3U1OA

Three dimensional structure of de novo designed cysteine esterase ech19, northeast structural genomics consortium target or49
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
411
structure length
411
Chain Sequence
GSHMEVNLRMSWWGGNGRHQVTLKALEEFHKQHPNINVKAEYTGWDGHLSRLTTQIAGGTEPDVMQTNWNWLPIFSKDGTGFYNLFSVKEQLDLAQFDPKELQQTTVNGKLNGIPISVTAMIFYFNDATWAKAGLEYPKTWDELLAAGKVFKEKLGDQYYPVVLCAGQTLVLIRSYMTQKYNIPTIDEANKKFAYSPEQWVEFFTMYKTMVDNHVMPSTKYYASFGKSNHYEMKPWINGEWAGTYMWNSTITKYSDNLTKPAKLVLGPYPMLPGAKDAGLFFLPAQMLSIGKSTKHPQESAMLINFLLNSKEGVEALGLERGVPLSATAVTQLRASGVIKDEDPSVAGLNMALELPHKMTTSPYFLDWQIWSLFLDAIQYIDYGQKTVQETAEYFNKQGDRILKRAMRGSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Computational design of catalytic dyads and oxyanion holes for ester hydrolysis.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Hydrolase
molecule keywords De Novo design cysteine esterase ECH19
total genus 127
structure length 411
sequence length 411
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3u1oA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3u1oA02
1SW5A 4O3AA 1A55A 4RK2A 4R75A 5FHOA 5CBRA 3U92A 3Q25A 4OESA 1MH4A 1Y4CA 3FD3A 5H8FB 1DPPA 1VSOA 3OO6A 2R9JA 3KZGA 4F3SA 5I57A 3QIMA 4RNSA 2DWHA 3IAZA 4EDPA 4F22A 1A8FA 1FTJA 3A09A 3TZAA 1B51A 3IX1A 1PB9A 3MZ9A 3QXMA 5L9MA 1N04A 4MH5A 5EHMA 2F6PA 1MPBA 2UVIA 1FQDA 2AYSA 2VD3A 5H8HB 2VGQA 3AXFA 3T66A 2XXUA 2ALUA 2Y7WA 1D9YA 5I59B 3IJOB 3BFTA 4YB5A 4XIGQ 3IOUA 1US5A 2VHAA 3GZGA 2GHBA 2AL5A 2Z23A 4G8NA 1N3XA 3SESA 5FHNA 4EQ7A 5H8NB 4P11A 4NF6B 4UACA 3ILTB 4C1UA 1B4HA 1SW1A 3B6WA 2DE4A 3MBPA 3C31A 3E13X 3Q28A 3MPKA 4DIGA 3V83A 3DP8A 1FCKA 4Q0CA 4EF2A 3TELA 3K1MA 3S4UA 1JNFA 1TT1A 3K4UA 2XX9A 1TWYA 4OZ9A 3UIFA 1MQGA 1P1OA 1UIUA 2DE3A 1MXZA 2HZLA 3KN8A 4FEDA 2NWJA 3LC8A 3U8QA 4YKIA 3A3UA 1MY3A 2R6GE 3VXCA 2O7UA 3OSQA 5H8QA 3JYRA 1AL3A 1M5CA 4KD5A 3S9NC 3KSJA 3IB1A 4LZ5A 4ZZAA 3T96B 2O1MA 1A7LA 4HCWA 3K2DA 1MY4A 1B5JA 5ITOA 3OEMA 1FQAA 3KFMA 4H67A 1SYIA 5A5XB 2Q2CA 3PPOA 4OETA 1FTKA 4QFPA 3VVFA 3HN0A 1B6HA 3O28A 4I8CA 3CR9A 1PDAA 1QKAA 4YICA 4OEVA 4GLIA 2XXRA 4NF5A 1SVXB 1Y3NA 2DSFA 3RT8A 4PFYA 4BDLA 4E0XA 1H43A 2OBGA 2RCBA 3FIRA 3O66A 1MS7A 1XC1A 3T93B 2DE2A 1POTA 4TLLB 3UGWA 2ANJA 3CG1A 3TODA 2QS1A 1SW2A 3FVKA 5DVJA 4F31B 3H3GA 1ANFA 3K01A 2I3WA 1LB9A 1NL5A 3G3GA 2LAOA 3TCHA 1N3WA 2DS9A 3TTKA 1MQJA 1POY1 3R7XA 3W15C 4WXJA 4AB5A 5HPQA 2V3TA 1B3LA 1MXXA 1MM6A 3KJTA 4ZECA 1ZTYA 3IK6B 4G2ZA 4GXSB 1B3FA 4WEPA 2OLBA 3THIA 1LCFA 4WKMA 4G68B 3K0VA 2CMOA 4QF9A 4NTLA 3LBSA 4THIA 4QFNA 4N13A 2I3VA 4RPOA 3RLFE 4ELRA 4F3BA 4H5GA 2D5WA 3RNNA 1LSTA 1LB8A 1ZLQA 4TOZA 3EHTA 3FASA 3PPRA 4F1UA 4OYVA 4IB2A 5I2KA 1NNPA 3FUZA 1B0LA 1DMBA 2QMWA 4WEDA 3VLVA 3IJXB 1DOTA 2W7YA 3RUMA 1OMPA 1VR5A 3B6TA 4JWOA 3USDA 5I56A 1JVXA 3OXNA 1DPEA 3MVYA 4MF3A 4U1OA 1VE4A 3W9WA 1WDNA 1SDXA 4RY1A 2XXQA 1PEBA 1DTZA 3I3VA 3IOVA 3K1PA 3FXUA 1IXGA 4POXA 3S2VA 1DTGA 2Q88A 2XD2A 3UP9A 3R26A 1B1XA 4FECA 3CSBA 3OOAA 2DYXA 2RC9A 1IIWA 4BDRA 1TXFA 4GRKA 1Q35A 1MXWA 2VP1A 1ELJA 3UN6A 2AL4A 3O9PA 4ISUA 5CMMA 4DXUA 2Z8FA 1D4NA 1LAFE 1JEVA 1GGGA 1XHYA 2UVJA 1Y9UA 3CI8A 3CRBA 4PFUA 4XTCQ 5EYFA 4BDOA 1R9LA 3ZS6A 1N0TA 5TPAA 3VLUA 1FTMA 2QJEA 1IXHA 1NNFA 3MVXA 3Q29A 4DDDA 4F2OA 3PPPA 5H8FA 3TFLA 3F11A 4JSDA 2DWAA 1D3KA 1Y20A 2ZXTA 3OD7A 1R6ZA 3GXAA 4FIMA 4H8IA 5B7DA 3O6GA 3OMBA 3HPIA 2RC7A 3W9VA 5L9OA 1OVBA 1AIVA 2REGA 4YKPA 1PBQA 1B0HA 1PB8A 1P1QA 2A5SA 3MP6A 4NF8B 2ONRA 2B3FA 5FHMA 3TYHA 5I84A 1CB6A 4KHZE 4PFWA 1QJMA 4DZ1A 5I57B 5TPAB 3HV1A 2UYFA 4BDMA 1B46A 2Y84A 3QUFA 5H8QB 4R9FA 2QSXA 3G3JA 1CE2A 3MC2A 1MH3A 4JSOA 1LFGA 3BKIB 3G3KA 3MQ9A 2GRVA 3KOSA 1LFHA 2F7BA 5AA4B 3E3KA 1I6QA 2XX7A 5KZTA 1A99A 2P0SA 1P99A 3MVWA 1LAGE 5AE4A 3ILUB 1AOVA 1MXYA 1MDQA 4PQJA 3SERA 2G93A 4IY5A 4DCXA 1LFIA 3E9XA 4JWXA 4LQ5A 2DXRA 4NF5B 5H8SA 3VXBA 3EN3A 5CBSA 4ZS9A 2H25A 1YAEA 4F19A 2Y7KA 3DLNA 4O3BA 2HEUA 3K6UA 4ZE9A 5I59A 3K6VA 1PBPA 4IY6A 1B4ZA 1SW4A 2UVGA 2O1LA 2V25A 4OFLA 1PC3A 1MG1A 2FYIA 4KCCA 2IEEA 3L6GA 1IXCA 1ZBMA 2Q9TA 2V3QA 3C33A 3LR1A 4R2BA 4R6KA 3PD8A 1KWHA 2REJA 1GTKA 3G3FA 3TTMA 2OZZA 1OQHA 5DVIA 5K2YA 2D3IA 3KOTA 4ZE8A 5ICQA 1RYOA 1URDA 1B7ZA 3IOWA 3LUYA 4H0WA 4M1VA 4FORA 2XXYA 1IXIA 3KEIA 3GBAA 3OELA 4Q8RA 3PMVA 4M4GA 1URGA 2M8CA 4IO3A 4QHQA 5FTIA 4X1DA 4IO4A 3FXQA 1Y1ZA 1B7HA 5AA1A 3FJ7A 2H5YA 3D4CA 4FEBA 1MQIA 1FQFA 3HHFA 4IO7A 2UVHA 4MFIA 3K02A 4GXAA 3ZKLA 3SKPA 2DVZA 1FQBA 1AH5A 2Z22A 4QFLA 2QS3A 1JQFA 1Y3QA 3FJMA 3PUYE 3KG2A 3MUQA 4GD5A 4MBPA 2B3BA 2PT1A 1SYHA 2THIA 1B1HA 1Y4TA 1Z7ME 1JW1A 1FTLA 1XT8A 3KGCA 3KN7A 3V8XB 2I58A 2RC8A 3PUXE 3QYTA 3ODBA 2O69A 2F6GA 1BTJA 4L17A 4OFJA 3OO7A 1B3GA 1MXUA 3FZVA 4LUBA 3FVNA 2XXPA 1L5TA 4ZEKA 2H9BA 1B7UA 1QUJA 4O3CA 4OWDA 3PD9A 3C36A 4DE8A 4DCYA 1MQHA 2PYYA 3ECRA 4XKPA 4ZEIA 3UORA 3T22A 4YAHX 1TFDA 2A5TA 2GHAA 1N84A 2YJPA 3O6IA 2NOOA 2DQVA 3IB0A 2O51A 1UTBB 1SD3A 4ELQA 3O97A 3IL1B 2ONSA 2Q89A 1QUKA 2F78A 2I6EA 2O6AA 4QRZA 3K6WA 3N6UA 4ZDMA 4I62A 2V84A 4KR5A 2X7PA 3SEVA 3T9XB 3S9EA 5EHSA 1A8EA 5M2VA 2OWSA 4GWOA 1QUIA 4FE8A 3MVZA 3TQLA 3LSLA 1OLCA 5F1QA 3RTWB 1XOCA 5ELVA 3SETA 3TTNA 1H3DA 4OERA 3KJ7A 2H99A 4U22A 3D4GA 3OEKA 4F1YA 3SEUA 1USYH 2ZMBA 2PVUA 3EF7A 2H98A 3FVOA 1EH3A 4RYAA 3U1OA 4F39A 4XKNA 1NFTA 2D21A 3DELB 1B5HA 3MZ1A 3RPWA 1A40A 4R72A 3CVGA 4AB6A 1B3EA 4Q5TA 1MPCA 2I48A 2X7QA 4R6YA 5I58A 4U23A 5AA4A 2PT2A 1FTOA 3H6WA 2F35A 4KPTA 3FV2A 4ESWA 4OVJA 4NMYA 1B52A 2ZYKA 3N5LA 4Z7EA 4YMBA 1P1WA 4XKRA 5DT6A 3FXRA 3PU5A 2F34A 1NKXA 2Q8JA 2Q2AA 1BLFA 3H06B 4R74A 5DTBA 3V89B 1LAXA 4K3FA 1ZIUA 2QS4A 3C32A 4NF4A 4NEDA 1S50A 4EXLA 5AA3A 3N94A 5L9SA 1HSEA 2DXYA 1I6AA 2RKMA 5HBCA 4BLAA 1D9VA 1VFEA 2OJTA 3EQ1A 5BUUA 1B05A 4YKJA 1UIVA 2UYEA 4AQ4A 1FQCA 5KDTB 2X26A 4RK9A 4TLMB 2Z8DA 3TUSA 1BP5A 1OIBA 3MP1A 3OO9A 3O6HA 4IO6A 1VFDA 2E1SA 4FJPA 4NF4B 4ELPA 2GH9A 1ZKBA 4C1TA 4NF8A 5JEIA 4LQ2A 2NVUB 4IGRA 3VVEA 3SEXA 3H7MA 4EQBA 5BWJA 3C35A 4HS7A 1NNKA 2ZNTA 4YB6A 3CG3A 3SDFA 3U72A 2ZYOA 3Q27A 3MJNA 2I49A 4MLVA 1EZOA 3PV0E 3U93A 4OTEA 3G3HA 2XHDA 3RY3A 3FV1A 4G8MA 1RKMA 3C34A 3CFZA 3IB2A 1USYE 1JW5A 2DWIA 2OWTA 4GIZA 4GL0A 4G8HA 4LA9A 4OQOA 3K00A 2KLFA 3MAMA 3QUJA 2RCAA 1BKAA 4IGTA 1B58A 2I4BA 2PMSA 4R6HA 3H4ZA 4Z0IA 3TKDA 4C0RA 1TFAA 3FVGA 3PPNA 5I2NA 2QRYA 4JBZA 3H6VA 2ZNSA 3HSTA 3T9HB 4ECFA 5CMKA 3ZKKA 4E0WA 3JV9A 2HXWA 4RPNA 1MM7A 1QKBA 2Y7PA 1LCTA 1XS5A 1P1UA 1NH7A 2B65A 2Y7RA 1R1NA 4GOTA 4I9DA 4PFTA 5CI5A 4YB7A 1GV8A 4YU0A 3U94A 5B70A 1B5IA 1FQEA 2Z8EA 2ZYMA 1M5FA 2F5XA 4X1BA 4IO2A 1LLSA 3RGYA 3RT6B 1IEJA 3B7DA 4G68A 3L6HA 3T9VA 2XXVA 4OXVA 2RF1A 4LZ8A 4G4PA 5LOMA 3MP8A 5L8DA 4QFOA 4BDQA 5ISUA 4ZEDA 3ZSFA 5IKBA 3TPAA 3FGSA 2I4CA 1Y3PA 3MWBA 3DM0A 5J1DA 5ITPA 3LSFB 3HO7A 4ZZEA 5TP9A 4LATA 2PX1A 4U21A 1Y1MA 3IO6A 2DVCA 2WKYA 3C4MA 1R9QA 1QULA 3H6UA 1UTHB 4YKKA 1H44A 3PMWA 5HM4B 4XKQA 5KCJA 3PMXA 1MDP1 1OLAA 1RYXA 2CZLA 4KCDA 2BJJX 3LSWA 3I5OA 4FAJA 4EF1A 1NNTA 4RJZA 4DXBA 1H76A 4N07A 1SI0A 1O7TA 2FNCA 3QSLA 4LP2B 4PP0A 5JTYB 1I69A 1MRPA 1ZJLA 4GVOA 4HCYA 4F29A 2HAVA 4ND9A 5K2XA 1O64A 4XXUA 5I58B 5DEXB 1IITA 4POWA 2HQ0A 3VLWA 2O7IA 1WVJA 1NMUA 4KQPA 4QSEA 4RXLA 2XXWA 2ABHA 3IO4A 1US4A 1UTHA 2YLNA 1XVYA 3PUZE 3FJGA 4GQOA 5IAIA 4U4SA 2XX8A 1OVTA 3MZBA 1ATGA 1QVSA 1FW0A 3FATA 2DWJA 4DLDA 4ZEBA 2QPQA 4OENA 3UA8A 1B32A 1LBBA 1N7WA 4LONB 4G68C 4LVQA 4ELOA 1MPDA 3EPEA 2F97A 3PUVE 5A5XA 3V5AA 1ZU0A 4QFKA 1AMFA 1F9BA 3QK6A 2IA4A 1YPNA 4OFOA 4F1VA 4IO5A 1H45A 4GL8A 1DSNA 4H5FA 1JVYA 1MY0A 2VOZA 2ESNA 2FA7A 1B2HA 3IORA 2DP8A 4P0IA 1NH8A 3TMGA 3DP6A 1UTBA 2ONKE 4G77A 2E0SA 5CMBA 4UA8A 2P2AA 4JXIA 1IZ1A 3RTFB 2R71A 1URSA 1SI1A 3HCQA 1XVXA 4NWCA 5H8HA 2V3UA 3S9LC 4QSCA 1OQGA 3GLBA 3O29A 1M5DA 1BIYA 3CFLA 4EXKA 3B6QA 1II5A 1N76A 3N6TA 1P1NA 1M5BA 2NUVA 1QW0A 2XXHA 3BBRA 3R6UA 4LZ7A 4TQUQ 2ZNUA 4U4XA 3QAXA 3IOTA 3E4RA 5ICTA 3DP4A 4NF6A 4JDFA 2F7CA 3TCGA 3KSXA 4KYSA 3VV5A 1T0KA 5CMCA 3SEYA 3OSRA 4EQ9A 1ZMGA 2UXAA 5JTYA 3H03A 4X48A 5AA2B 3M3FA 4ESXA 1LBCA 2H4IA 1B40A 1JETA 1LGBC 2Y7IA 5I2KB 1LAHE 3TQWA 1SBPA 1Z7NE 4HTGA 1YTVA 4FATA 1B3HA 4QSDA 2I0CA 5KCJB 4BDNA 1SQYA 4KYEA 2XD3A 3KBRA 3MPLA 3UK4A 2DOJA 2AIXA 5TU0A 4R73A 4U2RA 1HSLA 4I1DA 2YPNA 5DEXA 2HZKA 3G3IA 3KN3A 1N7XA 1Q1KA 4H6DA 2QMXA 2P1SA 1A54A 4X9TA 1YCJA 2XXTA 2ZYNA 1GVCA 3TEPA 1HSJA 1J1NA 1WODA 2OK2A 3M3KA 3N26A 5AA2A 4NE4A 3Q26A 1IQ7A 3VFJA 1JW4A 5F7VA 5CRYA 3EHUA 1S7YA 2XXXA 3IR1A 3PUWE 4KYDA 3S9MC 4N6PA 3CSGA 4F2QA 4F3PA 4MLQA 5JK4A 4YZZA 5FTHA 5H8NA 3VE1B 4H1XA 3M8UA 2O68A 2G29A 2HFBA 2F8DA 3EHSA 3K6XA 5TP9B 3TDJA 3TTLA 1JEUA 4U1ZA 1MXVA 2I0BA 1UQWA 2F36A 2GFEA 1MY2A 2NXOA 3RQTA 2QL3A 3C9HA 2VD2A 3P7IA 1EU8A 3RN8A 2HCAA 4H8JA 3GBBA 4RA1A 4HW8A 4P0GA 1PB7A 4PETA 4KFQA 3CIJA 3G7WA 1B9JA 3I6VA 4R9GA 5DYHA 3SEWA 3T9UA 3PGFA 1EZPA 2O84X 4JB7A 4NWDA 3HHGA 2RINA 3H6TA 4ONYA 3WAFA 3VVDA 5I2NB 4H65A 1MQDA 2PBWA 2OCUA 5CM6A 4YMAA 1S9TA 4OEUA 3BFUA 5DVFA 3ONMA 1IUDA 5I56B 4R2FA 3PPQA 1GR2A 3VDFA 3O2AA 2A5TB 4EUOA 1O63A 1MY1A 4F3GA 4Q30B 4OHNA 3OENA 3CFXA 1EZ9A 2HAUA 4PE5B 4ZEFA 4GF8A 3TCFA 1M5EA 1I6BA 3JZJA 3OO8A 4JWYA 3WAEA 4OMBA 2V93A 3TTRA 4F18A 4GFRA 3TAJA 3LSXA 4DXCA 2XXIA 3M3LA 3A3CA 5CC2A 3K1NA 2F7AA 5KDTA 5AA2D 2QS2A 3MW0A 4KI0E
chains in the Genus database with same CATH superfamily
2WYKA 1MH4A 1IMFA 3KZGA 3QIMA 1A8FA 1FTJA 3TZAA 3MZ9A 3QXMA 1N04A 2F6PA 1MPBA 1FQDA 2VD3A 5H8HB 2XXUA 1D9YA 5I59B 2ZZWA 4YB5A 2VHAA 2GHBA 3MPKA 5I7IA 1G0HA 3DP8A 3V83A 4EF2A 3TELA 3S4UA 4OZ9A 3KN8A 2NWJA 2HZLA 4YKIA 3A3UA 1MY3A 5H8QA 1M5CA 4LZ5A 2O1MA 2B4MA 1B5JA 1FQAA 4NN3A 4QFPA 4OEVA 4GLIA 2XXRA 3RT8A 4E0XA 4AS4A 1XC1A 4TLLB 2ANJA 1SW2A 4PDDA 3K01A 1LB9A 1NL5A 2LAOA 2DS9A 4AB5A 1MQJA 1POY1 2VT5A 4WXJA 1MM6A 1ZTYA 3IK6B 4GXSB 1LCFA 4N13A 1ZLQA 4PF6A 3EHTA 3FASA 4IB2A 1B0LA 1EYJA 2QMWA 1DOTA 4I40A 1VR5A 5I56A 4JWOA 3OXNA 3W9WA 2XXQA 1PEBA 3UP9A 1KA0A 3S2VA 2DYXA 1ELJA 3UN6A 4ISUA 1D4NA 1LAFE 4GBVA 1GGGA 2UVJA 4PFUA 3CRBA 1R9LA 1N0TA 5H8FA 1IMAA 2CZIA 2XXKA 3F11A 4XFEA 3O6GA 3W9VA 5L9OA 2REGA 5AA1A 1B0HA 3MP6A 5EYGA 4MAGA 4NF8B 3TYHA 5FHMA 1QJMA 4OVTA 4R9FA 2QSXA 1YYZA 3G3JA 3MC2A 1LFGA 5AA4B 2XX7A 4JVDA 1A99A 2QVUA 3ILUB 4IY5A 5CBSA 3EN3A 2ZZVA 2BJIA 1CNQA 4F19A 5I59A 1B4ZA 2O1LA 4OFLA 4KCCA 3T9UA 2Q9TA 2V3QA 3QMFA 4MMPA 1IMCA 1OQHA 3KOTA 4ZE8A 4M1VA 3OELA 2M8CA 1RDZA 3D4CA 4IO7A 4O7MA 2B3BA 1SYHA 1B1HA 3KGCA 2RC8A 2O69A 2F6GA 1L5TA 2H9BA 1MQHA 4XKPA 3UORA 4YAHX 2YJPA 2NOOA 2DQVA 4ELQA 2O51A 4N6DA 2Q89A 2PFZA 2I6EA 3N6UA 2X7PA 3T9XB 4GWOA 3LSLA 1OLCA 1H3DA 4OERA 2H99A 2WBDA 4F39A 3DELB 1A40A 4R6YA 2X7QA 3HFUA 4KPTA 2F35A 4ESWA 4OVJA 3N5LA 2QVRA 1LAXA 4NF4A 4NEDA 3N94A 1I6AA 2RKMA 4BLAA 4X8RA 1D9VA 4YKJA 1UIVA 2UYEA 2X26A 1OIBA 2KQZA 1FPJA 4NF4B 2GH9A 1ZKBA 3SDFA 3Q27A 4MLVA 3U93A 3BIGA 2XHDA 1USYE 4GIZA 4G8HA 4HE1A 3MAMA 4GWWA 1B58A 4Z0IA 3H4ZA 3TKDA 3FVGA 2QRYA 4JBZA 4ECFA 3ZKKA 4NQ8A 4E0WA 4RPNA 2Y7PA 1QKBA 4I9DA 5CI5A 5EQ9A 4GOTA 1B5IA 4EQBA 2ZYMA 4X1BA 4IO2A 3L6HA 4O7IA 3T9VA 4OXVA 4QFOA 3TPAA 5ITPA 3IFCA 4NF0A 4LATA 1Y1MA 4IR8A 1QULA 3B8BA 1H44A 2BJJX 3LSWA 4FAJA 4EF1A 4DXBA 1SI0A 2FNCA 4F29A 2HAVA 4ND9A 4XXUA 5I58B 5DEXB 1IITA 4POWA 3VLWA 1NMUA 4KQPA 4RXLA 2XXWA 3PUZE 3FJGA 4PE3A 4N17A 3MZBA 3FATA 1FBHA 5LTCA 4DLDA 4GBWA 1N7WA 4LONB 4G68C 4LVQA 1MPDA 1DCUA 3BIHA 4X04A 4QFKA 4F1VA 4IO5A 1JVYA 2ESNA 2FA7A 1UTBA 5CMBA 2E0SA 4JXIA 1IZ1A 1KZ8A 1URSA 4QXDA 1SI1A 1XVXA 1FPFA 1BIYA 2PCRA 4U4XA 5ICTA 3DP4A 4NF6A 3TCGA 4PCDA 3OSRA 4EQ9A 4X48A 4ESXA 2H4IA 4ZECA 5I2KB 1LAHE 4FATA 1B3HA 1FBFA 2AIXA 5TU0A 4R73A 1BK4A 4U2RA 3KN3A 1N7XA 2QMXA 2XXTA 1KA1A 1HSJA 1NUXA 5AA2A 3EHUA 3PUWE 4N6PA 4F3PA 4MLQA 5FTHA 3VE1B 3EHSA 2HFBA 3K6XA 3TDJA 5J1DA 1JEUA 1MXVA 1UQWA 2GFEA 2WYPA 3RN8A 2HCAA 4HW8A 3GBBA 4KFQA 1EZPA 4NWDA 3S9EA 2RINA 4ONYA 4G61A 1MQDA 5CM6A 3BFUA 3ONMA 5I56B 4EUOA 1O63A 3FXBA 2HAUA 3TCFA 1NUZA 3JZJA 4JWYA 4PFBA 3TTRA 4DXCA 3M3LA 2F7AA 3MW0A 1SW5A 1A55A 4R75A 5CBRA 1Y4CA 5H8FB 1DPPA 5I57A 4MNPA 2R9JA 4F3SA 4RNSA 4F22A 3A09A 1NV6A 3AXFA 1US5A 3GZGA 2Z23A 2AL5A 1N3XA 4P11A 4NF6B 2DE4A 2XX9A 1TWYA 1MXZA 3LC8A 2R6GE 4QBAA 3VXCA 2O7UA 3OSQA 1A7LA 4HCWA 3K2DA 1MY4A 5ITOA 3PPOA 3VVFA 1FTKA 3O28A 1B6HA 4I8CA 3CR9A 4YICA 4NF5A 2RCBA 3UGWA 2VPOA 4OVRA 3TCHA 5HPQA 3R7XA 1B3FA 3K0VA 2XWKA 4ELRA 3LBSA 4N6KA 2I3VA 4H5GA 3RNNA 3PPRA 4OYVA 5I2KA 1NNPA 1DMBA 1FRPA 2W7YA 4MF3A 1G0IA 1VE4A 1WDNA 5IZZA 1DTZA 3I3VA 5EYHA 1IXGA 2Q88A 2RC9A 1MXWA 2F3BA 2VP1A 1DK4A 3O9PA 5CMMA 3VLUA 1IXHA 1NNFA 3MVXA 3PPPA 2DWAA 1Y20A 4FIMA 3OMBA 3HPIA 2RC7A 2CZHA 4NGUA 1PBQA 4KHZE 4DZ1A 4PAFA 1B46A 3QUFA 3MQ9A 2GRVA 3KOSA 1D9QA 3E3KA 1I6QA 2G93A 3VXBA 4ZS9A 2Y7KA 3DLNA 4ZE9A 5ET5A 4DCXA 5H8SA 4GWSA 3L6GA 1IXCA 1ZBMA 4R6KA 2QFLA 3C33A 4AS5A 3TTMA 1GTKA 2OZZA 5DVIA 1RYOA 3GBAA 4M4GA 1URGA 4IO3A 4IO4A 3FXQA 3FJ7A 2H5YA 1FQFA 2WEFA 4GXAA 1FJ9A 1NV3A 4QFLA 1Y3QA 2P3NA 3FJMA 4GD5A 2THIA 1Y4TA 1JW1A 5T3JA 3V8XB 2I58A 3ODBA 1B3GA 3FZVA 3FVNA 4ZEKA 1QUJA 3C36A 3T22A 2GHAA 1N84A 2ONSA 2O6AA 5IAIA 3MVZA 5F1QA 1XOCA 5ELVA 4MX6A 4JVCA 4XEQA 5J16A 2PVUA 2H98A 1EH3A 4UABA 1B5HA 3RPWA 1B3EA 2I48A 4U23A 3H6WA 1B52A 2ZYKA 2FHYA 3EKIA 1NKXA 4LN5A 1LEVA 2Q8JA 3H06B 4R74A 2DDKA 5DTBA 4K3FA 1ZIUA 1FPIA 1S50A 4EXLA 4OVSA 2DXYA 5HBCA 4HE0A 2OJTA 1LBXA 4RK9A 1NUWA 4IO6A 2QVVA 4FJPA 4C1TA 4NF8A 5JEIA 2NVUB 3H7MA 4P1LA 1NNKA 3CG3A 4O94A 3RY3A 1JW5A 2DWIA 4OQOA 2KLFA 2RCAA 3T0JA 2HXWA 1MM7A 2Y7RA 4YB7A 5B70A 4I3YA 5I5PA 2Q74A 3RT6B 2F5XA 1LBZA 1LLSA 1IEJA 4G68A 1EYIA 4G4PA 5LOMA 1LBYA 4ZEDA 3FGSA 2I4CA 1Y3PA 3MWBA 4NAPA 5TP9A 1Q9DA 3IO6A 5FBPA 4O8MA 1R9QA 4YKKA 2OX3A 5HM4B 5KCJA 3PMXA 2CZLA 1NNTA 5EQAA 1H76A 4N07A 3QSLA 1O7TA 5JTYB 1MRPA 4QSEA 3IO4A 4JVIA 1FPGA 3LUZA 2DWJA 4OENA 1B32A 3EPEA 2F97A 2R8TA 1ZU0A 1AMFA 4OFOA 1YPNA 1H45A 1DSNA 1QGXA 2VOZA 4P0IA 3IORA 3ZS6A 3TMGA 3RTFB 4NWCA 3S9LC 3O29A 1FBCA 1II5A 4PFRA 2XXHA 3BBRA 3R6UA 3RPLB 4PFIA 2F7CA 5CMCA 1ZMGA 2UXAA 3H03A 3M3FA 4MJOA 3TQWA 1LGBC 1SBPA 2I0CA 4BDNA 3UK4A 2PFYA 2DOJA 4I1DA 2YPNA 1Q1KA 4H6DA 2P1SA 1YCJA 1GVCA 3TEPA 1J1NA 4N81A 3VFJA 1JW4A 1S7YA 1IMDA 4KYDA 3S9MC 3CSGA 3LV0A 3ROJA 4H1XA 2O68A 4N15A 5ESYA 3TTLA 4U1ZA 2F36A 2NXOA 2VD2A 1EU8A 4H8JA 1NV2A 3G7WA 4R9GA 1DBZA 3KC1A 3H6TA 4H65A 2PBWA 2OCUA 1IUDA 3PPQA 1GR2A 4GX6A 1MY1A 4Q30B 4OHNA 3OENA 3CFXA 3OO8A 3LSXA 3A3CA 5CC2A 3K1NA 5IM2A 5L8DA 4KI0E 5ISUA 4RK2A 5FHOA 2JJKA 3U92A 3Q25A 4OESA 3FD3A 1XI6A 3IAZA 1B51A 3IX1A 1PB9A 2HPGA 2VGQA 2ALUA 2Y7WA 3BFTA 2V4CA 5H8NB 4C1UA 3ILTB 1SW1A 1FPEA 3MBPA 4DIGA 1IMBA 1FCKA 3K4UA 1TT1A 1P1OA 3KSJA 3T96B 4MHFA 4H67A 5A5XB 2Q2CA 1VDWA 1QKAA 5IGAA 1SVXB 2DSFA 4BDLA 2VPNA 4MEVA 3FIRA 3O66A 1MS7A 2DE2A 1POTA 2QS1A 3H3GA 1ANFA 2I3WA 3G3GA 3TTKA 4H46A 3W15C 3U65A 2V3TA 1B3LA 1MXXA 3KJTA 4G2ZA 3FBPA 4G68B 3RLFE 4QF9A 4F3BA 4QFNA 4RPOA 2D5WA 1LSTA 4MNCA 2CEYA 3B50A 3IJXB 1SDXA 4POXA 1DTGA 1B1XA 3CSBA 2FIEA 1TXFA 4GRKA 2AL4A 2Z8FA 3V5AA 1Y9UA 5TPAA 1FTMA 2QJEA 3Q29A 2ZXTA 3OD7A 1R6ZA 3GXAA 1AIVA 4YKPA 2A5SA 1P1QA 4GX3A 2ONRA 1CB6A 4PFWA 4PGPA 5TPAB 4OANA 4BDMA 2Y84A 1NV0A 1CE2A 1YZ0A 3BKIB 3G3KA 4N8GA 1LFHA 2F7BA 4GWZA 5KZTA 2P0SA 1P99A 3GYYA 3MVWA 1LAGE 5AE4A 1AOVA 1MXYA 4PQJA 3SERA 1LFIA 3E9XA 4LQ5A 4NF5B 5DW8A 1YAEA 2HEUA 3K6VA 4KXPA 1SW4A 2V25A 2P3VA 1PC3A 1MG1A 3LR1A 4R2BA 1KWHA 3G3FA 4GWYA 5K2YA 2D3IA 5ICQA 3IOWA 1URDA 1IXIA 3PMVA 4QHQA 1Y1ZA 1NUYA 4GX4A 4PDHA 2UVHA 3K02A 3SKPA 5LDZA 1FQBA 2QS3A 1JQFA 3MUQA 2PT1A 1XT8A 3PUXE 1BTJA 4L17A 3PD9A 4DE8A 2PYYA 3ECRA 4ZEIA 2WBBA 2A5TA 3IB0A 1QUKA 2F78A 4ZDMA 4I62A 2V84A 4KR5A 3SEVA 1A8EA 3TQLA 3SETA 2Y5KA 3TTNA 4F1YA 1USYH 3FVOA 2Q8MA 4RYAA 4XKNA 1NFTA 2XWVA 3MZ1A 4AB6A 2XWOA 3FV2A 4NMYA 4YMBA 2F34A 2Q2AA 3V89B 3C32A 5L9SA 1HSEA 1VFEA 3EQ1A 5BUUA 5KDTB 3TUSA 1BP5A 1FBGA 3MP1A 3OO9A 3O6HA 1VFDA 2E1SA 4ELPA 4LQ2A 4IGRA 3SEXA 4HS7A 2ZNTA 4YB6A 3U72A 3MJNA 1EZOA 4G8MA 1RKMA 3C34A 3CFZA 3IB2A 1FTAA 4IGTA 2I4BA 4R6HA 1TFAA 3PPNA 3H6VA 2ZNSA 3HSTA 5CMKA 2CEXA 1IMEA 1LCTA 1P1UA 3TFLA 4PFTA 3U94A 1FQEA 2Z8EA 2XXVA 2RF1A 3MP8A 4BDQA 1FPKA 3ZSFA 3DM0A 4P3LA 2FVZA 3LSFB 2PX1A 1FBPA 3C4MA 1MDP1 1OLAA 1RYXA 4RJZA 4PTKA 2WX9A 4LP2B 4PP0A 1I69A 5K2XA 2HQ0A 2O7IA 1NV1A 4GQOA 1XVYA 2KR0A 4PAKA 4XF5A 4ZEBA 2QPQA 1LBBA 4ELOA 2GQ1A 3PUVE 1F9BA 2IA4A 4EDPA 1B2HA 5I57B 2DP8A 2ONKE 4G77A 5IZ1A 2R71A 3HCQA 4QSCA 1M5DA 4EXKA 1N76A 4WKMA 3N6TA 1P1NA 1NI9A 4TQUQ 4LZ7A 2ZNUA 3IOTA 3E4RA 4I3EA 3SEYA 5AA2B 1NV7A 2Y7IA 1B40A 1Z7NE 4QSDA 1SQYA 4KYEA 2XD3A 3KBRA 4GWUA 1HSLA 2HZKA 1A54A 2OK2A 4NE4A 5F7VA 5CRYA 4P9KA 4F2QA 4YZZA 3M8UA 2G29A 5TP9B 1FSAA 3RQTA 2QL3A 3C9HA 3T1BA 3P7IA 3SEWA 3CIJA 3I6VA 1B9JA 1FPLA 5DYHA 2O84X 3WAFA 5I2NB 3IFAA 3RYDA 1S9TA 1FBEA 5DVFA 3VDFA 2A5TB 4FBPA 1FJ6A 1RDXA 1EZ9A 4ZEFA 1M5EA 1I6BA 4OMBA 2V93A 4F18A 3TAJA 2XXIA 5KDTA 5AA2D 4PAIA 3H6UA 3O2AA 2QS2A 4O3AA 3OO6A 1VSOA 2DWHA 5L9MA 5EHMA 4MH5A 2UVIA 2AYSA 3T66A 3IJOB 4XIGQ 3IOUA 3SESA 4G8NA 4EQ7A 4UACA 1B4HA 3B6WA 3Q28A 3C31A 3E13X 4Q0CA 3K1MA 1JNFA 2FBPA 3UIFA 1MQGA 1UIUA 2DE3A 3U8QA 4FEDA 1LBWA 3JYRA 1AL3A 4KD5A 2OWZA 3S9NC 4ZZAA 3IB1A 4NG7A 3MSTA 4P47A 3OEMA 3KFMA 1SYIA 4OETA 3HN0A 1NV4A 1PDAA 1Y3NA 3E79A 4PFYA 1H43A 2OBGA 3T93B 3CG1A 4NX1A 3TODA 3FVKA 5DVJA 4F31B 1N3WA 4WEPA 2OLBA 4PF8A 3THIA 2CMOA 4NTLA 4THIA 4PBQA 1FBDA 1LB8A 4TOZA 4F1UA 5EQ7A 3FUZA 4WEDA 3VLVA 3RUMA 1OMPA 3B6TA 3USDA 1JVXA 1DPEA 2F3DA 3MVYA 4U1OA 4RY1A 3IOVA 3K1PA 3FXUA 2XD2A 3R26A 4FECA 3OOAA 1IIWA 4BDRA 1Q35A 4DXUA 5FHNA 1XHYA 4JSOA 1JEVA 5EYFA 3CI8A 4BDOA 4XTCQ 4PGNA 4DDDA 4F2OA 4JSDA 1D3KA 4H8IA 5B7DA 1OVBA 4P56A 1PB8A 5ET6A 5I84A 2B3FA 3HV1A 2UYFA 4MIJA 4DI4B 5H8QB 1NV5A 1MH3A 5A5LA 3A29A 1MDQA 4JWXA 2DXRA 2H25A 4O3BA 3K6UA 1PBPA 4IY6A 2UVGA 5I2NA 2FYIA 5ET7A 2IEEA 3ZKLA 3RGYA 3PD8A 2REJA 3ISPA 1B7ZA 3LUYA 4H0WA 4FORA 2XXYA 3KEIA 4Q8RA 5FTIA 4X1DA 4N4UA 1B7HA 2Y5LA 4FEBA 1MQIA 4GWXA 4MFIA 2DVZA 1AH5A 2Z22A 3PUYE 1LBVA 3D1RA 3KG2A 4MBPA 1Z7ME 1FTLA 3KN7A 4PC9A 3QYTA 4N91A 4OFJA 3OO7A 1MXUA 4OA4A 3CHGA 4LUBA 2XXPA 1B7UA 4O3CA 4OWDA 4DCYA 1AWBA 1TFDA 3O6IA 1UTBB 1SD3A 3O97A 3IL1B 4P1EA 4QRZA 3UA8A 3K6WA 5IZ3B 5EHSA 5M2VA 2OWSA 1QUIA 4FE8A 3RTWB 2FIXA 3KJ7A 4U22A 3D4GA 3OEKA 1YXIA 3SEUA 2ZMBA 3EF7A 3U1OA 2D21A 3RPLA 4R72A 3CVGA 4MCOA 4Q5TA 1JP4A 1MPCA 5I58A 5AA4A 2PT2A 1FTOA 4Z7EA 1P1WA 4XKRA 5DT6A 3FXRA 3PU5A 1BLFA 2QS4A 5AA3A 1RDYA 1B05A 4HE2A 4HXVA 4MNIA 4AQ4A 1FQCA 2HXRA 4TLMB 2Z8DA 1EYKA 3KBZA 3E78A 3VVEA 3C35A 2ZYOA 2I49A 3PV0E 4OTEA 3G3HA 2ZZXA 3FV1A 4GL0A 2OWTA 2XA5A 4LA9A 3K00A 3QUJA 1BKAA 2PMSA 4C0RA 3T9HB 3JV9A 3HHFA 1XS5A 2B65A 1NH7A 1GV8A 1R1NA 4YU0A 1M5FA 3B7DA 5ET8A 4LZ8A 5IKBA 2XWIA 1K9YA 3HO7A 4ZZEA 4U21A 2DVCA 2MKZA 2WKYA 3SZPA 1FPBA 1UTHB 3PMWA 4XKQA 4KCDA 3I5OA 1FPDA 1ZJLA 4HCYA 2CZKA 4GVOA 4PBHA 1O64A 1WVJA 2ABHA 1US4A 1UTHA 2YLNA 4H45A 4U4SA 2XX8A 1OVTA 1ATGA 1QVSA 1FW0A 4P8BA 5A5XA 3QK6A 4GL8A 4H5FA 1MY0A 3PTYA 4N8YA 1NH8A 3DP6A 4UA8A 2P2AA 2HHMA 5H8HA 2V3UA 1OQGA 3GLBA 3CFLA 3B6QA 5I3SA 2NUVA 1M5BA 3KC0A 1QW0A 5IZ3A 1K9ZA 3QAXA 4JDFA 3KSXA 4KYSA 3VV5A 1T0KA 5JTYA 1LBCA 1JETA 4HTGA 1YTVA 5KCJB 4OVQA 3MPLA 5DEXA 5BWJA 3G3IA 1INPA 4X9TA 2ZYNA 3M3KA 1WODA 3N26A 3Q26A 1IQ7A 4DI3D 2XXXA 3IR1A 2L5VA 5EQ8A 5JK4A 5H8NA 2F8DA 2B4LA 2I0BA 3NOHA 1MY2A 4NHBA 4RA1A 3MYUA 1PB7A 4P0GA 4PETA 3PGFA 5F24A 4JB7A 3HHGA 3VVDA 4OVPA 4YMAA 4OEUA 4R2FA 1SPIA 4F3GA 4PE5B 4GF8A 3WAEA 4GFRA
chains in the Genus database with same CATH topology
1SW5A 4O3AA 1A55A 4RK2A 4R75A 5FHOA 5CBRA 3U92A 3Q25A 4OESA 1MH4A 1Y4CA 3FD3A 5H8FB 1DPPA 1VSOA 3OO6A 2R9JA 3KZGA 4F3SA 5I57A 3QIMA 4RNSA 2DWHA 3IAZA 4EDPA 4F22A 1A8FA 1FTJA 3A09A 3TZAA 1B51A 3IX1A 1PB9A 3MZ9A 3QXMA 5L9MA 1N04A 4MH5A 5EHMA 2F6PA 1MPBA 2UVIA 1FQDA 2AYSA 2VD3A 5H8HB 2VGQA 3AXFA 3T66A 2XXUA 2ALUA 2Y7WA 1D9YA 5I59B 3IJOB 3BFTA 4YB5A 4XIGQ 3IOUA 1US5A 2VHAA 3GZGA 2GHBA 2AL5A 2Z23A 4G8NA 1N3XA 3SESA 5FHNA 4EQ7A 5H8NB 4P11A 4NF6B 4UACA 3ILTB 4C1UA 1B4HA 1SW1A 3B6WA 2DE4A 3MBPA 3C31A 3E13X 3Q28A 3MPKA 4DIGA 3V83A 3DP8A 1FCKA 4Q0CA 4EF2A 3TELA 3K1MA 3S4UA 1JNFA 1TT1A 3K4UA 2XX9A 1TWYA 4OZ9A 3UIFA 1MQGA 1P1OA 1UIUA 2DE3A 1MXZA 2HZLA 3KN8A 4FEDA 2NWJA 3LC8A 3U8QA 4YKIA 3A3UA 1MY3A 2R6GE 3VXCA 2O7UA 3OSQA 5H8QA 3JYRA 1AL3A 1M5CA 4KD5A 3S9NC 3KSJA 3IB1A 4LZ5A 4ZZAA 3T96B 2O1MA 1A7LA 4HCWA 3K2DA 1MY4A 1B5JA 5ITOA 3OEMA 1FQAA 3KFMA 4H67A 1SYIA 5A5XB 2Q2CA 3PPOA 4OETA 1FTKA 4QFPA 3VVFA 3HN0A 1B6HA 3O28A 4I8CA 3CR9A 1PDAA 1QKAA 4YICA 4OEVA 4GLIA 2XXRA 4NF5A 1SVXB 1Y3NA 2DSFA 3RT8A 4PFYA 4BDLA 4E0XA 1H43A 2OBGA 2RCBA 3FIRA 3O66A 1MS7A 1XC1A 3T93B 2DE2A 1POTA 4TLLB 3UGWA 2ANJA 3CG1A 3TODA 2QS1A 1SW2A 3FVKA 5DVJA 4F31B 3H3GA 1ANFA 3K01A 2I3WA 1LB9A 1NL5A 3G3GA 2LAOA 3TCHA 1N3WA 2DS9A 3TTKA 1MQJA 1POY1 3R7XA 3W15C 4WXJA 4AB5A 5HPQA 2V3TA 1B3LA 1MXXA 1MM6A 3KJTA 4ZECA 1ZTYA 3IK6B 4G2ZA 4GXSB 1B3FA 4WEPA 2OLBA 3THIA 1LCFA 4WKMA 4G68B 3K0VA 2CMOA 4QF9A 4NTLA 3LBSA 4THIA 4QFNA 4N13A 2I3VA 4RPOA 3RLFE 4ELRA 4F3BA 4H5GA 2D5WA 3RNNA 1LSTA 1LB8A 1ZLQA 4TOZA 3EHTA 3FASA 3PPRA 4F1UA 4OYVA 4IB2A 5I2KA 1NNPA 3FUZA 1B0LA 1DMBA 2QMWA 4WEDA 3VLVA 3IJXB 1DOTA 2W7YA 3RUMA 1OMPA 1VR5A 3B6TA 4JWOA 3USDA 5I56A 1JVXA 3OXNA 1DPEA 3MVYA 4MF3A 4U1OA 1VE4A 3W9WA 1WDNA 1SDXA 4RY1A 2XXQA 1PEBA 1DTZA 3I3VA 3IOVA 3K1PA 3FXUA 1IXGA 4POXA 3S2VA 1DTGA 2Q88A 2XD2A 3UP9A 3R26A 1B1XA 4FECA 3CSBA 3OOAA 2DYXA 2RC9A 1IIWA 4BDRA 1TXFA 4GRKA 1Q35A 1MXWA 2VP1A 1ELJA 3UN6A 2AL4A 3O9PA 4ISUA 5CMMA 4DXUA 2Z8FA 1D4NA 1LAFE 1JEVA 1GGGA 1XHYA 2UVJA 1Y9UA 3CI8A 3CRBA 4PFUA 4XTCQ 5EYFA 4BDOA 1R9LA 3ZS6A 1N0TA 5TPAA 3VLUA 1FTMA 2QJEA 1IXHA 1NNFA 3MVXA 3Q29A 4DDDA 4F2OA 3PPPA 5H8FA 3TFLA 3F11A 4JSDA 2DWAA 1D3KA 1Y20A 2ZXTA 3OD7A 1R6ZA 3GXAA 4FIMA 4H8IA 5B7DA 3O6GA 3OMBA 3HPIA 2RC7A 3W9VA 5L9OA 1OVBA 1AIVA 2REGA 4YKPA 1PBQA 1B0HA 1PB8A 1P1QA 2A5SA 3MP6A 4NF8B 2ONRA 2B3FA 5FHMA 3TYHA 5I84A 1CB6A 4KHZE 4PFWA 1QJMA 4DZ1A 5I57B 5TPAB 3HV1A 2UYFA 4BDMA 1B46A 2Y84A 3QUFA 5H8QB 4R9FA 2QSXA 3G3JA 1CE2A 3MC2A 1MH3A 4JSOA 1LFGA 3BKIB 3G3KA 3MQ9A 2GRVA 3KOSA 1LFHA 2F7BA 5AA4B 3E3KA 1I6QA 2XX7A 5KZTA 1A99A 2P0SA 1P99A 3MVWA 1LAGE 5AE4A 3ILUB 1AOVA 1MXYA 1MDQA 4PQJA 3SERA 2G93A 4IY5A 4DCXA 1LFIA 3E9XA 4JWXA 4LQ5A 2DXRA 4NF5B 5H8SA 3VXBA 3EN3A 5CBSA 4ZS9A 2H25A 1YAEA 4F19A 2Y7KA 3DLNA 4O3BA 2HEUA 3K6UA 4ZE9A 5I59A 3K6VA 1PBPA 4IY6A 1B4ZA 1SW4A 2UVGA 2O1LA 2V25A 4OFLA 1PC3A 1MG1A 2FYIA 4KCCA 2IEEA 3L6GA 1IXCA 1ZBMA 2Q9TA 2V3QA 3C33A 3LR1A 4R2BA 4R6KA 3PD8A 1KWHA 2REJA 1GTKA 3G3FA 3TTMA 2OZZA 1OQHA 5DVIA 5K2YA 2D3IA 3KOTA 4ZE8A 5ICQA 1RYOA 1URDA 1B7ZA 3IOWA 3LUYA 4H0WA 4M1VA 4FORA 2XXYA 1IXIA 3KEIA 3GBAA 3OELA 4Q8RA 3PMVA 4M4GA 1URGA 2M8CA 4IO3A 4QHQA 5FTIA 4X1DA 4IO4A 3FXQA 1Y1ZA 1B7HA 5AA1A 3FJ7A 2H5YA 3D4CA 4FEBA 1MQIA 1FQFA 3HHFA 4IO7A 2UVHA 4MFIA 3K02A 4GXAA 3ZKLA 3SKPA 2DVZA 1FQBA 1AH5A 2Z22A 4QFLA 2QS3A 1JQFA 1Y3QA 3FJMA 3PUYE 3KG2A 3MUQA 4GD5A 4MBPA 2B3BA 2PT1A 1SYHA 2THIA 1B1HA 1Y4TA 1Z7ME 1JW1A 1FTLA 1XT8A 3KGCA 3KN7A 3V8XB 2I58A 2RC8A 3PUXE 3QYTA 3ODBA 2O69A 2F6GA 1BTJA 4L17A 4OFJA 3OO7A 1B3GA 1MXUA 3FZVA 4LUBA 3FVNA 2XXPA 1L5TA 4ZEKA 2H9BA 1B7UA 1QUJA 4O3CA 4OWDA 3PD9A 3C36A 4DE8A 4DCYA 1MQHA 2PYYA 3ECRA 4XKPA 4ZEIA 3UORA 3T22A 4YAHX 1TFDA 2A5TA 2GHAA 1N84A 2YJPA 3O6IA 2NOOA 2DQVA 3IB0A 2O51A 1UTBB 1SD3A 4ELQA 3O97A 3IL1B 2ONSA 2Q89A 1QUKA 2F78A 2I6EA 2O6AA 4QRZA 3K6WA 3N6UA 4ZDMA 4I62A 2V84A 4KR5A 2X7PA 3SEVA 3T9XB 3S9EA 5EHSA 1A8EA 5M2VA 2OWSA 4GWOA 1QUIA 4FE8A 3MVZA 3TQLA 3LSLA 1OLCA 5F1QA 3RTWB 1XOCA 5ELVA 3SETA 3TTNA 1H3DA 4OERA 3KJ7A 2H99A 4U22A 3D4GA 3OEKA 4F1YA 3SEUA 1USYH 2ZMBA 2PVUA 3EF7A 2H98A 3FVOA 1EH3A 4RYAA 3U1OA 4F39A 4XKNA 1NFTA 2D21A 3DELB 1B5HA 3MZ1A 3RPWA 1A40A 4R72A 3CVGA 4AB6A 1B3EA 4Q5TA 1MPCA 2I48A 2X7QA 4R6YA 5I58A 4U23A 5AA4A 2PT2A 1FTOA 3H6WA 2F35A 4KPTA 3FV2A 4ESWA 4OVJA 4NMYA 1B52A 2ZYKA 3N5LA 4Z7EA 4YMBA 1P1WA 4XKRA 5DT6A 3FXRA 3PU5A 2F34A 1NKXA 2Q8JA 2Q2AA 1BLFA 3H06B 4R74A 5DTBA 3V89B 1LAXA 4K3FA 1ZIUA 2QS4A 3C32A 4NF4A 4NEDA 1S50A 4EXLA 5AA3A 3N94A 5L9SA 1HSEA 2DXYA 1I6AA 2RKMA 5HBCA 4BLAA 1D9VA 1VFEA 2OJTA 3EQ1A 5BUUA 1B05A 4YKJA 1UIVA 2UYEA 4AQ4A 1FQCA 5KDTB 2X26A 4RK9A 4TLMB 2Z8DA 3TUSA 1BP5A 1OIBA 3MP1A 3OO9A 3O6HA 4IO6A 1VFDA 2E1SA 4FJPA 4NF4B 4ELPA 2GH9A 1ZKBA 4C1TA 4NF8A 5JEIA 4LQ2A 2NVUB 4IGRA 3VVEA 3SEXA 3H7MA 4EQBA 5BWJA 3C35A 4HS7A 1NNKA 2ZNTA 4YB6A 3CG3A 3SDFA 3U72A 2ZYOA 3Q27A 3MJNA 2I49A 4MLVA 1EZOA 3PV0E 3U93A 4OTEA 3G3HA 2XHDA 3RY3A 3FV1A 4G8MA 1RKMA 3C34A 3CFZA 3IB2A 1USYE 1JW5A 2DWIA 2OWTA 4GIZA 4GL0A 4G8HA 4LA9A 4OQOA 3K00A 2KLFA 3MAMA 3QUJA 2RCAA 1BKAA 4IGTA 1B58A 2I4BA 2PMSA 4R6HA 3H4ZA 4Z0IA 3TKDA 4C0RA 1TFAA 3FVGA 3PPNA 5I2NA 2QRYA 4JBZA 3H6VA 2ZNSA 3HSTA 3T9HB 4ECFA 5CMKA 3ZKKA 4E0WA 3JV9A 2HXWA 4RPNA 1MM7A 1QKBA 2Y7PA 1LCTA 1XS5A 1P1UA 1NH7A 2B65A 2Y7RA 1R1NA 4GOTA 4I9DA 4PFTA 5CI5A 4YB7A 1GV8A 4YU0A 3U94A 5B70A 1B5IA 1FQEA 2Z8EA 2ZYMA 1M5FA 2F5XA 4X1BA 4IO2A 1LLSA 3RGYA 3RT6B 1IEJA 3B7DA 4G68A 3L6HA 3T9VA 2XXVA 4OXVA 2RF1A 4LZ8A 4G4PA 5LOMA 3MP8A 5L8DA 4QFOA 4BDQA 5ISUA 4ZEDA 3ZSFA 5IKBA 3TPAA 3FGSA 2I4CA 1Y3PA 3MWBA 3DM0A 5J1DA 5ITPA 3LSFB 3HO7A 4ZZEA 5TP9A 4LATA 2PX1A 4U21A 1Y1MA 3IO6A 2DVCA 2WKYA 3C4MA 1R9QA 1QULA 3H6UA 1UTHB 4YKKA 1H44A 3PMWA 5HM4B 4XKQA 5KCJA 3PMXA 1MDP1 1OLAA 1RYXA 2CZLA 4KCDA 2BJJX 3LSWA 3I5OA 4FAJA 4EF1A 1NNTA 4RJZA 4DXBA 1H76A 4N07A 1SI0A 1O7TA 2FNCA 3QSLA 4LP2B 4PP0A 5JTYB 1I69A 1MRPA 1ZJLA 4GVOA 4HCYA 4F29A 2HAVA 4ND9A 5K2XA 1O64A 4XXUA 5I58B 5DEXB 1IITA 4POWA 2HQ0A 3VLWA 2O7IA 1WVJA 1NMUA 4KQPA 4QSEA 4RXLA 2XXWA 2ABHA 3IO4A 1US4A 1UTHA 2YLNA 1XVYA 3PUZE 3FJGA 4GQOA 5IAIA 4U4SA 2XX8A 1OVTA 3MZBA 1ATGA 1QVSA 1FW0A 3FATA 2DWJA 4DLDA 4ZEBA 2QPQA 4OENA 3UA8A 1B32A 1LBBA 1N7WA 4LONB 4G68C 4LVQA 4ELOA 1MPDA 3EPEA 2F97A 3PUVE 5A5XA 3V5AA 1ZU0A 4QFKA 1AMFA 1F9BA 3QK6A 2IA4A 1YPNA 4OFOA 4F1VA 4IO5A 1H45A 4GL8A 1DSNA 4H5FA 1JVYA 1MY0A 2VOZA 2ESNA 2FA7A 1B2HA 3IORA 2DP8A 4P0IA 1NH8A 3TMGA 3DP6A 1UTBA 2ONKE 4G77A 2E0SA 5CMBA 4UA8A 2P2AA 4JXIA 1IZ1A 3RTFB 2R71A 1URSA 1SI1A 3HCQA 1XVXA 4NWCA 5H8HA 2V3UA 3S9LC 4QSCA 1OQGA 3GLBA 3O29A 1M5DA 1BIYA 3CFLA 4EXKA 3B6QA 1II5A 1N76A 3N6TA 1P1NA 1M5BA 2NUVA 1QW0A 2XXHA 3BBRA 3R6UA 4LZ7A 4TQUQ 2ZNUA 4U4XA 3QAXA 3IOTA 3E4RA 5ICTA 3DP4A 4NF6A 4JDFA 2F7CA 3TCGA 3KSXA 4KYSA 3VV5A 1T0KA 5CMCA 3SEYA 3OSRA 4EQ9A 1ZMGA 2UXAA 5JTYA 3H03A 4X48A 5AA2B 3M3FA 4ESXA 1LBCA 2H4IA 1B40A 1JETA 1LGBC 2Y7IA 5I2KB 1LAHE 3TQWA 1SBPA 1Z7NE 4HTGA 1YTVA 4FATA 1B3HA 4QSDA 2I0CA 5KCJB 4BDNA 1SQYA 4KYEA 2XD3A 3KBRA 3MPLA 3UK4A 2DOJA 2AIXA 5TU0A 4R73A 4U2RA 1HSLA 4I1DA 2YPNA 5DEXA 2HZKA 3G3IA 3KN3A 1N7XA 1Q1KA 4H6DA 2QMXA 2P1SA 1A54A 4X9TA 1YCJA 2XXTA 2ZYNA 1GVCA 3TEPA 1HSJA 1J1NA 1WODA 2OK2A 3M3KA 3N26A 5AA2A 4NE4A 3Q26A 1IQ7A 3VFJA 1JW4A 5F7VA 5CRYA 3EHUA 1S7YA 2XXXA 3IR1A 3PUWE 4KYDA 3S9MC 4N6PA 3CSGA 4F2QA 4F3PA 4MLQA 5JK4A 4YZZA 5FTHA 5H8NA 3VE1B 4H1XA 3M8UA 2O68A 2G29A 2HFBA 2F8DA 3EHSA 3K6XA 5TP9B 3TDJA 3TTLA 1JEUA 4U1ZA 1MXVA 2I0BA 1UQWA 2F36A 2GFEA 1MY2A 2NXOA 3RQTA 2QL3A 3C9HA 2VD2A 3P7IA 1EU8A 3RN8A 2HCAA 4H8JA 3GBBA 4RA1A 4HW8A 4P0GA 1PB7A 4PETA 4KFQA 3CIJA 3G7WA 1B9JA 3I6VA 4R9GA 5DYHA 3SEWA 3T9UA 3PGFA 1EZPA 2O84X 4JB7A 4NWDA 3HHGA 2RINA 3H6TA 4ONYA 3WAFA 3VVDA 5I2NB 4H65A 1MQDA 2PBWA 2OCUA 5CM6A 4YMAA 1S9TA 4OEUA 3BFUA 5DVFA 3ONMA 1IUDA 5I56B 4R2FA 3PPQA 1GR2A 3VDFA 3O2AA 2A5TB 4EUOA 1O63A 1MY1A 4F3GA 4Q30B 4OHNA 3OENA 3CFXA 1EZ9A 2HAUA 4PE5B 4ZEFA 4GF8A 3TCFA 1M5EA 1I6BA 3JZJA 3OO8A 4JWYA 3WAEA 4OMBA 2V93A 3TTRA 4F18A 4GFRA 3TAJA 3LSXA 4DXCA 2XXIA 3M3LA 3A3CA 5CC2A 3K1NA 2F7AA 5KDTA 5AA2D 2QS2A 3MW0A 4KI0E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SW5 A;  4O3A A;  1A55 A;  4RK2 A;  4R75 A;  5FHO A;  5CBR A;  3U92 A;  3Q25 A;  4OES A;  1MH4 A;  1Y4C A;  3FD3 A;  5H8F B;  1DPP A;  1VSO A;  3OO6 A;  2R9J A;  3KZG A;  4F3S A;  5I57 A;  3QIM A;  4RNS A;  2DWH A;  3IAZ A;  4EDP A;  4F22 A;  1A8F A;  1FTJ A;  3A09 A;  3TZA A;  1B51 A;  3IX1 A;  1PB9 A;  3MZ9 A;  3QXM A;  5L9M A;  1N04 A;  4MH5 A;  5EHM A;  2F6P A;  1MPB A;  2UVI A;  1FQD A;  2AYS A;  2VD3 A;  5H8H B;  2VGQ A;  3AXF A;  3T66 A;  2XXU A;  2ALU A;  2Y7W A;  1D9Y A;  5I59 B;  3IJO B;  3BFT A;  4YB5 A;  4XIG Q;  3IOU A;  1US5 A;  2VHA A;  3GZG A;  2GHB A;  2AL5 A;  2Z23 A;  4G8N A;  1N3X A;  3SES A;  5FHN A;  4EQ7 A;  5H8N B;  4P11 A;  4NF6 B;  4UAC A;  3ILT B;  4C1U A;  1B4H A;  1SW1 A;  3B6W A;  2DE4 A;  3MBP A;  3C31 A;  3E13 X;  3Q28 A;  3MPK A;  4DIG A;  3V83 A;  3DP8 A;  1FCK A;  4Q0C A;  4EF2 A;  3TEL A;  3K1M A;  3S4U A;  1JNF A;  1TT1 A;  3K4U A;  2XX9 A;  1TWY A;  4OZ9 A;  3UIF A;  1MQG A;  1P1O A;  1UIU A;  2DE3 A;  1MXZ A;  2HZL A;  3KN8 A;  4FED A;  2NWJ A;  3LC8 A;  3U8Q A;  4YKI A;  3A3U A;  1MY3 A;  2R6G E;  3VXC A;  2O7U A;  3OSQ A;  5H8Q A;  3JYR A;  1AL3 A;  1M5C A;  4KD5 A;  3S9N C;  3KSJ A;  3IB1 A;  4LZ5 A;  4ZZA A;  3T96 B;  2O1M A;  1A7L A;  4HCW A;  3K2D A;  1MY4 A;  1B5J A;  5ITO A;  3OEM A;  1FQA A;  3KFM A;  4H67 A;  1SYI A;  5A5X B;  2Q2C A;  3PPO A;  4OET A;  1FTK A;  4QFP A;  3VVF A;  3HN0 A;  1B6H A;  3O28 A;  4I8C A;  3CR9 A;  1PDA A;  1QKA A;  4YIC A;  4OEV A;  4GLI A;  2XXR A;  4NF5 A;  1SVX B;  1Y3N A;  2DSF A;  3RT8 A;  4PFY A;  4BDL A;  4E0X A;  1H43 A;  2OBG A;  2RCB A;  3FIR A;  3O66 A;  1MS7 A;  1XC1 A;  3T93 B;  2DE2 A;  1POT A;  4TLL B;  3UGW A;  2ANJ A;  3CG1 A;  3TOD A;  2QS1 A;  1SW2 A;  3FVK A;  5DVJ A;  4F31 B;  3H3G A;  1ANF A;  3K01 A;  2I3W A;  1LB9 A;  1NL5 A;  3G3G A;  2LAO A;  3TCH A;  1N3W A;  2DS9 A;  3TTK A;  1MQJ A;  1POY 1;  3R7X A;  3W15 C;  4WXJ A;  4AB5 A;  5HPQ A;  2V3T A;  1B3L A;  1MXX A;  1MM6 A;  3KJT A;  4ZEC A;  1ZTY A;  3IK6 B;  4G2Z A;  4GXS B;  1B3F A;  4WEP A;  2OLB A;  3THI A;  1LCF A;  4WKM A;  4G68 B;  3K0V A;  2CMO A;  4QF9 A;  4NTL A;  3LBS A;  4THI A;  4QFN A;  4N13 A;  2I3V A;  4RPO A;  3RLF E;  4ELR A;  4F3B A;  4H5G A;  2D5W A;  3RNN A;  1LST A;  1LB8 A;  1ZLQ A;  4TOZ A;  3EHT A;  3FAS A;  3PPR A;  4F1U A;  4OYV A;  4IB2 A;  5I2K A;  1NNP A;  3FUZ A;  1B0L A;  1DMB A;  2QMW A;  4WED A;  3VLV A;  3IJX B;  1DOT A;  2W7Y A;  3RUM A;  1OMP A;  1VR5 A;  3B6T A;  4JWO A;  3USD A;  5I56 A;  1JVX A;  3OXN A;  1DPE A;  3MVY A;  4MF3 A;  4U1O A;  1VE4 A;  3W9W A;  1WDN A;  1SDX A;  4RY1 A;  2XXQ A;  1PEB A;  1DTZ A;  3I3V A;  3IOV A;  3K1P A;  3FXU A;  1IXG A;  4POX A;  3S2V A;  1DTG A;  2Q88 A;  2XD2 A;  3UP9 A;  3R26 A;  1B1X A;  4FEC A;  3CSB A;  3OOA A;  2DYX A;  2RC9 A;  1IIW A;  4BDR A;  1TXF A;  4GRK A;  1Q35 A;  1MXW A;  2VP1 A;  1ELJ A;  3UN6 A;  2AL4 A;  3O9P A;  4ISU A;  5CMM A;  4DXU A;  2Z8F A;  1D4N A;  1LAF E;  1JEV A;  1GGG A;  1XHY A;  2UVJ A;  1Y9U A;  3CI8 A;  3CRB A;  4PFU A;  4XTC Q;  5EYF A;  4BDO A;  1R9L A;  3ZS6 A;  1N0T A;  5TPA A;  3VLU A;  1FTM A;  2QJE A;  1IXH A;  1NNF A;  3MVX A;  3Q29 A;  4DDD A;  4F2O A;  3PPP A;  5H8F A;  3TFL A;  3F11 A;  4JSD A;  2DWA A;  1D3K A;  1Y20 A;  2ZXT A;  3OD7 A;  1R6Z A;  3GXA A;  4FIM A;  4H8I A;  5B7D A;  3O6G A;  3OMB A;  3HPI A;  2RC7 A;  3W9V A;  5L9O A;  1OVB A;  1AIV A;  2REG A;  4YKP A;  1PBQ A;  1B0H A;  1PB8 A;  1P1Q A;  2A5S A;  3MP6 A;  4NF8 B;  2ONR A;  2B3F A;  5FHM A;  3TYH A;  5I84 A;  1CB6 A;  4KHZ E;  4PFW A;  1QJM A;  4DZ1 A;  5I57 B;  5TPA B;  3HV1 A;  2UYF A;  4BDM A;  1B46 A;  2Y84 A;  3QUF A;  5H8Q B;  4R9F A;  2QSX A;  3G3J A;  1CE2 A;  3MC2 A;  1MH3 A;  4JSO A;  1LFG A;  3BKI B;  3G3K A;  3MQ9 A;  2GRV A;  3KOS A;  1LFH A;  2F7B A;  5AA4 B;  3E3K A;  1I6Q A;  2XX7 A;  5KZT A;  1A99 A;  2P0S A;  1P99 A;  3MVW A;  1LAG E;  5AE4 A;  3ILU B;  1AOV A;  1MXY A;  1MDQ A;  4PQJ A;  3SER A;  2G93 A;  4IY5 A;  4DCX A;  1LFI A;  3E9X A;  4JWX A;  4LQ5 A;  2DXR A;  4NF5 B;  5H8S A;  3VXB A;  3EN3 A;  5CBS A;  4ZS9 A;  2H25 A;  1YAE A;  4F19 A;  2Y7K A;  3DLN A;  4O3B A;  2HEU A;  3K6U A;  4ZE9 A;  5I59 A;  3K6V A;  1PBP A;  4IY6 A;  1B4Z A;  1SW4 A;  2UVG A;  2O1L A;  2V25 A;  4OFL A;  1PC3 A;  1MG1 A;  2FYI A;  4KCC A;  2IEE A;  3L6G A;  1IXC A;  1ZBM A;  2Q9T A;  2V3Q A;  3C33 A;  3LR1 A;  4R2B A;  4R6K A;  3PD8 A;  1KWH A;  2REJ A;  1GTK A;  3G3F A;  3TTM A;  2OZZ A;  1OQH A;  5DVI A;  5K2Y A;  2D3I A;  3KOT A;  4ZE8 A;  5ICQ A;  1RYO A;  1URD A;  1B7Z A;  3IOW A;  3LUY A;  4H0W A;  4M1V A;  4FOR A;  2XXY A;  1IXI A;  3KEI A;  3GBA A;  3OEL A;  4Q8R A;  3PMV A;  4M4G A;  1URG A;  2M8C A;  4IO3 A;  4QHQ A;  5FTI A;  4X1D A;  4IO4 A;  3FXQ A;  1Y1Z A;  1B7H A;  5AA1 A;  3FJ7 A;  2H5Y A;  3D4C A;  4FEB A;  1MQI A;  1FQF A;  3HHF A;  4IO7 A;  2UVH A;  4MFI A;  3K02 A;  4GXA A;  3ZKL A;  3SKP A;  2DVZ A;  1FQB A;  1AH5 A;  2Z22 A;  4QFL A;  2QS3 A;  1JQF A;  1Y3Q A;  3FJM A;  3PUY E;  3KG2 A;  3MUQ A;  4GD5 A;  4MBP A;  2B3B A;  2PT1 A;  1SYH A;  2THI A;  1B1H A;  1Y4T A;  1Z7M E;  1JW1 A;  1FTL A;  1XT8 A;  3KGC A;  3KN7 A;  3V8X B;  2I58 A;  2RC8 A;  3PUX E;  3QYT A;  3ODB A;  2O69 A;  2F6G A;  1BTJ A;  4L17 A;  4OFJ A;  3OO7 A;  1B3G A;  1MXU A;  3FZV A;  4LUB A;  3FVN A;  2XXP A;  1L5T A;  4ZEK A;  2H9B A;  1B7U A;  1QUJ A;  4O3C A;  4OWD A;  3PD9 A;  3C36 A;  4DE8 A;  4DCY A;  1MQH A;  2PYY A;  3ECR A;  4XKP A;  4ZEI A;  3UOR A;  3T22 A;  4YAH X;  1TFD A;  2A5T A;  2GHA A;  1N84 A;  2YJP A;  3O6I A;  2NOO A;  2DQV A;  3IB0 A;  2O51 A;  1UTB B;  1SD3 A;  4ELQ A;  3O97 A;  3IL1 B;  2ONS A;  2Q89 A;  1QUK A;  2F78 A;  2I6E A;  2O6A A;  4QRZ A;  3K6W A;  3N6U A;  4ZDM A;  4I62 A;  2V84 A;  4KR5 A;  2X7P A;  3SEV A;  3T9X B;  3S9E A;  5EHS A;  1A8E A;  5M2V A;  2OWS A;  4GWO A;  1QUI A;  4FE8 A;  3MVZ A;  3TQL A;  3LSL A;  1OLC A;  5F1Q A;  3RTW B;  1XOC A;  5ELV A;  3SET A;  3TTN A;  1H3D A;  4OER A;  3KJ7 A;  2H99 A;  4U22 A;  3D4G A;  3OEK A;  4F1Y A;  3SEU A;  1USY H;  2ZMB A;  2PVU A;  3EF7 A;  2H98 A;  3FVO A;  1EH3 A;  4RYA A;  3U1O A;  4F39 A;  4XKN A;  1NFT A;  2D21 A;  3DEL B;  1B5H A;  3MZ1 A;  3RPW A;  1A40 A;  4R72 A;  3CVG A;  4AB6 A;  1B3E A;  4Q5T A;  1MPC A;  2I48 A;  2X7Q A;  4R6Y A;  5I58 A;  4U23 A;  5AA4 A;  2PT2 A;  1FTO A;  3H6W A;  2F35 A;  4KPT A;  3FV2 A;  4ESW A;  4OVJ A;  4NMY A;  1B52 A;  2ZYK A;  3N5L A;  4Z7E A;  4YMB A;  1P1W A;  4XKR A;  5DT6 A;  3FXR A;  3PU5 A;  2F34 A;  1NKX A;  2Q8J A;  2Q2A A;  1BLF A;  3H06 B;  4R74 A;  5DTB A;  3V89 B;  1LAX A;  4K3F A;  1ZIU A;  2QS4 A;  3C32 A;  4NF4 A;  4NED A;  1S50 A;  4EXL A;  5AA3 A;  3N94 A;  5L9S A;  1HSE A;  2DXY A;  1I6A A;  2RKM A;  5HBC A;  4BLA A;  1D9V A;  1VFE A;  2OJT A;  3EQ1 A;  5BUU A;  1B05 A;  4YKJ A;  1UIV A;  2UYE A;  4AQ4 A;  1FQC A;  5KDT B;  2X26 A;  4RK9 A;  4TLM B;  2Z8D A;  3TUS A;  1BP5 A;  1OIB A;  3MP1 A;  3OO9 A;  3O6H A;  4IO6 A;  1VFD A;  2E1S A;  4FJP A;  4NF4 B;  4ELP A;  2GH9 A;  1ZKB A;  4C1T A;  4NF8 A;  5JEI A;  4LQ2 A;  2NVU B;  4IGR A;  3VVE A;  3SEX A;  3H7M A;  4EQB A;  5BWJ A;  3C35 A;  4HS7 A;  1NNK A;  2ZNT A;  4YB6 A;  3CG3 A;  3SDF A;  3U72 A;  2ZYO A;  3Q27 A;  3MJN A;  2I49 A;  4MLV A;  1EZO A;  3PV0 E;  3U93 A;  4OTE A;  3G3H A;  2XHD A;  3RY3 A;  3FV1 A;  4G8M A;  1RKM A;  3C34 A;  3CFZ A;  3IB2 A;  1USY E;  1JW5 A;  2DWI A;  2OWT A;  4GIZ A;  4GL0 A;  4G8H A;  4LA9 A;  4OQO A;  3K00 A;  2KLF A;  3MAM A;  3QUJ A;  2RCA A;  1BKA A;  4IGT A;  1B58 A;  2I4B A;  2PMS A;  4R6H A;  3H4Z A;  4Z0I A;  3TKD A;  4C0R A;  1TFA A;  3FVG A;  3PPN A;  5I2N A;  2QRY A;  4JBZ A;  3H6V A;  2ZNS A;  3HST A;  3T9H B;  4ECF A;  5CMK A;  3ZKK A;  4E0W A;  3JV9 A;  2HXW A;  4RPN A;  1MM7 A;  1QKB A;  2Y7P A;  1LCT A;  1XS5 A;  1P1U A;  1NH7 A;  2B65 A;  2Y7R A;  1R1N A;  4GOT A;  4I9D A;  4PFT A;  5CI5 A;  4YB7 A;  1GV8 A;  4YU0 A;  3U94 A;  5B70 A;  1B5I A;  1FQE A;  2Z8E A;  2ZYM A;  1M5F A;  2F5X A;  4X1B A;  4IO2 A;  1LLS A;  3RGY A;  3RT6 B;  1IEJ A;  3B7D A;  4G68 A;  3L6H A;  3T9V A;  2XXV A;  4OXV A;  2RF1 A;  4LZ8 A;  4G4P A;  5LOM A;  3MP8 A;  5L8D A;  4QFO A;  4BDQ A;  5ISU A;  4ZED A;  3ZSF A;  5IKB A;  3TPA A;  3FGS A;  2I4C A;  1Y3P A;  3MWB A;  3DM0 A;  5J1D A;  5ITP A;  3LSF B;  3HO7 A;  4ZZE A;  5TP9 A;  4LAT A;  2PX1 A;  4U21 A;  1Y1M A;  3IO6 A;  2DVC A;  2WKY A;  3C4M A;  1R9Q A;  1QUL A;  3H6U A;  1UTH B;  4YKK A;  1H44 A;  3PMW A;  5HM4 B;  4XKQ A;  5KCJ A;  3PMX A;  1MDP 1;  1OLA A;  1RYX A;  2CZL A;  4KCD A;  2BJJ X;  3LSW A;  3I5O A;  4FAJ A;  4EF1 A;  1NNT A;  4RJZ A;  4DXB A;  1H76 A;  4N07 A;  1SI0 A;  1O7T A;  2FNC A;  3QSL A;  4LP2 B;  4PP0 A;  5JTY B;  1I69 A;  1MRP A;  1ZJL A;  4GVO A;  4HCY A;  4F29 A;  2HAV A;  4ND9 A;  5K2X A;  1O64 A;  4XXU A;  5I58 B;  5DEX B;  1IIT A;  4POW A;  2HQ0 A;  3VLW A;  2O7I A;  1WVJ A;  1NMU A;  4KQP A;  4QSE A;  4RXL A;  2XXW A;  2ABH A;  3IO4 A;  1US4 A;  1UTH A;  2YLN A;  1XVY A;  3PUZ E;  3FJG A;  4GQO A;  5IAI A;  4U4S A;  2XX8 A;  1OVT A;  3MZB A;  1ATG A;  1QVS A;  1FW0 A;  3FAT A;  2DWJ A;  4DLD A;  4ZEB A;  2QPQ A;  4OEN A;  3UA8 A;  1B32 A;  1LBB A;  1N7W A;  4LON B;  4G68 C;  4LVQ A;  4ELO A;  1MPD A;  3EPE A;  2F97 A;  3PUV E;  5A5X A;  3V5A A;  1ZU0 A;  4QFK A;  1AMF A;  1F9B A;  3QK6 A;  2IA4 A;  1YPN A;  4OFO A;  4F1V A;  4IO5 A;  1H45 A;  4GL8 A;  1DSN A;  4H5F A;  1JVY A;  1MY0 A;  2VOZ A;  2ESN A;  2FA7 A;  1B2H A;  3IOR A;  2DP8 A;  4P0I A;  1NH8 A;  3TMG A;  3DP6 A;  1UTB A;  2ONK E;  4G77 A;  2E0S A;  5CMB A;  4UA8 A;  2P2A A;  4JXI A;  1IZ1 A;  3RTF B;  2R71 A;  1URS A;  1SI1 A;  3HCQ A;  1XVX A;  4NWC A;  5H8H A;  2V3U A;  3S9L C;  4QSC A;  1OQG A;  3GLB A;  3O29 A;  1M5D A;  1BIY A;  3CFL A;  4EXK A;  3B6Q A;  1II5 A;  1N76 A;  3N6T A;  1P1N A;  1M5B A;  2NUV A;  1QW0 A;  2XXH A;  3BBR A;  3R6U A;  4LZ7 A;  4TQU Q;  2ZNU A;  4U4X A;  3QAX A;  3IOT A;  3E4R A;  5ICT A;  3DP4 A;  4NF6 A;  4JDF A;  2F7C A;  3TCG A;  3KSX A;  4KYS A;  3VV5 A;  1T0K A;  5CMC A;  3SEY A;  3OSR A;  4EQ9 A;  1ZMG A;  2UXA A;  5JTY A;  3H03 A;  4X48 A;  5AA2 B;  3M3F A;  4ESX A;  1LBC A;  2H4I A;  1B40 A;  1JET A;  1LGB C;  2Y7I A;  5I2K B;  1LAH E;  3TQW A;  1SBP A;  1Z7N E;  4HTG A;  1YTV A;  4FAT A;  1B3H A;  4QSD A;  2I0C A;  5KCJ B;  4BDN A;  1SQY A;  4KYE A;  2XD3 A;  3KBR A;  3MPL A;  3UK4 A;  2DOJ A;  2AIX A;  5TU0 A;  4R73 A;  4U2R A;  1HSL A;  4I1D A;  2YPN A;  5DEX A;  2HZK A;  3G3I A;  3KN3 A;  1N7X A;  1Q1K A;  4H6D A;  2QMX A;  2P1S A;  1A54 A;  4X9T A;  1YCJ A;  2XXT A;  2ZYN A;  1GVC A;  3TEP A;  1HSJ A;  1J1N A;  1WOD A;  2OK2 A;  3M3K A;  3N26 A;  5AA2 A;  4NE4 A;  3Q26 A;  1IQ7 A;  3VFJ A;  1JW4 A;  5F7V A;  5CRY A;  3EHU A;  1S7Y A;  2XXX A;  3IR1 A;  3PUW E;  4KYD A;  3S9M C;  4N6P A;  3CSG A;  4F2Q A;  4F3P A;  4MLQ A;  5JK4 A;  4YZZ A;  5FTH A;  5H8N A;  3VE1 B;  4H1X A;  3M8U A;  2O68 A;  2G29 A;  2HFB A;  2F8D A;  3EHS A;  3K6X A;  5TP9 B;  3TDJ A;  3TTL A;  1JEU A;  4U1Z A;  1MXV A;  2I0B A;  1UQW A;  2F36 A;  2GFE A;  1MY2 A;  2NXO A;  3RQT A;  2QL3 A;  3C9H A;  2VD2 A;  3P7I A;  1EU8 A;  3RN8 A;  2HCA A;  4H8J A;  3GBB A;  4RA1 A;  4HW8 A;  4P0G A;  1PB7 A;  4PET A;  4KFQ A;  3CIJ A;  3G7W A;  1B9J A;  3I6V A;  4R9G A;  5DYH A;  3SEW A;  3T9U A;  3PGF A;  1EZP A;  2O84 X;  4JB7 A;  4NWD A;  3HHG A;  2RIN A;  3H6T A;  4ONY A;  3WAF A;  3VVD A;  5I2N B;  4H65 A;  1MQD A;  2PBW A;  2OCU A;  5CM6 A;  4YMA A;  1S9T A;  4OEU A;  3BFU A;  5DVF A;  3ONM A;  1IUD A;  5I56 B;  4R2F A;  3PPQ A;  1GR2 A;  3VDF A;  3O2A A;  2A5T B;  4EUO A;  1O63 A;  1MY1 A;  4F3G A;  4Q30 B;  4OHN A;  3OEN A;  3CFX A;  1EZ9 A;  2HAU A;  4PE5 B;  4ZEF A;  4GF8 A;  3TCF A;  1M5E A;  1I6B A;  3JZJ A;  3OO8 A;  4JWY A;  3WAE A;  4OMB A;  2V93 A;  3TTR A;  4F18 A;  4GFR A;  3TAJ A;  3LSX A;  4DXC A;  2XXI A;  3M3L A;  3A3C A;  5CC2 A;  3K1N A;  2F7A A;  5KDT A;  5AA2 D;  2QS2 A;  3MW0 A;  4KI0 E; 
#chains in the Genus database with same CATH topology
 2WYK A;  1MH4 A;  1IMF A;  3KZG A;  3QIM A;  1A8F A;  1FTJ A;  3TZA A;  3MZ9 A;  3QXM A;  1N04 A;  2F6P A;  1MPB A;  1FQD A;  2VD3 A;  5H8H B;  2XXU A;  1D9Y A;  5I59 B;  2ZZW A;  4YB5 A;  2VHA A;  2GHB A;  3MPK A;  5I7I A;  1G0H A;  3DP8 A;  3V83 A;  4EF2 A;  3TEL A;  3S4U A;  4OZ9 A;  3KN8 A;  2NWJ A;  2HZL A;  4YKI A;  3A3U A;  1MY3 A;  5H8Q A;  1M5C A;  4LZ5 A;  2O1M A;  2B4M A;  1B5J A;  1FQA A;  4NN3 A;  4QFP A;  4OEV A;  4GLI A;  2XXR A;  3RT8 A;  4E0X A;  4AS4 A;  1XC1 A;  4TLL B;  2ANJ A;  1SW2 A;  4PDD A;  3K01 A;  1LB9 A;  1NL5 A;  2LAO A;  2DS9 A;  4AB5 A;  1MQJ A;  1POY 1;  2VT5 A;  4WXJ A;  1MM6 A;  1ZTY A;  3IK6 B;  4GXS B;  1LCF A;  4N13 A;  1ZLQ A;  4PF6 A;  3EHT A;  3FAS A;  4IB2 A;  1B0L A;  1EYJ A;  2QMW A;  1DOT A;  4I40 A;  1VR5 A;  5I56 A;  4JWO A;  3OXN A;  3W9W A;  2XXQ A;  1PEB A;  3UP9 A;  1KA0 A;  3S2V A;  2DYX A;  1ELJ A;  3UN6 A;  4ISU A;  1D4N A;  1LAF E;  4GBV A;  1GGG A;  2UVJ A;  4PFU A;  3CRB A;  1R9L A;  1N0T A;  5H8F A;  1IMA A;  2CZI A;  2XXK A;  3F11 A;  4XFE A;  3O6G A;  3W9V A;  5L9O A;  2REG A;  5AA1 A;  1B0H A;  3MP6 A;  5EYG A;  4MAG A;  4NF8 B;  3TYH A;  5FHM A;  1QJM A;  4OVT A;  4R9F A;  2QSX A;  1YYZ A;  3G3J A;  3MC2 A;  1LFG A;  5AA4 B;  2XX7 A;  4JVD A;  1A99 A;  2QVU A;  3ILU B;  4IY5 A;  5CBS A;  3EN3 A;  2ZZV A;  2BJI A;  1CNQ A;  4F19 A;  5I59 A;  1B4Z A;  2O1L A;  4OFL A;  4KCC A;  3T9U A;  2Q9T A;  2V3Q A;  3QMF A;  4MMP A;  1IMC A;  1OQH A;  3KOT A;  4ZE8 A;  4M1V A;  3OEL A;  2M8C A;  1RDZ A;  3D4C A;  4IO7 A;  4O7M A;  2B3B A;  1SYH A;  1B1H A;  3KGC A;  2RC8 A;  2O69 A;  2F6G A;  1L5T A;  2H9B A;  1MQH A;  4XKP A;  3UOR A;  4YAH X;  2YJP A;  2NOO A;  2DQV A;  4ELQ A;  2O51 A;  4N6D A;  2Q89 A;  2PFZ A;  2I6E A;  3N6U A;  2X7P A;  3T9X B;  4GWO A;  3LSL A;  1OLC A;  1H3D A;  4OER A;  2H99 A;  2WBD A;  4F39 A;  3DEL B;  1A40 A;  4R6Y A;  2X7Q A;  3HFU A;  4KPT A;  2F35 A;  4ESW A;  4OVJ A;  3N5L A;  2QVR A;  1LAX A;  4NF4 A;  4NED A;  3N94 A;  1I6A A;  2RKM A;  4BLA A;  4X8R A;  1D9V A;  4YKJ A;  1UIV A;  2UYE A;  2X26 A;  1OIB A;  2KQZ A;  1FPJ A;  4NF4 B;  2GH9 A;  1ZKB A;  3SDF A;  3Q27 A;  4MLV A;  3U93 A;  3BIG A;  2XHD A;  1USY E;  4GIZ A;  4G8H A;  4HE1 A;  3MAM A;  4GWW A;  1B58 A;  4Z0I A;  3H4Z A;  3TKD A;  3FVG A;  2QRY A;  4JBZ A;  4ECF A;  3ZKK A;  4NQ8 A;  4E0W A;  4RPN A;  2Y7P A;  1QKB A;  4I9D A;  5CI5 A;  5EQ9 A;  4GOT A;  1B5I A;  4EQB A;  2ZYM A;  4X1B A;  4IO2 A;  3L6H A;  4O7I A;  3T9V A;  4OXV A;  4QFO A;  3TPA A;  5ITP A;  3IFC A;  4NF0 A;  4LAT A;  1Y1M A;  4IR8 A;  1QUL A;  3B8B A;  1H44 A;  2BJJ X;  3LSW A;  4FAJ A;  4EF1 A;  4DXB A;  1SI0 A;  2FNC A;  4F29 A;  2HAV A;  4ND9 A;  4XXU A;  5I58 B;  5DEX B;  1IIT A;  4POW A;  3VLW A;  1NMU A;  4KQP A;  4RXL A;  2XXW A;  3PUZ E;  3FJG A;  4PE3 A;  4N17 A;  3MZB A;  3FAT A;  1FBH A;  5LTC A;  4DLD A;  4GBW A;  1N7W A;  4LON B;  4G68 C;  4LVQ A;  1MPD A;  1DCU A;  3BIH A;  4X04 A;  4QFK A;  4F1V A;  4IO5 A;  1JVY A;  2ESN A;  2FA7 A;  1UTB A;  5CMB A;  2E0S A;  4JXI A;  1IZ1 A;  1KZ8 A;  1URS A;  4QXD A;  1SI1 A;  1XVX A;  1FPF A;  1BIY A;  2PCR A;  4U4X A;  5ICT A;  3DP4 A;  4NF6 A;  3TCG A;  4PCD A;  3OSR A;  4EQ9 A;  4X48 A;  4ESX A;  2H4I A;  4ZEC A;  5I2K B;  1LAH E;  4FAT A;  1B3H A;  1FBF A;  2AIX A;  5TU0 A;  4R73 A;  1BK4 A;  4U2R A;  3KN3 A;  1N7X A;  2QMX A;  2XXT A;  1KA1 A;  1HSJ A;  1NUX A;  5AA2 A;  3EHU A;  3PUW E;  4N6P A;  4F3P A;  4MLQ A;  5FTH A;  3VE1 B;  3EHS A;  2HFB A;  3K6X A;  3TDJ A;  5J1D A;  1JEU A;  1MXV A;  1UQW A;  2GFE A;  2WYP A;  3RN8 A;  2HCA A;  4HW8 A;  3GBB A;  4KFQ A;  1EZP A;  4NWD A;  3S9E A;  2RIN A;  4ONY A;  4G61 A;  1MQD A;  5CM6 A;  3BFU A;  3ONM A;  5I56 B;  4EUO A;  1O63 A;  3FXB A;  2HAU A;  3TCF A;  1NUZ A;  3JZJ A;  4JWY A;  4PFB A;  3TTR A;  4DXC A;  3M3L A;  2F7A A;  3MW0 A;  1SW5 A;  1A55 A;  4R75 A;  5CBR A;  1Y4C A;  5H8F B;  1DPP A;  5I57 A;  4MNP A;  2R9J A;  4F3S A;  4RNS A;  4F22 A;  3A09 A;  1NV6 A;  3AXF A;  1US5 A;  3GZG A;  2Z23 A;  2AL5 A;  1N3X A;  4P11 A;  4NF6 B;  2DE4 A;  2XX9 A;  1TWY A;  1MXZ A;  3LC8 A;  2R6G E;  4QBA A;  3VXC A;  2O7U A;  3OSQ A;  1A7L A;  4HCW A;  3K2D A;  1MY4 A;  5ITO A;  3PPO A;  3VVF A;  1FTK A;  3O28 A;  1B6H A;  4I8C A;  3CR9 A;  4YIC A;  4NF5 A;  2RCB A;  3UGW A;  2VPO A;  4OVR A;  3TCH A;  5HPQ A;  3R7X A;  1B3F A;  3K0V A;  2XWK A;  4ELR A;  3LBS A;  4N6K A;  2I3V A;  4H5G A;  3RNN A;  3PPR A;  4OYV A;  5I2K A;  1NNP A;  1DMB A;  1FRP A;  2W7Y A;  4MF3 A;  1G0I A;  1VE4 A;  1WDN A;  5IZZ A;  1DTZ A;  3I3V A;  5EYH A;  1IXG A;  2Q88 A;  2RC9 A;  1MXW A;  2F3B A;  2VP1 A;  1DK4 A;  3O9P A;  5CMM A;  3VLU A;  1IXH A;  1NNF A;  3MVX A;  3PPP A;  2DWA A;  1Y20 A;  4FIM A;  3OMB A;  3HPI A;  2RC7 A;  2CZH A;  4NGU A;  1PBQ A;  4KHZ E;  4DZ1 A;  4PAF A;  1B46 A;  3QUF A;  3MQ9 A;  2GRV A;  3KOS A;  1D9Q A;  3E3K A;  1I6Q A;  2G93 A;  3VXB A;  4ZS9 A;  2Y7K A;  3DLN A;  4ZE9 A;  5ET5 A;  4DCX A;  5H8S A;  4GWS A;  3L6G A;  1IXC A;  1ZBM A;  4R6K A;  2QFL A;  3C33 A;  4AS5 A;  3TTM A;  1GTK A;  2OZZ A;  5DVI A;  1RYO A;  3GBA A;  4M4G A;  1URG A;  4IO3 A;  4IO4 A;  3FXQ A;  3FJ7 A;  2H5Y A;  1FQF A;  2WEF A;  4GXA A;  1FJ9 A;  1NV3 A;  4QFL A;  1Y3Q A;  2P3N A;  3FJM A;  4GD5 A;  2THI A;  1Y4T A;  1JW1 A;  5T3J A;  3V8X B;  2I58 A;  3ODB A;  1B3G A;  3FZV A;  3FVN A;  4ZEK A;  1QUJ A;  3C36 A;  3T22 A;  2GHA A;  1N84 A;  2ONS A;  2O6A A;  5IAI A;  3MVZ A;  5F1Q A;  1XOC A;  5ELV A;  4MX6 A;  4JVC A;  4XEQ A;  5J16 A;  2PVU A;  2H98 A;  1EH3 A;  4UAB A;  1B5H A;  3RPW A;  1B3E A;  2I48 A;  4U23 A;  3H6W A;  1B52 A;  2ZYK A;  2FHY A;  3EKI A;  1NKX A;  4LN5 A;  1LEV A;  2Q8J A;  3H06 B;  4R74 A;  2DDK A;  5DTB A;  4K3F A;  1ZIU A;  1FPI A;  1S50 A;  4EXL A;  4OVS A;  2DXY A;  5HBC A;  4HE0 A;  2OJT A;  1LBX A;  4RK9 A;  1NUW A;  4IO6 A;  2QVV A;  4FJP A;  4C1T A;  4NF8 A;  5JEI A;  2NVU B;  3H7M A;  4P1L A;  1NNK A;  3CG3 A;  4O94 A;  3RY3 A;  1JW5 A;  2DWI A;  4OQO A;  2KLF A;  2RCA A;  3T0J A;  2HXW A;  1MM7 A;  2Y7R A;  4YB7 A;  5B70 A;  4I3Y A;  5I5P A;  2Q74 A;  3RT6 B;  2F5X A;  1LBZ A;  1LLS A;  1IEJ A;  4G68 A;  1EYI A;  4G4P A;  5LOM A;  1LBY A;  4ZED A;  3FGS A;  2I4C A;  1Y3P A;  3MWB A;  4NAP A;  5TP9 A;  1Q9D A;  3IO6 A;  5FBP A;  4O8M A;  1R9Q A;  4YKK A;  2OX3 A;  5HM4 B;  5KCJ A;  3PMX A;  2CZL A;  1NNT A;  5EQA A;  1H76 A;  4N07 A;  3QSL A;  1O7T A;  5JTY B;  1MRP A;  4QSE A;  3IO4 A;  4JVI A;  1FPG A;  3LUZ A;  2DWJ A;  4OEN A;  1B32 A;  3EPE A;  2F97 A;  2R8T A;  1ZU0 A;  1AMF A;  4OFO A;  1YPN A;  1H45 A;  1DSN A;  1QGX A;  2VOZ A;  4P0I A;  3IOR A;  3ZS6 A;  3TMG A;  3RTF B;  4NWC A;  3S9L C;  3O29 A;  1FBC A;  1II5 A;  4PFR A;  2XXH A;  3BBR A;  3R6U A;  3RPL B;  4PFI A;  2F7C A;  5CMC A;  1ZMG A;  2UXA A;  3H03 A;  3M3F A;  4MJO A;  3TQW A;  1LGB C;  1SBP A;  2I0C A;  4BDN A;  3UK4 A;  2PFY A;  2DOJ A;  4I1D A;  2YPN A;  1Q1K A;  4H6D A;  2P1S A;  1YCJ A;  1GVC A;  3TEP A;  1J1N A;  4N81 A;  3VFJ A;  1JW4 A;  1S7Y A;  1IMD A;  4KYD A;  3S9M C;  3CSG A;  3LV0 A;  3ROJ A;  4H1X A;  2O68 A;  4N15 A;  5ESY A;  3TTL A;  4U1Z A;  2F36 A;  2NXO A;  2VD2 A;  1EU8 A;  4H8J A;  1NV2 A;  3G7W A;  4R9G A;  1DBZ A;  3KC1 A;  3H6T A;  4H65 A;  2PBW A;  2OCU A;  1IUD A;  3PPQ A;  1GR2 A;  4GX6 A;  1MY1 A;  4Q30 B;  4OHN A;  3OEN A;  3CFX A;  3OO8 A;  3LSX A;  3A3C A;  5CC2 A;  3K1N A;  5IM2 A;  5L8D A;  4KI0 E;  5ISU A;  4RK2 A;  5FHO A;  2JJK A;  3U92 A;  3Q25 A;  4OES A;  3FD3 A;  1XI6 A;  3IAZ A;  1B51 A;  3IX1 A;  1PB9 A;  2HPG A;  2VGQ A;  2ALU A;  2Y7W A;  3BFT A;  2V4C A;  5H8N B;  4C1U A;  3ILT B;  1SW1 A;  1FPE A;  3MBP A;  4DIG A;  1IMB A;  1FCK A;  3K4U A;  1TT1 A;  1P1O A;  3KSJ A;  3T96 B;  4MHF A;  4H67 A;  5A5X B;  2Q2C A;  1VDW A;  1QKA A;  5IGA A;  1SVX B;  2DSF A;  4BDL A;  2VPN A;  4MEV A;  3FIR A;  3O66 A;  1MS7 A;  2DE2 A;  1POT A;  2QS1 A;  3H3G A;  1ANF A;  2I3W A;  3G3G A;  3TTK A;  4H46 A;  3W15 C;  3U65 A;  2V3T A;  1B3L A;  1MXX A;  3KJT A;  4G2Z A;  3FBP A;  4G68 B;  3RLF E;  4QF9 A;  4F3B A;  4QFN A;  4RPO A;  2D5W A;  1LST A;  4MNC A;  2CEY A;  3B50 A;  3IJX B;  1SDX A;  4POX A;  1DTG A;  1B1X A;  3CSB A;  2FIE A;  1TXF A;  4GRK A;  2AL4 A;  2Z8F A;  3V5A A;  1Y9U A;  5TPA A;  1FTM A;  2QJE A;  3Q29 A;  2ZXT A;  3OD7 A;  1R6Z A;  3GXA A;  1AIV A;  4YKP A;  2A5S A;  1P1Q A;  4GX3 A;  2ONR A;  1CB6 A;  4PFW A;  4PGP A;  5TPA B;  4OAN A;  4BDM A;  2Y84 A;  1NV0 A;  1CE2 A;  1YZ0 A;  3BKI B;  3G3K A;  4N8G A;  1LFH A;  2F7B A;  4GWZ A;  5KZT A;  2P0S A;  1P99 A;  3GYY A;  3MVW A;  1LAG E;  5AE4 A;  1AOV A;  1MXY A;  4PQJ A;  3SER A;  1LFI A;  3E9X A;  4LQ5 A;  4NF5 B;  5DW8 A;  1YAE A;  2HEU A;  3K6V A;  4KXP A;  1SW4 A;  2V25 A;  2P3V A;  1PC3 A;  1MG1 A;  3LR1 A;  4R2B A;  1KWH A;  3G3F A;  4GWY A;  5K2Y A;  2D3I A;  5ICQ A;  3IOW A;  1URD A;  1IXI A;  3PMV A;  4QHQ A;  1Y1Z A;  1NUY A;  4GX4 A;  4PDH A;  2UVH A;  3K02 A;  3SKP A;  5LDZ A;  1FQB A;  2QS3 A;  1JQF A;  3MUQ A;  2PT1 A;  1XT8 A;  3PUX E;  1BTJ A;  4L17 A;  3PD9 A;  4DE8 A;  2PYY A;  3ECR A;  4ZEI A;  2WBB A;  2A5T A;  3IB0 A;  1QUK A;  2F78 A;  4ZDM A;  4I62 A;  2V84 A;  4KR5 A;  3SEV A;  1A8E A;  3TQL A;  3SET A;  2Y5K A;  3TTN A;  4F1Y A;  1USY H;  3FVO A;  2Q8M A;  4RYA A;  4XKN A;  1NFT A;  2XWV A;  3MZ1 A;  4AB6 A;  2XWO A;  3FV2 A;  4NMY A;  4YMB A;  2F34 A;  2Q2A A;  3V89 B;  3C32 A;  5L9S A;  1HSE A;  1VFE A;  3EQ1 A;  5BUU A;  5KDT B;  3TUS A;  1BP5 A;  1FBG A;  3MP1 A;  3OO9 A;  3O6H A;  1VFD A;  2E1S A;  4ELP A;  4LQ2 A;  4IGR A;  3SEX A;  4HS7 A;  2ZNT A;  4YB6 A;  3U72 A;  3MJN A;  1EZO A;  4G8M A;  1RKM A;  3C34 A;  3CFZ A;  3IB2 A;  1FTA A;  4IGT A;  2I4B A;  4R6H A;  1TFA A;  3PPN A;  3H6V A;  2ZNS A;  3HST A;  5CMK A;  2CEX A;  1IME A;  1LCT A;  1P1U A;  3TFL A;  4PFT A;  3U94 A;  1FQE A;  2Z8E A;  2XXV A;  2RF1 A;  3MP8 A;  4BDQ A;  1FPK A;  3ZSF A;  3DM0 A;  4P3L A;  2FVZ A;  3LSF B;  2PX1 A;  1FBP A;  3C4M A;  1MDP 1;  1OLA A;  1RYX A;  4RJZ A;  4PTK A;  2WX9 A;  4LP2 B;  4PP0 A;  1I69 A;  5K2X A;  2HQ0 A;  2O7I A;  1NV1 A;  4GQO A;  1XVY A;  2KR0 A;  4PAK A;  4XF5 A;  4ZEB A;  2QPQ A;  1LBB A;  4ELO A;  2GQ1 A;  3PUV E;  1F9B A;  2IA4 A;  4EDP A;  1B2H A;  5I57 B;  2DP8 A;  2ONK E;  4G77 A;  5IZ1 A;  2R71 A;  3HCQ A;  4QSC A;  1M5D A;  4EXK A;  1N76 A;  4WKM A;  3N6T A;  1P1N A;  1NI9 A;  4TQU Q;  4LZ7 A;  2ZNU A;  3IOT A;  3E4R A;  4I3E A;  3SEY A;  5AA2 B;  1NV7 A;  2Y7I A;  1B40 A;  1Z7N E;  4QSD A;  1SQY A;  4KYE A;  2XD3 A;  3KBR A;  4GWU A;  1HSL A;  2HZK A;  1A54 A;  2OK2 A;  4NE4 A;  5F7V A;  5CRY A;  4P9K A;  4F2Q A;  4YZZ A;  3M8U A;  2G29 A;  5TP9 B;  1FSA A;  3RQT A;  2QL3 A;  3C9H A;  3T1B A;  3P7I A;  3SEW A;  3CIJ A;  3I6V A;  1B9J A;  1FPL A;  5DYH A;  2O84 X;  3WAF A;  5I2N B;  3IFA A;  3RYD A;  1S9T A;  1FBE A;  5DVF A;  3VDF A;  2A5T B;  4FBP A;  1FJ6 A;  1RDX A;  1EZ9 A;  4ZEF A;  1M5E A;  1I6B A;  4OMB A;  2V93 A;  4F18 A;  3TAJ A;  2XXI A;  5KDT A;  5AA2 D;  4PAI A;  3H6U A;  3O2A A;  2QS2 A;  4O3A A;  3OO6 A;  1VSO A;  2DWH A;  5L9M A;  5EHM A;  4MH5 A;  2UVI A;  2AYS A;  3T66 A;  3IJO B;  4XIG Q;  3IOU A;  3SES A;  4G8N A;  4EQ7 A;  4UAC A;  1B4H A;  3B6W A;  3Q28 A;  3C31 A;  3E13 X;  4Q0C A;  3K1M A;  1JNF A;  2FBP A;  3UIF A;  1MQG A;  1UIU A;  2DE3 A;  3U8Q A;  4FED A;  1LBW A;  3JYR A;  1AL3 A;  4KD5 A;  2OWZ A;  3S9N C;  4ZZA A;  3IB1 A;  4NG7 A;  3MST A;  4P47 A;  3OEM A;  3KFM A;  1SYI A;  4OET A;  3HN0 A;  1NV4 A;  1PDA A;  1Y3N A;  3E79 A;  4PFY A;  1H43 A;  2OBG A;  3T93 B;  3CG1 A;  4NX1 A;  3TOD A;  3FVK A;  5DVJ A;  4F31 B;  1N3W A;  4WEP A;  2OLB A;  4PF8 A;  3THI A;  2CMO A;  4NTL A;  4THI A;  4PBQ A;  1FBD A;  1LB8 A;  4TOZ A;  4F1U A;  5EQ7 A;  3FUZ A;  4WED A;  3VLV A;  3RUM A;  1OMP A;  3B6T A;  3USD A;  1JVX A;  1DPE A;  2F3D A;  3MVY A;  4U1O A;  4RY1 A;  3IOV A;  3K1P A;  3FXU A;  2XD2 A;  3R26 A;  4FEC A;  3OOA A;  1IIW A;  4BDR A;  1Q35 A;  4DXU A;  5FHN A;  1XHY A;  4JSO A;  1JEV A;  5EYF A;  3CI8 A;  4BDO A;  4XTC Q;  4PGN A;  4DDD A;  4F2O A;  4JSD A;  1D3K A;  4H8I A;  5B7D A;  1OVB A;  4P56 A;  1PB8 A;  5ET6 A;  5I84 A;  2B3F A;  3HV1 A;  2UYF A;  4MIJ A;  4DI4 B;  5H8Q B;  1NV5 A;  1MH3 A;  5A5L A;  3A29 A;  1MDQ A;  4JWX A;  2DXR A;  2H25 A;  4O3B A;  3K6U A;  1PBP A;  4IY6 A;  2UVG A;  5I2N A;  2FYI A;  5ET7 A;  2IEE A;  3ZKL A;  3RGY A;  3PD8 A;  2REJ A;  3ISP A;  1B7Z A;  3LUY A;  4H0W A;  4FOR A;  2XXY A;  3KEI A;  4Q8R A;  5FTI A;  4X1D A;  4N4U A;  1B7H A;  2Y5L A;  4FEB A;  1MQI A;  4GWX A;  4MFI A;  2DVZ A;  1AH5 A;  2Z22 A;  3PUY E;  1LBV A;  3D1R A;  3KG2 A;  4MBP A;  1Z7M E;  1FTL A;  3KN7 A;  4PC9 A;  3QYT A;  4N91 A;  4OFJ A;  3OO7 A;  1MXU A;  4OA4 A;  3CHG A;  4LUB A;  2XXP A;  1B7U A;  4O3C A;  4OWD A;  4DCY A;  1AWB A;  1TFD A;  3O6I A;  1UTB B;  1SD3 A;  3O97 A;  3IL1 B;  4P1E A;  4QRZ A;  3UA8 A;  3K6W A;  5IZ3 B;  5EHS A;  5M2V A;  2OWS A;  1QUI A;  4FE8 A;  3RTW B;  2FIX A;  3KJ7 A;  4U22 A;  3D4G A;  3OEK A;  1YXI A;  3SEU A;  2ZMB A;  3EF7 A;  3U1O A;  2D21 A;  3RPL A;  4R72 A;  3CVG A;  4MCO A;  4Q5T A;  1JP4 A;  1MPC A;  5I58 A;  5AA4 A;  2PT2 A;  1FTO A;  4Z7E A;  1P1W A;  4XKR A;  5DT6 A;  3FXR A;  3PU5 A;  1BLF A;  2QS4 A;  5AA3 A;  1RDY A;  1B05 A;  4HE2 A;  4HXV A;  4MNI A;  4AQ4 A;  1FQC A;  2HXR A;  4TLM B;  2Z8D A;  1EYK A;  3KBZ A;  3E78 A;  3VVE A;  3C35 A;  2ZYO A;  2I49 A;  3PV0 E;  4OTE A;  3G3H A;  2ZZX A;  3FV1 A;  4GL0 A;  2OWT A;  2XA5 A;  4LA9 A;  3K00 A;  3QUJ A;  1BKA A;  2PMS A;  4C0R A;  3T9H B;  3JV9 A;  3HHF A;  1XS5 A;  2B65 A;  1NH7 A;  1GV8 A;  1R1N A;  4YU0 A;  1M5F A;  3B7D A;  5ET8 A;  4LZ8 A;  5IKB A;  2XWI A;  1K9Y A;  3HO7 A;  4ZZE A;  4U21 A;  2DVC A;  2MKZ A;  2WKY A;  3SZP A;  1FPB A;  1UTH B;  3PMW A;  4XKQ A;  4KCD A;  3I5O A;  1FPD A;  1ZJL A;  4HCY A;  2CZK A;  4GVO A;  4PBH A;  1O64 A;  1WVJ A;  2ABH A;  1US4 A;  1UTH A;  2YLN A;  4H45 A;  4U4S A;  2XX8 A;  1OVT A;  1ATG A;  1QVS A;  1FW0 A;  4P8B A;  5A5X A;  3QK6 A;  4GL8 A;  4H5F A;  1MY0 A;  3PTY A;  4N8Y A;  1NH8 A;  3DP6 A;  4UA8 A;  2P2A A;  2HHM A;  5H8H A;  2V3U A;  1OQG A;  3GLB A;  3CFL A;  3B6Q A;  5I3S A;  2NUV A;  1M5B A;  3KC0 A;  1QW0 A;  5IZ3 A;  1K9Z A;  3QAX A;  4JDF A;  3KSX A;  4KYS A;  3VV5 A;  1T0K A;  5JTY A;  1LBC A;  1JET A;  4HTG A;  1YTV A;  5KCJ B;  4OVQ A;  3MPL A;  5DEX A;  5BWJ A;  3G3I A;  1INP A;  4X9T A;  2ZYN A;  3M3K A;  1WOD A;  3N26 A;  3Q26 A;  1IQ7 A;  4DI3 D;  2XXX A;  3IR1 A;  2L5V A;  5EQ8 A;  5JK4 A;  5H8N A;  2F8D A;  2B4L A;  2I0B A;  3NOH A;  1MY2 A;  4NHB A;  4RA1 A;  3MYU A;  1PB7 A;  4P0G A;  4PET A;  3PGF A;  5F24 A;  4JB7 A;  3HHG A;  3VVD A;  4OVP A;  4YMA A;  4OEU A;  4R2F A;  1SPI A;  4F3G A;  4PE5 B;  4GF8 A;  3WAE A;  4GFR A; 
#chains in the Genus database with same CATH homology
 1SW5 A;  4O3A A;  1A55 A;  4RK2 A;  4R75 A;  5FHO A;  5CBR A;  3U92 A;  3Q25 A;  4OES A;  1MH4 A;  1Y4C A;  3FD3 A;  5H8F B;  1DPP A;  1VSO A;  3OO6 A;  2R9J A;  3KZG A;  4F3S A;  5I57 A;  3QIM A;  4RNS A;  2DWH A;  3IAZ A;  4EDP A;  4F22 A;  1A8F A;  1FTJ A;  3A09 A;  3TZA A;  1B51 A;  3IX1 A;  1PB9 A;  3MZ9 A;  3QXM A;  5L9M A;  1N04 A;  4MH5 A;  5EHM A;  2F6P A;  1MPB A;  2UVI A;  1FQD A;  2AYS A;  2VD3 A;  5H8H B;  2VGQ A;  3AXF A;  3T66 A;  2XXU A;  2ALU A;  2Y7W A;  1D9Y A;  5I59 B;  3IJO B;  3BFT A;  4YB5 A;  4XIG Q;  3IOU A;  1US5 A;  2VHA A;  3GZG A;  2GHB A;  2AL5 A;  2Z23 A;  4G8N A;  1N3X A;  3SES A;  5FHN A;  4EQ7 A;  5H8N B;  4P11 A;  4NF6 B;  4UAC A;  3ILT B;  4C1U A;  1B4H A;  1SW1 A;  3B6W A;  2DE4 A;  3MBP A;  3C31 A;  3E13 X;  3Q28 A;  3MPK A;  4DIG A;  3V83 A;  3DP8 A;  1FCK A;  4Q0C A;  4EF2 A;  3TEL A;  3K1M A;  3S4U A;  1JNF A;  1TT1 A;  3K4U A;  2XX9 A;  1TWY A;  4OZ9 A;  3UIF A;  1MQG A;  1P1O A;  1UIU A;  2DE3 A;  1MXZ A;  2HZL A;  3KN8 A;  4FED A;  2NWJ A;  3LC8 A;  3U8Q A;  4YKI A;  3A3U A;  1MY3 A;  2R6G E;  3VXC A;  2O7U A;  3OSQ A;  5H8Q A;  3JYR A;  1AL3 A;  1M5C A;  4KD5 A;  3S9N C;  3KSJ A;  3IB1 A;  4LZ5 A;  4ZZA A;  3T96 B;  2O1M A;  1A7L A;  4HCW A;  3K2D A;  1MY4 A;  1B5J A;  5ITO A;  3OEM A;  1FQA A;  3KFM A;  4H67 A;  1SYI A;  5A5X B;  2Q2C A;  3PPO A;  4OET A;  1FTK A;  4QFP A;  3VVF A;  3HN0 A;  1B6H A;  3O28 A;  4I8C A;  3CR9 A;  1PDA A;  1QKA A;  4YIC A;  4OEV A;  4GLI A;  2XXR A;  4NF5 A;  1SVX B;  1Y3N A;  2DSF A;  3RT8 A;  4PFY A;  4BDL A;  4E0X A;  1H43 A;  2OBG A;  2RCB A;  3FIR A;  3O66 A;  1MS7 A;  1XC1 A;  3T93 B;  2DE2 A;  1POT A;  4TLL B;  3UGW A;  2ANJ A;  3CG1 A;  3TOD A;  2QS1 A;  1SW2 A;  3FVK A;  5DVJ A;  4F31 B;  3H3G A;  1ANF A;  3K01 A;  2I3W A;  1LB9 A;  1NL5 A;  3G3G A;  2LAO A;  3TCH A;  1N3W A;  2DS9 A;  3TTK A;  1MQJ A;  1POY 1;  3R7X A;  3W15 C;  4WXJ A;  4AB5 A;  5HPQ A;  2V3T A;  1B3L A;  1MXX A;  1MM6 A;  3KJT A;  4ZEC A;  1ZTY A;  3IK6 B;  4G2Z A;  4GXS B;  1B3F A;  4WEP A;  2OLB A;  3THI A;  1LCF A;  4WKM A;  4G68 B;  3K0V A;  2CMO A;  4QF9 A;  4NTL A;  3LBS A;  4THI A;  4QFN A;  4N13 A;  2I3V A;  4RPO A;  3RLF E;  4ELR A;  4F3B A;  4H5G A;  2D5W A;  3RNN A;  1LST A;  1LB8 A;  1ZLQ A;  4TOZ A;  3EHT A;  3FAS A;  3PPR A;  4F1U A;  4OYV A;  4IB2 A;  5I2K A;  1NNP A;  3FUZ A;  1B0L A;  1DMB A;  2QMW A;  4WED A;  3VLV A;  3IJX B;  1DOT A;  2W7Y A;  3RUM A;  1OMP A;  1VR5 A;  3B6T A;  4JWO A;  3USD A;  5I56 A;  1JVX A;  3OXN A;  1DPE A;  3MVY A;  4MF3 A;  4U1O A;  1VE4 A;  3W9W A;  1WDN A;  1SDX A;  4RY1 A;  2XXQ A;  1PEB A;  1DTZ A;  3I3V A;  3IOV A;  3K1P A;  3FXU A;  1IXG A;  4POX A;  3S2V A;  1DTG A;  2Q88 A;  2XD2 A;  3UP9 A;  3R26 A;  1B1X A;  4FEC A;  3CSB A;  3OOA A;  2DYX A;  2RC9 A;  1IIW A;  4BDR A;  1TXF A;  4GRK A;  1Q35 A;  1MXW A;  2VP1 A;  1ELJ A;  3UN6 A;  2AL4 A;  3O9P A;  4ISU A;  5CMM A;  4DXU A;  2Z8F A;  1D4N A;  1LAF E;  1JEV A;  1GGG A;  1XHY A;  2UVJ A;  1Y9U A;  3CI8 A;  3CRB A;  4PFU A;  4XTC Q;  5EYF A;  4BDO A;  1R9L A;  3ZS6 A;  1N0T A;  5TPA A;  3VLU A;  1FTM A;  2QJE A;  1IXH A;  1NNF A;  3MVX A;  3Q29 A;  4DDD A;  4F2O A;  3PPP A;  5H8F A;  3TFL A;  3F11 A;  4JSD A;  2DWA A;  1D3K A;  1Y20 A;  2ZXT A;  3OD7 A;  1R6Z A;  3GXA A;  4FIM A;  4H8I A;  5B7D A;  3O6G A;  3OMB A;  3HPI A;  2RC7 A;  3W9V A;  5L9O A;  1OVB A;  1AIV A;  2REG A;  4YKP A;  1PBQ A;  1B0H A;  1PB8 A;  1P1Q A;  2A5S A;  3MP6 A;  4NF8 B;  2ONR A;  2B3F A;  5FHM A;  3TYH A;  5I84 A;  1CB6 A;  4KHZ E;  4PFW A;  1QJM A;  4DZ1 A;  5I57 B;  5TPA B;  3HV1 A;  2UYF A;  4BDM A;  1B46 A;  2Y84 A;  3QUF A;  5H8Q B;  4R9F A;  2QSX A;  3G3J A;  1CE2 A;  3MC2 A;  1MH3 A;  4JSO A;  1LFG A;  3BKI B;  3G3K A;  3MQ9 A;  2GRV A;  3KOS A;  1LFH A;  2F7B A;  5AA4 B;  3E3K A;  1I6Q A;  2XX7 A;  5KZT A;  1A99 A;  2P0S A;  1P99 A;  3MVW A;  1LAG E;  5AE4 A;  3ILU B;  1AOV A;  1MXY A;  1MDQ A;  4PQJ A;  3SER A;  2G93 A;  4IY5 A;  4DCX A;  1LFI A;  3E9X A;  4JWX A;  4LQ5 A;  2DXR A;  4NF5 B;  5H8S A;  3VXB A;  3EN3 A;  5CBS A;  4ZS9 A;  2H25 A;  1YAE A;  4F19 A;  2Y7K A;  3DLN A;  4O3B A;  2HEU A;  3K6U A;  4ZE9 A;  5I59 A;  3K6V A;  1PBP A;  4IY6 A;  1B4Z A;  1SW4 A;  2UVG A;  2O1L A;  2V25 A;  4OFL A;  1PC3 A;  1MG1 A;  2FYI A;  4KCC A;  2IEE A;  3L6G A;  1IXC A;  1ZBM A;  2Q9T A;  2V3Q A;  3C33 A;  3LR1 A;  4R2B A;  4R6K A;  3PD8 A;  1KWH A;  2REJ A;  1GTK A;  3G3F A;  3TTM A;  2OZZ A;  1OQH A;  5DVI A;  5K2Y A;  2D3I A;  3KOT A;  4ZE8 A;  5ICQ A;  1RYO A;  1URD A;  1B7Z A;  3IOW A;  3LUY A;  4H0W A;  4M1V A;  4FOR A;  2XXY A;  1IXI A;  3KEI A;  3GBA A;  3OEL A;  4Q8R A;  3PMV A;  4M4G A;  1URG A;  2M8C A;  4IO3 A;  4QHQ A;  5FTI A;  4X1D A;  4IO4 A;  3FXQ A;  1Y1Z A;  1B7H A;  5AA1 A;  3FJ7 A;  2H5Y A;  3D4C A;  4FEB A;  1MQI A;  1FQF A;  3HHF A;  4IO7 A;  2UVH A;  4MFI A;  3K02 A;  4GXA A;  3ZKL A;  3SKP A;  2DVZ A;  1FQB A;  1AH5 A;  2Z22 A;  4QFL A;  2QS3 A;  1JQF A;  1Y3Q A;  3FJM A;  3PUY E;  3KG2 A;  3MUQ A;  4GD5 A;  4MBP A;  2B3B A;  2PT1 A;  1SYH A;  2THI A;  1B1H A;  1Y4T A;  1Z7M E;  1JW1 A;  1FTL A;  1XT8 A;  3KGC A;  3KN7 A;  3V8X B;  2I58 A;  2RC8 A;  3PUX E;  3QYT A;  3ODB A;  2O69 A;  2F6G A;  1BTJ A;  4L17 A;  4OFJ A;  3OO7 A;  1B3G A;  1MXU A;  3FZV A;  4LUB A;  3FVN A;  2XXP A;  1L5T A;  4ZEK A;  2H9B A;  1B7U A;  1QUJ A;  4O3C A;  4OWD A;  3PD9 A;  3C36 A;  4DE8 A;  4DCY A;  1MQH A;  2PYY A;  3ECR A;  4XKP A;  4ZEI A;  3UOR A;  3T22 A;  4YAH X;  1TFD A;  2A5T A;  2GHA A;  1N84 A;  2YJP A;  3O6I A;  2NOO A;  2DQV A;  3IB0 A;  2O51 A;  1UTB B;  1SD3 A;  4ELQ A;  3O97 A;  3IL1 B;  2ONS A;  2Q89 A;  1QUK A;  2F78 A;  2I6E A;  2O6A A;  4QRZ A;  3K6W A;  3N6U A;  4ZDM A;  4I62 A;  2V84 A;  4KR5 A;  2X7P A;  3SEV A;  3T9X B;  3S9E A;  5EHS A;  1A8E A;  5M2V A;  2OWS A;  4GWO A;  1QUI A;  4FE8 A;  3MVZ A;  3TQL A;  3LSL A;  1OLC A;  5F1Q A;  3RTW B;  1XOC A;  5ELV A;  3SET A;  3TTN A;  1H3D A;  4OER A;  3KJ7 A;  2H99 A;  4U22 A;  3D4G A;  3OEK A;  4F1Y A;  3SEU A;  1USY H;  2ZMB A;  2PVU A;  3EF7 A;  2H98 A;  3FVO A;  1EH3 A;  4RYA A;  3U1O A;  4F39 A;  4XKN A;  1NFT A;  2D21 A;  3DEL B;  1B5H A;  3MZ1 A;  3RPW A;  1A40 A;  4R72 A;  3CVG A;  4AB6 A;  1B3E A;  4Q5T A;  1MPC A;  2I48 A;  2X7Q A;  4R6Y A;  5I58 A;  4U23 A;  5AA4 A;  2PT2 A;  1FTO A;  3H6W A;  2F35 A;  4KPT A;  3FV2 A;  4ESW A;  4OVJ A;  4NMY A;  1B52 A;  2ZYK A;  3N5L A;  4Z7E A;  4YMB A;  1P1W A;  4XKR A;  5DT6 A;  3FXR A;  3PU5 A;  2F34 A;  1NKX A;  2Q8J A;  2Q2A A;  1BLF A;  3H06 B;  4R74 A;  5DTB A;  3V89 B;  1LAX A;  4K3F A;  1ZIU A;  2QS4 A;  3C32 A;  4NF4 A;  4NED A;  1S50 A;  4EXL A;  5AA3 A;  3N94 A;  5L9S A;  1HSE A;  2DXY A;  1I6A A;  2RKM A;  5HBC A;  4BLA A;  1D9V A;  1VFE A;  2OJT A;  3EQ1 A;  5BUU A;  1B05 A;  4YKJ A;  1UIV A;  2UYE A;  4AQ4 A;  1FQC A;  5KDT B;  2X26 A;  4RK9 A;  4TLM B;  2Z8D A;  3TUS A;  1BP5 A;  1OIB A;  3MP1 A;  3OO9 A;  3O6H A;  4IO6 A;  1VFD A;  2E1S A;  4FJP A;  4NF4 B;  4ELP A;  2GH9 A;  1ZKB A;  4C1T A;  4NF8 A;  5JEI A;  4LQ2 A;  2NVU B;  4IGR A;  3VVE A;  3SEX A;  3H7M A;  4EQB A;  5BWJ A;  3C35 A;  4HS7 A;  1NNK A;  2ZNT A;  4YB6 A;  3CG3 A;  3SDF A;  3U72 A;  2ZYO A;  3Q27 A;  3MJN A;  2I49 A;  4MLV A;  1EZO A;  3PV0 E;  3U93 A;  4OTE A;  3G3H A;  2XHD A;  3RY3 A;  3FV1 A;  4G8M A;  1RKM A;  3C34 A;  3CFZ A;  3IB2 A;  1USY E;  1JW5 A;  2DWI A;  2OWT A;  4GIZ A;  4GL0 A;  4G8H A;  4LA9 A;  4OQO A;  3K00 A;  2KLF A;  3MAM A;  3QUJ A;  2RCA A;  1BKA A;  4IGT A;  1B58 A;  2I4B A;  2PMS A;  4R6H A;  3H4Z A;  4Z0I A;  3TKD A;  4C0R A;  1TFA A;  3FVG A;  3PPN A;  5I2N A;  2QRY A;  4JBZ A;  3H6V A;  2ZNS A;  3HST A;  3T9H B;  4ECF A;  5CMK A;  3ZKK A;  4E0W A;  3JV9 A;  2HXW A;  4RPN A;  1MM7 A;  1QKB A;  2Y7P A;  1LCT A;  1XS5 A;  1P1U A;  1NH7 A;  2B65 A;  2Y7R A;  1R1N A;  4GOT A;  4I9D A;  4PFT A;  5CI5 A;  4YB7 A;  1GV8 A;  4YU0 A;  3U94 A;  5B70 A;  1B5I A;  1FQE A;  2Z8E A;  2ZYM A;  1M5F A;  2F5X A;  4X1B A;  4IO2 A;  1LLS A;  3RGY A;  3RT6 B;  1IEJ A;  3B7D A;  4G68 A;  3L6H A;  3T9V A;  2XXV A;  4OXV A;  2RF1 A;  4LZ8 A;  4G4P A;  5LOM A;  3MP8 A;  5L8D A;  4QFO A;  4BDQ A;  5ISU A;  4ZED A;  3ZSF A;  5IKB A;  3TPA A;  3FGS A;  2I4C A;  1Y3P A;  3MWB A;  3DM0 A;  5J1D A;  5ITP A;  3LSF B;  3HO7 A;  4ZZE A;  5TP9 A;  4LAT A;  2PX1 A;  4U21 A;  1Y1M A;  3IO6 A;  2DVC A;  2WKY A;  3C4M A;  1R9Q A;  1QUL A;  3H6U A;  1UTH B;  4YKK A;  1H44 A;  3PMW A;  5HM4 B;  4XKQ A;  5KCJ A;  3PMX A;  1MDP 1;  1OLA A;  1RYX A;  2CZL A;  4KCD A;  2BJJ X;  3LSW A;  3I5O A;  4FAJ A;  4EF1 A;  1NNT A;  4RJZ A;  4DXB A;  1H76 A;  4N07 A;  1SI0 A;  1O7T A;  2FNC A;  3QSL A;  4LP2 B;  4PP0 A;  5JTY B;  1I69 A;  1MRP A;  1ZJL A;  4GVO A;  4HCY A;  4F29 A;  2HAV A;  4ND9 A;  5K2X A;  1O64 A;  4XXU A;  5I58 B;  5DEX B;  1IIT A;  4POW A;  2HQ0 A;  3VLW A;  2O7I A;  1WVJ A;  1NMU A;  4KQP A;  4QSE A;  4RXL A;  2XXW A;  2ABH A;  3IO4 A;  1US4 A;  1UTH A;  2YLN A;  1XVY A;  3PUZ E;  3FJG A;  4GQO A;  5IAI A;  4U4S A;  2XX8 A;  1OVT A;  3MZB A;  1ATG A;  1QVS A;  1FW0 A;  3FAT A;  2DWJ A;  4DLD A;  4ZEB A;  2QPQ A;  4OEN A;  3UA8 A;  1B32 A;  1LBB A;  1N7W A;  4LON B;  4G68 C;  4LVQ A;  4ELO A;  1MPD A;  3EPE A;  2F97 A;  3PUV E;  5A5X A;  3V5A A;  1ZU0 A;  4QFK A;  1AMF A;  1F9B A;  3QK6 A;  2IA4 A;  1YPN A;  4OFO A;  4F1V A;  4IO5 A;  1H45 A;  4GL8 A;  1DSN A;  4H5F A;  1JVY A;  1MY0 A;  2VOZ A;  2ESN A;  2FA7 A;  1B2H A;  3IOR A;  2DP8 A;  4P0I A;  1NH8 A;  3TMG A;  3DP6 A;  1UTB A;  2ONK E;  4G77 A;  2E0S A;  5CMB A;  4UA8 A;  2P2A A;  4JXI A;  1IZ1 A;  3RTF B;  2R71 A;  1URS A;  1SI1 A;  3HCQ A;  1XVX A;  4NWC A;  5H8H A;  2V3U A;  3S9L C;  4QSC A;  1OQG A;  3GLB A;  3O29 A;  1M5D A;  1BIY A;  3CFL A;  4EXK A;  3B6Q A;  1II5 A;  1N76 A;  3N6T A;  1P1N A;  1M5B A;  2NUV A;  1QW0 A;  2XXH A;  3BBR A;  3R6U A;  4LZ7 A;  4TQU Q;  2ZNU A;  4U4X A;  3QAX A;  3IOT A;  3E4R A;  5ICT A;  3DP4 A;  4NF6 A;  4JDF A;  2F7C A;  3TCG A;  3KSX A;  4KYS A;  3VV5 A;  1T0K A;  5CMC A;  3SEY A;  3OSR A;  4EQ9 A;  1ZMG A;  2UXA A;  5JTY A;  3H03 A;  4X48 A;  5AA2 B;  3M3F A;  4ESX A;  1LBC A;  2H4I A;  1B40 A;  1JET A;  1LGB C;  2Y7I A;  5I2K B;  1LAH E;  3TQW A;  1SBP A;  1Z7N E;  4HTG A;  1YTV A;  4FAT A;  1B3H A;  4QSD A;  2I0C A;  5KCJ B;  4BDN A;  1SQY A;  4KYE A;  2XD3 A;  3KBR A;  3MPL A;  3UK4 A;  2DOJ A;  2AIX A;  5TU0 A;  4R73 A;  4U2R A;  1HSL A;  4I1D A;  2YPN A;  5DEX A;  2HZK A;  3G3I A;  3KN3 A;  1N7X A;  1Q1K A;  4H6D A;  2QMX A;  2P1S A;  1A54 A;  4X9T A;  1YCJ A;  2XXT A;  2ZYN A;  1GVC A;  3TEP A;  1HSJ A;  1J1N A;  1WOD A;  2OK2 A;  3M3K A;  3N26 A;  5AA2 A;  4NE4 A;  3Q26 A;  1IQ7 A;  3VFJ A;  1JW4 A;  5F7V A;  5CRY A;  3EHU A;  1S7Y A;  2XXX A;  3IR1 A;  3PUW E;  4KYD A;  3S9M C;  4N6P A;  3CSG A;  4F2Q A;  4F3P A;  4MLQ A;  5JK4 A;  4YZZ A;  5FTH A;  5H8N A;  3VE1 B;  4H1X A;  3M8U A;  2O68 A;  2G29 A;  2HFB A;  2F8D A;  3EHS A;  3K6X A;  5TP9 B;  3TDJ A;  3TTL A;  1JEU A;  4U1Z A;  1MXV A;  2I0B A;  1UQW A;  2F36 A;  2GFE A;  1MY2 A;  2NXO A;  3RQT A;  2QL3 A;  3C9H A;  2VD2 A;  3P7I A;  1EU8 A;  3RN8 A;  2HCA A;  4H8J A;  3GBB A;  4RA1 A;  4HW8 A;  4P0G A;  1PB7 A;  4PET A;  4KFQ A;  3CIJ A;  3G7W A;  1B9J A;  3I6V A;  4R9G A;  5DYH A;  3SEW A;  3T9U A;  3PGF A;  1EZP A;  2O84 X;  4JB7 A;  4NWD A;  3HHG A;  2RIN A;  3H6T A;  4ONY A;  3WAF A;  3VVD A;  5I2N B;  4H65 A;  1MQD A;  2PBW A;  2OCU A;  5CM6 A;  4YMA A;  1S9T A;  4OEU A;  3BFU A;  5DVF A;  3ONM A;  1IUD A;  5I56 B;  4R2F A;  3PPQ A;  1GR2 A;  3VDF A;  3O2A A;  2A5T B;  4EUO A;  1O63 A;  1MY1 A;  4F3G A;  4Q30 B;  4OHN A;  3OEN A;  3CFX A;  1EZ9 A;  2HAU A;  4PE5 B;  4ZEF A;  4GF8 A;  3TCF A;  1M5E A;  1I6B A;  3JZJ A;  3OO8 A;  4JWY A;  3WAE A;  4OMB A;  2V93 A;  3TTR A;  4F18 A;  4GFR A;  3TAJ A;  3LSX A;  4DXC A;  2XXI A;  3M3L A;  3A3C A;  5CC2 A;  3K1N A;  2F7A A;  5KDT A;  5AA2 D;  2QS2 A;  3MW0 A;  4KI0 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...