3G3IA

Crystal structure of the glur6 ligand binding domain dimer i442h k494e i749l q753k mutant with glutamate and nacl at 1.37 angstrom resolution
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
256
structure length
255
Chain Sequence
NRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLELSTHLGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREEVIDFSKPFMTLGISILYRKGTPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITLAILKLQEEGKLHMMKEKWWRGNGCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Glutamate receptor, ionotropic kainate 2
publication title Stability of ligand-binding domain dimer assembly controls kainate receptor desensitization.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 84
structure length 255
sequence length 256
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-02-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3g3iA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3g3iA02
3FVKA 3O6GA 4RYAA 2HCAA 4GVOA 3MW0A 4N07A 3S9LC 1QULA 1N0TA 5I84A 4LONB 1JNFA 3HV1A 3LSXA 3B6TA 5EHSA 3O6IA 2F6PA 4JB7A 3KJ7A 3IO4A 1NMUA 3CVGA 1US5A 4OFOA 1Z7NE 2O1LA 1MQJA 1ZU0A 4LQ2A 2Q9TA 1MH4A 4BDMA 4R9FA 3MBPA 5FHOA 4HW8A 4QHQA 1N04A 2DWIA 2PX1A 2F6GA 4PE5B 2UYEA 4G4PA 5ICQA 1URSA 4I62A 4O3AA 4GL8A 1IXIA 4JWOA 4ZECA 1WDNA 4KYEA 3RT6B 2P2AA 3LSLA 2HXWA 4RK2A 4NMYA 1AL3A 1B52A 3HHGA 3RGYA 4OERA 4IO5A 1ZMGA 5L8DA 4F22A 1JVYA 1Q35A 1LAXA 2I4BA 5I59A 3PPRA 2GHBA 1MPCA 3K1NA 1FTMA 2Y7KA 1DPPA 2CZLA 4HCWA 3RUMA 1MXXA 5ITPA 4RA1A 2Z8EA 1SD3A 3RPWA 3L6HA 3MZ1A 4EQ7A 2DE4A 4F31B 2Q2AA 4QFNA 1NNFA 2Q8JA 4ZZEA 2E0SA 3ODBA 5A5XB 2A5TB 3IK6B 1D9YA 3Q28A 1OVBA 3N6TA 2ONRA 2Y7PA 3KBRA 2PT1A 1II5A 1PDAA 1URDA 3RY3A 4X1DA 3K6UA 1UTHB 3T9XB 3TQLA 4AB5A 4OXVA 5LOMA 2HFBA 3H06B 2Q89A 3IL1B 2F36A 3QAXA 5DYHA 3K1PA 1DMBA 1SI1A 3N6UA 3ONMA 4DXBA 4U1ZA 2Q2CA 2V93A 3VXBA 2GRVA 1S50A 3CSGA 4KYDA 5JTYB 3K6VA 4MBPA 5IAIA 1MXVA 2QJEA 2F35A 4M1VA 2V3TA 1HSEA 4G77A 3LR1A 1B5IA 4MLQA 3KOSA 1CB6A 4U4SA 3VLWA 3V5AA 1L5TA 4NWDA 3PUXE 2I4CA 1WODA 4OEUA 4ZEFA 1N7WA 2THIA 1FQEA 3PUZE 1MM6A 4GL0A 1LB8A 1H43A 4QSDA 1M5BA 3C33A 2OK2A 2DQVA 4F3GA 1IIWA 1B1XA 2REGA 5DEXA 3FVNA 2DYXA 4LZ8A 2V3QA 1MQIA 2XX9A 3HN0A 1I6BA 1VFEA 5B7DA 5H8HA 5AA2D 1Y20A 4R6KA 1Y4CA 1ZKBA 4KD5A 4H6DA 4OQOA 3Q25A 1D4NA 4YMAA 2DXYA 2UVIA 3B6WA 3FJGA 3BFTA 3TTMA 3H3GA 3VDFA 1O7TA 2DS9A 3SKPA 3MP6A 5CBSA 4FORA 5F1QA 4EF2A 4EXKA 4PP0A 4POXA 4BDRA 2I3WA 1B7UA 4TLLB 2G29A 1JW4A 5I2NA 4JSOA 1MDP1 4BDQA 4HS7A 3MPLA 4O3BA 4FIMA 2X26A 4IB2A 3K6WA 3ZKKA 4OHNA 4YKKA 4U4XA 1JVXA 4PFTA 2F97A 4GLIA 4BDNA 1B3GA 4NF5B 4F3SA 3G3FA 1FQCA 1USYH 3ZKLA 3U92A 5AA2A 3EHSA 1M5FA 4DCYA 1IQ7A 3FJ7A 3KSJA 1VR5A 4IO3A 3PPNA 4F3PA 5J1DA 2DE2A 1Y1MA 2B65A 1URGA 2QMWA 2O6AA 4KCCA 5TPAA 5TP9B 2F7BA 4JDFA 4ZEBA 2XXVA 4YICA 1P1OA 4L17A 1MRPA 3EHTA 3VVFA 3ECRA 2A5SA 2PMSA 4OVJA 3TCHA 2RC7A 1A54A 1B0HA 1NNTA 3PU5A 1Q1KA 4NTLA 1JEUA 4U1OA 2Z8FA 3BKIB 1ELJA 1QJMA 4WEDA 1DTZA 3M8UA 1XVYA 2OCUA 5M2VA 3GXAA 3PD9A 3TCGA 2XXRA 3DP8A 2H98A 4GIZA 1P1UA 3QSLA 1MPBA 4OESA 5EYFA 3N26A 1RYOA 4QF9A 2R9JA 1DTGA 5KDTA 1IXGA 3WAFA 1AH5A 1IZ1A 2ANJA 3I5OA 3CRBA 3S2VA 4O3CA 4TOZA 4P0IA 3R7XA 3S9MC 1MS7A 1NL5A 1FTOA 2Z8DA 1B4HA 2UXAA 3DM0A 5I58B 2CMOA 1P99A 1B51A 4OFJA 4OFLA 3V89B 3FXQA 4OEVA 4Q0CA 1B58A 2G93A 4DLDA 5JK4A 3S9EA 2QS2A 1EH3A 4JBZA 5BWJA 2UVJA 5I59B 1US4A 1B3FA 1SVXB 4IO7A 4DE8A 1D3KA 4ZEKA 3LBSA 5L9MA 5K2YA 3UGWA 4RPNA 3ZS6A 4FECA 3VXCA 1OLAA 1B3LA 4DXCA 3FUZA 5JEIA 3BBRA 3PPPA 3GLBA 1EZOA 2RKMA 3PD8A 5H8SA 4R6HA 2O51A 2HEUA 2ZNSA 3E3KA 3F11A 3IJXB 3PPOA 1LAGE 2QMXA 4KYSA 3U1OA 3A3UA 5KZTA 3MUQA 1R9LA 3DP6A 1M5CA 3EF7A 2ZXTA 4R2BA 1LBBA 1GTKA 1VFDA 4U22A 1ATGA 3I6VA 2R71A 4R72A 3R6UA 4XKRA 1QKBA 4FATA 4ISUA 3K6XA 3MVZA 3C36A 4RK9A 4N13A 1LLSA 5HBCA 1ZJLA 3OO7A 2DVCA 3D4GA 1Y3PA 4POWA 4P0GA 2ESNA 4F2OA 3K2DA 3SETA 2NVUB 1FQAA 4GOTA 2P0SA 1Y3QA 4OETA 5I58A 1XHYA 2VP1A 3OENA 3EQ1A 4RPOA 1Y3NA 1Z7ME 4ZEDA 1IEJA 1BKAA 3O2AA 1MDQA 3O9PA 4AQ4A 1ZLQA 2OWSA 3LC8A 2ONSA 1RKMA 1A40A 2DVZA 2UVGA 2NOOA 3RTWB 3FATA 5DEXB 1B3EA 3G3HA 1B1HA 1JW5A 5I57A 1LFHA 1I6AA 1IITA 3CIJA 1LFIA 3C32A 5KCJA 2AL4A 3GBBA 4YKPA 1GR2A 5H8HB 2DWJA 3OXNA 4H0WA 3Q26A 1SW5A 3OO6A 2XXQA 4ZEIA 2GFEA 4NF6A 2BJJX 3IOUA 5H8QA 3K00A 2XD3A 4YKJA 4LATA 3CFXA 1WVJA 3RQTA 4R6YA 1SW2A 1SDXA 5DT6A 5I2KA 4Z0IA 4I1DA 4MLVA 2RC9A 4QSEA 3PUYE 4F18A 3TPAA 2XHDA 1GV8A 1XS5A 1A99A 2V3UA 3CI8A 2DE3A 4F19A 4R73A 2X7QA 5I2NB 3E13X 1A55A 3G3IA 4OENA 4OWDA 4U23A 2NXOA 1VSOA 4DZ1A 1B3HA 1LAFE 5AA2B 2ZYOA 1ZTYA 4EQ9A 1HSLA 1LAHE 3QUJA 2XXTA 2IEEA 1VE4A 2F8DA 3T22A 4BDLA 3SESA 1ANFA 4IGTA 4ZZAA 5TPAB 3PUVE 4XIGQ 4PFWA 2HZKA 2ONKE 4DXUA 1N3XA 2OWTA 4LZ5A 4ONYA 1OVTA 3K0VA 3MVWA 3TDJA 2ZYNA 1XOCA 2ZMBA 3PMXA 4GF8A 2B3FA 1MXYA 3B6QA 4UACA 3TTNA 1H76A 3H6WA 2Y7RA 1NKXA 1YAEA 2DXRA 3IOTA 3UN6A 3KGCA 3LUYA 4WKMA 1I6QA 3FIRA 4YB5A 3IB1A 2GH9A 2XX7A 1P1QA 3RNNA 1B5HA 1DSNA 3VVDA 4F3BA 1NH8A 1POTA 2XD2A 1O64A 4OYVA 3QXMA 3OMBA 2ZYMA 2H99A 1R6ZA 3I3VA 3WAEA 1XT8A 3HPIA 4XKQA 4I9DA 5KDTB 1TFAA 2KLFA 3FGSA 4OTEA 3THIA 4BDOA 3TODA 4H67A 2DWHA 1GVCA 3TEPA 1FQFA 2ALUA 4ZS9A 1OQGA 5HM4B 2E1SA 1LB9A 2FA7A 1R1NA 2HAUA 3CFLA 2ZYKA 3VVEA 1PB9A 1B5JA 3Q27A 3GZGA 4F1UA 5AA3A 3C9HA 4G68C 1FTKA 4F2QA 1TXFA 2PBWA 4IO6A 3W9VA 5EHMA 4XXUA 4ELOA 4KQPA 5ICTA 1MQGA 3RN8A 5CMBA 3OO8A 3CSBA 3CFZA 3OO9A 5DVIA 3KSXA 1B32A 4YMBA 4LA9A 3TMGA 4MFIA 4FJPA 3U93A 5AA1A 2D21A 2O69A 3S9NC 1OQHA 1H44A 2VHAA 4GXSB 2VD3A 5DVFA 3UORA 5CM6A 3OEMA 1B7HA 3IORA 4RJZA 4FEBA 1M5EA 1TFDA 4QFOA 3KFMA 3TQWA 1ZBMA 1LCTA 4Q8RA 1QUKA 4YB6A 1TT1A 3C34A 4G8MA 2OBGA 4P11A 1PB8A 3B7DA 3SEUA 2DSFA 3S4UA 4U2RA 1POY1 1JEVA 4ELPA 4DDDA 1SQYA 3ILUB 1PBQA 1XVXA 3MC2A 4JWYA 3LSFB 4LVQA 2RC8A 3W15C 4NE4A 2ABHA 4FAJA 3PMVA 3MP8A 4KCDA 1UIUA 3TKDA 3VE1B 4G68A 5L9OA 3VLUA 4YZZA 5CI5A 3P7IA 1AIVA 3DELB 4Q5TA 2XX8A 3V8XB 3IB0A 1MY4A 1N3WA 4R9GA 2ZNUA 3MJNA 1DOTA 1O63A 3G3JA 4H1XA 4X48A 2QSXA 2XXPA 5H8NA 4EF1A 1Y4TA 2F78A 1MM7A 1P1NA 2QRYA 4EQBA 2H9BA 1RYXA 1SW1A 1A8FA 2M8CA 3O6HA 5K2XA 1BIYA 3TAJA 2Y7WA 2AYSA 3PPQA 1SW4A 3FV1A 3C35A 4DCXA 2H25A 2XXHA 3IAZA 3TUSA 1QVSA 2RCBA 3T9VA 2REJA 4JSDA 4ZE9A 5AE4A 4IO4A 4QRZA 5I57B 2NUVA 5FHMA 5KCJB 3CR9A 2I6EA 3OD7A 2AL5A 4ESXA 1I69A 4OMBA 1SYHA 2PVUA 2XXYA 1PBPA 3A09A 3MAMA 3E9XA 4NF6B 2YJPA 3QYTA 5H8QB 2GHAA 2QL3A 4NF4A 3SEXA 2LAOA 4F1YA 2PYYA 1MXWA 1S7YA 5I2KB 3VLVA 1MY1A 4H8JA 4M4GA 2D3IA 1AOVA 4I8CA 3KN7A 1QKAA 4GWOA 2R6GE 4NWCA 4WXJA 1LFGA 1ZIUA 4QFPA 4GRKA 1FTLA 1B46A 3QIMA 3LSWA 3JV9A 4JWXA 1PB7A 1LCFA 1PEBA 1B4ZA 1JW1A 1LSTA 2O68A 4YAHX 4PETA 2UVHA 4QFKA 2XXWA 1B9JA 2RF1A 4FE8A 3RTFB 3KG2A 4GXAA 4NF8A 3MPKA 3IO6A 3VV5A 3UK4A 1R9QA 3DLNA 5CBRA 3FXRA 5ISUA 4H5GA 2DWAA 2H4IA 4KHZE 1MY3A 5BUUA 4ESWA 4MF3A 1OMPA 3QUFA 1MY2A 1F9BA 3SEVA 3MVYA 3L6GA 2FYIA 1MQDA 5CC2A 3RT8A 1GGGA 4C1UA 2DOJA 3T9HB 1T0KA 1UTBB 2V25A 4XTCQ 3OOAA 5DTBA 5L9SA 3A3CA 4EUOA 1MXZA 2V84A 1MQHA 1SI0A 3CG3A 4RNSA 1YCJA 3FD3A 1A8EA 3KN8A 4UA8A 1FCKA 3OSQA 3SEWA 3OELA 3QK6A 3TELA 4KFQA 3K4UA 4KI0E 1NH7A 3M3LA 1YPNA 5AA4B 3H6VA 3U94A 3KJTA 1B40A 2PT2A 5H8FA 3AXFA 2F34A 4OZ9A 3DP4A 1TWYA 1FQBA 3M3FA 2W7YA 1USYE 3TTKA 2RCAA 3FVOA 1UQWA 3OSRA 1MPDA 1M5DA 2Q88A 3D4CA 3FVGA 1JETA 4NEDA 1SYIA 5ITOA 5TU0A 1Y1ZA 1Y9UA 1B2HA 2F7AA 3N5LA 2QS4A 1FTJA 2RINA 4LZ7A 2OZZA 2VD2A 4F1VA 1BLFA 4PFYA 3PUWE 2F7CA 1BTJA 1A7LA 4G8HA 2H5YA 1B7ZA 2I3VA 3JYRA 4H8IA 4PQJA 2QPQA 3W9WA 4U21A 1D9VA 2IA4A 4WEPA 5CMMA 3M3KA 5FHNA 4TLMB 1MH3A 1XC1A 3TTLA 3FXUA 3PV0E 1OIBA 3PGFA 1B0LA 4E0XA 2X7PA 4X9TA 2Y84A 1B05A 5CMKA 2Z23A 1UTBA 3H6UA 4DIGA 3K02A 1QUIA 3TZAA 3IOVA 2B3BA 1LGBC 1NNPA 3FASA 3FJMA 4THIA 1SBPA 4C0RA 3G7WA 5I56B 3USDA 4LUBA 3U8QA 5A5XA 4ECFA 2A5TA 2O84X 3IJOB 3G3KA 4G68B 1LBCA 2ZNTA 5AA4A 5FTHA 4H65A 4ELRA 4QSCA 1HSJA 3HO7A 1EU8A 4ZDMA 3H03A 3KOTA 1UTHA 4FEDA 3UA8A 3ZSFA 3H7MA 3TTRA 3OEKA 5H8NB 1MY0A 3C4MA 1S9TA 2NWJA 3K1MA 3GBAA 4IGRA 4RXLA 4BLAA 1J1NA 2D5WA 4KR5A 3IX1A 4R75A 4ZE8A 4IY5A 3T93B 5CMCA 4YB7A 4MH5A 4QFLA 2DP8A 1YTVA 3SDFA 5JTYA 1EZ9A 1H45A 5ELVA 1UIVA 3FZVA 3TCFA 2O7UA 4LP2B 3RLFE 3MVXA 3HCQA 3E4RA 4R74A 1FQDA 2XXUA 2YPNA 4NF4B 2I48A 4IY6A 2WKYA 4HTGA 3MZ9A 1N84A 2Y7IA 2HQ0A 4LQ5A 3TFLA 1QUJA 4XKPA 5CRYA 4IO2A 4N6PA 3O28A 5FTIA 3SEYA 2O7IA 3ILTB 1B6HA 4K3FA 2UYFA 1DPEA 1EZPA 4R2FA 3G3GA 4F29A 3PMWA 3V83A 3K01A 4AB6A 4GFRA 4Q30B 3U72A 1MXUA 5I56A 3C31A 3MZBA 3Q29A 2HAVA 3H6TA 1PC3A 1P1WA 2XXIA 1IXCA 1NNKA 3IR1A 2FNCA 4ELQA 2I0CA 4YKIA 4EXLA 1AMFA 4NF8B 4GQOA 4YU0A 3UIFA 1QW0A 3O66A 2OJTA 3FV2A 3IB2A 3T9UA 1JQFA 4E0WA 3EPEA 1NFTA 4H5FA 2I49A 4ND9A 5B70A 4XKNA 3T66A 2VGQA 3TYHA 1N76A 2VOZA 3EN3A 3HHFA 3EHUA 3MWBA 4NF5A 3N94A 4TQUQ 3VFJA 5F7VA 4Z7EA 2YLNA 3H4ZA 3KEIA 3MQ9A 4X1BA 1N7XA 3HSTA 4F39A 3T96B 3R26A 4KPTA 1KWHA 4G2ZA 2O1MA 4EDPA 3O29A 5TP9A 2HZLA 4C1TA 1FW0A 3JZJA 3KN3A 2OLBA 4PFUA 1IXHA 3O97A 5IKBA 3KZGA 5HPQA 3UP9A 1IUDA 2XXXA 1H3DA 1CE2A 1OLCA 2I0BA 4HCYA 3IOWA 4GD5A 1BP5A 1MG1A 5H8FB 4RY1A 5DVJA 2F5XA 2AIXA 2P1SA 2QS3A 2QS1A 2I58A 4G8NA 3CG1A 3BFUA 4JXIA 3MP1A 3SERA 2Z22A
chains in the Genus database with same CATH superfamily
3FVKA 3O6GA 4RYAA 2HCAA 4GVOA 3MW0A 4N07A 3S9LC 1QULA 1N0TA 5I84A 5IZ1A 4LONB 1JNFA 3HV1A 3LSXA 3B6TA 5EHSA 3O6IA 2F6PA 1IMEA 4JB7A 3KJ7A 3IO4A 1NMUA 3CVGA 4OANA 4PTKA 1US5A 3GYYA 1FPLA 4OFOA 1Z7NE 2O1LA 1MQJA 2V4CA 1ZU0A 4LQ2A 2Q9TA 1MH4A 4BDMA 4R9FA 3MBPA 4NX1A 5FHOA 4HW8A 4QHQA 1N04A 2DWIA 2PX1A 2F6GA 1NV4A 1CNQA 4PE5B 2UYEA 4G4PA 5ICQA 1URSA 4NQ8A 4FBPA 4I62A 4O3AA 4GL8A 1IXIA 4JWOA 1FBHA 4P1LA 2CZHA 4ZECA 1WDNA 4KYEA 3RT6B 2P2AA 3LSLA 2HXWA 4RK2A 4NMYA 1AL3A 1B52A 2B4LA 3HHGA 3RGYA 4OERA 4IO5A 1ZMGA 5L8DA 4F22A 1JVYA 1Q35A 1LAXA 2I4BA 5I59A 3PPRA 2GHBA 1MPCA 3K1NA 1FTMA 2Y7KA 1DPPA 2CZLA 4HCWA 3RUMA 1MXXA 4DI3D 5ITPA 1EYIA 4RA1A 2Z8EA 1SD3A 3RPWA 3L6HA 3MZ1A 4EQ7A 2DE4A 1Q9DA 4F31B 3SZPA 2Q2AA 4QFNA 1NNFA 2Q8JA 5EQ7A 4ZZEA 4PBQA 4N15A 2E0SA 3ODBA 5A5XB 2A5TB 2XWKA 3IK6B 1D9YA 3Q28A 1OVBA 3N6TA 2ONRA 2Y7PA 3KBRA 2PT1A 1II5A 1PDAA 1G0IA 1URDA 3RY3A 4X1DA 3U65A 3K6UA 1UTHB 3T9XB 1K9YA 3TQLA 4AB5A 4OXVA 5LOMA 2HFBA 3H06B 2Q89A 3IL1B 4I40A 2F36A 3QAXA 5DYHA 3K1PA 1DMBA 1SI1A 1FBDA 3N6UA 4O7IA 3ONMA 4DXBA 4U1ZA 4PDDA 2Q2CA 4GWXA 4MNPA 2V93A 1NV0A 3VXBA 2GRVA 1FTAA 1S50A 3CSGA 4KYDA 1LEVA 5JTYB 3K6VA 4MBPA 5IAIA 1MXVA 2QJEA 2F35A 4M1VA 2V3TA 2PCRA 1HSEA 4G77A 3LR1A 1B5IA 4MLQA 3IFAA 3KOSA 1CB6A 2WYKA 4U4SA 3VLWA 3V5AA 1L5TA 4NWDA 3PUXE 2I4CA 1WODA 2BJIA 4OEUA 4ZEFA 1N7WA 2THIA 1FQEA 3PUZE 4PBHA 1MM6A 4GL0A 1LB8A 1H43A 4QSDA 1M5BA 1LBWA 3C33A 2OK2A 2DQVA 4F3GA 1IIWA 1B1XA 2REGA 5DEXA 3FVNA 2DYXA 4LZ8A 2V3QA 1MQIA 2XX9A 3IFCA 3HN0A 1I6BA 1NI9A 1VFEA 5B7DA 5H8HA 5AA2D 1DBZA 1Y20A 4R6KA 1Y4CA 1ZKBA 3B8BA 4KD5A 4H6DA 4OQOA 1FJ9A 3Q25A 1D4NA 3KBZA 5EQ8A 4YMAA 2DXYA 3QMFA 2UVIA 3B6WA 3FJGA 3BFTA 2XA5A 4GWSA 3E78A 3TTMA 3H3GA 3VDFA 1EYKA 1O7TA 2DS9A 2XWIA 3SKPA 1RDZA 3MP6A 5CBSA 4FORA 5F1QA 4EF2A 4MHFA 4EXKA 4PP0A 4POXA 4MJOA 4N6DA 4BDRA 2I3WA 1B7UA 4TLLB 2G29A 1JW4A 5I2NA 4JSOA 1MDP1 1SPIA 4BDQA 4HS7A 3MPLA 4O3BA 1KA1A 4FIMA 2X26A 4IB2A 3K6WA 3ZKKA 4OHNA 4YKKA 4U4XA 1JVXA 4PFTA 5I3SA 2F97A 4GLIA 4BDNA 1B3GA 4NF5B 4F3SA 3G3FA 1FQCA 1USYH 3ZKLA 4MNCA 3U92A 5AA2A 3EHSA 1M5FA 4DCYA 1IQ7A 3FJ7A 3KSJA 1VR5A 4IO3A 3PPNA 4F3PA 5J1DA 2DE2A 1Y1MA 2B65A 1URGA 2QMWA 2O6AA 4KCCA 5TPAA 5TP9B 2F7BA 4JDFA 4OVTA 4ZEBA 2XXVA 5ET8A 4YICA 1P1OA 2ZZXA 2FBPA 4L17A 1MRPA 3EHTA 4P8BA 2VPOA 3VVFA 4GX6A 3ECRA 2CZKA 2ZZVA 2A5SA 2PMSA 4OVJA 3TCHA 2RC7A 1A54A 1B0HA 2OX3A 5ET5A 1NNTA 3PU5A 1Q1KA 4NTLA 1JEUA 4U1OA 2Z8FA 3BKIB 1ELJA 1QJMA 4WEDA 1DTZA 2Q8MA 3M8UA 1XVYA 2OCUA 2FVZA 5M2VA 3GXAA 3PD9A 3TCGA 1FRPA 2XXRA 3DP8A 2H98A 4GIZA 1P1UA 3QSLA 1MPBA 4OESA 5EYFA 3N26A 3LV0A 1RYOA 4QF9A 2R9JA 1DTGA 5KDTA 1IXGA 3WAFA 1AH5A 1IZ1A 2ANJA 3I5OA 3CRBA 3S2VA 4O3CA 4TOZA 3KC0A 4P0IA 3R7XA 3S9MC 1MS7A 1NL5A 1FTOA 2Z8DA 1B4HA 4OVRA 2UXAA 3DM0A 5I58B 2CMOA 1P99A 1B51A 4OFJA 4OFLA 3V89B 3FXQA 4OEVA 1INPA 4Q0CA 1B58A 2G93A 4DLDA 1XI6A 5JK4A 3S9EA 2QS2A 1EH3A 4JBZA 5BWJA 2UVJA 5I59B 1US4A 1B3FA 2WBBA 1SVXB 4IO7A 4DE8A 1D3KA 4ZEKA 5T3JA 3LBSA 5L9MA 1K9ZA 4G61A 5K2YA 3UGWA 2MKZA 4RPNA 3ZS6A 4FECA 3VXCA 1OLAA 4O7MA 3MYUA 4O94A 3LUZA 1B3LA 4DXCA 3FUZA 5JEIA 1IMFA 3BBRA 3PPPA 3GLBA 5ESYA 1EZOA 2RKMA 1LBZA 3PD8A 5I5PA 5H8SA 4R6HA 4GX3A 1FBEA 2O51A 2HEUA 2ZNSA 3E3KA 3F11A 3IJXB 3PPOA 1LAGE 2QMXA 4KYSA 4PAIA 3A3UA 3U1OA 5KZTA 3MUQA 1R9LA 1IMCA 3DP6A 4OVSA 1M5CA 3EF7A 2ZXTA 4R2BA 1LBBA 1GTKA 1VFDA 4U22A 1ATGA 3I6VA 2R71A 4R72A 2QVRA 3R6UA 4XKRA 1QKBA 4FATA 2XWOA 4ISUA 4P47A 4P56A 4PCDA 3K6XA 3MVZA 3C36A 4RK9A 4GWUA 4N13A 5IGAA 1LLSA 5HBCA 1ZJLA 3OO7A 2F3DA 3D1RA 4GWWA 3T0JA 2DVCA 3D4GA 1Y3PA 4POWA 4MEVA 4P0GA 2ESNA 1FPJA 5A5LA 4F2OA 4PF8A 2HXRA 3K2DA 3SETA 3T1BA 2NVUB 1FQAA 5F24A 3HFUA 4GOTA 2P0SA 1Y3QA 4OETA 5I58A 1XHYA 2VP1A 3OENA 4PGPA 3EQ1A 4RPOA 1Y3NA 1Z7ME 4ZEDA 1IEJA 4N6KA 4N4UA 1BKAA 3O2AA 4MAGA 1MDQA 3O9PA 4AQ4A 1ZLQA 2OWSA 3LC8A 2ONSA 1RKMA 1A40A 2DVZA 2UVGA 2NOOA 3RTWB 3FATA 1NV6A 5DEXB 1B3EA 3G3HA 1B1HA 4MIJA 1JW5A 5I57A 4NHBA 1LFHA 1I6AA 1IITA 3CIJA 1LFIA 3C32A 5KCJA 2AL4A 3GBBA 4YKPA 1GR2A 5H8HB 2DWJA 3OXNA 4H0WA 3Q26A 1SW5A 4MMPA 3OO6A 2XXQA 4ZEIA 2GFEA 4NF6A 2BJJX 3IOUA 5H8QA 3K00A 2XD3A 4HE2A 4YKJA 4LATA 5IM2A 3CFXA 1WVJA 1RDXA 3RQTA 4R6YA 1SW2A 1SDXA 5DT6A 5I2KA 2F3BA 4Z0IA 4I1DA 4MLVA 2RC9A 4QSEA 3PUYE 4F18A 3TPAA 2XHDA 1GV8A 1XS5A 1A99A 4NAPA 2V3UA 3CI8A 2DE3A 4F19A 4R73A 4MCOA 2OWZA 2X7QA 2VPNA 5I2NB 3E13X 1A55A 3G3IA 4OENA 2CEXA 4OWDA 4I3EA 4U23A 4I3YA 2B4MA 4MX6A 2NXOA 1VSOA 4DZ1A 1B3HA 5IZ3A 1LAFE 2FHYA 5AA2B 2ZYOA 1ZTYA 4PGNA 4EQ9A 4UABA 1HSLA 1LAHE 1NV7A 3QUJA 2XXTA 2IEEA 1VE4A 2F8DA 3T22A 2L5VA 4BDLA 3SESA 1ANFA 4IGTA 4ZZAA 5TPAB 1FBFA 3PUVE 4XIGQ 4PE3A 4PFWA 2HZKA 2ONKE 1NV2A 4DXUA 1N3XA 2OWTA 4LZ5A 4ONYA 1OVTA 1AWBA 3K0VA 3MVWA 3TDJA 2ZYNA 1XOCA 2ZMBA 3PMXA 4GF8A 2B3FA 1MXYA 3B6QA 3E79A 4UACA 3TTNA 1H76A 3H6WA 2Y7RA 2FIXA 1NKXA 1YAEA 2DXRA 3IOTA 1FPIA 3UN6A 3KGCA 3LUYA 4WKMA 1I6QA 3FIRA 4YB5A 3IB1A 2GH9A 2XX7A 1P1QA 5LTCA 3RNNA 1B5HA 1DSNA 3VVDA 4F3BA 1NH8A 1POTA 2XD2A 1O64A 4OYVA 3QXMA 3OMBA 2ZYMA 2H99A 5DW8A 2HPGA 1R6ZA 3I3VA 3WAEA 1XT8A 2WBDA 3HPIA 4XKQA 4I9DA 5KDTB 1TFAA 2KLFA 3FGSA 2QVVA 4OTEA 3THIA 4BDOA 3TODA 4H67A 2DWHA 1GVCA 3TEPA 1FQFA 2ALUA 4ZS9A 1OQGA 5HM4B 2E1SA 1LB9A 2FA7A 1R1NA 2HAUA 3CFLA 2ZYKA 3VVEA 1PB9A 1B5JA 4PFBA 3Q27A 3GZGA 4F1UA 5AA3A 3C9HA 4G68C 1FTKA 4F2QA 4PFRA 1TXFA 2PBWA 4IO6A 3W9VA 4AS4A 5EHMA 4XXUA 4ELOA 4KQPA 4QXDA 5ICTA 1MQGA 3RN8A 5CMBA 3OO8A 3CSBA 3CFZA 3OO9A 5DVIA 3KSXA 1B32A 4YMBA 4X8RA 4LA9A 1YZ0A 3TMGA 4MFIA 4FJPA 3U93A 2XWVA 5AA1A 2D21A 2O69A 3S9NC 1OQHA 1H44A 2VHAA 1LBYA 2R8TA 4GXSB 2VD3A 2VT5A 5DVFA 3UORA 5CM6A 2WEFA 3OEMA 1B7HA 3IORA 4RJZA 2P3NA 4GBVA 4FEBA 1M5EA 2QVUA 1TFDA 4QFOA 3KFMA 3TQWA 4X04A 1ZBMA 1LCTA 4Q8RA 1QUKA 4YB6A 1TT1A 3C34A 4G8MA 2OBGA 4P11A 1PB8A 3B7DA 3SEUA 2DSFA 3S4UA 4U2RA 1POY1 1JEVA 4ELPA 4DDDA 1SQYA 3ILUB 1PBQA 1XVXA 3MC2A 4JWYA 3LSFB 4LVQA 2RC8A 3W15C 4NE4A 2ABHA 4FAJA 3PMVA 3MP8A 4KCDA 1UIUA 3TKDA 3VE1B 3A29A 4G68A 4OVQA 5L9OA 4IR8A 3VLUA 4YZZA 5CI5A 3P7IA 1AIVA 3DELB 4Q5TA 2XX8A 3V8XB 3IB0A 1MY4A 1N3WA 1FBCA 4R9GA 2ZNUA 3MJNA 1DOTA 1O63A 3G3JA 4H1XA 4X48A 2QSXA 2XXPA 5H8NA 4EF1A 1G0HA 4JVIA 5IZZA 1Y4TA 2F78A 1MM7A 1P1NA 2QRYA 4EQBA 2H9BA 1RYXA 1SW1A 1A8FA 2M8CA 3O6HA 5K2XA 1BIYA 2DDKA 3TAJA 2Y7WA 2AYSA 3PPQA 1SW4A 3FV1A 3C35A 4DCXA 2H25A 2XXHA 3IAZA 3TUSA 1QVSA 2RCBA 3FBPA 3T9VA 3B50A 2REJA 3RPLA 4JSDA 4ZE9A 5AE4A 1FSAA 4QRZA 4IO4A 4N91A 5I57B 2NUVA 5FHMA 5KCJB 3CR9A 2I6EA 2CZIA 3OD7A 2AL5A 4ESXA 4PAKA 1I69A 4OMBA 1SYHA 2PVUA 2XXYA 2Y5LA 1PBPA 1NUWA 3A09A 3MAMA 2PFYA 3E9XA 4NF6B 2YJPA 3QYTA 5H8QB 2GHAA 2QL3A 4NF4A 3SEXA 1NUYA 2LAOA 4F1YA 2PYYA 1MXWA 1LBXA 1S7YA 2KQZA 4N81A 5I2KB 3VLVA 1IMBA 1MY1A 4H8JA 4M4GA 1NV5A 2D3IA 1IMDA 4NGUA 1AOVA 4I8CA 3KN7A 1QKAA 4GWOA 2R6GE 4NWCA 4WXJA 1LFGA 1ZIUA 4QFPA 4GRKA 1FTLA 1B46A 3QIMA 3LSWA 3JV9A 4JWXA 3EKIA 1PB7A 1LCFA 1PEBA 1B4ZA 1JW1A 5ET7A 1LSTA 2O68A 1QGXA 2XXKA 4YAHX 5IZ3B 3FXBA 4PETA 2UVHA 4QFKA 2XXWA 3NOHA 1B9JA 2RF1A 4FE8A 3RTFB 4XEQA 3KG2A 3MSTA 4GXAA 4NF8A 3MPKA 3IO6A 4OA4A 2CEYA 3VV5A 1NUXA 3UK4A 1R9QA 3DLNA 5CBRA 3FXRA 5ISUA 4H5GA 2DWAA 2H4IA 2P3VA 1BK4A 4KHZE 1MY3A 4NG7A 5BUUA 3BIGA 4ESWA 1NUZA 4MF3A 1OMPA 3QUFA 1IMAA 1MY2A 1F9BA 3SEVA 3MVYA 3L6GA 2FYIA 1MQDA 5CC2A 3RT8A 1GGGA 4C1UA 2DOJA 3T9HB 1T0KA 1UTBB 2V25A 4XTCQ 3OOAA 5DTBA 5L9SA 3A3CA 4EUOA 4HE1A 1MXZA 2V84A 1MQHA 3KC1A 1SI0A 3CG3A 4RNSA 1YCJA 3FD3A 1A8EA 3KN8A 4AS5A 4H45A 1DK4A 1FBGA 1RDYA 4PF6A 4UA8A 1FCKA 3OSQA 3SEWA 3OELA 2FIEA 3QK6A 3TELA 4KFQA 2WYPA 1KA0A 3K4UA 4KI0E 1NH7A 3M3LA 1FBPA 1YPNA 5AA4B 3H6VA 3U94A 2QFLA 3KJTA 1B40A 4OVPA 2PT2A 5H8FA 3AXFA 2F34A 4OZ9A 3DP4A 1TWYA 1FQBA 4JVCA 3M3FA 2W7YA 1USYE 3TTKA 2RCAA 3FVOA 1UQWA 3OSRA 1MPDA 4N8YA 1FPGA 1M5DA 2Q88A 3D4CA 3FVGA 1JETA 4NEDA 2WX9A 1SYIA 5ITOA 5TU0A 5I7IA 1Y1ZA 1Y9UA 3CHGA 1B2HA 2F7AA 3N5LA 4GBWA 2QS4A 1FTJA 2RINA 4LZ7A 2OZZA 2VD2A 4N8GA 4F1VA 1BLFA 4PFYA 3PUWE 2F7CA 2HHMA 1BTJA 1A7LA 4G8HA 2H5YA 1B7ZA 2I3VA 4GWZA 3JYRA 4H8IA 4PQJA 2QPQA 3W9WA 4U21A 1D9VA 2IA4A 4WEPA 5CMMA 3M3KA 5FHNA 4TLMB 1MH3A 4P3LA 1XC1A 3TTLA 1YXIA 3FXUA 3PV0E 1OIBA 4P1EA 3PGFA 1FPFA 1B0LA 1JP4A 4E0XA 4HXVA 2X7PA 4X9TA 2Y84A 1B05A 5CMKA 2Z23A 1UTBA 3H6UA 4DIGA 3K02A 1VDWA 1LBVA 1QUIA 3TZAA 3IOVA 2B3BA 4P9KA 4QBAA 1LGBC 1NNPA 4GX4A 3FASA 1NV3A 3FJMA 4THIA 1SBPA 4C0RA 3G7WA 5I56B 3USDA 4LUBA 3U8QA 5A5XA 4ECFA 2A5TA 2O84X 3IJOB 3G3KA 4G68B 1LBCA 4MNIA 2ZNTA 5AA4A 5FTHA 4H65A 4ELRA 3ROJA 4QSCA 1HSJA 3HO7A 1EU8A 3ISPA 4ZDMA 3H03A 3KOTA 1FPEA 1UTHA 4FEDA 3UA8A 3ZSFA 3H7MA 3TTRA 2Y5KA 3OEKA 5H8NB 1MY0A 3C4MA 1S9TA 2NWJA 3K1MA 3GBAA 4IGRA 4RXLA 4BLAA 1J1NA 2D5WA 4NF0A 1FJ6A 4KR5A 3IX1A 4R75A 3PTYA 4ZE8A 4IY5A 3T93B 5CMCA 3RYDA 4YB7A 4MH5A 3RPLB 4QFLA 2DP8A 1YTVA 3SDFA 5JTYA 1EZ9A 1H45A 5ELVA 1UIVA 3FZVA 3TCFA 2O7UA 4LP2B 3RLFE 3MVXA 2KR0A 3HCQA 3E4RA 4R74A 1FQDA 2XXUA 2YPNA 4NF4B 2I48A 4IY6A 2GQ1A 2WKYA 4HTGA 4PDHA 3MZ9A 1FPKA 1N84A 2Y7IA 2HQ0A 4LQ5A 5EYHA 5EYGA 3TFLA 1QUJA 4HE0A 4XKPA 5CRYA 4IO2A 4N6PA 3O28A 5FTIA 3SEYA 2O7IA 3ILTB 1B6HA 4K3FA 2UYFA 1DPEA 5EQ9A 1EZPA 4LN5A 4R2FA 3G3GA 4F29A 3PMWA 3V83A 3K01A 4AB6A 4GFRA 5ET6A 4Q30B 4KXPA 3U72A 1MXUA 5I56A 3C31A 3MZBA 3Q29A 2HAVA 1NV1A 3H6TA 1PC3A 1FPDA 1P1WA 2XXIA 1IXCA 4PFIA 1NNKA 3IR1A 2FNCA 2PFZA 4GWYA 4ELQA 2I0CA 4YKIA 4EXLA 1AMFA 4XF5A 4NF8B 3BIHA 4GQOA 4YU0A 3UIFA 1QW0A 3O66A 2OJTA 3FV2A 4H46A 3IB2A 3T9UA 4XFEA 1EYJA 1JQFA 4E0WA 3EPEA 1NFTA 4H5FA 2I49A 4PAFA 4ND9A 5B70A 4XKNA 1YYZA 3T66A 2VGQA 3TYHA 1N76A 2VOZA 3EN3A 3HHFA 3EHUA 3MWBA 4NF5A 3N94A 4TQUQ 5EQAA 3VFJA 5F7VA 4Z7EA 2YLNA 3H4ZA 5J16A 3KEIA 3MQ9A 4X1BA 2ZZWA 4O8MA 1N7XA 2JJKA 3HSTA 4F39A 3T96B 3R26A 4KPTA 1KWHA 4G2ZA 2O1MA 4EDPA 3O29A 5TP9A 2HZLA 4C1TA 1FW0A 3JZJA 3KN3A 2OLBA 4PFUA 1IXHA 3O97A 4N17A 5IKBA 1KZ8A 3KZGA 5HPQA 5LDZA 4DI4B 5FBPA 3UP9A 4NN3A 1IUDA 2XXXA 1H3DA 1DCUA 1CE2A 1OLCA 4JVDA 2I0BA 4HCYA 3IOWA 4GD5A 1BP5A 1FPBA 2Q74A 1MG1A 5H8FB 4RY1A 5DVJA 2F5XA 2AIXA 2P1SA 2QS3A 2QS1A 4PC9A 4G8NA 2I58A 1D9QA 3CG1A 3BFUA 4JXIA 3MP1A 3SERA 2Z22A
chains in the Genus database with same CATH topology
3FVKA 3O6GA 4RYAA 2HCAA 4GVOA 3MW0A 4N07A 3S9LC 1QULA 1N0TA 5I84A 4LONB 1JNFA 3HV1A 3LSXA 3B6TA 5EHSA 3O6IA 2F6PA 4JB7A 3KJ7A 3IO4A 1NMUA 3CVGA 1US5A 4OFOA 1Z7NE 2O1LA 1MQJA 1ZU0A 4LQ2A 2Q9TA 1MH4A 4BDMA 4R9FA 3MBPA 5FHOA 4HW8A 4QHQA 1N04A 2DWIA 2PX1A 2F6GA 4PE5B 2UYEA 4G4PA 5ICQA 1URSA 4I62A 4O3AA 4GL8A 1IXIA 4JWOA 4ZECA 1WDNA 4KYEA 3RT6B 2P2AA 3LSLA 2HXWA 4RK2A 4NMYA 1AL3A 1B52A 3HHGA 3RGYA 4OERA 4IO5A 1ZMGA 5L8DA 4F22A 1JVYA 1Q35A 1LAXA 2I4BA 5I59A 3PPRA 2GHBA 1MPCA 3K1NA 1FTMA 2Y7KA 1DPPA 2CZLA 4HCWA 3RUMA 1MXXA 5ITPA 4RA1A 2Z8EA 1SD3A 3RPWA 3L6HA 3MZ1A 4EQ7A 2DE4A 4F31B 2Q2AA 4QFNA 1NNFA 2Q8JA 4ZZEA 2E0SA 3ODBA 5A5XB 2A5TB 3IK6B 1D9YA 3Q28A 1OVBA 3N6TA 2ONRA 2Y7PA 3KBRA 2PT1A 1II5A 1PDAA 1URDA 3RY3A 4X1DA 3K6UA 1UTHB 3T9XB 3TQLA 4AB5A 4OXVA 5LOMA 2HFBA 3H06B 2Q89A 3IL1B 2F36A 3QAXA 5DYHA 3K1PA 1DMBA 1SI1A 3N6UA 3ONMA 4DXBA 4U1ZA 2Q2CA 2V93A 3VXBA 2GRVA 1S50A 3CSGA 4KYDA 5JTYB 3K6VA 4MBPA 5IAIA 1MXVA 2QJEA 2F35A 4M1VA 2V3TA 1HSEA 4G77A 3LR1A 1B5IA 4MLQA 3KOSA 1CB6A 4U4SA 3VLWA 3V5AA 1L5TA 4NWDA 3PUXE 2I4CA 1WODA 4OEUA 4ZEFA 1N7WA 2THIA 1FQEA 3PUZE 1MM6A 4GL0A 1LB8A 1H43A 4QSDA 1M5BA 3C33A 2OK2A 2DQVA 4F3GA 1IIWA 1B1XA 2REGA 5DEXA 3FVNA 2DYXA 4LZ8A 2V3QA 1MQIA 2XX9A 3HN0A 1I6BA 1VFEA 5B7DA 5H8HA 5AA2D 1Y20A 4R6KA 1Y4CA 1ZKBA 4KD5A 4H6DA 4OQOA 3Q25A 1D4NA 4YMAA 2DXYA 2UVIA 3B6WA 3FJGA 3BFTA 3TTMA 3H3GA 3VDFA 1O7TA 2DS9A 3SKPA 3MP6A 5CBSA 4FORA 5F1QA 4EF2A 4EXKA 4PP0A 4POXA 4BDRA 2I3WA 1B7UA 4TLLB 2G29A 1JW4A 5I2NA 4JSOA 1MDP1 4BDQA 4HS7A 3MPLA 4O3BA 4FIMA 2X26A 4IB2A 3K6WA 3ZKKA 4OHNA 4YKKA 4U4XA 1JVXA 4PFTA 2F97A 4GLIA 4BDNA 1B3GA 4NF5B 4F3SA 3G3FA 1FQCA 1USYH 3ZKLA 3U92A 5AA2A 3EHSA 1M5FA 4DCYA 1IQ7A 3FJ7A 3KSJA 1VR5A 4IO3A 3PPNA 4F3PA 5J1DA 2DE2A 1Y1MA 2B65A 1URGA 2QMWA 2O6AA 4KCCA 5TPAA 5TP9B 2F7BA 4JDFA 4ZEBA 2XXVA 4YICA 1P1OA 4L17A 1MRPA 3EHTA 3VVFA 3ECRA 2A5SA 2PMSA 4OVJA 3TCHA 2RC7A 1A54A 1B0HA 1NNTA 3PU5A 1Q1KA 4NTLA 1JEUA 4U1OA 2Z8FA 3BKIB 1ELJA 1QJMA 4WEDA 1DTZA 3M8UA 1XVYA 2OCUA 5M2VA 3GXAA 3PD9A 3TCGA 2XXRA 3DP8A 2H98A 4GIZA 1P1UA 3QSLA 1MPBA 4OESA 5EYFA 3N26A 1RYOA 4QF9A 2R9JA 1DTGA 5KDTA 1IXGA 3WAFA 1AH5A 1IZ1A 2ANJA 3I5OA 3CRBA 3S2VA 4O3CA 4TOZA 4P0IA 3R7XA 3S9MC 1MS7A 1NL5A 1FTOA 2Z8DA 1B4HA 2UXAA 3DM0A 5I58B 2CMOA 1P99A 1B51A 4OFJA 4OFLA 3V89B 3FXQA 4OEVA 4Q0CA 1B58A 2G93A 4DLDA 5JK4A 3S9EA 2QS2A 1EH3A 4JBZA 5BWJA 2UVJA 5I59B 1US4A 1B3FA 1SVXB 4IO7A 4DE8A 1D3KA 4ZEKA 3LBSA 5L9MA 5K2YA 3UGWA 4RPNA 3ZS6A 4FECA 3VXCA 1OLAA 1B3LA 4DXCA 3FUZA 5JEIA 3BBRA 3PPPA 3GLBA 1EZOA 2RKMA 3PD8A 5H8SA 4R6HA 2O51A 2HEUA 2ZNSA 3E3KA 3F11A 3IJXB 3PPOA 1LAGE 2QMXA 4KYSA 3U1OA 3A3UA 5KZTA 3MUQA 1R9LA 3DP6A 1M5CA 3EF7A 2ZXTA 4R2BA 1LBBA 1GTKA 1VFDA 4U22A 1ATGA 3I6VA 2R71A 4R72A 3R6UA 4XKRA 1QKBA 4FATA 4ISUA 3K6XA 3MVZA 3C36A 4RK9A 4N13A 1LLSA 5HBCA 1ZJLA 3OO7A 2DVCA 3D4GA 1Y3PA 4POWA 4P0GA 2ESNA 4F2OA 3K2DA 3SETA 2NVUB 1FQAA 4GOTA 2P0SA 1Y3QA 4OETA 5I58A 1XHYA 2VP1A 3OENA 3EQ1A 4RPOA 1Y3NA 1Z7ME 4ZEDA 1IEJA 1BKAA 3O2AA 1MDQA 3O9PA 4AQ4A 1ZLQA 2OWSA 3LC8A 2ONSA 1RKMA 1A40A 2DVZA 2UVGA 2NOOA 3RTWB 3FATA 5DEXB 1B3EA 3G3HA 1B1HA 1JW5A 5I57A 1LFHA 1I6AA 1IITA 3CIJA 1LFIA 3C32A 5KCJA 2AL4A 3GBBA 4YKPA 1GR2A 5H8HB 2DWJA 3OXNA 4H0WA 3Q26A 1SW5A 3OO6A 2XXQA 4ZEIA 2GFEA 4NF6A 2BJJX 3IOUA 5H8QA 3K00A 2XD3A 4YKJA 4LATA 3CFXA 1WVJA 3RQTA 4R6YA 1SW2A 1SDXA 5DT6A 5I2KA 4Z0IA 4I1DA 4MLVA 2RC9A 4QSEA 3PUYE 4F18A 3TPAA 2XHDA 1GV8A 1XS5A 1A99A 2V3UA 3CI8A 2DE3A 4F19A 4R73A 2X7QA 5I2NB 3E13X 1A55A 3G3IA 4OENA 4OWDA 4U23A 2NXOA 1VSOA 4DZ1A 1B3HA 1LAFE 5AA2B 2ZYOA 1ZTYA 4EQ9A 1HSLA 1LAHE 3QUJA 2XXTA 2IEEA 1VE4A 2F8DA 3T22A 4BDLA 3SESA 1ANFA 4IGTA 4ZZAA 5TPAB 3PUVE 4XIGQ 4PFWA 2HZKA 2ONKE 4DXUA 1N3XA 2OWTA 4LZ5A 4ONYA 1OVTA 3K0VA 3MVWA 3TDJA 2ZYNA 1XOCA 2ZMBA 3PMXA 4GF8A 2B3FA 1MXYA 3B6QA 4UACA 3TTNA 1H76A 3H6WA 2Y7RA 1NKXA 1YAEA 2DXRA 3IOTA 3UN6A 3KGCA 3LUYA 4WKMA 1I6QA 3FIRA 4YB5A 3IB1A 2GH9A 2XX7A 1P1QA 3RNNA 1B5HA 1DSNA 3VVDA 4F3BA 1NH8A 1POTA 2XD2A 1O64A 4OYVA 3QXMA 3OMBA 2ZYMA 2H99A 1R6ZA 3I3VA 3WAEA 1XT8A 3HPIA 4XKQA 4I9DA 5KDTB 1TFAA 2KLFA 3FGSA 4OTEA 3THIA 4BDOA 3TODA 4H67A 2DWHA 1GVCA 3TEPA 1FQFA 2ALUA 4ZS9A 1OQGA 5HM4B 2E1SA 1LB9A 2FA7A 1R1NA 2HAUA 3CFLA 2ZYKA 3VVEA 1PB9A 1B5JA 3Q27A 3GZGA 4F1UA 5AA3A 3C9HA 4G68C 1FTKA 4F2QA 1TXFA 2PBWA 4IO6A 3W9VA 5EHMA 4XXUA 4ELOA 4KQPA 5ICTA 1MQGA 3RN8A 5CMBA 3OO8A 3CSBA 3CFZA 3OO9A 5DVIA 3KSXA 1B32A 4YMBA 4LA9A 3TMGA 4MFIA 4FJPA 3U93A 5AA1A 2D21A 2O69A 3S9NC 1OQHA 1H44A 2VHAA 4GXSB 2VD3A 5DVFA 3UORA 5CM6A 3OEMA 1B7HA 3IORA 4RJZA 4FEBA 1M5EA 1TFDA 4QFOA 3KFMA 3TQWA 1ZBMA 1LCTA 4Q8RA 1QUKA 4YB6A 1TT1A 3C34A 4G8MA 2OBGA 4P11A 1PB8A 3B7DA 3SEUA 2DSFA 3S4UA 4U2RA 1POY1 1JEVA 4ELPA 4DDDA 1SQYA 3ILUB 1PBQA 1XVXA 3MC2A 4JWYA 3LSFB 4LVQA 2RC8A 3W15C 4NE4A 2ABHA 4FAJA 3PMVA 3MP8A 4KCDA 1UIUA 3TKDA 3VE1B 4G68A 5L9OA 3VLUA 4YZZA 5CI5A 3P7IA 1AIVA 3DELB 4Q5TA 2XX8A 3V8XB 3IB0A 1MY4A 1N3WA 4R9GA 2ZNUA 3MJNA 1DOTA 1O63A 3G3JA 4H1XA 4X48A 2QSXA 2XXPA 5H8NA 4EF1A 1Y4TA 2F78A 1MM7A 1P1NA 2QRYA 4EQBA 2H9BA 1RYXA 1SW1A 1A8FA 2M8CA 3O6HA 5K2XA 1BIYA 3TAJA 2Y7WA 2AYSA 3PPQA 1SW4A 3FV1A 3C35A 4DCXA 2H25A 2XXHA 3IAZA 3TUSA 1QVSA 2RCBA 3T9VA 2REJA 4JSDA 4ZE9A 5AE4A 4IO4A 4QRZA 5I57B 2NUVA 5FHMA 5KCJB 3CR9A 2I6EA 3OD7A 2AL5A 4ESXA 1I69A 4OMBA 1SYHA 2PVUA 2XXYA 1PBPA 3A09A 3MAMA 3E9XA 4NF6B 2YJPA 3QYTA 5H8QB 2GHAA 2QL3A 4NF4A 3SEXA 2LAOA 4F1YA 2PYYA 1MXWA 1S7YA 5I2KB 3VLVA 1MY1A 4H8JA 4M4GA 2D3IA 1AOVA 4I8CA 3KN7A 1QKAA 4GWOA 2R6GE 4NWCA 4WXJA 1LFGA 1ZIUA 4QFPA 4GRKA 1FTLA 1B46A 3QIMA 3LSWA 3JV9A 4JWXA 1PB7A 1LCFA 1PEBA 1B4ZA 1JW1A 1LSTA 2O68A 4YAHX 4PETA 2UVHA 4QFKA 2XXWA 1B9JA 2RF1A 4FE8A 3RTFB 3KG2A 4GXAA 4NF8A 3MPKA 3IO6A 3VV5A 3UK4A 1R9QA 3DLNA 5CBRA 3FXRA 5ISUA 4H5GA 2DWAA 2H4IA 4KHZE 1MY3A 5BUUA 4ESWA 4MF3A 1OMPA 3QUFA 1MY2A 1F9BA 3SEVA 3MVYA 3L6GA 2FYIA 1MQDA 5CC2A 3RT8A 1GGGA 4C1UA 2DOJA 3T9HB 1T0KA 1UTBB 2V25A 4XTCQ 3OOAA 5DTBA 5L9SA 3A3CA 4EUOA 1MXZA 2V84A 1MQHA 1SI0A 3CG3A 4RNSA 1YCJA 3FD3A 1A8EA 3KN8A 4UA8A 1FCKA 3OSQA 3SEWA 3OELA 3QK6A 3TELA 4KFQA 3K4UA 4KI0E 1NH7A 3M3LA 1YPNA 5AA4B 3H6VA 3U94A 3KJTA 1B40A 2PT2A 5H8FA 3AXFA 2F34A 4OZ9A 3DP4A 1TWYA 1FQBA 3M3FA 2W7YA 1USYE 3TTKA 2RCAA 3FVOA 1UQWA 3OSRA 1MPDA 1M5DA 2Q88A 3D4CA 3FVGA 1JETA 4NEDA 1SYIA 5ITOA 5TU0A 1Y1ZA 1Y9UA 1B2HA 2F7AA 3N5LA 2QS4A 1FTJA 2RINA 4LZ7A 2OZZA 2VD2A 4F1VA 1BLFA 4PFYA 3PUWE 2F7CA 1BTJA 1A7LA 4G8HA 2H5YA 1B7ZA 2I3VA 3JYRA 4H8IA 4PQJA 2QPQA 3W9WA 4U21A 1D9VA 2IA4A 4WEPA 5CMMA 3M3KA 5FHNA 4TLMB 1MH3A 1XC1A 3TTLA 3FXUA 3PV0E 1OIBA 3PGFA 1B0LA 4E0XA 2X7PA 4X9TA 2Y84A 1B05A 5CMKA 2Z23A 1UTBA 3H6UA 4DIGA 3K02A 1QUIA 3TZAA 3IOVA 2B3BA 1LGBC 1NNPA 3FASA 3FJMA 4THIA 1SBPA 4C0RA 3G7WA 5I56B 3USDA 4LUBA 3U8QA 5A5XA 4ECFA 2A5TA 2O84X 3IJOB 3G3KA 4G68B 1LBCA 2ZNTA 5AA4A 5FTHA 4H65A 4ELRA 4QSCA 1HSJA 3HO7A 1EU8A 4ZDMA 3H03A 3KOTA 1UTHA 4FEDA 3UA8A 3ZSFA 3H7MA 3TTRA 3OEKA 5H8NB 1MY0A 3C4MA 1S9TA 2NWJA 3K1MA 3GBAA 4IGRA 4RXLA 4BLAA 1J1NA 2D5WA 4KR5A 3IX1A 4R75A 4ZE8A 4IY5A 3T93B 5CMCA 4YB7A 4MH5A 4QFLA 2DP8A 1YTVA 3SDFA 5JTYA 1EZ9A 1H45A 5ELVA 1UIVA 3FZVA 3TCFA 2O7UA 4LP2B 3RLFE 3MVXA 3HCQA 3E4RA 4R74A 1FQDA 2XXUA 2YPNA 4NF4B 2I48A 4IY6A 2WKYA 4HTGA 3MZ9A 1N84A 2Y7IA 2HQ0A 4LQ5A 3TFLA 1QUJA 4XKPA 5CRYA 4IO2A 4N6PA 3O28A 5FTIA 3SEYA 2O7IA 3ILTB 1B6HA 4K3FA 2UYFA 1DPEA 1EZPA 4R2FA 3G3GA 4F29A 3PMWA 3V83A 3K01A 4AB6A 4GFRA 4Q30B 3U72A 1MXUA 5I56A 3C31A 3MZBA 3Q29A 2HAVA 3H6TA 1PC3A 1P1WA 2XXIA 1IXCA 1NNKA 3IR1A 2FNCA 4ELQA 2I0CA 4YKIA 4EXLA 1AMFA 4NF8B 4GQOA 4YU0A 3UIFA 1QW0A 3O66A 2OJTA 3FV2A 3IB2A 3T9UA 1JQFA 4E0WA 3EPEA 1NFTA 4H5FA 2I49A 4ND9A 5B70A 4XKNA 3T66A 2VGQA 3TYHA 1N76A 2VOZA 3EN3A 3HHFA 3EHUA 3MWBA 4NF5A 3N94A 4TQUQ 3VFJA 5F7VA 4Z7EA 2YLNA 3H4ZA 3KEIA 3MQ9A 4X1BA 1N7XA 3HSTA 4F39A 3T96B 3R26A 4KPTA 1KWHA 4G2ZA 2O1MA 4EDPA 3O29A 5TP9A 2HZLA 4C1TA 1FW0A 3JZJA 3KN3A 2OLBA 4PFUA 1IXHA 3O97A 5IKBA 3KZGA 5HPQA 3UP9A 1IUDA 2XXXA 1H3DA 1CE2A 1OLCA 2I0BA 4HCYA 3IOWA 4GD5A 1BP5A 1MG1A 5H8FB 4RY1A 5DVJA 2F5XA 2AIXA 2P1SA 2QS3A 2QS1A 2I58A 4G8NA 3CG1A 3BFUA 4JXIA 3MP1A 3SERA 2Z22A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FVK A;  3O6G A;  4RYA A;  2HCA A;  4GVO A;  3MW0 A;  4N07 A;  3S9L C;  1QUL A;  1N0T A;  5I84 A;  4LON B;  1JNF A;  3HV1 A;  3LSX A;  3B6T A;  5EHS A;  3O6I A;  2F6P A;  4JB7 A;  3KJ7 A;  3IO4 A;  1NMU A;  3CVG A;  1US5 A;  4OFO A;  1Z7N E;  2O1L A;  1MQJ A;  1ZU0 A;  4LQ2 A;  2Q9T A;  1MH4 A;  4BDM A;  4R9F A;  3MBP A;  5FHO A;  4HW8 A;  4QHQ A;  1N04 A;  2DWI A;  2PX1 A;  2F6G A;  4PE5 B;  2UYE A;  4G4P A;  5ICQ A;  1URS A;  4I62 A;  4O3A A;  4GL8 A;  1IXI A;  4JWO A;  4ZEC A;  1WDN A;  4KYE A;  3RT6 B;  2P2A A;  3LSL A;  2HXW A;  4RK2 A;  4NMY A;  1AL3 A;  1B52 A;  3HHG A;  3RGY A;  4OER A;  4IO5 A;  1ZMG A;  5L8D A;  4F22 A;  1JVY A;  1Q35 A;  1LAX A;  2I4B A;  5I59 A;  3PPR A;  2GHB A;  1MPC A;  3K1N A;  1FTM A;  2Y7K A;  1DPP A;  2CZL A;  4HCW A;  3RUM A;  1MXX A;  5ITP A;  4RA1 A;  2Z8E A;  1SD3 A;  3RPW A;  3L6H A;  3MZ1 A;  4EQ7 A;  2DE4 A;  4F31 B;  2Q2A A;  4QFN A;  1NNF A;  2Q8J A;  4ZZE A;  2E0S A;  3ODB A;  5A5X B;  2A5T B;  3IK6 B;  1D9Y A;  3Q28 A;  1OVB A;  3N6T A;  2ONR A;  2Y7P A;  3KBR A;  2PT1 A;  1II5 A;  1PDA A;  1URD A;  3RY3 A;  4X1D A;  3K6U A;  1UTH B;  3T9X B;  3TQL A;  4AB5 A;  4OXV A;  5LOM A;  2HFB A;  3H06 B;  2Q89 A;  3IL1 B;  2F36 A;  3QAX A;  5DYH A;  3K1P A;  1DMB A;  1SI1 A;  3N6U A;  3ONM A;  4DXB A;  4U1Z A;  2Q2C A;  2V93 A;  3VXB A;  2GRV A;  1S50 A;  3CSG A;  4KYD A;  5JTY B;  3K6V A;  4MBP A;  5IAI A;  1MXV A;  2QJE A;  2F35 A;  4M1V A;  2V3T A;  1HSE A;  4G77 A;  3LR1 A;  1B5I A;  4MLQ A;  3KOS A;  1CB6 A;  4U4S A;  3VLW A;  3V5A A;  1L5T A;  4NWD A;  3PUX E;  2I4C A;  1WOD A;  4OEU A;  4ZEF A;  1N7W A;  2THI A;  1FQE A;  3PUZ E;  1MM6 A;  4GL0 A;  1LB8 A;  1H43 A;  4QSD A;  1M5B A;  3C33 A;  2OK2 A;  2DQV A;  4F3G A;  1IIW A;  1B1X A;  2REG A;  5DEX A;  3FVN A;  2DYX A;  4LZ8 A;  2V3Q A;  1MQI A;  2XX9 A;  3HN0 A;  1I6B A;  1VFE A;  5B7D A;  5H8H A;  5AA2 D;  1Y20 A;  4R6K A;  1Y4C A;  1ZKB A;  4KD5 A;  4H6D A;  4OQO A;  3Q25 A;  1D4N A;  4YMA A;  2DXY A;  2UVI A;  3B6W A;  3FJG A;  3BFT A;  3TTM A;  3H3G A;  3VDF A;  1O7T A;  2DS9 A;  3SKP A;  3MP6 A;  5CBS A;  4FOR A;  5F1Q A;  4EF2 A;  4EXK A;  4PP0 A;  4POX A;  4BDR A;  2I3W A;  1B7U A;  4TLL B;  2G29 A;  1JW4 A;  5I2N A;  4JSO A;  1MDP 1;  4BDQ A;  4HS7 A;  3MPL A;  4O3B A;  4FIM A;  2X26 A;  4IB2 A;  3K6W A;  3ZKK A;  4OHN A;  4YKK A;  4U4X A;  1JVX A;  4PFT A;  2F97 A;  4GLI A;  4BDN A;  1B3G A;  4NF5 B;  4F3S A;  3G3F A;  1FQC A;  1USY H;  3ZKL A;  3U92 A;  5AA2 A;  3EHS A;  1M5F A;  4DCY A;  1IQ7 A;  3FJ7 A;  3KSJ A;  1VR5 A;  4IO3 A;  3PPN A;  4F3P A;  5J1D A;  2DE2 A;  1Y1M A;  2B65 A;  1URG A;  2QMW A;  2O6A A;  4KCC A;  5TPA A;  5TP9 B;  2F7B A;  4JDF A;  4ZEB A;  2XXV A;  4YIC A;  1P1O A;  4L17 A;  1MRP A;  3EHT A;  3VVF A;  3ECR A;  2A5S A;  2PMS A;  4OVJ A;  3TCH A;  2RC7 A;  1A54 A;  1B0H A;  1NNT A;  3PU5 A;  1Q1K A;  4NTL A;  1JEU A;  4U1O A;  2Z8F A;  3BKI B;  1ELJ A;  1QJM A;  4WED A;  1DTZ A;  3M8U A;  1XVY A;  2OCU A;  5M2V A;  3GXA A;  3PD9 A;  3TCG A;  2XXR A;  3DP8 A;  2H98 A;  4GIZ A;  1P1U A;  3QSL A;  1MPB A;  4OES A;  5EYF A;  3N26 A;  1RYO A;  4QF9 A;  2R9J A;  1DTG A;  5KDT A;  1IXG A;  3WAF A;  1AH5 A;  1IZ1 A;  2ANJ A;  3I5O A;  3CRB A;  3S2V A;  4O3C A;  4TOZ A;  4P0I A;  3R7X A;  3S9M C;  1MS7 A;  1NL5 A;  1FTO A;  2Z8D A;  1B4H A;  2UXA A;  3DM0 A;  5I58 B;  2CMO A;  1P99 A;  1B51 A;  4OFJ A;  4OFL A;  3V89 B;  3FXQ A;  4OEV A;  4Q0C A;  1B58 A;  2G93 A;  4DLD A;  5JK4 A;  3S9E A;  2QS2 A;  1EH3 A;  4JBZ A;  5BWJ A;  2UVJ A;  5I59 B;  1US4 A;  1B3F A;  1SVX B;  4IO7 A;  4DE8 A;  1D3K A;  4ZEK A;  3LBS A;  5L9M A;  5K2Y A;  3UGW A;  4RPN A;  3ZS6 A;  4FEC A;  3VXC A;  1OLA A;  1B3L A;  4DXC A;  3FUZ A;  5JEI A;  3BBR A;  3PPP A;  3GLB A;  1EZO A;  2RKM A;  3PD8 A;  5H8S A;  4R6H A;  2O51 A;  2HEU A;  2ZNS A;  3E3K A;  3F11 A;  3IJX B;  3PPO A;  1LAG E;  2QMX A;  4KYS A;  3U1O A;  3A3U A;  5KZT A;  3MUQ A;  1R9L A;  3DP6 A;  1M5C A;  3EF7 A;  2ZXT A;  4R2B A;  1LBB A;  1GTK A;  1VFD A;  4U22 A;  1ATG A;  3I6V A;  2R71 A;  4R72 A;  3R6U A;  4XKR A;  1QKB A;  4FAT A;  4ISU A;  3K6X A;  3MVZ A;  3C36 A;  4RK9 A;  4N13 A;  1LLS A;  5HBC A;  1ZJL A;  3OO7 A;  2DVC A;  3D4G A;  1Y3P A;  4POW A;  4P0G A;  2ESN A;  4F2O A;  3K2D A;  3SET A;  2NVU B;  1FQA A;  4GOT A;  2P0S A;  1Y3Q A;  4OET A;  5I58 A;  1XHY A;  2VP1 A;  3OEN A;  3EQ1 A;  4RPO A;  1Y3N A;  1Z7M E;  4ZED A;  1IEJ A;  1BKA A;  3O2A A;  1MDQ A;  3O9P A;  4AQ4 A;  1ZLQ A;  2OWS A;  3LC8 A;  2ONS A;  1RKM A;  1A40 A;  2DVZ A;  2UVG A;  2NOO A;  3RTW B;  3FAT A;  5DEX B;  1B3E A;  3G3H A;  1B1H A;  1JW5 A;  5I57 A;  1LFH A;  1I6A A;  1IIT A;  3CIJ A;  1LFI A;  3C32 A;  5KCJ A;  2AL4 A;  3GBB A;  4YKP A;  1GR2 A;  5H8H B;  2DWJ A;  3OXN A;  4H0W A;  3Q26 A;  1SW5 A;  3OO6 A;  2XXQ A;  4ZEI A;  2GFE A;  4NF6 A;  2BJJ X;  3IOU A;  5H8Q A;  3K00 A;  2XD3 A;  4YKJ A;  4LAT A;  3CFX A;  1WVJ A;  3RQT A;  4R6Y A;  1SW2 A;  1SDX A;  5DT6 A;  5I2K A;  4Z0I A;  4I1D A;  4MLV A;  2RC9 A;  4QSE A;  3PUY E;  4F18 A;  3TPA A;  2XHD A;  1GV8 A;  1XS5 A;  1A99 A;  2V3U A;  3CI8 A;  2DE3 A;  4F19 A;  4R73 A;  2X7Q A;  5I2N B;  3E13 X;  1A55 A;  3G3I A;  4OEN A;  4OWD A;  4U23 A;  2NXO A;  1VSO A;  4DZ1 A;  1B3H A;  1LAF E;  5AA2 B;  2ZYO A;  1ZTY A;  4EQ9 A;  1HSL A;  1LAH E;  3QUJ A;  2XXT A;  2IEE A;  1VE4 A;  2F8D A;  3T22 A;  4BDL A;  3SES A;  1ANF A;  4IGT A;  4ZZA A;  5TPA B;  3PUV E;  4XIG Q;  4PFW A;  2HZK A;  2ONK E;  4DXU A;  1N3X A;  2OWT A;  4LZ5 A;  4ONY A;  1OVT A;  3K0V A;  3MVW A;  3TDJ A;  2ZYN A;  1XOC A;  2ZMB A;  3PMX A;  4GF8 A;  2B3F A;  1MXY A;  3B6Q A;  4UAC A;  3TTN A;  1H76 A;  3H6W A;  2Y7R A;  1NKX A;  1YAE A;  2DXR A;  3IOT A;  3UN6 A;  3KGC A;  3LUY A;  4WKM A;  1I6Q A;  3FIR A;  4YB5 A;  3IB1 A;  2GH9 A;  2XX7 A;  1P1Q A;  3RNN A;  1B5H A;  1DSN A;  3VVD A;  4F3B A;  1NH8 A;  1POT A;  2XD2 A;  1O64 A;  4OYV A;  3QXM A;  3OMB A;  2ZYM A;  2H99 A;  1R6Z A;  3I3V A;  3WAE A;  1XT8 A;  3HPI A;  4XKQ A;  4I9D A;  5KDT B;  1TFA A;  2KLF A;  3FGS A;  4OTE A;  3THI A;  4BDO A;  3TOD A;  4H67 A;  2DWH A;  1GVC A;  3TEP A;  1FQF A;  2ALU A;  4ZS9 A;  1OQG A;  5HM4 B;  2E1S A;  1LB9 A;  2FA7 A;  1R1N A;  2HAU A;  3CFL A;  2ZYK A;  3VVE A;  1PB9 A;  1B5J A;  3Q27 A;  3GZG A;  4F1U A;  5AA3 A;  3C9H A;  4G68 C;  1FTK A;  4F2Q A;  1TXF A;  2PBW A;  4IO6 A;  3W9V A;  5EHM A;  4XXU A;  4ELO A;  4KQP A;  5ICT A;  1MQG A;  3RN8 A;  5CMB A;  3OO8 A;  3CSB A;  3CFZ A;  3OO9 A;  5DVI A;  3KSX A;  1B32 A;  4YMB A;  4LA9 A;  3TMG A;  4MFI A;  4FJP A;  3U93 A;  5AA1 A;  2D21 A;  2O69 A;  3S9N C;  1OQH A;  1H44 A;  2VHA A;  4GXS B;  2VD3 A;  5DVF A;  3UOR A;  5CM6 A;  3OEM A;  1B7H A;  3IOR A;  4RJZ A;  4FEB A;  1M5E A;  1TFD A;  4QFO A;  3KFM A;  3TQW A;  1ZBM A;  1LCT A;  4Q8R A;  1QUK A;  4YB6 A;  1TT1 A;  3C34 A;  4G8M A;  2OBG A;  4P11 A;  1PB8 A;  3B7D A;  3SEU A;  2DSF A;  3S4U A;  4U2R A;  1POY 1;  1JEV A;  4ELP A;  4DDD A;  1SQY A;  3ILU B;  1PBQ A;  1XVX A;  3MC2 A;  4JWY A;  3LSF B;  4LVQ A;  2RC8 A;  3W15 C;  4NE4 A;  2ABH A;  4FAJ A;  3PMV A;  3MP8 A;  4KCD A;  1UIU A;  3TKD A;  3VE1 B;  4G68 A;  5L9O A;  3VLU A;  4YZZ A;  5CI5 A;  3P7I A;  1AIV A;  3DEL B;  4Q5T A;  2XX8 A;  3V8X B;  3IB0 A;  1MY4 A;  1N3W A;  4R9G A;  2ZNU A;  3MJN A;  1DOT A;  1O63 A;  3G3J A;  4H1X A;  4X48 A;  2QSX A;  2XXP A;  5H8N A;  4EF1 A;  1Y4T A;  2F78 A;  1MM7 A;  1P1N A;  2QRY A;  4EQB A;  2H9B A;  1RYX A;  1SW1 A;  1A8F A;  2M8C A;  3O6H A;  5K2X A;  1BIY A;  3TAJ A;  2Y7W A;  2AYS A;  3PPQ A;  1SW4 A;  3FV1 A;  3C35 A;  4DCX A;  2H25 A;  2XXH A;  3IAZ A;  3TUS A;  1QVS A;  2RCB A;  3T9V A;  2REJ A;  4JSD A;  4ZE9 A;  5AE4 A;  4IO4 A;  4QRZ A;  5I57 B;  2NUV A;  5FHM A;  5KCJ B;  3CR9 A;  2I6E A;  3OD7 A;  2AL5 A;  4ESX A;  1I69 A;  4OMB A;  1SYH A;  2PVU A;  2XXY A;  1PBP A;  3A09 A;  3MAM A;  3E9X A;  4NF6 B;  2YJP A;  3QYT A;  5H8Q B;  2GHA A;  2QL3 A;  4NF4 A;  3SEX A;  2LAO A;  4F1Y A;  2PYY A;  1MXW A;  1S7Y A;  5I2K B;  3VLV A;  1MY1 A;  4H8J A;  4M4G A;  2D3I A;  1AOV A;  4I8C A;  3KN7 A;  1QKA A;  4GWO A;  2R6G E;  4NWC A;  4WXJ A;  1LFG A;  1ZIU A;  4QFP A;  4GRK A;  1FTL A;  1B46 A;  3QIM A;  3LSW A;  3JV9 A;  4JWX A;  1PB7 A;  1LCF A;  1PEB A;  1B4Z A;  1JW1 A;  1LST A;  2O68 A;  4YAH X;  4PET A;  2UVH A;  4QFK A;  2XXW A;  1B9J A;  2RF1 A;  4FE8 A;  3RTF B;  3KG2 A;  4GXA A;  4NF8 A;  3MPK A;  3IO6 A;  3VV5 A;  3UK4 A;  1R9Q A;  3DLN A;  5CBR A;  3FXR A;  5ISU A;  4H5G A;  2DWA A;  2H4I A;  4KHZ E;  1MY3 A;  5BUU A;  4ESW A;  4MF3 A;  1OMP A;  3QUF A;  1MY2 A;  1F9B A;  3SEV A;  3MVY A;  3L6G A;  2FYI A;  1MQD A;  5CC2 A;  3RT8 A;  1GGG A;  4C1U A;  2DOJ A;  3T9H B;  1T0K A;  1UTB B;  2V25 A;  4XTC Q;  3OOA A;  5DTB A;  5L9S A;  3A3C A;  4EUO A;  1MXZ A;  2V84 A;  1MQH A;  1SI0 A;  3CG3 A;  4RNS A;  1YCJ A;  3FD3 A;  1A8E A;  3KN8 A;  4UA8 A;  1FCK A;  3OSQ A;  3SEW A;  3OEL A;  3QK6 A;  3TEL A;  4KFQ A;  3K4U A;  4KI0 E;  1NH7 A;  3M3L A;  1YPN A;  5AA4 B;  3H6V A;  3U94 A;  3KJT A;  1B40 A;  2PT2 A;  5H8F A;  3AXF A;  2F34 A;  4OZ9 A;  3DP4 A;  1TWY A;  1FQB A;  3M3F A;  2W7Y A;  1USY E;  3TTK A;  2RCA A;  3FVO A;  1UQW A;  3OSR A;  1MPD A;  1M5D A;  2Q88 A;  3D4C A;  3FVG A;  1JET A;  4NED A;  1SYI A;  5ITO A;  5TU0 A;  1Y1Z A;  1Y9U A;  1B2H A;  2F7A A;  3N5L A;  2QS4 A;  1FTJ A;  2RIN A;  4LZ7 A;  2OZZ A;  2VD2 A;  4F1V A;  1BLF A;  4PFY A;  3PUW E;  2F7C A;  1BTJ A;  1A7L A;  4G8H A;  2H5Y A;  1B7Z A;  2I3V A;  3JYR A;  4H8I A;  4PQJ A;  2QPQ A;  3W9W A;  4U21 A;  1D9V A;  2IA4 A;  4WEP A;  5CMM A;  3M3K A;  5FHN A;  4TLM B;  1MH3 A;  1XC1 A;  3TTL A;  3FXU A;  3PV0 E;  1OIB A;  3PGF A;  1B0L A;  4E0X A;  2X7P A;  4X9T A;  2Y84 A;  1B05 A;  5CMK A;  2Z23 A;  1UTB A;  3H6U A;  4DIG A;  3K02 A;  1QUI A;  3TZA A;  3IOV A;  2B3B A;  1LGB C;  1NNP A;  3FAS A;  3FJM A;  4THI A;  1SBP A;  4C0R A;  3G7W A;  5I56 B;  3USD A;  4LUB A;  3U8Q A;  5A5X A;  4ECF A;  2A5T A;  2O84 X;  3IJO B;  3G3K A;  4G68 B;  1LBC A;  2ZNT A;  5AA4 A;  5FTH A;  4H65 A;  4ELR A;  4QSC A;  1HSJ A;  3HO7 A;  1EU8 A;  4ZDM A;  3H03 A;  3KOT A;  1UTH A;  4FED A;  3UA8 A;  3ZSF A;  3H7M A;  3TTR A;  3OEK A;  5H8N B;  1MY0 A;  3C4M A;  1S9T A;  2NWJ A;  3K1M A;  3GBA A;  4IGR A;  4RXL A;  4BLA A;  1J1N A;  2D5W A;  4KR5 A;  3IX1 A;  4R75 A;  4ZE8 A;  4IY5 A;  3T93 B;  5CMC A;  4YB7 A;  4MH5 A;  4QFL A;  2DP8 A;  1YTV A;  3SDF A;  5JTY A;  1EZ9 A;  1H45 A;  5ELV A;  1UIV A;  3FZV A;  3TCF A;  2O7U A;  4LP2 B;  3RLF E;  3MVX A;  3HCQ A;  3E4R A;  4R74 A;  1FQD A;  2XXU A;  2YPN A;  4NF4 B;  2I48 A;  4IY6 A;  2WKY A;  4HTG A;  3MZ9 A;  1N84 A;  2Y7I A;  2HQ0 A;  4LQ5 A;  3TFL A;  1QUJ A;  4XKP A;  5CRY A;  4IO2 A;  4N6P A;  3O28 A;  5FTI A;  3SEY A;  2O7I A;  3ILT B;  1B6H A;  4K3F A;  2UYF A;  1DPE A;  1EZP A;  4R2F A;  3G3G A;  4F29 A;  3PMW A;  3V83 A;  3K01 A;  4AB6 A;  4GFR A;  4Q30 B;  3U72 A;  1MXU A;  5I56 A;  3C31 A;  3MZB A;  3Q29 A;  2HAV A;  3H6T A;  1PC3 A;  1P1W A;  2XXI A;  1IXC A;  1NNK A;  3IR1 A;  2FNC A;  4ELQ A;  2I0C A;  4YKI A;  4EXL A;  1AMF A;  4NF8 B;  4GQO A;  4YU0 A;  3UIF A;  1QW0 A;  3O66 A;  2OJT A;  3FV2 A;  3IB2 A;  3T9U A;  1JQF A;  4E0W A;  3EPE A;  1NFT A;  4H5F A;  2I49 A;  4ND9 A;  5B70 A;  4XKN A;  3T66 A;  2VGQ A;  3TYH A;  1N76 A;  2VOZ A;  3EN3 A;  3HHF A;  3EHU A;  3MWB A;  4NF5 A;  3N94 A;  4TQU Q;  3VFJ A;  5F7V A;  4Z7E A;  2YLN A;  3H4Z A;  3KEI A;  3MQ9 A;  4X1B A;  1N7X A;  3HST A;  4F39 A;  3T96 B;  3R26 A;  4KPT A;  1KWH A;  4G2Z A;  2O1M A;  4EDP A;  3O29 A;  5TP9 A;  2HZL A;  4C1T A;  1FW0 A;  3JZJ A;  3KN3 A;  2OLB A;  4PFU A;  1IXH A;  3O97 A;  5IKB A;  3KZG A;  5HPQ A;  3UP9 A;  1IUD A;  2XXX A;  1H3D A;  1CE2 A;  1OLC A;  2I0B A;  4HCY A;  3IOW A;  4GD5 A;  1BP5 A;  1MG1 A;  5H8F B;  4RY1 A;  5DVJ A;  2F5X A;  2AIX A;  2P1S A;  2QS3 A;  2QS1 A;  2I58 A;  4G8N A;  3CG1 A;  3BFU A;  4JXI A;  3MP1 A;  3SER A;  2Z22 A; 
#chains in the Genus database with same CATH topology
 3FVK A;  3O6G A;  4RYA A;  2HCA A;  4GVO A;  3MW0 A;  4N07 A;  3S9L C;  1QUL A;  1N0T A;  5I84 A;  5IZ1 A;  4LON B;  1JNF A;  3HV1 A;  3LSX A;  3B6T A;  5EHS A;  3O6I A;  2F6P A;  1IME A;  4JB7 A;  3KJ7 A;  3IO4 A;  1NMU A;  3CVG A;  4OAN A;  4PTK A;  1US5 A;  3GYY A;  1FPL A;  4OFO A;  1Z7N E;  2O1L A;  1MQJ A;  2V4C A;  1ZU0 A;  4LQ2 A;  2Q9T A;  1MH4 A;  4BDM A;  4R9F A;  3MBP A;  4NX1 A;  5FHO A;  4HW8 A;  4QHQ A;  1N04 A;  2DWI A;  2PX1 A;  2F6G A;  1NV4 A;  1CNQ A;  4PE5 B;  2UYE A;  4G4P A;  5ICQ A;  1URS A;  4NQ8 A;  4FBP A;  4I62 A;  4O3A A;  4GL8 A;  1IXI A;  4JWO A;  1FBH A;  4P1L A;  2CZH A;  4ZEC A;  1WDN A;  4KYE A;  3RT6 B;  2P2A A;  3LSL A;  2HXW A;  4RK2 A;  4NMY A;  1AL3 A;  1B52 A;  2B4L A;  3HHG A;  3RGY A;  4OER A;  4IO5 A;  1ZMG A;  5L8D A;  4F22 A;  1JVY A;  1Q35 A;  1LAX A;  2I4B A;  5I59 A;  3PPR A;  2GHB A;  1MPC A;  3K1N A;  1FTM A;  2Y7K A;  1DPP A;  2CZL A;  4HCW A;  3RUM A;  1MXX A;  4DI3 D;  5ITP A;  1EYI A;  4RA1 A;  2Z8E A;  1SD3 A;  3RPW A;  3L6H A;  3MZ1 A;  4EQ7 A;  2DE4 A;  1Q9D A;  4F31 B;  3SZP A;  2Q2A A;  4QFN A;  1NNF A;  2Q8J A;  5EQ7 A;  4ZZE A;  4PBQ A;  4N15 A;  2E0S A;  3ODB A;  5A5X B;  2A5T B;  2XWK A;  3IK6 B;  1D9Y A;  3Q28 A;  1OVB A;  3N6T A;  2ONR A;  2Y7P A;  3KBR A;  2PT1 A;  1II5 A;  1PDA A;  1G0I A;  1URD A;  3RY3 A;  4X1D A;  3U65 A;  3K6U A;  1UTH B;  3T9X B;  1K9Y A;  3TQL A;  4AB5 A;  4OXV A;  5LOM A;  2HFB A;  3H06 B;  2Q89 A;  3IL1 B;  4I40 A;  2F36 A;  3QAX A;  5DYH A;  3K1P A;  1DMB A;  1SI1 A;  1FBD A;  3N6U A;  4O7I A;  3ONM A;  4DXB A;  4U1Z A;  4PDD A;  2Q2C A;  4GWX A;  4MNP A;  2V93 A;  1NV0 A;  3VXB A;  2GRV A;  1FTA A;  1S50 A;  3CSG A;  4KYD A;  1LEV A;  5JTY B;  3K6V A;  4MBP A;  5IAI A;  1MXV A;  2QJE A;  2F35 A;  4M1V A;  2V3T A;  2PCR A;  1HSE A;  4G77 A;  3LR1 A;  1B5I A;  4MLQ A;  3IFA A;  3KOS A;  1CB6 A;  2WYK A;  4U4S A;  3VLW A;  3V5A A;  1L5T A;  4NWD A;  3PUX E;  2I4C A;  1WOD A;  2BJI A;  4OEU A;  4ZEF A;  1N7W A;  2THI A;  1FQE A;  3PUZ E;  4PBH A;  1MM6 A;  4GL0 A;  1LB8 A;  1H43 A;  4QSD A;  1M5B A;  1LBW A;  3C33 A;  2OK2 A;  2DQV A;  4F3G A;  1IIW A;  1B1X A;  2REG A;  5DEX A;  3FVN A;  2DYX A;  4LZ8 A;  2V3Q A;  1MQI A;  2XX9 A;  3IFC A;  3HN0 A;  1I6B A;  1NI9 A;  1VFE A;  5B7D A;  5H8H A;  5AA2 D;  1DBZ A;  1Y20 A;  4R6K A;  1Y4C A;  1ZKB A;  3B8B A;  4KD5 A;  4H6D A;  4OQO A;  1FJ9 A;  3Q25 A;  1D4N A;  3KBZ A;  5EQ8 A;  4YMA A;  2DXY A;  3QMF A;  2UVI A;  3B6W A;  3FJG A;  3BFT A;  2XA5 A;  4GWS A;  3E78 A;  3TTM A;  3H3G A;  3VDF A;  1EYK A;  1O7T A;  2DS9 A;  2XWI A;  3SKP A;  1RDZ A;  3MP6 A;  5CBS A;  4FOR A;  5F1Q A;  4EF2 A;  4MHF A;  4EXK A;  4PP0 A;  4POX A;  4MJO A;  4N6D A;  4BDR A;  2I3W A;  1B7U A;  4TLL B;  2G29 A;  1JW4 A;  5I2N A;  4JSO A;  1MDP 1;  1SPI A;  4BDQ A;  4HS7 A;  3MPL A;  4O3B A;  1KA1 A;  4FIM A;  2X26 A;  4IB2 A;  3K6W A;  3ZKK A;  4OHN A;  4YKK A;  4U4X A;  1JVX A;  4PFT A;  5I3S A;  2F97 A;  4GLI A;  4BDN A;  1B3G A;  4NF5 B;  4F3S A;  3G3F A;  1FQC A;  1USY H;  3ZKL A;  4MNC A;  3U92 A;  5AA2 A;  3EHS A;  1M5F A;  4DCY A;  1IQ7 A;  3FJ7 A;  3KSJ A;  1VR5 A;  4IO3 A;  3PPN A;  4F3P A;  5J1D A;  2DE2 A;  1Y1M A;  2B65 A;  1URG A;  2QMW A;  2O6A A;  4KCC A;  5TPA A;  5TP9 B;  2F7B A;  4JDF A;  4OVT A;  4ZEB A;  2XXV A;  5ET8 A;  4YIC A;  1P1O A;  2ZZX A;  2FBP A;  4L17 A;  1MRP A;  3EHT A;  4P8B A;  2VPO A;  3VVF A;  4GX6 A;  3ECR A;  2CZK A;  2ZZV A;  2A5S A;  2PMS A;  4OVJ A;  3TCH A;  2RC7 A;  1A54 A;  1B0H A;  2OX3 A;  5ET5 A;  1NNT A;  3PU5 A;  1Q1K A;  4NTL A;  1JEU A;  4U1O A;  2Z8F A;  3BKI B;  1ELJ A;  1QJM A;  4WED A;  1DTZ A;  2Q8M A;  3M8U A;  1XVY A;  2OCU A;  2FVZ A;  5M2V A;  3GXA A;  3PD9 A;  3TCG A;  1FRP A;  2XXR A;  3DP8 A;  2H98 A;  4GIZ A;  1P1U A;  3QSL A;  1MPB A;  4OES A;  5EYF A;  3N26 A;  3LV0 A;  1RYO A;  4QF9 A;  2R9J A;  1DTG A;  5KDT A;  1IXG A;  3WAF A;  1AH5 A;  1IZ1 A;  2ANJ A;  3I5O A;  3CRB A;  3S2V A;  4O3C A;  4TOZ A;  3KC0 A;  4P0I A;  3R7X A;  3S9M C;  1MS7 A;  1NL5 A;  1FTO A;  2Z8D A;  1B4H A;  4OVR A;  2UXA A;  3DM0 A;  5I58 B;  2CMO A;  1P99 A;  1B51 A;  4OFJ A;  4OFL A;  3V89 B;  3FXQ A;  4OEV A;  1INP A;  4Q0C A;  1B58 A;  2G93 A;  4DLD A;  1XI6 A;  5JK4 A;  3S9E A;  2QS2 A;  1EH3 A;  4JBZ A;  5BWJ A;  2UVJ A;  5I59 B;  1US4 A;  1B3F A;  2WBB A;  1SVX B;  4IO7 A;  4DE8 A;  1D3K A;  4ZEK A;  5T3J A;  3LBS A;  5L9M A;  1K9Z A;  4G61 A;  5K2Y A;  3UGW A;  2MKZ A;  4RPN A;  3ZS6 A;  4FEC A;  3VXC A;  1OLA A;  4O7M A;  3MYU A;  4O94 A;  3LUZ A;  1B3L A;  4DXC A;  3FUZ A;  5JEI A;  1IMF A;  3BBR A;  3PPP A;  3GLB A;  5ESY A;  1EZO A;  2RKM A;  1LBZ A;  3PD8 A;  5I5P A;  5H8S A;  4R6H A;  4GX3 A;  1FBE A;  2O51 A;  2HEU A;  2ZNS A;  3E3K A;  3F11 A;  3IJX B;  3PPO A;  1LAG E;  2QMX A;  4KYS A;  4PAI A;  3A3U A;  3U1O A;  5KZT A;  3MUQ A;  1R9L A;  1IMC A;  3DP6 A;  4OVS A;  1M5C A;  3EF7 A;  2ZXT A;  4R2B A;  1LBB A;  1GTK A;  1VFD A;  4U22 A;  1ATG A;  3I6V A;  2R71 A;  4R72 A;  2QVR A;  3R6U A;  4XKR A;  1QKB A;  4FAT A;  2XWO A;  4ISU A;  4P47 A;  4P56 A;  4PCD A;  3K6X A;  3MVZ A;  3C36 A;  4RK9 A;  4GWU A;  4N13 A;  5IGA A;  1LLS A;  5HBC A;  1ZJL A;  3OO7 A;  2F3D A;  3D1R A;  4GWW A;  3T0J A;  2DVC A;  3D4G A;  1Y3P A;  4POW A;  4MEV A;  4P0G A;  2ESN A;  1FPJ A;  5A5L A;  4F2O A;  4PF8 A;  2HXR A;  3K2D A;  3SET A;  3T1B A;  2NVU B;  1FQA A;  5F24 A;  3HFU A;  4GOT A;  2P0S A;  1Y3Q A;  4OET A;  5I58 A;  1XHY A;  2VP1 A;  3OEN A;  4PGP A;  3EQ1 A;  4RPO A;  1Y3N A;  1Z7M E;  4ZED A;  1IEJ A;  4N6K A;  4N4U A;  1BKA A;  3O2A A;  4MAG A;  1MDQ A;  3O9P A;  4AQ4 A;  1ZLQ A;  2OWS A;  3LC8 A;  2ONS A;  1RKM A;  1A40 A;  2DVZ A;  2UVG A;  2NOO A;  3RTW B;  3FAT A;  1NV6 A;  5DEX B;  1B3E A;  3G3H A;  1B1H A;  4MIJ A;  1JW5 A;  5I57 A;  4NHB A;  1LFH A;  1I6A A;  1IIT A;  3CIJ A;  1LFI A;  3C32 A;  5KCJ A;  2AL4 A;  3GBB A;  4YKP A;  1GR2 A;  5H8H B;  2DWJ A;  3OXN A;  4H0W A;  3Q26 A;  1SW5 A;  4MMP A;  3OO6 A;  2XXQ A;  4ZEI A;  2GFE A;  4NF6 A;  2BJJ X;  3IOU A;  5H8Q A;  3K00 A;  2XD3 A;  4HE2 A;  4YKJ A;  4LAT A;  5IM2 A;  3CFX A;  1WVJ A;  1RDX A;  3RQT A;  4R6Y A;  1SW2 A;  1SDX A;  5DT6 A;  5I2K A;  2F3B A;  4Z0I A;  4I1D A;  4MLV A;  2RC9 A;  4QSE A;  3PUY E;  4F18 A;  3TPA A;  2XHD A;  1GV8 A;  1XS5 A;  1A99 A;  4NAP A;  2V3U A;  3CI8 A;  2DE3 A;  4F19 A;  4R73 A;  4MCO A;  2OWZ A;  2X7Q A;  2VPN A;  5I2N B;  3E13 X;  1A55 A;  3G3I A;  4OEN A;  2CEX A;  4OWD A;  4I3E A;  4U23 A;  4I3Y A;  2B4M A;  4MX6 A;  2NXO A;  1VSO A;  4DZ1 A;  1B3H A;  5IZ3 A;  1LAF E;  2FHY A;  5AA2 B;  2ZYO A;  1ZTY A;  4PGN A;  4EQ9 A;  4UAB A;  1HSL A;  1LAH E;  1NV7 A;  3QUJ A;  2XXT A;  2IEE A;  1VE4 A;  2F8D A;  3T22 A;  2L5V A;  4BDL A;  3SES A;  1ANF A;  4IGT A;  4ZZA A;  5TPA B;  1FBF A;  3PUV E;  4XIG Q;  4PE3 A;  4PFW A;  2HZK A;  2ONK E;  1NV2 A;  4DXU A;  1N3X A;  2OWT A;  4LZ5 A;  4ONY A;  1OVT A;  1AWB A;  3K0V A;  3MVW A;  3TDJ A;  2ZYN A;  1XOC A;  2ZMB A;  3PMX A;  4GF8 A;  2B3F A;  1MXY A;  3B6Q A;  3E79 A;  4UAC A;  3TTN A;  1H76 A;  3H6W A;  2Y7R A;  2FIX A;  1NKX A;  1YAE A;  2DXR A;  3IOT A;  1FPI A;  3UN6 A;  3KGC A;  3LUY A;  4WKM A;  1I6Q A;  3FIR A;  4YB5 A;  3IB1 A;  2GH9 A;  2XX7 A;  1P1Q A;  5LTC A;  3RNN A;  1B5H A;  1DSN A;  3VVD A;  4F3B A;  1NH8 A;  1POT A;  2XD2 A;  1O64 A;  4OYV A;  3QXM A;  3OMB A;  2ZYM A;  2H99 A;  5DW8 A;  2HPG A;  1R6Z A;  3I3V A;  3WAE A;  1XT8 A;  2WBD A;  3HPI A;  4XKQ A;  4I9D A;  5KDT B;  1TFA A;  2KLF A;  3FGS A;  2QVV A;  4OTE A;  3THI A;  4BDO A;  3TOD A;  4H67 A;  2DWH A;  1GVC A;  3TEP A;  1FQF A;  2ALU A;  4ZS9 A;  1OQG A;  5HM4 B;  2E1S A;  1LB9 A;  2FA7 A;  1R1N A;  2HAU A;  3CFL A;  2ZYK A;  3VVE A;  1PB9 A;  1B5J A;  4PFB A;  3Q27 A;  3GZG A;  4F1U A;  5AA3 A;  3C9H A;  4G68 C;  1FTK A;  4F2Q A;  4PFR A;  1TXF A;  2PBW A;  4IO6 A;  3W9V A;  4AS4 A;  5EHM A;  4XXU A;  4ELO A;  4KQP A;  4QXD A;  5ICT A;  1MQG A;  3RN8 A;  5CMB A;  3OO8 A;  3CSB A;  3CFZ A;  3OO9 A;  5DVI A;  3KSX A;  1B32 A;  4YMB A;  4X8R A;  4LA9 A;  1YZ0 A;  3TMG A;  4MFI A;  4FJP A;  3U93 A;  2XWV A;  5AA1 A;  2D21 A;  2O69 A;  3S9N C;  1OQH A;  1H44 A;  2VHA A;  1LBY A;  2R8T A;  4GXS B;  2VD3 A;  2VT5 A;  5DVF A;  3UOR A;  5CM6 A;  2WEF A;  3OEM A;  1B7H A;  3IOR A;  4RJZ A;  2P3N A;  4GBV A;  4FEB A;  1M5E A;  2QVU A;  1TFD A;  4QFO A;  3KFM A;  3TQW A;  4X04 A;  1ZBM A;  1LCT A;  4Q8R A;  1QUK A;  4YB6 A;  1TT1 A;  3C34 A;  4G8M A;  2OBG A;  4P11 A;  1PB8 A;  3B7D A;  3SEU A;  2DSF A;  3S4U A;  4U2R A;  1POY 1;  1JEV A;  4ELP A;  4DDD A;  1SQY A;  3ILU B;  1PBQ A;  1XVX A;  3MC2 A;  4JWY A;  3LSF B;  4LVQ A;  2RC8 A;  3W15 C;  4NE4 A;  2ABH A;  4FAJ A;  3PMV A;  3MP8 A;  4KCD A;  1UIU A;  3TKD A;  3VE1 B;  3A29 A;  4G68 A;  4OVQ A;  5L9O A;  4IR8 A;  3VLU A;  4YZZ A;  5CI5 A;  3P7I A;  1AIV A;  3DEL B;  4Q5T A;  2XX8 A;  3V8X B;  3IB0 A;  1MY4 A;  1N3W A;  1FBC A;  4R9G A;  2ZNU A;  3MJN A;  1DOT A;  1O63 A;  3G3J A;  4H1X A;  4X48 A;  2QSX A;  2XXP A;  5H8N A;  4EF1 A;  1G0H A;  4JVI A;  5IZZ A;  1Y4T A;  2F78 A;  1MM7 A;  1P1N A;  2QRY A;  4EQB A;  2H9B A;  1RYX A;  1SW1 A;  1A8F A;  2M8C A;  3O6H A;  5K2X A;  1BIY A;  2DDK A;  3TAJ A;  2Y7W A;  2AYS A;  3PPQ A;  1SW4 A;  3FV1 A;  3C35 A;  4DCX A;  2H25 A;  2XXH A;  3IAZ A;  3TUS A;  1QVS A;  2RCB A;  3FBP A;  3T9V A;  3B50 A;  2REJ A;  3RPL A;  4JSD A;  4ZE9 A;  5AE4 A;  1FSA A;  4QRZ A;  4IO4 A;  4N91 A;  5I57 B;  2NUV A;  5FHM A;  5KCJ B;  3CR9 A;  2I6E A;  2CZI A;  3OD7 A;  2AL5 A;  4ESX A;  4PAK A;  1I69 A;  4OMB A;  1SYH A;  2PVU A;  2XXY A;  2Y5L A;  1PBP A;  1NUW A;  3A09 A;  3MAM A;  2PFY A;  3E9X A;  4NF6 B;  2YJP A;  3QYT A;  5H8Q B;  2GHA A;  2QL3 A;  4NF4 A;  3SEX A;  1NUY A;  2LAO A;  4F1Y A;  2PYY A;  1MXW A;  1LBX A;  1S7Y A;  2KQZ A;  4N81 A;  5I2K B;  3VLV A;  1IMB A;  1MY1 A;  4H8J A;  4M4G A;  1NV5 A;  2D3I A;  1IMD A;  4NGU A;  1AOV A;  4I8C A;  3KN7 A;  1QKA A;  4GWO A;  2R6G E;  4NWC A;  4WXJ A;  1LFG A;  1ZIU A;  4QFP A;  4GRK A;  1FTL A;  1B46 A;  3QIM A;  3LSW A;  3JV9 A;  4JWX A;  3EKI A;  1PB7 A;  1LCF A;  1PEB A;  1B4Z A;  1JW1 A;  5ET7 A;  1LST A;  2O68 A;  1QGX A;  2XXK A;  4YAH X;  5IZ3 B;  3FXB A;  4PET A;  2UVH A;  4QFK A;  2XXW A;  3NOH A;  1B9J A;  2RF1 A;  4FE8 A;  3RTF B;  4XEQ A;  3KG2 A;  3MST A;  4GXA A;  4NF8 A;  3MPK A;  3IO6 A;  4OA4 A;  2CEY A;  3VV5 A;  1NUX A;  3UK4 A;  1R9Q A;  3DLN A;  5CBR A;  3FXR A;  5ISU A;  4H5G A;  2DWA A;  2H4I A;  2P3V A;  1BK4 A;  4KHZ E;  1MY3 A;  4NG7 A;  5BUU A;  3BIG A;  4ESW A;  1NUZ A;  4MF3 A;  1OMP A;  3QUF A;  1IMA A;  1MY2 A;  1F9B A;  3SEV A;  3MVY A;  3L6G A;  2FYI A;  1MQD A;  5CC2 A;  3RT8 A;  1GGG A;  4C1U A;  2DOJ A;  3T9H B;  1T0K A;  1UTB B;  2V25 A;  4XTC Q;  3OOA A;  5DTB A;  5L9S A;  3A3C A;  4EUO A;  4HE1 A;  1MXZ A;  2V84 A;  1MQH A;  3KC1 A;  1SI0 A;  3CG3 A;  4RNS A;  1YCJ A;  3FD3 A;  1A8E A;  3KN8 A;  4AS5 A;  4H45 A;  1DK4 A;  1FBG A;  1RDY A;  4PF6 A;  4UA8 A;  1FCK A;  3OSQ A;  3SEW A;  3OEL A;  2FIE A;  3QK6 A;  3TEL A;  4KFQ A;  2WYP A;  1KA0 A;  3K4U A;  4KI0 E;  1NH7 A;  3M3L A;  1FBP A;  1YPN A;  5AA4 B;  3H6V A;  3U94 A;  2QFL A;  3KJT A;  1B40 A;  4OVP A;  2PT2 A;  5H8F A;  3AXF A;  2F34 A;  4OZ9 A;  3DP4 A;  1TWY A;  1FQB A;  4JVC A;  3M3F A;  2W7Y A;  1USY E;  3TTK A;  2RCA A;  3FVO A;  1UQW A;  3OSR A;  1MPD A;  4N8Y A;  1FPG A;  1M5D A;  2Q88 A;  3D4C A;  3FVG A;  1JET A;  4NED A;  2WX9 A;  1SYI A;  5ITO A;  5TU0 A;  5I7I A;  1Y1Z A;  1Y9U A;  3CHG A;  1B2H A;  2F7A A;  3N5L A;  4GBW A;  2QS4 A;  1FTJ A;  2RIN A;  4LZ7 A;  2OZZ A;  2VD2 A;  4N8G A;  4F1V A;  1BLF A;  4PFY A;  3PUW E;  2F7C A;  2HHM A;  1BTJ A;  1A7L A;  4G8H A;  2H5Y A;  1B7Z A;  2I3V A;  4GWZ A;  3JYR A;  4H8I A;  4PQJ A;  2QPQ A;  3W9W A;  4U21 A;  1D9V A;  2IA4 A;  4WEP A;  5CMM A;  3M3K A;  5FHN A;  4TLM B;  1MH3 A;  4P3L A;  1XC1 A;  3TTL A;  1YXI A;  3FXU A;  3PV0 E;  1OIB A;  4P1E A;  3PGF A;  1FPF A;  1B0L A;  1JP4 A;  4E0X A;  4HXV A;  2X7P A;  4X9T A;  2Y84 A;  1B05 A;  5CMK A;  2Z23 A;  1UTB A;  3H6U A;  4DIG A;  3K02 A;  1VDW A;  1LBV A;  1QUI A;  3TZA A;  3IOV A;  2B3B A;  4P9K A;  4QBA A;  1LGB C;  1NNP A;  4GX4 A;  3FAS A;  1NV3 A;  3FJM A;  4THI A;  1SBP A;  4C0R A;  3G7W A;  5I56 B;  3USD A;  4LUB A;  3U8Q A;  5A5X A;  4ECF A;  2A5T A;  2O84 X;  3IJO B;  3G3K A;  4G68 B;  1LBC A;  4MNI A;  2ZNT A;  5AA4 A;  5FTH A;  4H65 A;  4ELR A;  3ROJ A;  4QSC A;  1HSJ A;  3HO7 A;  1EU8 A;  3ISP A;  4ZDM A;  3H03 A;  3KOT A;  1FPE A;  1UTH A;  4FED A;  3UA8 A;  3ZSF A;  3H7M A;  3TTR A;  2Y5K A;  3OEK A;  5H8N B;  1MY0 A;  3C4M A;  1S9T A;  2NWJ A;  3K1M A;  3GBA A;  4IGR A;  4RXL A;  4BLA A;  1J1N A;  2D5W A;  4NF0 A;  1FJ6 A;  4KR5 A;  3IX1 A;  4R75 A;  3PTY A;  4ZE8 A;  4IY5 A;  3T93 B;  5CMC A;  3RYD A;  4YB7 A;  4MH5 A;  3RPL B;  4QFL A;  2DP8 A;  1YTV A;  3SDF A;  5JTY A;  1EZ9 A;  1H45 A;  5ELV A;  1UIV A;  3FZV A;  3TCF A;  2O7U A;  4LP2 B;  3RLF E;  3MVX A;  2KR0 A;  3HCQ A;  3E4R A;  4R74 A;  1FQD A;  2XXU A;  2YPN A;  4NF4 B;  2I48 A;  4IY6 A;  2GQ1 A;  2WKY A;  4HTG A;  4PDH A;  3MZ9 A;  1FPK A;  1N84 A;  2Y7I A;  2HQ0 A;  4LQ5 A;  5EYH A;  5EYG A;  3TFL A;  1QUJ A;  4HE0 A;  4XKP A;  5CRY A;  4IO2 A;  4N6P A;  3O28 A;  5FTI A;  3SEY A;  2O7I A;  3ILT B;  1B6H A;  4K3F A;  2UYF A;  1DPE A;  5EQ9 A;  1EZP A;  4LN5 A;  4R2F A;  3G3G A;  4F29 A;  3PMW A;  3V83 A;  3K01 A;  4AB6 A;  4GFR A;  5ET6 A;  4Q30 B;  4KXP A;  3U72 A;  1MXU A;  5I56 A;  3C31 A;  3MZB A;  3Q29 A;  2HAV A;  1NV1 A;  3H6T A;  1PC3 A;  1FPD A;  1P1W A;  2XXI A;  1IXC A;  4PFI A;  1NNK A;  3IR1 A;  2FNC A;  2PFZ A;  4GWY A;  4ELQ A;  2I0C A;  4YKI A;  4EXL A;  1AMF A;  4XF5 A;  4NF8 B;  3BIH A;  4GQO A;  4YU0 A;  3UIF A;  1QW0 A;  3O66 A;  2OJT A;  3FV2 A;  4H46 A;  3IB2 A;  3T9U A;  4XFE A;  1EYJ A;  1JQF A;  4E0W A;  3EPE A;  1NFT A;  4H5F A;  2I49 A;  4PAF A;  4ND9 A;  5B70 A;  4XKN A;  1YYZ A;  3T66 A;  2VGQ A;  3TYH A;  1N76 A;  2VOZ A;  3EN3 A;  3HHF A;  3EHU A;  3MWB A;  4NF5 A;  3N94 A;  4TQU Q;  5EQA A;  3VFJ A;  5F7V A;  4Z7E A;  2YLN A;  3H4Z A;  5J16 A;  3KEI A;  3MQ9 A;  4X1B A;  2ZZW A;  4O8M A;  1N7X A;  2JJK A;  3HST A;  4F39 A;  3T96 B;  3R26 A;  4KPT A;  1KWH A;  4G2Z A;  2O1M A;  4EDP A;  3O29 A;  5TP9 A;  2HZL A;  4C1T A;  1FW0 A;  3JZJ A;  3KN3 A;  2OLB A;  4PFU A;  1IXH A;  3O97 A;  4N17 A;  5IKB A;  1KZ8 A;  3KZG A;  5HPQ A;  5LDZ A;  4DI4 B;  5FBP A;  3UP9 A;  4NN3 A;  1IUD A;  2XXX A;  1H3D A;  1DCU A;  1CE2 A;  1OLC A;  4JVD A;  2I0B A;  4HCY A;  3IOW A;  4GD5 A;  1BP5 A;  1FPB A;  2Q74 A;  1MG1 A;  5H8F B;  4RY1 A;  5DVJ A;  2F5X A;  2AIX A;  2P1S A;  2QS3 A;  2QS1 A;  4PC9 A;  4G8N A;  2I58 A;  1D9Q A;  3CG1 A;  3BFU A;  4JXI A;  3MP1 A;  3SER A;  2Z22 A; 
#chains in the Genus database with same CATH homology
 3FVK A;  3O6G A;  4RYA A;  2HCA A;  4GVO A;  3MW0 A;  4N07 A;  3S9L C;  1QUL A;  1N0T A;  5I84 A;  4LON B;  1JNF A;  3HV1 A;  3LSX A;  3B6T A;  5EHS A;  3O6I A;  2F6P A;  4JB7 A;  3KJ7 A;  3IO4 A;  1NMU A;  3CVG A;  1US5 A;  4OFO A;  1Z7N E;  2O1L A;  1MQJ A;  1ZU0 A;  4LQ2 A;  2Q9T A;  1MH4 A;  4BDM A;  4R9F A;  3MBP A;  5FHO A;  4HW8 A;  4QHQ A;  1N04 A;  2DWI A;  2PX1 A;  2F6G A;  4PE5 B;  2UYE A;  4G4P A;  5ICQ A;  1URS A;  4I62 A;  4O3A A;  4GL8 A;  1IXI A;  4JWO A;  4ZEC A;  1WDN A;  4KYE A;  3RT6 B;  2P2A A;  3LSL A;  2HXW A;  4RK2 A;  4NMY A;  1AL3 A;  1B52 A;  3HHG A;  3RGY A;  4OER A;  4IO5 A;  1ZMG A;  5L8D A;  4F22 A;  1JVY A;  1Q35 A;  1LAX A;  2I4B A;  5I59 A;  3PPR A;  2GHB A;  1MPC A;  3K1N A;  1FTM A;  2Y7K A;  1DPP A;  2CZL A;  4HCW A;  3RUM A;  1MXX A;  5ITP A;  4RA1 A;  2Z8E A;  1SD3 A;  3RPW A;  3L6H A;  3MZ1 A;  4EQ7 A;  2DE4 A;  4F31 B;  2Q2A A;  4QFN A;  1NNF A;  2Q8J A;  4ZZE A;  2E0S A;  3ODB A;  5A5X B;  2A5T B;  3IK6 B;  1D9Y A;  3Q28 A;  1OVB A;  3N6T A;  2ONR A;  2Y7P A;  3KBR A;  2PT1 A;  1II5 A;  1PDA A;  1URD A;  3RY3 A;  4X1D A;  3K6U A;  1UTH B;  3T9X B;  3TQL A;  4AB5 A;  4OXV A;  5LOM A;  2HFB A;  3H06 B;  2Q89 A;  3IL1 B;  2F36 A;  3QAX A;  5DYH A;  3K1P A;  1DMB A;  1SI1 A;  3N6U A;  3ONM A;  4DXB A;  4U1Z A;  2Q2C A;  2V93 A;  3VXB A;  2GRV A;  1S50 A;  3CSG A;  4KYD A;  5JTY B;  3K6V A;  4MBP A;  5IAI A;  1MXV A;  2QJE A;  2F35 A;  4M1V A;  2V3T A;  1HSE A;  4G77 A;  3LR1 A;  1B5I A;  4MLQ A;  3KOS A;  1CB6 A;  4U4S A;  3VLW A;  3V5A A;  1L5T A;  4NWD A;  3PUX E;  2I4C A;  1WOD A;  4OEU A;  4ZEF A;  1N7W A;  2THI A;  1FQE A;  3PUZ E;  1MM6 A;  4GL0 A;  1LB8 A;  1H43 A;  4QSD A;  1M5B A;  3C33 A;  2OK2 A;  2DQV A;  4F3G A;  1IIW A;  1B1X A;  2REG A;  5DEX A;  3FVN A;  2DYX A;  4LZ8 A;  2V3Q A;  1MQI A;  2XX9 A;  3HN0 A;  1I6B A;  1VFE A;  5B7D A;  5H8H A;  5AA2 D;  1Y20 A;  4R6K A;  1Y4C A;  1ZKB A;  4KD5 A;  4H6D A;  4OQO A;  3Q25 A;  1D4N A;  4YMA A;  2DXY A;  2UVI A;  3B6W A;  3FJG A;  3BFT A;  3TTM A;  3H3G A;  3VDF A;  1O7T A;  2DS9 A;  3SKP A;  3MP6 A;  5CBS A;  4FOR A;  5F1Q A;  4EF2 A;  4EXK A;  4PP0 A;  4POX A;  4BDR A;  2I3W A;  1B7U A;  4TLL B;  2G29 A;  1JW4 A;  5I2N A;  4JSO A;  1MDP 1;  4BDQ A;  4HS7 A;  3MPL A;  4O3B A;  4FIM A;  2X26 A;  4IB2 A;  3K6W A;  3ZKK A;  4OHN A;  4YKK A;  4U4X A;  1JVX A;  4PFT A;  2F97 A;  4GLI A;  4BDN A;  1B3G A;  4NF5 B;  4F3S A;  3G3F A;  1FQC A;  1USY H;  3ZKL A;  3U92 A;  5AA2 A;  3EHS A;  1M5F A;  4DCY A;  1IQ7 A;  3FJ7 A;  3KSJ A;  1VR5 A;  4IO3 A;  3PPN A;  4F3P A;  5J1D A;  2DE2 A;  1Y1M A;  2B65 A;  1URG A;  2QMW A;  2O6A A;  4KCC A;  5TPA A;  5TP9 B;  2F7B A;  4JDF A;  4ZEB A;  2XXV A;  4YIC A;  1P1O A;  4L17 A;  1MRP A;  3EHT A;  3VVF A;  3ECR A;  2A5S A;  2PMS A;  4OVJ A;  3TCH A;  2RC7 A;  1A54 A;  1B0H A;  1NNT A;  3PU5 A;  1Q1K A;  4NTL A;  1JEU A;  4U1O A;  2Z8F A;  3BKI B;  1ELJ A;  1QJM A;  4WED A;  1DTZ A;  3M8U A;  1XVY A;  2OCU A;  5M2V A;  3GXA A;  3PD9 A;  3TCG A;  2XXR A;  3DP8 A;  2H98 A;  4GIZ A;  1P1U A;  3QSL A;  1MPB A;  4OES A;  5EYF A;  3N26 A;  1RYO A;  4QF9 A;  2R9J A;  1DTG A;  5KDT A;  1IXG A;  3WAF A;  1AH5 A;  1IZ1 A;  2ANJ A;  3I5O A;  3CRB A;  3S2V A;  4O3C A;  4TOZ A;  4P0I A;  3R7X A;  3S9M C;  1MS7 A;  1NL5 A;  1FTO A;  2Z8D A;  1B4H A;  2UXA A;  3DM0 A;  5I58 B;  2CMO A;  1P99 A;  1B51 A;  4OFJ A;  4OFL A;  3V89 B;  3FXQ A;  4OEV A;  4Q0C A;  1B58 A;  2G93 A;  4DLD A;  5JK4 A;  3S9E A;  2QS2 A;  1EH3 A;  4JBZ A;  5BWJ A;  2UVJ A;  5I59 B;  1US4 A;  1B3F A;  1SVX B;  4IO7 A;  4DE8 A;  1D3K A;  4ZEK A;  3LBS A;  5L9M A;  5K2Y A;  3UGW A;  4RPN A;  3ZS6 A;  4FEC A;  3VXC A;  1OLA A;  1B3L A;  4DXC A;  3FUZ A;  5JEI A;  3BBR A;  3PPP A;  3GLB A;  1EZO A;  2RKM A;  3PD8 A;  5H8S A;  4R6H A;  2O51 A;  2HEU A;  2ZNS A;  3E3K A;  3F11 A;  3IJX B;  3PPO A;  1LAG E;  2QMX A;  4KYS A;  3U1O A;  3A3U A;  5KZT A;  3MUQ A;  1R9L A;  3DP6 A;  1M5C A;  3EF7 A;  2ZXT A;  4R2B A;  1LBB A;  1GTK A;  1VFD A;  4U22 A;  1ATG A;  3I6V A;  2R71 A;  4R72 A;  3R6U A;  4XKR A;  1QKB A;  4FAT A;  4ISU A;  3K6X A;  3MVZ A;  3C36 A;  4RK9 A;  4N13 A;  1LLS A;  5HBC A;  1ZJL A;  3OO7 A;  2DVC A;  3D4G A;  1Y3P A;  4POW A;  4P0G A;  2ESN A;  4F2O A;  3K2D A;  3SET A;  2NVU B;  1FQA A;  4GOT A;  2P0S A;  1Y3Q A;  4OET A;  5I58 A;  1XHY A;  2VP1 A;  3OEN A;  3EQ1 A;  4RPO A;  1Y3N A;  1Z7M E;  4ZED A;  1IEJ A;  1BKA A;  3O2A A;  1MDQ A;  3O9P A;  4AQ4 A;  1ZLQ A;  2OWS A;  3LC8 A;  2ONS A;  1RKM A;  1A40 A;  2DVZ A;  2UVG A;  2NOO A;  3RTW B;  3FAT A;  5DEX B;  1B3E A;  3G3H A;  1B1H A;  1JW5 A;  5I57 A;  1LFH A;  1I6A A;  1IIT A;  3CIJ A;  1LFI A;  3C32 A;  5KCJ A;  2AL4 A;  3GBB A;  4YKP A;  1GR2 A;  5H8H B;  2DWJ A;  3OXN A;  4H0W A;  3Q26 A;  1SW5 A;  3OO6 A;  2XXQ A;  4ZEI A;  2GFE A;  4NF6 A;  2BJJ X;  3IOU A;  5H8Q A;  3K00 A;  2XD3 A;  4YKJ A;  4LAT A;  3CFX A;  1WVJ A;  3RQT A;  4R6Y A;  1SW2 A;  1SDX A;  5DT6 A;  5I2K A;  4Z0I A;  4I1D A;  4MLV A;  2RC9 A;  4QSE A;  3PUY E;  4F18 A;  3TPA A;  2XHD A;  1GV8 A;  1XS5 A;  1A99 A;  2V3U A;  3CI8 A;  2DE3 A;  4F19 A;  4R73 A;  2X7Q A;  5I2N B;  3E13 X;  1A55 A;  3G3I A;  4OEN A;  4OWD A;  4U23 A;  2NXO A;  1VSO A;  4DZ1 A;  1B3H A;  1LAF E;  5AA2 B;  2ZYO A;  1ZTY A;  4EQ9 A;  1HSL A;  1LAH E;  3QUJ A;  2XXT A;  2IEE A;  1VE4 A;  2F8D A;  3T22 A;  4BDL A;  3SES A;  1ANF A;  4IGT A;  4ZZA A;  5TPA B;  3PUV E;  4XIG Q;  4PFW A;  2HZK A;  2ONK E;  4DXU A;  1N3X A;  2OWT A;  4LZ5 A;  4ONY A;  1OVT A;  3K0V A;  3MVW A;  3TDJ A;  2ZYN A;  1XOC A;  2ZMB A;  3PMX A;  4GF8 A;  2B3F A;  1MXY A;  3B6Q A;  4UAC A;  3TTN A;  1H76 A;  3H6W A;  2Y7R A;  1NKX A;  1YAE A;  2DXR A;  3IOT A;  3UN6 A;  3KGC A;  3LUY A;  4WKM A;  1I6Q A;  3FIR A;  4YB5 A;  3IB1 A;  2GH9 A;  2XX7 A;  1P1Q A;  3RNN A;  1B5H A;  1DSN A;  3VVD A;  4F3B A;  1NH8 A;  1POT A;  2XD2 A;  1O64 A;  4OYV A;  3QXM A;  3OMB A;  2ZYM A;  2H99 A;  1R6Z A;  3I3V A;  3WAE A;  1XT8 A;  3HPI A;  4XKQ A;  4I9D A;  5KDT B;  1TFA A;  2KLF A;  3FGS A;  4OTE A;  3THI A;  4BDO A;  3TOD A;  4H67 A;  2DWH A;  1GVC A;  3TEP A;  1FQF A;  2ALU A;  4ZS9 A;  1OQG A;  5HM4 B;  2E1S A;  1LB9 A;  2FA7 A;  1R1N A;  2HAU A;  3CFL A;  2ZYK A;  3VVE A;  1PB9 A;  1B5J A;  3Q27 A;  3GZG A;  4F1U A;  5AA3 A;  3C9H A;  4G68 C;  1FTK A;  4F2Q A;  1TXF A;  2PBW A;  4IO6 A;  3W9V A;  5EHM A;  4XXU A;  4ELO A;  4KQP A;  5ICT A;  1MQG A;  3RN8 A;  5CMB A;  3OO8 A;  3CSB A;  3CFZ A;  3OO9 A;  5DVI A;  3KSX A;  1B32 A;  4YMB A;  4LA9 A;  3TMG A;  4MFI A;  4FJP A;  3U93 A;  5AA1 A;  2D21 A;  2O69 A;  3S9N C;  1OQH A;  1H44 A;  2VHA A;  4GXS B;  2VD3 A;  5DVF A;  3UOR A;  5CM6 A;  3OEM A;  1B7H A;  3IOR A;  4RJZ A;  4FEB A;  1M5E A;  1TFD A;  4QFO A;  3KFM A;  3TQW A;  1ZBM A;  1LCT A;  4Q8R A;  1QUK A;  4YB6 A;  1TT1 A;  3C34 A;  4G8M A;  2OBG A;  4P11 A;  1PB8 A;  3B7D A;  3SEU A;  2DSF A;  3S4U A;  4U2R A;  1POY 1;  1JEV A;  4ELP A;  4DDD A;  1SQY A;  3ILU B;  1PBQ A;  1XVX A;  3MC2 A;  4JWY A;  3LSF B;  4LVQ A;  2RC8 A;  3W15 C;  4NE4 A;  2ABH A;  4FAJ A;  3PMV A;  3MP8 A;  4KCD A;  1UIU A;  3TKD A;  3VE1 B;  4G68 A;  5L9O A;  3VLU A;  4YZZ A;  5CI5 A;  3P7I A;  1AIV A;  3DEL B;  4Q5T A;  2XX8 A;  3V8X B;  3IB0 A;  1MY4 A;  1N3W A;  4R9G A;  2ZNU A;  3MJN A;  1DOT A;  1O63 A;  3G3J A;  4H1X A;  4X48 A;  2QSX A;  2XXP A;  5H8N A;  4EF1 A;  1Y4T A;  2F78 A;  1MM7 A;  1P1N A;  2QRY A;  4EQB A;  2H9B A;  1RYX A;  1SW1 A;  1A8F A;  2M8C A;  3O6H A;  5K2X A;  1BIY A;  3TAJ A;  2Y7W A;  2AYS A;  3PPQ A;  1SW4 A;  3FV1 A;  3C35 A;  4DCX A;  2H25 A;  2XXH A;  3IAZ A;  3TUS A;  1QVS A;  2RCB A;  3T9V A;  2REJ A;  4JSD A;  4ZE9 A;  5AE4 A;  4IO4 A;  4QRZ A;  5I57 B;  2NUV A;  5FHM A;  5KCJ B;  3CR9 A;  2I6E A;  3OD7 A;  2AL5 A;  4ESX A;  1I69 A;  4OMB A;  1SYH A;  2PVU A;  2XXY A;  1PBP A;  3A09 A;  3MAM A;  3E9X A;  4NF6 B;  2YJP A;  3QYT A;  5H8Q B;  2GHA A;  2QL3 A;  4NF4 A;  3SEX A;  2LAO A;  4F1Y A;  2PYY A;  1MXW A;  1S7Y A;  5I2K B;  3VLV A;  1MY1 A;  4H8J A;  4M4G A;  2D3I A;  1AOV A;  4I8C A;  3KN7 A;  1QKA A;  4GWO A;  2R6G E;  4NWC A;  4WXJ A;  1LFG A;  1ZIU A;  4QFP A;  4GRK A;  1FTL A;  1B46 A;  3QIM A;  3LSW A;  3JV9 A;  4JWX A;  1PB7 A;  1LCF A;  1PEB A;  1B4Z A;  1JW1 A;  1LST A;  2O68 A;  4YAH X;  4PET A;  2UVH A;  4QFK A;  2XXW A;  1B9J A;  2RF1 A;  4FE8 A;  3RTF B;  3KG2 A;  4GXA A;  4NF8 A;  3MPK A;  3IO6 A;  3VV5 A;  3UK4 A;  1R9Q A;  3DLN A;  5CBR A;  3FXR A;  5ISU A;  4H5G A;  2DWA A;  2H4I A;  4KHZ E;  1MY3 A;  5BUU A;  4ESW A;  4MF3 A;  1OMP A;  3QUF A;  1MY2 A;  1F9B A;  3SEV A;  3MVY A;  3L6G A;  2FYI A;  1MQD A;  5CC2 A;  3RT8 A;  1GGG A;  4C1U A;  2DOJ A;  3T9H B;  1T0K A;  1UTB B;  2V25 A;  4XTC Q;  3OOA A;  5DTB A;  5L9S A;  3A3C A;  4EUO A;  1MXZ A;  2V84 A;  1MQH A;  1SI0 A;  3CG3 A;  4RNS A;  1YCJ A;  3FD3 A;  1A8E A;  3KN8 A;  4UA8 A;  1FCK A;  3OSQ A;  3SEW A;  3OEL A;  3QK6 A;  3TEL A;  4KFQ A;  3K4U A;  4KI0 E;  1NH7 A;  3M3L A;  1YPN A;  5AA4 B;  3H6V A;  3U94 A;  3KJT A;  1B40 A;  2PT2 A;  5H8F A;  3AXF A;  2F34 A;  4OZ9 A;  3DP4 A;  1TWY A;  1FQB A;  3M3F A;  2W7Y A;  1USY E;  3TTK A;  2RCA A;  3FVO A;  1UQW A;  3OSR A;  1MPD A;  1M5D A;  2Q88 A;  3D4C A;  3FVG A;  1JET A;  4NED A;  1SYI A;  5ITO A;  5TU0 A;  1Y1Z A;  1Y9U A;  1B2H A;  2F7A A;  3N5L A;  2QS4 A;  1FTJ A;  2RIN A;  4LZ7 A;  2OZZ A;  2VD2 A;  4F1V A;  1BLF A;  4PFY A;  3PUW E;  2F7C A;  1BTJ A;  1A7L A;  4G8H A;  2H5Y A;  1B7Z A;  2I3V A;  3JYR A;  4H8I A;  4PQJ A;  2QPQ A;  3W9W A;  4U21 A;  1D9V A;  2IA4 A;  4WEP A;  5CMM A;  3M3K A;  5FHN A;  4TLM B;  1MH3 A;  1XC1 A;  3TTL A;  3FXU A;  3PV0 E;  1OIB A;  3PGF A;  1B0L A;  4E0X A;  2X7P A;  4X9T A;  2Y84 A;  1B05 A;  5CMK A;  2Z23 A;  1UTB A;  3H6U A;  4DIG A;  3K02 A;  1QUI A;  3TZA A;  3IOV A;  2B3B A;  1LGB C;  1NNP A;  3FAS A;  3FJM A;  4THI A;  1SBP A;  4C0R A;  3G7W A;  5I56 B;  3USD A;  4LUB A;  3U8Q A;  5A5X A;  4ECF A;  2A5T A;  2O84 X;  3IJO B;  3G3K A;  4G68 B;  1LBC A;  2ZNT A;  5AA4 A;  5FTH A;  4H65 A;  4ELR A;  4QSC A;  1HSJ A;  3HO7 A;  1EU8 A;  4ZDM A;  3H03 A;  3KOT A;  1UTH A;  4FED A;  3UA8 A;  3ZSF A;  3H7M A;  3TTR A;  3OEK A;  5H8N B;  1MY0 A;  3C4M A;  1S9T A;  2NWJ A;  3K1M A;  3GBA A;  4IGR A;  4RXL A;  4BLA A;  1J1N A;  2D5W A;  4KR5 A;  3IX1 A;  4R75 A;  4ZE8 A;  4IY5 A;  3T93 B;  5CMC A;  4YB7 A;  4MH5 A;  4QFL A;  2DP8 A;  1YTV A;  3SDF A;  5JTY A;  1EZ9 A;  1H45 A;  5ELV A;  1UIV A;  3FZV A;  3TCF A;  2O7U A;  4LP2 B;  3RLF E;  3MVX A;  3HCQ A;  3E4R A;  4R74 A;  1FQD A;  2XXU A;  2YPN A;  4NF4 B;  2I48 A;  4IY6 A;  2WKY A;  4HTG A;  3MZ9 A;  1N84 A;  2Y7I A;  2HQ0 A;  4LQ5 A;  3TFL A;  1QUJ A;  4XKP A;  5CRY A;  4IO2 A;  4N6P A;  3O28 A;  5FTI A;  3SEY A;  2O7I A;  3ILT B;  1B6H A;  4K3F A;  2UYF A;  1DPE A;  1EZP A;  4R2F A;  3G3G A;  4F29 A;  3PMW A;  3V83 A;  3K01 A;  4AB6 A;  4GFR A;  4Q30 B;  3U72 A;  1MXU A;  5I56 A;  3C31 A;  3MZB A;  3Q29 A;  2HAV A;  3H6T A;  1PC3 A;  1P1W A;  2XXI A;  1IXC A;  1NNK A;  3IR1 A;  2FNC A;  4ELQ A;  2I0C A;  4YKI A;  4EXL A;  1AMF A;  4NF8 B;  4GQO A;  4YU0 A;  3UIF A;  1QW0 A;  3O66 A;  2OJT A;  3FV2 A;  3IB2 A;  3T9U A;  1JQF A;  4E0W A;  3EPE A;  1NFT A;  4H5F A;  2I49 A;  4ND9 A;  5B70 A;  4XKN A;  3T66 A;  2VGQ A;  3TYH A;  1N76 A;  2VOZ A;  3EN3 A;  3HHF A;  3EHU A;  3MWB A;  4NF5 A;  3N94 A;  4TQU Q;  3VFJ A;  5F7V A;  4Z7E A;  2YLN A;  3H4Z A;  3KEI A;  3MQ9 A;  4X1B A;  1N7X A;  3HST A;  4F39 A;  3T96 B;  3R26 A;  4KPT A;  1KWH A;  4G2Z A;  2O1M A;  4EDP A;  3O29 A;  5TP9 A;  2HZL A;  4C1T A;  1FW0 A;  3JZJ A;  3KN3 A;  2OLB A;  4PFU A;  1IXH A;  3O97 A;  5IKB A;  3KZG A;  5HPQ A;  3UP9 A;  1IUD A;  2XXX A;  1H3D A;  1CE2 A;  1OLC A;  2I0B A;  4HCY A;  3IOW A;  4GD5 A;  1BP5 A;  1MG1 A;  5H8F B;  4RY1 A;  5DVJ A;  2F5X A;  2AIX A;  2P1S A;  2QS3 A;  2QS1 A;  2I58 A;  4G8N A;  3CG1 A;  3BFU A;  4JXI A;  3MP1 A;  3SER A;  2Z22 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...