3U1OA

Three dimensional structure of de novo designed cysteine esterase ech19, northeast structural genomics consortium target or49
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
411
structure length
411
Chain Sequence
GSHMEVNLRMSWWGGNGRHQVTLKALEEFHKQHPNINVKAEYTGWDGHLSRLTTQIAGGTEPDVMQTNWNWLPIFSKDGTGFYNLFSVKEQLDLAQFDPKELQQTTVNGKLNGIPISVTAMIFYFNDATWAKAGLEYPKTWDELLAAGKVFKEKLGDQYYPVVLCAGQTLVLIRSYMTQKYNIPTIDEANKKFAYSPEQWVEFFTMYKTMVDNHVMPSTKYYASFGKSNHYEMKPWINGEWAGTYMWNSTITKYSDNLTKPAKLVLGPYPMLPGAKDAGLFFLPAQMLSIGKSTKHPQESAMLINFLLNSKEGVEALGLERGVPLSATAVTQLRASGVIKDEDPSVAGLNMALELPHKMTTSPYFLDWQIWSLFLDAIQYIDYGQKTVQETAEYFNKQGDRILKRAMRGSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords De Novo design cysteine esterase ECH19
publication title Computational design of catalytic dyads and oxyanion holes for ester hydrolysis.
pubmed doi rcsb
source organism Synthetic construct
total genus 127
structure length 411
sequence length 411
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3u1oA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3u1oA02
2F36A 2Z8DA 1US5A 4ZE9A 1FTKA 3IAZA 3M3LA 3D4GA 1B7ZA 1R6ZA 4F3GA 4Z7EA 4GL8A 3HPIA 3FATA 3H7MA 4C1UA 2ALUA 2HXWA 5CMKA 1MXVA 2HEUA 5I2KB 2OWSA 3FVNA 4XKNA 5HPQA 4OENA 5I84A 3GXAA 1NNKA 3FGSA 4TLLB 5L8DA 4MBPA 4Q8RA 4GQOA 1B58A 2O51A 1Y4TA 1VE4A 1ZU0A 1MY2A 3G7WA 3HSTA 4H8JA 5CMCA 3QIMA 3H4ZA 5AA4B 2W7YA 3V89B 3IO6A 1IQ7A 2UVHA 4WKMA 2DWAA 4H67A 1JW5A 2OWTA 2O69A 4LATA 1M5CA 4C1TA 2H4IA 3PMWA 4ZECA 1FQFA 3USDA 4GWOA 2FA7A 4LZ5A 4R6HA 4JWYA 3EHUA 4R6KA 1B5HA 1QJMA 1NNFA 2DSFA 2YLNA 2KLFA 5I58A 1MPBA 1Y1ZA 2UXAA 2D3IA 4NF6A 2Q8JA 3U93A 2D5WA 3RTFB 5EHSA 4JSDA 4O3BA 4H5FA 4R2BA 1MQIA 4ZEKA 1B7UA 1EH3A 3N94A 1B0LA 4Q0CA 1MPCA 2F7AA 3KOTA 3SEUA 3QAXA 3GBAA 5I2NA 3ZKKA 1ANFA 3MVYA 3RPWA 1B3HA 3IJOB 4RXLA 2XD3A 2DE4A 2XXXA 2H98A 2Y7KA 5KZTA 3ZKLA 1MDP1 1SYIA 4X48A 3TYHA 3C9HA 2O84X 5IKBA 3G3JA 1JETA 1ATGA 3UK4A 1QUJA 1FCKA 2CMOA 2R71A 1LFIA 2Y7RA 3KJTA 1SW2A 2V3QA 4IO7A 4IY6A 5L9OA 1ZTYA 4QFNA 5ICTA 1IXCA 2RC7A 3VFJA 4KYDA 1JEVA 3GZGA 5I56B 2Y7PA 2I48A 4GVOA 3PV0E 4BDQA 4HCWA 3OELA 2IA4A 2H99A 4IGRA 4N13A 1AIVA 1GVCA 2B3BA 3R26A 1A40A 2ANJA 2ABHA 1DMBA 3FIRA 1P1OA 3U92A 1P1QA 1Z7ME 1EZPA 4QRZA 2V3UA 5CMBA 1I6AA 1OQGA 3IR1A 2Q9TA 4GRKA 3T66A 1NL5A 3KBRA 4F1VA 3K01A 1NNTA 1LCTA 2RF1A 4FORA 1R9LA 5DYHA 1FQCA 5KDTA 1LB8A 4DXCA 1LAFE 3HN0A 1PB7A 2Y7IA 1Y4CA 1ZIUA 3PUVE 5TPAA 1D9VA 1MXXA 2F78A 3Q29A 2QL3A 5CM6A 3FJMA 1R1NA 1BIYA 3T22A 3TQLA 5CMMA 5F1QA 3RNNA 1LAHE 2ONKE 1BP5A 4I8CA 1N76A 3C36A 2F5XA 1LCFA 1DSNA 3G3FA 3CSGA 3CRBA 1LAGE 5I58B 4MLVA 4EQ7A 1R9QA 5FHOA 3HHGA 3CVGA 3M3KA 2HCAA 2XXIA 4WEPA 3U72A 3EQ1A 4QFKA 1N7XA 2IEEA 2VHAA 2X7QA 1MQHA 1B7HA 4C0RA 2PYYA 2HFBA 3TDJA 3VXCA 1NMUA 3I6VA 3VVFA 1B40A 2QS3A 4U23A 4KD5A 4F1YA 1TXFA 3K1PA 3T9VA 5AE4A 2Q89A 3VVEA 2NVUB 5B7DA 5LOMA 5TP9A 1B3LA 2DWIA 3HV1A 2THIA 3MZ9A 2QMXA 3ODBA 1Q35A 1XS5A 4NF5B 2ZNSA 5HM4B 4U22A 2F35A 3K6VA 4OEUA 5AA2D 3THIA 4QSCA 1XVXA 4GFRA 5ISUA 3PD8A 3K4UA 3E9XA 1IXIA 5L9SA 1QULA 3U94A 3G3IA 1IXGA 4FE8A 1B3GA 2BJJX 2RKMA 4F19A 1A99A 3IB0A 4ZEBA 1AL3A 1B3EA 4G68B 2V84A 3MVWA 4PFUA 1B4HA 5HBCA 2ONSA 3IX1A 3IOUA 1YAEA 3EF7A 4KPTA 4EXLA 3TAJA 4PFYA 3IL1B 1UIUA 2REJA 4JXIA 1ZJLA 1SW5A 4M1VA 4RA1A 5BUUA 1T0KA 4ELPA 1ELJA 4KR5A 3DM0A 1Y1MA 4DXBA 3N6TA 1I69A 2XXTA 4POWA 5H8QB 3EN3A 4EUOA 3UORA 1YTVA 2DXYA 3TELA 2HAVA 4UACA 4OETA 3F11A 2XXQA 4ELQA 4NTLA 4FECA 1MM6A 3B6WA 1Y3QA 3OO6A 5K2YA 3K0VA 3RT8A 1MY4A 5KDTB 2ZYNA 4LZ8A 5DEXA 1N7WA 1SQYA 2I49A 2GH9A 5TPAB 1XHYA 5ELVA 3ZS6A 2I6EA 3FVKA 3MPLA 4QFLA 1NH7A 1DTZA 4JDFA 1GGGA 4OFJA 3D4CA 3C34A 3A3CA 3ILTB 1P1WA 4G4PA 3IK6B 1S7YA 5J1DA 4KCCA 4L17A 3W9WA 3KN3A 2XX9A 2DWJA 4R72A 1TFDA 3KJ7A 4DDDA 1NH8A 4GXAA 4ZS9A 3K1NA 5CRYA 4ISUA 1XT8A 5DVFA 3SERA 1D9YA 3MVZA 3I5OA 4QFOA 1POY1 2I0BA 3H6WA 1ZKBA 4YB6A 3G3KA 2DQVA 1S50A 4GIZA 3HHFA 3VE1B 1NFTA 1PBQA 3CSBA 3R7XA 4R6YA 4QFPA 3BBRA 4RPNA 4XKPA 3U1OA 4GD5A 1QKAA 3L6HA 3RUMA 1MXZA 4H6DA 4UA8A 4LQ5A 1MXWA 2G29A 4O3CA 1A8EA 1B6HA 4ZDMA 2XXPA 4YKIA 3JZJA 2XXHA 5TP9B 3V5AA 1FTLA 5TU0A 1CE2A 1OLCA 2DWHA 1YCJA 4RK2A 3O29A 1MQGA 1P99A 3VXBA 1SDXA 1PEBA 3WAEA 3QSLA 3JYRA 4H5GA 2Q88A 3B6TA 4KFQA 1GR2A 3MW0A 1PDAA 3OD7A 3FXUA 3Q25A 4FAJA 2XD2A 3QUJA 4HTGA 3IORA 3TFLA 4G2ZA 4YAHX 2HQ0A 2B3FA 2UVJA 3FVOA 4I62A 3VV5A 1XC1A 1JVYA 4QSEA 3SEWA 4P0GA 1PB8A 1H76A 4MLQA 5H8HA 1HSJA 1JQFA 2HAUA 3OOAA 5I57B 3MC2A 3VDFA 3T9HB 1II5A 3MP1A 4E0WA 3C33A 2HZLA 2XXRA 2QSXA 4WEDA 5FHMA 3FZVA 1MH3A 2VOZA 3FASA 4EDPA 1UQWA 2UVIA 3KGCA 3DP4A 2NWJA 1Y9UA 2F97A 4ND9A 4FEBA 3BKIB 5DTBA 3KSJA 3PUYE 1P1UA 4U4SA 2O1LA 1MQDA 1MPDA 1VR5A 1MG1A 3MJNA 3MP6A 3OENA 5H8FA 2R6GE 3V8XB 1UTHA 4E0XA 2F34A 1URDA 4QSDA 3KN8A 3W9VA 2A5TA 3EHTA 3CFLA 4XKQA 3O6HA 3MQ9A 4ONYA 5AA3A 2GHAA 5H8NA 2FYIA 4FEDA 3CR9A 5DT6A 4THIA 2P2AA 3TZAA 1FQEA 4I1DA 3PMVA 4IO5A 1OVBA 1MY1A 3RTWB 3TTNA 4FJPA 5I59A 3PUZE 3ONMA 4U2RA 3KN7A 3TCFA 3DP6A 1USYH 3PPOA 3IO4A 1UTBA 2LAOA 3IJXB 3RT6B 3QUFA 1IITA 3FV1A 4QHQA 2ZYMA 4GLIA 5AA2A 4JSOA 3TMGA 2PBWA 4F3SA 4H65A 1QKBA 1AOVA 3GLBA 3IOTA 1SW4A 3OMBA 2B65A 1FTJA 1I6BA 1POTA 4RK9A 4X1DA 1MXYA 2Y84A 4PFTA 2O1MA 4OFLA 3O6IA 2E1SA 4NMYA 4BLAA 1WDNA 4DZ1A 1M5FA 1Y3NA 4KQPA 2H9BA 3PGFA 1B52A 2DE3A 1B5IA 1URGA 3LBSA 4YKPA 1GTKA 5K2XA 3O9PA 1S9TA 1TT1A 3PPRA 3OXNA 1F9BA 1O64A 1LSTA 4G8HA 3E13X 2DOJA 1SW1A 2F8DA 3N5LA 1J1NA 1RYXA 2VD3A 4EQBA 4NF6B 1B32A 4OERA 2OLBA 3TODA 4GL0A 3IB2A 1FQAA 3H3GA 2GHBA 3BFUA 1XOCA 4F1UA 4IGTA 3G3HA 4G8NA 2X26A 5I2KA 4Q5TA 4GF8A 4DCYA 3V83A 1B1HA 1Q1KA 4X1BA 2DS9A 5ICQA 4OTEA 4PQJA 1OLAA 3CG1A 2RINA 5FTHA 2V25A 3CG3A 2NOOA 3C32A 3O66A 3FV2A 4IO2A 3FXQA 3FJGA 1EZ9A 1Z7NE 2F6GA 2Z23A 5AA4A 5I2NB 4EF1A 4PP0A 3OO9A 4F31B 2QS1A 4YKKA 2CZLA 2OCUA 2X7PA 3TQWA 5ITOA 1M5DA 3IOVA 1CB6A 3OSQA 3UP9A 2H25A 4R9GA 3T9UA 1B9JA 1B3FA 5BWJA 4OZ9A 1B5JA 1YPNA 4QF9A 4YB5A 3E4RA 2ZMBA 4OHNA 3TTKA 1Y3PA 1MY3A 4O3AA 4XIGQ 5FHNA 3H6UA 2PVUA 1LFHA 1OIBA 4AB6A 5CC2A 2A5TB 4N6PA 2O7UA 3N26A 4F18A 3Q27A 4HW8A 2QPQA 5JK4A 4H1XA 5EHMA 3TTLA 3H03A 3IOWA 1FTMA 1L5TA 4PFWA 4HCYA 2YPNA 1B2HA 2ZYOA 3RY3A 2M8CA 4F3BA 4LZ7A 5AA1A 4X9TA 3H6TA 1N84A 4KYEA 1Y20A 1PC3A 2VGQA 4I9DA 4YKJA 1PB9A 3K6UA 1EU8A 1N3WA 4MFIA 1OQHA 5A5XA 4AB5A 2Z22A 2P0SA 1IUDA 2OJTA 3C4MA 1FQDA 1UTBB 3AXFA 1IEJA 1MDQA 2REGA 4RYAA 1A7LA 5AA2B 4U21A 4ESWA 1B51A 2D21A 4KYSA 5M2VA 2O68A 1DOTA 5KCJA 2DYXA 5DVIA 1HSEA 1H45A 2XXVA 4ZEDA 2F6PA 4LP2B 4OFOA 4JWOA 5I56A 1AMFA 1JEUA 3G3GA 2DVZA 5IAIA 1M5BA 3UA8A 1VFDA 3LR1A 1BTJA 1SD3A 4YB7A 4R9FA 4EXKA 2PT2A 2ESNA 4DE8A 1TFAA 3MVXA 3TKDA 3C35A 4NF4A 3KFMA 3BFTA 3B6QA 4FATA 5H8SA 1LLSA 4YMBA 4N07A 4PE5B 4HS7A 3A09A 1KWHA 3CFXA 1MY0A 3DELB 1B4ZA 4JWXA 3LSFB 4NWCA 4LQ2A 1VFEA 3MUQA 3TCHA 3MBPA 2V3TA 1M5EA 3OSRA 2PMSA 4R2FA 3VLWA 1A8FA 4G68C 3FXRA 3MP8A 2PX1A 3SEVA 2QJEA 3S4UA 3LSXA 4JB7A 4XXUA 4ELOA 3ILUB 5CI5A 4ECFA 4OEVA 1RKMA 3EPEA 4BDOA 3KOSA 3MAMA 2P1SA 2R9JA 4OVJA 3MPKA 4R73A 5DVJA 4LA9A 3JV9A 2RC8A 4YICA 4IB2A 1BLFA 2YJPA 3RLFE 2RC9A 1IIWA 1H44A 3C31A 2XX8A 3MWBA 1MXUA 4TOZA 1JW1A 5ITPA 1QW0A 2H5YA 3QK6A 4KI0E 4F29A 1DPPA 4F2OA 2RCBA 5CBSA 2DE2A 3N6UA 2DVCA 3PD9A 2AL4A 2I58A 3M3FA 1DPEA 1SVXB 2FNCA 1LFGA 1O7TA 3PPQA 3FD3A 3LC8A 4EQ9A 4ZEFA 3K00A 1LB9A 3W15C 4LVQA 1AH5A 4RNSA 4OQOA 1MS7A 4R74A 2GFEA 3TTRA 3O97A 3PUWE 4TQUQ 4RPOA 4NF8A 4ZZEA 1MRPA 4ZE8A 5JTYA 3MZ1A 4BDNA 5CBRA 3QXMA 2O7IA 1US4A 4OYVA 3KG2A 2AYSA 1B1XA 3RGYA 4WXJA 2Z8EA 1BKAA 4NF5A 1VSOA 4POXA 5A5XB 2QS4A 4IO6A 3FVGA 3T93B 3O2AA 1D4NA 4Z0IA 4F2QA 3IB1A 4IY5A 4NWDA 2Q2CA 3UGWA 2QRYA 4AQ4A 3KEIA 5KCJB 3MZBA 4OMBA 1RYOA 4YU0A 4U1ZA 3CIJA 1ZMGA 3TTMA 1WVJA 5DEXB 2QMWA 1LAXA 3L6GA 4G68A 4XTCQ 1N3XA 2WKYA 1LGBC 3K6XA 2OZZA 4OWDA 1IXHA 1GV8A 3TEPA 4GOTA 2ZXTA 4NF4B 4ESXA 1A55A 1FQBA 1P1NA 3GBBA 3Q28A 3HCQA 5L9MA 3QYTA 1USYE 1NNPA 1A54A 1QUIA 3LSLA 3ZSFA 3PU5A 1SI1A 3S9EA 2Z8FA 3RN8A 1ZBMA 3A3UA 2OBGA 3S9LC 3SETA 3H06B 5H8QA 3CFZA 4P11A 4P0IA 2NXOA 4KHZE 4JBZA 5JEIA 2UYEA 4OXVA 3SEXA 3SKPA 2ZNUA 3TUSA 1JNFA 1MH4A 2AIXA 3OO7A 1IZ1A 3SEYA 4DXUA 3S2VA 2A5SA 4RJZA 1SI0A 3E3KA 4DIGA 4IO4A 1URSA 2E0SA 3O6GA 4ELRA 2OK2A 4R75A 3Q26A 3KZGA 1NKXA 3O28A 2I4BA 4PETA 3I3VA 3U8QA 3PUXE 1B05A 4MF3A 4TLMB 1QUKA 1OMPA 1H43A 3S9NC 3M8UA 1O63A 2I3WA 2AL5A 1D3KA 5F7VA 1JVXA 2G93A 4K3FA 1I6QA 4Q30B 4ZEIA 4YMAA 2I3VA 1ZLQA 5FTIA 2GRVA 4DCXA 3SESA 4BDRA 3K6WA 3KSXA 3UIFA 3RQTA 1XVYA 3CI8A 1JW4A 3UN6A 1LBCA 5H8HB 1LBBA 2PT1A 3SDFA 2F7BA 2NUVA 4BDLA 4LONB 4NF8B 1SYHA 3LUYA 5JTYB 2Y7WA 3EHSA 3OEMA 3OO8A 3DP8A 4G8MA 2V93A 4NEDA 1B46A 4H0WA 2UVGA 4IO3A 4U1OA 3T96B 3TPAA 4U4XA 3VVDA 3K02A 1N04A 2XHDA 2I4CA 3VLVA 4OESA 3FJ7A 4G77A 4H8IA 3R6UA 4EF2A 5H8FB 2F7CA 2VD2A 3K1MA 4M4GA 3LSWA 1UTHB 3DLNA 2ONRA 3ECRA 3K2DA 4ZZAA 1TWYA 1MQJA 4BDMA 1WODA 2DP8A 4XKRA 1EZOA 2Q2AA 5H8NB 4GXSB 4YZZA 3HO7A 5I57A 1OVTA 1HSLA 2HZKA 3PPNA 1QVSA 2XXWA 2XX7A 5I59B 4RY1A 4FIMA 2ZYKA 2XXUA 2I0CA 1UIVA 2QS2A 1B0HA 2XXYA 4DLDA 5B70A 4KCDA 1MM7A 1SBPA 4LUBA 4F3PA 3P7IA 3VLUA 1FW0A 3T9XB 1PBPA 1DTGA 3WAFA 3S9MC 2VP1A 1H3DA 1FTOA 3OEKA 3TCGA 2DXRA 4F22A 3B7DA 4MH5A 4F39A 2RCAA 4NE4A 3PMXA 1N0TA 3PPPA 3H6VA 5EYFA 3FUZA 2UYFA 2ZNTA 2O6AA
chains in the Genus database with same CATH superfamily
2F36A 2Z8DA 1US5A 4ZE9A 1FTKA 3IAZA 3M3LA 2R8TA 3D4GA 1B7ZA 1R6ZA 4F3GA 4Z7EA 1SPIA 4GL8A 3HPIA 3FATA 3H7MA 1EYJA 4C1UA 2ALUA 4GWUA 2HXWA 4N6DA 3KC0A 5CMKA 1MXVA 2HEUA 5I2KB 2OWSA 3FVNA 4XKNA 5HPQA 1FRPA 3QMFA 4OENA 5I84A 4PCDA 3GXAA 1NNKA 3FGSA 4TLLB 5L8DA 4MBPA 4Q8RA 4GQOA 1B58A 2O51A 2ZZVA 1Y4TA 1VE4A 1FPJA 1ZU0A 1MY2A 3G7WA 4MNPA 3HSTA 4H8JA 5CMCA 3QIMA 1NV2A 3H4ZA 5AA4B 4PC9A 2W7YA 3V89B 3IO6A 1IQ7A 2UVHA 4WKMA 2DWAA 4H67A 1JW5A 2OWTA 2O69A 4LATA 1M5CA 4C1TA 2H4IA 3PMWA 4ZECA 1FQFA 3USDA 4PDDA 4GWOA 2FA7A 1FPFA 4LZ5A 4R6HA 4JWYA 3EHUA 4R6KA 1B5HA 1QJMA 1NNFA 2DSFA 2YLNA 4MIJA 2KLFA 5I58A 1MPBA 1Y1ZA 1NI9A 2UXAA 2D3IA 4NF6A 1AWBA 2Q8JA 3U93A 4PAFA 2D5WA 3RTFB 5EHSA 4JSDA 4O3BA 4P47A 4H5FA 4QXDA 4R2BA 1MQIA 4ZEKA 1B7UA 1EH3A 2V4CA 3N94A 1B0LA 4Q0CA 1MPCA 2F7AA 3KOTA 3SEUA 3QAXA 3GBAA 5I2NA 3ZKKA 1ANFA 3MVYA 3RPWA 1B3HA 3IJOB 4MMPA 4RXLA 2XD3A 2DE4A 2XXXA 2H98A 2WBBA 3U65A 2Y7KA 5KZTA 3ZKLA 5A5LA 2OWZA 4G61A 2B4LA 4LN5A 1MDP1 1NV6A 1SYIA 4X48A 3TYHA 3C9HA 2O84X 4P56A 4P1EA 5IKBA 5EYGA 2FBPA 3G3JA 1JETA 5EQAA 1ATGA 3UK4A 1QUJA 1FCKA 2CMOA 2R71A 2ZZXA 1LFIA 2Y7RA 3KJTA 1SW2A 1VDWA 2V3QA 4IO7A 1INPA 1FBPA 2WX9A 4IY6A 4GBWA 5L9OA 1ZTYA 4QFNA 5ICTA 1IXCA 2RC7A 3VFJA 4KYDA 1JEVA 3GZGA 5I56B 2Y7PA 2I48A 4GVOA 3PV0E 4BDQA 4HCWA 3OELA 2IA4A 2H99A 2CEXA 4IGRA 4N13A 1AIVA 1NV0A 1GVCA 1IMFA 2B3BA 3R26A 1A40A 2ANJA 2ABHA 1DMBA 3FIRA 1IMCA 1CNQA 1P1OA 3U92A 1P1QA 1RDZA 1Z7ME 4DI4B 1EZPA 4QRZA 2V3UA 4KXPA 1RDXA 2HPGA 5CMBA 3PTYA 4PTKA 1I6AA 4GWZA 1OQGA 3IR1A 5ESYA 2Q9TA 4GRKA 3T66A 1NL5A 3KBRA 4F1VA 1LBYA 3CHGA 3K01A 1NNTA 4MEVA 1LCTA 2RF1A 4FORA 1R9LA 2FVZA 5DYHA 1FQCA 4GX3A 1LB8A 5KDTA 2KR0A 4DXCA 5T3JA 1LAFE 3HN0A 1NV3A 1PB7A 2Y7IA 1Y4CA 1ZIUA 3PUVE 5TPAA 1D9VA 1MXXA 1FBCA 2F78A 3Q29A 1KZ8A 5IZ3B 2QL3A 5CM6A 3FJMA 1R1NA 5FBPA 1BIYA 3T22A 3TQLA 5CMMA 5F1QA 3RNNA 1LAHE 4JVDA 2ONKE 1BP5A 4I8CA 1N76A 4MNIA 3C36A 2F5XA 1LCFA 1K9YA 1DSNA 3G3FA 3CSGA 1LBVA 3CRBA 5EQ8A 4I40A 1LAGE 5I58B 4MLVA 4NN3A 4EQ7A 1R9QA 5FHOA 3HHGA 3CVGA 3M3KA 2HCAA 2XXIA 4WEPA 3U72A 3EQ1A 4QFKA 4H46A 1NUYA 1N7XA 2IEEA 2VHAA 2X7QA 1MQHA 1B7HA 4XEQA 4C0RA 1LBXA 2PYYA 2HFBA 3TDJA 3VXCA 1NV7A 4NX1A 1DCUA 1NMUA 3I6VA 1BK4A 1FPKA 2CZIA 3VVFA 1B40A 2QS3A 4U23A 4KD5A 4F1YA 4PGPA 1TXFA 3K1PA 3T9VA 5AE4A 2Q89A 3VVEA 2NVUB 4DI3D 5B7DA 5LOMA 5TP9A 1B3LA 2DWIA 4NAPA 3HV1A 2THIA 4MAGA 3MZ9A 2QMXA 3ODBA 1Q35A 1XS5A 4NF5B 2ZNSA 5HM4B 4U22A 2F35A 3K6VA 4OEUA 5AA2D 3THIA 4QSCA 1XVXA 4GFRA 5ISUA 4X04A 3PD8A 4N91A 3K4UA 3E9XA 1IXIA 5L9SA 1QULA 4PAIA 3U94A 3G3IA 1IXGA 2XWIA 4FE8A 1B3GA 4X8RA 5EQ7A 2BJJX 2RKMA 3NOHA 4F19A 1A99A 2CZKA 3IB0A 4ZEBA 1AL3A 1B3EA 4G68B 3A29A 2V84A 3MVWA 4PFUA 1B4HA 5HBCA 2ONSA 3IX1A 3IOUA 1YAEA 3EF7A 4KPTA 4EXLA 3TAJA 4PFYA 3IL1B 1UIUA 2REJA 4JXIA 1ZJLA 1FPBA 1SW5A 4M1VA 2QVRA 5ET6A 4RA1A 5BUUA 1T0KA 4ELPA 1ELJA 4KR5A 3DM0A 1Y1MA 5EYHA 4DXBA 3N6TA 4P1LA 1I69A 2XXTA 4O8MA 4POWA 5H8QB 3T1BA 3EN3A 4EUOA 4OVTA 3UORA 1YTVA 2DXYA 3TELA 2HAVA 4UACA 2JJKA 4UABA 4OETA 3F11A 2XXQA 4ELQA 4NTLA 4FECA 4XF5A 1MM6A 3B6WA 1Y3QA 3OO6A 5K2YA 3K0VA 3RT8A 1MY4A 3IFCA 5KDTB 2ZYNA 4LZ8A 4OVRA 4N6KA 5DEXA 1N7WA 1SQYA 2I49A 2GH9A 5TPAB 1XHYA 5ELVA 3ZS6A 4N15A 2I6EA 3FVKA 3MPLA 4QFLA 4HE2A 1NH7A 1IMAA 1DTZA 4JDFA 4OANA 1GGGA 4OFJA 3D4CA 3C34A 3A3CA 3ILTB 1P1WA 3RYDA 4G4PA 3IK6B 1S7YA 5J1DA 4KCCA 4L17A 3W9WA 1FBFA 5I3SA 3KN3A 2XX9A 2DWJA 4R72A 1TFDA 3KJ7A 4DDDA 1NH8A 4GXAA 4ZS9A 3K1NA 5CRYA 4ISUA 1XT8A 5DVFA 3SERA 1D9YA 1G0HA 3MVZA 4OVPA 3I5OA 4QFOA 1POY1 2I0BA 3H6WA 1ZKBA 4YB6A 1FBEA 3G3KA 2DQVA 1S50A 2FHYA 4GIZA 3HHFA 3VE1B 1NFTA 1PBQA 3CSBA 3R7XA 4R6YA 4QFPA 3BBRA 4RPNA 4XKPA 3U1OA 4GD5A 1QKAA 3L6HA 3RUMA 4AS5A 1MXZA 4H6DA 1NV1A 4UA8A 4LQ5A 1MXWA 2G29A 4O3CA 1A8EA 1B6HA 4ZDMA 2XXPA 4YKIA 3JZJA 1NUXA 2DDKA 2XXHA 2BJIA 5TP9B 3V5AA 1FTLA 5TU0A 1CE2A 4N81A 1OLCA 2DWHA 1YCJA 4RK2A 3O29A 1MQGA 1P99A 3VXBA 1SDXA 1PEBA 3WAEA 3QSLA 3JYRA 4H5GA 2Q88A 3B6TA 4KFQA 1YZ0A 1GR2A 3MW0A 1PDAA 3OD7A 3FXUA 3Q25A 4FAJA 2XD2A 3QUJA 4HTGA 3IORA 4GX6A 3TFLA 4G2ZA 1QGXA 4YAHX 2HQ0A 2B3FA 3T0JA 2UVJA 3FVOA 4I62A 3VV5A 1FJ6A 1XC1A 1JVYA 4QSEA 3SEWA 4P0GA 1PB8A 1H76A 4MLQA 5H8HA 1HSJA 1JQFA 2HAUA 1EYKA 3OOAA 5I57B 3MC2A 3VDFA 3T9HB 1II5A 3MP1A 4E0WA 3C33A 2HZLA 2XXRA 2QSXA 4WEDA 1NUWA 5FHMA 3FZVA 1MH3A 2VOZA 3FASA 4EDPA 1UQWA 2UVIA 3KGCA 3DP4A 2NWJA 1Y9UA 2F97A 4ND9A 4FEBA 2PFYA 3BKIB 5DTBA 3KSJA 3PUYE 1P1UA 4U4SA 2O1LA 1MQDA 1MPDA 1VR5A 1MG1A 3MJNA 3MP6A 3OENA 5H8FA 5F24A 2R6GE 3V8XB 1UTHA 4FBPA 4E0XA 2F34A 1URDA 4O7IA 4QSDA 2QFLA 3KN8A 1G0IA 3W9VA 2A5TA 3EHTA 3CFLA 4XKQA 3O6HA 3B50A 3MQ9A 4ONYA 5AA3A 2GHAA 5ET5A 5H8NA 2FYIA 4FEDA 3CR9A 5DT6A 4THIA 2P2AA 2Y5LA 4O94A 3SZPA 3TZAA 1FQEA 4I1DA 3PMVA 4IO5A 2XWVA 1OVBA 1MY1A 5I7IA 1JP4A 3RTWB 3TTNA 2HXRA 4FJPA 5I59A 3PUZE 3ONMA 4U2RA 3KN7A 3TCFA 3DP6A 1USYH 3PPOA 3IO4A 5ET8A 5LDZA 1UTBA 2LAOA 3IJXB 3RT6B 3QUFA 1IITA 1FJ9A 2CEYA 3FV1A 4QHQA 2ZYMA 4GLIA 5AA2A 4JSOA 4I3EA 3TMGA 2PBWA 5I5PA 4F3SA 4H65A 1QKBA 3RPLA 1AOVA 3GLBA 3IOTA 1SW4A 3OMBA 2B65A 1FTJA 1I6BA 1POTA 4RK9A 4X1DA 2PCRA 4JVIA 1MXYA 2Y84A 3KC1A 4PFTA 2MKZA 2O1MA 4OFLA 1LBWA 3O6IA 2E1SA 4NMYA 4BLAA 1WDNA 3FXBA 4DZ1A 1M5FA 1Y3NA 4KQPA 2H9BA 4PBQA 3PGFA 1B52A 2DE3A 1B5IA 1URGA 3LBSA 4YKPA 1GTKA 5K2XA 2VT5A 3O9PA 1S9TA 1TT1A 3PPRA 3OXNA 3BIHA 1F9BA 1O64A 1LSTA 4G8HA 3E13X 2DOJA 1SW1A 2F8DA 3N5LA 1J1NA 2Y5KA 1RYXA 2VD3A 4EQBA 4JVCA 4NF6B 1B32A 4GWYA 4OERA 2OLBA 3TODA 4GL0A 3IB2A 4PF6A 1FQAA 3H3GA 2GHBA 1FBGA 3BFUA 1XOCA 4F1UA 4IGTA 3G3HA 4G8NA 2X26A 5I2KA 4Q5TA 4GF8A 4DCYA 3ISPA 3V83A 1B1HA 1Q1KA 4X1BA 2DS9A 5ICQA 4OTEA 4PQJA 1OLAA 3CG1A 2RINA 5FTHA 2V25A 3CG3A 2NOOA 3C32A 5IZZA 2FIXA 3O66A 3FV2A 4IO2A 3FXQA 3FJGA 1EZ9A 1Z7NE 2F6GA 2Z23A 5AA4A 5I2NB 4EF1A 4PP0A 3OO9A 4F31B 2QS1A 4YKKA 2CZLA 2OCUA 2X7PA 3TQWA 5ITOA 4PF8A 1M5DA 3IOVA 4PE3A 1CB6A 3OSQA 3UP9A 2H25A 4R9GA 3T9UA 1B9JA 1B3FA 5BWJA 4OZ9A 1B5JA 1YPNA 4QF9A 4YB5A 3E4RA 2PFZA 1NUZA 2ZMBA 4OHNA 3TTKA 1Y3PA 4GX4A 1MY3A 4O3AA 4XIGQ 5FHNA 1KA0A 3H6UA 2PVUA 1LFHA 1OIBA 3ROJA 4AB6A 1FBDA 5CC2A 2A5TB 1D9QA 4PAKA 4N6PA 2O7UA 3N26A 4F18A 3Q27A 4HW8A 2QPQA 5JK4A 4MX6A 4H1XA 1IMBA 5EHMA 2XWKA 3TTLA 3H03A 3IOWA 1FTMA 4OVSA 1L5TA 4PFWA 4GBVA 4HCYA 2YPNA 1B2HA 2ZYOA 3RY3A 2M8CA 4F3BA 1NV4A 4LZ7A 5AA1A 4X9TA 2ZZWA 3H6TA 1N84A 4KYEA 1Y20A 1PC3A 2VGQA 4I9DA 4YKJA 1PB9A 3K6UA 1EU8A 1N3WA 2QVVA 4MFIA 1OQHA 5A5XA 4AB5A 2Z22A 3MSTA 1FPGA 2P0SA 1IUDA 2OJTA 2HHMA 3C4MA 1FQDA 1UTBB 3AXFA 1IEJA 1MDQA 2REGA 4RYAA 2P3NA 1A7LA 5AA2B 4U21A 4ESWA 5IM2A 1B51A 2D21A 4KYSA 5M2VA 3RPLB 2O68A 1DOTA 5KCJA 2DYXA 5LTCA 5DVIA 4QBAA 1KA1A 4HXVA 1HSEA 1H45A 2XXVA 4ZEDA 3KBZA 2F6PA 4LP2B 5IGAA 4OFOA 1EYIA 4JWOA 5I56A 1AMFA 1JEUA 3G3GA 2DVZA 5IAIA 1M5BA 3UA8A 4N8GA 1VFDA 3LR1A 1BTJA 1SD3A 4YB7A 4R9FA 4EXKA 2PT2A 2ESNA 4DE8A 1XI6A 1TFAA 3MVXA 5DW8A 3TKDA 3C35A 4NF4A 2QVUA 2VPNA 3KFMA 3BFTA 3B6QA 4FATA 5H8SA 1LLSA 4YMBA 4N07A 4PE5B 4HS7A 3A09A 1KWHA 3CFXA 1FPDA 1MY0A 3DELB 5ET7A 1B4ZA 4JWXA 3LSFB 4NWCA 4LQ2A 4P3LA 1VFEA 4P9KA 3MUQA 3TCHA 3MBPA 2V3TA 1M5EA 2FIEA 3OSRA 2PMSA 4NQ8A 4R2FA 3VLWA 1A8FA 4G68C 3FXRA 3MP8A 1RDYA 2PX1A 3SEVA 2QJEA 3S4UA 3LSXA 4JB7A 4XXUA 4ELOA 3ILUB 5CI5A 3E78A 4ECFA 4OEVA 4NHBA 1RKMA 3EPEA 4BDOA 3E79A 3KOSA 3MAMA 2P1SA 2R9JA 4PBHA 4OVJA 3MPKA 4O7MA 5IZ3A 4R73A 5DVJA 4LA9A 3JV9A 2RC8A 1FPEA 4YICA 4IB2A 1BLFA 4PGNA 2YJPA 3RLFE 2RC9A 1IIWA 1H44A 3C31A 2XX8A 3MWBA 1MXUA 4TOZA 1JW1A 2WYKA 4MNCA 5ITPA 1QW0A 2H5YA 3QK6A 4KI0E 4F29A 1DPPA 4F2OA 2RCBA 3GYYA 5CBSA 2DE2A 4P8BA 3N6UA 2DVCA 3PD9A 2AL4A 2I58A 3MYUA 3M3FA 1DPEA 1SVXB 2FNCA 1LFGA 1O7TA 1IMEA 3PPQA 3FD3A 3LC8A 4EQ9A 4ZEFA 3K00A 1LB9A 3W15C 1LBZA 4LVQA 1AH5A 4RNSA 4OQOA 1MS7A 4R74A 2GFEA 3TTRA 2F3DA 3O97A 3PUWE 4TQUQ 4RPOA 4NF8A 4ZZEA 1MRPA 1FTAA 4ZE8A 5JTYA 3MZ1A 4BDNA 5CBRA 3QXMA 2O7IA 1FPIA 1US4A 4OYVA 3KG2A 2AYSA 1B1XA 3RGYA 4GWSA 3BIGA 1YXIA 4WXJA 2Z8EA 1BKAA 4NF5A 1VSOA 4N17A 4POXA 5A5XB 2QS4A 4IO6A 1K9ZA 4MHFA 2F3BA 3FVGA 3T93B 3O2AA 1D4NA 2XWOA 4Z0IA 4F2QA 3IB1A 4IY5A 4NWDA 2Q2CA 3IFAA 3UGWA 2QRYA 4AQ4A 3KEIA 5KCJB 3MZBA 4OMBA 1RYOA 4YU0A 4U1ZA 2VPOA 3CIJA 1ZMGA 3B8BA 3TTMA 1WVJA 1Q9DA 5DEXB 2QMWA 4PDHA 1LAXA 3L6GA 4G68A 4XTCQ 1N3XA 2WKYA 4GWXA 1LGBC 3K6XA 2OZZA 4OWDA 1IXHA 1GV8A 3TEPA 4GOTA 5IZ1A 2ZXTA 4NF4B 4ESXA 3EKIA 1A55A 1FQBA 1P1NA 3GBBA 3Q28A 3HCQA 5L9MA 3QYTA 1USYE 4MJOA 1NNPA 1A54A 1QUIA 3LSLA 3ZSFA 3PU5A 1SI1A 3LV0A 3S9EA 4NG7A 2Z8FA 3FBPA 3RN8A 1IMDA 1ZBMA 3A3UA 2OBGA 3S9LC 3SETA 3H06B 5H8QA 1YYZA 3CFZA 4P11A 4P0IA 2NXOA 4KHZE 4JBZA 5JEIA 2UYEA 4OXVA 4HE1A 3SEXA 4PFIA 2Q74A 3SKPA 2ZNUA 4HE0A 3TUSA 2B4MA 4I3YA 1JNFA 1MH4A 2AIXA 3OO7A 1IZ1A 2GQ1A 3SEYA 4DXUA 3S2VA 2A5SA 4RJZA 1SI0A 3E3KA 4DIGA 4IO4A 1URSA 2E0SA 3O6GA 4ELRA 2OK2A 4N4UA 4R75A 2WEFA 3Q26A 3KZGA 1NKXA 3O28A 2I4BA 4PETA 3I3VA 3U8QA 3PUXE 1B05A 4MF3A 2WYPA 4TLMB 1QUKA 1OMPA 1H43A 3S9NC 3M8UA 4H45A 1O63A 2Q8MA 2I3WA 2AL5A 1D3KA 5F7VA 1JVXA 2G93A 4K3FA 1I6QA 4Q30B 4ZEIA 4YMAA 2I3VA 4NF0A 1ZLQA 5FTIA 2GRVA 4DCXA 3SESA 4BDRA 3K6WA 3KSXA 1FSAA 3UIFA 3RQTA 1XVYA 3CI8A 1JW4A 3UN6A 1LBCA 5H8HB 1LBBA 2XA5A 2PT1A 1LEVA 4PFBA 2OX3A 3SDFA 2F7BA 2NUVA 4BDLA 4LONB 2KQZA 4NF8B 1SYHA 3LUYA 5JTYB 2Y7WA 3EHSA 3OEMA 3OO8A 3DP8A 4G8MA 2V93A 2CZHA 4NEDA 4IR8A 1B46A 4H0WA 2UVGA 4IO3A 4U1OA 3LUZA 3T96B 3TPAA 4U4XA 3VVDA 3K02A 4MCOA 1N04A 2XHDA 2I4CA 3VLVA 4OESA 3FJ7A 4G77A 4H8IA 3R6UA 4EF2A 5H8FB 2F7CA 2VD2A 3K1MA 4M4GA 3LSWA 1UTHB 3DLNA 2ONRA 3ECRA 3K2DA 4ZZAA 1TWYA 1MQJA 4XFEA 4BDMA 1WODA 2DP8A 4XKRA 1EZOA 1FPLA 2Q2AA 4NGUA 5H8NB 4GXSB 4YZZA 3HO7A 5I57A 1OVTA 1HSLA 2HZKA 4GWWA 5EQ9A 3PPNA 1QVSA 2XXWA 2XX7A 5I59B 3D1RA 1DBZA 1DK4A 3HFUA 4RY1A 4FIMA 2ZYKA 2XXUA 2WBDA 2I0CA 1NV5A 1UIVA 2QS2A 1B0HA 2XXYA 4DLDA 5B70A 4KCDA 1MM7A 1SBPA 4LUBA 4F3PA 3P7IA 3VLUA 1FW0A 3T9XB 1PBPA 4AS4A 1DTGA 4OA4A 3WAFA 3S9MC 2VP1A 1H3DA 1FTOA 3OEKA 4OVQA 3TCGA 2DXRA 2XXKA 4F22A 4N8YA 3B7DA 4MH5A 1FBHA 4PFRA 4F39A 2RCAA 4NE4A 3PMXA 2L5VA 2P3VA 1N0TA 3PPPA 3H6VA 5EYFA 3FUZA 5J16A 2UYFA 2ZNTA 2O6AA
chains in the Genus database with same CATH topology
2F36A 2Z8DA 1US5A 4ZE9A 1FTKA 3IAZA 3M3LA 3D4GA 1B7ZA 1R6ZA 4F3GA 4Z7EA 4GL8A 3HPIA 3FATA 3H7MA 4C1UA 2ALUA 2HXWA 5CMKA 1MXVA 2HEUA 5I2KB 2OWSA 3FVNA 4XKNA 5HPQA 4OENA 5I84A 3GXAA 1NNKA 3FGSA 4TLLB 5L8DA 4MBPA 4Q8RA 4GQOA 1B58A 2O51A 1Y4TA 1VE4A 1ZU0A 1MY2A 3G7WA 3HSTA 4H8JA 5CMCA 3QIMA 3H4ZA 5AA4B 2W7YA 3V89B 3IO6A 1IQ7A 2UVHA 4WKMA 2DWAA 4H67A 1JW5A 2OWTA 2O69A 4LATA 1M5CA 4C1TA 2H4IA 3PMWA 4ZECA 1FQFA 3USDA 4GWOA 2FA7A 4LZ5A 4R6HA 4JWYA 3EHUA 4R6KA 1B5HA 1QJMA 1NNFA 2DSFA 2YLNA 2KLFA 5I58A 1MPBA 1Y1ZA 2UXAA 2D3IA 4NF6A 2Q8JA 3U93A 2D5WA 3RTFB 5EHSA 4JSDA 4O3BA 4H5FA 4R2BA 1MQIA 4ZEKA 1B7UA 1EH3A 3N94A 1B0LA 4Q0CA 1MPCA 2F7AA 3KOTA 3SEUA 3QAXA 3GBAA 5I2NA 3ZKKA 1ANFA 3MVYA 3RPWA 1B3HA 3IJOB 4RXLA 2XD3A 2DE4A 2XXXA 2H98A 2Y7KA 5KZTA 3ZKLA 1MDP1 1SYIA 4X48A 3TYHA 3C9HA 2O84X 5IKBA 3G3JA 1JETA 1ATGA 3UK4A 1QUJA 1FCKA 2CMOA 2R71A 1LFIA 2Y7RA 3KJTA 1SW2A 2V3QA 4IO7A 4IY6A 5L9OA 1ZTYA 4QFNA 5ICTA 1IXCA 2RC7A 3VFJA 4KYDA 1JEVA 3GZGA 5I56B 2Y7PA 2I48A 4GVOA 3PV0E 4BDQA 4HCWA 3OELA 2IA4A 2H99A 4IGRA 4N13A 1AIVA 1GVCA 2B3BA 3R26A 1A40A 2ANJA 2ABHA 1DMBA 3FIRA 1P1OA 3U92A 1P1QA 1Z7ME 1EZPA 4QRZA 2V3UA 5CMBA 1I6AA 1OQGA 3IR1A 2Q9TA 4GRKA 3T66A 1NL5A 3KBRA 4F1VA 3K01A 1NNTA 1LCTA 2RF1A 4FORA 1R9LA 5DYHA 1FQCA 5KDTA 1LB8A 4DXCA 1LAFE 3HN0A 1PB7A 2Y7IA 1Y4CA 1ZIUA 3PUVE 5TPAA 1D9VA 1MXXA 2F78A 3Q29A 2QL3A 5CM6A 3FJMA 1R1NA 1BIYA 3T22A 3TQLA 5CMMA 5F1QA 3RNNA 1LAHE 2ONKE 1BP5A 4I8CA 1N76A 3C36A 2F5XA 1LCFA 1DSNA 3G3FA 3CSGA 3CRBA 1LAGE 5I58B 4MLVA 4EQ7A 1R9QA 5FHOA 3HHGA 3CVGA 3M3KA 2HCAA 2XXIA 4WEPA 3U72A 3EQ1A 4QFKA 1N7XA 2IEEA 2VHAA 2X7QA 1MQHA 1B7HA 4C0RA 2PYYA 2HFBA 3TDJA 3VXCA 1NMUA 3I6VA 3VVFA 1B40A 2QS3A 4U23A 4KD5A 4F1YA 1TXFA 3K1PA 3T9VA 5AE4A 2Q89A 3VVEA 2NVUB 5B7DA 5LOMA 5TP9A 1B3LA 2DWIA 3HV1A 2THIA 3MZ9A 2QMXA 3ODBA 1Q35A 1XS5A 4NF5B 2ZNSA 5HM4B 4U22A 2F35A 3K6VA 4OEUA 5AA2D 3THIA 4QSCA 1XVXA 4GFRA 5ISUA 3PD8A 3K4UA 3E9XA 1IXIA 5L9SA 1QULA 3U94A 3G3IA 1IXGA 4FE8A 1B3GA 2BJJX 2RKMA 4F19A 1A99A 3IB0A 4ZEBA 1AL3A 1B3EA 4G68B 2V84A 3MVWA 4PFUA 1B4HA 5HBCA 2ONSA 3IX1A 3IOUA 1YAEA 3EF7A 4KPTA 4EXLA 3TAJA 4PFYA 3IL1B 1UIUA 2REJA 4JXIA 1ZJLA 1SW5A 4M1VA 4RA1A 5BUUA 1T0KA 4ELPA 1ELJA 4KR5A 3DM0A 1Y1MA 4DXBA 3N6TA 1I69A 2XXTA 4POWA 5H8QB 3EN3A 4EUOA 3UORA 1YTVA 2DXYA 3TELA 2HAVA 4UACA 4OETA 3F11A 2XXQA 4ELQA 4NTLA 4FECA 1MM6A 3B6WA 1Y3QA 3OO6A 5K2YA 3K0VA 3RT8A 1MY4A 5KDTB 2ZYNA 4LZ8A 5DEXA 1N7WA 1SQYA 2I49A 2GH9A 5TPAB 1XHYA 5ELVA 3ZS6A 2I6EA 3FVKA 3MPLA 4QFLA 1NH7A 1DTZA 4JDFA 1GGGA 4OFJA 3D4CA 3C34A 3A3CA 3ILTB 1P1WA 4G4PA 3IK6B 1S7YA 5J1DA 4KCCA 4L17A 3W9WA 3KN3A 2XX9A 2DWJA 4R72A 1TFDA 3KJ7A 4DDDA 1NH8A 4GXAA 4ZS9A 3K1NA 5CRYA 4ISUA 1XT8A 5DVFA 3SERA 1D9YA 3MVZA 3I5OA 4QFOA 1POY1 2I0BA 3H6WA 1ZKBA 4YB6A 3G3KA 2DQVA 1S50A 4GIZA 3HHFA 3VE1B 1NFTA 1PBQA 3CSBA 3R7XA 4R6YA 4QFPA 3BBRA 4RPNA 4XKPA 3U1OA 4GD5A 1QKAA 3L6HA 3RUMA 1MXZA 4H6DA 4UA8A 4LQ5A 1MXWA 2G29A 4O3CA 1A8EA 1B6HA 4ZDMA 2XXPA 4YKIA 3JZJA 2XXHA 5TP9B 3V5AA 1FTLA 5TU0A 1CE2A 1OLCA 2DWHA 1YCJA 4RK2A 3O29A 1MQGA 1P99A 3VXBA 1SDXA 1PEBA 3WAEA 3QSLA 3JYRA 4H5GA 2Q88A 3B6TA 4KFQA 1GR2A 3MW0A 1PDAA 3OD7A 3FXUA 3Q25A 4FAJA 2XD2A 3QUJA 4HTGA 3IORA 3TFLA 4G2ZA 4YAHX 2HQ0A 2B3FA 2UVJA 3FVOA 4I62A 3VV5A 1XC1A 1JVYA 4QSEA 3SEWA 4P0GA 1PB8A 1H76A 4MLQA 5H8HA 1HSJA 1JQFA 2HAUA 3OOAA 5I57B 3MC2A 3VDFA 3T9HB 1II5A 3MP1A 4E0WA 3C33A 2HZLA 2XXRA 2QSXA 4WEDA 5FHMA 3FZVA 1MH3A 2VOZA 3FASA 4EDPA 1UQWA 2UVIA 3KGCA 3DP4A 2NWJA 1Y9UA 2F97A 4ND9A 4FEBA 3BKIB 5DTBA 3KSJA 3PUYE 1P1UA 4U4SA 2O1LA 1MQDA 1MPDA 1VR5A 1MG1A 3MJNA 3MP6A 3OENA 5H8FA 2R6GE 3V8XB 1UTHA 4E0XA 2F34A 1URDA 4QSDA 3KN8A 3W9VA 2A5TA 3EHTA 3CFLA 4XKQA 3O6HA 3MQ9A 4ONYA 5AA3A 2GHAA 5H8NA 2FYIA 4FEDA 3CR9A 5DT6A 4THIA 2P2AA 3TZAA 1FQEA 4I1DA 3PMVA 4IO5A 1OVBA 1MY1A 3RTWB 3TTNA 4FJPA 5I59A 3PUZE 3ONMA 4U2RA 3KN7A 3TCFA 3DP6A 1USYH 3PPOA 3IO4A 1UTBA 2LAOA 3IJXB 3RT6B 3QUFA 1IITA 3FV1A 4QHQA 2ZYMA 4GLIA 5AA2A 4JSOA 3TMGA 2PBWA 4F3SA 4H65A 1QKBA 1AOVA 3GLBA 3IOTA 1SW4A 3OMBA 2B65A 1FTJA 1I6BA 1POTA 4RK9A 4X1DA 1MXYA 2Y84A 4PFTA 2O1MA 4OFLA 3O6IA 2E1SA 4NMYA 4BLAA 1WDNA 4DZ1A 1M5FA 1Y3NA 4KQPA 2H9BA 3PGFA 1B52A 2DE3A 1B5IA 1URGA 3LBSA 4YKPA 1GTKA 5K2XA 3O9PA 1S9TA 1TT1A 3PPRA 3OXNA 1F9BA 1O64A 1LSTA 4G8HA 3E13X 2DOJA 1SW1A 2F8DA 3N5LA 1J1NA 1RYXA 2VD3A 4EQBA 4NF6B 1B32A 4OERA 2OLBA 3TODA 4GL0A 3IB2A 1FQAA 3H3GA 2GHBA 3BFUA 1XOCA 4F1UA 4IGTA 3G3HA 4G8NA 2X26A 5I2KA 4Q5TA 4GF8A 4DCYA 3V83A 1B1HA 1Q1KA 4X1BA 2DS9A 5ICQA 4OTEA 4PQJA 1OLAA 3CG1A 2RINA 5FTHA 2V25A 3CG3A 2NOOA 3C32A 3O66A 3FV2A 4IO2A 3FXQA 3FJGA 1EZ9A 1Z7NE 2F6GA 2Z23A 5AA4A 5I2NB 4EF1A 4PP0A 3OO9A 4F31B 2QS1A 4YKKA 2CZLA 2OCUA 2X7PA 3TQWA 5ITOA 1M5DA 3IOVA 1CB6A 3OSQA 3UP9A 2H25A 4R9GA 3T9UA 1B9JA 1B3FA 5BWJA 4OZ9A 1B5JA 1YPNA 4QF9A 4YB5A 3E4RA 2ZMBA 4OHNA 3TTKA 1Y3PA 1MY3A 4O3AA 4XIGQ 5FHNA 3H6UA 2PVUA 1LFHA 1OIBA 4AB6A 5CC2A 2A5TB 4N6PA 2O7UA 3N26A 4F18A 3Q27A 4HW8A 2QPQA 5JK4A 4H1XA 5EHMA 3TTLA 3H03A 3IOWA 1FTMA 1L5TA 4PFWA 4HCYA 2YPNA 1B2HA 2ZYOA 3RY3A 2M8CA 4F3BA 4LZ7A 5AA1A 4X9TA 3H6TA 1N84A 4KYEA 1Y20A 1PC3A 2VGQA 4I9DA 4YKJA 1PB9A 3K6UA 1EU8A 1N3WA 4MFIA 1OQHA 5A5XA 4AB5A 2Z22A 2P0SA 1IUDA 2OJTA 3C4MA 1FQDA 1UTBB 3AXFA 1IEJA 1MDQA 2REGA 4RYAA 1A7LA 5AA2B 4U21A 4ESWA 1B51A 2D21A 4KYSA 5M2VA 2O68A 1DOTA 5KCJA 2DYXA 5DVIA 1HSEA 1H45A 2XXVA 4ZEDA 2F6PA 4LP2B 4OFOA 4JWOA 5I56A 1AMFA 1JEUA 3G3GA 2DVZA 5IAIA 1M5BA 3UA8A 1VFDA 3LR1A 1BTJA 1SD3A 4YB7A 4R9FA 4EXKA 2PT2A 2ESNA 4DE8A 1TFAA 3MVXA 3TKDA 3C35A 4NF4A 3KFMA 3BFTA 3B6QA 4FATA 5H8SA 1LLSA 4YMBA 4N07A 4PE5B 4HS7A 3A09A 1KWHA 3CFXA 1MY0A 3DELB 1B4ZA 4JWXA 3LSFB 4NWCA 4LQ2A 1VFEA 3MUQA 3TCHA 3MBPA 2V3TA 1M5EA 3OSRA 2PMSA 4R2FA 3VLWA 1A8FA 4G68C 3FXRA 3MP8A 2PX1A 3SEVA 2QJEA 3S4UA 3LSXA 4JB7A 4XXUA 4ELOA 3ILUB 5CI5A 4ECFA 4OEVA 1RKMA 3EPEA 4BDOA 3KOSA 3MAMA 2P1SA 2R9JA 4OVJA 3MPKA 4R73A 5DVJA 4LA9A 3JV9A 2RC8A 4YICA 4IB2A 1BLFA 2YJPA 3RLFE 2RC9A 1IIWA 1H44A 3C31A 2XX8A 3MWBA 1MXUA 4TOZA 1JW1A 5ITPA 1QW0A 2H5YA 3QK6A 4KI0E 4F29A 1DPPA 4F2OA 2RCBA 5CBSA 2DE2A 3N6UA 2DVCA 3PD9A 2AL4A 2I58A 3M3FA 1DPEA 1SVXB 2FNCA 1LFGA 1O7TA 3PPQA 3FD3A 3LC8A 4EQ9A 4ZEFA 3K00A 1LB9A 3W15C 4LVQA 1AH5A 4RNSA 4OQOA 1MS7A 4R74A 2GFEA 3TTRA 3O97A 3PUWE 4TQUQ 4RPOA 4NF8A 4ZZEA 1MRPA 4ZE8A 5JTYA 3MZ1A 4BDNA 5CBRA 3QXMA 2O7IA 1US4A 4OYVA 3KG2A 2AYSA 1B1XA 3RGYA 4WXJA 2Z8EA 1BKAA 4NF5A 1VSOA 4POXA 5A5XB 2QS4A 4IO6A 3FVGA 3T93B 3O2AA 1D4NA 4Z0IA 4F2QA 3IB1A 4IY5A 4NWDA 2Q2CA 3UGWA 2QRYA 4AQ4A 3KEIA 5KCJB 3MZBA 4OMBA 1RYOA 4YU0A 4U1ZA 3CIJA 1ZMGA 3TTMA 1WVJA 5DEXB 2QMWA 1LAXA 3L6GA 4G68A 4XTCQ 1N3XA 2WKYA 1LGBC 3K6XA 2OZZA 4OWDA 1IXHA 1GV8A 3TEPA 4GOTA 2ZXTA 4NF4B 4ESXA 1A55A 1FQBA 1P1NA 3GBBA 3Q28A 3HCQA 5L9MA 3QYTA 1USYE 1NNPA 1A54A 1QUIA 3LSLA 3ZSFA 3PU5A 1SI1A 3S9EA 2Z8FA 3RN8A 1ZBMA 3A3UA 2OBGA 3S9LC 3SETA 3H06B 5H8QA 3CFZA 4P11A 4P0IA 2NXOA 4KHZE 4JBZA 5JEIA 2UYEA 4OXVA 3SEXA 3SKPA 2ZNUA 3TUSA 1JNFA 1MH4A 2AIXA 3OO7A 1IZ1A 3SEYA 4DXUA 3S2VA 2A5SA 4RJZA 1SI0A 3E3KA 4DIGA 4IO4A 1URSA 2E0SA 3O6GA 4ELRA 2OK2A 4R75A 3Q26A 3KZGA 1NKXA 3O28A 2I4BA 4PETA 3I3VA 3U8QA 3PUXE 1B05A 4MF3A 4TLMB 1QUKA 1OMPA 1H43A 3S9NC 3M8UA 1O63A 2I3WA 2AL5A 1D3KA 5F7VA 1JVXA 2G93A 4K3FA 1I6QA 4Q30B 4ZEIA 4YMAA 2I3VA 1ZLQA 5FTIA 2GRVA 4DCXA 3SESA 4BDRA 3K6WA 3KSXA 3UIFA 3RQTA 1XVYA 3CI8A 1JW4A 3UN6A 1LBCA 5H8HB 1LBBA 2PT1A 3SDFA 2F7BA 2NUVA 4BDLA 4LONB 4NF8B 1SYHA 3LUYA 5JTYB 2Y7WA 3EHSA 3OEMA 3OO8A 3DP8A 4G8MA 2V93A 4NEDA 1B46A 4H0WA 2UVGA 4IO3A 4U1OA 3T96B 3TPAA 4U4XA 3VVDA 3K02A 1N04A 2XHDA 2I4CA 3VLVA 4OESA 3FJ7A 4G77A 4H8IA 3R6UA 4EF2A 5H8FB 2F7CA 2VD2A 3K1MA 4M4GA 3LSWA 1UTHB 3DLNA 2ONRA 3ECRA 3K2DA 4ZZAA 1TWYA 1MQJA 4BDMA 1WODA 2DP8A 4XKRA 1EZOA 2Q2AA 5H8NB 4GXSB 4YZZA 3HO7A 5I57A 1OVTA 1HSLA 2HZKA 3PPNA 1QVSA 2XXWA 2XX7A 5I59B 4RY1A 4FIMA 2ZYKA 2XXUA 2I0CA 1UIVA 2QS2A 1B0HA 2XXYA 4DLDA 5B70A 4KCDA 1MM7A 1SBPA 4LUBA 4F3PA 3P7IA 3VLUA 1FW0A 3T9XB 1PBPA 1DTGA 3WAFA 3S9MC 2VP1A 1H3DA 1FTOA 3OEKA 3TCGA 2DXRA 4F22A 3B7DA 4MH5A 4F39A 2RCAA 4NE4A 3PMXA 1N0TA 3PPPA 3H6VA 5EYFA 3FUZA 2UYFA 2ZNTA 2O6AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F36 A;  2Z8D A;  1US5 A;  4ZE9 A;  1FTK A;  3IAZ A;  3M3L A;  3D4G A;  1B7Z A;  1R6Z A;  4F3G A;  4Z7E A;  4GL8 A;  3HPI A;  3FAT A;  3H7M A;  4C1U A;  2ALU A;  2HXW A;  5CMK A;  1MXV A;  2HEU A;  5I2K B;  2OWS A;  3FVN A;  4XKN A;  5HPQ A;  4OEN A;  5I84 A;  3GXA A;  1NNK A;  3FGS A;  4TLL B;  5L8D A;  4MBP A;  4Q8R A;  4GQO A;  1B58 A;  2O51 A;  1Y4T A;  1VE4 A;  1ZU0 A;  1MY2 A;  3G7W A;  3HST A;  4H8J A;  5CMC A;  3QIM A;  3H4Z A;  5AA4 B;  2W7Y A;  3V89 B;  3IO6 A;  1IQ7 A;  2UVH A;  4WKM A;  2DWA A;  4H67 A;  1JW5 A;  2OWT A;  2O69 A;  4LAT A;  1M5C A;  4C1T A;  2H4I A;  3PMW A;  4ZEC A;  1FQF A;  3USD A;  4GWO A;  2FA7 A;  4LZ5 A;  4R6H A;  4JWY A;  3EHU A;  4R6K A;  1B5H A;  1QJM A;  1NNF A;  2DSF A;  2YLN A;  2KLF A;  5I58 A;  1MPB A;  1Y1Z A;  2UXA A;  2D3I A;  4NF6 A;  2Q8J A;  3U93 A;  2D5W A;  3RTF B;  5EHS A;  4JSD A;  4O3B A;  4H5F A;  4R2B A;  1MQI A;  4ZEK A;  1B7U A;  1EH3 A;  3N94 A;  1B0L A;  4Q0C A;  1MPC A;  2F7A A;  3KOT A;  3SEU A;  3QAX A;  3GBA A;  5I2N A;  3ZKK A;  1ANF A;  3MVY A;  3RPW A;  1B3H A;  3IJO B;  4RXL A;  2XD3 A;  2DE4 A;  2XXX A;  2H98 A;  2Y7K A;  5KZT A;  3ZKL A;  1MDP 1;  1SYI A;  4X48 A;  3TYH A;  3C9H A;  2O84 X;  5IKB A;  3G3J A;  1JET A;  1ATG A;  3UK4 A;  1QUJ A;  1FCK A;  2CMO A;  2R71 A;  1LFI A;  2Y7R A;  3KJT A;  1SW2 A;  2V3Q A;  4IO7 A;  4IY6 A;  5L9O A;  1ZTY A;  4QFN A;  5ICT A;  1IXC A;  2RC7 A;  3VFJ A;  4KYD A;  1JEV A;  3GZG A;  5I56 B;  2Y7P A;  2I48 A;  4GVO A;  3PV0 E;  4BDQ A;  4HCW A;  3OEL A;  2IA4 A;  2H99 A;  4IGR A;  4N13 A;  1AIV A;  1GVC A;  2B3B A;  3R26 A;  1A40 A;  2ANJ A;  2ABH A;  1DMB A;  3FIR A;  1P1O A;  3U92 A;  1P1Q A;  1Z7M E;  1EZP A;  4QRZ A;  2V3U A;  5CMB A;  1I6A A;  1OQG A;  3IR1 A;  2Q9T A;  4GRK A;  3T66 A;  1NL5 A;  3KBR A;  4F1V A;  3K01 A;  1NNT A;  1LCT A;  2RF1 A;  4FOR A;  1R9L A;  5DYH A;  1FQC A;  5KDT A;  1LB8 A;  4DXC A;  1LAF E;  3HN0 A;  1PB7 A;  2Y7I A;  1Y4C A;  1ZIU A;  3PUV E;  5TPA A;  1D9V A;  1MXX A;  2F78 A;  3Q29 A;  2QL3 A;  5CM6 A;  3FJM A;  1R1N A;  1BIY A;  3T22 A;  3TQL A;  5CMM A;  5F1Q A;  3RNN A;  1LAH E;  2ONK E;  1BP5 A;  4I8C A;  1N76 A;  3C36 A;  2F5X A;  1LCF A;  1DSN A;  3G3F A;  3CSG A;  3CRB A;  1LAG E;  5I58 B;  4MLV A;  4EQ7 A;  1R9Q A;  5FHO A;  3HHG A;  3CVG A;  3M3K A;  2HCA A;  2XXI A;  4WEP A;  3U72 A;  3EQ1 A;  4QFK A;  1N7X A;  2IEE A;  2VHA A;  2X7Q A;  1MQH A;  1B7H A;  4C0R A;  2PYY A;  2HFB A;  3TDJ A;  3VXC A;  1NMU A;  3I6V A;  3VVF A;  1B40 A;  2QS3 A;  4U23 A;  4KD5 A;  4F1Y A;  1TXF A;  3K1P A;  3T9V A;  5AE4 A;  2Q89 A;  3VVE A;  2NVU B;  5B7D A;  5LOM A;  5TP9 A;  1B3L A;  2DWI A;  3HV1 A;  2THI A;  3MZ9 A;  2QMX A;  3ODB A;  1Q35 A;  1XS5 A;  4NF5 B;  2ZNS A;  5HM4 B;  4U22 A;  2F35 A;  3K6V A;  4OEU A;  5AA2 D;  3THI A;  4QSC A;  1XVX A;  4GFR A;  5ISU A;  3PD8 A;  3K4U A;  3E9X A;  1IXI A;  5L9S A;  1QUL A;  3U94 A;  3G3I A;  1IXG A;  4FE8 A;  1B3G A;  2BJJ X;  2RKM A;  4F19 A;  1A99 A;  3IB0 A;  4ZEB A;  1AL3 A;  1B3E A;  4G68 B;  2V84 A;  3MVW A;  4PFU A;  1B4H A;  5HBC A;  2ONS A;  3IX1 A;  3IOU A;  1YAE A;  3EF7 A;  4KPT A;  4EXL A;  3TAJ A;  4PFY A;  3IL1 B;  1UIU A;  2REJ A;  4JXI A;  1ZJL A;  1SW5 A;  4M1V A;  4RA1 A;  5BUU A;  1T0K A;  4ELP A;  1ELJ A;  4KR5 A;  3DM0 A;  1Y1M A;  4DXB A;  3N6T A;  1I69 A;  2XXT A;  4POW A;  5H8Q B;  3EN3 A;  4EUO A;  3UOR A;  1YTV A;  2DXY A;  3TEL A;  2HAV A;  4UAC A;  4OET A;  3F11 A;  2XXQ A;  4ELQ A;  4NTL A;  4FEC A;  1MM6 A;  3B6W A;  1Y3Q A;  3OO6 A;  5K2Y A;  3K0V A;  3RT8 A;  1MY4 A;  5KDT B;  2ZYN A;  4LZ8 A;  5DEX A;  1N7W A;  1SQY A;  2I49 A;  2GH9 A;  5TPA B;  1XHY A;  5ELV A;  3ZS6 A;  2I6E A;  3FVK A;  3MPL A;  4QFL A;  1NH7 A;  1DTZ A;  4JDF A;  1GGG A;  4OFJ A;  3D4C A;  3C34 A;  3A3C A;  3ILT B;  1P1W A;  4G4P A;  3IK6 B;  1S7Y A;  5J1D A;  4KCC A;  4L17 A;  3W9W A;  3KN3 A;  2XX9 A;  2DWJ A;  4R72 A;  1TFD A;  3KJ7 A;  4DDD A;  1NH8 A;  4GXA A;  4ZS9 A;  3K1N A;  5CRY A;  4ISU A;  1XT8 A;  5DVF A;  3SER A;  1D9Y A;  3MVZ A;  3I5O A;  4QFO A;  1POY 1;  2I0B A;  3H6W A;  1ZKB A;  4YB6 A;  3G3K A;  2DQV A;  1S50 A;  4GIZ A;  3HHF A;  3VE1 B;  1NFT A;  1PBQ A;  3CSB A;  3R7X A;  4R6Y A;  4QFP A;  3BBR A;  4RPN A;  4XKP A;  3U1O A;  4GD5 A;  1QKA A;  3L6H A;  3RUM A;  1MXZ A;  4H6D A;  4UA8 A;  4LQ5 A;  1MXW A;  2G29 A;  4O3C A;  1A8E A;  1B6H A;  4ZDM A;  2XXP A;  4YKI A;  3JZJ A;  2XXH A;  5TP9 B;  3V5A A;  1FTL A;  5TU0 A;  1CE2 A;  1OLC A;  2DWH A;  1YCJ A;  4RK2 A;  3O29 A;  1MQG A;  1P99 A;  3VXB A;  1SDX A;  1PEB A;  3WAE A;  3QSL A;  3JYR A;  4H5G A;  2Q88 A;  3B6T A;  4KFQ A;  1GR2 A;  3MW0 A;  1PDA A;  3OD7 A;  3FXU A;  3Q25 A;  4FAJ A;  2XD2 A;  3QUJ A;  4HTG A;  3IOR A;  3TFL A;  4G2Z A;  4YAH X;  2HQ0 A;  2B3F A;  2UVJ A;  3FVO A;  4I62 A;  3VV5 A;  1XC1 A;  1JVY A;  4QSE A;  3SEW A;  4P0G A;  1PB8 A;  1H76 A;  4MLQ A;  5H8H A;  1HSJ A;  1JQF A;  2HAU A;  3OOA A;  5I57 B;  3MC2 A;  3VDF A;  3T9H B;  1II5 A;  3MP1 A;  4E0W A;  3C33 A;  2HZL A;  2XXR A;  2QSX A;  4WED A;  5FHM A;  3FZV A;  1MH3 A;  2VOZ A;  3FAS A;  4EDP A;  1UQW A;  2UVI A;  3KGC A;  3DP4 A;  2NWJ A;  1Y9U A;  2F97 A;  4ND9 A;  4FEB A;  3BKI B;  5DTB A;  3KSJ A;  3PUY E;  1P1U A;  4U4S A;  2O1L A;  1MQD A;  1MPD A;  1VR5 A;  1MG1 A;  3MJN A;  3MP6 A;  3OEN A;  5H8F A;  2R6G E;  3V8X B;  1UTH A;  4E0X A;  2F34 A;  1URD A;  4QSD A;  3KN8 A;  3W9V A;  2A5T A;  3EHT A;  3CFL A;  4XKQ A;  3O6H A;  3MQ9 A;  4ONY A;  5AA3 A;  2GHA A;  5H8N A;  2FYI A;  4FED A;  3CR9 A;  5DT6 A;  4THI A;  2P2A A;  3TZA A;  1FQE A;  4I1D A;  3PMV A;  4IO5 A;  1OVB A;  1MY1 A;  3RTW B;  3TTN A;  4FJP A;  5I59 A;  3PUZ E;  3ONM A;  4U2R A;  3KN7 A;  3TCF A;  3DP6 A;  1USY H;  3PPO A;  3IO4 A;  1UTB A;  2LAO A;  3IJX B;  3RT6 B;  3QUF A;  1IIT A;  3FV1 A;  4QHQ A;  2ZYM A;  4GLI A;  5AA2 A;  4JSO A;  3TMG A;  2PBW A;  4F3S A;  4H65 A;  1QKB A;  1AOV A;  3GLB A;  3IOT A;  1SW4 A;  3OMB A;  2B65 A;  1FTJ A;  1I6B A;  1POT A;  4RK9 A;  4X1D A;  1MXY A;  2Y84 A;  4PFT A;  2O1M A;  4OFL A;  3O6I A;  2E1S A;  4NMY A;  4BLA A;  1WDN A;  4DZ1 A;  1M5F A;  1Y3N A;  4KQP A;  2H9B A;  3PGF A;  1B52 A;  2DE3 A;  1B5I A;  1URG A;  3LBS A;  4YKP A;  1GTK A;  5K2X A;  3O9P A;  1S9T A;  1TT1 A;  3PPR A;  3OXN A;  1F9B A;  1O64 A;  1LST A;  4G8H A;  3E13 X;  2DOJ A;  1SW1 A;  2F8D A;  3N5L A;  1J1N A;  1RYX A;  2VD3 A;  4EQB A;  4NF6 B;  1B32 A;  4OER A;  2OLB A;  3TOD A;  4GL0 A;  3IB2 A;  1FQA A;  3H3G A;  2GHB A;  3BFU A;  1XOC A;  4F1U A;  4IGT A;  3G3H A;  4G8N A;  2X26 A;  5I2K A;  4Q5T A;  4GF8 A;  4DCY A;  3V83 A;  1B1H A;  1Q1K A;  4X1B A;  2DS9 A;  5ICQ A;  4OTE A;  4PQJ A;  1OLA A;  3CG1 A;  2RIN A;  5FTH A;  2V25 A;  3CG3 A;  2NOO A;  3C32 A;  3O66 A;  3FV2 A;  4IO2 A;  3FXQ A;  3FJG A;  1EZ9 A;  1Z7N E;  2F6G A;  2Z23 A;  5AA4 A;  5I2N B;  4EF1 A;  4PP0 A;  3OO9 A;  4F31 B;  2QS1 A;  4YKK A;  2CZL A;  2OCU A;  2X7P A;  3TQW A;  5ITO A;  1M5D A;  3IOV A;  1CB6 A;  3OSQ A;  3UP9 A;  2H25 A;  4R9G A;  3T9U A;  1B9J A;  1B3F A;  5BWJ A;  4OZ9 A;  1B5J A;  1YPN A;  4QF9 A;  4YB5 A;  3E4R A;  2ZMB A;  4OHN A;  3TTK A;  1Y3P A;  1MY3 A;  4O3A A;  4XIG Q;  5FHN A;  3H6U A;  2PVU A;  1LFH A;  1OIB A;  4AB6 A;  5CC2 A;  2A5T B;  4N6P A;  2O7U A;  3N26 A;  4F18 A;  3Q27 A;  4HW8 A;  2QPQ A;  5JK4 A;  4H1X A;  5EHM A;  3TTL A;  3H03 A;  3IOW A;  1FTM A;  1L5T A;  4PFW A;  4HCY A;  2YPN A;  1B2H A;  2ZYO A;  3RY3 A;  2M8C A;  4F3B A;  4LZ7 A;  5AA1 A;  4X9T A;  3H6T A;  1N84 A;  4KYE A;  1Y20 A;  1PC3 A;  2VGQ A;  4I9D A;  4YKJ A;  1PB9 A;  3K6U A;  1EU8 A;  1N3W A;  4MFI A;  1OQH A;  5A5X A;  4AB5 A;  2Z22 A;  2P0S A;  1IUD A;  2OJT A;  3C4M A;  1FQD A;  1UTB B;  3AXF A;  1IEJ A;  1MDQ A;  2REG A;  4RYA A;  1A7L A;  5AA2 B;  4U21 A;  4ESW A;  1B51 A;  2D21 A;  4KYS A;  5M2V A;  2O68 A;  1DOT A;  5KCJ A;  2DYX A;  5DVI A;  1HSE A;  1H45 A;  2XXV A;  4ZED A;  2F6P A;  4LP2 B;  4OFO A;  4JWO A;  5I56 A;  1AMF A;  1JEU A;  3G3G A;  2DVZ A;  5IAI A;  1M5B A;  3UA8 A;  1VFD A;  3LR1 A;  1BTJ A;  1SD3 A;  4YB7 A;  4R9F A;  4EXK A;  2PT2 A;  2ESN A;  4DE8 A;  1TFA A;  3MVX A;  3TKD A;  3C35 A;  4NF4 A;  3KFM A;  3BFT A;  3B6Q A;  4FAT A;  5H8S A;  1LLS A;  4YMB A;  4N07 A;  4PE5 B;  4HS7 A;  3A09 A;  1KWH A;  3CFX A;  1MY0 A;  3DEL B;  1B4Z A;  4JWX A;  3LSF B;  4NWC A;  4LQ2 A;  1VFE A;  3MUQ A;  3TCH A;  3MBP A;  2V3T A;  1M5E A;  3OSR A;  2PMS A;  4R2F A;  3VLW A;  1A8F A;  4G68 C;  3FXR A;  3MP8 A;  2PX1 A;  3SEV A;  2QJE A;  3S4U A;  3LSX A;  4JB7 A;  4XXU A;  4ELO A;  3ILU B;  5CI5 A;  4ECF A;  4OEV A;  1RKM A;  3EPE A;  4BDO A;  3KOS A;  3MAM A;  2P1S A;  2R9J A;  4OVJ A;  3MPK A;  4R73 A;  5DVJ A;  4LA9 A;  3JV9 A;  2RC8 A;  4YIC A;  4IB2 A;  1BLF A;  2YJP A;  3RLF E;  2RC9 A;  1IIW A;  1H44 A;  3C31 A;  2XX8 A;  3MWB A;  1MXU A;  4TOZ A;  1JW1 A;  5ITP A;  1QW0 A;  2H5Y A;  3QK6 A;  4KI0 E;  4F29 A;  1DPP A;  4F2O A;  2RCB A;  5CBS A;  2DE2 A;  3N6U A;  2DVC A;  3PD9 A;  2AL4 A;  2I58 A;  3M3F A;  1DPE A;  1SVX B;  2FNC A;  1LFG A;  1O7T A;  3PPQ A;  3FD3 A;  3LC8 A;  4EQ9 A;  4ZEF A;  3K00 A;  1LB9 A;  3W15 C;  4LVQ A;  1AH5 A;  4RNS A;  4OQO A;  1MS7 A;  4R74 A;  2GFE A;  3TTR A;  3O97 A;  3PUW E;  4TQU Q;  4RPO A;  4NF8 A;  4ZZE A;  1MRP A;  4ZE8 A;  5JTY A;  3MZ1 A;  4BDN A;  5CBR A;  3QXM A;  2O7I A;  1US4 A;  4OYV A;  3KG2 A;  2AYS A;  1B1X A;  3RGY A;  4WXJ A;  2Z8E A;  1BKA A;  4NF5 A;  1VSO A;  4POX A;  5A5X B;  2QS4 A;  4IO6 A;  3FVG A;  3T93 B;  3O2A A;  1D4N A;  4Z0I A;  4F2Q A;  3IB1 A;  4IY5 A;  4NWD A;  2Q2C A;  3UGW A;  2QRY A;  4AQ4 A;  3KEI A;  5KCJ B;  3MZB A;  4OMB A;  1RYO A;  4YU0 A;  4U1Z A;  3CIJ A;  1ZMG A;  3TTM A;  1WVJ A;  5DEX B;  2QMW A;  1LAX A;  3L6G A;  4G68 A;  4XTC Q;  1N3X A;  2WKY A;  1LGB C;  3K6X A;  2OZZ A;  4OWD A;  1IXH A;  1GV8 A;  3TEP A;  4GOT A;  2ZXT A;  4NF4 B;  4ESX A;  1A55 A;  1FQB A;  1P1N A;  3GBB A;  3Q28 A;  3HCQ A;  5L9M A;  3QYT A;  1USY E;  1NNP A;  1A54 A;  1QUI A;  3LSL A;  3ZSF A;  3PU5 A;  1SI1 A;  3S9E A;  2Z8F A;  3RN8 A;  1ZBM A;  3A3U A;  2OBG A;  3S9L C;  3SET A;  3H06 B;  5H8Q A;  3CFZ A;  4P11 A;  4P0I A;  2NXO A;  4KHZ E;  4JBZ A;  5JEI A;  2UYE A;  4OXV A;  3SEX A;  3SKP A;  2ZNU A;  3TUS A;  1JNF A;  1MH4 A;  2AIX A;  3OO7 A;  1IZ1 A;  3SEY A;  4DXU A;  3S2V A;  2A5S A;  4RJZ A;  1SI0 A;  3E3K A;  4DIG A;  4IO4 A;  1URS A;  2E0S A;  3O6G A;  4ELR A;  2OK2 A;  4R75 A;  3Q26 A;  3KZG A;  1NKX A;  3O28 A;  2I4B A;  4PET A;  3I3V A;  3U8Q A;  3PUX E;  1B05 A;  4MF3 A;  4TLM B;  1QUK A;  1OMP A;  1H43 A;  3S9N C;  3M8U A;  1O63 A;  2I3W A;  2AL5 A;  1D3K A;  5F7V A;  1JVX A;  2G93 A;  4K3F A;  1I6Q A;  4Q30 B;  4ZEI A;  4YMA A;  2I3V A;  1ZLQ A;  5FTI A;  2GRV A;  4DCX A;  3SES A;  4BDR A;  3K6W A;  3KSX A;  3UIF A;  3RQT A;  1XVY A;  3CI8 A;  1JW4 A;  3UN6 A;  1LBC A;  5H8H B;  1LBB A;  2PT1 A;  3SDF A;  2F7B A;  2NUV A;  4BDL A;  4LON B;  4NF8 B;  1SYH A;  3LUY A;  5JTY B;  2Y7W A;  3EHS A;  3OEM A;  3OO8 A;  3DP8 A;  4G8M A;  2V93 A;  4NED A;  1B46 A;  4H0W A;  2UVG A;  4IO3 A;  4U1O A;  3T96 B;  3TPA A;  4U4X A;  3VVD A;  3K02 A;  1N04 A;  2XHD A;  2I4C A;  3VLV A;  4OES A;  3FJ7 A;  4G77 A;  4H8I A;  3R6U A;  4EF2 A;  5H8F B;  2F7C A;  2VD2 A;  3K1M A;  4M4G A;  3LSW A;  1UTH B;  3DLN A;  2ONR A;  3ECR A;  3K2D A;  4ZZA A;  1TWY A;  1MQJ A;  4BDM A;  1WOD A;  2DP8 A;  4XKR A;  1EZO A;  2Q2A A;  5H8N B;  4GXS B;  4YZZ A;  3HO7 A;  5I57 A;  1OVT A;  1HSL A;  2HZK A;  3PPN A;  1QVS A;  2XXW A;  2XX7 A;  5I59 B;  4RY1 A;  4FIM A;  2ZYK A;  2XXU A;  2I0C A;  1UIV A;  2QS2 A;  1B0H A;  2XXY A;  4DLD A;  5B70 A;  4KCD A;  1MM7 A;  1SBP A;  4LUB A;  4F3P A;  3P7I A;  3VLU A;  1FW0 A;  3T9X B;  1PBP A;  1DTG A;  3WAF A;  3S9M C;  2VP1 A;  1H3D A;  1FTO A;  3OEK A;  3TCG A;  2DXR A;  4F22 A;  3B7D A;  4MH5 A;  4F39 A;  2RCA A;  4NE4 A;  3PMX A;  1N0T A;  3PPP A;  3H6V A;  5EYF A;  3FUZ A;  2UYF A;  2ZNT A;  2O6A A; 
#chains in the Genus database with same CATH topology
 2F36 A;  2Z8D A;  1US5 A;  4ZE9 A;  1FTK A;  3IAZ A;  3M3L A;  2R8T A;  3D4G A;  1B7Z A;  1R6Z A;  4F3G A;  4Z7E A;  1SPI A;  4GL8 A;  3HPI A;  3FAT A;  3H7M A;  1EYJ A;  4C1U A;  2ALU A;  4GWU A;  2HXW A;  4N6D A;  3KC0 A;  5CMK A;  1MXV A;  2HEU A;  5I2K B;  2OWS A;  3FVN A;  4XKN A;  5HPQ A;  1FRP A;  3QMF A;  4OEN A;  5I84 A;  4PCD A;  3GXA A;  1NNK A;  3FGS A;  4TLL B;  5L8D A;  4MBP A;  4Q8R A;  4GQO A;  1B58 A;  2O51 A;  2ZZV A;  1Y4T A;  1VE4 A;  1FPJ A;  1ZU0 A;  1MY2 A;  3G7W A;  4MNP A;  3HST A;  4H8J A;  5CMC A;  3QIM A;  1NV2 A;  3H4Z A;  5AA4 B;  4PC9 A;  2W7Y A;  3V89 B;  3IO6 A;  1IQ7 A;  2UVH A;  4WKM A;  2DWA A;  4H67 A;  1JW5 A;  2OWT A;  2O69 A;  4LAT A;  1M5C A;  4C1T A;  2H4I A;  3PMW A;  4ZEC A;  1FQF A;  3USD A;  4PDD A;  4GWO A;  2FA7 A;  1FPF A;  4LZ5 A;  4R6H A;  4JWY A;  3EHU A;  4R6K A;  1B5H A;  1QJM A;  1NNF A;  2DSF A;  2YLN A;  4MIJ A;  2KLF A;  5I58 A;  1MPB A;  1Y1Z A;  1NI9 A;  2UXA A;  2D3I A;  4NF6 A;  1AWB A;  2Q8J A;  3U93 A;  4PAF A;  2D5W A;  3RTF B;  5EHS A;  4JSD A;  4O3B A;  4P47 A;  4H5F A;  4QXD A;  4R2B A;  1MQI A;  4ZEK A;  1B7U A;  1EH3 A;  2V4C A;  3N94 A;  1B0L A;  4Q0C A;  1MPC A;  2F7A A;  3KOT A;  3SEU A;  3QAX A;  3GBA A;  5I2N A;  3ZKK A;  1ANF A;  3MVY A;  3RPW A;  1B3H A;  3IJO B;  4MMP A;  4RXL A;  2XD3 A;  2DE4 A;  2XXX A;  2H98 A;  2WBB A;  3U65 A;  2Y7K A;  5KZT A;  3ZKL A;  5A5L A;  2OWZ A;  4G61 A;  2B4L A;  4LN5 A;  1MDP 1;  1NV6 A;  1SYI A;  4X48 A;  3TYH A;  3C9H A;  2O84 X;  4P56 A;  4P1E A;  5IKB A;  5EYG A;  2FBP A;  3G3J A;  1JET A;  5EQA A;  1ATG A;  3UK4 A;  1QUJ A;  1FCK A;  2CMO A;  2R71 A;  2ZZX A;  1LFI A;  2Y7R A;  3KJT A;  1SW2 A;  1VDW A;  2V3Q A;  4IO7 A;  1INP A;  1FBP A;  2WX9 A;  4IY6 A;  4GBW A;  5L9O A;  1ZTY A;  4QFN A;  5ICT A;  1IXC A;  2RC7 A;  3VFJ A;  4KYD A;  1JEV A;  3GZG A;  5I56 B;  2Y7P A;  2I48 A;  4GVO A;  3PV0 E;  4BDQ A;  4HCW A;  3OEL A;  2IA4 A;  2H99 A;  2CEX A;  4IGR A;  4N13 A;  1AIV A;  1NV0 A;  1GVC A;  1IMF A;  2B3B A;  3R26 A;  1A40 A;  2ANJ A;  2ABH A;  1DMB A;  3FIR A;  1IMC A;  1CNQ A;  1P1O A;  3U92 A;  1P1Q A;  1RDZ A;  1Z7M E;  4DI4 B;  1EZP A;  4QRZ A;  2V3U A;  4KXP A;  1RDX A;  2HPG A;  5CMB A;  3PTY A;  4PTK A;  1I6A A;  4GWZ A;  1OQG A;  3IR1 A;  5ESY A;  2Q9T A;  4GRK A;  3T66 A;  1NL5 A;  3KBR A;  4F1V A;  1LBY A;  3CHG A;  3K01 A;  1NNT A;  4MEV A;  1LCT A;  2RF1 A;  4FOR A;  1R9L A;  2FVZ A;  5DYH A;  1FQC A;  4GX3 A;  1LB8 A;  5KDT A;  2KR0 A;  4DXC A;  5T3J A;  1LAF E;  3HN0 A;  1NV3 A;  1PB7 A;  2Y7I A;  1Y4C A;  1ZIU A;  3PUV E;  5TPA A;  1D9V A;  1MXX A;  1FBC A;  2F78 A;  3Q29 A;  1KZ8 A;  5IZ3 B;  2QL3 A;  5CM6 A;  3FJM A;  1R1N A;  5FBP A;  1BIY A;  3T22 A;  3TQL A;  5CMM A;  5F1Q A;  3RNN A;  1LAH E;  4JVD A;  2ONK E;  1BP5 A;  4I8C A;  1N76 A;  4MNI A;  3C36 A;  2F5X A;  1LCF A;  1K9Y A;  1DSN A;  3G3F A;  3CSG A;  1LBV A;  3CRB A;  5EQ8 A;  4I40 A;  1LAG E;  5I58 B;  4MLV A;  4NN3 A;  4EQ7 A;  1R9Q A;  5FHO A;  3HHG A;  3CVG A;  3M3K A;  2HCA A;  2XXI A;  4WEP A;  3U72 A;  3EQ1 A;  4QFK A;  4H46 A;  1NUY A;  1N7X A;  2IEE A;  2VHA A;  2X7Q A;  1MQH A;  1B7H A;  4XEQ A;  4C0R A;  1LBX A;  2PYY A;  2HFB A;  3TDJ A;  3VXC A;  1NV7 A;  4NX1 A;  1DCU A;  1NMU A;  3I6V A;  1BK4 A;  1FPK A;  2CZI A;  3VVF A;  1B40 A;  2QS3 A;  4U23 A;  4KD5 A;  4F1Y A;  4PGP A;  1TXF A;  3K1P A;  3T9V A;  5AE4 A;  2Q89 A;  3VVE A;  2NVU B;  4DI3 D;  5B7D A;  5LOM A;  5TP9 A;  1B3L A;  2DWI A;  4NAP A;  3HV1 A;  2THI A;  4MAG A;  3MZ9 A;  2QMX A;  3ODB A;  1Q35 A;  1XS5 A;  4NF5 B;  2ZNS A;  5HM4 B;  4U22 A;  2F35 A;  3K6V A;  4OEU A;  5AA2 D;  3THI A;  4QSC A;  1XVX A;  4GFR A;  5ISU A;  4X04 A;  3PD8 A;  4N91 A;  3K4U A;  3E9X A;  1IXI A;  5L9S A;  1QUL A;  4PAI A;  3U94 A;  3G3I A;  1IXG A;  2XWI A;  4FE8 A;  1B3G A;  4X8R A;  5EQ7 A;  2BJJ X;  2RKM A;  3NOH A;  4F19 A;  1A99 A;  2CZK A;  3IB0 A;  4ZEB A;  1AL3 A;  1B3E A;  4G68 B;  3A29 A;  2V84 A;  3MVW A;  4PFU A;  1B4H A;  5HBC A;  2ONS A;  3IX1 A;  3IOU A;  1YAE A;  3EF7 A;  4KPT A;  4EXL A;  3TAJ A;  4PFY A;  3IL1 B;  1UIU A;  2REJ A;  4JXI A;  1ZJL A;  1FPB A;  1SW5 A;  4M1V A;  2QVR A;  5ET6 A;  4RA1 A;  5BUU A;  1T0K A;  4ELP A;  1ELJ A;  4KR5 A;  3DM0 A;  1Y1M A;  5EYH A;  4DXB A;  3N6T A;  4P1L A;  1I69 A;  2XXT A;  4O8M A;  4POW A;  5H8Q B;  3T1B A;  3EN3 A;  4EUO A;  4OVT A;  3UOR A;  1YTV A;  2DXY A;  3TEL A;  2HAV A;  4UAC A;  2JJK A;  4UAB A;  4OET A;  3F11 A;  2XXQ A;  4ELQ A;  4NTL A;  4FEC A;  4XF5 A;  1MM6 A;  3B6W A;  1Y3Q A;  3OO6 A;  5K2Y A;  3K0V A;  3RT8 A;  1MY4 A;  3IFC A;  5KDT B;  2ZYN A;  4LZ8 A;  4OVR A;  4N6K A;  5DEX A;  1N7W A;  1SQY A;  2I49 A;  2GH9 A;  5TPA B;  1XHY A;  5ELV A;  3ZS6 A;  4N15 A;  2I6E A;  3FVK A;  3MPL A;  4QFL A;  4HE2 A;  1NH7 A;  1IMA A;  1DTZ A;  4JDF A;  4OAN A;  1GGG A;  4OFJ A;  3D4C A;  3C34 A;  3A3C A;  3ILT B;  1P1W A;  3RYD A;  4G4P A;  3IK6 B;  1S7Y A;  5J1D A;  4KCC A;  4L17 A;  3W9W A;  1FBF A;  5I3S A;  3KN3 A;  2XX9 A;  2DWJ A;  4R72 A;  1TFD A;  3KJ7 A;  4DDD A;  1NH8 A;  4GXA A;  4ZS9 A;  3K1N A;  5CRY A;  4ISU A;  1XT8 A;  5DVF A;  3SER A;  1D9Y A;  1G0H A;  3MVZ A;  4OVP A;  3I5O A;  4QFO A;  1POY 1;  2I0B A;  3H6W A;  1ZKB A;  4YB6 A;  1FBE A;  3G3K A;  2DQV A;  1S50 A;  2FHY A;  4GIZ A;  3HHF A;  3VE1 B;  1NFT A;  1PBQ A;  3CSB A;  3R7X A;  4R6Y A;  4QFP A;  3BBR A;  4RPN A;  4XKP A;  3U1O A;  4GD5 A;  1QKA A;  3L6H A;  3RUM A;  4AS5 A;  1MXZ A;  4H6D A;  1NV1 A;  4UA8 A;  4LQ5 A;  1MXW A;  2G29 A;  4O3C A;  1A8E A;  1B6H A;  4ZDM A;  2XXP A;  4YKI A;  3JZJ A;  1NUX A;  2DDK A;  2XXH A;  2BJI A;  5TP9 B;  3V5A A;  1FTL A;  5TU0 A;  1CE2 A;  4N81 A;  1OLC A;  2DWH A;  1YCJ A;  4RK2 A;  3O29 A;  1MQG A;  1P99 A;  3VXB A;  1SDX A;  1PEB A;  3WAE A;  3QSL A;  3JYR A;  4H5G A;  2Q88 A;  3B6T A;  4KFQ A;  1YZ0 A;  1GR2 A;  3MW0 A;  1PDA A;  3OD7 A;  3FXU A;  3Q25 A;  4FAJ A;  2XD2 A;  3QUJ A;  4HTG A;  3IOR A;  4GX6 A;  3TFL A;  4G2Z A;  1QGX A;  4YAH X;  2HQ0 A;  2B3F A;  3T0J A;  2UVJ A;  3FVO A;  4I62 A;  3VV5 A;  1FJ6 A;  1XC1 A;  1JVY A;  4QSE A;  3SEW A;  4P0G A;  1PB8 A;  1H76 A;  4MLQ A;  5H8H A;  1HSJ A;  1JQF A;  2HAU A;  1EYK A;  3OOA A;  5I57 B;  3MC2 A;  3VDF A;  3T9H B;  1II5 A;  3MP1 A;  4E0W A;  3C33 A;  2HZL A;  2XXR A;  2QSX A;  4WED A;  1NUW A;  5FHM A;  3FZV A;  1MH3 A;  2VOZ A;  3FAS A;  4EDP A;  1UQW A;  2UVI A;  3KGC A;  3DP4 A;  2NWJ A;  1Y9U A;  2F97 A;  4ND9 A;  4FEB A;  2PFY A;  3BKI B;  5DTB A;  3KSJ A;  3PUY E;  1P1U A;  4U4S A;  2O1L A;  1MQD A;  1MPD A;  1VR5 A;  1MG1 A;  3MJN A;  3MP6 A;  3OEN A;  5H8F A;  5F24 A;  2R6G E;  3V8X B;  1UTH A;  4FBP A;  4E0X A;  2F34 A;  1URD A;  4O7I A;  4QSD A;  2QFL A;  3KN8 A;  1G0I A;  3W9V A;  2A5T A;  3EHT A;  3CFL A;  4XKQ A;  3O6H A;  3B50 A;  3MQ9 A;  4ONY A;  5AA3 A;  2GHA A;  5ET5 A;  5H8N A;  2FYI A;  4FED A;  3CR9 A;  5DT6 A;  4THI A;  2P2A A;  2Y5L A;  4O94 A;  3SZP A;  3TZA A;  1FQE A;  4I1D A;  3PMV A;  4IO5 A;  2XWV A;  1OVB A;  1MY1 A;  5I7I A;  1JP4 A;  3RTW B;  3TTN A;  2HXR A;  4FJP A;  5I59 A;  3PUZ E;  3ONM A;  4U2R A;  3KN7 A;  3TCF A;  3DP6 A;  1USY H;  3PPO A;  3IO4 A;  5ET8 A;  5LDZ A;  1UTB A;  2LAO A;  3IJX B;  3RT6 B;  3QUF A;  1IIT A;  1FJ9 A;  2CEY A;  3FV1 A;  4QHQ A;  2ZYM A;  4GLI A;  5AA2 A;  4JSO A;  4I3E A;  3TMG A;  2PBW A;  5I5P A;  4F3S A;  4H65 A;  1QKB A;  3RPL A;  1AOV A;  3GLB A;  3IOT A;  1SW4 A;  3OMB A;  2B65 A;  1FTJ A;  1I6B A;  1POT A;  4RK9 A;  4X1D A;  2PCR A;  4JVI A;  1MXY A;  2Y84 A;  3KC1 A;  4PFT A;  2MKZ A;  2O1M A;  4OFL A;  1LBW A;  3O6I A;  2E1S A;  4NMY A;  4BLA A;  1WDN A;  3FXB A;  4DZ1 A;  1M5F A;  1Y3N A;  4KQP A;  2H9B A;  4PBQ A;  3PGF A;  1B52 A;  2DE3 A;  1B5I A;  1URG A;  3LBS A;  4YKP A;  1GTK A;  5K2X A;  2VT5 A;  3O9P A;  1S9T A;  1TT1 A;  3PPR A;  3OXN A;  3BIH A;  1F9B A;  1O64 A;  1LST A;  4G8H A;  3E13 X;  2DOJ A;  1SW1 A;  2F8D A;  3N5L A;  1J1N A;  2Y5K A;  1RYX A;  2VD3 A;  4EQB A;  4JVC A;  4NF6 B;  1B32 A;  4GWY A;  4OER A;  2OLB A;  3TOD A;  4GL0 A;  3IB2 A;  4PF6 A;  1FQA A;  3H3G A;  2GHB A;  1FBG A;  3BFU A;  1XOC A;  4F1U A;  4IGT A;  3G3H A;  4G8N A;  2X26 A;  5I2K A;  4Q5T A;  4GF8 A;  4DCY A;  3ISP A;  3V83 A;  1B1H A;  1Q1K A;  4X1B A;  2DS9 A;  5ICQ A;  4OTE A;  4PQJ A;  1OLA A;  3CG1 A;  2RIN A;  5FTH A;  2V25 A;  3CG3 A;  2NOO A;  3C32 A;  5IZZ A;  2FIX A;  3O66 A;  3FV2 A;  4IO2 A;  3FXQ A;  3FJG A;  1EZ9 A;  1Z7N E;  2F6G A;  2Z23 A;  5AA4 A;  5I2N B;  4EF1 A;  4PP0 A;  3OO9 A;  4F31 B;  2QS1 A;  4YKK A;  2CZL A;  2OCU A;  2X7P A;  3TQW A;  5ITO A;  4PF8 A;  1M5D A;  3IOV A;  4PE3 A;  1CB6 A;  3OSQ A;  3UP9 A;  2H25 A;  4R9G A;  3T9U A;  1B9J A;  1B3F A;  5BWJ A;  4OZ9 A;  1B5J A;  1YPN A;  4QF9 A;  4YB5 A;  3E4R A;  2PFZ A;  1NUZ A;  2ZMB A;  4OHN A;  3TTK A;  1Y3P A;  4GX4 A;  1MY3 A;  4O3A A;  4XIG Q;  5FHN A;  1KA0 A;  3H6U A;  2PVU A;  1LFH A;  1OIB A;  3ROJ A;  4AB6 A;  1FBD A;  5CC2 A;  2A5T B;  1D9Q A;  4PAK A;  4N6P A;  2O7U A;  3N26 A;  4F18 A;  3Q27 A;  4HW8 A;  2QPQ A;  5JK4 A;  4MX6 A;  4H1X A;  1IMB A;  5EHM A;  2XWK A;  3TTL A;  3H03 A;  3IOW A;  1FTM A;  4OVS A;  1L5T A;  4PFW A;  4GBV A;  4HCY A;  2YPN A;  1B2H A;  2ZYO A;  3RY3 A;  2M8C A;  4F3B A;  1NV4 A;  4LZ7 A;  5AA1 A;  4X9T A;  2ZZW A;  3H6T A;  1N84 A;  4KYE A;  1Y20 A;  1PC3 A;  2VGQ A;  4I9D A;  4YKJ A;  1PB9 A;  3K6U A;  1EU8 A;  1N3W A;  2QVV A;  4MFI A;  1OQH A;  5A5X A;  4AB5 A;  2Z22 A;  3MST A;  1FPG A;  2P0S A;  1IUD A;  2OJT A;  2HHM A;  3C4M A;  1FQD A;  1UTB B;  3AXF A;  1IEJ A;  1MDQ A;  2REG A;  4RYA A;  2P3N A;  1A7L A;  5AA2 B;  4U21 A;  4ESW A;  5IM2 A;  1B51 A;  2D21 A;  4KYS A;  5M2V A;  3RPL B;  2O68 A;  1DOT A;  5KCJ A;  2DYX A;  5LTC A;  5DVI A;  4QBA A;  1KA1 A;  4HXV A;  1HSE A;  1H45 A;  2XXV A;  4ZED A;  3KBZ A;  2F6P A;  4LP2 B;  5IGA A;  4OFO A;  1EYI A;  4JWO A;  5I56 A;  1AMF A;  1JEU A;  3G3G A;  2DVZ A;  5IAI A;  1M5B A;  3UA8 A;  4N8G A;  1VFD A;  3LR1 A;  1BTJ A;  1SD3 A;  4YB7 A;  4R9F A;  4EXK A;  2PT2 A;  2ESN A;  4DE8 A;  1XI6 A;  1TFA A;  3MVX A;  5DW8 A;  3TKD A;  3C35 A;  4NF4 A;  2QVU A;  2VPN A;  3KFM A;  3BFT A;  3B6Q A;  4FAT A;  5H8S A;  1LLS A;  4YMB A;  4N07 A;  4PE5 B;  4HS7 A;  3A09 A;  1KWH A;  3CFX A;  1FPD A;  1MY0 A;  3DEL B;  5ET7 A;  1B4Z A;  4JWX A;  3LSF B;  4NWC A;  4LQ2 A;  4P3L A;  1VFE A;  4P9K A;  3MUQ A;  3TCH A;  3MBP A;  2V3T A;  1M5E A;  2FIE A;  3OSR A;  2PMS A;  4NQ8 A;  4R2F A;  3VLW A;  1A8F A;  4G68 C;  3FXR A;  3MP8 A;  1RDY A;  2PX1 A;  3SEV A;  2QJE A;  3S4U A;  3LSX A;  4JB7 A;  4XXU A;  4ELO A;  3ILU B;  5CI5 A;  3E78 A;  4ECF A;  4OEV A;  4NHB A;  1RKM A;  3EPE A;  4BDO A;  3E79 A;  3KOS A;  3MAM A;  2P1S A;  2R9J A;  4PBH A;  4OVJ A;  3MPK A;  4O7M A;  5IZ3 A;  4R73 A;  5DVJ A;  4LA9 A;  3JV9 A;  2RC8 A;  1FPE A;  4YIC A;  4IB2 A;  1BLF A;  4PGN A;  2YJP A;  3RLF E;  2RC9 A;  1IIW A;  1H44 A;  3C31 A;  2XX8 A;  3MWB A;  1MXU A;  4TOZ A;  1JW1 A;  2WYK A;  4MNC A;  5ITP A;  1QW0 A;  2H5Y A;  3QK6 A;  4KI0 E;  4F29 A;  1DPP A;  4F2O A;  2RCB A;  3GYY A;  5CBS A;  2DE2 A;  4P8B A;  3N6U A;  2DVC A;  3PD9 A;  2AL4 A;  2I58 A;  3MYU A;  3M3F A;  1DPE A;  1SVX B;  2FNC A;  1LFG A;  1O7T A;  1IME A;  3PPQ A;  3FD3 A;  3LC8 A;  4EQ9 A;  4ZEF A;  3K00 A;  1LB9 A;  3W15 C;  1LBZ A;  4LVQ A;  1AH5 A;  4RNS A;  4OQO A;  1MS7 A;  4R74 A;  2GFE A;  3TTR A;  2F3D A;  3O97 A;  3PUW E;  4TQU Q;  4RPO A;  4NF8 A;  4ZZE A;  1MRP A;  1FTA A;  4ZE8 A;  5JTY A;  3MZ1 A;  4BDN A;  5CBR A;  3QXM A;  2O7I A;  1FPI A;  1US4 A;  4OYV A;  3KG2 A;  2AYS A;  1B1X A;  3RGY A;  4GWS A;  3BIG A;  1YXI A;  4WXJ A;  2Z8E A;  1BKA A;  4NF5 A;  1VSO A;  4N17 A;  4POX A;  5A5X B;  2QS4 A;  4IO6 A;  1K9Z A;  4MHF A;  2F3B A;  3FVG A;  3T93 B;  3O2A A;  1D4N A;  2XWO A;  4Z0I A;  4F2Q A;  3IB1 A;  4IY5 A;  4NWD A;  2Q2C A;  3IFA A;  3UGW A;  2QRY A;  4AQ4 A;  3KEI A;  5KCJ B;  3MZB A;  4OMB A;  1RYO A;  4YU0 A;  4U1Z A;  2VPO A;  3CIJ A;  1ZMG A;  3B8B A;  3TTM A;  1WVJ A;  1Q9D A;  5DEX B;  2QMW A;  4PDH A;  1LAX A;  3L6G A;  4G68 A;  4XTC Q;  1N3X A;  2WKY A;  4GWX A;  1LGB C;  3K6X A;  2OZZ A;  4OWD A;  1IXH A;  1GV8 A;  3TEP A;  4GOT A;  5IZ1 A;  2ZXT A;  4NF4 B;  4ESX A;  3EKI A;  1A55 A;  1FQB A;  1P1N A;  3GBB A;  3Q28 A;  3HCQ A;  5L9M A;  3QYT A;  1USY E;  4MJO A;  1NNP A;  1A54 A;  1QUI A;  3LSL A;  3ZSF A;  3PU5 A;  1SI1 A;  3LV0 A;  3S9E A;  4NG7 A;  2Z8F A;  3FBP A;  3RN8 A;  1IMD A;  1ZBM A;  3A3U A;  2OBG A;  3S9L C;  3SET A;  3H06 B;  5H8Q A;  1YYZ A;  3CFZ A;  4P11 A;  4P0I A;  2NXO A;  4KHZ E;  4JBZ A;  5JEI A;  2UYE A;  4OXV A;  4HE1 A;  3SEX A;  4PFI A;  2Q74 A;  3SKP A;  2ZNU A;  4HE0 A;  3TUS A;  2B4M A;  4I3Y A;  1JNF A;  1MH4 A;  2AIX A;  3OO7 A;  1IZ1 A;  2GQ1 A;  3SEY A;  4DXU A;  3S2V A;  2A5S A;  4RJZ A;  1SI0 A;  3E3K A;  4DIG A;  4IO4 A;  1URS A;  2E0S A;  3O6G A;  4ELR A;  2OK2 A;  4N4U A;  4R75 A;  2WEF A;  3Q26 A;  3KZG A;  1NKX A;  3O28 A;  2I4B A;  4PET A;  3I3V A;  3U8Q A;  3PUX E;  1B05 A;  4MF3 A;  2WYP A;  4TLM B;  1QUK A;  1OMP A;  1H43 A;  3S9N C;  3M8U A;  4H45 A;  1O63 A;  2Q8M A;  2I3W A;  2AL5 A;  1D3K A;  5F7V A;  1JVX A;  2G93 A;  4K3F A;  1I6Q A;  4Q30 B;  4ZEI A;  4YMA A;  2I3V A;  4NF0 A;  1ZLQ A;  5FTI A;  2GRV A;  4DCX A;  3SES A;  4BDR A;  3K6W A;  3KSX A;  1FSA A;  3UIF A;  3RQT A;  1XVY A;  3CI8 A;  1JW4 A;  3UN6 A;  1LBC A;  5H8H B;  1LBB A;  2XA5 A;  2PT1 A;  1LEV A;  4PFB A;  2OX3 A;  3SDF A;  2F7B A;  2NUV A;  4BDL A;  4LON B;  2KQZ A;  4NF8 B;  1SYH A;  3LUY A;  5JTY B;  2Y7W A;  3EHS A;  3OEM A;  3OO8 A;  3DP8 A;  4G8M A;  2V93 A;  2CZH A;  4NED A;  4IR8 A;  1B46 A;  4H0W A;  2UVG A;  4IO3 A;  4U1O A;  3LUZ A;  3T96 B;  3TPA A;  4U4X A;  3VVD A;  3K02 A;  4MCO A;  1N04 A;  2XHD A;  2I4C A;  3VLV A;  4OES A;  3FJ7 A;  4G77 A;  4H8I A;  3R6U A;  4EF2 A;  5H8F B;  2F7C A;  2VD2 A;  3K1M A;  4M4G A;  3LSW A;  1UTH B;  3DLN A;  2ONR A;  3ECR A;  3K2D A;  4ZZA A;  1TWY A;  1MQJ A;  4XFE A;  4BDM A;  1WOD A;  2DP8 A;  4XKR A;  1EZO A;  1FPL A;  2Q2A A;  4NGU A;  5H8N B;  4GXS B;  4YZZ A;  3HO7 A;  5I57 A;  1OVT A;  1HSL A;  2HZK A;  4GWW A;  5EQ9 A;  3PPN A;  1QVS A;  2XXW A;  2XX7 A;  5I59 B;  3D1R A;  1DBZ A;  1DK4 A;  3HFU A;  4RY1 A;  4FIM A;  2ZYK A;  2XXU A;  2WBD A;  2I0C A;  1NV5 A;  1UIV A;  2QS2 A;  1B0H A;  2XXY A;  4DLD A;  5B70 A;  4KCD A;  1MM7 A;  1SBP A;  4LUB A;  4F3P A;  3P7I A;  3VLU A;  1FW0 A;  3T9X B;  1PBP A;  4AS4 A;  1DTG A;  4OA4 A;  3WAF A;  3S9M C;  2VP1 A;  1H3D A;  1FTO A;  3OEK A;  4OVQ A;  3TCG A;  2DXR A;  2XXK A;  4F22 A;  4N8Y A;  3B7D A;  4MH5 A;  1FBH A;  4PFR A;  4F39 A;  2RCA A;  4NE4 A;  3PMX A;  2L5V A;  2P3V A;  1N0T A;  3PPP A;  3H6V A;  5EYF A;  3FUZ A;  5J16 A;  2UYF A;  2ZNT A;  2O6A A; 
#chains in the Genus database with same CATH homology
 2F36 A;  2Z8D A;  1US5 A;  4ZE9 A;  1FTK A;  3IAZ A;  3M3L A;  3D4G A;  1B7Z A;  1R6Z A;  4F3G A;  4Z7E A;  4GL8 A;  3HPI A;  3FAT A;  3H7M A;  4C1U A;  2ALU A;  2HXW A;  5CMK A;  1MXV A;  2HEU A;  5I2K B;  2OWS A;  3FVN A;  4XKN A;  5HPQ A;  4OEN A;  5I84 A;  3GXA A;  1NNK A;  3FGS A;  4TLL B;  5L8D A;  4MBP A;  4Q8R A;  4GQO A;  1B58 A;  2O51 A;  1Y4T A;  1VE4 A;  1ZU0 A;  1MY2 A;  3G7W A;  3HST A;  4H8J A;  5CMC A;  3QIM A;  3H4Z A;  5AA4 B;  2W7Y A;  3V89 B;  3IO6 A;  1IQ7 A;  2UVH A;  4WKM A;  2DWA A;  4H67 A;  1JW5 A;  2OWT A;  2O69 A;  4LAT A;  1M5C A;  4C1T A;  2H4I A;  3PMW A;  4ZEC A;  1FQF A;  3USD A;  4GWO A;  2FA7 A;  4LZ5 A;  4R6H A;  4JWY A;  3EHU A;  4R6K A;  1B5H A;  1QJM A;  1NNF A;  2DSF A;  2YLN A;  2KLF A;  5I58 A;  1MPB A;  1Y1Z A;  2UXA A;  2D3I A;  4NF6 A;  2Q8J A;  3U93 A;  2D5W A;  3RTF B;  5EHS A;  4JSD A;  4O3B A;  4H5F A;  4R2B A;  1MQI A;  4ZEK A;  1B7U A;  1EH3 A;  3N94 A;  1B0L A;  4Q0C A;  1MPC A;  2F7A A;  3KOT A;  3SEU A;  3QAX A;  3GBA A;  5I2N A;  3ZKK A;  1ANF A;  3MVY A;  3RPW A;  1B3H A;  3IJO B;  4RXL A;  2XD3 A;  2DE4 A;  2XXX A;  2H98 A;  2Y7K A;  5KZT A;  3ZKL A;  1MDP 1;  1SYI A;  4X48 A;  3TYH A;  3C9H A;  2O84 X;  5IKB A;  3G3J A;  1JET A;  1ATG A;  3UK4 A;  1QUJ A;  1FCK A;  2CMO A;  2R71 A;  1LFI A;  2Y7R A;  3KJT A;  1SW2 A;  2V3Q A;  4IO7 A;  4IY6 A;  5L9O A;  1ZTY A;  4QFN A;  5ICT A;  1IXC A;  2RC7 A;  3VFJ A;  4KYD A;  1JEV A;  3GZG A;  5I56 B;  2Y7P A;  2I48 A;  4GVO A;  3PV0 E;  4BDQ A;  4HCW A;  3OEL A;  2IA4 A;  2H99 A;  4IGR A;  4N13 A;  1AIV A;  1GVC A;  2B3B A;  3R26 A;  1A40 A;  2ANJ A;  2ABH A;  1DMB A;  3FIR A;  1P1O A;  3U92 A;  1P1Q A;  1Z7M E;  1EZP A;  4QRZ A;  2V3U A;  5CMB A;  1I6A A;  1OQG A;  3IR1 A;  2Q9T A;  4GRK A;  3T66 A;  1NL5 A;  3KBR A;  4F1V A;  3K01 A;  1NNT A;  1LCT A;  2RF1 A;  4FOR A;  1R9L A;  5DYH A;  1FQC A;  5KDT A;  1LB8 A;  4DXC A;  1LAF E;  3HN0 A;  1PB7 A;  2Y7I A;  1Y4C A;  1ZIU A;  3PUV E;  5TPA A;  1D9V A;  1MXX A;  2F78 A;  3Q29 A;  2QL3 A;  5CM6 A;  3FJM A;  1R1N A;  1BIY A;  3T22 A;  3TQL A;  5CMM A;  5F1Q A;  3RNN A;  1LAH E;  2ONK E;  1BP5 A;  4I8C A;  1N76 A;  3C36 A;  2F5X A;  1LCF A;  1DSN A;  3G3F A;  3CSG A;  3CRB A;  1LAG E;  5I58 B;  4MLV A;  4EQ7 A;  1R9Q A;  5FHO A;  3HHG A;  3CVG A;  3M3K A;  2HCA A;  2XXI A;  4WEP A;  3U72 A;  3EQ1 A;  4QFK A;  1N7X A;  2IEE A;  2VHA A;  2X7Q A;  1MQH A;  1B7H A;  4C0R A;  2PYY A;  2HFB A;  3TDJ A;  3VXC A;  1NMU A;  3I6V A;  3VVF A;  1B40 A;  2QS3 A;  4U23 A;  4KD5 A;  4F1Y A;  1TXF A;  3K1P A;  3T9V A;  5AE4 A;  2Q89 A;  3VVE A;  2NVU B;  5B7D A;  5LOM A;  5TP9 A;  1B3L A;  2DWI A;  3HV1 A;  2THI A;  3MZ9 A;  2QMX A;  3ODB A;  1Q35 A;  1XS5 A;  4NF5 B;  2ZNS A;  5HM4 B;  4U22 A;  2F35 A;  3K6V A;  4OEU A;  5AA2 D;  3THI A;  4QSC A;  1XVX A;  4GFR A;  5ISU A;  3PD8 A;  3K4U A;  3E9X A;  1IXI A;  5L9S A;  1QUL A;  3U94 A;  3G3I A;  1IXG A;  4FE8 A;  1B3G A;  2BJJ X;  2RKM A;  4F19 A;  1A99 A;  3IB0 A;  4ZEB A;  1AL3 A;  1B3E A;  4G68 B;  2V84 A;  3MVW A;  4PFU A;  1B4H A;  5HBC A;  2ONS A;  3IX1 A;  3IOU A;  1YAE A;  3EF7 A;  4KPT A;  4EXL A;  3TAJ A;  4PFY A;  3IL1 B;  1UIU A;  2REJ A;  4JXI A;  1ZJL A;  1SW5 A;  4M1V A;  4RA1 A;  5BUU A;  1T0K A;  4ELP A;  1ELJ A;  4KR5 A;  3DM0 A;  1Y1M A;  4DXB A;  3N6T A;  1I69 A;  2XXT A;  4POW A;  5H8Q B;  3EN3 A;  4EUO A;  3UOR A;  1YTV A;  2DXY A;  3TEL A;  2HAV A;  4UAC A;  4OET A;  3F11 A;  2XXQ A;  4ELQ A;  4NTL A;  4FEC A;  1MM6 A;  3B6W A;  1Y3Q A;  3OO6 A;  5K2Y A;  3K0V A;  3RT8 A;  1MY4 A;  5KDT B;  2ZYN A;  4LZ8 A;  5DEX A;  1N7W A;  1SQY A;  2I49 A;  2GH9 A;  5TPA B;  1XHY A;  5ELV A;  3ZS6 A;  2I6E A;  3FVK A;  3MPL A;  4QFL A;  1NH7 A;  1DTZ A;  4JDF A;  1GGG A;  4OFJ A;  3D4C A;  3C34 A;  3A3C A;  3ILT B;  1P1W A;  4G4P A;  3IK6 B;  1S7Y A;  5J1D A;  4KCC A;  4L17 A;  3W9W A;  3KN3 A;  2XX9 A;  2DWJ A;  4R72 A;  1TFD A;  3KJ7 A;  4DDD A;  1NH8 A;  4GXA A;  4ZS9 A;  3K1N A;  5CRY A;  4ISU A;  1XT8 A;  5DVF A;  3SER A;  1D9Y A;  3MVZ A;  3I5O A;  4QFO A;  1POY 1;  2I0B A;  3H6W A;  1ZKB A;  4YB6 A;  3G3K A;  2DQV A;  1S50 A;  4GIZ A;  3HHF A;  3VE1 B;  1NFT A;  1PBQ A;  3CSB A;  3R7X A;  4R6Y A;  4QFP A;  3BBR A;  4RPN A;  4XKP A;  3U1O A;  4GD5 A;  1QKA A;  3L6H A;  3RUM A;  1MXZ A;  4H6D A;  4UA8 A;  4LQ5 A;  1MXW A;  2G29 A;  4O3C A;  1A8E A;  1B6H A;  4ZDM A;  2XXP A;  4YKI A;  3JZJ A;  2XXH A;  5TP9 B;  3V5A A;  1FTL A;  5TU0 A;  1CE2 A;  1OLC A;  2DWH A;  1YCJ A;  4RK2 A;  3O29 A;  1MQG A;  1P99 A;  3VXB A;  1SDX A;  1PEB A;  3WAE A;  3QSL A;  3JYR A;  4H5G A;  2Q88 A;  3B6T A;  4KFQ A;  1GR2 A;  3MW0 A;  1PDA A;  3OD7 A;  3FXU A;  3Q25 A;  4FAJ A;  2XD2 A;  3QUJ A;  4HTG A;  3IOR A;  3TFL A;  4G2Z A;  4YAH X;  2HQ0 A;  2B3F A;  2UVJ A;  3FVO A;  4I62 A;  3VV5 A;  1XC1 A;  1JVY A;  4QSE A;  3SEW A;  4P0G A;  1PB8 A;  1H76 A;  4MLQ A;  5H8H A;  1HSJ A;  1JQF A;  2HAU A;  3OOA A;  5I57 B;  3MC2 A;  3VDF A;  3T9H B;  1II5 A;  3MP1 A;  4E0W A;  3C33 A;  2HZL A;  2XXR A;  2QSX A;  4WED A;  5FHM A;  3FZV A;  1MH3 A;  2VOZ A;  3FAS A;  4EDP A;  1UQW A;  2UVI A;  3KGC A;  3DP4 A;  2NWJ A;  1Y9U A;  2F97 A;  4ND9 A;  4FEB A;  3BKI B;  5DTB A;  3KSJ A;  3PUY E;  1P1U A;  4U4S A;  2O1L A;  1MQD A;  1MPD A;  1VR5 A;  1MG1 A;  3MJN A;  3MP6 A;  3OEN A;  5H8F A;  2R6G E;  3V8X B;  1UTH A;  4E0X A;  2F34 A;  1URD A;  4QSD A;  3KN8 A;  3W9V A;  2A5T A;  3EHT A;  3CFL A;  4XKQ A;  3O6H A;  3MQ9 A;  4ONY A;  5AA3 A;  2GHA A;  5H8N A;  2FYI A;  4FED A;  3CR9 A;  5DT6 A;  4THI A;  2P2A A;  3TZA A;  1FQE A;  4I1D A;  3PMV A;  4IO5 A;  1OVB A;  1MY1 A;  3RTW B;  3TTN A;  4FJP A;  5I59 A;  3PUZ E;  3ONM A;  4U2R A;  3KN7 A;  3TCF A;  3DP6 A;  1USY H;  3PPO A;  3IO4 A;  1UTB A;  2LAO A;  3IJX B;  3RT6 B;  3QUF A;  1IIT A;  3FV1 A;  4QHQ A;  2ZYM A;  4GLI A;  5AA2 A;  4JSO A;  3TMG A;  2PBW A;  4F3S A;  4H65 A;  1QKB A;  1AOV A;  3GLB A;  3IOT A;  1SW4 A;  3OMB A;  2B65 A;  1FTJ A;  1I6B A;  1POT A;  4RK9 A;  4X1D A;  1MXY A;  2Y84 A;  4PFT A;  2O1M A;  4OFL A;  3O6I A;  2E1S A;  4NMY A;  4BLA A;  1WDN A;  4DZ1 A;  1M5F A;  1Y3N A;  4KQP A;  2H9B A;  3PGF A;  1B52 A;  2DE3 A;  1B5I A;  1URG A;  3LBS A;  4YKP A;  1GTK A;  5K2X A;  3O9P A;  1S9T A;  1TT1 A;  3PPR A;  3OXN A;  1F9B A;  1O64 A;  1LST A;  4G8H A;  3E13 X;  2DOJ A;  1SW1 A;  2F8D A;  3N5L A;  1J1N A;  1RYX A;  2VD3 A;  4EQB A;  4NF6 B;  1B32 A;  4OER A;  2OLB A;  3TOD A;  4GL0 A;  3IB2 A;  1FQA A;  3H3G A;  2GHB A;  3BFU A;  1XOC A;  4F1U A;  4IGT A;  3G3H A;  4G8N A;  2X26 A;  5I2K A;  4Q5T A;  4GF8 A;  4DCY A;  3V83 A;  1B1H A;  1Q1K A;  4X1B A;  2DS9 A;  5ICQ A;  4OTE A;  4PQJ A;  1OLA A;  3CG1 A;  2RIN A;  5FTH A;  2V25 A;  3CG3 A;  2NOO A;  3C32 A;  3O66 A;  3FV2 A;  4IO2 A;  3FXQ A;  3FJG A;  1EZ9 A;  1Z7N E;  2F6G A;  2Z23 A;  5AA4 A;  5I2N B;  4EF1 A;  4PP0 A;  3OO9 A;  4F31 B;  2QS1 A;  4YKK A;  2CZL A;  2OCU A;  2X7P A;  3TQW A;  5ITO A;  1M5D A;  3IOV A;  1CB6 A;  3OSQ A;  3UP9 A;  2H25 A;  4R9G A;  3T9U A;  1B9J A;  1B3F A;  5BWJ A;  4OZ9 A;  1B5J A;  1YPN A;  4QF9 A;  4YB5 A;  3E4R A;  2ZMB A;  4OHN A;  3TTK A;  1Y3P A;  1MY3 A;  4O3A A;  4XIG Q;  5FHN A;  3H6U A;  2PVU A;  1LFH A;  1OIB A;  4AB6 A;  5CC2 A;  2A5T B;  4N6P A;  2O7U A;  3N26 A;  4F18 A;  3Q27 A;  4HW8 A;  2QPQ A;  5JK4 A;  4H1X A;  5EHM A;  3TTL A;  3H03 A;  3IOW A;  1FTM A;  1L5T A;  4PFW A;  4HCY A;  2YPN A;  1B2H A;  2ZYO A;  3RY3 A;  2M8C A;  4F3B A;  4LZ7 A;  5AA1 A;  4X9T A;  3H6T A;  1N84 A;  4KYE A;  1Y20 A;  1PC3 A;  2VGQ A;  4I9D A;  4YKJ A;  1PB9 A;  3K6U A;  1EU8 A;  1N3W A;  4MFI A;  1OQH A;  5A5X A;  4AB5 A;  2Z22 A;  2P0S A;  1IUD A;  2OJT A;  3C4M A;  1FQD A;  1UTB B;  3AXF A;  1IEJ A;  1MDQ A;  2REG A;  4RYA A;  1A7L A;  5AA2 B;  4U21 A;  4ESW A;  1B51 A;  2D21 A;  4KYS A;  5M2V A;  2O68 A;  1DOT A;  5KCJ A;  2DYX A;  5DVI A;  1HSE A;  1H45 A;  2XXV A;  4ZED A;  2F6P A;  4LP2 B;  4OFO A;  4JWO A;  5I56 A;  1AMF A;  1JEU A;  3G3G A;  2DVZ A;  5IAI A;  1M5B A;  3UA8 A;  1VFD A;  3LR1 A;  1BTJ A;  1SD3 A;  4YB7 A;  4R9F A;  4EXK A;  2PT2 A;  2ESN A;  4DE8 A;  1TFA A;  3MVX A;  3TKD A;  3C35 A;  4NF4 A;  3KFM A;  3BFT A;  3B6Q A;  4FAT A;  5H8S A;  1LLS A;  4YMB A;  4N07 A;  4PE5 B;  4HS7 A;  3A09 A;  1KWH A;  3CFX A;  1MY0 A;  3DEL B;  1B4Z A;  4JWX A;  3LSF B;  4NWC A;  4LQ2 A;  1VFE A;  3MUQ A;  3TCH A;  3MBP A;  2V3T A;  1M5E A;  3OSR A;  2PMS A;  4R2F A;  3VLW A;  1A8F A;  4G68 C;  3FXR A;  3MP8 A;  2PX1 A;  3SEV A;  2QJE A;  3S4U A;  3LSX A;  4JB7 A;  4XXU A;  4ELO A;  3ILU B;  5CI5 A;  4ECF A;  4OEV A;  1RKM A;  3EPE A;  4BDO A;  3KOS A;  3MAM A;  2P1S A;  2R9J A;  4OVJ A;  3MPK A;  4R73 A;  5DVJ A;  4LA9 A;  3JV9 A;  2RC8 A;  4YIC A;  4IB2 A;  1BLF A;  2YJP A;  3RLF E;  2RC9 A;  1IIW A;  1H44 A;  3C31 A;  2XX8 A;  3MWB A;  1MXU A;  4TOZ A;  1JW1 A;  5ITP A;  1QW0 A;  2H5Y A;  3QK6 A;  4KI0 E;  4F29 A;  1DPP A;  4F2O A;  2RCB A;  5CBS A;  2DE2 A;  3N6U A;  2DVC A;  3PD9 A;  2AL4 A;  2I58 A;  3M3F A;  1DPE A;  1SVX B;  2FNC A;  1LFG A;  1O7T A;  3PPQ A;  3FD3 A;  3LC8 A;  4EQ9 A;  4ZEF A;  3K00 A;  1LB9 A;  3W15 C;  4LVQ A;  1AH5 A;  4RNS A;  4OQO A;  1MS7 A;  4R74 A;  2GFE A;  3TTR A;  3O97 A;  3PUW E;  4TQU Q;  4RPO A;  4NF8 A;  4ZZE A;  1MRP A;  4ZE8 A;  5JTY A;  3MZ1 A;  4BDN A;  5CBR A;  3QXM A;  2O7I A;  1US4 A;  4OYV A;  3KG2 A;  2AYS A;  1B1X A;  3RGY A;  4WXJ A;  2Z8E A;  1BKA A;  4NF5 A;  1VSO A;  4POX A;  5A5X B;  2QS4 A;  4IO6 A;  3FVG A;  3T93 B;  3O2A A;  1D4N A;  4Z0I A;  4F2Q A;  3IB1 A;  4IY5 A;  4NWD A;  2Q2C A;  3UGW A;  2QRY A;  4AQ4 A;  3KEI A;  5KCJ B;  3MZB A;  4OMB A;  1RYO A;  4YU0 A;  4U1Z A;  3CIJ A;  1ZMG A;  3TTM A;  1WVJ A;  5DEX B;  2QMW A;  1LAX A;  3L6G A;  4G68 A;  4XTC Q;  1N3X A;  2WKY A;  1LGB C;  3K6X A;  2OZZ A;  4OWD A;  1IXH A;  1GV8 A;  3TEP A;  4GOT A;  2ZXT A;  4NF4 B;  4ESX A;  1A55 A;  1FQB A;  1P1N A;  3GBB A;  3Q28 A;  3HCQ A;  5L9M A;  3QYT A;  1USY E;  1NNP A;  1A54 A;  1QUI A;  3LSL A;  3ZSF A;  3PU5 A;  1SI1 A;  3S9E A;  2Z8F A;  3RN8 A;  1ZBM A;  3A3U A;  2OBG A;  3S9L C;  3SET A;  3H06 B;  5H8Q A;  3CFZ A;  4P11 A;  4P0I A;  2NXO A;  4KHZ E;  4JBZ A;  5JEI A;  2UYE A;  4OXV A;  3SEX A;  3SKP A;  2ZNU A;  3TUS A;  1JNF A;  1MH4 A;  2AIX A;  3OO7 A;  1IZ1 A;  3SEY A;  4DXU A;  3S2V A;  2A5S A;  4RJZ A;  1SI0 A;  3E3K A;  4DIG A;  4IO4 A;  1URS A;  2E0S A;  3O6G A;  4ELR A;  2OK2 A;  4R75 A;  3Q26 A;  3KZG A;  1NKX A;  3O28 A;  2I4B A;  4PET A;  3I3V A;  3U8Q A;  3PUX E;  1B05 A;  4MF3 A;  4TLM B;  1QUK A;  1OMP A;  1H43 A;  3S9N C;  3M8U A;  1O63 A;  2I3W A;  2AL5 A;  1D3K A;  5F7V A;  1JVX A;  2G93 A;  4K3F A;  1I6Q A;  4Q30 B;  4ZEI A;  4YMA A;  2I3V A;  1ZLQ A;  5FTI A;  2GRV A;  4DCX A;  3SES A;  4BDR A;  3K6W A;  3KSX A;  3UIF A;  3RQT A;  1XVY A;  3CI8 A;  1JW4 A;  3UN6 A;  1LBC A;  5H8H B;  1LBB A;  2PT1 A;  3SDF A;  2F7B A;  2NUV A;  4BDL A;  4LON B;  4NF8 B;  1SYH A;  3LUY A;  5JTY B;  2Y7W A;  3EHS A;  3OEM A;  3OO8 A;  3DP8 A;  4G8M A;  2V93 A;  4NED A;  1B46 A;  4H0W A;  2UVG A;  4IO3 A;  4U1O A;  3T96 B;  3TPA A;  4U4X A;  3VVD A;  3K02 A;  1N04 A;  2XHD A;  2I4C A;  3VLV A;  4OES A;  3FJ7 A;  4G77 A;  4H8I A;  3R6U A;  4EF2 A;  5H8F B;  2F7C A;  2VD2 A;  3K1M A;  4M4G A;  3LSW A;  1UTH B;  3DLN A;  2ONR A;  3ECR A;  3K2D A;  4ZZA A;  1TWY A;  1MQJ A;  4BDM A;  1WOD A;  2DP8 A;  4XKR A;  1EZO A;  2Q2A A;  5H8N B;  4GXS B;  4YZZ A;  3HO7 A;  5I57 A;  1OVT A;  1HSL A;  2HZK A;  3PPN A;  1QVS A;  2XXW A;  2XX7 A;  5I59 B;  4RY1 A;  4FIM A;  2ZYK A;  2XXU A;  2I0C A;  1UIV A;  2QS2 A;  1B0H A;  2XXY A;  4DLD A;  5B70 A;  4KCD A;  1MM7 A;  1SBP A;  4LUB A;  4F3P A;  3P7I A;  3VLU A;  1FW0 A;  3T9X B;  1PBP A;  1DTG A;  3WAF A;  3S9M C;  2VP1 A;  1H3D A;  1FTO A;  3OEK A;  3TCG A;  2DXR A;  4F22 A;  3B7D A;  4MH5 A;  4F39 A;  2RCA A;  4NE4 A;  3PMX A;  1N0T A;  3PPP A;  3H6V A;  5EYF A;  3FUZ A;  2UYF A;  2ZNT A;  2O6A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...