3G3IA

Crystal structure of the glur6 ligand binding domain dimer i442h k494e i749l q753k mutant with glutamate and nacl at 1.37 angstrom resolution
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
256
structure length
255
Chain Sequence
NRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLELSTHLGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREEVIDFSKPFMTLGISILYRKGTPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITLAILKLQEEGKLHMMKEKWWRGNGCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Stability of ligand-binding domain dimer assembly controls kainate receptor desensitization.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Membrane protein
molecule keywords Glutamate receptor, ionotropic kainate 2
total genus 84
structure length 255
sequence length 256
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-02-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3g3iA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3g3iA02
4Q5TA 3UA8A 4F2OA 4H65A 1DSNA 2CMOA 1JNFA 4GL0A 4TLMB 4F3SA 1FQAA 2F6PA 4LUBA 4QSCA 4TLLB 3SESA 1DPEA 1MS7A 1SW5A 3FXRA 3LSLA 3OO7A 1MQJA 2Y7WA 1AH5A 2E0SA 1SD3A 1SDXA 1BLFA 2ZYNA 3FJMA 1XT8A 1IQ7A 1B1XA 3QUFA 3OO9A 1Y3PA 3D4CA 4EQ7A 1XC1A 4ZEBA 3V8XB 4RK9A 1LAFE 3JZJA 1XOCA 4H0WA 4GXAA 1AL3A 3PMWA 4MFIA 4P0IA 1IEJA 1LBBA 5H8QA 3OOAA 3TELA 5L9MA 3OO8A 1B3GA 4XXUA 2DE4A 5A5XA 2O1LA 2R71A 1LFIA 3GLBA 4X9TA 3O9PA 3E9XA 3CI8A 3PUXE 3KBRA 1CB6A 1VE4A 3G3FA 3PPOA 5TP9A 1ZMGA 1B3HA 2QS4A 3VFJA 2I4CA 3N6TA 4R2FA 2O51A 1LAXA 5AA1A 3IJXB 4G68A 1DMBA 1H3DA 2RC9A 2X7PA 3KZGA 4L17A 1YTVA 3W9VA 3MVWA 2F7AA 4KCDA 3HV1A 2O84X 1A8EA 3IAZA 5DVJA 3T66A 3QK6A 3CIJA 1RYOA 3CFLA 1L5TA 4R2BA 2DQVA 4ZEIA 1QJMA 3BFUA 1OLCA 2OLBA 3RT6B 3SEWA 3TDJA 3UORA 3GZGA 2V3UA 1A54A 1TXFA 2ZNTA 2A5TA 1HSEA 3ECRA 3L6HA 3OMBA 4MH5A 3Q28A 3KSJA 3IJOB 3PPNA 1URDA 1Y3NA 5CMMA 3PD8A 5CMCA 1TWYA 1UTHB 2DWAA 1A40A 2ANJA 2X7QA 3HHFA 3IO4A 3KOTA 5CI5A 1XHYA 2PBWA 1GTKA 3IK6B 1Y4CA 3FXUA 3VVFA 1DOTA 4K3FA 4O3CA 3TTKA 3LBSA 5B7DA 4KI0E 3HO7A 4QFLA 5LOMA 3V89B 3CVGA 2QMWA 1I6BA 1AMFA 5ISUA 4QFOA 3K02A 4G4PA 1QVSA 2DVCA 2XX9A 1ZKBA 3SEUA 3W9WA 3MP6A 4QHQA 5CBRA 2QJEA 3SDFA 4E0XA 3C33A 2Q2CA 3IB2A 2XXVA 1SYHA 4NF4A 1FTLA 4I8CA 5ICQA 3PPQA 4LONB 4QF9A 2QMXA 1MY4A 3F11A 2F36A 2NVUB 3KEIA 3MP8A 2Q89A 1MXVA 3OXNA 3RTFB 4F2QA 4OESA 3PMVA 1S7YA 1POY1 1URSA 1USYE 1Y3QA 3CR9A 3S9EA 4R6KA 2I6EA 1M5DA 3G3IA 3R6UA 3C34A 2XX7A 4H8JA 3PGFA 4N13A 5KCJA 1DPPA 3G3GA 2F7BA 2LAOA 4OVJA 4XKRA 5ITPA 3PUWE 4YAHX 1PB9A 1EZPA 1EH3A 5CMBA 4ZE9A 1B58A 4U4XA 1MM6A 3FVNA 3FZVA 4IY5A 4NWDA 3VLUA 3THIA 2Y84A 3H06B 2O68A 3A09A 4TQUQ 3T96B 4DE8A 1ZBMA 4FE8A 2DP8A 3TTNA 4RXLA 1BIYA 1O7TA 4PE5B 4C1TA 1OVTA 4R9GA 3U93A 4EUOA 4YMBA 4ZEDA 1QUIA 1FQCA 1LB8A 4Z7EA 3SETA 5HM4B 3KG2A 5AA2B 1MG1A 5CM6A 3QSLA 5JK4A 3OENA 5I2KB 5FTHA 3CFZA 2DOJA 2HCAA 3DP6A 1B7HA 3IO6A 1MM7A 2XHDA 2E1SA 3VDFA 2V84A 3A3CA 2G93A 1A8FA 4HS7A 1SW1A 1B4HA 1NH7A 2B3BA 4NWCA 3K1PA 5BWJA 5I57B 3TEPA 1VR5A 3SEXA 2V93A 4PFTA 4F22A 5I59A 3HCQA 5H8SA 3OSRA 4R74A 2Y7PA 3H03A 3HPIA 4GLIA 2REJA 3VV5A 4ZEFA 1M5EA 1MQHA 2HQ0A 4F1UA 4KYSA 3A3UA 4LATA 5KDTA 1Y4TA 4GFRA 2KLFA 2V25A 1Y9UA 1B5JA 3N5LA 2AIXA 1N7XA 4OZ9A 1NNPA 3N6UA 2FA7A 1MDP1 4HTGA 1QULA 3UGWA 1MXYA 3CG1A 2DWHA 4H5FA 1N84A 1VFEA 3G3HA 1P1QA 1JW5A 4OFLA 1USYH 3KN3A 4XTCQ 3RNNA 5CBSA 1I6QA 3EN3A 3O29A 4GIZA 3EHSA 1PDAA 4YKIA 3UIFA 2CZLA 4FATA 1YAEA 1LGBC 4OXVA 4OTEA 2NUVA 4DZ1A 1FTJA 1M5BA 1QUKA 3Q26A 4U4SA 3MC2A 4FIMA 4OENA 2F34A 1UIVA 4PFWA 4KFQA 2BJJX 2F97A 3ONMA 4KR5A 1QUJA 4ZEKA 1B5HA 1B6HA 4LQ5A 4YKJA 3S4UA 4F19A 5HPQA 3MBPA 1SW4A 2DE3A 4O3AA 2B3FA 3RY3A 1MQGA 5I2NA 2W7YA 3JV9A 1IITA 1F9BA 3DP8A 4G68B 4R72A 3T93B 5ICTA 3RT8A 5I2KA 3KJTA 1ZIUA 1ZJLA 2NOOA 4N6PA 2UVHA 4NEDA 4QFPA 4YZZA 2F78A 1JETA 1Y20A 5H8FA 3H6VA 2UXAA 3H7MA 4AB6A 4IO4A 3O6HA 1P1UA 1R6ZA 4JBZA 5TPAB 4F31B 4F29A 4M4GA 1I6AA 3TQWA 2UVJA 4LQ2A 1LCFA 3M3LA 5FTIA 2Q2AA 1H43A 4PQJA 2XXPA 1NMUA 1US4A 5H8NA 4HW8A 1LLSA 1MQDA 1JW1A 3I3VA 3B6TA 4RYAA 4YB6A 4QFKA 1B3FA 4R6YA 3QXMA 1H76A 4RJZA 2I0CA 5L8DA 1R9LA 4FJPA 3PPRA 1M5FA 2NXOA 4Q8RA 1WDNA 4YU0A 3OEKA 1NH8A 3MJNA 1UTHA 3MZBA 1N3WA 1OMPA 1PEBA 1YPNA 2YPNA 3UP9A 1Q35A 4GL8A 2R6GE 3O66A 5BUUA 3HSTA 3M3KA 3RN8A 1D4NA 4JXIA 1J1NA 4F1YA 2XXQA 1JVYA 1ZTYA 2DXRA 1JQFA 4YKPA 1A99A 1B32A 3O28A 2D5WA 4YB5A 3KN8A 3BBRA 1HSLA 4KYDA 5JTYA 3MZ1A 3TFLA 1MY2A 2QS3A 3GBBA 3K4UA 3MVXA 3FJ7A 3U72A 2I3VA 2G29A 4IB2A 5H8HB 2OZZA 4DCXA 3C9HA 3U8QA 4IO3A 3VVEA 3E13X 2Y7KA 1GV8A 2H99A 2UYEA 2WKYA 2XXHA 1EU8A 2Z8DA 2O1MA 4U1OA 1EZOA 2V3QA 4BDMA 2O7UA 1B3EA 3OO6A 4F3PA 4BDQA 3QUJA 4PP0A 1ELJA 4IO2A 4XKQA 1XVXA 3EPEA 4HCWA 4U2RA 5DT6A 4FEBA 3VXCA 2A5SA 3BFTA 4OFOA 1NL5A 1FQBA 3B6QA 3MP1A 3RPWA 2FYIA 3SEYA 2NWJA 2Z22A 3U1OA 2HAUA 1MPBA 1RKMA 3W15C 4ELQA 4G68C 3TUSA 4ESWA 5KCJB 1UQWA 2Y7IA 3IOVA 3MW0A 5IAIA 1N0TA 4GWOA 5H8FB 5HBCA 2DYXA 1QKAA 2ZYKA 1MDQA 3G7WA 4EDPA 1N7WA 2P2AA 1B7ZA 1PBPA 1LFHA 3V5AA 3K00A 3TTMA 2GRVA 4N07A 4NMYA 1OIBA 1LAHE 1B51A 3TTRA 3WAFA 4WEDA 3ZKLA 5AE4A 3MQ9A 1UTBB 1DTZA 2OJTA 1BTJA 3K2DA 4FECA 4HCYA 2AL5A 1OQHA 3LSFB 3PV0E 3H6TA 3K0VA 3TZAA 5AA3A 3MVYA 4KHZE 4ELRA 1D3KA 4MBPA 4EF2A 4U23A 1M5CA 3IL1B 1IZ1A 3Q29A 5EHMA 4BDLA 4YICA 4EXKA 1JEUA 4NF6B 1B0HA 4NTLA 1MH3A 2QS1A 2O6AA 2H25A 2XXXA 5F7VA 1MH4A 1Z7NE 2B65A 3GXAA 4OQOA 3LC8A 1MXUA 4IGRA 4JDFA 3ILTB 1WODA 4LP2B 2I49A 3UK4A 2I4BA 2OK2A 2I58A 5I56A 2QS2A 1B46A 5I58B 4XKNA 2Q9TA 2Z23A 3MVZA 1UIUA 3K1NA 2Q88A 2I0BA 4P11A 1Y1MA 1LFGA 1URGA 2OWSA 2RC7A 3H3GA 2X26A 3LSWA 2XXRA 4P0GA 4ZS9A 3G3KA 4H6DA 3ZS6A 2DS9A 1I69A 2OWTA 3DELB 2OCUA 2F6GA 3HN0A 4EF1A 2HAVA 1FQDA 3PU5A 1GR2A 1SI0A 2HZKA 3ILUB 3KN7A 1Y1ZA 5TPAA 5CMKA 5I56B 4QSDA 3EHUA 4NE4A 1N04A 2A5TB 4GOTA 4GRKA 4NF5A 4OEVA 3I6VA 2D3IA 4F18A 4ZECA 4X1DA 2RF1A 3FGSA 3K6WA 1N76A 4C0RA 3TCFA 2ZYMA 4EXLA 4H8IA 1LB9A 1OQGA 4LZ8A 3FATA 4RPOA 4R9FA 4POXA 1B7UA 4DXBA 3CSGA 4F3BA 2H9BA 3PMXA 4DDDA 3SERA 1B2HA 1IUDA 1P1NA 2GHBA 3SKPA 3TPAA 5I59B 1H44A 3RLFE 3USDA 1MXWA 2ZXTA 1S9TA 2VP1A 2O7IA 5AA4B 3DM0A 4DXCA 2UVIA 3C4MA 5ITOA 4THIA 3K6XA 1EZ9A 5I2NB 3I5OA 3OSQA 4H67A 3KOSA 3MWBA 3O6IA 2QL3A 1VFDA 2RCBA 3CRBA 5DVIA 3JYRA 3T9XB 3B6WA 4R6HA 3M8UA 2H5YA 2RC8A 4BDNA 5B70A 2ONSA 1H45A 5H8NB 3FVGA 3OD7A 4FAJA 4EQ9A 2ABHA 3FD3A 3KSXA 4R75A 2VD3A 3TCHA 4M1VA 4H5GA 5FHMA 5KZTA 3G3JA 4FEDA 2H98A 2UYFA 1R1NA 4X1BA 4UACA 4KCCA 4ESXA 3K1MA 2XXWA 4C1UA 3TMGA 4DLDA 3T9UA 4AQ4A 2XX8A 3FASA 3MPLA 4JWXA 3K01A 4I62A 4PFUA 3R26A 4NF4B 2ONKE 2GH9A 2PVUA 3CFXA 4WXJA 1PB8A 3T9HB 4BDRA 2YLNA 4UA8A 5CC2A 2F8DA 4GVOA 1PC3A 2ESNA 3FXQA 5K2YA 3DLNA 1B5IA 4ELOA 3EHTA 1NNTA 4ZDMA 1AOVA 2DVZA 4XKPA 1B52A 1OLAA 4NF6A 2P0SA 2DWIA 1D9VA 1FTMA 1GGGA 4OEUA 4QRZA 4DIGA 4F3GA 3IOUA 3IR1A 4BDOA 4F1VA 3Q25A 4LA9A 5I57A 3FIRA 3C32A 3IB0A 1US5A 2XXTA 4R73A 2XXYA 4Z0IA 4IGTA 3MZ9A 3TAJA 4U22A 1O64A 1IXIA 1YCJA 1QW0A 1MRPA 1TT1A 1SI1A 2ZNUA 1Z7ME 1ANFA 1B3LA 3PUVE 5M2VA 1Q1KA 3QYTA 4GF8A 3K6VA 3IX1A 4YB7A 4IO7A 2RKMA 3C36A 4I9DA 4ISUA 5L9SA 5FHNA 3T9VA 4G8MA 1N3XA 4RPNA 4NF8B 3S9MC 3V83A 2XD2A 3VXBA 2Z8EA 3E3KA 4KD5A 1P1WA 5KDTB 1WVJA 4NF8A 1MQIA 4Q0CA 1LAGE 1SW2A 2AYSA 5I84A 3S2VA 3ZKKA 4DXUA 3ZSFA 1QKBA 5TP9B 3KGCA 4ECFA 5I58A 2UVGA 1MXXA 3E4RA 4WEPA 5ELVA 5JEIA 2DSFA 5F1QA 2YJPA 1SVXB 3H4ZA 2ZNSA 2D21A 3LR1A 2ONRA 3L6GA 3MUQA 5H8QB 3N94A 1RYXA 2I3WA 1B1HA 4KPTA 4Q30B 1A55A 1KWHA 3R7XA 3UN6A 4O3BA 4OERA 2IEEA 1CE2A 3N26A 1IIWA 3U94A 5AA2A 2VGQA 4FORA 3CSBA 4GQOA 3O6GA 4RY1A 1TFAA 5DEXA 5TU0A 3P7IA 3ODBA 5CRYA 1MY3A 2FNCA 2PYYA 3KFMA 3H6WA 3VLVA 5EYFA 3TCGA 2REGA 1B0LA 1XS5A 1XVYA 4PETA 4U1ZA 5K2XA 2XXUA 4AB5A 4GD5A 2HZLA 3LSXA 1ATGA 4RA1A 4EQBA 1O63A 2THIA 2XD3A 3QIMA 1BP5A 3AXFA 3M3FA 2VOZA 3PD9A 1FTOA 5AA4A 3OEMA 4I1DA 1GVCA 1II5A 3IB1A 4LZ7A 4GXSB 4LVQA 2PMSA 5DTBA 2VHAA 2PX1A 4DCYA 1ZLQA 2ZMBA 4RK2A 4F39A 4X48A 5J1DA 4BLAA 4OFJA 2P1SA 3BKIB 3O97A 3PPPA 3PUZE 3VE1B 3TQLA 2QRYA 1NNKA 1PBQA 1LCTA 3DP4A 1NNFA 1B4ZA 2ZYOA 4G8HA 3T22A 4YMAA 3C35A 4QFNA 1BKAA 3EF7A 3CG3A 2F5XA 4YKKA 3U92A 3D4GA 2PT1A 4PFYA 2HFBA 2Q8JA 4ELPA 4JSDA 5JTYB 1VSOA 1A7LA 1DTGA 3FUZA 4JWYA 4JB7A 4KQPA 3MPKA 2GFEA 3OELA 4OETA 4JSOA 1NKXA 5A5XB 4U21A 2DXYA 2IA4A 2HEUA 3HHGA 1TFDA 3MAMA 1OVBA 3IORA 2DE2A 2QPQA 2V3TA 1S50A 2RCAA 1MY1A 3EQ1A 4OHNA 4QSEA 4XIGQ 1IXCA 1JW4A 3K6UA 5AA2D 1T0KA 1FQFA 3GBAA 3IOWA 4LZ5A 4POWA 3RGYA 3FV2A 3QAXA 2M8CA 5FHOA 3TKDA 1IXHA 4E0WA 2Y7RA 3B7DA 2R9JA 3FJGA 4OYVA 3IOTA 2QSXA 3PUYE 1MPCA 1LSTA 4MLVA 4ONYA 1SBPA 2ALUA 2VD2A 3FVOA 1B05A 3WAEA 1B9JA 1MY0A 4G2ZA 5EHSA 1JEVA 2DWJA 4G8NA 5H8HA 5DVFA 1SYIA 3FV1A 2OBGA 1FCKA 1JVXA 4H1XA 3TODA 1MPDA 1AIVA 3VLWA 2O69A 3TTLA 3SEVA 1MXZA 4MLQA 5IKBA 4ND9A 1FW0A 2AL4A 3Q27A 3S9NC 3VVDA 4OMBA 5DEXB 3KJ7A 4MF3A 4RNSA 2PT2A 1LBCA 1UTBA 2F35A 1R9QA 2HXWA 3H6UA 1IXGA 1HSJA 4IO6A 4KYEA 4OWDA 2RINA 4JWOA 4ZZAA 2F7CA 3RTWB 2H4IA 1NFTA 1FQEA 1P1OA 2GHAA 4IO5A 1D9YA 4TOZA 3RQTA 3FVKA 1PB7A 2I48A 5L9OA 3S9LC 2Z8FA 3LUYA 4IY6A 3RUMA 1B40A 1POTA 4NF5B 1ZU0A 4WKMA 3C31A 3O2AA 5DYHA 4ZZEA 1P99A 2XXIA 1FTKA 1SQYA 3TYHA 4ZE8A 4G77A
chains in the Genus database with same CATH superfamily
4OVTA 1JNFA 1DBZA 1SW5A 1MQJA 2E0SA 1XT8A 4GX3A 1NV4A 2WYKA 4P0IA 3TELA 4XXUA 2DE4A 4X9TA 1CB6A 3G3FA 5TP9A 2I4CA 2O51A 4G68A 1YTVA 2F7AA 5DVJA 2O84X 4N91A 1FPJA 3T96B 3W9VA 3UORA 3BFUA 3GZGA 3OMBA 2ZNTA 2A5TA 3Q28A 3IJOB 2MKZA 1TWYA 3IO4A 2ANJA 5CI5A 4PGPA 1DOTA 1FBGA 1AMFA 3K02A 4G4PA 1QVSA 2OX3A 3SEUA 1FBEA 4QHQA 5EQ9A 1FTLA 1NV3A 2F36A 3OXNA 1MXVA 4OESA 1S7YA 3S9EA 4R6KA 5KZTA 3G3GA 4OVJA 2F7BA 4MJOA 3PUWE 4YAHX 4U4XA 4IY5A 3VLUA 4PE5B 4R9GA 3SETA 5AA2B 3T0JA 3CFZA 3IO6A 1FPFA 3MSTA 1LBZA 1MM7A 3RPLA 1D9QA 2G93A 1B4HA 1NH7A 1Q9DA 4PFTA 4F22A 1FBDA 4PC9A 4R74A 3HPIA 4PFIA 4GLIA 1M5EA 4F1UA 3A3UA 4O7IA 2V25A 1N7XA 4HTGA 1MDP1 3CG1A 4O94A 4H5FA 3G3HA 2F3BA 3KN3A 3RNNA 4YKIA 3O29A 1PDAA 4FATA 1LGBC 4OXVA 2NUVA 4U4SA 3MC2A 3B50A 4OENA 4PFWA 4ZEKA 4F19A 5L9SA 1FRPA 1SW4A 2W7YA 2CZHA 3T93B 3KJTA 1ZIUA 5EQ8A 2UVHA 1Y20A 2UXAA 3TQWA 2UVJA 4LQ2A 3M3LA 2Q2AA 1US4A 1MQDA 1JW1A 4YB6A 4QFKA 1H76A 3OEKA 1NH8A 3MJNA 1N3WA 3UP9A 3RN8A 4NG7A 1JQFA 4MMPA 2I3VA 3E78A 3U65A 2Z8DA 2O1MA 4U1OA 2V3QA 1B3EA 4PP0A 3EPEA 4FEBA 2A5SA 3BFTA 1FQBA 2FYIA 1YYZA 3W15C 4PGNA 1RKMA 1FBHA 1UQWA 1N0TA 5HBCA 2DYXA 3G7WA 4EDPA 1B7ZA 3V5AA 3K00A 1B51A 3ZKLA 1UTBB 2OJTA 3LSFB 4OANA 3H6TA 3K0VA 1D3KA 4N4UA 1IZ1A 4PF6A 2QS1A 2XXXA 3UK4A 1MXUA 5I56A 1WODA 2I58A 1B46A 2I0BA 1Y1MA 2OWSA 3ZS6A 3H3GA 4DLDA 4P8BA 2HZKA 3ILUB 4QSDA 4N81A 1N04A 4GOTA 4GRKA 4ZECA 2RF1A 3K6WA 2ZYMA 1OQGA 4R9FA 5I59B 2GHBA 1H44A 3RLFE 5AA4B 2UVIA 3RYDA 3O6IA 1LBWA 4R6HA 3FVGA 3OD7A 4FAJA 4I40A 2ABHA 3FD3A 4R75A 4M1VA 4H5GA 4FEDA 2UYFA 1R1NA 4KCCA 3TMGA 4PFUA 4NF4B 2ONKE 1PB8A 5CC2A 2ESNA 1AOVA 2P0SA 4F3GA 4QRZA 4F1VA 4LA9A 1US5A 1LEVA 2XXTA 2XXYA 4IGTA 4HE0A 4BDLA 3QYTA 4NN3A 4IO7A 4RPNA 4KD5A 2Y5KA 3LUZA 1WVJA 1MQIA 1SW2A 3ZKKA 3ZSFA 2QVVA 3KGCA 4ECFA 1MXXA 1JP4A 2FIXA 3PTYA 1SVXB 2ZNSA 2ONRA 5H8QB 4KPTA 1RYXA 2I3WA 1B1HA 4Q30B 4BDOA 1KWHA 4O3BA 3KC1A 2IEEA 5AA2A 3CSBA 3O6GA 2FVZA 1MY3A 1FSAA 5EYFA 2REGA 4PETA 2B4MA 2XXUA 4AB5A 3LSXA 2THIA 1BK4A 1EYJA 1BP5A 3M3FA 3PD9A 1K9YA 4LVQA 2VHAA 2PX1A 4PAFA 1PBQA 3DP4A 4AS5A 2QFLA 2F5XA 3U92A 3E79A 2GFEA 5A5XB 2HEUA 3HHGA 2V3TA 1MY1A 1T0KA 1IXCA 4OYVA 3IOTA 2QSXA 3PUYE 1IMAA 1LSTA 5EHSA 5H8HA 2OBGA 1FCKA 2O69A 3NOHA 3SEVA 1MXZA 3TTLA 4ND9A 3S9NC 4OMBA 3KJ7A 1FPGA 2PT2A 1NV2A 4OWDA 3RTWB 2F7CA 2GHAA 2QVUA 5L9OA 1PB7A 2I48A 2Z8FA 1POTA 4NF5B 1ZU0A 3D1RA 5DYHA 3QXMA 4G77A 4Q5TA 4F3SA 2Y5LA 1YZ0A 4TLLB 3LSLA 3FXRA 2ZYNA 1AH5A 1SDXA 3QUFA 3OO9A 1Y3PA 1XC1A 4ZEBA 3JZJA 4GBWA 3OOAA 5L9MA 1B3GA 1LFIA 3GLBA 4P1EA 3CI8A 1VE4A 3PPOA 1B3HA 4NHBA 5AA1A 4L17A 1DMBA 2RC9A 3KZGA 3MVWA 4KCDA 3CIJA 1L5TA 4ZEIA 1QJMA 2OLBA 4DI4B 2V3UA 3ECRA 3PPNA 5CMMA 3PD8A 3T66A 1UTHB 2DWAA 3KOTA 2PBWA 1FBFA 5I5PA 1Y4CA 4KI0E 3V89B 3CVGA 4E0XA 2B4LA 2Q8MA 1FJ6A 4LONB 2Q89A 2KQZA 4GWYA 1Y3QA 3G3IA 3R6UA 1IMEA 5KCJA 1DPPA 3KC0A 1MM6A 3FVNA 3FZVA 3A09A 1ZBMA 3TTNA 1O7TA 4C1TA 4JVIA 1FQCA 3KG2A 3OENA 5I2KB 2HCAA 3DP6A 4MNIA 2E1SA 3VDFA 2HPGA 4HS7A 5BWJA 5I57B 1VR5A 3SEXA 5I59A 3HCQA 2WEFA 2Y7PA 2REJA 3VV5A 5KDTA 4LATA 2AIXA 4XF5A 2FA7A 1FPLA 1FPDA 1JW5A 1USYH 4OFLA 4N8YA 5B70A 3UIFA 4NX1A 1YAEA 1FTJA 1QUKA 4NQ8A 2JJKA 4KR5A 3ONMA 2HXRA 2B3FA 1MQGA 1F9BA 3DP8A 4G68B 3T1BA 5I2KA 2FIEA 4N6PA 4NEDA 4YZZA 1JETA 3H6VA 3H7MA 3O6HA 4JBZA 4M4GA 1H43A 5H8NA 5ET8A 3I3VA 4RYAA 4LN5A 4R6YA 2I0CA 4XEQA 5L8DA 4FJPA 5J16A 2NXOA 1WDNA 4YU0A 1OMPA 1PEBA 3HSTA 3M3KA 1JVYA 1ZTYA 4YKPA 1B32A 3O28A 2D5WA 2QS3A 2G29A 4IB2A 5H8HB 2OZZA 4DCXA 3C9HA 3U8QA 3VVEA 1AWBA 1DK4A 2WKYA 2UYEA 1EU8A 2ZZVA 4BDMA 3QUJA 4GWWA 1ELJA 5IGAA 4OFOA 3SEYA 2Z22A 5A5LA 5H8FB 2ZYKA 1MDQA 1FBPA 3GYYA 3WAFA 3TTMA 4NMYA 4N07A 3TTRA 2HHMA 1BTJA 4FECA 4QXDA 3PV0E 3TZAA 4U23A 1M5CA 3IL1B 1MH4A 1Z7NE 2WYPA 1SPIA 4N15A 5IZ3A 2QS2A 5LDZA 1LFGA 4P0GA 2XXRA 2DS9A 1I69A 2F6GA 4EF1A 3PU5A 1Y1ZA 4NE4A 2A5TB 4NF5A 5ET7A 4X1DA 4C0RA 3TCFA 4EXLA 4LZ8A 1B7UA 1FPIA 4F3BA 4HE2A 3TPAA 1MXWA 2O7IA 3DM0A 4DXCA 5ITOA 3K6XA 1EZ9A 3OSQA 1LBYA 3KOSA 3MWBA 3CRBA 3T9XB 4OVQA 2H5YA 2RC8A 2ONSA 1H45A 4EQ9A 4P9KA 3KSXA 2H98A 1IMBA 4UACA 4AQ4A 1NUXA 3R26A 2PVUA 2YLNA 4UA8A 2XXKA 1PC3A 3FXQA 5K2YA 4ZDMA 2DWIA 1D9VA 1GGGA 4PE3A 2R8TA 3FIRA 3C32A 4Z0IA 4XKNA 1O64A 1QW0A 2ZNUA 1Z7ME 3K6VA 4YB7A 3C36A 1IMDA 4I9DA 4NF8B 3V83A 2Z8EA 3E3KA 2GQ1A 5KDTB 1LAGE 3S2VA 5I58A 1K9ZA 5ELVA 4PFBA 5F1QA 2YJPA 3LR1A 3L6GA 3N94A 3CHGA 4OVSA 3N26A 1IIWA 3U94A 4P1LA 3ISPA 4RY1A 5DEXA 1RDZA 4GBVA 2FNCA 3KFMA 2VPOA 3VLVA 2P3NA 1NV7A 5DW8A 1ATGA 1O63A 1NV6A 3OEMA 1II5A 2F3DA 3IB1A 4LZ7A 1G0HA 2PMSA 4X04A 4DCYA 4RK2A 5J1DA 1NI9A 4BLAA 4OFJA 2P1SA 3PPPA 3VE1B 3TQLA 4YMAA 1NNFA 1B4ZA 3EF7A 3CG3A 2PT1A 2HFBA 1EYKA 4ELPA 1VSOA 1A7LA 1DTGA 3FUZA 4JB7A 3OELA 4U21A 2DXYA 1TFDA 3IORA 4QSEA 5AA2D 3IOWA 4LZ5A 2M8CA 1IXHA 3LV0A 4MLVA 2VD2A 2ALUA 1B05A 4G2ZA 2DWJA 4G8NA 1SYIA 1JVXA 3TODA 3VLWA 4GWUA 1LBCA 2F35A 1IXGA 1HSJA 2H4IA 1FQEA 1D9YA 3RQTA 4I3YA 4IY6A 3O2AA 3TYHA 1P99A 2XXIA 1FTKA 4ZE8A 3UA8A 4F2OA 4H65A 1DSNA 2CMOA 4GL0A 4XFEA 4QSCA 3FJMA 1BLFA 1IQ7A 3D4CA 3V8XB 4RK9A 1XOCA 4H0WA 4GXAA 3PMWA 4MFIA 1IEJA 3MYUA 5H8QA 2PFZA 5A5XA 3O9PA 3PUXE 3KBRA 3VFJA 3SZPA 3IJXB 2X7PA 1H3DA 1A8EA 4DI3D 1RYOA 3CFLA 4ELRA 4R2BA 2DQVA 1IMCA 3SEWA 1OLCA 4JVCA 1A54A 1IMFA 1TXFA 3L6HA 1HSEA 4MH5A 5CMCA 1XHYA 1GTKA 3IK6B 3FXUA 3VVFA 4K3FA 4O3CA 1NV1A 3LBSA 5B7DA 4QFLA 2QMWA 2DVCA 4UABA 1DCUA 3W9WA 3MP6A 2QJEA 3SDFA 3QMFA 3IB2A 2XXVA 1SYHA 4NF4A 4I8CA 3PPQA 4QF9A 2QMXA 1MY4A 3F11A 3KEIA 3MP8A 3RTFB 4F2QA 3PMVA 1POY1 1URSA 1USYE 2I6EA 4H8JA 1EZPA 5CMBA 4NWDA 3THIA 4TQUQ 4DE8A 4YMBA 4ZEDA 1QUIA 5CM6A 2ZZXA 4PDHA 1FPEA 3A3CA 4HE1A 1SW1A 3EKIA 3TEPA 2XA5A 5H8SA 3H03A 4ZEFA 2P3VA 4KYSA 1Y4TA 4GX6A 2KLFA 1B5JA 1LBVA 3N5LA 4OZ9A 1NNPA 2DWHA 1P1QA 5CBSA 3EHSA 3FBPA 2FHYA 4DZ1A 4FIMA 2F34A 2VT5A 2BJJX 1QUJA 1B5HA 4LQ5A 4YKJA 3MBPA 4O3AA 3RY3A 2BJIA 3JV9A 1IITA 4R72A 5ICTA 5FBPA 4QFPA 5I7IA 5I3SA 1R6ZA 4F31B 4PF8A 1I6AA 3HFUA 2XXPA 1NMUA 4HW8A 1LLSA 4MAGA 4RJZA 3PPRA 1M5FA 4Q8RA 3MZBA 1Q35A 4GL8A 2L5VA 3O66A 1D4NA 4JXIA 4F1YA 2XXQA 4GX4A 3KN8A 3BBRA 1HSLA 4KYDA 3MZ1A 3U72A 3MVXA 3FJ7A 3KBZA 1GV8A 4F3PA 4XKQA 5DT6A 4HCWA 4U2RA 3VXCA 4EQ7A 1NL5A 3MP1A 3U1OA 2HAUA 5EYGA 3TUSA 4ELQA 4ESWA 5KCJB 3MW0A 2Y7IA 4I3EA 1QKAA 2CZKA 2P2AA 1LFHA 4N6DA 2GRVA 1OIBA 4WEDA 3MQ9A 3SKPA 4HCYA 4KHZE 4MBPA 3Q29A 4EXKA 4YICA 5EYHA 4NF6B 1MH3A 2O6AA 2B65A 3GXAA 4OQOA 4IGRA 4LP2B 3ILTB 2I49A 4N6KA 5I58B 2Q9TA 2Z23A 3MVZA 1UIUA 2Q88A 2RC7A 4ZS9A 4H6DA 3DELB 2OWZA 1VDWA 1NV0A 5EQ7A 1SI0A 3KN7A 5TPAA 4PAIA 4OEVA 5IM2A 3I6VA 2D3IA 4F18A 2H9BA 3SERA 1B2HA 1IUDA 1S9TA 2VPNA 4O8MA 3I5OA 4H67A 1VFDA 5DVIA 4P3LA 3B6WA 4BDNA 3TCHA 5IZ1A 5FHMA 3G3JA 4X1BA 2XXWA 1QGXA 2XX8A 4JWXA 3T9HB 3CFXA 4BDRA 2F8DA 3DLNA 3EHTA 2DVZA 1B52A 4NF6A 3IR1A 5EQAA 4U22A 1IXIA 5M2VA 5LTCA 1ANFA 1B3LA 4NAPA 4P56A 4ISUA 5FHNA 2DDKA 1N3XA 3S9MC 2XD2A 3VXBA 1P1WA 4NF8A 4Q0CA 4PCDA 1QKBA 5TP9B 2UVGA 3E4RA 5JEIA 2DSFA 3H4ZA 2D21A 3R7XA 1A55A 4HXVA 3UN6A 5ESYA 4FORA 1NV5A 5CRYA 2PYYA 1B0LA 1XS5A 1XVYA 5K2XA 2HZLA 5IZ3B 2XD3A 3QIMA 3AXFA 2VOZA 4JVDA 5AA4A 1GVCA 4PFRA 5DTBA 2V4CA 3O97A 2QRYA 1LCTA 3T22A 4G8HA 1BKAA 4YKKA 3D4GA 4PFYA 2Q8JA 4JSDA 5JTYB 1NUZA 2WX9A 4KQPA 1NKXA 2IA4A 1OVBA 2QPQA 4OHNA 1S50A 4XIGQ 3EQ1A 1JW4A 2CEYA 3K6UA 1FQFA 3GBAA 3TKDA 5FHOA 4E0WA 2Y7RA 4OVPA 1MPCA 4OA4A 4ONYA 3FVOA 3WAEA 4C1UA 1MY0A 1FJ9A 1JEVA 5DVFA 3FV1A 4MIJA 1AIVA 1FBCA 3Q27A 2AL4A 3VVDA 3BIHA 5DEXB 4MF3A 4RNSA 1UTBA 4IO6A 1R9QA 3S4UA 3H6UA 1P1OA 4TOZA 4PTKA 3S9LC 3RUMA 1B40A 4WKMA 1SQYA 3A29A 4TLMB 1FQAA 2F6PA 4LUBA 3SESA 1DPEA 1MS7A 3OO7A 2Y7WA 1SD3A 4FBPA 4EUOA 1B1XA 4AS4A 3IFCA 1LAFE 1AL3A 1LBBA 3OO8A 4H46A 2O1LA 2R71A 2WBBA 3E9XA 1ZMGA 2QS4A 1EYIA 3N6TA 4R2FA 1LAXA 3HV1A 3IAZA 3QK6A 3TDJA 3RT6B 4NF0A 3IFAA 3KSJA 1URDA 1Y3NA 2CZIA 1A40A 2X7QA 3HHFA 5ICQA 3TTKA 3HO7A 5ISUA 5LOMA 1I6BA 4QFOA 2XX9A 1ZKBA 5CBRA 3C33A 2Q2CA 2NVUB 1NUYA 3CR9A 1M5DA 3C34A 2XX7A 4N13A 3PGFA 2LAOA 5ITPA 4XKRA 1PB9A 1EH3A 4ZE9A 1B58A 4MHFA 1KA1A 2Y84A 3H06B 2O68A 4O7MA 4FE8A 2DP8A 4RXLA 1BIYA 1OVTA 3U93A 4Z7EA 1RDYA 1LB8A 5HM4B 1MG1A 3QSLA 5JK4A 5FTHA 2DOJA 1B7HA 2XHDA 2V84A 1A8FA 2B3BA 4NWCA 3K1PA 2V93A 3OSRA 1MQHA 2HQ0A 3ROJA 4MNCA 4GFRA 1Y9UA 3N6UA 1QULA 3UGWA 1MXYA 1N84A 1VFEA 4XTCQ 1I6QA 3EN3A 4GIZA 2CZLA 4OTEA 3Q26A 1M5BA 1UIVA 4KFQA 2F97A 1B6HA 5HPQA 2KR0A 2DE3A 5I2NA 4X8RA 3RT8A 4OVRA 1ZJLA 2NOOA 5H8FA 2F78A 2ZZWA 1KZ8A 4IO4A 5TPAB 1P1UA 4F29A 4N17A 1LCFA 5FTIA 5ET6A 4PQJA 3B6TA 1B3FA 1R9LA 4MNPA 1UTHA 1YPNA 2YPNA 1XI6A 2R6GE 5BUUA 1J1NA 2DXRA 1A99A 4YB5A 5JTYA 3TFLA 1MY2A 3GBBA 3K4UA 2XWOA 4IO3A 3E13X 4GWSA 2Y7KA 3RPLB 2H99A 2XXHA 1EZOA 2O7UA 3OO6A 4BDQA 4IO2A 1XVXA 3RPWA 3B6QA 5IZZA 2NWJA 1MPBA 4G68C 1FPBA 3B8BA 3IOVA 5IAIA 4GWOA 1N7WA 1PBPA 1LAHE 2PCRA 5AE4A 1DTZA 3K2DA 4PDDA 2AL5A 1OQHA 5AA3A 3MVYA 4EF2A 5EHMA 1JEUA 1B0HA 4NTLA 2H25A 5F7VA 4NGUA 3LC8A 4JDFA 2I4BA 2OK2A 3TAJA 4AB6A 4P11A 3K1NA 3LSWA 1URGA 2X26A 3G3KA 2OWTA 2OCUA 3HN0A 2HAVA 1FQDA 1GR2A 5CMKA 4P47A 5I56B 3EHUA 3FGSA 1N76A 4H8IA 1LB9A 4RPOA 3FATA 1KA0A 4POXA 4DXBA 3CSGA 3PMXA 4DDDA 1P1NA 3USDA 2ZXTA 2VP1A 3C4MA 4IR8A 4THIA 5I2NB 4MX6A 2QL3A 2RCBA 5T3JA 3JYRA 3M8UA 2XWVA 2Q74A 5H8NB 2CEXA 2VD3A 4KXPA 1LBXA 4ESXA 3K1MA 1INPA 3T9UA 3FASA 3MPLA 3K01A 4I62A 2GH9A 1FPKA 4WXJA 4H45A 4GVOA 1B5IA 4ELOA 4GWXA 1NNTA 4XKPA 1OLAA 1FTMA 4OEUA 4DIGA 3IOUA 4PBHA 1FTAA 3Q25A 5I57A 3IB0A 4R73A 3MZ9A 1YCJA 1MRPA 1TT1A 1SI1A 3PUVE 2FBPA 1Q1KA 5F24A 4GF8A 1CNQA 3IX1A 4MCOA 2RKMA 3T9VA 4G8MA 2WBDA 5I84A 2AYSA 4DXUA 4WEPA 4PBQA 3MUQA 4OERA 1G0IA 1CE2A 2XWIA 2VGQA 4GQOA 1TFAA 5TU0A 3P7IA 3ODBA 4N8GA 3H6WA 3TCGA 4U1ZA 4GD5A 4RA1A 4EQBA 1FTOA 4I1DA 4GXSB 1YXIA 1ZLQA 2ZMBA 5ET5A 4F39A 4X48A 3BKIB 3PUZE 4MEVA 1NNKA 2ZYOA 3C35A 4G61A 4QFNA 3FXBA 4JWYA 3MPKA 4OETA 4JSOA 4QBAA 3MAMA 4PAKA 2DE2A 2RCAA 4POWA 3RGYA 3FV2A 2PFYA 3QAXA 3B7DA 2QVRA 2R9JA 3FJGA 1RDXA 1SBPA 1B9JA 4H1XA 1MPDA 5IKBA 1NUWA 4MLQA 1FW0A 3BIGA 2HXWA 4GWZA 4KYEA 4ZZAA 2RINA 4JWOA 4IO5A 1NFTA 3FVKA 2XWKA 3LUYA 3C31A 4ZZEA
chains in the Genus database with same CATH topology
4Q5TA 3UA8A 4F2OA 4H65A 1DSNA 2CMOA 1JNFA 4GL0A 4TLMB 4F3SA 1FQAA 2F6PA 4LUBA 4QSCA 4TLLB 3SESA 1DPEA 1MS7A 1SW5A 3FXRA 3LSLA 3OO7A 1MQJA 2Y7WA 1AH5A 2E0SA 1SD3A 1SDXA 1BLFA 2ZYNA 3FJMA 1XT8A 1IQ7A 1B1XA 3QUFA 3OO9A 1Y3PA 3D4CA 4EQ7A 1XC1A 4ZEBA 3V8XB 4RK9A 1LAFE 3JZJA 1XOCA 4H0WA 4GXAA 1AL3A 3PMWA 4MFIA 4P0IA 1IEJA 1LBBA 5H8QA 3OOAA 3TELA 5L9MA 3OO8A 1B3GA 4XXUA 2DE4A 5A5XA 2O1LA 2R71A 1LFIA 3GLBA 4X9TA 3O9PA 3E9XA 3CI8A 3PUXE 3KBRA 1CB6A 1VE4A 3G3FA 3PPOA 5TP9A 1ZMGA 1B3HA 2QS4A 3VFJA 2I4CA 3N6TA 4R2FA 2O51A 1LAXA 5AA1A 3IJXB 4G68A 1DMBA 1H3DA 2RC9A 2X7PA 3KZGA 4L17A 1YTVA 3W9VA 3MVWA 2F7AA 4KCDA 3HV1A 2O84X 1A8EA 3IAZA 5DVJA 3T66A 3QK6A 3CIJA 1RYOA 3CFLA 1L5TA 4R2BA 2DQVA 4ZEIA 1QJMA 3BFUA 1OLCA 2OLBA 3RT6B 3SEWA 3TDJA 3UORA 3GZGA 2V3UA 1A54A 1TXFA 2ZNTA 2A5TA 1HSEA 3ECRA 3L6HA 3OMBA 4MH5A 3Q28A 3KSJA 3IJOB 3PPNA 1URDA 1Y3NA 5CMMA 3PD8A 5CMCA 1TWYA 1UTHB 2DWAA 1A40A 2ANJA 2X7QA 3HHFA 3IO4A 3KOTA 5CI5A 1XHYA 2PBWA 1GTKA 3IK6B 1Y4CA 3FXUA 3VVFA 1DOTA 4K3FA 4O3CA 3TTKA 3LBSA 5B7DA 4KI0E 3HO7A 4QFLA 5LOMA 3V89B 3CVGA 2QMWA 1I6BA 1AMFA 5ISUA 4QFOA 3K02A 4G4PA 1QVSA 2DVCA 2XX9A 1ZKBA 3SEUA 3W9WA 3MP6A 4QHQA 5CBRA 2QJEA 3SDFA 4E0XA 3C33A 2Q2CA 3IB2A 2XXVA 1SYHA 4NF4A 1FTLA 4I8CA 5ICQA 3PPQA 4LONB 4QF9A 2QMXA 1MY4A 3F11A 2F36A 2NVUB 3KEIA 3MP8A 2Q89A 1MXVA 3OXNA 3RTFB 4F2QA 4OESA 3PMVA 1S7YA 1POY1 1URSA 1USYE 1Y3QA 3CR9A 3S9EA 4R6KA 2I6EA 1M5DA 3G3IA 3R6UA 3C34A 2XX7A 4H8JA 3PGFA 4N13A 5KCJA 1DPPA 3G3GA 2F7BA 2LAOA 4OVJA 4XKRA 5ITPA 3PUWE 4YAHX 1PB9A 1EZPA 1EH3A 5CMBA 4ZE9A 1B58A 4U4XA 1MM6A 3FVNA 3FZVA 4IY5A 4NWDA 3VLUA 3THIA 2Y84A 3H06B 2O68A 3A09A 4TQUQ 3T96B 4DE8A 1ZBMA 4FE8A 2DP8A 3TTNA 4RXLA 1BIYA 1O7TA 4PE5B 4C1TA 1OVTA 4R9GA 3U93A 4EUOA 4YMBA 4ZEDA 1QUIA 1FQCA 1LB8A 4Z7EA 3SETA 5HM4B 3KG2A 5AA2B 1MG1A 5CM6A 3QSLA 5JK4A 3OENA 5I2KB 5FTHA 3CFZA 2DOJA 2HCAA 3DP6A 1B7HA 3IO6A 1MM7A 2XHDA 2E1SA 3VDFA 2V84A 3A3CA 2G93A 1A8FA 4HS7A 1SW1A 1B4HA 1NH7A 2B3BA 4NWCA 3K1PA 5BWJA 5I57B 3TEPA 1VR5A 3SEXA 2V93A 4PFTA 4F22A 5I59A 3HCQA 5H8SA 3OSRA 4R74A 2Y7PA 3H03A 3HPIA 4GLIA 2REJA 3VV5A 4ZEFA 1M5EA 1MQHA 2HQ0A 4F1UA 4KYSA 3A3UA 4LATA 5KDTA 1Y4TA 4GFRA 2KLFA 2V25A 1Y9UA 1B5JA 3N5LA 2AIXA 1N7XA 4OZ9A 1NNPA 3N6UA 2FA7A 1MDP1 4HTGA 1QULA 3UGWA 1MXYA 3CG1A 2DWHA 4H5FA 1N84A 1VFEA 3G3HA 1P1QA 1JW5A 4OFLA 1USYH 3KN3A 4XTCQ 3RNNA 5CBSA 1I6QA 3EN3A 3O29A 4GIZA 3EHSA 1PDAA 4YKIA 3UIFA 2CZLA 4FATA 1YAEA 1LGBC 4OXVA 4OTEA 2NUVA 4DZ1A 1FTJA 1M5BA 1QUKA 3Q26A 4U4SA 3MC2A 4FIMA 4OENA 2F34A 1UIVA 4PFWA 4KFQA 2BJJX 2F97A 3ONMA 4KR5A 1QUJA 4ZEKA 1B5HA 1B6HA 4LQ5A 4YKJA 3S4UA 4F19A 5HPQA 3MBPA 1SW4A 2DE3A 4O3AA 2B3FA 3RY3A 1MQGA 5I2NA 2W7YA 3JV9A 1IITA 1F9BA 3DP8A 4G68B 4R72A 3T93B 5ICTA 3RT8A 5I2KA 3KJTA 1ZIUA 1ZJLA 2NOOA 4N6PA 2UVHA 4NEDA 4QFPA 4YZZA 2F78A 1JETA 1Y20A 5H8FA 3H6VA 2UXAA 3H7MA 4AB6A 4IO4A 3O6HA 1P1UA 1R6ZA 4JBZA 5TPAB 4F31B 4F29A 4M4GA 1I6AA 3TQWA 2UVJA 4LQ2A 1LCFA 3M3LA 5FTIA 2Q2AA 1H43A 4PQJA 2XXPA 1NMUA 1US4A 5H8NA 4HW8A 1LLSA 1MQDA 1JW1A 3I3VA 3B6TA 4RYAA 4YB6A 4QFKA 1B3FA 4R6YA 3QXMA 1H76A 4RJZA 2I0CA 5L8DA 1R9LA 4FJPA 3PPRA 1M5FA 2NXOA 4Q8RA 1WDNA 4YU0A 3OEKA 1NH8A 3MJNA 1UTHA 3MZBA 1N3WA 1OMPA 1PEBA 1YPNA 2YPNA 3UP9A 1Q35A 4GL8A 2R6GE 3O66A 5BUUA 3HSTA 3M3KA 3RN8A 1D4NA 4JXIA 1J1NA 4F1YA 2XXQA 1JVYA 1ZTYA 2DXRA 1JQFA 4YKPA 1A99A 1B32A 3O28A 2D5WA 4YB5A 3KN8A 3BBRA 1HSLA 4KYDA 5JTYA 3MZ1A 3TFLA 1MY2A 2QS3A 3GBBA 3K4UA 3MVXA 3FJ7A 3U72A 2I3VA 2G29A 4IB2A 5H8HB 2OZZA 4DCXA 3C9HA 3U8QA 4IO3A 3VVEA 3E13X 2Y7KA 1GV8A 2H99A 2UYEA 2WKYA 2XXHA 1EU8A 2Z8DA 2O1MA 4U1OA 1EZOA 2V3QA 4BDMA 2O7UA 1B3EA 3OO6A 4F3PA 4BDQA 3QUJA 4PP0A 1ELJA 4IO2A 4XKQA 1XVXA 3EPEA 4HCWA 4U2RA 5DT6A 4FEBA 3VXCA 2A5SA 3BFTA 4OFOA 1NL5A 1FQBA 3B6QA 3MP1A 3RPWA 2FYIA 3SEYA 2NWJA 2Z22A 3U1OA 2HAUA 1MPBA 1RKMA 3W15C 4ELQA 4G68C 3TUSA 4ESWA 5KCJB 1UQWA 2Y7IA 3IOVA 3MW0A 5IAIA 1N0TA 4GWOA 5H8FB 5HBCA 2DYXA 1QKAA 2ZYKA 1MDQA 3G7WA 4EDPA 1N7WA 2P2AA 1B7ZA 1PBPA 1LFHA 3V5AA 3K00A 3TTMA 2GRVA 4N07A 4NMYA 1OIBA 1LAHE 1B51A 3TTRA 3WAFA 4WEDA 3ZKLA 5AE4A 3MQ9A 1UTBB 1DTZA 2OJTA 1BTJA 3K2DA 4FECA 4HCYA 2AL5A 1OQHA 3LSFB 3PV0E 3H6TA 3K0VA 3TZAA 5AA3A 3MVYA 4KHZE 4ELRA 1D3KA 4MBPA 4EF2A 4U23A 1M5CA 3IL1B 1IZ1A 3Q29A 5EHMA 4BDLA 4YICA 4EXKA 1JEUA 4NF6B 1B0HA 4NTLA 1MH3A 2QS1A 2O6AA 2H25A 2XXXA 5F7VA 1MH4A 1Z7NE 2B65A 3GXAA 4OQOA 3LC8A 1MXUA 4IGRA 4JDFA 3ILTB 1WODA 4LP2B 2I49A 3UK4A 2I4BA 2OK2A 2I58A 5I56A 2QS2A 1B46A 5I58B 4XKNA 2Q9TA 2Z23A 3MVZA 1UIUA 3K1NA 2Q88A 2I0BA 4P11A 1Y1MA 1LFGA 1URGA 2OWSA 2RC7A 3H3GA 2X26A 3LSWA 2XXRA 4P0GA 4ZS9A 3G3KA 4H6DA 3ZS6A 2DS9A 1I69A 2OWTA 3DELB 2OCUA 2F6GA 3HN0A 4EF1A 2HAVA 1FQDA 3PU5A 1GR2A 1SI0A 2HZKA 3ILUB 3KN7A 1Y1ZA 5TPAA 5CMKA 5I56B 4QSDA 3EHUA 4NE4A 1N04A 2A5TB 4GOTA 4GRKA 4NF5A 4OEVA 3I6VA 2D3IA 4F18A 4ZECA 4X1DA 2RF1A 3FGSA 3K6WA 1N76A 4C0RA 3TCFA 2ZYMA 4EXLA 4H8IA 1LB9A 1OQGA 4LZ8A 3FATA 4RPOA 4R9FA 4POXA 1B7UA 4DXBA 3CSGA 4F3BA 2H9BA 3PMXA 4DDDA 3SERA 1B2HA 1IUDA 1P1NA 2GHBA 3SKPA 3TPAA 5I59B 1H44A 3RLFE 3USDA 1MXWA 2ZXTA 1S9TA 2VP1A 2O7IA 5AA4B 3DM0A 4DXCA 2UVIA 3C4MA 5ITOA 4THIA 3K6XA 1EZ9A 5I2NB 3I5OA 3OSQA 4H67A 3KOSA 3MWBA 3O6IA 2QL3A 1VFDA 2RCBA 3CRBA 5DVIA 3JYRA 3T9XB 3B6WA 4R6HA 3M8UA 2H5YA 2RC8A 4BDNA 5B70A 2ONSA 1H45A 5H8NB 3FVGA 3OD7A 4FAJA 4EQ9A 2ABHA 3FD3A 3KSXA 4R75A 2VD3A 3TCHA 4M1VA 4H5GA 5FHMA 5KZTA 3G3JA 4FEDA 2H98A 2UYFA 1R1NA 4X1BA 4UACA 4KCCA 4ESXA 3K1MA 2XXWA 4C1UA 3TMGA 4DLDA 3T9UA 4AQ4A 2XX8A 3FASA 3MPLA 4JWXA 3K01A 4I62A 4PFUA 3R26A 4NF4B 2ONKE 2GH9A 2PVUA 3CFXA 4WXJA 1PB8A 3T9HB 4BDRA 2YLNA 4UA8A 5CC2A 2F8DA 4GVOA 1PC3A 2ESNA 3FXQA 5K2YA 3DLNA 1B5IA 4ELOA 3EHTA 1NNTA 4ZDMA 1AOVA 2DVZA 4XKPA 1B52A 1OLAA 4NF6A 2P0SA 2DWIA 1D9VA 1FTMA 1GGGA 4OEUA 4QRZA 4DIGA 4F3GA 3IOUA 3IR1A 4BDOA 4F1VA 3Q25A 4LA9A 5I57A 3FIRA 3C32A 3IB0A 1US5A 2XXTA 4R73A 2XXYA 4Z0IA 4IGTA 3MZ9A 3TAJA 4U22A 1O64A 1IXIA 1YCJA 1QW0A 1MRPA 1TT1A 1SI1A 2ZNUA 1Z7ME 1ANFA 1B3LA 3PUVE 5M2VA 1Q1KA 3QYTA 4GF8A 3K6VA 3IX1A 4YB7A 4IO7A 2RKMA 3C36A 4I9DA 4ISUA 5L9SA 5FHNA 3T9VA 4G8MA 1N3XA 4RPNA 4NF8B 3S9MC 3V83A 2XD2A 3VXBA 2Z8EA 3E3KA 4KD5A 1P1WA 5KDTB 1WVJA 4NF8A 1MQIA 4Q0CA 1LAGE 1SW2A 2AYSA 5I84A 3S2VA 3ZKKA 4DXUA 3ZSFA 1QKBA 5TP9B 3KGCA 4ECFA 5I58A 2UVGA 1MXXA 3E4RA 4WEPA 5ELVA 5JEIA 2DSFA 5F1QA 2YJPA 1SVXB 3H4ZA 2ZNSA 2D21A 3LR1A 2ONRA 3L6GA 3MUQA 5H8QB 3N94A 1RYXA 2I3WA 1B1HA 4KPTA 4Q30B 1A55A 1KWHA 3R7XA 3UN6A 4O3BA 4OERA 2IEEA 1CE2A 3N26A 1IIWA 3U94A 5AA2A 2VGQA 4FORA 3CSBA 4GQOA 3O6GA 4RY1A 1TFAA 5DEXA 5TU0A 3P7IA 3ODBA 5CRYA 1MY3A 2FNCA 2PYYA 3KFMA 3H6WA 3VLVA 5EYFA 3TCGA 2REGA 1B0LA 1XS5A 1XVYA 4PETA 4U1ZA 5K2XA 2XXUA 4AB5A 4GD5A 2HZLA 3LSXA 1ATGA 4RA1A 4EQBA 1O63A 2THIA 2XD3A 3QIMA 1BP5A 3AXFA 3M3FA 2VOZA 3PD9A 1FTOA 5AA4A 3OEMA 4I1DA 1GVCA 1II5A 3IB1A 4LZ7A 4GXSB 4LVQA 2PMSA 5DTBA 2VHAA 2PX1A 4DCYA 1ZLQA 2ZMBA 4RK2A 4F39A 4X48A 5J1DA 4BLAA 4OFJA 2P1SA 3BKIB 3O97A 3PPPA 3PUZE 3VE1B 3TQLA 2QRYA 1NNKA 1PBQA 1LCTA 3DP4A 1NNFA 1B4ZA 2ZYOA 4G8HA 3T22A 4YMAA 3C35A 4QFNA 1BKAA 3EF7A 3CG3A 2F5XA 4YKKA 3U92A 3D4GA 2PT1A 4PFYA 2HFBA 2Q8JA 4ELPA 4JSDA 5JTYB 1VSOA 1A7LA 1DTGA 3FUZA 4JWYA 4JB7A 4KQPA 3MPKA 2GFEA 3OELA 4OETA 4JSOA 1NKXA 5A5XB 4U21A 2DXYA 2IA4A 2HEUA 3HHGA 1TFDA 3MAMA 1OVBA 3IORA 2DE2A 2QPQA 2V3TA 1S50A 2RCAA 1MY1A 3EQ1A 4OHNA 4QSEA 4XIGQ 1IXCA 1JW4A 3K6UA 5AA2D 1T0KA 1FQFA 3GBAA 3IOWA 4LZ5A 4POWA 3RGYA 3FV2A 3QAXA 2M8CA 5FHOA 3TKDA 1IXHA 4E0WA 2Y7RA 3B7DA 2R9JA 3FJGA 4OYVA 3IOTA 2QSXA 3PUYE 1MPCA 1LSTA 4MLVA 4ONYA 1SBPA 2ALUA 2VD2A 3FVOA 1B05A 3WAEA 1B9JA 1MY0A 4G2ZA 5EHSA 1JEVA 2DWJA 4G8NA 5H8HA 5DVFA 1SYIA 3FV1A 2OBGA 1FCKA 1JVXA 4H1XA 3TODA 1MPDA 1AIVA 3VLWA 2O69A 3TTLA 3SEVA 1MXZA 4MLQA 5IKBA 4ND9A 1FW0A 2AL4A 3Q27A 3S9NC 3VVDA 4OMBA 5DEXB 3KJ7A 4MF3A 4RNSA 2PT2A 1LBCA 1UTBA 2F35A 1R9QA 2HXWA 3H6UA 1IXGA 1HSJA 4IO6A 4KYEA 4OWDA 2RINA 4JWOA 4ZZAA 2F7CA 3RTWB 2H4IA 1NFTA 1FQEA 1P1OA 2GHAA 4IO5A 1D9YA 4TOZA 3RQTA 3FVKA 1PB7A 2I48A 5L9OA 3S9LC 2Z8FA 3LUYA 4IY6A 3RUMA 1B40A 1POTA 4NF5B 1ZU0A 4WKMA 3C31A 3O2AA 5DYHA 4ZZEA 1P99A 2XXIA 1FTKA 1SQYA 3TYHA 4ZE8A 4G77A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q5T A;  3UA8 A;  4F2O A;  4H65 A;  1DSN A;  2CMO A;  1JNF A;  4GL0 A;  4TLM B;  4F3S A;  1FQA A;  2F6P A;  4LUB A;  4QSC A;  4TLL B;  3SES A;  1DPE A;  1MS7 A;  1SW5 A;  3FXR A;  3LSL A;  3OO7 A;  1MQJ A;  2Y7W A;  1AH5 A;  2E0S A;  1SD3 A;  1SDX A;  1BLF A;  2ZYN A;  3FJM A;  1XT8 A;  1IQ7 A;  1B1X A;  3QUF A;  3OO9 A;  1Y3P A;  3D4C A;  4EQ7 A;  1XC1 A;  4ZEB A;  3V8X B;  4RK9 A;  1LAF E;  3JZJ A;  1XOC A;  4H0W A;  4GXA A;  1AL3 A;  3PMW A;  4MFI A;  4P0I A;  1IEJ A;  1LBB A;  5H8Q A;  3OOA A;  3TEL A;  5L9M A;  3OO8 A;  1B3G A;  4XXU A;  2DE4 A;  5A5X A;  2O1L A;  2R71 A;  1LFI A;  3GLB A;  4X9T A;  3O9P A;  3E9X A;  3CI8 A;  3PUX E;  3KBR A;  1CB6 A;  1VE4 A;  3G3F A;  3PPO A;  5TP9 A;  1ZMG A;  1B3H A;  2QS4 A;  3VFJ A;  2I4C A;  3N6T A;  4R2F A;  2O51 A;  1LAX A;  5AA1 A;  3IJX B;  4G68 A;  1DMB A;  1H3D A;  2RC9 A;  2X7P A;  3KZG A;  4L17 A;  1YTV A;  3W9V A;  3MVW A;  2F7A A;  4KCD A;  3HV1 A;  2O84 X;  1A8E A;  3IAZ A;  5DVJ A;  3T66 A;  3QK6 A;  3CIJ A;  1RYO A;  3CFL A;  1L5T A;  4R2B A;  2DQV A;  4ZEI A;  1QJM A;  3BFU A;  1OLC A;  2OLB A;  3RT6 B;  3SEW A;  3TDJ A;  3UOR A;  3GZG A;  2V3U A;  1A54 A;  1TXF A;  2ZNT A;  2A5T A;  1HSE A;  3ECR A;  3L6H A;  3OMB A;  4MH5 A;  3Q28 A;  3KSJ A;  3IJO B;  3PPN A;  1URD A;  1Y3N A;  5CMM A;  3PD8 A;  5CMC A;  1TWY A;  1UTH B;  2DWA A;  1A40 A;  2ANJ A;  2X7Q A;  3HHF A;  3IO4 A;  3KOT A;  5CI5 A;  1XHY A;  2PBW A;  1GTK A;  3IK6 B;  1Y4C A;  3FXU A;  3VVF A;  1DOT A;  4K3F A;  4O3C A;  3TTK A;  3LBS A;  5B7D A;  4KI0 E;  3HO7 A;  4QFL A;  5LOM A;  3V89 B;  3CVG A;  2QMW A;  1I6B A;  1AMF A;  5ISU A;  4QFO A;  3K02 A;  4G4P A;  1QVS A;  2DVC A;  2XX9 A;  1ZKB A;  3SEU A;  3W9W A;  3MP6 A;  4QHQ A;  5CBR A;  2QJE A;  3SDF A;  4E0X A;  3C33 A;  2Q2C A;  3IB2 A;  2XXV A;  1SYH A;  4NF4 A;  1FTL A;  4I8C A;  5ICQ A;  3PPQ A;  4LON B;  4QF9 A;  2QMX A;  1MY4 A;  3F11 A;  2F36 A;  2NVU B;  3KEI A;  3MP8 A;  2Q89 A;  1MXV A;  3OXN A;  3RTF B;  4F2Q A;  4OES A;  3PMV A;  1S7Y A;  1POY 1;  1URS A;  1USY E;  1Y3Q A;  3CR9 A;  3S9E A;  4R6K A;  2I6E A;  1M5D A;  3G3I A;  3R6U A;  3C34 A;  2XX7 A;  4H8J A;  3PGF A;  4N13 A;  5KCJ A;  1DPP A;  3G3G A;  2F7B A;  2LAO A;  4OVJ A;  4XKR A;  5ITP A;  3PUW E;  4YAH X;  1PB9 A;  1EZP A;  1EH3 A;  5CMB A;  4ZE9 A;  1B58 A;  4U4X A;  1MM6 A;  3FVN A;  3FZV A;  4IY5 A;  4NWD A;  3VLU A;  3THI A;  2Y84 A;  3H06 B;  2O68 A;  3A09 A;  4TQU Q;  3T96 B;  4DE8 A;  1ZBM A;  4FE8 A;  2DP8 A;  3TTN A;  4RXL A;  1BIY A;  1O7T A;  4PE5 B;  4C1T A;  1OVT A;  4R9G A;  3U93 A;  4EUO A;  4YMB A;  4ZED A;  1QUI A;  1FQC A;  1LB8 A;  4Z7E A;  3SET A;  5HM4 B;  3KG2 A;  5AA2 B;  1MG1 A;  5CM6 A;  3QSL A;  5JK4 A;  3OEN A;  5I2K B;  5FTH A;  3CFZ A;  2DOJ A;  2HCA A;  3DP6 A;  1B7H A;  3IO6 A;  1MM7 A;  2XHD A;  2E1S A;  3VDF A;  2V84 A;  3A3C A;  2G93 A;  1A8F A;  4HS7 A;  1SW1 A;  1B4H A;  1NH7 A;  2B3B A;  4NWC A;  3K1P A;  5BWJ A;  5I57 B;  3TEP A;  1VR5 A;  3SEX A;  2V93 A;  4PFT A;  4F22 A;  5I59 A;  3HCQ A;  5H8S A;  3OSR A;  4R74 A;  2Y7P A;  3H03 A;  3HPI A;  4GLI A;  2REJ A;  3VV5 A;  4ZEF A;  1M5E A;  1MQH A;  2HQ0 A;  4F1U A;  4KYS A;  3A3U A;  4LAT A;  5KDT A;  1Y4T A;  4GFR A;  2KLF A;  2V25 A;  1Y9U A;  1B5J A;  3N5L A;  2AIX A;  1N7X A;  4OZ9 A;  1NNP A;  3N6U A;  2FA7 A;  1MDP 1;  4HTG A;  1QUL A;  3UGW A;  1MXY A;  3CG1 A;  2DWH A;  4H5F A;  1N84 A;  1VFE A;  3G3H A;  1P1Q A;  1JW5 A;  4OFL A;  1USY H;  3KN3 A;  4XTC Q;  3RNN A;  5CBS A;  1I6Q A;  3EN3 A;  3O29 A;  4GIZ A;  3EHS A;  1PDA A;  4YKI A;  3UIF A;  2CZL A;  4FAT A;  1YAE A;  1LGB C;  4OXV A;  4OTE A;  2NUV A;  4DZ1 A;  1FTJ A;  1M5B A;  1QUK A;  3Q26 A;  4U4S A;  3MC2 A;  4FIM A;  4OEN A;  2F34 A;  1UIV A;  4PFW A;  4KFQ A;  2BJJ X;  2F97 A;  3ONM A;  4KR5 A;  1QUJ A;  4ZEK A;  1B5H A;  1B6H A;  4LQ5 A;  4YKJ A;  3S4U A;  4F19 A;  5HPQ A;  3MBP A;  1SW4 A;  2DE3 A;  4O3A A;  2B3F A;  3RY3 A;  1MQG A;  5I2N A;  2W7Y A;  3JV9 A;  1IIT A;  1F9B A;  3DP8 A;  4G68 B;  4R72 A;  3T93 B;  5ICT A;  3RT8 A;  5I2K A;  3KJT A;  1ZIU A;  1ZJL A;  2NOO A;  4N6P A;  2UVH A;  4NED A;  4QFP A;  4YZZ A;  2F78 A;  1JET A;  1Y20 A;  5H8F A;  3H6V A;  2UXA A;  3H7M A;  4AB6 A;  4IO4 A;  3O6H A;  1P1U A;  1R6Z A;  4JBZ A;  5TPA B;  4F31 B;  4F29 A;  4M4G A;  1I6A A;  3TQW A;  2UVJ A;  4LQ2 A;  1LCF A;  3M3L A;  5FTI A;  2Q2A A;  1H43 A;  4PQJ A;  2XXP A;  1NMU A;  1US4 A;  5H8N A;  4HW8 A;  1LLS A;  1MQD A;  1JW1 A;  3I3V A;  3B6T A;  4RYA A;  4YB6 A;  4QFK A;  1B3F A;  4R6Y A;  3QXM A;  1H76 A;  4RJZ A;  2I0C A;  5L8D A;  1R9L A;  4FJP A;  3PPR A;  1M5F A;  2NXO A;  4Q8R A;  1WDN A;  4YU0 A;  3OEK A;  1NH8 A;  3MJN A;  1UTH A;  3MZB A;  1N3W A;  1OMP A;  1PEB A;  1YPN A;  2YPN A;  3UP9 A;  1Q35 A;  4GL8 A;  2R6G E;  3O66 A;  5BUU A;  3HST A;  3M3K A;  3RN8 A;  1D4N A;  4JXI A;  1J1N A;  4F1Y A;  2XXQ A;  1JVY A;  1ZTY A;  2DXR A;  1JQF A;  4YKP A;  1A99 A;  1B32 A;  3O28 A;  2D5W A;  4YB5 A;  3KN8 A;  3BBR A;  1HSL A;  4KYD A;  5JTY A;  3MZ1 A;  3TFL A;  1MY2 A;  2QS3 A;  3GBB A;  3K4U A;  3MVX A;  3FJ7 A;  3U72 A;  2I3V A;  2G29 A;  4IB2 A;  5H8H B;  2OZZ A;  4DCX A;  3C9H A;  3U8Q A;  4IO3 A;  3VVE A;  3E13 X;  2Y7K A;  1GV8 A;  2H99 A;  2UYE A;  2WKY A;  2XXH A;  1EU8 A;  2Z8D A;  2O1M A;  4U1O A;  1EZO A;  2V3Q A;  4BDM A;  2O7U A;  1B3E A;  3OO6 A;  4F3P A;  4BDQ A;  3QUJ A;  4PP0 A;  1ELJ A;  4IO2 A;  4XKQ A;  1XVX A;  3EPE A;  4HCW A;  4U2R A;  5DT6 A;  4FEB A;  3VXC A;  2A5S A;  3BFT A;  4OFO A;  1NL5 A;  1FQB A;  3B6Q A;  3MP1 A;  3RPW A;  2FYI A;  3SEY A;  2NWJ A;  2Z22 A;  3U1O A;  2HAU A;  1MPB A;  1RKM A;  3W15 C;  4ELQ A;  4G68 C;  3TUS A;  4ESW A;  5KCJ B;  1UQW A;  2Y7I A;  3IOV A;  3MW0 A;  5IAI A;  1N0T A;  4GWO A;  5H8F B;  5HBC A;  2DYX A;  1QKA A;  2ZYK A;  1MDQ A;  3G7W A;  4EDP A;  1N7W A;  2P2A A;  1B7Z A;  1PBP A;  1LFH A;  3V5A A;  3K00 A;  3TTM A;  2GRV A;  4N07 A;  4NMY A;  1OIB A;  1LAH E;  1B51 A;  3TTR A;  3WAF A;  4WED A;  3ZKL A;  5AE4 A;  3MQ9 A;  1UTB B;  1DTZ A;  2OJT A;  1BTJ A;  3K2D A;  4FEC A;  4HCY A;  2AL5 A;  1OQH A;  3LSF B;  3PV0 E;  3H6T A;  3K0V A;  3TZA A;  5AA3 A;  3MVY A;  4KHZ E;  4ELR A;  1D3K A;  4MBP A;  4EF2 A;  4U23 A;  1M5C A;  3IL1 B;  1IZ1 A;  3Q29 A;  5EHM A;  4BDL A;  4YIC A;  4EXK A;  1JEU A;  4NF6 B;  1B0H A;  4NTL A;  1MH3 A;  2QS1 A;  2O6A A;  2H25 A;  2XXX A;  5F7V A;  1MH4 A;  1Z7N E;  2B65 A;  3GXA A;  4OQO A;  3LC8 A;  1MXU A;  4IGR A;  4JDF A;  3ILT B;  1WOD A;  4LP2 B;  2I49 A;  3UK4 A;  2I4B A;  2OK2 A;  2I58 A;  5I56 A;  2QS2 A;  1B46 A;  5I58 B;  4XKN A;  2Q9T A;  2Z23 A;  3MVZ A;  1UIU A;  3K1N A;  2Q88 A;  2I0B A;  4P11 A;  1Y1M A;  1LFG A;  1URG A;  2OWS A;  2RC7 A;  3H3G A;  2X26 A;  3LSW A;  2XXR A;  4P0G A;  4ZS9 A;  3G3K A;  4H6D A;  3ZS6 A;  2DS9 A;  1I69 A;  2OWT A;  3DEL B;  2OCU A;  2F6G A;  3HN0 A;  4EF1 A;  2HAV A;  1FQD A;  3PU5 A;  1GR2 A;  1SI0 A;  2HZK A;  3ILU B;  3KN7 A;  1Y1Z A;  5TPA A;  5CMK A;  5I56 B;  4QSD A;  3EHU A;  4NE4 A;  1N04 A;  2A5T B;  4GOT A;  4GRK A;  4NF5 A;  4OEV A;  3I6V A;  2D3I A;  4F18 A;  4ZEC A;  4X1D A;  2RF1 A;  3FGS A;  3K6W A;  1N76 A;  4C0R A;  3TCF A;  2ZYM A;  4EXL A;  4H8I A;  1LB9 A;  1OQG A;  4LZ8 A;  3FAT A;  4RPO A;  4R9F A;  4POX A;  1B7U A;  4DXB A;  3CSG A;  4F3B A;  2H9B A;  3PMX A;  4DDD A;  3SER A;  1B2H A;  1IUD A;  1P1N A;  2GHB A;  3SKP A;  3TPA A;  5I59 B;  1H44 A;  3RLF E;  3USD A;  1MXW A;  2ZXT A;  1S9T A;  2VP1 A;  2O7I A;  5AA4 B;  3DM0 A;  4DXC A;  2UVI A;  3C4M A;  5ITO A;  4THI A;  3K6X A;  1EZ9 A;  5I2N B;  3I5O A;  3OSQ A;  4H67 A;  3KOS A;  3MWB A;  3O6I A;  2QL3 A;  1VFD A;  2RCB A;  3CRB A;  5DVI A;  3JYR A;  3T9X B;  3B6W A;  4R6H A;  3M8U A;  2H5Y A;  2RC8 A;  4BDN A;  5B70 A;  2ONS A;  1H45 A;  5H8N B;  3FVG A;  3OD7 A;  4FAJ A;  4EQ9 A;  2ABH A;  3FD3 A;  3KSX A;  4R75 A;  2VD3 A;  3TCH A;  4M1V A;  4H5G A;  5FHM A;  5KZT A;  3G3J A;  4FED A;  2H98 A;  2UYF A;  1R1N A;  4X1B A;  4UAC A;  4KCC A;  4ESX A;  3K1M A;  2XXW A;  4C1U A;  3TMG A;  4DLD A;  3T9U A;  4AQ4 A;  2XX8 A;  3FAS A;  3MPL A;  4JWX A;  3K01 A;  4I62 A;  4PFU A;  3R26 A;  4NF4 B;  2ONK E;  2GH9 A;  2PVU A;  3CFX A;  4WXJ A;  1PB8 A;  3T9H B;  4BDR A;  2YLN A;  4UA8 A;  5CC2 A;  2F8D A;  4GVO A;  1PC3 A;  2ESN A;  3FXQ A;  5K2Y A;  3DLN A;  1B5I A;  4ELO A;  3EHT A;  1NNT A;  4ZDM A;  1AOV A;  2DVZ A;  4XKP A;  1B52 A;  1OLA A;  4NF6 A;  2P0S A;  2DWI A;  1D9V A;  1FTM A;  1GGG A;  4OEU A;  4QRZ A;  4DIG A;  4F3G A;  3IOU A;  3IR1 A;  4BDO A;  4F1V A;  3Q25 A;  4LA9 A;  5I57 A;  3FIR A;  3C32 A;  3IB0 A;  1US5 A;  2XXT A;  4R73 A;  2XXY A;  4Z0I A;  4IGT A;  3MZ9 A;  3TAJ A;  4U22 A;  1O64 A;  1IXI A;  1YCJ A;  1QW0 A;  1MRP A;  1TT1 A;  1SI1 A;  2ZNU A;  1Z7M E;  1ANF A;  1B3L A;  3PUV E;  5M2V A;  1Q1K A;  3QYT A;  4GF8 A;  3K6V A;  3IX1 A;  4YB7 A;  4IO7 A;  2RKM A;  3C36 A;  4I9D A;  4ISU A;  5L9S A;  5FHN A;  3T9V A;  4G8M A;  1N3X A;  4RPN A;  4NF8 B;  3S9M C;  3V83 A;  2XD2 A;  3VXB A;  2Z8E A;  3E3K A;  4KD5 A;  1P1W A;  5KDT B;  1WVJ A;  4NF8 A;  1MQI A;  4Q0C A;  1LAG E;  1SW2 A;  2AYS A;  5I84 A;  3S2V A;  3ZKK A;  4DXU A;  3ZSF A;  1QKB A;  5TP9 B;  3KGC A;  4ECF A;  5I58 A;  2UVG A;  1MXX A;  3E4R A;  4WEP A;  5ELV A;  5JEI A;  2DSF A;  5F1Q A;  2YJP A;  1SVX B;  3H4Z A;  2ZNS A;  2D21 A;  3LR1 A;  2ONR A;  3L6G A;  3MUQ A;  5H8Q B;  3N94 A;  1RYX A;  2I3W A;  1B1H A;  4KPT A;  4Q30 B;  1A55 A;  1KWH A;  3R7X A;  3UN6 A;  4O3B A;  4OER A;  2IEE A;  1CE2 A;  3N26 A;  1IIW A;  3U94 A;  5AA2 A;  2VGQ A;  4FOR A;  3CSB A;  4GQO A;  3O6G A;  4RY1 A;  1TFA A;  5DEX A;  5TU0 A;  3P7I A;  3ODB A;  5CRY A;  1MY3 A;  2FNC A;  2PYY A;  3KFM A;  3H6W A;  3VLV A;  5EYF A;  3TCG A;  2REG A;  1B0L A;  1XS5 A;  1XVY A;  4PET A;  4U1Z A;  5K2X A;  2XXU A;  4AB5 A;  4GD5 A;  2HZL A;  3LSX A;  1ATG A;  4RA1 A;  4EQB A;  1O63 A;  2THI A;  2XD3 A;  3QIM A;  1BP5 A;  3AXF A;  3M3F A;  2VOZ A;  3PD9 A;  1FTO A;  5AA4 A;  3OEM A;  4I1D A;  1GVC A;  1II5 A;  3IB1 A;  4LZ7 A;  4GXS B;  4LVQ A;  2PMS A;  5DTB A;  2VHA A;  2PX1 A;  4DCY A;  1ZLQ A;  2ZMB A;  4RK2 A;  4F39 A;  4X48 A;  5J1D A;  4BLA A;  4OFJ A;  2P1S A;  3BKI B;  3O97 A;  3PPP A;  3PUZ E;  3VE1 B;  3TQL A;  2QRY A;  1NNK A;  1PBQ A;  1LCT A;  3DP4 A;  1NNF A;  1B4Z A;  2ZYO A;  4G8H A;  3T22 A;  4YMA A;  3C35 A;  4QFN A;  1BKA A;  3EF7 A;  3CG3 A;  2F5X A;  4YKK A;  3U92 A;  3D4G A;  2PT1 A;  4PFY A;  2HFB A;  2Q8J A;  4ELP A;  4JSD A;  5JTY B;  1VSO A;  1A7L A;  1DTG A;  3FUZ A;  4JWY A;  4JB7 A;  4KQP A;  3MPK A;  2GFE A;  3OEL A;  4OET A;  4JSO A;  1NKX A;  5A5X B;  4U21 A;  2DXY A;  2IA4 A;  2HEU A;  3HHG A;  1TFD A;  3MAM A;  1OVB A;  3IOR A;  2DE2 A;  2QPQ A;  2V3T A;  1S50 A;  2RCA A;  1MY1 A;  3EQ1 A;  4OHN A;  4QSE A;  4XIG Q;  1IXC A;  1JW4 A;  3K6U A;  5AA2 D;  1T0K A;  1FQF A;  3GBA A;  3IOW A;  4LZ5 A;  4POW A;  3RGY A;  3FV2 A;  3QAX A;  2M8C A;  5FHO A;  3TKD A;  1IXH A;  4E0W A;  2Y7R A;  3B7D A;  2R9J A;  3FJG A;  4OYV A;  3IOT A;  2QSX A;  3PUY E;  1MPC A;  1LST A;  4MLV A;  4ONY A;  1SBP A;  2ALU A;  2VD2 A;  3FVO A;  1B05 A;  3WAE A;  1B9J A;  1MY0 A;  4G2Z A;  5EHS A;  1JEV A;  2DWJ A;  4G8N A;  5H8H A;  5DVF A;  1SYI A;  3FV1 A;  2OBG A;  1FCK A;  1JVX A;  4H1X A;  3TOD A;  1MPD A;  1AIV A;  3VLW A;  2O69 A;  3TTL A;  3SEV A;  1MXZ A;  4MLQ A;  5IKB A;  4ND9 A;  1FW0 A;  2AL4 A;  3Q27 A;  3S9N C;  3VVD A;  4OMB A;  5DEX B;  3KJ7 A;  4MF3 A;  4RNS A;  2PT2 A;  1LBC A;  1UTB A;  2F35 A;  1R9Q A;  2HXW A;  3H6U A;  1IXG A;  1HSJ A;  4IO6 A;  4KYE A;  4OWD A;  2RIN A;  4JWO A;  4ZZA A;  2F7C A;  3RTW B;  2H4I A;  1NFT A;  1FQE A;  1P1O A;  2GHA A;  4IO5 A;  1D9Y A;  4TOZ A;  3RQT A;  3FVK A;  1PB7 A;  2I48 A;  5L9O A;  3S9L C;  2Z8F A;  3LUY A;  4IY6 A;  3RUM A;  1B40 A;  1POT A;  4NF5 B;  1ZU0 A;  4WKM A;  3C31 A;  3O2A A;  5DYH A;  4ZZE A;  1P99 A;  2XXI A;  1FTK A;  1SQY A;  3TYH A;  4ZE8 A;  4G77 A; 
#chains in the Genus database with same CATH topology
 4OVT A;  1JNF A;  1DBZ A;  1SW5 A;  1MQJ A;  2E0S A;  1XT8 A;  4GX3 A;  1NV4 A;  2WYK A;  4P0I A;  3TEL A;  4XXU A;  2DE4 A;  4X9T A;  1CB6 A;  3G3F A;  5TP9 A;  2I4C A;  2O51 A;  4G68 A;  1YTV A;  2F7A A;  5DVJ A;  2O84 X;  4N91 A;  1FPJ A;  3T96 B;  3W9V A;  3UOR A;  3BFU A;  3GZG A;  3OMB A;  2ZNT A;  2A5T A;  3Q28 A;  3IJO B;  2MKZ A;  1TWY A;  3IO4 A;  2ANJ A;  5CI5 A;  4PGP A;  1DOT A;  1FBG A;  1AMF A;  3K02 A;  4G4P A;  1QVS A;  2OX3 A;  3SEU A;  1FBE A;  4QHQ A;  5EQ9 A;  1FTL A;  1NV3 A;  2F36 A;  3OXN A;  1MXV A;  4OES A;  1S7Y A;  3S9E A;  4R6K A;  5KZT A;  3G3G A;  4OVJ A;  2F7B A;  4MJO A;  3PUW E;  4YAH X;  4U4X A;  4IY5 A;  3VLU A;  4PE5 B;  4R9G A;  3SET A;  5AA2 B;  3T0J A;  3CFZ A;  3IO6 A;  1FPF A;  3MST A;  1LBZ A;  1MM7 A;  3RPL A;  1D9Q A;  2G93 A;  1B4H A;  1NH7 A;  1Q9D A;  4PFT A;  4F22 A;  1FBD A;  4PC9 A;  4R74 A;  3HPI A;  4PFI A;  4GLI A;  1M5E A;  4F1U A;  3A3U A;  4O7I A;  2V25 A;  1N7X A;  4HTG A;  1MDP 1;  3CG1 A;  4O94 A;  4H5F A;  3G3H A;  2F3B A;  3KN3 A;  3RNN A;  4YKI A;  3O29 A;  1PDA A;  4FAT A;  1LGB C;  4OXV A;  2NUV A;  4U4S A;  3MC2 A;  3B50 A;  4OEN A;  4PFW A;  4ZEK A;  4F19 A;  5L9S A;  1FRP A;  1SW4 A;  2W7Y A;  2CZH A;  3T93 B;  3KJT A;  1ZIU A;  5EQ8 A;  2UVH A;  1Y20 A;  2UXA A;  3TQW A;  2UVJ A;  4LQ2 A;  3M3L A;  2Q2A A;  1US4 A;  1MQD A;  1JW1 A;  4YB6 A;  4QFK A;  1H76 A;  3OEK A;  1NH8 A;  3MJN A;  1N3W A;  3UP9 A;  3RN8 A;  4NG7 A;  1JQF A;  4MMP A;  2I3V A;  3E78 A;  3U65 A;  2Z8D A;  2O1M A;  4U1O A;  2V3Q A;  1B3E A;  4PP0 A;  3EPE A;  4FEB A;  2A5S A;  3BFT A;  1FQB A;  2FYI A;  1YYZ A;  3W15 C;  4PGN A;  1RKM A;  1FBH A;  1UQW A;  1N0T A;  5HBC A;  2DYX A;  3G7W A;  4EDP A;  1B7Z A;  3V5A A;  3K00 A;  1B51 A;  3ZKL A;  1UTB B;  2OJT A;  3LSF B;  4OAN A;  3H6T A;  3K0V A;  1D3K A;  4N4U A;  1IZ1 A;  4PF6 A;  2QS1 A;  2XXX A;  3UK4 A;  1MXU A;  5I56 A;  1WOD A;  2I58 A;  1B46 A;  2I0B A;  1Y1M A;  2OWS A;  3ZS6 A;  3H3G A;  4DLD A;  4P8B A;  2HZK A;  3ILU B;  4QSD A;  4N81 A;  1N04 A;  4GOT A;  4GRK A;  4ZEC A;  2RF1 A;  3K6W A;  2ZYM A;  1OQG A;  4R9F A;  5I59 B;  2GHB A;  1H44 A;  3RLF E;  5AA4 B;  2UVI A;  3RYD A;  3O6I A;  1LBW A;  4R6H A;  3FVG A;  3OD7 A;  4FAJ A;  4I40 A;  2ABH A;  3FD3 A;  4R75 A;  4M1V A;  4H5G A;  4FED A;  2UYF A;  1R1N A;  4KCC A;  3TMG A;  4PFU A;  4NF4 B;  2ONK E;  1PB8 A;  5CC2 A;  2ESN A;  1AOV A;  2P0S A;  4F3G A;  4QRZ A;  4F1V A;  4LA9 A;  1US5 A;  1LEV A;  2XXT A;  2XXY A;  4IGT A;  4HE0 A;  4BDL A;  3QYT A;  4NN3 A;  4IO7 A;  4RPN A;  4KD5 A;  2Y5K A;  3LUZ A;  1WVJ A;  1MQI A;  1SW2 A;  3ZKK A;  3ZSF A;  2QVV A;  3KGC A;  4ECF A;  1MXX A;  1JP4 A;  2FIX A;  3PTY A;  1SVX B;  2ZNS A;  2ONR A;  5H8Q B;  4KPT A;  1RYX A;  2I3W A;  1B1H A;  4Q30 B;  4BDO A;  1KWH A;  4O3B A;  3KC1 A;  2IEE A;  5AA2 A;  3CSB A;  3O6G A;  2FVZ A;  1MY3 A;  1FSA A;  5EYF A;  2REG A;  4PET A;  2B4M A;  2XXU A;  4AB5 A;  3LSX A;  2THI A;  1BK4 A;  1EYJ A;  1BP5 A;  3M3F A;  3PD9 A;  1K9Y A;  4LVQ A;  2VHA A;  2PX1 A;  4PAF A;  1PBQ A;  3DP4 A;  4AS5 A;  2QFL A;  2F5X A;  3U92 A;  3E79 A;  2GFE A;  5A5X B;  2HEU A;  3HHG A;  2V3T A;  1MY1 A;  1T0K A;  1IXC A;  4OYV A;  3IOT A;  2QSX A;  3PUY E;  1IMA A;  1LST A;  5EHS A;  5H8H A;  2OBG A;  1FCK A;  2O69 A;  3NOH A;  3SEV A;  1MXZ A;  3TTL A;  4ND9 A;  3S9N C;  4OMB A;  3KJ7 A;  1FPG A;  2PT2 A;  1NV2 A;  4OWD A;  3RTW B;  2F7C A;  2GHA A;  2QVU A;  5L9O A;  1PB7 A;  2I48 A;  2Z8F A;  1POT A;  4NF5 B;  1ZU0 A;  3D1R A;  5DYH A;  3QXM A;  4G77 A;  4Q5T A;  4F3S A;  2Y5L A;  1YZ0 A;  4TLL B;  3LSL A;  3FXR A;  2ZYN A;  1AH5 A;  1SDX A;  3QUF A;  3OO9 A;  1Y3P A;  1XC1 A;  4ZEB A;  3JZJ A;  4GBW A;  3OOA A;  5L9M A;  1B3G A;  1LFI A;  3GLB A;  4P1E A;  3CI8 A;  1VE4 A;  3PPO A;  1B3H A;  4NHB A;  5AA1 A;  4L17 A;  1DMB A;  2RC9 A;  3KZG A;  3MVW A;  4KCD A;  3CIJ A;  1L5T A;  4ZEI A;  1QJM A;  2OLB A;  4DI4 B;  2V3U A;  3ECR A;  3PPN A;  5CMM A;  3PD8 A;  3T66 A;  1UTH B;  2DWA A;  3KOT A;  2PBW A;  1FBF A;  5I5P A;  1Y4C A;  4KI0 E;  3V89 B;  3CVG A;  4E0X A;  2B4L A;  2Q8M A;  1FJ6 A;  4LON B;  2Q89 A;  2KQZ A;  4GWY A;  1Y3Q A;  3G3I A;  3R6U A;  1IME A;  5KCJ A;  1DPP A;  3KC0 A;  1MM6 A;  3FVN A;  3FZV A;  3A09 A;  1ZBM A;  3TTN A;  1O7T A;  4C1T A;  4JVI A;  1FQC A;  3KG2 A;  3OEN A;  5I2K B;  2HCA A;  3DP6 A;  4MNI A;  2E1S A;  3VDF A;  2HPG A;  4HS7 A;  5BWJ A;  5I57 B;  1VR5 A;  3SEX A;  5I59 A;  3HCQ A;  2WEF A;  2Y7P A;  2REJ A;  3VV5 A;  5KDT A;  4LAT A;  2AIX A;  4XF5 A;  2FA7 A;  1FPL A;  1FPD A;  1JW5 A;  1USY H;  4OFL A;  4N8Y A;  5B70 A;  3UIF A;  4NX1 A;  1YAE A;  1FTJ A;  1QUK A;  4NQ8 A;  2JJK A;  4KR5 A;  3ONM A;  2HXR A;  2B3F A;  1MQG A;  1F9B A;  3DP8 A;  4G68 B;  3T1B A;  5I2K A;  2FIE A;  4N6P A;  4NED A;  4YZZ A;  1JET A;  3H6V A;  3H7M A;  3O6H A;  4JBZ A;  4M4G A;  1H43 A;  5H8N A;  5ET8 A;  3I3V A;  4RYA A;  4LN5 A;  4R6Y A;  2I0C A;  4XEQ A;  5L8D A;  4FJP A;  5J16 A;  2NXO A;  1WDN A;  4YU0 A;  1OMP A;  1PEB A;  3HST A;  3M3K A;  1JVY A;  1ZTY A;  4YKP A;  1B32 A;  3O28 A;  2D5W A;  2QS3 A;  2G29 A;  4IB2 A;  5H8H B;  2OZZ A;  4DCX A;  3C9H A;  3U8Q A;  3VVE A;  1AWB A;  1DK4 A;  2WKY A;  2UYE A;  1EU8 A;  2ZZV A;  4BDM A;  3QUJ A;  4GWW A;  1ELJ A;  5IGA A;  4OFO A;  3SEY A;  2Z22 A;  5A5L A;  5H8F B;  2ZYK A;  1MDQ A;  1FBP A;  3GYY A;  3WAF A;  3TTM A;  4NMY A;  4N07 A;  3TTR A;  2HHM A;  1BTJ A;  4FEC A;  4QXD A;  3PV0 E;  3TZA A;  4U23 A;  1M5C A;  3IL1 B;  1MH4 A;  1Z7N E;  2WYP A;  1SPI A;  4N15 A;  5IZ3 A;  2QS2 A;  5LDZ A;  1LFG A;  4P0G A;  2XXR A;  2DS9 A;  1I69 A;  2F6G A;  4EF1 A;  3PU5 A;  1Y1Z A;  4NE4 A;  2A5T B;  4NF5 A;  5ET7 A;  4X1D A;  4C0R A;  3TCF A;  4EXL A;  4LZ8 A;  1B7U A;  1FPI A;  4F3B A;  4HE2 A;  3TPA A;  1MXW A;  2O7I A;  3DM0 A;  4DXC A;  5ITO A;  3K6X A;  1EZ9 A;  3OSQ A;  1LBY A;  3KOS A;  3MWB A;  3CRB A;  3T9X B;  4OVQ A;  2H5Y A;  2RC8 A;  2ONS A;  1H45 A;  4EQ9 A;  4P9K A;  3KSX A;  2H98 A;  1IMB A;  4UAC A;  4AQ4 A;  1NUX A;  3R26 A;  2PVU A;  2YLN A;  4UA8 A;  2XXK A;  1PC3 A;  3FXQ A;  5K2Y A;  4ZDM A;  2DWI A;  1D9V A;  1GGG A;  4PE3 A;  2R8T A;  3FIR A;  3C32 A;  4Z0I A;  4XKN A;  1O64 A;  1QW0 A;  2ZNU A;  1Z7M E;  3K6V A;  4YB7 A;  3C36 A;  1IMD A;  4I9D A;  4NF8 B;  3V83 A;  2Z8E A;  3E3K A;  2GQ1 A;  5KDT B;  1LAG E;  3S2V A;  5I58 A;  1K9Z A;  5ELV A;  4PFB A;  5F1Q A;  2YJP A;  3LR1 A;  3L6G A;  3N94 A;  3CHG A;  4OVS A;  3N26 A;  1IIW A;  3U94 A;  4P1L A;  3ISP A;  4RY1 A;  5DEX A;  1RDZ A;  4GBV A;  2FNC A;  3KFM A;  2VPO A;  3VLV A;  2P3N A;  1NV7 A;  5DW8 A;  1ATG A;  1O63 A;  1NV6 A;  3OEM A;  1II5 A;  2F3D A;  3IB1 A;  4LZ7 A;  1G0H A;  2PMS A;  4X04 A;  4DCY A;  4RK2 A;  5J1D A;  1NI9 A;  4BLA A;  4OFJ A;  2P1S A;  3PPP A;  3VE1 B;  3TQL A;  4YMA A;  1NNF A;  1B4Z A;  3EF7 A;  3CG3 A;  2PT1 A;  2HFB A;  1EYK A;  4ELP A;  1VSO A;  1A7L A;  1DTG A;  3FUZ A;  4JB7 A;  3OEL A;  4U21 A;  2DXY A;  1TFD A;  3IOR A;  4QSE A;  5AA2 D;  3IOW A;  4LZ5 A;  2M8C A;  1IXH A;  3LV0 A;  4MLV A;  2VD2 A;  2ALU A;  1B05 A;  4G2Z A;  2DWJ A;  4G8N A;  1SYI A;  1JVX A;  3TOD A;  3VLW A;  4GWU A;  1LBC A;  2F35 A;  1IXG A;  1HSJ A;  2H4I A;  1FQE A;  1D9Y A;  3RQT A;  4I3Y A;  4IY6 A;  3O2A A;  3TYH A;  1P99 A;  2XXI A;  1FTK A;  4ZE8 A;  3UA8 A;  4F2O A;  4H65 A;  1DSN A;  2CMO A;  4GL0 A;  4XFE A;  4QSC A;  3FJM A;  1BLF A;  1IQ7 A;  3D4C A;  3V8X B;  4RK9 A;  1XOC A;  4H0W A;  4GXA A;  3PMW A;  4MFI A;  1IEJ A;  3MYU A;  5H8Q A;  2PFZ A;  5A5X A;  3O9P A;  3PUX E;  3KBR A;  3VFJ A;  3SZP A;  3IJX B;  2X7P A;  1H3D A;  1A8E A;  4DI3 D;  1RYO A;  3CFL A;  4ELR A;  4R2B A;  2DQV A;  1IMC A;  3SEW A;  1OLC A;  4JVC A;  1A54 A;  1IMF A;  1TXF A;  3L6H A;  1HSE A;  4MH5 A;  5CMC A;  1XHY A;  1GTK A;  3IK6 B;  3FXU A;  3VVF A;  4K3F A;  4O3C A;  1NV1 A;  3LBS A;  5B7D A;  4QFL A;  2QMW A;  2DVC A;  4UAB A;  1DCU A;  3W9W A;  3MP6 A;  2QJE A;  3SDF A;  3QMF A;  3IB2 A;  2XXV A;  1SYH A;  4NF4 A;  4I8C A;  3PPQ A;  4QF9 A;  2QMX A;  1MY4 A;  3F11 A;  3KEI A;  3MP8 A;  3RTF B;  4F2Q A;  3PMV A;  1POY 1;  1URS A;  1USY E;  2I6E A;  4H8J A;  1EZP A;  5CMB A;  4NWD A;  3THI A;  4TQU Q;  4DE8 A;  4YMB A;  4ZED A;  1QUI A;  5CM6 A;  2ZZX A;  4PDH A;  1FPE A;  3A3C A;  4HE1 A;  1SW1 A;  3EKI A;  3TEP A;  2XA5 A;  5H8S A;  3H03 A;  4ZEF A;  2P3V A;  4KYS A;  1Y4T A;  4GX6 A;  2KLF A;  1B5J A;  1LBV A;  3N5L A;  4OZ9 A;  1NNP A;  2DWH A;  1P1Q A;  5CBS A;  3EHS A;  3FBP A;  2FHY A;  4DZ1 A;  4FIM A;  2F34 A;  2VT5 A;  2BJJ X;  1QUJ A;  1B5H A;  4LQ5 A;  4YKJ A;  3MBP A;  4O3A A;  3RY3 A;  2BJI A;  3JV9 A;  1IIT A;  4R72 A;  5ICT A;  5FBP A;  4QFP A;  5I7I A;  5I3S A;  1R6Z A;  4F31 B;  4PF8 A;  1I6A A;  3HFU A;  2XXP A;  1NMU A;  4HW8 A;  1LLS A;  4MAG A;  4RJZ A;  3PPR A;  1M5F A;  4Q8R A;  3MZB A;  1Q35 A;  4GL8 A;  2L5V A;  3O66 A;  1D4N A;  4JXI A;  4F1Y A;  2XXQ A;  4GX4 A;  3KN8 A;  3BBR A;  1HSL A;  4KYD A;  3MZ1 A;  3U72 A;  3MVX A;  3FJ7 A;  3KBZ A;  1GV8 A;  4F3P A;  4XKQ A;  5DT6 A;  4HCW A;  4U2R A;  3VXC A;  4EQ7 A;  1NL5 A;  3MP1 A;  3U1O A;  2HAU A;  5EYG A;  3TUS A;  4ELQ A;  4ESW A;  5KCJ B;  3MW0 A;  2Y7I A;  4I3E A;  1QKA A;  2CZK A;  2P2A A;  1LFH A;  4N6D A;  2GRV A;  1OIB A;  4WED A;  3MQ9 A;  3SKP A;  4HCY A;  4KHZ E;  4MBP A;  3Q29 A;  4EXK A;  4YIC A;  5EYH A;  4NF6 B;  1MH3 A;  2O6A A;  2B65 A;  3GXA A;  4OQO A;  4IGR A;  4LP2 B;  3ILT B;  2I49 A;  4N6K A;  5I58 B;  2Q9T A;  2Z23 A;  3MVZ A;  1UIU A;  2Q88 A;  2RC7 A;  4ZS9 A;  4H6D A;  3DEL B;  2OWZ A;  1VDW A;  1NV0 A;  5EQ7 A;  1SI0 A;  3KN7 A;  5TPA A;  4PAI A;  4OEV A;  5IM2 A;  3I6V A;  2D3I A;  4F18 A;  2H9B A;  3SER A;  1B2H A;  1IUD A;  1S9T A;  2VPN A;  4O8M A;  3I5O A;  4H67 A;  1VFD A;  5DVI A;  4P3L A;  3B6W A;  4BDN A;  3TCH A;  5IZ1 A;  5FHM A;  3G3J A;  4X1B A;  2XXW A;  1QGX A;  2XX8 A;  4JWX A;  3T9H B;  3CFX A;  4BDR A;  2F8D A;  3DLN A;  3EHT A;  2DVZ A;  1B52 A;  4NF6 A;  3IR1 A;  5EQA A;  4U22 A;  1IXI A;  5M2V A;  5LTC A;  1ANF A;  1B3L A;  4NAP A;  4P56 A;  4ISU A;  5FHN A;  2DDK A;  1N3X A;  3S9M C;  2XD2 A;  3VXB A;  1P1W A;  4NF8 A;  4Q0C A;  4PCD A;  1QKB A;  5TP9 B;  2UVG A;  3E4R A;  5JEI A;  2DSF A;  3H4Z A;  2D21 A;  3R7X A;  1A55 A;  4HXV A;  3UN6 A;  5ESY A;  4FOR A;  1NV5 A;  5CRY A;  2PYY A;  1B0L A;  1XS5 A;  1XVY A;  5K2X A;  2HZL A;  5IZ3 B;  2XD3 A;  3QIM A;  3AXF A;  2VOZ A;  4JVD A;  5AA4 A;  1GVC A;  4PFR A;  5DTB A;  2V4C A;  3O97 A;  2QRY A;  1LCT A;  3T22 A;  4G8H A;  1BKA A;  4YKK A;  3D4G A;  4PFY A;  2Q8J A;  4JSD A;  5JTY B;  1NUZ A;  2WX9 A;  4KQP A;  1NKX A;  2IA4 A;  1OVB A;  2QPQ A;  4OHN A;  1S50 A;  4XIG Q;  3EQ1 A;  1JW4 A;  2CEY A;  3K6U A;  1FQF A;  3GBA A;  3TKD A;  5FHO A;  4E0W A;  2Y7R A;  4OVP A;  1MPC A;  4OA4 A;  4ONY A;  3FVO A;  3WAE A;  4C1U A;  1MY0 A;  1FJ9 A;  1JEV A;  5DVF A;  3FV1 A;  4MIJ A;  1AIV A;  1FBC A;  3Q27 A;  2AL4 A;  3VVD A;  3BIH A;  5DEX B;  4MF3 A;  4RNS A;  1UTB A;  4IO6 A;  1R9Q A;  3S4U A;  3H6U A;  1P1O A;  4TOZ A;  4PTK A;  3S9L C;  3RUM A;  1B40 A;  4WKM A;  1SQY A;  3A29 A;  4TLM B;  1FQA A;  2F6P A;  4LUB A;  3SES A;  1DPE A;  1MS7 A;  3OO7 A;  2Y7W A;  1SD3 A;  4FBP A;  4EUO A;  1B1X A;  4AS4 A;  3IFC A;  1LAF E;  1AL3 A;  1LBB A;  3OO8 A;  4H46 A;  2O1L A;  2R71 A;  2WBB A;  3E9X A;  1ZMG A;  2QS4 A;  1EYI A;  3N6T A;  4R2F A;  1LAX A;  3HV1 A;  3IAZ A;  3QK6 A;  3TDJ A;  3RT6 B;  4NF0 A;  3IFA A;  3KSJ A;  1URD A;  1Y3N A;  2CZI A;  1A40 A;  2X7Q A;  3HHF A;  5ICQ A;  3TTK A;  3HO7 A;  5ISU A;  5LOM A;  1I6B A;  4QFO A;  2XX9 A;  1ZKB A;  5CBR A;  3C33 A;  2Q2C A;  2NVU B;  1NUY A;  3CR9 A;  1M5D A;  3C34 A;  2XX7 A;  4N13 A;  3PGF A;  2LAO A;  5ITP A;  4XKR A;  1PB9 A;  1EH3 A;  4ZE9 A;  1B58 A;  4MHF A;  1KA1 A;  2Y84 A;  3H06 B;  2O68 A;  4O7M A;  4FE8 A;  2DP8 A;  4RXL A;  1BIY A;  1OVT A;  3U93 A;  4Z7E A;  1RDY A;  1LB8 A;  5HM4 B;  1MG1 A;  3QSL A;  5JK4 A;  5FTH A;  2DOJ A;  1B7H A;  2XHD A;  2V84 A;  1A8F A;  2B3B A;  4NWC A;  3K1P A;  2V93 A;  3OSR A;  1MQH A;  2HQ0 A;  3ROJ A;  4MNC A;  4GFR A;  1Y9U A;  3N6U A;  1QUL A;  3UGW A;  1MXY A;  1N84 A;  1VFE A;  4XTC Q;  1I6Q A;  3EN3 A;  4GIZ A;  2CZL A;  4OTE A;  3Q26 A;  1M5B A;  1UIV A;  4KFQ A;  2F97 A;  1B6H A;  5HPQ A;  2KR0 A;  2DE3 A;  5I2N A;  4X8R A;  3RT8 A;  4OVR A;  1ZJL A;  2NOO A;  5H8F A;  2F78 A;  2ZZW A;  1KZ8 A;  4IO4 A;  5TPA B;  1P1U A;  4F29 A;  4N17 A;  1LCF A;  5FTI A;  5ET6 A;  4PQJ A;  3B6T A;  1B3F A;  1R9L A;  4MNP A;  1UTH A;  1YPN A;  2YPN A;  1XI6 A;  2R6G E;  5BUU A;  1J1N A;  2DXR A;  1A99 A;  4YB5 A;  5JTY A;  3TFL A;  1MY2 A;  3GBB A;  3K4U A;  2XWO A;  4IO3 A;  3E13 X;  4GWS A;  2Y7K A;  3RPL B;  2H99 A;  2XXH A;  1EZO A;  2O7U A;  3OO6 A;  4BDQ A;  4IO2 A;  1XVX A;  3RPW A;  3B6Q A;  5IZZ A;  2NWJ A;  1MPB A;  4G68 C;  1FPB A;  3B8B A;  3IOV A;  5IAI A;  4GWO A;  1N7W A;  1PBP A;  1LAH E;  2PCR A;  5AE4 A;  1DTZ A;  3K2D A;  4PDD A;  2AL5 A;  1OQH A;  5AA3 A;  3MVY A;  4EF2 A;  5EHM A;  1JEU A;  1B0H A;  4NTL A;  2H25 A;  5F7V A;  4NGU A;  3LC8 A;  4JDF A;  2I4B A;  2OK2 A;  3TAJ A;  4AB6 A;  4P11 A;  3K1N A;  3LSW A;  1URG A;  2X26 A;  3G3K A;  2OWT A;  2OCU A;  3HN0 A;  2HAV A;  1FQD A;  1GR2 A;  5CMK A;  4P47 A;  5I56 B;  3EHU A;  3FGS A;  1N76 A;  4H8I A;  1LB9 A;  4RPO A;  3FAT A;  1KA0 A;  4POX A;  4DXB A;  3CSG A;  3PMX A;  4DDD A;  1P1N A;  3USD A;  2ZXT A;  2VP1 A;  3C4M A;  4IR8 A;  4THI A;  5I2N B;  4MX6 A;  2QL3 A;  2RCB A;  5T3J A;  3JYR A;  3M8U A;  2XWV A;  2Q74 A;  5H8N B;  2CEX A;  2VD3 A;  4KXP A;  1LBX A;  4ESX A;  3K1M A;  1INP A;  3T9U A;  3FAS A;  3MPL A;  3K01 A;  4I62 A;  2GH9 A;  1FPK A;  4WXJ A;  4H45 A;  4GVO A;  1B5I A;  4ELO A;  4GWX A;  1NNT A;  4XKP A;  1OLA A;  1FTM A;  4OEU A;  4DIG A;  3IOU A;  4PBH A;  1FTA A;  3Q25 A;  5I57 A;  3IB0 A;  4R73 A;  3MZ9 A;  1YCJ A;  1MRP A;  1TT1 A;  1SI1 A;  3PUV E;  2FBP A;  1Q1K A;  5F24 A;  4GF8 A;  1CNQ A;  3IX1 A;  4MCO A;  2RKM A;  3T9V A;  4G8M A;  2WBD A;  5I84 A;  2AYS A;  4DXU A;  4WEP A;  4PBQ A;  3MUQ A;  4OER A;  1G0I A;  1CE2 A;  2XWI A;  2VGQ A;  4GQO A;  1TFA A;  5TU0 A;  3P7I A;  3ODB A;  4N8G A;  3H6W A;  3TCG A;  4U1Z A;  4GD5 A;  4RA1 A;  4EQB A;  1FTO A;  4I1D A;  4GXS B;  1YXI A;  1ZLQ A;  2ZMB A;  5ET5 A;  4F39 A;  4X48 A;  3BKI B;  3PUZ E;  4MEV A;  1NNK A;  2ZYO A;  3C35 A;  4G61 A;  4QFN A;  3FXB A;  4JWY A;  3MPK A;  4OET A;  4JSO A;  4QBA A;  3MAM A;  4PAK A;  2DE2 A;  2RCA A;  4POW A;  3RGY A;  3FV2 A;  2PFY A;  3QAX A;  3B7D A;  2QVR A;  2R9J A;  3FJG A;  1RDX A;  1SBP A;  1B9J A;  4H1X A;  1MPD A;  5IKB A;  1NUW A;  4MLQ A;  1FW0 A;  3BIG A;  2HXW A;  4GWZ A;  4KYE A;  4ZZA A;  2RIN A;  4JWO A;  4IO5 A;  1NFT A;  3FVK A;  2XWK A;  3LUY A;  3C31 A;  4ZZE A; 
#chains in the Genus database with same CATH homology
 4Q5T A;  3UA8 A;  4F2O A;  4H65 A;  1DSN A;  2CMO A;  1JNF A;  4GL0 A;  4TLM B;  4F3S A;  1FQA A;  2F6P A;  4LUB A;  4QSC A;  4TLL B;  3SES A;  1DPE A;  1MS7 A;  1SW5 A;  3FXR A;  3LSL A;  3OO7 A;  1MQJ A;  2Y7W A;  1AH5 A;  2E0S A;  1SD3 A;  1SDX A;  1BLF A;  2ZYN A;  3FJM A;  1XT8 A;  1IQ7 A;  1B1X A;  3QUF A;  3OO9 A;  1Y3P A;  3D4C A;  4EQ7 A;  1XC1 A;  4ZEB A;  3V8X B;  4RK9 A;  1LAF E;  3JZJ A;  1XOC A;  4H0W A;  4GXA A;  1AL3 A;  3PMW A;  4MFI A;  4P0I A;  1IEJ A;  1LBB A;  5H8Q A;  3OOA A;  3TEL A;  5L9M A;  3OO8 A;  1B3G A;  4XXU A;  2DE4 A;  5A5X A;  2O1L A;  2R71 A;  1LFI A;  3GLB A;  4X9T A;  3O9P A;  3E9X A;  3CI8 A;  3PUX E;  3KBR A;  1CB6 A;  1VE4 A;  3G3F A;  3PPO A;  5TP9 A;  1ZMG A;  1B3H A;  2QS4 A;  3VFJ A;  2I4C A;  3N6T A;  4R2F A;  2O51 A;  1LAX A;  5AA1 A;  3IJX B;  4G68 A;  1DMB A;  1H3D A;  2RC9 A;  2X7P A;  3KZG A;  4L17 A;  1YTV A;  3W9V A;  3MVW A;  2F7A A;  4KCD A;  3HV1 A;  2O84 X;  1A8E A;  3IAZ A;  5DVJ A;  3T66 A;  3QK6 A;  3CIJ A;  1RYO A;  3CFL A;  1L5T A;  4R2B A;  2DQV A;  4ZEI A;  1QJM A;  3BFU A;  1OLC A;  2OLB A;  3RT6 B;  3SEW A;  3TDJ A;  3UOR A;  3GZG A;  2V3U A;  1A54 A;  1TXF A;  2ZNT A;  2A5T A;  1HSE A;  3ECR A;  3L6H A;  3OMB A;  4MH5 A;  3Q28 A;  3KSJ A;  3IJO B;  3PPN A;  1URD A;  1Y3N A;  5CMM A;  3PD8 A;  5CMC A;  1TWY A;  1UTH B;  2DWA A;  1A40 A;  2ANJ A;  2X7Q A;  3HHF A;  3IO4 A;  3KOT A;  5CI5 A;  1XHY A;  2PBW A;  1GTK A;  3IK6 B;  1Y4C A;  3FXU A;  3VVF A;  1DOT A;  4K3F A;  4O3C A;  3TTK A;  3LBS A;  5B7D A;  4KI0 E;  3HO7 A;  4QFL A;  5LOM A;  3V89 B;  3CVG A;  2QMW A;  1I6B A;  1AMF A;  5ISU A;  4QFO A;  3K02 A;  4G4P A;  1QVS A;  2DVC A;  2XX9 A;  1ZKB A;  3SEU A;  3W9W A;  3MP6 A;  4QHQ A;  5CBR A;  2QJE A;  3SDF A;  4E0X A;  3C33 A;  2Q2C A;  3IB2 A;  2XXV A;  1SYH A;  4NF4 A;  1FTL A;  4I8C A;  5ICQ A;  3PPQ A;  4LON B;  4QF9 A;  2QMX A;  1MY4 A;  3F11 A;  2F36 A;  2NVU B;  3KEI A;  3MP8 A;  2Q89 A;  1MXV A;  3OXN A;  3RTF B;  4F2Q A;  4OES A;  3PMV A;  1S7Y A;  1POY 1;  1URS A;  1USY E;  1Y3Q A;  3CR9 A;  3S9E A;  4R6K A;  2I6E A;  1M5D A;  3G3I A;  3R6U A;  3C34 A;  2XX7 A;  4H8J A;  3PGF A;  4N13 A;  5KCJ A;  1DPP A;  3G3G A;  2F7B A;  2LAO A;  4OVJ A;  4XKR A;  5ITP A;  3PUW E;  4YAH X;  1PB9 A;  1EZP A;  1EH3 A;  5CMB A;  4ZE9 A;  1B58 A;  4U4X A;  1MM6 A;  3FVN A;  3FZV A;  4IY5 A;  4NWD A;  3VLU A;  3THI A;  2Y84 A;  3H06 B;  2O68 A;  3A09 A;  4TQU Q;  3T96 B;  4DE8 A;  1ZBM A;  4FE8 A;  2DP8 A;  3TTN A;  4RXL A;  1BIY A;  1O7T A;  4PE5 B;  4C1T A;  1OVT A;  4R9G A;  3U93 A;  4EUO A;  4YMB A;  4ZED A;  1QUI A;  1FQC A;  1LB8 A;  4Z7E A;  3SET A;  5HM4 B;  3KG2 A;  5AA2 B;  1MG1 A;  5CM6 A;  3QSL A;  5JK4 A;  3OEN A;  5I2K B;  5FTH A;  3CFZ A;  2DOJ A;  2HCA A;  3DP6 A;  1B7H A;  3IO6 A;  1MM7 A;  2XHD A;  2E1S A;  3VDF A;  2V84 A;  3A3C A;  2G93 A;  1A8F A;  4HS7 A;  1SW1 A;  1B4H A;  1NH7 A;  2B3B A;  4NWC A;  3K1P A;  5BWJ A;  5I57 B;  3TEP A;  1VR5 A;  3SEX A;  2V93 A;  4PFT A;  4F22 A;  5I59 A;  3HCQ A;  5H8S A;  3OSR A;  4R74 A;  2Y7P A;  3H03 A;  3HPI A;  4GLI A;  2REJ A;  3VV5 A;  4ZEF A;  1M5E A;  1MQH A;  2HQ0 A;  4F1U A;  4KYS A;  3A3U A;  4LAT A;  5KDT A;  1Y4T A;  4GFR A;  2KLF A;  2V25 A;  1Y9U A;  1B5J A;  3N5L A;  2AIX A;  1N7X A;  4OZ9 A;  1NNP A;  3N6U A;  2FA7 A;  1MDP 1;  4HTG A;  1QUL A;  3UGW A;  1MXY A;  3CG1 A;  2DWH A;  4H5F A;  1N84 A;  1VFE A;  3G3H A;  1P1Q A;  1JW5 A;  4OFL A;  1USY H;  3KN3 A;  4XTC Q;  3RNN A;  5CBS A;  1I6Q A;  3EN3 A;  3O29 A;  4GIZ A;  3EHS A;  1PDA A;  4YKI A;  3UIF A;  2CZL A;  4FAT A;  1YAE A;  1LGB C;  4OXV A;  4OTE A;  2NUV A;  4DZ1 A;  1FTJ A;  1M5B A;  1QUK A;  3Q26 A;  4U4S A;  3MC2 A;  4FIM A;  4OEN A;  2F34 A;  1UIV A;  4PFW A;  4KFQ A;  2BJJ X;  2F97 A;  3ONM A;  4KR5 A;  1QUJ A;  4ZEK A;  1B5H A;  1B6H A;  4LQ5 A;  4YKJ A;  3S4U A;  4F19 A;  5HPQ A;  3MBP A;  1SW4 A;  2DE3 A;  4O3A A;  2B3F A;  3RY3 A;  1MQG A;  5I2N A;  2W7Y A;  3JV9 A;  1IIT A;  1F9B A;  3DP8 A;  4G68 B;  4R72 A;  3T93 B;  5ICT A;  3RT8 A;  5I2K A;  3KJT A;  1ZIU A;  1ZJL A;  2NOO A;  4N6P A;  2UVH A;  4NED A;  4QFP A;  4YZZ A;  2F78 A;  1JET A;  1Y20 A;  5H8F A;  3H6V A;  2UXA A;  3H7M A;  4AB6 A;  4IO4 A;  3O6H A;  1P1U A;  1R6Z A;  4JBZ A;  5TPA B;  4F31 B;  4F29 A;  4M4G A;  1I6A A;  3TQW A;  2UVJ A;  4LQ2 A;  1LCF A;  3M3L A;  5FTI A;  2Q2A A;  1H43 A;  4PQJ A;  2XXP A;  1NMU A;  1US4 A;  5H8N A;  4HW8 A;  1LLS A;  1MQD A;  1JW1 A;  3I3V A;  3B6T A;  4RYA A;  4YB6 A;  4QFK A;  1B3F A;  4R6Y A;  3QXM A;  1H76 A;  4RJZ A;  2I0C A;  5L8D A;  1R9L A;  4FJP A;  3PPR A;  1M5F A;  2NXO A;  4Q8R A;  1WDN A;  4YU0 A;  3OEK A;  1NH8 A;  3MJN A;  1UTH A;  3MZB A;  1N3W A;  1OMP A;  1PEB A;  1YPN A;  2YPN A;  3UP9 A;  1Q35 A;  4GL8 A;  2R6G E;  3O66 A;  5BUU A;  3HST A;  3M3K A;  3RN8 A;  1D4N A;  4JXI A;  1J1N A;  4F1Y A;  2XXQ A;  1JVY A;  1ZTY A;  2DXR A;  1JQF A;  4YKP A;  1A99 A;  1B32 A;  3O28 A;  2D5W A;  4YB5 A;  3KN8 A;  3BBR A;  1HSL A;  4KYD A;  5JTY A;  3MZ1 A;  3TFL A;  1MY2 A;  2QS3 A;  3GBB A;  3K4U A;  3MVX A;  3FJ7 A;  3U72 A;  2I3V A;  2G29 A;  4IB2 A;  5H8H B;  2OZZ A;  4DCX A;  3C9H A;  3U8Q A;  4IO3 A;  3VVE A;  3E13 X;  2Y7K A;  1GV8 A;  2H99 A;  2UYE A;  2WKY A;  2XXH A;  1EU8 A;  2Z8D A;  2O1M A;  4U1O A;  1EZO A;  2V3Q A;  4BDM A;  2O7U A;  1B3E A;  3OO6 A;  4F3P A;  4BDQ A;  3QUJ A;  4PP0 A;  1ELJ A;  4IO2 A;  4XKQ A;  1XVX A;  3EPE A;  4HCW A;  4U2R A;  5DT6 A;  4FEB A;  3VXC A;  2A5S A;  3BFT A;  4OFO A;  1NL5 A;  1FQB A;  3B6Q A;  3MP1 A;  3RPW A;  2FYI A;  3SEY A;  2NWJ A;  2Z22 A;  3U1O A;  2HAU A;  1MPB A;  1RKM A;  3W15 C;  4ELQ A;  4G68 C;  3TUS A;  4ESW A;  5KCJ B;  1UQW A;  2Y7I A;  3IOV A;  3MW0 A;  5IAI A;  1N0T A;  4GWO A;  5H8F B;  5HBC A;  2DYX A;  1QKA A;  2ZYK A;  1MDQ A;  3G7W A;  4EDP A;  1N7W A;  2P2A A;  1B7Z A;  1PBP A;  1LFH A;  3V5A A;  3K00 A;  3TTM A;  2GRV A;  4N07 A;  4NMY A;  1OIB A;  1LAH E;  1B51 A;  3TTR A;  3WAF A;  4WED A;  3ZKL A;  5AE4 A;  3MQ9 A;  1UTB B;  1DTZ A;  2OJT A;  1BTJ A;  3K2D A;  4FEC A;  4HCY A;  2AL5 A;  1OQH A;  3LSF B;  3PV0 E;  3H6T A;  3K0V A;  3TZA A;  5AA3 A;  3MVY A;  4KHZ E;  4ELR A;  1D3K A;  4MBP A;  4EF2 A;  4U23 A;  1M5C A;  3IL1 B;  1IZ1 A;  3Q29 A;  5EHM A;  4BDL A;  4YIC A;  4EXK A;  1JEU A;  4NF6 B;  1B0H A;  4NTL A;  1MH3 A;  2QS1 A;  2O6A A;  2H25 A;  2XXX A;  5F7V A;  1MH4 A;  1Z7N E;  2B65 A;  3GXA A;  4OQO A;  3LC8 A;  1MXU A;  4IGR A;  4JDF A;  3ILT B;  1WOD A;  4LP2 B;  2I49 A;  3UK4 A;  2I4B A;  2OK2 A;  2I58 A;  5I56 A;  2QS2 A;  1B46 A;  5I58 B;  4XKN A;  2Q9T A;  2Z23 A;  3MVZ A;  1UIU A;  3K1N A;  2Q88 A;  2I0B A;  4P11 A;  1Y1M A;  1LFG A;  1URG A;  2OWS A;  2RC7 A;  3H3G A;  2X26 A;  3LSW A;  2XXR A;  4P0G A;  4ZS9 A;  3G3K A;  4H6D A;  3ZS6 A;  2DS9 A;  1I69 A;  2OWT A;  3DEL B;  2OCU A;  2F6G A;  3HN0 A;  4EF1 A;  2HAV A;  1FQD A;  3PU5 A;  1GR2 A;  1SI0 A;  2HZK A;  3ILU B;  3KN7 A;  1Y1Z A;  5TPA A;  5CMK A;  5I56 B;  4QSD A;  3EHU A;  4NE4 A;  1N04 A;  2A5T B;  4GOT A;  4GRK A;  4NF5 A;  4OEV A;  3I6V A;  2D3I A;  4F18 A;  4ZEC A;  4X1D A;  2RF1 A;  3FGS A;  3K6W A;  1N76 A;  4C0R A;  3TCF A;  2ZYM A;  4EXL A;  4H8I A;  1LB9 A;  1OQG A;  4LZ8 A;  3FAT A;  4RPO A;  4R9F A;  4POX A;  1B7U A;  4DXB A;  3CSG A;  4F3B A;  2H9B A;  3PMX A;  4DDD A;  3SER A;  1B2H A;  1IUD A;  1P1N A;  2GHB A;  3SKP A;  3TPA A;  5I59 B;  1H44 A;  3RLF E;  3USD A;  1MXW A;  2ZXT A;  1S9T A;  2VP1 A;  2O7I A;  5AA4 B;  3DM0 A;  4DXC A;  2UVI A;  3C4M A;  5ITO A;  4THI A;  3K6X A;  1EZ9 A;  5I2N B;  3I5O A;  3OSQ A;  4H67 A;  3KOS A;  3MWB A;  3O6I A;  2QL3 A;  1VFD A;  2RCB A;  3CRB A;  5DVI A;  3JYR A;  3T9X B;  3B6W A;  4R6H A;  3M8U A;  2H5Y A;  2RC8 A;  4BDN A;  5B70 A;  2ONS A;  1H45 A;  5H8N B;  3FVG A;  3OD7 A;  4FAJ A;  4EQ9 A;  2ABH A;  3FD3 A;  3KSX A;  4R75 A;  2VD3 A;  3TCH A;  4M1V A;  4H5G A;  5FHM A;  5KZT A;  3G3J A;  4FED A;  2H98 A;  2UYF A;  1R1N A;  4X1B A;  4UAC A;  4KCC A;  4ESX A;  3K1M A;  2XXW A;  4C1U A;  3TMG A;  4DLD A;  3T9U A;  4AQ4 A;  2XX8 A;  3FAS A;  3MPL A;  4JWX A;  3K01 A;  4I62 A;  4PFU A;  3R26 A;  4NF4 B;  2ONK E;  2GH9 A;  2PVU A;  3CFX A;  4WXJ A;  1PB8 A;  3T9H B;  4BDR A;  2YLN A;  4UA8 A;  5CC2 A;  2F8D A;  4GVO A;  1PC3 A;  2ESN A;  3FXQ A;  5K2Y A;  3DLN A;  1B5I A;  4ELO A;  3EHT A;  1NNT A;  4ZDM A;  1AOV A;  2DVZ A;  4XKP A;  1B52 A;  1OLA A;  4NF6 A;  2P0S A;  2DWI A;  1D9V A;  1FTM A;  1GGG A;  4OEU A;  4QRZ A;  4DIG A;  4F3G A;  3IOU A;  3IR1 A;  4BDO A;  4F1V A;  3Q25 A;  4LA9 A;  5I57 A;  3FIR A;  3C32 A;  3IB0 A;  1US5 A;  2XXT A;  4R73 A;  2XXY A;  4Z0I A;  4IGT A;  3MZ9 A;  3TAJ A;  4U22 A;  1O64 A;  1IXI A;  1YCJ A;  1QW0 A;  1MRP A;  1TT1 A;  1SI1 A;  2ZNU A;  1Z7M E;  1ANF A;  1B3L A;  3PUV E;  5M2V A;  1Q1K A;  3QYT A;  4GF8 A;  3K6V A;  3IX1 A;  4YB7 A;  4IO7 A;  2RKM A;  3C36 A;  4I9D A;  4ISU A;  5L9S A;  5FHN A;  3T9V A;  4G8M A;  1N3X A;  4RPN A;  4NF8 B;  3S9M C;  3V83 A;  2XD2 A;  3VXB A;  2Z8E A;  3E3K A;  4KD5 A;  1P1W A;  5KDT B;  1WVJ A;  4NF8 A;  1MQI A;  4Q0C A;  1LAG E;  1SW2 A;  2AYS A;  5I84 A;  3S2V A;  3ZKK A;  4DXU A;  3ZSF A;  1QKB A;  5TP9 B;  3KGC A;  4ECF A;  5I58 A;  2UVG A;  1MXX A;  3E4R A;  4WEP A;  5ELV A;  5JEI A;  2DSF A;  5F1Q A;  2YJP A;  1SVX B;  3H4Z A;  2ZNS A;  2D21 A;  3LR1 A;  2ONR A;  3L6G A;  3MUQ A;  5H8Q B;  3N94 A;  1RYX A;  2I3W A;  1B1H A;  4KPT A;  4Q30 B;  1A55 A;  1KWH A;  3R7X A;  3UN6 A;  4O3B A;  4OER A;  2IEE A;  1CE2 A;  3N26 A;  1IIW A;  3U94 A;  5AA2 A;  2VGQ A;  4FOR A;  3CSB A;  4GQO A;  3O6G A;  4RY1 A;  1TFA A;  5DEX A;  5TU0 A;  3P7I A;  3ODB A;  5CRY A;  1MY3 A;  2FNC A;  2PYY A;  3KFM A;  3H6W A;  3VLV A;  5EYF A;  3TCG A;  2REG A;  1B0L A;  1XS5 A;  1XVY A;  4PET A;  4U1Z A;  5K2X A;  2XXU A;  4AB5 A;  4GD5 A;  2HZL A;  3LSX A;  1ATG A;  4RA1 A;  4EQB A;  1O63 A;  2THI A;  2XD3 A;  3QIM A;  1BP5 A;  3AXF A;  3M3F A;  2VOZ A;  3PD9 A;  1FTO A;  5AA4 A;  3OEM A;  4I1D A;  1GVC A;  1II5 A;  3IB1 A;  4LZ7 A;  4GXS B;  4LVQ A;  2PMS A;  5DTB A;  2VHA A;  2PX1 A;  4DCY A;  1ZLQ A;  2ZMB A;  4RK2 A;  4F39 A;  4X48 A;  5J1D A;  4BLA A;  4OFJ A;  2P1S A;  3BKI B;  3O97 A;  3PPP A;  3PUZ E;  3VE1 B;  3TQL A;  2QRY A;  1NNK A;  1PBQ A;  1LCT A;  3DP4 A;  1NNF A;  1B4Z A;  2ZYO A;  4G8H A;  3T22 A;  4YMA A;  3C35 A;  4QFN A;  1BKA A;  3EF7 A;  3CG3 A;  2F5X A;  4YKK A;  3U92 A;  3D4G A;  2PT1 A;  4PFY A;  2HFB A;  2Q8J A;  4ELP A;  4JSD A;  5JTY B;  1VSO A;  1A7L A;  1DTG A;  3FUZ A;  4JWY A;  4JB7 A;  4KQP A;  3MPK A;  2GFE A;  3OEL A;  4OET A;  4JSO A;  1NKX A;  5A5X B;  4U21 A;  2DXY A;  2IA4 A;  2HEU A;  3HHG A;  1TFD A;  3MAM A;  1OVB A;  3IOR A;  2DE2 A;  2QPQ A;  2V3T A;  1S50 A;  2RCA A;  1MY1 A;  3EQ1 A;  4OHN A;  4QSE A;  4XIG Q;  1IXC A;  1JW4 A;  3K6U A;  5AA2 D;  1T0K A;  1FQF A;  3GBA A;  3IOW A;  4LZ5 A;  4POW A;  3RGY A;  3FV2 A;  3QAX A;  2M8C A;  5FHO A;  3TKD A;  1IXH A;  4E0W A;  2Y7R A;  3B7D A;  2R9J A;  3FJG A;  4OYV A;  3IOT A;  2QSX A;  3PUY E;  1MPC A;  1LST A;  4MLV A;  4ONY A;  1SBP A;  2ALU A;  2VD2 A;  3FVO A;  1B05 A;  3WAE A;  1B9J A;  1MY0 A;  4G2Z A;  5EHS A;  1JEV A;  2DWJ A;  4G8N A;  5H8H A;  5DVF A;  1SYI A;  3FV1 A;  2OBG A;  1FCK A;  1JVX A;  4H1X A;  3TOD A;  1MPD A;  1AIV A;  3VLW A;  2O69 A;  3TTL A;  3SEV A;  1MXZ A;  4MLQ A;  5IKB A;  4ND9 A;  1FW0 A;  2AL4 A;  3Q27 A;  3S9N C;  3VVD A;  4OMB A;  5DEX B;  3KJ7 A;  4MF3 A;  4RNS A;  2PT2 A;  1LBC A;  1UTB A;  2F35 A;  1R9Q A;  2HXW A;  3H6U A;  1IXG A;  1HSJ A;  4IO6 A;  4KYE A;  4OWD A;  2RIN A;  4JWO A;  4ZZA A;  2F7C A;  3RTW B;  2H4I A;  1NFT A;  1FQE A;  1P1O A;  2GHA A;  4IO5 A;  1D9Y A;  4TOZ A;  3RQT A;  3FVK A;  1PB7 A;  2I48 A;  5L9O A;  3S9L C;  2Z8F A;  3LUY A;  4IY6 A;  3RUM A;  1B40 A;  1POT A;  4NF5 B;  1ZU0 A;  4WKM A;  3C31 A;  3O2A A;  5DYH A;  4ZZE A;  1P99 A;  2XXI A;  1FTK A;  1SQY A;  3TYH A;  4ZE8 A;  4G77 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...