA 3THIA 3N94A 4G77A 2PYYA 1Y3PA 3MVXA 4IGTA 2XXUA 3H6UA 5DEXB 3TTMA 1NNTA 3PMXA 3B6QA 3KZGA 1WDNA 4DE8A 4ELRA 3FXRA 1Z7ME 4PETA 2Q88A 4HTGA 1MH4A 2UXAA 2HAUA 1A99A 1ATGA 4BLAA 4ELQA 3USDA 3DP8A 1MQGA 4GQOA 2RF1A 4F1UA 3U72A 2FYIA 3N6TA 1KWHA 2UVHA 5DTBA 2ONKE 5ELVA 2V3TA 3SKPA 1QUJA 1A8EA 1QVSA 4QSCA 3QK6A 5DEXA 3PGFA 5JTYB 4ZDMA 1A8FA 3QUJA 4H5GA 1MXXA 4ZEDA 4M4GA 4ZEIA 3HN0A 5TPAA 2I0BA 3KG2A 4YB6A 4POXA 3U92A 5CMCA 4QFNA 3QAXA 3VXBA 3OO9A 1UTHB 5HM4B 1MG1A 1HSJA 1H43A 2H99A 1A7LA 3HCQA 4JB7A 2ZYMA 4FEDA 2H25A 3RPWA 3EQ1A 1P1QA 2DVCA 5J1DA 3CFLA 2HZLA 4IO2A 1FQCA 4DDDA 4GIZA 1JW5A 1IXCA 4WEPA 3QIMA 2XX9A 3FJ7A 1LCTA 2XXTA 5JTYA 2RKMA 3OEKA 1B5HA 3PD9A 5K2XA 1B5IA 1LBBA 4ELPA 4WEDA 5IKBA 2PT2A 3C9HA 1J1NA 3C4MA 1RKMA 2HEUA 4FE8A 5B70A 4EDPA 4R2BA 2PT1A 3M3KA 2B3BA 2HAVA 4MLQA 4H67A 1Z7NE 4NF4B 2AL5A 2P2AA 4GFRA 2DE2A 1FTOA 2Q2CA 3IB1A 3IOVA 1QW0A 1VFDA 4RK2A 1TFDA 2ZYNA 4YICA 1GV8A 2VP1A 3MP8A 1AMFA 3OO6A 4YKIA 4R73A 3E13X 3GBAA 3O9PA 1LFIA 3OENA 4ONYA 3AXFA 4OZ9A 3K1PA 3OO8A 5ICTA 2WKYA 3HO7A 4F1YA 3H6WA 4OENA 1Y1MA 5KCJB 1BLFA 1OLCA 3MWBA 2XXYA 4R72A 2QS3A 3DP4A 3TCGA 1SD3A 1NNKA 3S9EA 4ISUA 1PBQA 5CBSA 5I2NB 2DQVA 1FQBA 4H8IA 3GLBA 1Y1ZA 4NF4A 3B6TA 4LZ5A 3JYRA 2E1SA 4MBPA 3S9NC 4RPNA 3VE1B 3CIJA 1FQDA 3PUVE 4NEDA 3K6VA 1I6QA 1PB7A 4H8JA 1MY1A 4Q8RA 1B6HA 2O7IA 4Z7EA 3O29A 4LUBA 2XXWA 5KDTA 4QFOA 1D4NA 4O3CA 2Z8EA 2Y7RA 4MH5A 4GF8A 1EZPA 3IK6B 1B7UA 5I2NA 3KSJA 4XTCQ 3KN8A 1S9TA 2PX1A 3WAFA 2ESNA 1ZMGA 3VLUA 1YCJA 1XVXA 5AA1A 3SEXA 4R74A 1UTBB 3U1OA 3FASA 3MVZA 3F11A 3H06B 1MDQA 4LATA 4NF5A 1GTKA 5FHNA 3CFXA 3CG3A 4N07A 5ISUA 1XS5A 3QYTA 2HXWA 2PMSA 4QFPA 4K3FA 4F19A 1OVBA 4PFUA 2NVUB 1XVYA 1D9VA 2V93A 3TZAA 4EQ9A 5AA4B 5I57A 1MXWA 3GXAA 3U93A 3U94A 3MC2A 2VHAA 3PD8A 1FTLA 1B51A 1MM7A 4EQBA 3V83A 1IXGA 2Z8FA 4KYSA 3CSBA 4H0WA 3IOUA 1N3XA 1UTBA 4I1DA 3FUZA 1JW1A 3IB2A 2PBWA 2QPQA 3FXUA 4IO4A 3MW0A 3CRBA 3M8UA 1H3DA 2O68A 5CMMA 3T9HB 2Q8JA 1VR5A 4YB5A 1D9YA 5DVFA 1HSLA 4ZE8A 1B3FA 2A5SA 3TEPA 1DMBA 5I59A 4I62A 3KEIA 2OLBA 3PPPA 5H8NB 4U2RA 1M5BA 5A5XB 2CMOA 2NXOA 3ZKKA 1IQ7A 3TCHA 3M3FA 4ELOA 3OMBA 4QSDA 4F31B 1B0LA 2DE3A 5BUUA 2THIA 4THIA 4HCWA 4ZE9A 3K02A 3VFJA 1EU8A 4KHZE 2QL3A 4PP0A 3PV0E 4EF1A 2DYXA 3KN7A 2I4CA 4MF3A 3K6WA 4GVOA 1ZLQA 3MJNA 5I58B 5H8NA 1FTMA 3FJGA 3C31A 4XKNA 4Z0IA 4F3GA 1US4A 1B3GA 3Q29A 1NMUA 1AIVA 2RC8A 3K00A 3PPNA 1POY1 1UIUA 3KOSA 1N76A 4DXUA 1LLSA 3Q28A 3UGWA 3L6GA 2X26A 1P1NA 1OQHA 1B7HA 4G8MA 1PB8A 4U4XA 4NE4A 4QSEA 3QXMA 2H5YA 2VD3A 3EPEA 3RY3A 2XXHA 2O84X 5H8FB 4LONB 2I48A 5IAIA 1P1UA 3FV1A 4NTLA 3W9WA 2I58A 1MM6A 1NFTA 3K1NA 1LAGE 4KYEA 3O28A 1A40A 3K2DA 1B58A 5JEIA 3RGYA 3C32A 4GL8A 2X7PA 3V5AA 5I58A 2Q9TA 4JSOA 3PUZE 1JEUA 3K6UA 3SETA 3LSWA 4IO6A 4F3PA 2RC7A 3R7XA 1SVXB 3U8QA 2F6GA 3ODBA 4YKKA 3RT8A 4IO7A 2HFBA 4RJZA 1FQFA 5TPAB 3TKDA 1URGA 1M5CA 3IAZA 1URSA 2R71A 1DTGA 3CI8A 4EQ7A 2X7QA 3MZ1A 3IO6A 3CG1A 2Q89A 3R6UA 5L9OA 3PPRA 5H8FA 3Q27A 4FIMA 3M3LA 2DP8A 3MP6A 3C34A 3KJ7A 3UK4A 2HCAA 3OEMA 1B1HA 5CM6A 4N13A 5EHSA 2XXQA 1UQWA 1II5A 2UVIA 3G3GA 2D21A 4GLIA 1ZKBA 4I9DA 2OWTA 3TDJA 2M8CA 1QUKA 3OOAA 2O69A 4NF8A 1WVJA 4KR5A 2E0SA 4AB5A 3RT6B 4H1XA 3SERA 3ILTB 3EHUA 5I84A 4MFIA 1LCFA 2OWSA 5L8DA 2DS9A 4BDNA 2O51A 3R26A 2H98A 3G3HA 3FATA 4TOZA 4U23A 1S7YA 1N3WA 2ZXTA 2XXXA 1ZBMA 4OTEA 3IJXB 1SDXA 3T9XB 1GGGA 3VV5A 4PFTA 1B4HA 4Q5TA 3PMWA 1POTA 1F9BA 3IR1A 4OEUA 1MH3A 3RQTA 3A09A 5DT6A 1L5TA 4IB2A 2CZLA 1P1WA 4RYAA 4ESWA 4YKJA 1WODA 2QS4A 3H3GA 4LZ7A 1BKAA 3UORA 4YMAA 4RK9A 2V84A 2FA7A 3C33A 4OESA 3D4CA 4HW8A 3JZJA 2I3VA 4OYVA 4FECA 1Y20A 3KBRA 1IXIA 1QUIA 1LFHA 4ZEKA 1Y4TA 3L6HA 2P0SA 1T0KA 3K0VA 1Y4CA 2IA4A 3SEWA 1VE4A 4C1UA 4R6KA 5KDTB 4WKMA 1AH5A 1FTKA 3HV1A 2FNCA 4YU0A 4TLMB 1ZJLA 1NL5A 1B3HA 4XKQA 5DVJA 4TQUQ 4IO5A 3T9UA 1LBCA 4E0WA 3OELA 2HQ0A 3VLWA 1LB8A 3MVWA 4EF2A 5B7DA 2OBGA 4KYDA 2QS2A 3FXQA 3SEUA 3G3KA 2R9JA 3K01A 1JW4A 4NF5B 4R9FA 3MAMA 4POWA 4NF6B 4OETA 3TTNA 4F18A 1B5JA 3MZBA 2DSFA 4LA9A 3SEYA 4ESXA 3PUXE 4E0XA 3C36A 4KI0E 3O6HA 5I57B 4F3SA 4NWDA 4C1TA 3FVGA 3VDFA 3H7MA 4OERA 3FZVA 1NH7A 1MDP1 4IO3A 4QFKA 2I6EA 2VGQA 1EZ9A 4JWYA 1MXUA 1DTZA 2W7YA 1CB6A 1IUDA 1OVTA 4KFQA 4F1VA 1GVCA 4G8NA 1LGBC 3LUYA 2Z23A 3LSFB 4ZZEA 1EH3A 5FHOA 1B3LA 3HSTA 4NF6A 2ABHA 4O3AA 3OO7A 4BDRA 4F22A 3H6TA 1I69A 3T93B 4QRZA 4ECFA 3N5LA 5I59B 1MQJA 4I8CA 1RYOA 1LB9A 3FV2A 3JV9A 3IOWA 1O7TA 3W15C 2DXYA 1DSNA 2ALUA 5AA2D 1JVYA 1N7WA 1XOCA 4O3BA 4UA8A 4YAHX 4RPOA 2DWIA 2XXPA 4FORA 4YKPA 1TFAA 3HHGA 1SQYA 3LR1A 1OIBA 1O64A 3TQWA 4KQPA 2I49A 4R2FA 2ZNUA 3PPQA 5AA2B 2UYFA 4GWOA 3E4RA 1IIWA 1LAFE 3LSXA 4R6YA 4ZS9A 3VVFA 1TT1A 2V3UA 2ZNTA 1US5A 1N84A 3ZSFA 4PQJA 3PPOA 2F35A 2QRYA 3UA8A 1MXVA 3RTFB 1FQEA 1R9QA 2KLFA 2F34A 2G93A 5AE4A 1SBPA 3N6UA 4JBZA 4HCYA 2I0CA 4U21A 2RCBA 2D5WA 2H4IA 3RUMA 3KSXA 2G29A 4LQ5A 1Y3QA 4ZECA 1B7ZA 3LC8A 4H5FA 2F6PA 3O6GA 3UP9A 1AOVA 3RN8A 2F97A 1JNFA 5AA2A 4OFLA 2BJJX 1BTJA 3FJMA 3GBBA 4HS7A 3OSQA 4XIGQ 2DWHA 5H8SA 4N6PA 3IB0A 4TLLB 1NKXA 4XKPA 1VSOA 1XT8A 3V8XB 1Y9UA 4GL0A 4PE5B 4DZ1A 3V89B 1IITA 4EXKA 2QSXA 4IY6A 1N0TA 3MUQA 1OMPA 1R6ZA 3H4ZA 3G3IA 2XX7A 1DPPA 1ZTYA 1FQAA 3CVGA 4F29A 1BIYA 1B2HA 3D4GA 2QJEA 3OD7A 2QMXA 1MQDA 2F7CA 1SI0A 2DE4A 4RXLA 1B52A 3O2AA 2I4BA 5FHMA 3K6XA 3ONMA 1I6AA 1NNPA 1JVXA 3K1MA 2XXRA 4AB6A 4DIGA 4P0GA 4KCCA 3UN6A 2YPNA 3EHTA 2Y7PA 1M5EA 2GHAA 2Y84A 3CFZA 3MP1A 3TYHA 4NF8B 4ZEFA 2ANJA 1XC1A 1MS7A 2RC9A 1JQFA 3LBSA 3VVDA 2F36A 4G68C 2AIXA 2NWJA 3K4UA 4X9TA 1LFGA 5TU0A 2HZKA 1Y3NA 1MXYA 2REGA 3PUWE 3PU5A 5DVIA 1GR2A 1FCKA 5BWJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RY1 A;  2DXR A;  3B6W A;  5LOM A;  5F7V A;  5F1Q A;  1MPD A;  2ZYO A;  3T9V A;  3DM0 A;  2Z22 A;  2QMW A;  4BDL A;  2UVJ A;  4GXS B;  4X1D A;  4OFO A;  4R9G A;  3DP6 A;  1SYI A;  2YJP A;  1B40 A;  5CMB A;  2F8D A;  2B3F A;  1P1O A;  3FVK A;  4U22 A;  3HHF A;  3ECR A;  3E3K A;  2GH9 A;  4OFJ A;  3T22 A;  3H6V A;  4G68 B;  4U1Z A;  2Y7W A;  1O63 A;  4XKR A;  1SW2 A;  3IOR A;  3HPI A;  2OJT A;  3FVN A;  2DWA A;  3O66 A;  2Y7I A;  1QJM A;  5H8H B;  4OHN A;  1YAE A;  4OQO A;  4DCY A;  1NNF A;  2XXV A;  4F2Q A;  1N7X A;  2GRV A;  5HPQ A;  1IEJ A;  3I6V A;  3E9X A;  1URD A;  2OK2 A;  2ONS A;  1MXZ A;  3IL1 B;  4Q30 B;  1H44 A;  4OEV A;  3TCF A;  1Q1K A;  5KZT A;  3O97 A;  1SW5 A;  2QS1 A;  1SW4 A;  3G3J A;  4LQ2 A;  4KD5 A;  4NWC A;  2AYS A;  4OMB A;  3S9L C;  4F2O A;  3OXN A;  3WAE A;  5FTH A;  2A5T B;  1UIV A;  4QF9 A;  4PFW A;  5K2Y A;  1MQI A;  1SI1 A;  4YB7 A;  4BDO A;  5EYF A;  4LVQ A;  3S9M C;  4L17 A;  4G68 A;  2UVG A;  3ILU B;  5ITO A;  1MQH A;  3GZG A;  3N26 A;  3TMG A;  4P0I A;  1D3K A;  1UTH A;  3TPA A;  4MLV A;  4GOT A;  2H9B A;  5CRY A;  2F5X A;  3QSL A;  3T66 A;  1HSE A;  5H8H A;  1B0H A;  4BDM A;  4RA1 A;  4DXC A;  3KOT A;  2ZYK A;  5TP9 B;  4JSD A;  1N04 A;  4JDF A;  1PBP A;  3O6I A;  3P7I A;  3IX1 A;  1LST A;  3SDF A;  1FW0 A;  3I3V A;  3RLF E;  5JK4 A;  2A5T A;  1A54 A;  1PC3 A;  3TTK A;  4YZZ A;  4DCX A;  5EHM A;  2F78 A;  4EXL A;  4KCD A;  3Q26 A;  4JWO A;  4H6D A;  2DWJ A;  3FIR A;  4R75 A;  5DYH A;  3MQ9 A;  2UYE A;  3TOD A;  1MY3 A;  3BFU A;  3DEL B;  3MZ9 A;  2XHD A;  5AA3 A;  4QHQ A;  3VXC A;  2O1L A;  4XXU A;  4RNS A;  1LAX A;  4DLD A;  1ZIU A;  4FAT A;  5L9M A;  4FAJ A;  1B46 A;  4IY5 A;  1DPE A;  5TP9 A;  3A3C A;  3LSL A;  4QFL A;  3S4U A;  5CMK A;  2XXI A;  3ZS6 A;  4G8H A;  2F7B A;  1USY H;  4P11 A;  2XD2 A;  4IGR A;  3KN3 A;  5CC2 A;  4JXI A;  4UAC A;  4KPT A;  2OCU A;  1SW1 A;  3IOT A;  5KCJ A;  2DOJ A;  1JEV A;  1ANF A;  2R6G E;  2GFE A;  2Y7K A;  1MY2 A;  1FTJ A;  4GD5 A;  5I56 B;  2ZNS A;  5L9S A;  1IZ1 A;  2RCA A;  3CSG A;  4FJP A;  5ICQ A;  4ND9 A;  3EHS A;  3TEL A;  3CR9 A;  1B05 A;  3TFL A;  4R6H A;  3KJT A;  3FVO A;  4GXA A;  1B9J A;  4G4P A;  2YLN A;  1A55 A;  3EF7 A;  3ZKL A;  2F7A A;  5H8Q B;  1IXH A;  4LP2 B;  1Q35 A;  2OZZ A;  1B1X A;  1PEB A;  2ZMB A;  2O6A A;  3RNN A;  1NH8 A;  3B7D A;  2AL4 A;  5M2V A;  1USY E;  2IEE A;  3SES A;  3TTR A;  1B3E A;  5I2K B;  2Z8D A;  3T96 B;  3A3U A;  2ONR A;  3IO4 A;  4BDQ A;  5I56 A;  1OLA A;  4F3B A;  1AL3 A;  1R9L A;  1ZU0 A;  3DLN A;  3MVY A;  2O1M A;  2XD3 A;  1YTV A;  2REJ A;  4GRK A;  2Q2A A;  1MRP A;  4U1O A;  1EZO A;  1TXF A;  1VFE A;  1R1N A;  5H8Q A;  2NOO A;  3BBR A;  5FTI A;  2V25 A;  3I5O A;  4OXV A;  3IJO B;  4Q0C A;  3Q25 A;  5AA4 A;  4AQ4 A;  2I3W A;  5ITP A;  2GHB A;  5CBR A;  5I2K A;  3MBP A;  2B65 A;  3TQL A;  1RYX A;  3PUY E;  4JWX A;  1ELJ A;  4NMY A;  3FD3 A;  1I6B A;  2VOZ A;  1QUL A;  4X48 A;  5CI5 A;  2PVU A;  3VLV A;  3UIF A;  1P99 A;  1TWY A;  1M5F A;  1B32 A;  3BKI B;  3EN3 A;  2DVZ A;  3FGS A;  3OSR A;  3TAJ A;  2D3I A;  4H65 A;  1B4Z A;  2RIN A;  5HBC A;  3BFT A;  1S50 A;  3G7W A;  4FEB A;  1PB9 A;  3W9V A;  3G3F A;  4EUO A;  3MPL A;  3TTL A;  3KFM A;  1DOT A;  1CE2 A;  3MPK A;  3TUS A;  1LAH E;  4DXB A;  4C0R A;  1JET A;  1H45 A;  1M5D A;  4OWD A;  4U4S A;  1PDA A;  3PMV A;  4OVJ A;  1SYH A;  4LZ8 A;  2NUV A;  2LAO A;  4WXJ A;  4ZEB A;  1YPN A;  3VVE A;  5A5X A;  2V3Q A;  3KGC A;  3RTW B;  3SEV A;  3H03 A;  3QUF A;  2P1S A;  1MY0 A;  2VD2 A;  1QKA A;  4YMB A;  3C35 A;  4X1B A;  1BP5 A;  1MPC A;  1OQG A;  4F39 A;  4M1V A;  2XX8 A;  1MPB A;  4PFY A;  1MY4 A;  4ZZA A;  1H76 A;  2O7U A;  1QKB A;  4G2Z A;  3S2V A;  1XHY A;  3THI A;  3N94 A;  4G77 A;  2PYY A;  1Y3P A;  3MVX A;  4IGT A;  2XXU A;  3H6U A;  5DEX B;  3TTM A;  1NNT A;  3PMX A;  3B6Q A;  3KZG A;  1WDN A;  4DE8 A;  4ELR A;  3FXR A;  1Z7M E;  4PET A;  2Q88 A;  4HTG A;  1MH4 A;  2UXA A;  2HAU A;  1A99 A;  1ATG A;  4BLA A;  4ELQ A;  3USD A;  3DP8 A;  1MQG A;  4GQO A;  2RF1 A;  4F1U A;  3U72 A;  2FYI A;  3N6T A;  1KWH A;  2UVH A;  5DTB A;  2ONK E;  5ELV A;  2V3T A;  3SKP A;  1QUJ A;  1A8E A;  1QVS A;  4QSC A;  3QK6 A;  5DEX A;  3PGF A;  5JTY B;  4ZDM A;  1A8F A;  3QUJ A;  4H5G A;  1MXX A;  4ZED A;  4M4G A;  4ZEI A;  3HN0 A;  5TPA A;  2I0B A;  3KG2 A;  4YB6 A;  4POX A;  3U92 A;  5CMC A;  4QFN A;  3QAX A;  3VXB A;  3OO9 A;  1UTH B;  5HM4 B;  1MG1 A;  1HSJ A;  1H43 A;  2H99 A;  1A7L A;  3HCQ A;  4JB7 A;  2ZYM A;  4FED A;  2H25 A;  3RPW A;  3EQ1 A;  1P1Q A;  2DVC A;  5J1D A;  3CFL A;  2HZL A;  4IO2 A;  1FQC A;  4DDD A;  4GIZ A;  1JW5 A;  1IXC A;  4WEP A;  3QIM A;  2XX9 A;  3FJ7 A;  1LCT A;  2XXT A;  5JTY A;  2RKM A;  3OEK A;  1B5H A;  3PD9 A;  5K2X A;  1B5I A;  1LBB A;  4ELP A;  4WED A;  5IKB A;  2PT2 A;  3C9H A;  1J1N A;  3C4M A;  1RKM A;  2HEU A;  4FE8 A;  5B70 A;  4EDP A;  4R2B A;  2PT1 A;  3M3K A;  2B3B A;  2HAV A;  4MLQ A;  4H67 A;  1Z7N E;  4NF4 B;  2AL5 A;  2P2A A;  4GFR A;  2DE2 A;  1FTO A;  2Q2C A;  3IB1 A;  3IOV A;  1QW0 A;  1VFD A;  4RK2 A;  1TFD A;  2ZYN A;  4YIC A;  1GV8 A;  2VP1 A;  3MP8 A;  1AMF A;  3OO6 A;  4YKI A;  4R73 A;  3E13 X;  3GBA A;  3O9P A;  1LFI A;  3OEN A;  4ONY A;  3AXF A;  4OZ9 A;  3K1P A;  3OO8 A;  5ICT A;  2WKY A;  3HO7 A;  4F1Y A;  3H6W A;  4OEN A;  1Y1M A;  5KCJ B;  1BLF A;  1OLC A;  3MWB A;  2XXY A;  4R72 A;  2QS3 A;  3DP4 A;  3TCG A;  1SD3 A;  1NNK A;  3S9E A;  4ISU A;  1PBQ A;  5CBS A;  5I2N B;  2DQV A;  1FQB A;  4H8I A;  3GLB A;  1Y1Z A;  4NF4 A;  3B6T A;  4LZ5 A;  3JYR A;  2E1S A;  4MBP A;  3S9N C;  4RPN A;  3VE1 B;  3CIJ A;  1FQD A;  3PUV E;  4NED A;  3K6V A;  1I6Q A;  1PB7 A;  4H8J A;  1MY1 A;  4Q8R A;  1B6H A;  2O7I A;  4Z7E A;  3O29 A;  4LUB A;  2XXW A;  5KDT A;  4QFO A;  1D4N A;  4O3C A;  2Z8E A;  2Y7R A;  4MH5 A;  4GF8 A;  1EZP A;  3IK6 B;  1B7U A;  5I2N A;  3KSJ A;  4XTC Q;  3KN8 A;  1S9T A;  2PX1 A;  3WAF A;  2ESN A;  1ZMG A;  3VLU A;  1YCJ A;  1XVX A;  5AA1 A;  3SEX A;  4R74 A;  1UTB B;  3U1O A;  3FAS A;  3MVZ A;  3F11 A;  3H06 B;  1MDQ A;  4LAT A;  4NF5 A;  1GTK A;  5FHN A;  3CFX A;  3CG3 A;  4N07 A;  5ISU A;  1XS5 A;  3QYT A;  2HXW A;  2PMS A;  4QFP A;  4K3F A;  4F19 A;  1OVB A;  4PFU A;  2NVU B;  1XVY A;  1D9V A;  2V93 A;  3TZA A;  4EQ9 A;  5AA4 B;  5I57 A;  1MXW A;  3GXA A;  3U93 A;  3U94 A;  3MC2 A;  2VHA A;  3PD8 A;  1FTL A;  1B51 A;  1MM7 A;  4EQB A;  3V83 A;  1IXG A;  2Z8F A;  4KYS A;  3CSB A;  4H0W A;  3IOU A;  1N3X A;  1UTB A;  4I1D A;  3FUZ A;  1JW1 A;  3IB2 A;  2PBW A;  2QPQ A;  3FXU A;  4IO4 A;  3MW0 A;  3CRB A;  3M8U A;  1H3D A;  2O68 A;  5CMM A;  3T9H B;  2Q8J A;  1VR5 A;  4YB5 A;  1D9Y A;  5DVF A;  1HSL A;  4ZE8 A;  1B3F A;  2A5S A;  3TEP A;  1DMB A;  5I59 A;  4I62 A;  3KEI A;  2OLB A;  3PPP A;  5H8N B;  4U2R A;  1M5B A;  5A5X B;  2CMO A;  2NXO A;  3ZKK A;  1IQ7 A;  3TCH A;  3M3F A;  4ELO A;  3OMB A;  4QSD A;  4F31 B;  1B0L A;  2DE3 A;  5BUU A;  2THI A;  4THI A;  4HCW A;  4ZE9 A;  3K02 A;  3VFJ A;  1EU8 A;  4KHZ E;  2QL3 A;  4PP0 A;  3PV0 E;  4EF1 A;  2DYX A;  3KN7 A;  2I4C A;  4MF3 A;  3K6W A;  4GVO A;  1ZLQ A;  3MJN A;  5I58 B;  5H8N A;  1FTM A;  3FJG A;  3C31 A;  4XKN A;  4Z0I A;  4F3G A;  1US4 A;  1B3G A;  3Q29 A;  1NMU A;  1AIV A;  2RC8 A;  3K00 A;  3PPN A;  1POY 1;  1UIU A;  3KOS A;  1N76 A;  4DXU A;  1LLS A;  3Q28 A;  3UGW A;  3L6G A;  2X26 A;  1P1N A;  1OQH A;  1B7H A;  4G8M A;  1PB8 A;  4U4X A;  4NE4 A;  4QSE A;  3QXM A;  2H5Y A;  2VD3 A;  3EPE A;  3RY3 A;  2XXH A;  2O84 X;  5H8F B;  4LON B;  2I48 A;  5IAI A;  1P1U A;  3FV1 A;  4NTL A;  3W9W A;  2I58 A;  1MM6 A;  1NFT A;  3K1N A;  1LAG E;  4KYE A;  3O28 A;  1A40 A;  3K2D A;  1B58 A;  5JEI A;  3RGY A;  3C32 A;  4GL8 A;  2X7P A;  3V5A A;  5I58 A;  2Q9T A;  4JSO A;  3PUZ E;  1JEU A;  3K6U A;  3SET A;  3LSW A;  4IO6 A;  4F3P A;  2RC7 A;  3R7X A;  1SVX B;  3U8Q A;  2F6G A;  3ODB A;  4YKK A;  3RT8 A;  4IO7 A;  2HFB A;  4RJZ A;  1FQF A;  5TPA B;  3TKD A;  1URG A;  1M5C A;  3IAZ A;  1URS A;  2R71 A;  1DTG A;  3CI8 A;  4EQ7 A;  2X7Q A;  3MZ1 A;  3IO6 A;  3CG1 A;  2Q89 A;  3R6U A;  5L9O A;  3PPR A;  5H8F A;  3Q27 A;  4FIM A;  3M3L A;  2DP8 A;  3MP6 A;  3C34 A;  3KJ7 A;  3UK4 A;  2HCA A;  3OEM A;  1B1H A;  5CM6 A;  4N13 A;  5EHS A;  2XXQ A;  1UQW A;  1II5 A;  2UVI A;  3G3G A;  2D21 A;  4GLI A;  1ZKB A;  4I9D A;  2OWT A;  3TDJ A;  2M8C A;  1QUK A;  3OOA A;  2O69 A;  4NF8 A;  1WVJ A;  4KR5 A;  2E0S A;  4AB5 A;  3RT6 B;  4H1X A;  3SER A;  3ILT B;  3EHU A;  5I84 A;  4MFI A;  1LCF A;  2OWS A;  5L8D A;  2DS9 A;  4BDN A;  2O51 A;  3R26 A;  2H98 A;  3G3H A;  3FAT A;  4TOZ A;  4U23 A;  1S7Y A;  1N3W A;  2ZXT A;  2XXX A;  1ZBM A;  4OTE A;  3IJX B;  1SDX A;  3T9X B;  1GGG A;  3VV5 A;  4PFT A;  1B4H A;  4Q5T A;  3PMW A;  1POT A;  1F9B A;  3IR1 A;  4OEU A;  1MH3 A;  3RQT A;  3A09 A;  5DT6 A;  1L5T A;  4IB2 A;  2CZL A;  1P1W A;  4RYA A;  4ESW A;  4YKJ A;  1WOD A;  2QS4 A;  3H3G A;  4LZ7 A;  1BKA A;  3UOR A;  4YMA A;  4RK9 A;  2V84 A;  2FA7 A;  3C33 A;  4OES A;  3D4C A;  4HW8 A;  3JZJ A;  2I3V A;  4OYV A;  4FEC A;  1Y20 A;  3KBR A;  1IXI A;  1QUI A;  1LFH A;  4ZEK A;  1Y4T A;  3L6H A;  2P0S A;  1T0K A;  3K0V A;  1Y4C A;  2IA4 A;  3SEW A;  1VE4 A;  4C1U A;  4R6K A;  5KDT B;  4WKM A;  1AH5 A;  1FTK A;  3HV1 A;  2FNC A;  4YU0 A;  4TLM B;  1ZJL A;  1NL5 A;  1B3H A;  4XKQ A;  5DVJ A;  4TQU Q;  4IO5 A;  3T9U A;  1LBC A;  4E0W A;  3OEL A;  2HQ0 A;  3VLW A;  1LB8 A;  3MVW A;  4EF2 A;  5B7D A;  2OBG A;  4KYD A;  2QS2 A;  3FXQ A;  3SEU A;  3G3K A;  2R9J A;  3K01 A;  1JW4 A;  4NF5 B;  4R9F A;  3MAM A;  4POW A;  4NF6 B;  4OET A;  3TTN A;  4F18 A;  1B5J A;  3MZB A;  2DSF A;  4LA9 A;  3SEY A;  4ESX A;  3PUX E;  4E0X A;  3C36 A;  4KI0 E;  3O6H A;  5I57 B;  4F3S A;  4NWD A;  4C1T A;  3FVG A;  3VDF A;  3H7M A;  4OER A;  3FZV A;  1NH7 A;  1MDP 1;  4IO3 A;  4QFK A;  2I6E A;  2VGQ A;  1EZ9 A;  4JWY A;  1MXU A;  1DTZ A;  2W7Y A;  1CB6 A;  1IUD A;  1OVT A;  4KFQ A;  4F1V A;  1GVC A;  4G8N A;  1LGB C;  3LUY A;  2Z23 A;  3LSF B;  4ZZE A;  1EH3 A;  5FHO A;  1B3L A;  3HST A;  4NF6 A;  2ABH A;  4O3A A;  3OO7 A;  4BDR A;  4F22 A;  3H6T A;  1I69 A;  3T93 B;  4QRZ A;  4ECF A;  3N5L A;  5I59 B;  1MQJ A;  4I8C A;  1RYO A;  1LB9 A;  3FV2 A;  3JV9 A;  3IOW A;  1O7T A;  3W15 C;  2DXY A;  1DSN A;  2ALU A;  5AA2 D;  1JVY A;  1N7W A;  1XOC A;  4O3B A;  4UA8 A;  4YAH X;  4RPO A;  2DWI A;  2XXP A;  4FOR A;  4YKP A;  1TFA A;  3HHG A;  1SQY A;  3LR1 A;  1OIB A;  1O64 A;  3TQW A;  4KQP A;  2I49 A;  4R2F A;  2ZNU A;  3PPQ A;  5AA2 B;  2UYF A;  4GWO A;  3E4R A;  1IIW A;  1LAF E;  3LSX A;  4R6Y A;  4ZS9 A;  3VVF A;  1TT1 A;  2V3U A;  2ZNT A;  1US5 A;  1N84 A;  3ZSF A;  4PQJ A;  3PPO A;  2F35 A;  2QRY A;  3UA8 A;  1MXV A;  3RTF B;  1FQE A;  1R9Q A;  2KLF A;  2F34 A;  2G93 A;  5AE4 A;  1SBP A;  3N6U A;  4JBZ A;  4HCY A;  2I0C A;  4U21 A;  2RCB A;  2D5W A;  2H4I A;  3RUM A;  3KSX A;  2G29 A;  4LQ5 A;  1Y3Q A;  4ZEC A;  1B7Z A;  3LC8 A;  4H5F A;  2F6P A;  3O6G A;  3UP9 A;  1AOV A;  3RN8 A;  2F97 A;  1JNF A;  5AA2 A;  4OFL A;  2BJJ X;  1BTJ A;  3FJM A;  3GBB A;  4HS7 A;  3OSQ A;  4XIG Q;  2DWH A;  5H8S A;  4N6P A;  3IB0 A;  4TLL B;  1NKX A;  4XKP A;  1VSO A;  1XT8 A;  3V8X B;  1Y9U A;  4GL0 A;  4PE5 B;  4DZ1 A;  3V89 B;  1IIT A;  4EXK A;  2QSX A;  4IY6 A;  1N0T A;  3MUQ A;  1OMP A;  1R6Z A;  3H4Z A;  3G3I A;  2XX7 A;  1DPP A;  1ZTY A;  1FQA A;  3CVG A;  4F29 A;  1BIY A;  1B2H A;  3D4G A;  2QJE A;  3OD7 A;  2QMX A;  1MQD A;  2F7C A;  1SI0 A;  2DE4 A;  4RXL A;  1B52 A;  3O2A A;  2I4B A;  5FHM A;  3K6X A;  3ONM A;  1I6A A;  1NNP A;  1JVX A;  3K1M A;  2XXR A;  4AB6 A;  4DIG A;  4P0G A;  4KCC A;  3UN6 A;  2YPN A;  3EHT A;  2Y7P A;  1M5E A;  2GHA A;  2Y84 A;  3CFZ A;  3MP1 A;  3TYH A;  4NF8 B;  4ZEF A;  2ANJ A;  1XC1 A;  1MS7 A;  2RC9 A;  1JQF A;  3LBS A;  3VVD A;  2F36 A;  4G68 C;  2AIX A;  2NWJ A;  3K4U A;  4X9T A;  1LFG A;  5TU0 A;  2HZK A;  1Y3N A;  1MXY A;  2REG A;  3PUW E;  3PU5 A;  5DVI A;  1GR2 A;  1FCK A;  5BWJ A; 
#chains in the Genus database with same CATH topology
 4RY1 A;  2DXR A;  3CHG A;  3B6W A;  5LOM A;  5F7V A;  5F1Q A;  5T3J A;  1MPD A;  2ZYO A;  3T9V A;  2WX9 A;  3DM0 A;  2Z22 A;  2QMW A;  2VPO A;  4BDL A;  4NX1 A;  2UVJ A;  4GXS B;  4X1D A;  4OFO A;  4R9G A;  3RYD A;  3DP6 A;  2FIX A;  1SYI A;  2YJP A;  1LBW A;  1B40 A;  5CMB A;  2F8D A;  4JVD A;  4OVT A;  4PCD A;  2B3F A;  1P1O A;  3FVK A;  4U22 A;  3HHF A;  3ECR A;  3E3K A;  2GH9 A;  4OFJ A;  3T22 A;  4X04 A;  4PAF A;  3H6V A;  4G68 B;  4U1Z A;  2Y7W A;  1O63 A;  4XKR A;  2R8T A;  1SW2 A;  4MMP A;  1NV6 A;  4GWZ A;  2OX3 A;  3IOR A;  3HPI A;  4I3E A;  3HFU A;  2OJT A;  3FVN A;  5IGA A;  2DWA A;  3O66 A;  2Y7I A;  1QJM A;  5H8H B;  3MYU A;  4OHN A;  1YAE A;  4OQO A;  4DCY A;  1NNF A;  2XXV A;  4F2Q A;  1N7X A;  2GRV A;  5HPQ A;  1IEJ A;  3I6V A;  3E9X A;  1URD A;  2OK2 A;  2ONS A;  1MXZ A;  3IL1 B;  4Q30 B;  1H44 A;  4OEV A;  3TCF A;  2GQ1 A;  1Q1K A;  5KZT A;  3O97 A;  1SW5 A;  2QS1 A;  1SW4 A;  3G3J A;  4LQ2 A;  4KD5 A;  4NWC A;  5J16 A;  2AYS A;  4OMB A;  3S9L C;  4F2O A;  3OXN A;  3WAE A;  5FTH A;  2A5T B;  1UIV A;  4QF9 A;  4PFW A;  5K2Y A;  1MQI A;  1SI1 A;  1NI9 A;  4YB7 A;  4BDO A;  5EYF A;  4LVQ A;  3S9M C;  4L17 A;  4G68 A;  2UVG A;  3ILU B;  5ITO A;  1MQH A;  3GZG A;  3N26 A;  3E79 A;  3TMG A;  4P0I A;  1D3K A;  1UTH A;  3TPA A;  1FPB A;  4MLV A;  4GOT A;  2H9B A;  5CRY A;  2F5X A;  3QSL A;  3T66 A;  1HSE A;  3B8B A;  5H8H A;  1B0H A;  3A29 A;  4BDM A;  4RA1 A;  1K9Y A;  4DXC A;  3KOT A;  1FPJ A;  2ZZX A;  2ZYK A;  5TP9 B;  4JSD A;  4N8Y A;  1N04 A;  1RDX A;  4JDF A;  1PBP A;  3O6I A;  3P7I A;  3IX1 A;  1LST A;  3SDF A;  1FW0 A;  3I3V A;  3RLF E;  5JK4 A;  2A5T A;  4MNP A;  1A54 A;  1PC3 A;  3TTK A;  4YZZ A;  4DCX A;  5EHM A;  2F78 A;  4EXL A;  4KCD A;  3U65 A;  1EYJ A;  3LV0 A;  3Q26 A;  5EQ8 A;  4JWO A;  1KA1 A;  4H6D A;  4N8G A;  2DWJ A;  3FIR A;  1FPD A;  4R75 A;  4P9K A;  5DYH A;  3MQ9 A;  4DI4 B;  1G0H A;  5A5L A;  2UYE A;  3TOD A;  1MY3 A;  3BFU A;  3DEL B;  3MZ9 A;  2XHD A;  5AA3 A;  4QHQ A;  4NHB A;  3VXC A;  2O1L A;  4XXU A;  4RNS A;  1LAX A;  4NQ8 A;  4DLD A;  1ZIU A;  4FAT A;  3QMF A;  5L9M A;  4FAJ A;  1B46 A;  4IY5 A;  1DPE A;  1DBZ A;  3A3C A;  5TP9 A;  3LSL A;  4QFL A;  3S4U A;  5CMK A;  2XXI A;  3ZS6 A;  1LBX A;  4G8H A;  4MAG A;  2F7B A;  4PF8 A;  1USY H;  4P11 A;  4O94 A;  4OVS A;  2XD2 A;  1FBD A;  3KN3 A;  4IGR A;  5CC2 A;  4JXI A;  4UAC A;  2VPN A;  4KPT A;  2OCU A;  1SW1 A;  3IOT A;  4HE0 A;  5KCJ A;  2DOJ A;  4MX6 A;  1K9Z A;  1JEV A;  1ANF A;  2R6G E;  2GFE A;  2Y7K A;  1MY2 A;  1FTJ A;  1YZ0 A;  4GD5 A;  5I56 B;  2ZNS A;  5L9S A;  1IZ1 A;  4NGU A;  2RCA A;  4GWS A;  3CSG A;  4FJP A;  5ICQ A;  4ND9 A;  3EHS A;  3TEL A;  2QVR A;  3CR9 A;  1B05 A;  3TFL A;  4R6H A;  3KJT A;  3FVO A;  4GXA A;  1B9J A;  4G4P A;  2YLN A;  4H45 A;  5FBP A;  1A55 A;  3EF7 A;  3ZKL A;  2F7A A;  5H8Q B;  1IXH A;  1NUY A;  4LP2 B;  1Q35 A;  2OZZ A;  1B1X A;  1PEB A;  2ZMB A;  2O6A A;  3RNN A;  1NH8 A;  3B7D A;  2AL4 A;  5M2V A;  1USY E;  2IEE A;  3SES A;  3TTR A;  1B3E A;  4GWU A;  2Q74 A;  5I2K B;  2Z8D A;  3T96 B;  3FBP A;  4PDD A;  3A3U A;  2ONR A;  4O7M A;  3IO4 A;  4BDQ A;  5I56 A;  1OLA A;  4F3B A;  1AL3 A;  1R9L A;  1ZU0 A;  5ESY A;  3DLN A;  3MVY A;  2O1M A;  2XD3 A;  1YTV A;  2REJ A;  4GRK A;  1RDY A;  2Q2A A;  1MRP A;  4U1O A;  1EZO A;  1KZ8 A;  1TXF A;  1VFE A;  1DCU A;  1R1N A;  5H8Q A;  1FBP A;  2NOO A;  3BBR A;  5FTI A;  2V25 A;  2F3B A;  3I5O A;  4OXV A;  3IJO B;  4Q0C A;  1LBY A;  4PE3 A;  3Q25 A;  5AA4 A;  5IM2 A;  4AQ4 A;  2I3W A;  5ITP A;  2GHB A;  5CBR A;  5I2K A;  3MBP A;  2B65 A;  3TQL A;  1RYX A;  4GBW A;  3PUY E;  4JWX A;  1ELJ A;  4NMY A;  4HE2 A;  4OVQ A;  3FD3 A;  1I6B A;  2VOZ A;  1QUL A;  4X48 A;  5CI5 A;  2PVU A;  3VLV A;  3UIF A;  1P99 A;  1TWY A;  1M5F A;  1B32 A;  4PF6 A;  3BKI B;  3EN3 A;  2DVZ A;  3FGS A;  3OSR A;  3TAJ A;  1NV1 A;  2D3I A;  4H65 A;  2WBD A;  1B4Z A;  2RIN A;  5HBC A;  3BFT A;  1S50 A;  3G7W A;  4FEB A;  1PB9 A;  4NG7 A;  3W9V A;  3G3F A;  4EUO A;  3MPL A;  1NV4 A;  3TTL A;  3KFM A;  1DOT A;  4LN5 A;  1CE2 A;  3MPK A;  3TUS A;  1LAH E;  4DXB A;  4C0R A;  1JET A;  5EYG A;  1H45 A;  1M5D A;  4OWD A;  4U4S A;  1PDA A;  3PMV A;  5I7I A;  4OVJ A;  1SYH A;  4LZ8 A;  2NUV A;  2LAO A;  4WXJ A;  4ZEB A;  1IMA A;  1YPN A;  3VVE A;  4N81 A;  1LEV A;  5A5X A;  2V3Q A;  3KGC A;  3RTW B;  3SEV A;  3H03 A;  4OVR A;  2JJK A;  3QUF A;  2P1S A;  1MY0 A;  2XWK A;  2VD2 A;  2KR0 A;  1QKA A;  2DDK A;  4YMB A;  3C35 A;  4GWX A;  4N91 A;  4X1B A;  1BP5 A;  1FTA A;  1MPC A;  1OQG A;  2VT5 A;  4F39 A;  4M1V A;  2XX8 A;  1MPB A;  4PFY A;  1MY4 A;  4ZZA A;  1H76 A;  4GX6 A;  4PAI A;  2O7U A;  4KXP A;  1QKB A;  4G2Z A;  3S2V A;  1XHY A;  3THI A;  1G0I A;  3N94 A;  4G77 A;  2PYY A;  1Y3P A;  3MVX A;  4IGT A;  2XXU A;  3H6U A;  5DEX B;  3TTM A;  1EYK A;  1NNT A;  1FBF A;  3PMX A;  3B6Q A;  3KZG A;  4MJO A;  1WDN A;  3LUZ A;  4DE8 A;  4ELR A;  3IFC A;  3FXR A;  1Z7M E;  4PET A;  2Q88 A;  4HTG A;  1MH4 A;  4XFE A;  2UXA A;  2HAU A;  1A99 A;  2FVZ A;  1ATG A;  4BLA A;  4ELQ A;  3USD A;  3DP8 A;  1MQG A;  3T0J A;  4GQO A;  5EYH A;  2RF1 A;  4F1U A;  3U72 A;  2FYI A;  3N6T A;  1KWH A;  2UVH A;  5DTB A;  2ONK E;  4P56 A;  5ELV A;  2XWV A;  2V3T A;  1FPF A;  1NV3 A;  3SKP A;  1QUJ A;  1A8E A;  4OA4 A;  1QVS A;  1FPL A;  4GBV A;  4PFR A;  4QSC A;  3QK6 A;  5DEX A;  3PGF A;  1NV2 A;  5JTY B;  4ZDM A;  1A8F A;  3QUJ A;  3PTY A;  4H5G A;  1MXX A;  4P47 A;  3BIH A;  4ZED A;  4M4G A;  4ZEI A;  3HN0 A;  5TPA A;  2I0B A;  3KG2 A;  4YB6 A;  4POX A;  3U92 A;  5CMC A;  4QFN A;  3QAX A;  3VXB A;  4X8R A;  3SZP A;  3OO9 A;  1FRP A;  1UTH B;  5HM4 B;  1MG1 A;  1HSJ A;  1H43 A;  2H99 A;  1A7L A;  3HCQ A;  4JB7 A;  2ZYM A;  4FED A;  2H25 A;  3RPW A;  3EQ1 A;  1P1Q A;  2DVC A;  5J1D A;  3CFL A;  2HZL A;  4IO2 A;  1FQC A;  4DDD A;  4GIZ A;  1JW5 A;  1IXC A;  4WEP A;  3QIM A;  2XX9 A;  1IMD A;  3FJ7 A;  1LCT A;  2XXT A;  5JTY A;  2RKM A;  3OEK A;  1B5H A;  3PD9 A;  4PGN A;  5ET6 A;  1B5I A;  5K2X A;  1LBB A;  1VDW A;  4ELP A;  4WED A;  2FBP A;  5IKB A;  2PT2 A;  3C9H A;  1J1N A;  3C4M A;  1RKM A;  2HEU A;  4FE8 A;  1NV5 A;  5B70 A;  2WYP A;  4EDP A;  4R2B A;  2PT1 A;  3M3K A;  2B3B A;  2HAV A;  4MLQ A;  4H67 A;  1Z7N E;  4NF4 B;  2AL5 A;  2P2A A;  4GFR A;  2DE2 A;  1FTO A;  4PC9 A;  2Q2C A;  3IB1 A;  3IOV A;  4MEV A;  1QW0 A;  1VFD A;  4RK2 A;  3KBZ A;  1TFD A;  2ZYN A;  3KC1 A;  4YIC A;  1GV8 A;  1FPG A;  2VP1 A;  3MP8 A;  1AMF A;  3OO6 A;  4YKI A;  4R73 A;  3E13 X;  3GBA A;  3O9P A;  1LFI A;  3OEN A;  4ONY A;  3AXF A;  4OZ9 A;  1XI6 A;  5IZZ A;  1INP A;  3K1P A;  3OO8 A;  5ICT A;  2WKY A;  3HO7 A;  4F1Y A;  3H6W A;  4OEN A;  2Y5K A;  1Y1M A;  3B50 A;  5KCJ B;  1BLF A;  1OLC A;  3MWB A;  2XXY A;  4R72 A;  2QS3 A;  3DP4 A;  3TCG A;  1SD3 A;  1NNK A;  3S9E A;  4ISU A;  1PBQ A;  5CBS A;  2CZK A;  5I2N B;  4MIJ A;  2PCR A;  2DQV A;  1FQB A;  4H8I A;  3GLB A;  1Y1Z A;  4NF4 A;  3B6T A;  4LZ5 A;  3JYR A;  1LBV A;  2E1S A;  4MBP A;  3S9N C;  4RPN A;  3VE1 B;  3CIJ A;  1FQD A;  2PFZ A;  3PUV E;  4NED A;  4JVI A;  3K6V A;  1I6Q A;  1PB7 A;  4H8J A;  3FXB A;  1MY1 A;  4Q8R A;  1B6H A;  2O7I A;  4Z7E A;  3O29 A;  4LUB A;  2XXW A;  5KDT A;  4P1E A;  1IMC A;  4OVP A;  4QFO A;  1D4N A;  4O3C A;  2Z8E A;  2Y7R A;  4MH5 A;  1FPK A;  4GF8 A;  1EZP A;  2HPG A;  1KA0 A;  3IK6 B;  1B7U A;  5I2N A;  3KSJ A;  4XTC Q;  2MKZ A;  3KN8 A;  1S9T A;  2PX1 A;  4MHF A;  3WAF A;  2ESN A;  4PDH A;  1ZMG A;  3VLU A;  1YCJ A;  1XVX A;  5AA1 A;  3SEX A;  4R74 A;  1UTB B;  3U1O A;  3FAS A;  3MVZ A;  3F11 A;  3H06 B;  1MDQ A;  4LAT A;  4NF5 A;  1GTK A;  5FHN A;  3CFX A;  3CG3 A;  4N07 A;  1FPI A;  5ISU A;  1XS5 A;  3QYT A;  4XF5 A;  2HXW A;  2PMS A;  4QFP A;  2B4L A;  1NV7 A;  4K3F A;  4F19 A;  2ZZW A;  1OVB A;  4PFU A;  2NVU B;  1XVY A;  1D9V A;  5IZ1 A;  2V93 A;  2Q8M A;  3TZA A;  4EQ9 A;  5AA4 B;  5I57 A;  1MXW A;  3GXA A;  3U93 A;  3U94 A;  3MC2 A;  3T1B A;  2VHA A;  3PD8 A;  1FTL A;  1B51 A;  3NOH A;  1MM7 A;  4EQB A;  3V83 A;  1IXG A;  2Z8F A;  3GYY A;  4KYS A;  3CSB A;  4H0W A;  3IOU A;  1N3X A;  1UTB A;  4I1D A;  3FUZ A;  1JW1 A;  3IB2 A;  2PBW A;  2QPQ A;  3FXU A;  4IO4 A;  3MW0 A;  3CRB A;  3M8U A;  1H3D A;  5IZ3 A;  2O68 A;  2B4M A;  5CMM A;  3T9H B;  2Q8J A;  3E78 A;  1VR5 A;  4YB5 A;  1D9Y A;  5LTC A;  3ROJ A;  1NUW A;  5DVF A;  1HSL A;  4ZE8 A;  1B3F A;  2A5S A;  3TEP A;  1DMB A;  5I59 A;  4I62 A;  3KEI A;  2OLB A;  3PPP A;  5H8N B;  4U2R A;  4GX4 A;  1M5B A;  5A5X B;  2CEY A;  2CMO A;  2NXO A;  3ZKK A;  1IQ7 A;  3TCH A;  3M3F A;  4IR8 A;  2L5V A;  3OMB A;  4ELO A;  4QSD A;  2F3D A;  1SPI A;  4F31 B;  1B0L A;  2DE3 A;  5BUU A;  2THI A;  4THI A;  4HCW A;  4ZE9 A;  3K02 A;  3VFJ A;  1EU8 A;  4KHZ E;  2QL3 A;  4PP0 A;  3PV0 E;  4EF1 A;  2DYX A;  3KN7 A;  2I4C A;  4MF3 A;  3K6W A;  4GVO A;  1ZLQ A;  1IME A;  3MJN A;  5I58 B;  5F24 A;  1FTM A;  5H8N A;  3FJG A;  3C31 A;  4XKN A;  4DI3 D;  4Z0I A;  4F3G A;  1US4 A;  1B3G A;  3Q29 A;  1NMU A;  1AIV A;  2RC8 A;  3K00 A;  3PPN A;  1POY 1;  1UIU A;  3KOS A;  2P3V A;  1N76 A;  4DXU A;  1LLS A;  3Q28 A;  3UGW A;  3L6G A;  2X26 A;  1P1N A;  1OQH A;  1B7H A;  4G8M A;  1FPE A;  1PB8 A;  4U4X A;  4NE4 A;  4QSE A;  1Q9D A;  3QXM A;  2H5Y A;  2VD3 A;  3EPE A;  3RY3 A;  2XXH A;  2O84 X;  5H8F B;  4LON B;  2I48 A;  2FHY A;  5IAI A;  4H46 A;  1P1U A;  3FV1 A;  4NTL A;  3W9W A;  2I58 A;  4NN3 A;  1YYZ A;  1MM6 A;  1NFT A;  3K1N A;  1LAG E;  4KYE A;  3BIG A;  1YXI A;  3O28 A;  1A40 A;  3K2D A;  1B58 A;  5JEI A;  3RGY A;  3C32 A;  4GL8 A;  2X7P A;  3V5A A;  5I58 A;  2Q9T A;  4JSO A;  3PUZ E;  1JEU A;  3K6U A;  3SET A;  3LSW A;  4IO6 A;  4F3P A;  2RC7 A;  3R7X A;  1SVX B;  3U8Q A;  2F6G A;  3ODB A;  4YKK A;  3RT8 A;  4IO7 A;  2HFB A;  4RJZ A;  1FQF A;  5TPA B;  3TKD A;  1URG A;  1M5C A;  1IMF A;  3IAZ A;  1URS A;  2R71 A;  1DTG A;  3CI8 A;  4EQ7 A;  4PGP A;  2X7Q A;  3MZ1 A;  3IO6 A;  4HE1 A;  3CG1 A;  2Q89 A;  3R6U A;  5L9O A;  3PPR A;  5H8F A;  3Q27 A;  4FIM A;  1FBH A;  3M3L A;  2DP8 A;  3MP6 A;  3C34 A;  3KJ7 A;  3UK4 A;  2HCA A;  3OEM A;  1B1H A;  5CM6 A;  1CNQ A;  4N13 A;  5EHS A;  2XXQ A;  1UQW A;  1II5 A;  2UVI A;  3G3G A;  2D21 A;  4GLI A;  1ZKB A;  4I9D A;  2OWT A;  3TDJ A;  2M8C A;  1QUK A;  3OOA A;  2O69 A;  4NF8 A;  1WVJ A;  4KR5 A;  2E0S A;  4AB5 A;  3RT6 B;  4H1X A;  3SER A;  1JP4 A;  3ILT B;  3EHU A;  5I84 A;  4I3Y A;  4MFI A;  1LCF A;  2OWS A;  5L8D A;  2DS9 A;  4BDN A;  2O51 A;  5EQ9 A;  1IMB A;  3R26 A;  2H98 A;  3G3H A;  3FAT A;  4TOZ A;  4U23 A;  1S7Y A;  1N3W A;  2ZXT A;  2XXX A;  1ZBM A;  4OTE A;  4GWW A;  3IJX B;  1SDX A;  3T9X B;  1GGG A;  3VV5 A;  4PFT A;  1B4H A;  4MCO A;  4Q5T A;  3PMW A;  4PFI A;  1POT A;  1F9B A;  3IR1 A;  4OEU A;  2KQZ A;  1MH3 A;  4UAB A;  3RQT A;  3A09 A;  5DT6 A;  1L5T A;  4IB2 A;  2CZL A;  1P1W A;  4RYA A;  4ESW A;  4YKJ A;  1WOD A;  2QS4 A;  3H3G A;  4LZ7 A;  1BKA A;  3UOR A;  4YMA A;  4RK9 A;  4N15 A;  2V84 A;  2FA7 A;  3C33 A;  4OES A;  3D4C A;  4HW8 A;  3JZJ A;  2I3V A;  4MNI A;  4N17 A;  4OYV A;  4FEC A;  1Y20 A;  3KBR A;  2WBB A;  1IXI A;  1QUI A;  1LFH A;  3D1R A;  4ZEK A;  1Y4T A;  3L6H A;  2P0S A;  4GWY A;  1T0K A;  3K0V A;  1Y4C A;  2IA4 A;  3SEW A;  1VE4 A;  4C1U A;  4R6K A;  5KDT B;  5ET8 A;  2OWZ A;  4WKM A;  1AH5 A;  1FTK A;  3HV1 A;  1NV0 A;  2FNC A;  1LBZ A;  4YU0 A;  4TLM B;  1ZJL A;  1NL5 A;  1B3H A;  4XKQ A;  5DVJ A;  4TQU Q;  4IO5 A;  3T9U A;  1LBC A;  2XXK A;  4E0W A;  3OEL A;  4QBA A;  2HQ0 A;  3VLW A;  1LB8 A;  3MVW A;  4EF2 A;  5B7D A;  2OBG A;  4KYD A;  2QS2 A;  3FXQ A;  3SEU A;  3G3K A;  4P8B A;  2R9J A;  3K01 A;  3MST A;  1JW4 A;  4PBH A;  4NF5 B;  4R9F A;  3KC0 A;  5EQ7 A;  3MAM A;  4POW A;  4NF6 B;  4OET A;  3TTN A;  4F18 A;  1B5J A;  3MZB A;  2DSF A;  4LA9 A;  3SEY A;  4ESX A;  2CEX A;  3PUX E;  4E0X A;  3C36 A;  4KI0 E;  3O6H A;  5I57 B;  4F3S A;  2XWO A;  4NWD A;  4C1T A;  3FVG A;  5EQA A;  3VDF A;  3H7M A;  4OER A;  3FZV A;  1D9Q A;  1NH7 A;  4AS4 A;  1MDP 1;  4IO3 A;  4N4U A;  4QFK A;  1EYI A;  2I6E A;  2VGQ A;  1EZ9 A;  4JWY A;  1MXU A;  5ET5 A;  1DTZ A;  2W7Y A;  1CB6 A;  2QVU A;  1IUD A;  1OVT A;  4KFQ A;  4F1V A;  1GVC A;  4G8N A;  1LGB C;  4O8M A;  3LUY A;  2Z23 A;  3LSF B;  1QGX A;  4ZZE A;  1EH3 A;  5FHO A;  4PTK A;  2CZH A;  5IZ3 B;  1B3L A;  3HST A;  4NF6 A;  4GX3 A;  2ABH A;  2XWI A;  4O3A A;  3OO7 A;  4BDR A;  4F22 A;  3H6T A;  1I69 A;  3T93 B;  4QRZ A;  4ECF A;  3N5L A;  5I59 B;  1MQJ A;  4I8C A;  1RYO A;  1LB9 A;  2HHM A;  3FV2 A;  3JV9 A;  3IOW A;  1O7T A;  3W15 C;  2DXY A;  1DSN A;  2ALU A;  5AA2 D;  1JVY A;  1N7W A;  1XOC A;  4O3B A;  4UA8 A;  4YAH X;  4RPO A;  2DWI A;  2XXP A;  4FOR A;  4YKP A;  2WEF A;  2FIE A;  1TFA A;  3HHG A;  2CZI A;  1SQY A;  3LR1 A;  1OIB A;  1O64 A;  3TQW A;  4KQP A;  1NUX A;  4P3L A;  2I49 A;  4R2F A;  2ZNU A;  2V4C A;  4XEQ A;  4N6D A;  3PPQ A;  5AA2 B;  2UYF A;  4GWO A;  3E4R A;  1IIW A;  1LAF E;  3LSX A;  4R6Y A;  4ZS9 A;  3VVF A;  1TT1 A;  2V3U A;  2ZNT A;  1US5 A;  1N84 A;  3ZSF A;  4PQJ A;  3PPO A;  2F35 A;  2QRY A;  3UA8 A;  1MXV A;  3RTF B;  1FQE A;  1R9Q A;  2KLF A;  4N6K A;  1AWB A;  1FSA A;  2F34 A;  2G93 A;  5AE4 A;  1SBP A;  3N6U A;  2ZZV A;  4JBZ A;  4HCY A;  2I0C A;  4NF0 A;  4U21 A;  4AS5 A;  2RCB A;  2D5W A;  2H4I A;  1FBE A;  3RUM A;  3KSX A;  2G29 A;  5ET7 A;  4LQ5 A;  1Y3Q A;  4OAN A;  4ZEC A;  1B7Z A;  3LC8 A;  4H5F A;  2F6P A;  3O6G A;  3UP9 A;  1AOV A;  2F97 A;  3RN8 A;  1JNF A;  5AA2 A;  4G61 A;  4OFL A;  2BJJ X;  1BTJ A;  3FJM A;  3GBB A;  4HXV A;  4HS7 A;  3OSQ A;  4XIG Q;  2DWH A;  5H8S A;  4N6P A;  3IB0 A;  2P3N A;  4TLL B;  1BK4 A;  1NKX A;  4XKP A;  1VSO A;  1XT8 A;  3RPL B;  3V8X B;  1Y9U A;  4GL0 A;  4PE5 B;  4DZ1 A;  3V89 B;  1IIT A;  4EXK A;  2QSX A;  4IY6 A;  1N0T A;  3MUQ A;  1OMP A;  1R6Z A;  3H4Z A;  3ISP A;  3G3I A;  2XX7 A;  1DPP A;  1ZTY A;  1FJ9 A;  2Y5L A;  1FQA A;  3CVG A;  4PAK A;  4P1L A;  4F29 A;  1BIY A;  1B2H A;  3D4G A;  1FBC A;  2QJE A;  3OD7 A;  2QMX A;  1MQD A;  2F7C A;  1SI0 A;  2DE4 A;  4RXL A;  4QXD A;  1B52 A;  3O2A A;  5LDZ A;  2I4B A;  5FHM A;  1NUZ A;  3K6X A;  3ONM A;  4I40 A;  1I6A A;  5I5P A;  1NNP A;  5DW8 A;  1JVX A;  3K1M A;  2XXR A;  4AB6 A;  4MNC A;  4DIG A;  4P0G A;  4KCC A;  4PBQ A;  3UN6 A;  2YPN A;  1FJ6 A;  3EHT A;  3RPL A;  2Y7P A;  1M5E A;  2WYK A;  2GHA A;  4FBP A;  2Y84 A;  4PFB A;  3CFZ A;  3MP1 A;  3TYH A;  2QVV A;  4NF8 B;  4ZEF A;  2ANJ A;  1RDZ A;  1XC1 A;  1MS7 A;  1FBG A;  4NAP A;  2RC9 A;  1JQF A;  1DK4 A;  3LBS A;  3VVD A;  2F36 A;  4G68 C;  2AIX A;  2NWJ A;  3IFA A;  3EKI A;  2BJI A;  3K4U A;  4X9T A;  1LFG A;  2XA5 A;  5TU0 A;  5I3S A;  2HZK A;  4O7I A;  1Y3N A;  1MXY A;  4JVC A;  2REG A;  2PFY A;  3PUW E;  2HXR A;  3PU5 A;  5DVI A;  1GR2 A;  1FCK A;  2QFL A;  5BWJ A; 
#chains in the Genus database with same CATH homology
 4RY1 A;  2DXR A;  3B6W A;  5LOM A;  5F7V A;  5F1Q A;  1MPD A;  2ZYO A;  3T9V A;  3DM0 A;  2Z22 A;  2QMW A;  4BDL A;  2UVJ A;  4GXS B;  4X1D A;  4OFO A;  4R9G A;  3DP6 A;  1SYI A;  2YJP A;  1B40 A;  5CMB A;  2F8D A;  2B3F A;  1P1O A;  3FVK A;  4U22 A;  3HHF A;  3ECR A;  3E3K A;  2GH9 A;  4OFJ A;  3T22 A;  3H6V A;  4G68 B;  4U1Z A;  2Y7W A;  1O63 A;  4XKR A;  1SW2 A;  3IOR A;  3HPI A;  2OJT A;  3FVN A;  2DWA A;  3O66 A;  2Y7I A;  1QJM A;  5H8H B;  4OHN A;  1YAE A;  4OQO A;  4DCY A;  1NNF A;  2XXV A;  4F2Q A;  1N7X A;  2GRV A;  5HPQ A;  1IEJ A;  3I6V A;  3E9X A;  1URD A;  2OK2 A;  2ONS A;  1MXZ A;  3IL1 B;  4Q30 B;  1H44 A;  4OEV A;  3TCF A;  1Q1K A;  5KZT A;  3O97 A;  1SW5 A;  2QS1 A;  1SW4 A;  3G3J A;  4LQ2 A;  4KD5 A;  4NWC A;  2AYS A;  4OMB A;  3S9L C;  4F2O A;  3OXN A;  3WAE A;  5FTH A;  2A5T B;  1UIV A;  4QF9 A;  4PFW A;  5K2Y A;  1MQI A;  1SI1 A;  4YB7 A;  4BDO A;  5EYF A;  4LVQ A;  3S9M C;  4L17 A;  4G68 A;  2UVG A;  3ILU B;  5ITO A;  1MQH A;  3GZG A;  3N26 A;  3TMG A;  4P0I A;  1D3K A;  1UTH A;  3TPA A;  4MLV A;  4GOT A;  2H9B A;  5CRY A;  2F5X A;  3QSL A;  3T66 A;  1HSE A;  5H8H A;  1B0H A;  4BDM A;  4RA1 A;  4DXC A;  3KOT A;  2ZYK A;  5TP9 B;  4JSD A;  1N04 A;  4JDF A;  1PBP A;  3O6I A;  3P7I A;  3IX1 A;  1LST A;  3SDF A;  1FW0 A;  3I3V A;  3RLF E;  5JK4 A;  2A5T A;  1A54 A;  1PC3 A;  3TTK A;  4YZZ A;  4DCX A;  5EHM A;  2F78 A;  4EXL A;  4KCD A;  3Q26 A;  4JWO A;  4H6D A;  2DWJ A;  3FIR A;  4R75 A;  5DYH A;  3MQ9 A;  2UYE A;  3TOD A;  1MY3 A;  3BFU A;  3DEL B;  3MZ9 A;  2XHD A;  5AA3 A;  4QHQ A;  3VXC A;  2O1L A;  4XXU A;  4RNS A;  1LAX A;  4DLD A;  1ZIU A;  4FAT A;  5L9M A;  4FAJ A;  1B46 A;  4IY5 A;  1DPE A;  5TP9 A;  3A3C A;  3LSL A;  4QFL A;  3S4U A;  5CMK A;  2XXI A;  3ZS6 A;  4G8H A;  2F7B A;  1USY H;  4P11 A;  2XD2 A;  4IGR A;  3KN3 A;  5CC2 A;  4JXI A;  4UAC A;  4KPT A;  2OCU A;  1SW1 A;  3IOT A;  5KCJ A;  2DOJ A;  1JEV A;  1ANF A;  2R6G E;  2GFE A;  2Y7K A;  1MY2 A;  1FTJ A;  4GD5 A;  5I56 B;  2ZNS A;  5L9S A;  1IZ1 A;  2RCA A;  3CSG A;  4FJP A;  5ICQ A;  4ND9 A;  3EHS A;  3TEL A;  3CR9 A;  1B05 A;  3TFL A;  4R6H A;  3KJT A;  3FVO A;  4GXA A;  1B9J A;  4G4P A;  2YLN A;  1A55 A;  3EF7 A;  3ZKL A;  2F7A A;  5H8Q B;  1IXH A;  4LP2 B;  1Q35 A;  2OZZ A;  1B1X A;  1PEB A;  2ZMB A;  2O6A A;  3RNN A;  1NH8 A;  3B7D A;  2AL4 A;  5M2V A;  1USY E;  2IEE A;  3SES A;  3TTR A;  1B3E A;  5I2K B;  2Z8D A;  3T96 B;  3A3U A;  2ONR A;  3IO4 A;  4BDQ A;  5I56 A;  1OLA A;  4F3B A;  1AL3 A;  1R9L A;  1ZU0 A;  3DLN A;  3MVY A;  2O1M A;  2XD3 A;  1YTV A;  2REJ A;  4GRK A;  2Q2A A;  1MRP A;  4U1O A;  1EZO A;  1TXF A;  1VFE A;  1R1N A;  5H8Q A;  2NOO A;  3BBR A;  5FTI A;  2V25 A;  3I5O A;  4OXV A;  3IJO B;  4Q0C A;  3Q25 A;  5AA4 A;  4AQ4 A;  2I3W A;  5ITP A;  2GHB A;  5CBR A;  5I2K A;  3MBP A;  2B65 A;  3TQL A;  1RYX A;  3PUY E;  4JWX A;  1ELJ A;  4NMY A;  3FD3 A;  1I6B A;  2VOZ A;  1QUL A;  4X48 A;  5CI5 A;  2PVU A;  3VLV A;  3UIF A;  1P99 A;  1TWY A;  1M5F A;  1B32 A;  3BKI B;  3EN3 A;  2DVZ A;  3FGS A;  3OSR A;  3TAJ A;  2D3I A;  4H65 A;  1B4Z A;  2RIN A;  5HBC A;  3BFT A;  1S50 A;  3G7W A;  4FEB A;  1PB9 A;  3W9V A;  3G3F A;  4EUO A;  3MPL A;  3TTL A;  3KFM A;  1DOT A;  1CE2 A;  3MPK A;  3TUS A;  1LAH E;  4DXB A;  4C0R A;  1JET A;  1H45 A;  1M5D A;  4OWD A;  4U4S A;  1PDA A;  3PMV A;  4OVJ A;  1SYH A;  4LZ8 A;  2NUV A;  2LAO A;  4WXJ A;  4ZEB A;  1YPN A;  3VVE A;  5A5X A;  2V3Q A;  3KGC A;  3RTW B;  3SEV A;  3H03 A;  3QUF A;  2P1S A;  1MY0 A;  2VD2 A;  1QKA A;  4YMB A;  3C35 A;  4X1B A;  1BP5 A;  1MPC A;  1OQG A;  4F39 A;  4M1V A;  2XX8 A;  1MPB A;  4PFY A;  1MY4 A;  4ZZA A;  1H76 A;  2O7U A;  1QKB A;  4G2Z A;  3S2V A;  1XHY A;  3THI A;  3N94 A;  4G77 A;  2PYY A;  1Y3P A;  3MVX A;  4IGT A;  2XXU A;  3H6U A;  5DEX B;  3TTM A;  1NNT A;  3PMX A;  3B6Q A;  3KZG A;  1WDN A;  4DE8 A;  4ELR A;  3FXR A;  1Z7M E;  4PET A;  2Q88 A;  4HTG A;  1MH4 A;  2UXA A;  2HAU A;  1A99 A;  1ATG A;  4BLA A;  4ELQ A;  3USD A;  3DP8 A;  1MQG A;  4GQO A;  2RF1 A;  4F1U A;  3U72 A;  2FYI A;  3N6T A;  1KWH A;  2UVH A;  5DTB A;  2ONK E;  5ELV A;  2V3T A;  3SKP A;  1QUJ A;  1A8E A;  1QVS A;  4QSC A;  3QK6 A;  5DEX A;  3PGF A;  5JTY B;  4ZDM A;  1A8F A;  3QUJ A;  4H5G A;  1MXX A;  4ZED A;  4M4G A;  4ZEI A;  3HN0 A;  5TPA A;  2I0B A;  3KG2 A;  4YB6 A;  4POX A;  3U92 A;  5CMC A;  4QFN A;  3QAX A;  3VXB A;  3OO9 A;  1UTH B;  5HM4 B;  1MG1 A;  1HSJ A;  1H43 A;  2H99 A;  1A7L A;  3HCQ A;  4JB7 A;  2ZYM A;  4FED A;  2H25 A;  3RPW A;  3EQ1 A;  1P1Q A;  2DVC A;  5J1D A;  3CFL A;  2HZL A;  4IO2 A;  1FQC A;  4DDD A;  4GIZ A;  1JW5 A;  1IXC A;  4WEP A;  3QIM A;  2XX9 A;  3FJ7 A;  1LCT A;  2XXT A;  5JTY A;  2RKM A;  3OEK A;  1B5H A;  3PD9 A;  5K2X A;  1B5I A;  1LBB A;  4ELP A;  4WED A;  5IKB A;  2PT2 A;  3C9H A;  1J1N A;  3C4M A;  1RKM A;  2HEU A;  4FE8 A;  5B70 A;  4EDP A;  4R2B A;  2PT1 A;  3M3K A;  2B3B A;  2HAV A;  4MLQ A;  4H67 A;  1Z7N E;  4NF4 B;  2AL5 A;  2P2A A;  4GFR A;  2DE2 A;  1FTO A;  2Q2C A;  3IB1 A;  3IOV A;  1QW0 A;  1VFD A;  4RK2 A;  1TFD A;  2ZYN A;  4YIC A;  1GV8 A;  2VP1 A;  3MP8 A;  1AMF A;  3OO6 A;  4YKI A;  4R73 A;  3E13 X;  3GBA A;  3O9P A;  1LFI A;  3OEN A;  4ONY A;  3AXF A;  4OZ9 A;  3K1P A;  3OO8 A;  5ICT A;  2WKY A;  3HO7 A;  4F1Y A;  3H6W A;  4OEN A;  1Y1M A;  5KCJ B;  1BLF A;  1OLC A;  3MWB A;  2XXY A;  4R72 A;  2QS3 A;  3DP4 A;  3TCG A;  1SD3 A;  1NNK A;  3S9E A;  4ISU A;  1PBQ A;  5CBS A;  5I2N B;  2DQV A;  1FQB A;  4H8I A;  3GLB A;  1Y1Z A;  4NF4 A;  3B6T A;  4LZ5 A;  3JYR A;  2E1S A;  4MBP A;  3S9N C;  4RPN A;  3VE1 B;  3CIJ A;  1FQD A;  3PUV E;  4NED A;  3K6V A;  1I6Q A;  1PB7 A;  4H8J A;  1MY1 A;  4Q8R A;  1B6H A;  2O7I A;  4Z7E A;  3O29 A;  4LUB A;  2XXW A;  5KDT A;  4QFO A;  1D4N A;  4O3C A;  2Z8E A;  2Y7R A;  4MH5 A;  4GF8 A;  1EZP A;  3IK6 B;  1B7U A;  5I2N A;  3KSJ A;  4XTC Q;  3KN8 A;  1S9T A;  2PX1 A;  3WAF A;  2ESN A;  1ZMG A;  3VLU A;  1YCJ A;  1XVX A;  5AA1 A;  3SEX A;  4R74 A;  1UTB B;  3U1O A;  3FAS A;  3MVZ A;  3F11 A;  3H06 B;  1MDQ A;  4LAT A;  4NF5 A;  1GTK A;  5FHN A;  3CFX A;  3CG3 A;  4N07 A;  5ISU A;  1XS5 A;  3QYT A;  2HXW A;  2PMS A;  4QFP A;  4K3F A;  4F19 A;  1OVB A;  4PFU A;  2NVU B;  1XVY A;  1D9V A;  2V93 A;  3TZA A;  4EQ9 A;  5AA4 B;  5I57 A;  1MXW A;  3GXA A;  3U93 A;  3U94 A;  3MC2 A;  2VHA A;  3PD8 A;  1FTL A;  1B51 A;  1MM7 A;  4EQB A;  3V83 A;  1IXG A;  2Z8F A;  4KYS A;  3CSB A;  4H0W A;  3IOU A;  1N3X A;  1UTB A;  4I1D A;  3FUZ A;  1JW1 A;  3IB2 A;  2PBW A;  2QPQ A;  3FXU A;  4IO4 A;  3MW0 A;  3CRB A;  3M8U A;  1H3D A;  2O68 A;  5CMM A;  3T9H B;  2Q8J A;  1VR5 A;  4YB5 A;  1D9Y A;  5DVF A;  1HSL A;  4ZE8 A;  1B3F A;  2A5S A;  3TEP A;  1DMB A;  5I59 A;  4I62 A;  3KEI A;  2OLB A;  3PPP A;  5H8N B;  4U2R A;  1M5B A;  5A5X B;  2CMO A;  2NXO A;  3ZKK A;  1IQ7 A;  3TCH A;  3M3F A;  4ELO A;  3OMB A;  4QSD A;  4F31 B;  1B0L A;  2DE3 A;  5BUU A;  2THI A;  4THI A;  4HCW A;  4ZE9 A;  3K02 A;  3VFJ A;  1EU8 A;  4KHZ E;  2QL3 A;  4PP0 A;  3PV0 E;  4EF1 A;  2DYX A;  3KN7 A;  2I4C A;  4MF3 A;  3K6W A;  4GVO A;  1ZLQ A;  3MJN A;  5I58 B;  5H8N A;  1FTM A;  3FJG A;  3C31 A;  4XKN A;  4Z0I A;  4F3G A;  1US4 A;  1B3G A;  3Q29 A;  1NMU A;  1AIV A;  2RC8 A;  3K00 A;  3PPN A;  1POY 1;  1UIU A;  3KOS A;  1N76 A;  4DXU A;  1LLS A;  3Q28 A;  3UGW A;  3L6G A;  2X26 A;  1P1N A;  1OQH A;  1B7H A;  4G8M A;  1PB8 A;  4U4X A;  4NE4 A;  4QSE A;  3QXM A;  2H5Y A;  2VD3 A;  3EPE A;  3RY3 A;  2XXH A;  2O84 X;  5H8F B;  4LON B;  2I48 A;  5IAI A;  1P1U A;  3FV1 A;  4NTL A;  3W9W A;  2I58 A;  1MM6 A;  1NFT A;  3K1N A;  1LAG E;  4KYE A;  3O28 A;  1A40 A;  3K2D A;  1B58 A;  5JEI A;  3RGY A;  3C32 A;  4GL8 A;  2X7P A;  3V5A A;  5I58 A;  2Q9T A;  4JSO A;  3PUZ E;  1JEU A;  3K6U A;  3SET A;  3LSW A;  4IO6 A;  4F3P A;  2RC7 A;  3R7X A;  1SVX B;  3U8Q A;  2F6G A;  3ODB A;  4YKK A;  3RT8 A;  4IO7 A;  2HFB A;  4RJZ A;  1FQF A;  5TPA B;  3TKD A;  1URG A;  1M5C A;  3IAZ A;  1URS A;  2R71 A;  1DTG A;  3CI8 A;  4EQ7 A;  2X7Q A;  3MZ1 A;  3IO6 A;  3CG1 A;  2Q89 A;  3R6U A;  5L9O A;  3PPR A;  5H8F A;  3Q27 A;  4FIM A;  3M3L A;  2DP8 A;  3MP6 A;  3C34 A;  3KJ7 A;  3UK4 A;  2HCA A;  3OEM A;  1B1H A;  5CM6 A;  4N13 A;  5EHS A;  2XXQ A;  1UQW A;  1II5 A;  2UVI A;  3G3G A;  2D21 A;  4GLI A;  1ZKB A;  4I9D A;  2OWT A;  3TDJ A;  2M8C A;  1QUK A;  3OOA A;  2O69 A;  4NF8 A;  1WVJ A;  4KR5 A;  2E0S A;  4AB5 A;  3RT6 B;  4H1X A;  3SER A;  3ILT B;  3EHU A;  5I84 A;  4MFI A;  1LCF A;  2OWS A;  5L8D A;  2DS9 A;  4BDN A;  2O51 A;  3R26 A;  2H98 A;  3G3H A;  3FAT A;  4TOZ A;  4U23 A;  1S7Y A;  1N3W A;  2ZXT A;  2XXX A;  1ZBM A;  4OTE A;  3IJX B;  1SDX A;  3T9X B;  1GGG A;  3VV5 A;  4PFT A;  1B4H A;  4Q5T A;  3PMW A;  1POT A;  1F9B A;  3IR1 A;  4OEU A;  1MH3 A;  3RQT A;  3A09 A;  5DT6 A;  1L5T A;  4IB2 A;  2CZL A;  1P1W A;  4RYA A;  4ESW A;  4YKJ A;  1WOD A;  2QS4 A;  3H3G A;  4LZ7 A;  1BKA A;  3UOR A;  4YMA A;  4RK9 A;  2V84 A;  2FA7 A;  3C33 A;  4OES A;  3D4C A;  4HW8 A;  3JZJ A;  2I3V A;  4OYV A;  4FEC A;  1Y20 A;  3KBR A;  1IXI A;  1QUI A;  1LFH A;  4ZEK A;  1Y4T A;  3L6H A;  2P0S A;  1T0K A;  3K0V A;  1Y4C A;  2IA4 A;  3SEW A;  1VE4 A;  4C1U A;  4R6K A;  5KDT B;  4WKM A;  1AH5 A;  1FTK A;  3HV1 A;  2FNC A;  4YU0 A;  4TLM B;  1ZJL A;  1NL5 A;  1B3H A;  4XKQ A;  5DVJ A;  4TQU Q;  4IO5 A;  3T9U A;  1LBC A;  4E0W A;  3OEL A;  2HQ0 A;  3VLW A;  1LB8 A;  3MVW A;  4EF2 A;  5B7D A;  2OBG A;  4KYD A;  2QS2 A;  3FXQ A;  3SEU A;  3G3K A;  2R9J A;  3K01 A;  1JW4 A;  4NF5 B;  4R9F A;  3MAM A;  4POW A;  4NF6 B;  4OET A;  3TTN A;  4F18 A;  1B5J A;  3MZB A;  2DSF A;  4LA9 A;  3SEY A;  4ESX A;  3PUX E;  4E0X A;  3C36 A;  4KI0 E;  3O6H A;  5I57 B;  4F3S A;  4NWD A;  4C1T A;  3FVG A;  3VDF A;  3H7M A;  4OER A;  3FZV A;  1NH7 A;  1MDP 1;  4IO3 A;  4QFK A;  2I6E A;  2VGQ A;  1EZ9 A;  4JWY A;  1MXU A;  1DTZ A;  2W7Y A;  1CB6 A;  1IUD A;  1OVT A;  4KFQ A;  4F1V A;  1GVC A;  4G8N A;  1LGB C;  3LUY A;  2Z23 A;  3LSF B;  4ZZE A;  1EH3 A;  5FHO A;  1B3L A;  3HST A;  4NF6 A;  2ABH A;  4O3A A;  3OO7 A;  4BDR A;  4F22 A;  3H6T A;  1I69 A;  3T93 B;  4QRZ A;  4ECF A;  3N5L A;  5I59 B;  1MQJ A;  4I8C A;  1RYO A;  1LB9 A;  3FV2 A;  3JV9 A;  3IOW A;  1O7T A;  3W15 C;  2DXY A;  1DSN A;  2ALU A;  5AA2 D;  1JVY A;  1N7W A;  1XOC A;  4O3B A;  4UA8 A;  4YAH X;  4RPO A;  2DWI A;  2XXP A;  4FOR A;  4YKP A;  1TFA A;  3HHG A;  1SQY A;  3LR1 A;  1OIB A;  1O64 A;  3TQW A;  4KQP A;  2I49 A;  4R2F A;  2ZNU A;  3PPQ A;  5AA2 B;  2UYF A;  4GWO A;  3E4R A;  1IIW A;  1LAF E;  3LSX A;  4R6Y A;  4ZS9 A;  3VVF A;  1TT1 A;  2V3U A;  2ZNT A;  1US5 A;  1N84 A;  3ZSF A;  4PQJ A;  3PPO A;  2F35 A;  2QRY A;  3UA8 A;  1MXV A;  3RTF B;  1FQE A;  1R9Q A;  2KLF A;  2F34 A;  2G93 A;  5AE4 A;  1SBP A;  3N6U A;  4JBZ A;  4HCY A;  2I0C A;  4U21 A;  2RCB A;  2D5W A;  2H4I A;  3RUM A;  3KSX A;  2G29 A;  4LQ5 A;  1Y3Q A;  4ZEC A;  1B7Z A;  3LC8 A;  4H5F A;  2F6P A;  3O6G A;  3UP9 A;  1AOV A;  3RN8 A;  2F97 A;  1JNF A;  5AA2 A;  4OFL A;  2BJJ X;  1BTJ A;  3FJM A;  3GBB A;  4HS7 A;  3OSQ A;  4XIG Q;  2DWH A;  5H8S A;  4N6P A;  3IB0 A;  4TLL B;  1NKX A;  4XKP A;  1VSO A;  1XT8 A;  3V8X B;  1Y9U A;  4GL0 A;  4PE5 B;  4DZ1 A;  3V89 B;  1IIT A;  4EXK A;  2QSX A;  4IY6 A;  1N0T A;  3MUQ A;  1OMP A;  1R6Z A;  3H4Z A;  3G3I A;  2XX7 A;  1DPP A;  1ZTY A;  1FQA A;  3CVG A;  4F29 A;  1BIY A;  1B2H A;  3D4G A;  2QJE A;  3OD7 A;  2QMX A;  1MQD A;  2F7C A;  1SI0 A;  2DE4 A;  4RXL A;  1B52 A;  3O2A A;  2I4B A;  5FHM A;  3K6X A;  3ONM A;  1I6A A;  1NNP A;  1JVX A;  3K1M A;  2XXR A;  4AB6 A;  4DIG A;  4P0G A;  4KCC A;  3UN6 A;  2YPN A;  3EHT A;  2Y7P A;  1M5E A;  2GHA A;  2Y84 A;  3CFZ A;  3MP1 A;  3TYH A;  4NF8 B;  4ZEF A;  2ANJ A;  1XC1 A;  1MS7 A;  2RC9 A;  1JQF A;  3LBS A;  3VVD A;  2F36 A;  4G68 C;  2AIX A;  2NWJ A;  3K4U A;  4X9T A;  1LFG A;  5TU0 A;  2HZK A;  1Y3N A;  1MXY A;  2REG A;  3PUW E;  3PU5 A;  5DVI A;  1GR2 A;  1FCK A;  5BWJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...