4KFQA

Crystal structure of the nmda receptor glun1 ligand binding domain in complex with 1-thioxo-1,2-dihydro-[1,2,4]triazolo[4,3-a]quinoxalin-4(5h)-one
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
289
structure length
289
Chain Sequence
TRLKIVTIHQEPFVYVKPTMSDGTCKEEFTVNGDPVKKVICTGPNDTSPGSPRHTVPQCCYGFCIDLLIKLARTMNFTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKGTRITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSHENGFMEDLDKTWVRYQECDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Glutamate receptor ionotropic, NMDA 1
publication title Crystal structure and pharmacological characterization of a novel N-methyl-D-aspartate (NMDA) receptor antagonist at the GluN1 glycine binding site.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 82
structure length 289
sequence length 289
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4kfqA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4kfqA02
5I2KB 4NF8A 1NNFA 1Y3PA 5TP9B 3TMGA 2NXOA 3O6IA 1LAGE 3QUJA 4F3SA 5K2YA 4KQPA 4GRKA 3U1OA 4OHNA 1FQCA 1A55A 4YB5A 1MQIA 3H6WA 5AE4A 5AA3A 1MY1A 4ONYA 2ANJA 4OVJA 4U4SA 2Z8FA 3RTWB 4F2QA 1DSNA 4JDFA 2OK2A 4YMBA 4K3FA 4ZZEA 3K6UA 2YPNA 1SBPA 4OEVA 3K1NA 4N07A 5AA4A 1UIVA 1J1NA 3OO8A 4IGTA 1XHYA 2H99A 1LBBA 2O51A 3VDFA 3IR1A 3DLNA 3FXUA 5CMBA 3Q27A 3D4GA 1VFDA 1D3KA 4IGRA 4JSDA 1RYOA 4KR5A 2XHDA 1Y4TA 4QF9A 1BIYA 1EZOA 4EUOA 3MJNA 2W7YA 1M5FA 3TZAA 4WXJA 2RC9A 2QPQA 3TODA 2I6EA 4X1BA 4ELRA 1JEUA 4IO7A 3E13X 1DTGA 3FGSA 1Z7ME 1Y1ZA 2D3IA 2Z8DA 3H03A 4R6KA 5CMCA 5H8SA 4RYAA 4WEDA 2R6GE 4R6HA 3UORA 3KN3A 5CBSA 4DLDA 3K01A 4OMBA 2ZNSA 2F6PA 1ZIUA 3S9MC 3SESA 4AB5A 1NKXA 4HCYA 2HQ0A 3ILUB 5EYFA 1BTJA 5A5XA 2Q8JA 1MY0A 4G8MA 3M8UA 1UQWA 4BDQA 3U72A 4RK2A 1XVXA 1CB6A 2QS1A 1SVXB 1H44A 3MPKA 1S50A 5CMKA 3FZVA 1POTA 1Y9UA 1MPBA 1XS5A 1B0HA 1M5CA 2QRYA 2I58A 4I1DA 5B70A 4PFYA 1MY2A 1R1NA 1UTBB 3K02A 1S7YA 4BDRA 1Q35A 3VLVA 1B4ZA 4OETA 5F7VA 5H8HA 3TTKA 4P0IA 2QMXA 3KEIA 5I56B 3O29A 1ZTYA 3KN8A 3P7IA 1N7XA 4NF4A 2XXIA 4GOTA 3VVFA 2R9JA 1P1OA 3FJ7A 1OMPA 3IL1B 2QS4A 3TCGA 4DIGA 5JEIA 2I0CA 3CSGA 4NF6A 4R6YA 1NH7A 4LUBA 4MBPA 1QUJA 2OJTA 3PUXE 1IEJA 3MVYA 3LSXA 4R73A 5L9OA 1Y1MA 4DCYA 5AA1A 3OD7A 2ZXTA 1US4A 4HS7A 4DCXA 1TXFA 1MH4A 3H6UA 3V5AA 2ESNA 3MPLA 4OZ9A 2X26A 3UN6A 1LCFA 3MVXA 2VD3A 4GQOA 1FQFA 3QIMA 4JXIA 3ZS6A 4G8NA 5M2VA 3KGCA 3TUSA 5I2NB 4FEBA 1LAXA 1XVYA 3U94A 4ELQA 1DMBA 1A8EA 1IXHA 4OXVA 3SEWA 4NF8B 5JK4A 1MXZA 1FQEA 4WEPA 5DYHA 1GR2A 1Y3NA 4NF5A 4F3BA 1MM7A 4F2OA 1OLAA 2DOJA 3C35A 1AOVA 4I9DA 4Z0IA 2I0BA 5I58A 4N6PA 4DE8A 4LVQA 2DWHA 5AA4B 1OVBA 3SDFA 5TPAA 3IB0A 4ZDMA 1MM6A 3PUYE 3Q25A 1B05A 4R75A 5TU0A 4RK9A 1QKBA 2RC7A 1AL3A 1EZPA 2DE4A 3TFLA 1SW4A 3FVGA 4LP2B 3QAXA 3FASA 4FATA 4MLQA 2Z8EA 4ZS9A 1JEVA 4ZEIA 3QUFA 2QJEA 4H0WA 2XX7A 3E9XA 1FTKA 1WDNA 5DVFA 4IO3A 2RKMA 5H8NA 3GBBA 4JBZA 4F1VA 2QS3A 3ILTB 4R74A 1PDAA 2AL4A 1YAEA 2UVIA 1POY1 3PMVA 3TTLA 2F97A 1OIBA 2KLFA 3FUZA 1US5A 1BP5A 3TTNA 4KD5A 1FQBA 3WAEA 3LUYA 3Q29A 3CG3A 2V25A 3B6WA 1B40A 4IO2A 4U2RA 1EU8A 3T9UA 3O97A 4OESA 3RT8A 2V3UA 1B7HA 2VD2A 4H67A 3OMBA 1PB8A 4LQ2A 5A5XB 3R6UA 3C4MA 2OBGA 3EN3A 5KDTA 4O3CA 1CE2A 3G3JA 5CC2A 1YPNA 3D4CA 1Y4CA 2Y7RA 3B6TA 2I4BA 4KFQA 4FEDA 2H4IA 3I3VA 3CI8A 1O7TA 3IORA 4HCWA 3U92A 4JWOA 2ZNUA 4YB6A 1N04A 2Y7PA 3PUVE 3V89B 3KJTA 3PD8A 2O68A 2HAUA 1NNKA 4GL0A 3N6TA 3LSWA 2OCUA 3QYTA 4F31B 2GHAA 3A09A 2Q89A 5DVJA 3VXCA 2VGQA 1AIVA 3IO4A 3PPPA 2G93A 3OENA 3CSBA 4Q8RA 4PQJA 4NF6B 2XXQA 3O9PA 4RJZA 4RPNA 4PE5B 3T96B 4LONB 4ECFA 1LFHA 4ELPA 1P1QA 4FAJA 1MXYA 1B52A 3IB2A 1PBQA 3RUMA 1LB9A 3GLBA 2CMOA 4Q30B 1D9YA 3S4UA 4OFOA 3T9HB 4TLLB 1B32A 4Z7EA 3KJ7A 4QSDA 2Y7KA 4U22A 5ICQA 5JTYA 2ZYOA 3PPRA 1ZMGA 4TLMB 1Y3QA 4YAHX 1IQ7A 3B7DA 4QFKA 2O7IA 3RPWA 1GVCA 3PGFA 5AA2B 4G2ZA 3W9WA 4OYVA 3N6UA 1P1NA 5CBRA 4HTGA 5KCJA 2NOOA 3ZKKA 1ATGA 2Y84A 4KYDA 4ZE9A 4JWYA 3LR1A 3AXFA 1H76A 3HSTA 3MVWA 1M5EA 3PPQA 3TELA 5L9MA 4H8JA 4C0RA 4F18A 1A54A 3HV1A 3VLUA 5H8QB 4QFLA 3TQLA 4OFJA 3W15C 1QW0A 4P11A 2XXXA 4PFUA 4MF3A 2IEEA 2F78A 3FVNA 3G3FA 2VOZA 2NVUB 1TFAA 1DOTA 3TPAA 2HEUA 1B3EA 4NEDA 3M3FA 4GF8A 3K4UA 2H5YA 2OWTA 3VVDA 3IOWA 3TYHA 1ZJLA 1FQAA 1USYH 4THIA 1LLSA 1B3HA 3MBPA 1UIUA 3DM0A 4F1YA 2P0SA 2X7PA 4DDDA 3MP1A 1VE4A 5H8NB 2UVHA 3LSLA 5FTHA 3FD3A 5HBCA 4XKQA 4ZZAA 4RPOA 3GBAA 5H8FA 1OVTA 3S9EA 1B51A 2DXYA 4GVOA 4PFWA 5ITOA 2AIXA 1B7UA 5FHOA 4MLVA 3MZ9A 3KSJA 2XX9A 2OZZA 1VR5A 4WKMA 4U21A 4G4PA 4GXAA 2I48A 4X48A 3UK4A 1IUDA 4L17A 1JVYA 3DP6A 5HPQA 3H6TA 2OWSA 2H9BA 3DELB 4QSCA 1IZ1A 3KOTA 3QXMA 3PPOA 3UA8A 2XXYA 2ABHA 4H1XA 2RC8A 3CIJA 4Q0CA 1M5DA 5LOMA 4R9GA 2A5TA 3IJOB 4OQOA 3IOTA 1HSEA 3CRBA 5B7DA 2O1MA 3LC8A 2B3BA 2XXHA 2RCBA 4GXSB 3TCHA 4EF1A 3FVKA 3O66A 1BLFA 4YU0A 4XIGQ 2RCAA 1PBPA 4BLAA 3R26A 1MDP1 4QRZA 1XOCA 1N3XA 3FXQA 1SYHA 5I84A 4P0GA 3A3UA 1I6AA 4F29A 2F8DA 4HW8A 5DEXB 3OEMA 5HM4B 1JQFA 4AQ4A 3I5OA 3HO7A 1EH3A 2F7BA 2GFEA 1SYIA 4R72A 3IOUA 2UYFA 1NH8A 2BJJX 5BUUA 2Q88A 3S9LC 3R7XA 4KYEA 3BKIB 3TTRA 1I69A 4KPTA 3IO6A 1GV8A 3L6GA 2IA4A 3OOAA 4FE8A 4FECA 1B1XA 4PFTA 1P99A 4BDOA 3EHTA 3SKPA 4ZEKA 5ITPA 3RGYA 3H06B 4EXLA 1SW1A 3CFLA 1R9LA 1H45A 2PT2A 3IOVA 1T0KA 1B3GA 4M1VA 5FHMA 3L6HA 2I4CA 4FORA 3KBRA 4IO5A 4EQBA 2O7UA 4POWA 4YKPA 5CRYA 1FTJA 2F6GA 4KCDA 3B6QA 1IIWA 2QS2A 5KCJB 2O69A 2YLNA 3V83A 4R9FA 5ICTA 4LZ5A 2P1SA 1ZU0A 1M5BA 4N13A 4YB7A 1SW5A 2V93A 1B5IA 4E0XA 3Q28A 2Y7WA 4XTCQ 4F3PA 3TTMA 3TQWA 4QSEA 3UP9A 3O28A 3KZGA 4LZ8A 4NWCA 4FIMA 3K1MA 2Q2AA 3PMWA 1N0TA 2B3FA 1NNTA 2R71A 4TOZA 4LQ5A 4XXUA 3LBSA 3K1PA 4YKKA 4MH5A 3MAMA 2VP1A 3VV5A 4LZ7A 1LB8A 2E1SA 5L9SA 4NTLA 1NL5A 2FNCA 1LSTA 4LATA 2XXRA 3FJGA 4O3BA 4GFRA 3EHSA 2Q9TA 4EF2A 1FTLA 5FHNA 3K6WA 2F36A 4H65A 2PX1A 1TT1A 3K0VA 4YZZA 4R2BA 4F39A 3ODBA 3DP8A 4ZECA 1JW5A 2ZYNA 3K2DA 5DVIA 1SI1A 3N94A 3TDJA 5I56A 1MG1A 4RA1A 4F1UA 3N26A 1N3WA 2RF1A 1XT8A 3W9VA 1P1WA 3GZGA 5H8HB 1MQDA 3H7MA 3SEUA 2ZYKA 1SI0A 4JWXA 1PEBA 2XXVA 3QSLA 3KSXA 4NF4B 1IXIA 4DXBA 1O63A 4Q5TA 4ZEBA 4FJPA 1ELJA 5I57A 1B5JA 1A8FA 4ELOA 4TQUQ 3T9XB 2ONRA 1JNFA 1P1UA 4LA9A 1AMFA 4OERA 1ZKBA 2PMSA 2REJA 1IXCA 4RY1A 3OO7A 2XD3A 3A3CA 2ZMBA 2DVCA 3VXBA 2ZNTA 4U1ZA 1YCJA 1IITA 3M3LA 3V8XB 2M8CA 3OO6A 1B3LA 5CMMA 4PP0A 1ZLQA 1NMUA 1A99A 4JSOA 4MFIA 1JVXA 4KYSA 1MXXA 1S9TA 1EZ9A 1FTMA 1VSOA 4C1UA 2HZKA 5I2NA 5IAIA 1B58A 1USYE 2ZYMA 1FW0A 1OQGA 1II5A 3RY3A 1N84A 1NFTA 3EF7A 1AH5A 4XKRA 4BDLA 2ALUA 5ELVA 2F7CA 3DP4A 4EXKA 3PMXA 3RLFE 3UIFA 4EDPA 3PPNA 3EHUA 5KZTA 2AL5A 4BDNA 1ZBMA 2YJPA 4IO6A 3PV0E 1UTHA 2PBWA 3BFUA 3VVEA 1MQJA 1JW4A 1SQYA 1BKAA 1DTZA 1B4HA 4NF5B 5J1DA 3QK6A 1D9VA 4RNSA 2V3TA 3HCQA 4U1OA 2DSFA 1R9QA 1QKAA 4G68A 4G8HA 4IB2A 4NE4A 3MQ9A 5I58B 3UGWA 2A5SA 3GXAA 1RKMA 3U8QA 3KG2A 2D21A 1NNPA 5FTIA 3PUWE 1QUKA 3MW0A 5TPAB 1KWHA 3G3IA 5I59A 3IK6B 3SEXA 1B9JA 1WODA 1Y20A 1N7WA 1MY3A 1Q1KA 1DPPA 5AA2D 3O6HA 1LAHE 4M4GA 3I6VA 2DQVA 3JYRA 4G68C 4ZEFA 2DYXA 1URDA 3TCFA 2DXRA 2THIA 4GWOA 2WKYA 2NUVA 2UVGA 2ONSA 3RTFB 1F9BA 3C33A 4JB7A 1B3FA 2HFBA 4YKJA 1HSLA 3M3KA 3TAJA 3C9HA 3T93B 4O3AA 4U23A 3SEVA 3CG1A 1D4NA 3F11A 4DXCA 1TFDA 2I3WA 2DE3A 3IX1A 4OFLA 3OSRA 1MS7A 4F3GA 4UA8A 3G3GA 2RINA 4QFPA 1R6ZA 3FXRA 2DWIA 3HHGA 2CZLA 2HXWA 4F19A 3THIA 3H3GA 2O6AA 4KCCA 4GIZA 3USDA 2O1LA 3VFJA 2O84X 5KDTB 3MVZA 3CFXA 4IY5A 1XC1A 2PVUA 5K2XA 1QUIA 2XX8A 1TWYA 2V84A 1LGBC 1LFGA 5F1QA 2OLBA 5CI5A 4QFNA 2H25A 5EHMA 4IO4A 2UXAA 1SW2A 4I62A 1LCTA 3K6XA 1YTVA 2F34A 2DE2A 1B5HA 2I49A 3ONMA 5I57B 2I3VA 1OQHA 4I8CA 1IXGA 3OXNA 3OO9A 3MWBA 4H5GA 3OEKA 4QHQA 1QJMA 2ONKE 3T9VA 3G3KA 3TKDA 3SERA 5I2KA 1MXUA 2NWJA 1LFIA 4POXA 3MUQA 3RN8A 1I6BA 3FJMA 3G3HA 5TP9A 2QSXA 3MC2A 3MP8A 3MP6A 4X1DA 1B0LA 4OWDA 2XXTA 4XKPA 3WAFA 5DTBA 3IB1A 4YMAA 5AA2A 1OLCA 5JTYB 5DT6A 3CFZA 3FV1A 1L5TA 3MZ1A 2UYEA 4DXUA 1H43A 5BWJA 3PUZE 4U4XA 4QFOA 4KHZE 3EQ1A 3RNNA 1MXWA 3H6VA 1WVJA 4UACA 4ZE8A 3RQTA 3T22A 3CR9A 3BFTA 1PB9A 2DP8A 2E0SA 3HN0A 5H8QA 3S9NC 2XXPA 2D5WA 3G7WA 1N76A 2B65A 1UTHB 2PYYA 4ESWA 1FQDA 2GRVA 1MPDA 1I6QA 3LSFB 3SETA 4GD5A 1B6HA 1PB7A 2UVJA 4R2FA 3C34A 4YICA 4G68B 3OELA 3RT6B 2GHBA 3ECRA 3FVOA 5CM6A 3FV2A 5L8DA 2Y7IA 1MH3A 4H5FA 5I59B 4GL8A 2F7AA 3K00A 1FTOA 1QULA 4OEUA 3PU5A 3U93A 4IY6A 3KN7A 2Z22A 3JV9A 4YKIA 1RYXA 1GGGA 5EHSA 3C36A 4EQ9A 3T66A 2LAOA 4F22A 1MPCA 4AB6A 2DVZA 1MRPA 3OSQA 2QL3A 3CVGA 3O6GA 1LAFE 1ANFA 1MDQA 2F35A 3HPIA 2P2AA 1SD3A 4OENA 4ISUA 3JZJA 3TEPA 3ZKLA 2XXWA 3HHFA 1A7LA 1URGA 3Q26A 5H8FB 1UTBA 3ZSFA 3VLWA 3VE1B 1B1HA 2F5XA 1URSA 4BDMA 2XD2A 1DPEA 3E4RA 4H8IA 1FCKA 3EPEA 4XKNA 2XXUA 1HSJA 2Z23A 5ISUA 4C1TA 3PD9A 1QVSA 2X7QA 2H98A 4ESXA 3SEYA 2Q2CA 4G77A 4KI0E 1A40A 2G29A 1JETA 5IKBA 3C31A 1B46A 1H3DA 2AYSA 2FA7A 2QMWA 4ND9A 4OTEA 3H4ZA 2A5TB 1MXVA 2GH9A 3O2AA 1JW1A 4NWDA 2HZLA 1PC3A 3MZBA 1MY4A 3K6VA 2REGA 4E0WA 4DZ1A 2FYIA 5DEXA 2DWAA 2DS9A 2PT1A 3S2VA 1VFEA 4EQ7A 1LBCA 3C32A 1MQGA 3KOSA 1B2HA 3FATA 2V3QA 4PETA 1GTKA 1SDXA 1Z7NE 2HCAA 1B7ZA 3N5LA 3IJXB 4ZEDA 4GLIA 3BBRA 3FIRA 3IAZA 2DWJA 2VHAA 4NMYA 1MQHA 4H6DA 4RXLA 2HAVA 3KFMA 4X9TA 1O64A 3E3KA
chains in the Genus database with same CATH superfamily
5I2KB 4NF8A 4MNIA 1NNFA 2OX3A 1Y3PA 5TP9B 3TMGA 2NXOA 3O6IA 1LAGE 3QUJA 3KBZA 4F3SA 5K2YA 4MMPA 2FIXA 4KQPA 4GRKA 3U1OA 4OHNA 1FQCA 2GQ1A 1A55A 4YB5A 1MQIA 3H6WA 5AE4A 5AA3A 1MY1A 4ONYA 2ANJA 4OVJA 4U4SA 2Z8FA 3RTWB 4F2QA 1DSNA 4JDFA 2OK2A 4YMBA 4K3FA 4ZZEA 3K6UA 2YPNA 1SBPA 4OEVA 3K1NA 4N07A 5A5LA 5AA4A 4GWYA 1UIVA 1J1NA 3OO8A 4IGTA 4JVCA 1XHYA 2H99A 1LBBA 2O51A 3VDFA 4MX6A 3IR1A 3DLNA 3FXUA 5CMBA 3Q27A 4OVPA 3D4GA 1VFDA 5EQ9A 1D3KA 4IGRA 4JSDA 1RYOA 4MIJA 4KR5A 2XHDA 1Y4TA 4QF9A 1BIYA 4PFIA 1EZOA 4EUOA 3MJNA 2W7YA 1M5FA 3TZAA 4WXJA 4OVTA 2RC9A 2QPQA 3TODA 2I6EA 4X1BA 4ELRA 1JEUA 4IO7A 3E13X 1DTGA 4NX1A 3FGSA 1Z7ME 1Y1ZA 2D3IA 2Z8DA 3H03A 4R6KA 5CMCA 5H8SA 4RYAA 4WEDA 2R6GE 2Q8MA 4R6HA 3UORA 3KN3A 5CBSA 4DLDA 2CEXA 3K01A 3U65A 4OMBA 2ZNSA 2F6PA 1ZIUA 3S9MC 3SESA 1JP4A 4AB5A 1NKXA 3E79A 4HCYA 2HQ0A 4AS5A 2XWIA 2F3DA 3ILUB 5EYFA 1BTJA 5A5XA 3LUZA 2Q8JA 2CEYA 1MY0A 3ISPA 1BK4A 4G8MA 3M8UA 1UQWA 4BDQA 3U72A 4RK2A 4MCOA 1XVXA 1CB6A 2QS1A 3KC0A 1SVXB 1H44A 3MPKA 1S50A 5CMKA 3FZVA 1POTA 1Y9UA 1MPBA 1XS5A 2MKZA 1B0HA 1M5CA 2QRYA 2I58A 4I1DA 5B70A 1FPKA 4PFYA 1MY2A 3D1RA 1R1NA 1UTBB 3K02A 1S7YA 4BDRA 1Q35A 3VLVA 5ET7A 3MYUA 3QMFA 1B4ZA 4OETA 5F7VA 5H8HA 3TTKA 4P0IA 1YYZA 2QMXA 3KEIA 5I56B 3O29A 1ZTYA 3KN8A 3P7IA 1N7XA 4N17A 4PF6A 3BIHA 4NF4A 2XXIA 4GOTA 3VVFA 2R9JA 3NOHA 4H46A 1P1OA 3FJ7A 2XA5A 1OMPA 3IL1B 2QS4A 3TCGA 4DIGA 5JEIA 2I0CA 3CSGA 4NF6A 4R6YA 1NH7A 4LUBA 4H45A 4MBPA 1QUJA 2OJTA 3PUXE 1IEJA 3MVYA 3LSXA 4R73A 5L9OA 1Y1MA 4GBVA 4DCYA 4GWSA 5AA1A 3OD7A 1FPIA 2ZXTA 1US4A 4HS7A 2F3BA 4DCXA 1TXFA 1MH4A 3H6UA 3V5AA 2ESNA 3MPLA 3T1BA 4OZ9A 2X26A 4XFEA 3UN6A 1LCFA 3MVXA 3MSTA 5IZ3A 2VD3A 1NV4A 4GQOA 1FQFA 5EQ8A 1FBCA 3SZPA 3QIMA 4JXIA 4GWWA 3ZS6A 4G8NA 2HXRA 5M2VA 3KGCA 3TUSA 5IZZA 5I2NB 1RDXA 3GYYA 4FEBA 1LAXA 1XVYA 3U94A 4ELQA 1DMBA 1A8EA 1IXHA 4OXVA 3SEWA 4NF8B 4LN5A 5JK4A 1MXZA 1IMAA 1FQEA 4WEPA 5DYHA 1GR2A 1Y3NA 2PFZA 4AS4A 4NF5A 4F3BA 1MM7A 1AWBA 4F2OA 1OLAA 2DOJA 3C35A 1AOVA 4PFRA 4I9DA 4Z0IA 1FPJA 2I0BA 5I58A 4N6PA 1FSAA 4DE8A 4LVQA 5ET5A 2DWHA 5AA4B 1OVBA 3SDFA 5TPAA 3IB0A 4KXPA 1NV3A 4ZDMA 1MM6A 3PUYE 1LBZA 1B05A 3Q25A 5IGAA 4NQ8A 4R75A 4RK9A 5TU0A 1QKBA 2FHYA 1AL3A 2RC7A 1EZPA 2DE4A 3TFLA 1SW4A 3FVGA 4LP2B 3QAXA 3FASA 4FATA 4MLQA 2Z8EA 4ZS9A 1CNQA 1JEVA 4ZEIA 3QUFA 2QJEA 4H0WA 4PAFA 2XX7A 1FRPA 4O7IA 2WEFA 3E9XA 1FTKA 1WDNA 5DVFA 4IO3A 2RKMA 5H8NA 3GBBA 4JBZA 4F1VA 2QS3A 4PAIA 3ILTB 4R74A 1PDAA 2XXKA 2AL4A 1YAEA 2UVIA 1POY1 3PMVA 3TTLA 2F97A 1OIBA 2KLFA 3FUZA 1US5A 1RDYA 1BP5A 3TTNA 4KD5A 1FQBA 3WAEA 2XWOA 3LUYA 4DI3D 3Q29A 3CG3A 2V25A 3B6WA 1B40A 4IO2A 4U2RA 3E78A 5ESYA 1EU8A 3T9UA 3O97A 4OESA 3RT8A 2V3UA 4NGUA 1B7HA 2VD2A 4H67A 4MHFA 3OMBA 4O7MA 1PB8A 4LQ2A 5A5XB 3R6UA 4OANA 3C4MA 2OBGA 2B4MA 3EN3A 5KDTA 4O3CA 1CE2A 3G3JA 5CC2A 1YPNA 3D4CA 1Y4CA 2Y7RA 1IMBA 3B6TA 2B4LA 2I4BA 3RPLB 4KFQA 4FEDA 2H4IA 3I3VA 3CI8A 1O7TA 3IORA 4HCWA 3U92A 4JWOA 2ZNUA 4YB6A 1N04A 2Y7PA 3PUVE 3V89B 3KJTA 3PD8A 2O68A 2HAUA 1NNKA 4GL0A 4JVIA 3N6TA 3LSWA 2VPOA 5I7IA 4PDDA 2OCUA 3QYTA 4F31B 2GHAA 3A09A 2Q89A 5DVJA 3VXCA 2ZZWA 1IMDA 2VGQA 1AIVA 3IO4A 3PPPA 2G93A 3OENA 4MNCA 3CSBA 4HXVA 4Q8RA 4PQJA 4I3EA 4NF6B 4P8BA 4PTKA 2XXQA 3O9PA 4RJZA 4RPNA 4PE5B 3T96B 4LONB 4ECFA 1EYIA 2WBBA 1LFHA 4ELPA 4MJOA 1P1QA 4FAJA 1MXYA 1B52A 3IB2A 1PBQA 3RUMA 1D9QA 1LB9A 1INPA 3GLBA 2CMOA 4MEVA 1KZ8A 1LBVA 4Q30B 1D9YA 3S4UA 4OFOA 3T9HB 4TLLB 1B32A 4Z7EA 1DK4A 3KJ7A 4QSDA 2Y7KA 4N8YA 4U22A 5ICQA 2HPGA 5IZ3B 5JTYA 2ZYOA 3PPRA 1ZMGA 4TLMB 1Y3QA 1NV1A 4YAHX 1IQ7A 5I5PA 3B7DA 2OWZA 4QFKA 2O7IA 4P9KA 3RPWA 1GVCA 3PGFA 5AA2B 4G2ZA 3W9WA 5IM2A 4OYVA 3N6UA 4PBQA 1NI9A 1P1NA 3A29A 5CBRA 4HTGA 5KCJA 2NOOA 2CZHA 3ZKKA 1ATGA 2Y84A 2KR0A 4KYDA 4ZE9A 4JWYA 3LR1A 3AXFA 1H76A 3HSTA 3MVWA 1M5EA 3PPQA 1LBWA 3TELA 5L9MA 4H8JA 4C0RA 4F18A 3BIGA 1A54A 3HV1A 3VLUA 5H8QB 4QFLA 3TQLA 4OFJA 3W15C 1QW0A 1YXIA 5IZ1A 4P11A 2XXXA 4P47A 2P3VA 4PFUA 4MF3A 2FBPA 2IEEA 2F78A 3FVNA 3G3FA 2VOZA 2NVUB 1TFAA 1DOTA 3TPAA 2HEUA 2Q74A 1B3EA 4NEDA 3M3FA 4GF8A 1KA0A 1LBXA 3K4UA 2H5YA 2OWTA 3VVDA 3IOWA 3TYHA 1ZJLA 1Q9DA 4FBPA 4IR8A 1FQAA 4OVSA 1USYH 4THIA 1LLSA 1B3HA 3MBPA 1UIUA 3DM0A 4F1YA 2P0SA 2X7PA 4DDDA 2P3NA 3MP1A 1NUWA 1VE4A 5H8NB 5EQ7A 2UVHA 3LSLA 5FTHA 3FD3A 5HBCA 4XKQA 4ZZAA 4RPOA 3GBAA 5H8FA 1OVTA 3S9EA 1B51A 2DXYA 4GVOA 4PFWA 5ITOA 2AIXA 1B7UA 5FHOA 4MLVA 3MZ9A 3KSJA 4O94A 2XX9A 2OZZA 1VR5A 4WKMA 2QFLA 1NUXA 4U21A 4G4PA 4GXAA 2I48A 4X48A 3UK4A 1IUDA 4L17A 1JVYA 3DP6A 3CHGA 5HPQA 2WYKA 3H6TA 4OVRA 2OWSA 2H9BA 3DELB 4QSCA 1IZ1A 3KOTA 3QXMA 1FBHA 3PPOA 2XXYA 3UA8A 2ABHA 4H1XA 2RC8A 3CIJA 4Q0CA 1M5DA 5LOMA 4R9GA 1FPDA 2A5TA 3IJOB 4OQOA 3IOTA 1HSEA 3CRBA 2Y5KA 5B7DA 2O1MA 3LC8A 2B3BA 2XXHA 5EYHA 2RCBA 4GXSB 3TCHA 4EF1A 3FVKA 3O66A 1BLFA 4YU0A 4XIGQ 2RCAA 1PBPA 4BLAA 3R26A 1MDP1 4QRZA 1XOCA 4PF8A 1N3XA 3FXQA 1SYHA 5I84A 4PGPA 4P0GA 3A3UA 1I6AA 4F29A 2F8DA 4HW8A 5DEXB 3OEMA 5HM4B 1JQFA 4AQ4A 3I5OA 3HO7A 1EH3A 3LV0A 2PCRA 2F7BA 2XWVA 2GFEA 1IMCA 1SYIA 4R72A 1QGXA 3IOUA 2UYFA 1NH8A 2BJJX 5BUUA 2JJKA 2Q88A 5J16A 3B50A 3S9LC 3R7XA 4KYEA 3BKIB 3TTRA 1I69A 2FVZA 4KPTA 4I40A 3IO6A 1GV8A 3L6GA 2IA4A 3OOAA 4FE8A 4FECA 1B1XA 4PFTA 4O8MA 1P99A 4BDOA 3EHTA 3SKPA 4ZEKA 5ITPA 3RGYA 3H06B 4EXLA 1SW1A 3CFLA 1R9LA 4GWZA 1H45A 2PT2A 3IOVA 1T0KA 1B3GA 4M1VA 5FHMA 3L6HA 4PBHA 2I4CA 4FORA 3KBRA 4IO5A 4EQBA 2O7UA 4POWA 2V4CA 4YKPA 5CRYA 1FTJA 1LEVA 2F6GA 4KCDA 3B6QA 1IIWA 2QS2A 5KCJB 2O69A 2YLNA 2DDKA 4R9FA 3V83A 5ICTA 5ET8A 4LZ5A 1IMEA 2P1SA 1ZU0A 4N91A 4X04A 1M5BA 4N13A 1EYJA 4YB7A 4PDHA 1SW5A 2V93A 2WBDA 1B5IA 4E0XA 3Q28A 2Y7WA 4XTCQ 4F3PA 3TTMA 3TQWA 4QSEA 3UP9A 3O28A 3KZGA 4LZ8A 1NV2A 4NWCA 4FIMA 3K1MA 2Q2AA 3PMWA 5ET6A 1N0TA 2B3FA 1NNTA 2R71A 2VT5A 4TOZA 4LQ5A 4XXUA 3LBSA 2QVRA 3K1PA 4YKKA 4MH5A 3MAMA 4NN3A 2VP1A 3VV5A 4LZ7A 1LB8A 1NUYA 1FBFA 5LTCA 2E1SA 5L9SA 4NTLA 1NL5A 2FNCA 1LSTA 4LATA 2XXRA 3FJGA 2CZIA 4O3BA 4GX3A 4GFRA 3EHSA 2Q9TA 4EF2A 1FTLA 5FHNA 3K6WA 2F36A 1NV0A 4H65A 2PX1A 4UABA 4PCDA 1TT1A 1K9YA 3K0VA 4GX4A 4YZZA 4R2BA 1FPLA 4F39A 3ODBA 4P3LA 3DP8A 4NHBA 4ZECA 1JW5A 2ZYNA 5DW8A 3K2DA 5DVIA 1SI1A 3N94A 3TDJA 5I56A 1MG1A 4RA1A 4F1UA 3N26A 4P1EA 1N3WA 2RF1A 1XT8A 3W9VA 1P1WA 3GZGA 1RDZA 1MQDA 5H8HB 3H7MA 3SEUA 2ZYKA 4N81A 1SI0A 4JWXA 1PEBA 2XXVA 3QSLA 3KSXA 4NF4B 1IXIA 4OA4A 4DXBA 1O63A 1DCUA 4Q5TA 4ZEBA 4FJPA 1ELJA 5I57A 1B5JA 1A8FA 4ELOA 4TQUQ 3T9XB 2ONRA 1JNFA 1P1UA 4LA9A 4NAPA 1AMFA 4OERA 1G0HA 1ZKBA 2PMSA 2REJA 1IXCA 4HE1A 1FBPA 4RY1A 3OO7A 2XD3A 3A3CA 4MNPA 2ZMBA 2DVCA 3VXBA 2ZNTA 4U1ZA 1YCJA 1IITA 2KQZA 3M3LA 3V8XB 2M8CA 3OO6A 1B3LA 5CMMA 4NG7A 2XWKA 4PP0A 1ZLQA 1NMUA 1A99A 4JSOA 4MFIA 1JVXA 4KYSA 1MXXA 1S9TA 1EZ9A 1FTMA 1VSOA 4C1UA 3IFCA 2HZKA 5I2NA 2QVVA 5IAIA 1FJ9A 1B58A 4GWUA 1USYE 2ZYMA 1FW0A 1OQGA 1II5A 3RY3A 1N84A 1NFTA 3EF7A 1AH5A 4XKRA 4BDLA 2ALUA 5ELVA 4HE2A 2F7CA 3DP4A 4EXKA 3PMXA 3RLFE 3UIFA 4EDPA 3PPNA 3EHUA 5KZTA 2AL5A 4BDNA 1ZBMA 2YJPA 4IO6A 3PV0E 1UTHA 2PBWA 3BFUA 3VVEA 4N6KA 1MQJA 1JW4A 1FPBA 4PAKA 1SQYA 1BKAA 1DTZA 1B4HA 4NF5B 5J1DA 3QK6A 1D9VA 4RNSA 2V3TA 3HCQA 4U1OA 2DSFA 1R9QA 1QKAA 4G68A 4G8HA 4IB2A 4NE4A 3MQ9A 5I58B 3UGWA 2A5SA 3GXAA 1RKMA 3U8QA 1NV7A 3KG2A 2D21A 1NNPA 5FTIA 3PUWE 1QUKA 3MW0A 5TPAB 1KWHA 3G3IA 5I59A 1LBYA 3IK6B 3SEXA 1B9JA 1WODA 1N7WA 1MY3A 1Q1KA 1Y20A 1DPPA 5AA2D 1FJ6A 3O6HA 1LAHE 4M4GA 3I6VA 2DQVA 5FBPA 3JYRA 3HFUA 4G68C 4ZEFA 2DYXA 4X8RA 1URDA 3TCFA 2DXRA 2THIA 4GWOA 2WKYA 2NUVA 2UVGA 2ONSA 3RTFB 2ZZVA 4OVQA 1F9BA 3C33A 4JB7A 1B3FA 2HFBA 4YKJA 5T3JA 1HSLA 3M3KA 3TAJA 3C9HA 4G61A 3T93B 1DBZA 4O3AA 4U23A 2L5VA 5F24A 5LDZA 3SEVA 3CG1A 1YZ0A 1D4NA 3F11A 4DXCA 1FPGA 1TFDA 2I3WA 2DE3A 3IX1A 4OFLA 3OSRA 1MS7A 4F3GA 4UA8A 3G3GA 5EYGA 2RINA 4QFPA 1R6ZA 3FXRA 2DWIA 3HHGA 2CZLA 2HXWA 4F19A 3THIA 1FBDA 2ZZXA 1G0IA 3H3GA 2O6AA 4P56A 3RPLA 4KCCA 2BJIA 3KC1A 4GIZA 3USDA 2O1LA 3VFJA 2O84X 3ROJA 5KDTB 2FIEA 3MVZA 3CFXA 4IY5A 1XC1A 3PTYA 2PVUA 1FPFA 4N8GA 5K2XA 1QUIA 2VPNA 2XX8A 2CZKA 1TWYA 2V84A 4QXDA 1LGBC 3FBPA 1LFGA 5F1QA 2OLBA 5CI5A 4QFNA 2H25A 5EHMA 4IO4A 2UXAA 1SW2A 4I62A 1LCTA 4N6DA 3K6XA 1YTVA 2F34A 2DE2A 1B5HA 2I49A 3ONMA 5I57B 2I3VA 1OQHA 4I8CA 1IXGA 3OXNA 3OO9A 3MWBA 1NV6A 4H5GA 3OEKA 4QHQA 1QJMA 4JVDA 2ONKE 1XI6A 4PE3A 3T9VA 3G3KA 3TKDA 1FBEA 3SERA 5I2KA 1MXUA 4GBWA 2NWJA 1LFIA 3RYDA 4POXA 3MUQA 3RN8A 1I6BA 3FJMA 3G3HA 5TP9A 1K9ZA 2QSXA 3MC2A 3MP8A 1IMFA 3MP6A 4X1DA 1B0LA 3T0JA 4OWDA 1NUZA 2XXTA 4XKPA 3WAFA 5DTBA 3IB1A 4YMAA 5AA2A 1OLCA 1NV5A 5JTYB 5DT6A 3CFZA 3FV1A 1L5TA 3MZ1A 2UYEA 4DXUA 1H43A 5BWJA 3PUZE 4U4XA 4QFOA 4KHZE 3EQ1A 3RNNA 1MXWA 3H6VA 1WVJA 4UACA 4ZE8A 3RQTA 3T22A 3CR9A 3BFTA 4NF0A 1PB9A 2WYPA 2DP8A 3EKIA 2E0SA 4I3YA 3HN0A 5H8QA 3S9NC 1EYKA 2XXPA 4MAGA 2D5WA 3G7WA 1N76A 2B65A 1UTHB 2PYYA 4ESWA 1FQDA 2GRVA 1MPDA 1I6QA 3LSFB 3SETA 4GD5A 1B6HA 1PB7A 2UVJA 4DI4B 4R2FA 3C34A 4YICA 4G68B 3OELA 2PFYA 3RT6B 2GHBA 3ECRA 4PC9A 3FVOA 5CM6A 3FV2A 5L8DA 1VDWA 2Y7IA 1MH3A 1FBGA 4H5FA 5I59B 4GL8A 2F7AA 3K00A 1FTOA 1QULA 4OEUA 3PU5A 3U93A 4IY6A 3KN7A 2Z22A 3JV9A 1RYXA 4YKIA 1GGGA 5EHSA 3C36A 4EQ9A 3T66A 2LAOA 4F22A 2HHMA 5I3SA 1MPCA 4AB6A 2DVZA 1MRPA 3OSQA 2QL3A 3CVGA 3O6GA 1LAFE 1ANFA 1MDQA 2F35A 2QVUA 4GWXA 3HPIA 2P2AA 1SD3A 4OENA 4ISUA 3JZJA 3TEPA 3ZKLA 3IFAA 2XXWA 1KA1A 3HHFA 1A7LA 1URGA 3Q26A 5EQAA 5H8FB 1UTBA 3ZSFA 3VLWA 4PGNA 3VE1B 1B1HA 4N4UA 1FTAA 1URSA 2F5XA 4BDMA 2XD2A 1DPEA 3E4RA 4H8IA 1FCKA 3EPEA 4XKNA 2XXUA 1HSJA 2Z23A 5ISUA 4C1TA 4HE0A 3PD9A 1QVSA 2X7QA 3B8BA 2H98A 4ESXA 3SEYA 2Q2CA 4G77A 2WX9A 4KI0E 1A40A 2G29A 1JETA 3FXBA 5IKBA 3C31A 1B46A 1H3DA 2AYSA 2FA7A 2QMWA 1FPEA 4ND9A 4OTEA 3H4ZA 2A5TB 1MXVA 2GH9A 4PFBA 3O2AA 1JW1A 4XEQA 4NWDA 2R8TA 2HZLA 1PC3A 3MZBA 1MY4A 3K6VA 2REGA 4P1LA 4E0WA 4DZ1A 2FYIA 4GX6A 5DEXA 2DWAA 2DS9A 2PT1A 3S2VA 1VFEA 4EQ7A 1LBCA 3C32A 1MQGA 3KOSA 1B2HA 2Y5LA 4N15A 3FATA 2V3QA 4PETA 1GTKA 1SDXA 1Z7NE 4QBAA 2HCAA 1B7ZA 3N5LA 4XF5A 3IJXB 4ZEDA 4GLIA 3BBRA 3FIRA 3IAZA 2DWJA 2VHAA 4NMYA 1MQHA 4H6DA 4RXLA 2HAVA 3KFMA 1SPIA 4X9TA 1O64A 3E3KA
chains in the Genus database with same CATH topology
5I2KB 4NF8A 1NNFA 1Y3PA 5TP9B 3TMGA 2NXOA 3O6IA 1LAGE 3QUJA 4F3SA 5K2YA 4KQPA 4GRKA 3U1OA 4OHNA 1FQCA 1A55A 4YB5A 1MQIA 3H6WA 5AE4A 5AA3A 1MY1A 4ONYA 2ANJA 4OVJA 4U4SA 2Z8FA 3RTWB 4F2QA 1DSNA 4JDFA 2OK2A 4YMBA 4K3FA 4ZZEA 3K6UA 2YPNA 1SBPA 4OEVA 3K1NA 4N07A 5AA4A 1UIVA 1J1NA 3OO8A 4IGTA 1XHYA 2H99A 1LBBA 2O51A 3VDFA 3IR1A 3DLNA 3FXUA 5CMBA 3Q27A 3D4GA 1VFDA 1D3KA 4IGRA 4JSDA 1RYOA 4KR5A 2XHDA 1Y4TA 4QF9A 1BIYA 1EZOA 4EUOA 3MJNA 2W7YA 1M5FA 3TZAA 4WXJA 2RC9A 2QPQA 3TODA 2I6EA 4X1BA 4ELRA 1JEUA 4IO7A 3E13X 1DTGA 3FGSA 1Z7ME 1Y1ZA 2D3IA 2Z8DA 3H03A 4R6KA 5CMCA 5H8SA 4RYAA 4WEDA 2R6GE 4R6HA 3UORA 3KN3A 5CBSA 4DLDA 3K01A 4OMBA 2ZNSA 2F6PA 1ZIUA 3S9MC 3SESA 4AB5A 1NKXA 4HCYA 2HQ0A 3ILUB 5EYFA 1BTJA 5A5XA 2Q8JA 1MY0A 4G8MA 3M8UA 1UQWA 4BDQA 3U72A 4RK2A 1XVXA 1CB6A 2QS1A 1SVXB 1H44A 3MPKA 1S50A 5CMKA 3FZVA 1POTA 1Y9UA 1MPBA 1XS5A 1B0HA 1M5CA 2QRYA 2I58A 4I1DA 5B70A 4PFYA 1MY2A 1R1NA 1UTBB 3K02A 1S7YA 4BDRA 1Q35A 3VLVA 1B4ZA 4OETA 5F7VA 5H8HA 3TTKA 4P0IA 2QMXA 3KEIA 5I56B 3O29A 1ZTYA 3KN8A 3P7IA 1N7XA 4NF4A 2XXIA 4GOTA 3VVFA 2R9JA 1P1OA 3FJ7A 1OMPA 3IL1B 2QS4A 3TCGA 4DIGA 5JEIA 2I0CA 3CSGA 4NF6A 4R6YA 1NH7A 4LUBA 4MBPA 1QUJA 2OJTA 3PUXE 1IEJA 3MVYA 3LSXA 4R73A 5L9OA 1Y1MA 4DCYA 5AA1A 3OD7A 2ZXTA 1US4A 4HS7A 4DCXA 1TXFA 1MH4A 3H6UA 3V5AA 2ESNA 3MPLA 4OZ9A 2X26A 3UN6A 1LCFA 3MVXA 2VD3A 4GQOA 1FQFA 3QIMA 4JXIA 3ZS6A 4G8NA 5M2VA 3KGCA 3TUSA 5I2NB 4FEBA 1LAXA 1XVYA 3U94A 4ELQA 1DMBA 1A8EA 1IXHA 4OXVA 3SEWA 4NF8B 5JK4A 1MXZA 1FQEA 4WEPA 5DYHA 1GR2A 1Y3NA 4NF5A 4F3BA 1MM7A 4F2OA 1OLAA 2DOJA 3C35A 1AOVA 4I9DA 4Z0IA 2I0BA 5I58A 4N6PA 4DE8A 4LVQA 2DWHA 5AA4B 1OVBA 3SDFA 5TPAA 3IB0A 4ZDMA 1MM6A 3PUYE 3Q25A 1B05A 4R75A 5TU0A 4RK9A 1QKBA 2RC7A 1AL3A 1EZPA 2DE4A 3TFLA 1SW4A 3FVGA 4LP2B 3QAXA 3FASA 4FATA 4MLQA 2Z8EA 4ZS9A 1JEVA 4ZEIA 3QUFA 2QJEA 4H0WA 2XX7A 3E9XA 1FTKA 1WDNA 5DVFA 4IO3A 2RKMA 5H8NA 3GBBA 4JBZA 4F1VA 2QS3A 3ILTB 4R74A 1PDAA 2AL4A 1YAEA 2UVIA 1POY1 3PMVA 3TTLA 2F97A 1OIBA 2KLFA 3FUZA 1US5A 1BP5A 3TTNA 4KD5A 1FQBA 3WAEA 3LUYA 3Q29A 3CG3A 2V25A 3B6WA 1B40A 4IO2A 4U2RA 1EU8A 3T9UA 3O97A 4OESA 3RT8A 2V3UA 1B7HA 2VD2A 4H67A 3OMBA 1PB8A 4LQ2A 5A5XB 3R6UA 3C4MA 2OBGA 3EN3A 5KDTA 4O3CA 1CE2A 3G3JA 5CC2A 1YPNA 3D4CA 1Y4CA 2Y7RA 3B6TA 2I4BA 4KFQA 4FEDA 2H4IA 3I3VA 3CI8A 1O7TA 3IORA 4HCWA 3U92A 4JWOA 2ZNUA 4YB6A 1N04A 2Y7PA 3PUVE 3V89B 3KJTA 3PD8A 2O68A 2HAUA 1NNKA 4GL0A 3N6TA 3LSWA 2OCUA 3QYTA 4F31B 2GHAA 3A09A 2Q89A 5DVJA 3VXCA 2VGQA 1AIVA 3IO4A 3PPPA 2G93A 3OENA 3CSBA 4Q8RA 4PQJA 4NF6B 2XXQA 3O9PA 4RJZA 4RPNA 4PE5B 3T96B 4LONB 4ECFA 1LFHA 4ELPA 1P1QA 4FAJA 1MXYA 1B52A 3IB2A 1PBQA 3RUMA 1LB9A 3GLBA 2CMOA 4Q30B 1D9YA 3S4UA 4OFOA 3T9HB 4TLLB 1B32A 4Z7EA 3KJ7A 4QSDA 2Y7KA 4U22A 5ICQA 5JTYA 2ZYOA 3PPRA 1ZMGA 4TLMB 1Y3QA 4YAHX 1IQ7A 3B7DA 4QFKA 2O7IA 3RPWA 1GVCA 3PGFA 5AA2B 4G2ZA 3W9WA 4OYVA 3N6UA 1P1NA 5CBRA 4HTGA 5KCJA 2NOOA 3ZKKA 1ATGA 2Y84A 4KYDA 4ZE9A 4JWYA 3LR1A 3AXFA 1H76A 3HSTA 3MVWA 1M5EA 3PPQA 3TELA 5L9MA 4H8JA 4C0RA 4F18A 1A54A 3HV1A 3VLUA 5H8QB 4QFLA 3TQLA 4OFJA 3W15C 1QW0A 4P11A 2XXXA 4PFUA 4MF3A 2IEEA 2F78A 3FVNA 3G3FA 2VOZA 2NVUB 1TFAA 1DOTA 3TPAA 2HEUA 1B3EA 4NEDA 3M3FA 4GF8A 3K4UA 2H5YA 2OWTA 3VVDA 3IOWA 3TYHA 1ZJLA 1FQAA 1USYH 4THIA 1LLSA 1B3HA 3MBPA 1UIUA 3DM0A 4F1YA 2P0SA 2X7PA 4DDDA 3MP1A 1VE4A 5H8NB 2UVHA 3LSLA 5FTHA 3FD3A 5HBCA 4XKQA 4ZZAA 4RPOA 3GBAA 5H8FA 1OVTA 3S9EA 1B51A 2DXYA 4GVOA 4PFWA 5ITOA 2AIXA 1B7UA 5FHOA 4MLVA 3MZ9A 3KSJA 2XX9A 2OZZA 1VR5A 4WKMA 4U21A 4G4PA 4GXAA 2I48A 4X48A 3UK4A 1IUDA 4L17A 1JVYA 3DP6A 5HPQA 3H6TA 2OWSA 2H9BA 3DELB 4QSCA 1IZ1A 3KOTA 3QXMA 3PPOA 3UA8A 2XXYA 2ABHA 4H1XA 2RC8A 3CIJA 4Q0CA 1M5DA 5LOMA 4R9GA 2A5TA 3IJOB 4OQOA 3IOTA 1HSEA 3CRBA 5B7DA 2O1MA 3LC8A 2B3BA 2XXHA 2RCBA 4GXSB 3TCHA 4EF1A 3FVKA 3O66A 1BLFA 4YU0A 4XIGQ 2RCAA 1PBPA 4BLAA 3R26A 1MDP1 4QRZA 1XOCA 1N3XA 3FXQA 1SYHA 5I84A 4P0GA 3A3UA 1I6AA 4F29A 2F8DA 4HW8A 5DEXB 3OEMA 5HM4B 1JQFA 4AQ4A 3I5OA 3HO7A 1EH3A 2F7BA 2GFEA 1SYIA 4R72A 3IOUA 2UYFA 1NH8A 2BJJX 5BUUA 2Q88A 3S9LC 3R7XA 4KYEA 3BKIB 3TTRA 1I69A 4KPTA 3IO6A 1GV8A 3L6GA 2IA4A 3OOAA 4FE8A 4FECA 1B1XA 4PFTA 1P99A 4BDOA 3EHTA 3SKPA 4ZEKA 5ITPA 3RGYA 3H06B 4EXLA 1SW1A 3CFLA 1R9LA 1H45A 2PT2A 3IOVA 1T0KA 1B3GA 4M1VA 5FHMA 3L6HA 2I4CA 4FORA 3KBRA 4IO5A 4EQBA 2O7UA 4POWA 4YKPA 5CRYA 1FTJA 2F6GA 4KCDA 3B6QA 1IIWA 2QS2A 5KCJB 2O69A 2YLNA 3V83A 4R9FA 5ICTA 4LZ5A 2P1SA 1ZU0A 1M5BA 4N13A 4YB7A 1SW5A 2V93A 1B5IA 4E0XA 3Q28A 2Y7WA 4XTCQ 4F3PA 3TTMA 3TQWA 4QSEA 3UP9A 3O28A 3KZGA 4LZ8A 4NWCA 4FIMA 3K1MA 2Q2AA 3PMWA 1N0TA 2B3FA 1NNTA 2R71A 4TOZA 4LQ5A 4XXUA 3LBSA 3K1PA 4YKKA 4MH5A 3MAMA 2VP1A 3VV5A 4LZ7A 1LB8A 2E1SA 5L9SA 4NTLA 1NL5A 2FNCA 1LSTA 4LATA 2XXRA 3FJGA 4O3BA 4GFRA 3EHSA 2Q9TA 4EF2A 1FTLA 5FHNA 3K6WA 2F36A 4H65A 2PX1A 1TT1A 3K0VA 4YZZA 4R2BA 4F39A 3ODBA 3DP8A 4ZECA 1JW5A 2ZYNA 3K2DA 5DVIA 1SI1A 3N94A 3TDJA 5I56A 1MG1A 4RA1A 4F1UA 3N26A 1N3WA 2RF1A 1XT8A 3W9VA 1P1WA 3GZGA 5H8HB 1MQDA 3H7MA 3SEUA 2ZYKA 1SI0A 4JWXA 1PEBA 2XXVA 3QSLA 3KSXA 4NF4B 1IXIA 4DXBA 1O63A 4Q5TA 4ZEBA 4FJPA 1ELJA 5I57A 1B5JA 1A8FA 4ELOA 4TQUQ 3T9XB 2ONRA 1JNFA 1P1UA 4LA9A 1AMFA 4OERA 1ZKBA 2PMSA 2REJA 1IXCA 4RY1A 3OO7A 2XD3A 3A3CA 2ZMBA 2DVCA 3VXBA 2ZNTA 4U1ZA 1YCJA 1IITA 3M3LA 3V8XB 2M8CA 3OO6A 1B3LA 5CMMA 4PP0A 1ZLQA 1NMUA 1A99A 4JSOA 4MFIA 1JVXA 4KYSA 1MXXA 1S9TA 1EZ9A 1FTMA 1VSOA 4C1UA 2HZKA 5I2NA 5IAIA 1B58A 1USYE 2ZYMA 1FW0A 1OQGA 1II5A 3RY3A 1N84A 1NFTA 3EF7A 1AH5A 4XKRA 4BDLA 2ALUA 5ELVA 2F7CA 3DP4A 4EXKA 3PMXA 3RLFE 3UIFA 4EDPA 3PPNA 3EHUA 5KZTA 2AL5A 4BDNA 1ZBMA 2YJPA 4IO6A 3PV0E 1UTHA 2PBWA 3BFUA 3VVEA 1MQJA 1JW4A 1SQYA 1BKAA 1DTZA 1B4HA 4NF5B 5J1DA 3QK6A 1D9VA 4RNSA 2V3TA 3HCQA 4U1OA 2DSFA 1R9QA 1QKAA 4G68A 4G8HA 4IB2A 4NE4A 3MQ9A 5I58B 3UGWA 2A5SA 3GXAA 1RKMA 3U8QA 3KG2A 2D21A 1NNPA 5FTIA 3PUWE 1QUKA 3MW0A 5TPAB 1KWHA 3G3IA 5I59A 3IK6B 3SEXA 1B9JA 1WODA 1Y20A 1N7WA 1MY3A 1Q1KA 1DPPA 5AA2D 3O6HA 1LAHE 4M4GA 3I6VA 2DQVA 3JYRA 4G68C 4ZEFA 2DYXA 1URDA 3TCFA 2DXRA 2THIA 4GWOA 2WKYA 2NUVA 2UVGA 2ONSA 3RTFB 1F9BA 3C33A 4JB7A 1B3FA 2HFBA 4YKJA 1HSLA 3M3KA 3TAJA 3C9HA 3T93B 4O3AA 4U23A 3SEVA 3CG1A 1D4NA 3F11A 4DXCA 1TFDA 2I3WA 2DE3A 3IX1A 4OFLA 3OSRA 1MS7A 4F3GA 4UA8A 3G3GA 2RINA 4QFPA 1R6ZA 3FXRA 2DWIA 3HHGA 2CZLA 2HXWA 4F19A 3THIA 3H3GA 2O6AA 4KCCA 4GIZA 3USDA 2O1LA 3VFJA 2O84X 5KDTB 3MVZA 3CFXA 4IY5A 1XC1A 2PVUA 5K2XA 1QUIA 2XX8A 1TWYA 2V84A 1LGBC 1LFGA 5F1QA 2OLBA 5CI5A 4QFNA 2H25A 5EHMA 4IO4A 2UXAA 1SW2A 4I62A 1LCTA 3K6XA 1YTVA 2F34A 2DE2A 1B5HA 2I49A 3ONMA 5I57B 2I3VA 1OQHA 4I8CA 1IXGA 3OXNA 3OO9A 3MWBA 4H5GA 3OEKA 4QHQA 1QJMA 2ONKE 3T9VA 3G3KA 3TKDA 3SERA 5I2KA 1MXUA 2NWJA 1LFIA 4POXA 3MUQA 3RN8A 1I6BA 3FJMA 3G3HA 5TP9A 2QSXA 3MC2A 3MP8A 3MP6A 4X1DA 1B0LA 4OWDA 2XXTA 4XKPA 3WAFA 5DTBA 3IB1A 4YMAA 5AA2A 1OLCA 5JTYB 5DT6A 3CFZA 3FV1A 1L5TA 3MZ1A 2UYEA 4DXUA 1H43A 5BWJA 3PUZE 4U4XA 4QFOA 4KHZE 3EQ1A 3RNNA 1MXWA 3H6VA 1WVJA 4UACA 4ZE8A 3RQTA 3T22A 3CR9A 3BFTA 1PB9A 2DP8A 2E0SA 3HN0A 5H8QA 3S9NC 2XXPA 2D5WA 3G7WA 1N76A 2B65A 1UTHB 2PYYA 4ESWA 1FQDA 2GRVA 1MPDA 1I6QA 3LSFB 3SETA 4GD5A 1B6HA 1PB7A 2UVJA 4R2FA 3C34A 4YICA 4G68B 3OELA 3RT6B 2GHBA 3ECRA 3FVOA 5CM6A 3FV2A 5L8DA 2Y7IA 1MH3A 4H5FA 5I59B 4GL8A 2F7AA 3K00A 1FTOA 1QULA 4OEUA 3PU5A 3U93A 4IY6A 3KN7A 2Z22A 3JV9A 4YKIA 1RYXA 1GGGA 5EHSA 3C36A 4EQ9A 3T66A 2LAOA 4F22A 1MPCA 4AB6A 2DVZA 1MRPA 3OSQA 2QL3A 3CVGA 3O6GA 1LAFE 1ANFA 1MDQA 2F35A 3HPIA 2P2AA 1SD3A 4OENA 4ISUA 3JZJA 3TEPA 3ZKLA 2XXWA 3HHFA 1A7LA 1URGA 3Q26A 5H8FB 1UTBA 3ZSFA 3VLWA 3VE1B 1B1HA 2F5XA 1URSA 4BDMA 2XD2A 1DPEA 3E4RA 4H8IA 1FCKA 3EPEA 4XKNA 2XXUA 1HSJA 2Z23A 5ISUA 4C1TA 3PD9A 1QVSA 2X7QA 2H98A 4ESXA 3SEYA 2Q2CA 4G77A 4KI0E 1A40A 2G29A 1JETA 5IKBA 3C31A 1B46A 1H3DA 2AYSA 2FA7A 2QMWA 4ND9A 4OTEA 3H4ZA 2A5TB 1MXVA 2GH9A 3O2AA 1JW1A 4NWDA 2HZLA 1PC3A 3MZBA 1MY4A 3K6VA 2REGA 4E0WA 4DZ1A 2FYIA 5DEXA 2DWAA 2DS9A 2PT1A 3S2VA 1VFEA 4EQ7A 1LBCA 3C32A 1MQGA 3KOSA 1B2HA 3FATA 2V3QA 4PETA 1GTKA 1SDXA 1Z7NE 2HCAA 1B7ZA 3N5LA 3IJXB 4ZEDA 4GLIA 3BBRA 3FIRA 3IAZA 2DWJA 2VHAA 4NMYA 1MQHA 4H6DA 4RXLA 2HAVA 3KFMA 4X9TA 1O64A 3E3KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I2K B;  4NF8 A;  1NNF A;  1Y3P A;  5TP9 B;  3TMG A;  2NXO A;  3O6I A;  1LAG E;  3QUJ A;  4F3S A;  5K2Y A;  4KQP A;  4GRK A;  3U1O A;  4OHN A;  1FQC A;  1A55 A;  4YB5 A;  1MQI A;  3H6W A;  5AE4 A;  5AA3 A;  1MY1 A;  4ONY A;  2ANJ A;  4OVJ A;  4U4S A;  2Z8F A;  3RTW B;  4F2Q A;  1DSN A;  4JDF A;  2OK2 A;  4YMB A;  4K3F A;  4ZZE A;  3K6U A;  2YPN A;  1SBP A;  4OEV A;  3K1N A;  4N07 A;  5AA4 A;  1UIV A;  1J1N A;  3OO8 A;  4IGT A;  1XHY A;  2H99 A;  1LBB A;  2O51 A;  3VDF A;  3IR1 A;  3DLN A;  3FXU A;  5CMB A;  3Q27 A;  3D4G A;  1VFD A;  1D3K A;  4IGR A;  4JSD A;  1RYO A;  4KR5 A;  2XHD A;  1Y4T A;  4QF9 A;  1BIY A;  1EZO A;  4EUO A;  3MJN A;  2W7Y A;  1M5F A;  3TZA A;  4WXJ A;  2RC9 A;  2QPQ A;  3TOD A;  2I6E A;  4X1B A;  4ELR A;  1JEU A;  4IO7 A;  3E13 X;  1DTG A;  3FGS A;  1Z7M E;  1Y1Z A;  2D3I A;  2Z8D A;  3H03 A;  4R6K A;  5CMC A;  5H8S A;  4RYA A;  4WED A;  2R6G E;  4R6H A;  3UOR A;  3KN3 A;  5CBS A;  4DLD A;  3K01 A;  4OMB A;  2ZNS A;  2F6P A;  1ZIU A;  3S9M C;  3SES A;  4AB5 A;  1NKX A;  4HCY A;  2HQ0 A;  3ILU B;  5EYF A;  1BTJ A;  5A5X A;  2Q8J A;  1MY0 A;  4G8M A;  3M8U A;  1UQW A;  4BDQ A;  3U72 A;  4RK2 A;  1XVX A;  1CB6 A;  2QS1 A;  1SVX B;  1H44 A;  3MPK A;  1S50 A;  5CMK A;  3FZV A;  1POT A;  1Y9U A;  1MPB A;  1XS5 A;  1B0H A;  1M5C A;  2QRY A;  2I58 A;  4I1D A;  5B70 A;  4PFY A;  1MY2 A;  1R1N A;  1UTB B;  3K02 A;  1S7Y A;  4BDR A;  1Q35 A;  3VLV A;  1B4Z A;  4OET A;  5F7V A;  5H8H A;  3TTK A;  4P0I A;  2QMX A;  3KEI A;  5I56 B;  3O29 A;  1ZTY A;  3KN8 A;  3P7I A;  1N7X A;  4NF4 A;  2XXI A;  4GOT A;  3VVF A;  2R9J A;  1P1O A;  3FJ7 A;  1OMP A;  3IL1 B;  2QS4 A;  3TCG A;  4DIG A;  5JEI A;  2I0C A;  3CSG A;  4NF6 A;  4R6Y A;  1NH7 A;  4LUB A;  4MBP A;  1QUJ A;  2OJT A;  3PUX E;  1IEJ A;  3MVY A;  3LSX A;  4R73 A;  5L9O A;  1Y1M A;  4DCY A;  5AA1 A;  3OD7 A;  2ZXT A;  1US4 A;  4HS7 A;  4DCX A;  1TXF A;  1MH4 A;  3H6U A;  3V5A A;  2ESN A;  3MPL A;  4OZ9 A;  2X26 A;  3UN6 A;  1LCF A;  3MVX A;  2VD3 A;  4GQO A;  1FQF A;  3QIM A;  4JXI A;  3ZS6 A;  4G8N A;  5M2V A;  3KGC A;  3TUS A;  5I2N B;  4FEB A;  1LAX A;  1XVY A;  3U94 A;  4ELQ A;  1DMB A;  1A8E A;  1IXH A;  4OXV A;  3SEW A;  4NF8 B;  5JK4 A;  1MXZ A;  1FQE A;  4WEP A;  5DYH A;  1GR2 A;  1Y3N A;  4NF5 A;  4F3B A;  1MM7 A;  4F2O A;  1OLA A;  2DOJ A;  3C35 A;  1AOV A;  4I9D A;  4Z0I A;  2I0B A;  5I58 A;  4N6P A;  4DE8 A;  4LVQ A;  2DWH A;  5AA4 B;  1OVB A;  3SDF A;  5TPA A;  3IB0 A;  4ZDM A;  1MM6 A;  3PUY E;  3Q25 A;  1B05 A;  4R75 A;  5TU0 A;  4RK9 A;  1QKB A;  2RC7 A;  1AL3 A;  1EZP A;  2DE4 A;  3TFL A;  1SW4 A;  3FVG A;  4LP2 B;  3QAX A;  3FAS A;  4FAT A;  4MLQ A;  2Z8E A;  4ZS9 A;  1JEV A;  4ZEI A;  3QUF A;  2QJE A;  4H0W A;  2XX7 A;  3E9X A;  1FTK A;  1WDN A;  5DVF A;  4IO3 A;  2RKM A;  5H8N A;  3GBB A;  4JBZ A;  4F1V A;  2QS3 A;  3ILT B;  4R74 A;  1PDA A;  2AL4 A;  1YAE A;  2UVI A;  1POY 1;  3PMV A;  3TTL A;  2F97 A;  1OIB A;  2KLF A;  3FUZ A;  1US5 A;  1BP5 A;  3TTN A;  4KD5 A;  1FQB A;  3WAE A;  3LUY A;  3Q29 A;  3CG3 A;  2V25 A;  3B6W A;  1B40 A;  4IO2 A;  4U2R A;  1EU8 A;  3T9U A;  3O97 A;  4OES A;  3RT8 A;  2V3U A;  1B7H A;  2VD2 A;  4H67 A;  3OMB A;  1PB8 A;  4LQ2 A;  5A5X B;  3R6U A;  3C4M A;  2OBG A;  3EN3 A;  5KDT A;  4O3C A;  1CE2 A;  3G3J A;  5CC2 A;  1YPN A;  3D4C A;  1Y4C A;  2Y7R A;  3B6T A;  2I4B A;  4KFQ A;  4FED A;  2H4I A;  3I3V A;  3CI8 A;  1O7T A;  3IOR A;  4HCW A;  3U92 A;  4JWO A;  2ZNU A;  4YB6 A;  1N04 A;  2Y7P A;  3PUV E;  3V89 B;  3KJT A;  3PD8 A;  2O68 A;  2HAU A;  1NNK A;  4GL0 A;  3N6T A;  3LSW A;  2OCU A;  3QYT A;  4F31 B;  2GHA A;  3A09 A;  2Q89 A;  5DVJ A;  3VXC A;  2VGQ A;  1AIV A;  3IO4 A;  3PPP A;  2G93 A;  3OEN A;  3CSB A;  4Q8R A;  4PQJ A;  4NF6 B;  2XXQ A;  3O9P A;  4RJZ A;  4RPN A;  4PE5 B;  3T96 B;  4LON B;  4ECF A;  1LFH A;  4ELP A;  1P1Q A;  4FAJ A;  1MXY A;  1B52 A;  3IB2 A;  1PBQ A;  3RUM A;  1LB9 A;  3GLB A;  2CMO A;  4Q30 B;  1D9Y A;  3S4U A;  4OFO A;  3T9H B;  4TLL B;  1B32 A;  4Z7E A;  3KJ7 A;  4QSD A;  2Y7K A;  4U22 A;  5ICQ A;  5JTY A;  2ZYO A;  3PPR A;  1ZMG A;  4TLM B;  1Y3Q A;  4YAH X;  1IQ7 A;  3B7D A;  4QFK A;  2O7I A;  3RPW A;  1GVC A;  3PGF A;  5AA2 B;  4G2Z A;  3W9W A;  4OYV A;  3N6U A;  1P1N A;  5CBR A;  4HTG A;  5KCJ A;  2NOO A;  3ZKK A;  1ATG A;  2Y84 A;  4KYD A;  4ZE9 A;  4JWY A;  3LR1 A;  3AXF A;  1H76 A;  3HST A;  3MVW A;  1M5E A;  3PPQ A;  3TEL A;  5L9M A;  4H8J A;  4C0R A;  4F18 A;  1A54 A;  3HV1 A;  3VLU A;  5H8Q B;  4QFL A;  3TQL A;  4OFJ A;  3W15 C;  1QW0 A;  4P11 A;  2XXX A;  4PFU A;  4MF3 A;  2IEE A;  2F78 A;  3FVN A;  3G3F A;  2VOZ A;  2NVU B;  1TFA A;  1DOT A;  3TPA A;  2HEU A;  1B3E A;  4NED A;  3M3F A;  4GF8 A;  3K4U A;  2H5Y A;  2OWT A;  3VVD A;  3IOW A;  3TYH A;  1ZJL A;  1FQA A;  1USY H;  4THI A;  1LLS A;  1B3H A;  3MBP A;  1UIU A;  3DM0 A;  4F1Y A;  2P0S A;  2X7P A;  4DDD A;  3MP1 A;  1VE4 A;  5H8N B;  2UVH A;  3LSL A;  5FTH A;  3FD3 A;  5HBC A;  4XKQ A;  4ZZA A;  4RPO A;  3GBA A;  5H8F A;  1OVT A;  3S9E A;  1B51 A;  2DXY A;  4GVO A;  4PFW A;  5ITO A;  2AIX A;  1B7U A;  5FHO A;  4MLV A;  3MZ9 A;  3KSJ A;  2XX9 A;  2OZZ A;  1VR5 A;  4WKM A;  4U21 A;  4G4P A;  4GXA A;  2I48 A;  4X48 A;  3UK4 A;  1IUD A;  4L17 A;  1JVY A;  3DP6 A;  5HPQ A;  3H6T A;  2OWS A;  2H9B A;  3DEL B;  4QSC A;  1IZ1 A;  3KOT A;  3QXM A;  3PPO A;  3UA8 A;  2XXY A;  2ABH A;  4H1X A;  2RC8 A;  3CIJ A;  4Q0C A;  1M5D A;  5LOM A;  4R9G A;  2A5T A;  3IJO B;  4OQO A;  3IOT A;  1HSE A;  3CRB A;  5B7D A;  2O1M A;  3LC8 A;  2B3B A;  2XXH A;  2RCB A;  4GXS B;  3TCH A;  4EF1 A;  3FVK A;  3O66 A;  1BLF A;  4YU0 A;  4XIG Q;  2RCA A;  1PBP A;  4BLA A;  3R26 A;  1MDP 1;  4QRZ A;  1XOC A;  1N3X A;  3FXQ A;  1SYH A;  5I84 A;  4P0G A;  3A3U A;  1I6A A;  4F29 A;  2F8D A;  4HW8 A;  5DEX B;  3OEM A;  5HM4 B;  1JQF A;  4AQ4 A;  3I5O A;  3HO7 A;  1EH3 A;  2F7B A;  2GFE A;  1SYI A;  4R72 A;  3IOU A;  2UYF A;  1NH8 A;  2BJJ X;  5BUU A;  2Q88 A;  3S9L C;  3R7X A;  4KYE A;  3BKI B;  3TTR A;  1I69 A;  4KPT A;  3IO6 A;  1GV8 A;  3L6G A;  2IA4 A;  3OOA A;  4FE8 A;  4FEC A;  1B1X A;  4PFT A;  1P99 A;  4BDO A;  3EHT A;  3SKP A;  4ZEK A;  5ITP A;  3RGY A;  3H06 B;  4EXL A;  1SW1 A;  3CFL A;  1R9L A;  1H45 A;  2PT2 A;  3IOV A;  1T0K A;  1B3G A;  4M1V A;  5FHM A;  3L6H A;  2I4C A;  4FOR A;  3KBR A;  4IO5 A;  4EQB A;  2O7U A;  4POW A;  4YKP A;  5CRY A;  1FTJ A;  2F6G A;  4KCD A;  3B6Q A;  1IIW A;  2QS2 A;  5KCJ B;  2O69 A;  2YLN A;  3V83 A;  4R9F A;  5ICT A;  4LZ5 A;  2P1S A;  1ZU0 A;  1M5B A;  4N13 A;  4YB7 A;  1SW5 A;  2V93 A;  1B5I A;  4E0X A;  3Q28 A;  2Y7W A;  4XTC Q;  4F3P A;  3TTM A;  3TQW A;  4QSE A;  3UP9 A;  3O28 A;  3KZG A;  4LZ8 A;  4NWC A;  4FIM A;  3K1M A;  2Q2A A;  3PMW A;  1N0T A;  2B3F A;  1NNT A;  2R71 A;  4TOZ A;  4LQ5 A;  4XXU A;  3LBS A;  3K1P A;  4YKK A;  4MH5 A;  3MAM A;  2VP1 A;  3VV5 A;  4LZ7 A;  1LB8 A;  2E1S A;  5L9S A;  4NTL A;  1NL5 A;  2FNC A;  1LST A;  4LAT A;  2XXR A;  3FJG A;  4O3B A;  4GFR A;  3EHS A;  2Q9T A;  4EF2 A;  1FTL A;  5FHN A;  3K6W A;  2F36 A;  4H65 A;  2PX1 A;  1TT1 A;  3K0V A;  4YZZ A;  4R2B A;  4F39 A;  3ODB A;  3DP8 A;  4ZEC A;  1JW5 A;  2ZYN A;  3K2D A;  5DVI A;  1SI1 A;  3N94 A;  3TDJ A;  5I56 A;  1MG1 A;  4RA1 A;  4F1U A;  3N26 A;  1N3W A;  2RF1 A;  1XT8 A;  3W9V A;  1P1W A;  3GZG A;  5H8H B;  1MQD A;  3H7M A;  3SEU A;  2ZYK A;  1SI0 A;  4JWX A;  1PEB A;  2XXV A;  3QSL A;  3KSX A;  4NF4 B;  1IXI A;  4DXB A;  1O63 A;  4Q5T A;  4ZEB A;  4FJP A;  1ELJ A;  5I57 A;  1B5J A;  1A8F A;  4ELO A;  4TQU Q;  3T9X B;  2ONR A;  1JNF A;  1P1U A;  4LA9 A;  1AMF A;  4OER A;  1ZKB A;  2PMS A;  2REJ A;  1IXC A;  4RY1 A;  3OO7 A;  2XD3 A;  3A3C A;  2ZMB A;  2DVC A;  3VXB A;  2ZNT A;  4U1Z A;  1YCJ A;  1IIT A;  3M3L A;  3V8X B;  2M8C A;  3OO6 A;  1B3L A;  5CMM A;  4PP0 A;  1ZLQ A;  1NMU A;  1A99 A;  4JSO A;  4MFI A;  1JVX A;  4KYS A;  1MXX A;  1S9T A;  1EZ9 A;  1FTM A;  1VSO A;  4C1U A;  2HZK A;  5I2N A;  5IAI A;  1B58 A;  1USY E;  2ZYM A;  1FW0 A;  1OQG A;  1II5 A;  3RY3 A;  1N84 A;  1NFT A;  3EF7 A;  1AH5 A;  4XKR A;  4BDL A;  2ALU A;  5ELV A;  2F7C A;  3DP4 A;  4EXK A;  3PMX A;  3RLF E;  3UIF A;  4EDP A;  3PPN A;  3EHU A;  5KZT A;  2AL5 A;  4BDN A;  1ZBM A;  2YJP A;  4IO6 A;  3PV0 E;  1UTH A;  2PBW A;  3BFU A;  3VVE A;  1MQJ A;  1JW4 A;  1SQY A;  1BKA A;  1DTZ A;  1B4H A;  4NF5 B;  5J1D A;  3QK6 A;  1D9V A;  4RNS A;  2V3T A;  3HCQ A;  4U1O A;  2DSF A;  1R9Q A;  1QKA A;  4G68 A;  4G8H A;  4IB2 A;  4NE4 A;  3MQ9 A;  5I58 B;  3UGW A;  2A5S A;  3GXA A;  1RKM A;  3U8Q A;  3KG2 A;  2D21 A;  1NNP A;  5FTI A;  3PUW E;  1QUK A;  3MW0 A;  5TPA B;  1KWH A;  3G3I A;  5I59 A;  3IK6 B;  3SEX A;  1B9J A;  1WOD A;  1Y20 A;  1N7W A;  1MY3 A;  1Q1K A;  1DPP A;  5AA2 D;  3O6H A;  1LAH E;  4M4G A;  3I6V A;  2DQV A;  3JYR A;  4G68 C;  4ZEF A;  2DYX A;  1URD A;  3TCF A;  2DXR A;  2THI A;  4GWO A;  2WKY A;  2NUV A;  2UVG A;  2ONS A;  3RTF B;  1F9B A;  3C33 A;  4JB7 A;  1B3F A;  2HFB A;  4YKJ A;  1HSL A;  3M3K A;  3TAJ A;  3C9H A;  3T93 B;  4O3A A;  4U23 A;  3SEV A;  3CG1 A;  1D4N A;  3F11 A;  4DXC A;  1TFD A;  2I3W A;  2DE3 A;  3IX1 A;  4OFL A;  3OSR A;  1MS7 A;  4F3G A;  4UA8 A;  3G3G A;  2RIN A;  4QFP A;  1R6Z A;  3FXR A;  2DWI A;  3HHG A;  2CZL A;  2HXW A;  4F19 A;  3THI A;  3H3G A;  2O6A A;  4KCC A;  4GIZ A;  3USD A;  2O1L A;  3VFJ A;  2O84 X;  5KDT B;  3MVZ A;  3CFX A;  4IY5 A;  1XC1 A;  2PVU A;  5K2X A;  1QUI A;  2XX8 A;  1TWY A;  2V84 A;  1LGB C;  1LFG A;  5F1Q A;  2OLB A;  5CI5 A;  4QFN A;  2H25 A;  5EHM A;  4IO4 A;  2UXA A;  1SW2 A;  4I62 A;  1LCT A;  3K6X A;  1YTV A;  2F34 A;  2DE2 A;  1B5H A;  2I49 A;  3ONM A;  5I57 B;  2I3V A;  1OQH A;  4I8C A;  1IXG A;  3OXN A;  3OO9 A;  3MWB A;  4H5G A;  3OEK A;  4QHQ A;  1QJM A;  2ONK E;  3T9V A;  3G3K A;  3TKD A;  3SER A;  5I2K A;  1MXU A;  2NWJ A;  1LFI A;  4POX A;  3MUQ A;  3RN8 A;  1I6B A;  3FJM A;  3G3H A;  5TP9 A;  2QSX A;  3MC2 A;  3MP8 A;  3MP6 A;  4X1D A;  1B0L A;  4OWD A;  2XXT A;  4XKP A;  3WAF A;  5DTB A;  3IB1 A;  4YMA A;  5AA2 A;  1OLC A;  5JTY B;  5DT6 A;  3CFZ A;  3FV1 A;  1L5T A;  3MZ1 A;  2UYE A;  4DXU A;  1H43 A;  5BWJ A;  3PUZ E;  4U4X A;  4QFO A;  4KHZ E;  3EQ1 A;  3RNN A;  1MXW A;  3H6V A;  1WVJ A;  4UAC A;  4ZE8 A;  3RQT A;  3T22 A;  3CR9 A;  3BFT A;  1PB9 A;  2DP8 A;  2E0S A;  3HN0 A;  5H8Q A;  3S9N C;  2XXP A;  2D5W A;  3G7W A;  1N76 A;  2B65 A;  1UTH B;  2PYY A;  4ESW A;  1FQD A;  2GRV A;  1MPD A;  1I6Q A;  3LSF B;  3SET A;  4GD5 A;  1B6H A;  1PB7 A;  2UVJ A;  4R2F A;  3C34 A;  4YIC A;  4G68 B;  3OEL A;  3RT6 B;  2GHB A;  3ECR A;  3FVO A;  5CM6 A;  3FV2 A;  5L8D A;  2Y7I A;  1MH3 A;  4H5F A;  5I59 B;  4GL8 A;  2F7A A;  3K00 A;  1FTO A;  1QUL A;  4OEU A;  3PU5 A;  3U93 A;  4IY6 A;  3KN7 A;  2Z22 A;  3JV9 A;  4YKI A;  1RYX A;  1GGG A;  5EHS A;  3C36 A;  4EQ9 A;  3T66 A;  2LAO A;  4F22 A;  1MPC A;  4AB6 A;  2DVZ A;  1MRP A;  3OSQ A;  2QL3 A;  3CVG A;  3O6G A;  1LAF E;  1ANF A;  1MDQ A;  2F35 A;  3HPI A;  2P2A A;  1SD3 A;  4OEN A;  4ISU A;  3JZJ A;  3TEP A;  3ZKL A;  2XXW A;  3HHF A;  1A7L A;  1URG A;  3Q26 A;  5H8F B;  1UTB A;  3ZSF A;  3VLW A;  3VE1 B;  1B1H A;  2F5X A;  1URS A;  4BDM A;  2XD2 A;  1DPE A;  3E4R A;  4H8I A;  1FCK A;  3EPE A;  4XKN A;  2XXU A;  1HSJ A;  2Z23 A;  5ISU A;  4C1T A;  3PD9 A;  1QVS A;  2X7Q A;  2H98 A;  4ESX A;  3SEY A;  2Q2C A;  4G77 A;  4KI0 E;  1A40 A;  2G29 A;  1JET A;  5IKB A;  3C31 A;  1B46 A;  1H3D A;  2AYS A;  2FA7 A;  2QMW A;  4ND9 A;  4OTE A;  3H4Z A;  2A5T B;  1MXV A;  2GH9 A;  3O2A A;  1JW1 A;  4NWD A;  2HZL A;  1PC3 A;  3MZB A;  1MY4 A;  3K6V A;  2REG A;  4E0W A;  4DZ1 A;  2FYI A;  5DEX A;  2DWA A;  2DS9 A;  2PT1 A;  3S2V A;  1VFE A;  4EQ7 A;  1LBC A;  3C32 A;  1MQG A;  3KOS A;  1B2H A;  3FAT A;  2V3Q A;  4PET A;  1GTK A;  1SDX A;  1Z7N E;  2HCA A;  1B7Z A;  3N5L A;  3IJX B;  4ZED A;  4GLI A;  3BBR A;  3FIR A;  3IAZ A;  2DWJ A;  2VHA A;  4NMY A;  1MQH A;  4H6D A;  4RXL A;  2HAV A;  3KFM A;  4X9T A;  1O64 A;  3E3K A; 
#chains in the Genus database with same CATH topology
 5I2K B;  4NF8 A;  4MNI A;  1NNF A;  2OX3 A;  1Y3P A;  5TP9 B;  3TMG A;  2NXO A;  3O6I A;  1LAG E;  3QUJ A;  3KBZ A;  4F3S A;  5K2Y A;  4MMP A;  2FIX A;  4KQP A;  4GRK A;  3U1O A;  4OHN A;  1FQC A;  2GQ1 A;  1A55 A;  4YB5 A;  1MQI A;  3H6W A;  5AE4 A;  5AA3 A;  1MY1 A;  4ONY A;  2ANJ A;  4OVJ A;  4U4S A;  2Z8F A;  3RTW B;  4F2Q A;  1DSN A;  4JDF A;  2OK2 A;  4YMB A;  4K3F A;  4ZZE A;  3K6U A;  2YPN A;  1SBP A;  4OEV A;  3K1N A;  4N07 A;  5A5L A;  5AA4 A;  4GWY A;  1UIV A;  1J1N A;  3OO8 A;  4IGT A;  4JVC A;  1XHY A;  2H99 A;  1LBB A;  2O51 A;  3VDF A;  4MX6 A;  3IR1 A;  3DLN A;  3FXU A;  5CMB A;  3Q27 A;  4OVP A;  3D4G A;  1VFD A;  5EQ9 A;  1D3K A;  4IGR A;  4JSD A;  1RYO A;  4MIJ A;  4KR5 A;  2XHD A;  1Y4T A;  4QF9 A;  1BIY A;  4PFI A;  1EZO A;  4EUO A;  3MJN A;  2W7Y A;  1M5F A;  3TZA A;  4WXJ A;  4OVT A;  2RC9 A;  2QPQ A;  3TOD A;  2I6E A;  4X1B A;  4ELR A;  1JEU A;  4IO7 A;  3E13 X;  1DTG A;  4NX1 A;  3FGS A;  1Z7M E;  1Y1Z A;  2D3I A;  2Z8D A;  3H03 A;  4R6K A;  5CMC A;  5H8S A;  4RYA A;  4WED A;  2R6G E;  2Q8M A;  4R6H A;  3UOR A;  3KN3 A;  5CBS A;  4DLD A;  2CEX A;  3K01 A;  3U65 A;  4OMB A;  2ZNS A;  2F6P A;  1ZIU A;  3S9M C;  3SES A;  1JP4 A;  4AB5 A;  1NKX A;  3E79 A;  4HCY A;  2HQ0 A;  4AS5 A;  2XWI A;  2F3D A;  3ILU B;  5EYF A;  1BTJ A;  5A5X A;  3LUZ A;  2Q8J A;  2CEY A;  1MY0 A;  3ISP A;  1BK4 A;  4G8M A;  3M8U A;  1UQW A;  4BDQ A;  3U72 A;  4RK2 A;  4MCO A;  1XVX A;  1CB6 A;  2QS1 A;  3KC0 A;  1SVX B;  1H44 A;  3MPK A;  1S50 A;  5CMK A;  3FZV A;  1POT A;  1Y9U A;  1MPB A;  1XS5 A;  2MKZ A;  1B0H A;  1M5C A;  2QRY A;  2I58 A;  4I1D A;  5B70 A;  1FPK A;  4PFY A;  1MY2 A;  3D1R A;  1R1N A;  1UTB B;  3K02 A;  1S7Y A;  4BDR A;  1Q35 A;  3VLV A;  5ET7 A;  3MYU A;  3QMF A;  1B4Z A;  4OET A;  5F7V A;  5H8H A;  3TTK A;  4P0I A;  1YYZ A;  2QMX A;  3KEI A;  5I56 B;  3O29 A;  1ZTY A;  3KN8 A;  3P7I A;  1N7X A;  4N17 A;  4PF6 A;  3BIH A;  4NF4 A;  2XXI A;  4GOT A;  3VVF A;  2R9J A;  3NOH A;  4H46 A;  1P1O A;  3FJ7 A;  2XA5 A;  1OMP A;  3IL1 B;  2QS4 A;  3TCG A;  4DIG A;  5JEI A;  2I0C A;  3CSG A;  4NF6 A;  4R6Y A;  1NH7 A;  4LUB A;  4H45 A;  4MBP A;  1QUJ A;  2OJT A;  3PUX E;  1IEJ A;  3MVY A;  3LSX A;  4R73 A;  5L9O A;  1Y1M A;  4GBV A;  4DCY A;  4GWS A;  5AA1 A;  3OD7 A;  1FPI A;  2ZXT A;  1US4 A;  4HS7 A;  2F3B A;  4DCX A;  1TXF A;  1MH4 A;  3H6U A;  3V5A A;  2ESN A;  3MPL A;  3T1B A;  4OZ9 A;  2X26 A;  4XFE A;  3UN6 A;  1LCF A;  3MVX A;  3MST A;  5IZ3 A;  2VD3 A;  1NV4 A;  4GQO A;  1FQF A;  5EQ8 A;  1FBC A;  3SZP A;  3QIM A;  4JXI A;  4GWW A;  3ZS6 A;  4G8N A;  2HXR A;  5M2V A;  3KGC A;  3TUS A;  5IZZ A;  5I2N B;  1RDX A;  3GYY A;  4FEB A;  1LAX A;  1XVY A;  3U94 A;  4ELQ A;  1DMB A;  1A8E A;  1IXH A;  4OXV A;  3SEW A;  4NF8 B;  4LN5 A;  5JK4 A;  1MXZ A;  1IMA A;  1FQE A;  4WEP A;  5DYH A;  1GR2 A;  1Y3N A;  2PFZ A;  4AS4 A;  4NF5 A;  4F3B A;  1MM7 A;  1AWB A;  4F2O A;  1OLA A;  2DOJ A;  3C35 A;  1AOV A;  4PFR A;  4I9D A;  4Z0I A;  1FPJ A;  2I0B A;  5I58 A;  4N6P A;  1FSA A;  4DE8 A;  4LVQ A;  5ET5 A;  2DWH A;  5AA4 B;  1OVB A;  3SDF A;  5TPA A;  3IB0 A;  4KXP A;  1NV3 A;  4ZDM A;  1MM6 A;  3PUY E;  1LBZ A;  1B05 A;  3Q25 A;  5IGA A;  4NQ8 A;  4R75 A;  4RK9 A;  5TU0 A;  1QKB A;  2FHY A;  1AL3 A;  2RC7 A;  1EZP A;  2DE4 A;  3TFL A;  1SW4 A;  3FVG A;  4LP2 B;  3QAX A;  3FAS A;  4FAT A;  4MLQ A;  2Z8E A;  4ZS9 A;  1CNQ A;  1JEV A;  4ZEI A;  3QUF A;  2QJE A;  4H0W A;  4PAF A;  2XX7 A;  1FRP A;  4O7I A;  2WEF A;  3E9X A;  1FTK A;  1WDN A;  5DVF A;  4IO3 A;  2RKM A;  5H8N A;  3GBB A;  4JBZ A;  4F1V A;  2QS3 A;  4PAI A;  3ILT B;  4R74 A;  1PDA A;  2XXK A;  2AL4 A;  1YAE A;  2UVI A;  1POY 1;  3PMV A;  3TTL A;  2F97 A;  1OIB A;  2KLF A;  3FUZ A;  1US5 A;  1RDY A;  1BP5 A;  3TTN A;  4KD5 A;  1FQB A;  3WAE A;  2XWO A;  3LUY A;  4DI3 D;  3Q29 A;  3CG3 A;  2V25 A;  3B6W A;  1B40 A;  4IO2 A;  4U2R A;  3E78 A;  5ESY A;  1EU8 A;  3T9U A;  3O97 A;  4OES A;  3RT8 A;  2V3U A;  4NGU A;  1B7H A;  2VD2 A;  4H67 A;  4MHF A;  3OMB A;  4O7M A;  1PB8 A;  4LQ2 A;  5A5X B;  3R6U A;  4OAN A;  3C4M A;  2OBG A;  2B4M A;  3EN3 A;  5KDT A;  4O3C A;  1CE2 A;  3G3J A;  5CC2 A;  1YPN A;  3D4C A;  1Y4C A;  2Y7R A;  1IMB A;  3B6T A;  2B4L A;  2I4B A;  3RPL B;  4KFQ A;  4FED A;  2H4I A;  3I3V A;  3CI8 A;  1O7T A;  3IOR A;  4HCW A;  3U92 A;  4JWO A;  2ZNU A;  4YB6 A;  1N04 A;  2Y7P A;  3PUV E;  3V89 B;  3KJT A;  3PD8 A;  2O68 A;  2HAU A;  1NNK A;  4GL0 A;  4JVI A;  3N6T A;  3LSW A;  2VPO A;  5I7I A;  4PDD A;  2OCU A;  3QYT A;  4F31 B;  2GHA A;  3A09 A;  2Q89 A;  5DVJ A;  3VXC A;  2ZZW A;  1IMD A;  2VGQ A;  1AIV A;  3IO4 A;  3PPP A;  2G93 A;  3OEN A;  4MNC A;  3CSB A;  4HXV A;  4Q8R A;  4PQJ A;  4I3E A;  4NF6 B;  4P8B A;  4PTK A;  2XXQ A;  3O9P A;  4RJZ A;  4RPN A;  4PE5 B;  3T96 B;  4LON B;  4ECF A;  1EYI A;  2WBB A;  1LFH A;  4ELP A;  4MJO A;  1P1Q A;  4FAJ A;  1MXY A;  1B52 A;  3IB2 A;  1PBQ A;  3RUM A;  1D9Q A;  1LB9 A;  1INP A;  3GLB A;  2CMO A;  4MEV A;  1KZ8 A;  1LBV A;  4Q30 B;  1D9Y A;  3S4U A;  4OFO A;  3T9H B;  4TLL B;  1B32 A;  4Z7E A;  1DK4 A;  3KJ7 A;  4QSD A;  2Y7K A;  4N8Y A;  4U22 A;  5ICQ A;  2HPG A;  5IZ3 B;  5JTY A;  2ZYO A;  3PPR A;  1ZMG A;  4TLM B;  1Y3Q A;  1NV1 A;  4YAH X;  1IQ7 A;  5I5P A;  3B7D A;  2OWZ A;  4QFK A;  2O7I A;  4P9K A;  3RPW A;  1GVC A;  3PGF A;  5AA2 B;  4G2Z A;  3W9W A;  5IM2 A;  4OYV A;  3N6U A;  4PBQ A;  1NI9 A;  1P1N A;  3A29 A;  5CBR A;  4HTG A;  5KCJ A;  2NOO A;  2CZH A;  3ZKK A;  1ATG A;  2Y84 A;  2KR0 A;  4KYD A;  4ZE9 A;  4JWY A;  3LR1 A;  3AXF A;  1H76 A;  3HST A;  3MVW A;  1M5E A;  3PPQ A;  1LBW A;  3TEL A;  5L9M A;  4H8J A;  4C0R A;  4F18 A;  3BIG A;  1A54 A;  3HV1 A;  3VLU A;  5H8Q B;  4QFL A;  3TQL A;  4OFJ A;  3W15 C;  1QW0 A;  1YXI A;  5IZ1 A;  4P11 A;  2XXX A;  4P47 A;  2P3V A;  4PFU A;  4MF3 A;  2FBP A;  2IEE A;  2F78 A;  3FVN A;  3G3F A;  2VOZ A;  2NVU B;  1TFA A;  1DOT A;  3TPA A;  2HEU A;  2Q74 A;  1B3E A;  4NED A;  3M3F A;  4GF8 A;  1KA0 A;  1LBX A;  3K4U A;  2H5Y A;  2OWT A;  3VVD A;  3IOW A;  3TYH A;  1ZJL A;  1Q9D A;  4FBP A;  4IR8 A;  1FQA A;  4OVS A;  1USY H;  4THI A;  1LLS A;  1B3H A;  3MBP A;  1UIU A;  3DM0 A;  4F1Y A;  2P0S A;  2X7P A;  4DDD A;  2P3N A;  3MP1 A;  1NUW A;  1VE4 A;  5H8N B;  5EQ7 A;  2UVH A;  3LSL A;  5FTH A;  3FD3 A;  5HBC A;  4XKQ A;  4ZZA A;  4RPO A;  3GBA A;  5H8F A;  1OVT A;  3S9E A;  1B51 A;  2DXY A;  4GVO A;  4PFW A;  5ITO A;  2AIX A;  1B7U A;  5FHO A;  4MLV A;  3MZ9 A;  3KSJ A;  4O94 A;  2XX9 A;  2OZZ A;  1VR5 A;  4WKM A;  2QFL A;  1NUX A;  4U21 A;  4G4P A;  4GXA A;  2I48 A;  4X48 A;  3UK4 A;  1IUD A;  4L17 A;  1JVY A;  3DP6 A;  3CHG A;  5HPQ A;  2WYK A;  3H6T A;  4OVR A;  2OWS A;  2H9B A;  3DEL B;  4QSC A;  1IZ1 A;  3KOT A;  3QXM A;  1FBH A;  3PPO A;  2XXY A;  3UA8 A;  2ABH A;  4H1X A;  2RC8 A;  3CIJ A;  4Q0C A;  1M5D A;  5LOM A;  4R9G A;  1FPD A;  2A5T A;  3IJO B;  4OQO A;  3IOT A;  1HSE A;  3CRB A;  2Y5K A;  5B7D A;  2O1M A;  3LC8 A;  2B3B A;  2XXH A;  5EYH A;  2RCB A;  4GXS B;  3TCH A;  4EF1 A;  3FVK A;  3O66 A;  1BLF A;  4YU0 A;  4XIG Q;  2RCA A;  1PBP A;  4BLA A;  3R26 A;  1MDP 1;  4QRZ A;  1XOC A;  4PF8 A;  1N3X A;  3FXQ A;  1SYH A;  5I84 A;  4PGP A;  4P0G A;  3A3U A;  1I6A A;  4F29 A;  2F8D A;  4HW8 A;  5DEX B;  3OEM A;  5HM4 B;  1JQF A;  4AQ4 A;  3I5O A;  3HO7 A;  1EH3 A;  3LV0 A;  2PCR A;  2F7B A;  2XWV A;  2GFE A;  1IMC A;  1SYI A;  4R72 A;  1QGX A;  3IOU A;  2UYF A;  1NH8 A;  2BJJ X;  5BUU A;  2JJK A;  2Q88 A;  5J16 A;  3B50 A;  3S9L C;  3R7X A;  4KYE A;  3BKI B;  3TTR A;  1I69 A;  2FVZ A;  4KPT A;  4I40 A;  3IO6 A;  1GV8 A;  3L6G A;  2IA4 A;  3OOA A;  4FE8 A;  4FEC A;  1B1X A;  4PFT A;  4O8M A;  1P99 A;  4BDO A;  3EHT A;  3SKP A;  4ZEK A;  5ITP A;  3RGY A;  3H06 B;  4EXL A;  1SW1 A;  3CFL A;  1R9L A;  4GWZ A;  1H45 A;  2PT2 A;  3IOV A;  1T0K A;  1B3G A;  4M1V A;  5FHM A;  3L6H A;  4PBH A;  2I4C A;  4FOR A;  3KBR A;  4IO5 A;  4EQB A;  2O7U A;  4POW A;  2V4C A;  4YKP A;  5CRY A;  1FTJ A;  1LEV A;  2F6G A;  4KCD A;  3B6Q A;  1IIW A;  2QS2 A;  5KCJ B;  2O69 A;  2YLN A;  2DDK A;  4R9F A;  3V83 A;  5ICT A;  5ET8 A;  4LZ5 A;  1IME A;  2P1S A;  1ZU0 A;  4N91 A;  4X04 A;  1M5B A;  4N13 A;  1EYJ A;  4YB7 A;  4PDH A;  1SW5 A;  2V93 A;  2WBD A;  1B5I A;  4E0X A;  3Q28 A;  2Y7W A;  4XTC Q;  4F3P A;  3TTM A;  3TQW A;  4QSE A;  3UP9 A;  3O28 A;  3KZG A;  4LZ8 A;  1NV2 A;  4NWC A;  4FIM A;  3K1M A;  2Q2A A;  3PMW A;  5ET6 A;  1N0T A;  2B3F A;  1NNT A;  2R71 A;  2VT5 A;  4TOZ A;  4LQ5 A;  4XXU A;  3LBS A;  2QVR A;  3K1P A;  4YKK A;  4MH5 A;  3MAM A;  4NN3 A;  2VP1 A;  3VV5 A;  4LZ7 A;  1LB8 A;  1NUY A;  1FBF A;  5LTC A;  2E1S A;  5L9S A;  4NTL A;  1NL5 A;  2FNC A;  1LST A;  4LAT A;  2XXR A;  3FJG A;  2CZI A;  4O3B A;  4GX3 A;  4GFR A;  3EHS A;  2Q9T A;  4EF2 A;  1FTL A;  5FHN A;  3K6W A;  2F36 A;  1NV0 A;  4H65 A;  2PX1 A;  4UAB A;  4PCD A;  1TT1 A;  1K9Y A;  3K0V A;  4GX4 A;  4YZZ A;  4R2B A;  1FPL A;  4F39 A;  3ODB A;  4P3L A;  3DP8 A;  4NHB A;  4ZEC A;  1JW5 A;  2ZYN A;  5DW8 A;  3K2D A;  5DVI A;  1SI1 A;  3N94 A;  3TDJ A;  5I56 A;  1MG1 A;  4RA1 A;  4F1U A;  3N26 A;  4P1E A;  1N3W A;  2RF1 A;  1XT8 A;  3W9V A;  1P1W A;  3GZG A;  1RDZ A;  1MQD A;  5H8H B;  3H7M A;  3SEU A;  2ZYK A;  4N81 A;  1SI0 A;  4JWX A;  1PEB A;  2XXV A;  3QSL A;  3KSX A;  4NF4 B;  1IXI A;  4OA4 A;  4DXB A;  1O63 A;  1DCU A;  4Q5T A;  4ZEB A;  4FJP A;  1ELJ A;  5I57 A;  1B5J A;  1A8F A;  4ELO A;  4TQU Q;  3T9X B;  2ONR A;  1JNF A;  1P1U A;  4LA9 A;  4NAP A;  1AMF A;  4OER A;  1G0H A;  1ZKB A;  2PMS A;  2REJ A;  1IXC A;  4HE1 A;  1FBP A;  4RY1 A;  3OO7 A;  2XD3 A;  3A3C A;  4MNP A;  2ZMB A;  2DVC A;  3VXB A;  2ZNT A;  4U1Z A;  1YCJ A;  1IIT A;  2KQZ A;  3M3L A;  3V8X B;  2M8C A;  3OO6 A;  1B3L A;  5CMM A;  4NG7 A;  2XWK A;  4PP0 A;  1ZLQ A;  1NMU A;  1A99 A;  4JSO A;  4MFI A;  1JVX A;  4KYS A;  1MXX A;  1S9T A;  1EZ9 A;  1FTM A;  1VSO A;  4C1U A;  3IFC A;  2HZK A;  5I2N A;  2QVV A;  5IAI A;  1FJ9 A;  1B58 A;  4GWU A;  1USY E;  2ZYM A;  1FW0 A;  1OQG A;  1II5 A;  3RY3 A;  1N84 A;  1NFT A;  3EF7 A;  1AH5 A;  4XKR A;  4BDL A;  2ALU A;  5ELV A;  4HE2 A;  2F7C A;  3DP4 A;  4EXK A;  3PMX A;  3RLF E;  3UIF A;  4EDP A;  3PPN A;  3EHU A;  5KZT A;  2AL5 A;  4BDN A;  1ZBM A;  2YJP A;  4IO6 A;  3PV0 E;  1UTH A;  2PBW A;  3BFU A;  3VVE A;  4N6K A;  1MQJ A;  1JW4 A;  1FPB A;  4PAK A;  1SQY A;  1BKA A;  1DTZ A;  1B4H A;  4NF5 B;  5J1D A;  3QK6 A;  1D9V A;  4RNS A;  2V3T A;  3HCQ A;  4U1O A;  2DSF A;  1R9Q A;  1QKA A;  4G68 A;  4G8H A;  4IB2 A;  4NE4 A;  3MQ9 A;  5I58 B;  3UGW A;  2A5S A;  3GXA A;  1RKM A;  3U8Q A;  1NV7 A;  3KG2 A;  2D21 A;  1NNP A;  5FTI A;  3PUW E;  1QUK A;  3MW0 A;  5TPA B;  1KWH A;  3G3I A;  5I59 A;  1LBY A;  3IK6 B;  3SEX A;  1B9J A;  1WOD A;  1N7W A;  1MY3 A;  1Q1K A;  1Y20 A;  1DPP A;  5AA2 D;  1FJ6 A;  3O6H A;  1LAH E;  4M4G A;  3I6V A;  2DQV A;  5FBP A;  3JYR A;  3HFU A;  4G68 C;  4ZEF A;  2DYX A;  4X8R A;  1URD A;  3TCF A;  2DXR A;  2THI A;  4GWO A;  2WKY A;  2NUV A;  2UVG A;  2ONS A;  3RTF B;  2ZZV A;  4OVQ A;  1F9B A;  3C33 A;  4JB7 A;  1B3F A;  2HFB A;  4YKJ A;  5T3J A;  1HSL A;  3M3K A;  3TAJ A;  3C9H A;  4G61 A;  3T93 B;  1DBZ A;  4O3A A;  4U23 A;  2L5V A;  5F24 A;  5LDZ A;  3SEV A;  3CG1 A;  1YZ0 A;  1D4N A;  3F11 A;  4DXC A;  1FPG A;  1TFD A;  2I3W A;  2DE3 A;  3IX1 A;  4OFL A;  3OSR A;  1MS7 A;  4F3G A;  4UA8 A;  3G3G A;  5EYG A;  2RIN A;  4QFP A;  1R6Z A;  3FXR A;  2DWI A;  3HHG A;  2CZL A;  2HXW A;  4F19 A;  3THI A;  1FBD A;  2ZZX A;  1G0I A;  3H3G A;  2O6A A;  4P56 A;  3RPL A;  4KCC A;  2BJI A;  3KC1 A;  4GIZ A;  3USD A;  2O1L A;  3VFJ A;  2O84 X;  3ROJ A;  5KDT B;  2FIE A;  3MVZ A;  3CFX A;  4IY5 A;  1XC1 A;  3PTY A;  2PVU A;  1FPF A;  4N8G A;  5K2X A;  1QUI A;  2VPN A;  2XX8 A;  2CZK A;  1TWY A;  2V84 A;  4QXD A;  1LGB C;  3FBP A;  1LFG A;  5F1Q A;  2OLB A;  5CI5 A;  4QFN A;  2H25 A;  5EHM A;  4IO4 A;  2UXA A;  1SW2 A;  4I62 A;  1LCT A;  4N6D A;  3K6X A;  1YTV A;  2F34 A;  2DE2 A;  1B5H A;  2I49 A;  3ONM A;  5I57 B;  2I3V A;  1OQH A;  4I8C A;  1IXG A;  3OXN A;  3OO9 A;  3MWB A;  1NV6 A;  4H5G A;  3OEK A;  4QHQ A;  1QJM A;  4JVD A;  2ONK E;  1XI6 A;  4PE3 A;  3T9V A;  3G3K A;  3TKD A;  1FBE A;  3SER A;  5I2K A;  1MXU A;  4GBW A;  2NWJ A;  1LFI A;  3RYD A;  4POX A;  3MUQ A;  3RN8 A;  1I6B A;  3FJM A;  3G3H A;  5TP9 A;  1K9Z A;  2QSX A;  3MC2 A;  3MP8 A;  1IMF A;  3MP6 A;  4X1D A;  1B0L A;  3T0J A;  4OWD A;  1NUZ A;  2XXT A;  4XKP A;  3WAF A;  5DTB A;  3IB1 A;  4YMA A;  5AA2 A;  1OLC A;  1NV5 A;  5JTY B;  5DT6 A;  3CFZ A;  3FV1 A;  1L5T A;  3MZ1 A;  2UYE A;  4DXU A;  1H43 A;  5BWJ A;  3PUZ E;  4U4X A;  4QFO A;  4KHZ E;  3EQ1 A;  3RNN A;  1MXW A;  3H6V A;  1WVJ A;  4UAC A;  4ZE8 A;  3RQT A;  3T22 A;  3CR9 A;  3BFT A;  4NF0 A;  1PB9 A;  2WYP A;  2DP8 A;  3EKI A;  2E0S A;  4I3Y A;  3HN0 A;  5H8Q A;  3S9N C;  1EYK A;  2XXP A;  4MAG A;  2D5W A;  3G7W A;  1N76 A;  2B65 A;  1UTH B;  2PYY A;  4ESW A;  1FQD A;  2GRV A;  1MPD A;  1I6Q A;  3LSF B;  3SET A;  4GD5 A;  1B6H A;  1PB7 A;  2UVJ A;  4DI4 B;  4R2F A;  3C34 A;  4YIC A;  4G68 B;  3OEL A;  2PFY A;  3RT6 B;  2GHB A;  3ECR A;  4PC9 A;  3FVO A;  5CM6 A;  3FV2 A;  5L8D A;  1VDW A;  2Y7I A;  1MH3 A;  1FBG A;  4H5F A;  5I59 B;  4GL8 A;  2F7A A;  3K00 A;  1FTO A;  1QUL A;  4OEU A;  3PU5 A;  3U93 A;  4IY6 A;  3KN7 A;  2Z22 A;  3JV9 A;  1RYX A;  4YKI A;  1GGG A;  5EHS A;  3C36 A;  4EQ9 A;  3T66 A;  2LAO A;  4F22 A;  2HHM A;  5I3S A;  1MPC A;  4AB6 A;  2DVZ A;  1MRP A;  3OSQ A;  2QL3 A;  3CVG A;  3O6G A;  1LAF E;  1ANF A;  1MDQ A;  2F35 A;  2QVU A;  4GWX A;  3HPI A;  2P2A A;  1SD3 A;  4OEN A;  4ISU A;  3JZJ A;  3TEP A;  3ZKL A;  3IFA A;  2XXW A;  1KA1 A;  3HHF A;  1A7L A;  1URG A;  3Q26 A;  5EQA A;  5H8F B;  1UTB A;  3ZSF A;  3VLW A;  4PGN A;  3VE1 B;  1B1H A;  4N4U A;  1FTA A;  1URS A;  2F5X A;  4BDM A;  2XD2 A;  1DPE A;  3E4R A;  4H8I A;  1FCK A;  3EPE A;  4XKN A;  2XXU A;  1HSJ A;  2Z23 A;  5ISU A;  4C1T A;  4HE0 A;  3PD9 A;  1QVS A;  2X7Q A;  3B8B A;  2H98 A;  4ESX A;  3SEY A;  2Q2C A;  4G77 A;  2WX9 A;  4KI0 E;  1A40 A;  2G29 A;  1JET A;  3FXB A;  5IKB A;  3C31 A;  1B46 A;  1H3D A;  2AYS A;  2FA7 A;  2QMW A;  1FPE A;  4ND9 A;  4OTE A;  3H4Z A;  2A5T B;  1MXV A;  2GH9 A;  4PFB A;  3O2A A;  1JW1 A;  4XEQ A;  4NWD A;  2R8T A;  2HZL A;  1PC3 A;  3MZB A;  1MY4 A;  3K6V A;  2REG A;  4P1L A;  4E0W A;  4DZ1 A;  2FYI A;  4GX6 A;  5DEX A;  2DWA A;  2DS9 A;  2PT1 A;  3S2V A;  1VFE A;  4EQ7 A;  1LBC A;  3C32 A;  1MQG A;  3KOS A;  1B2H A;  2Y5L A;  4N15 A;  3FAT A;  2V3Q A;  4PET A;  1GTK A;  1SDX A;  1Z7N E;  4QBA A;  2HCA A;  1B7Z A;  3N5L A;  4XF5 A;  3IJX B;  4ZED A;  4GLI A;  3BBR A;  3FIR A;  3IAZ A;  2DWJ A;  2VHA A;  4NMY A;  1MQH A;  4H6D A;  4RXL A;  2HAV A;  3KFM A;  1SPI A;  4X9T A;  1O64 A;  3E3K A; 
#chains in the Genus database with same CATH homology
 5I2K B;  4NF8 A;  1NNF A;  1Y3P A;  5TP9 B;  3TMG A;  2NXO A;  3O6I A;  1LAG E;  3QUJ A;  4F3S A;  5K2Y A;  4KQP A;  4GRK A;  3U1O A;  4OHN A;  1FQC A;  1A55 A;  4YB5 A;  1MQI A;  3H6W A;  5AE4 A;  5AA3 A;  1MY1 A;  4ONY A;  2ANJ A;  4OVJ A;  4U4S A;  2Z8F A;  3RTW B;  4F2Q A;  1DSN A;  4JDF A;  2OK2 A;  4YMB A;  4K3F A;  4ZZE A;  3K6U A;  2YPN A;  1SBP A;  4OEV A;  3K1N A;  4N07 A;  5AA4 A;  1UIV A;  1J1N A;  3OO8 A;  4IGT A;  1XHY A;  2H99 A;  1LBB A;  2O51 A;  3VDF A;  3IR1 A;  3DLN A;  3FXU A;  5CMB A;  3Q27 A;  3D4G A;  1VFD A;  1D3K A;  4IGR A;  4JSD A;  1RYO A;  4KR5 A;  2XHD A;  1Y4T A;  4QF9 A;  1BIY A;  1EZO A;  4EUO A;  3MJN A;  2W7Y A;  1M5F A;  3TZA A;  4WXJ A;  2RC9 A;  2QPQ A;  3TOD A;  2I6E A;  4X1B A;  4ELR A;  1JEU A;  4IO7 A;  3E13 X;  1DTG A;  3FGS A;  1Z7M E;  1Y1Z A;  2D3I A;  2Z8D A;  3H03 A;  4R6K A;  5CMC A;  5H8S A;  4RYA A;  4WED A;  2R6G E;  4R6H A;  3UOR A;  3KN3 A;  5CBS A;  4DLD A;  3K01 A;  4OMB A;  2ZNS A;  2F6P A;  1ZIU A;  3S9M C;  3SES A;  4AB5 A;  1NKX A;  4HCY A;  2HQ0 A;  3ILU B;  5EYF A;  1BTJ A;  5A5X A;  2Q8J A;  1MY0 A;  4G8M A;  3M8U A;  1UQW A;  4BDQ A;  3U72 A;  4RK2 A;  1XVX A;  1CB6 A;  2QS1 A;  1SVX B;  1H44 A;  3MPK A;  1S50 A;  5CMK A;  3FZV A;  1POT A;  1Y9U A;  1MPB A;  1XS5 A;  1B0H A;  1M5C A;  2QRY A;  2I58 A;  4I1D A;  5B70 A;  4PFY A;  1MY2 A;  1R1N A;  1UTB B;  3K02 A;  1S7Y A;  4BDR A;  1Q35 A;  3VLV A;  1B4Z A;  4OET A;  5F7V A;  5H8H A;  3TTK A;  4P0I A;  2QMX A;  3KEI A;  5I56 B;  3O29 A;  1ZTY A;  3KN8 A;  3P7I A;  1N7X A;  4NF4 A;  2XXI A;  4GOT A;  3VVF A;  2R9J A;  1P1O A;  3FJ7 A;  1OMP A;  3IL1 B;  2QS4 A;  3TCG A;  4DIG A;  5JEI A;  2I0C A;  3CSG A;  4NF6 A;  4R6Y A;  1NH7 A;  4LUB A;  4MBP A;  1QUJ A;  2OJT A;  3PUX E;  1IEJ A;  3MVY A;  3LSX A;  4R73 A;  5L9O A;  1Y1M A;  4DCY A;  5AA1 A;  3OD7 A;  2ZXT A;  1US4 A;  4HS7 A;  4DCX A;  1TXF A;  1MH4 A;  3H6U A;  3V5A A;  2ESN A;  3MPL A;  4OZ9 A;  2X26 A;  3UN6 A;  1LCF A;  3MVX A;  2VD3 A;  4GQO A;  1FQF A;  3QIM A;  4JXI A;  3ZS6 A;  4G8N A;  5M2V A;  3KGC A;  3TUS A;  5I2N B;  4FEB A;  1LAX A;  1XVY A;  3U94 A;  4ELQ A;  1DMB A;  1A8E A;  1IXH A;  4OXV A;  3SEW A;  4NF8 B;  5JK4 A;  1MXZ A;  1FQE A;  4WEP A;  5DYH A;  1GR2 A;  1Y3N A;  4NF5 A;  4F3B A;  1MM7 A;  4F2O A;  1OLA A;  2DOJ A;  3C35 A;  1AOV A;  4I9D A;  4Z0I A;  2I0B A;  5I58 A;  4N6P A;  4DE8 A;  4LVQ A;  2DWH A;  5AA4 B;  1OVB A;  3SDF A;  5TPA A;  3IB0 A;  4ZDM A;  1MM6 A;  3PUY E;  3Q25 A;  1B05 A;  4R75 A;  5TU0 A;  4RK9 A;  1QKB A;  2RC7 A;  1AL3 A;  1EZP A;  2DE4 A;  3TFL A;  1SW4 A;  3FVG A;  4LP2 B;  3QAX A;  3FAS A;  4FAT A;  4MLQ A;  2Z8E A;  4ZS9 A;  1JEV A;  4ZEI A;  3QUF A;  2QJE A;  4H0W A;  2XX7 A;  3E9X A;  1FTK A;  1WDN A;  5DVF A;  4IO3 A;  2RKM A;  5H8N A;  3GBB A;  4JBZ A;  4F1V A;  2QS3 A;  3ILT B;  4R74 A;  1PDA A;  2AL4 A;  1YAE A;  2UVI A;  1POY 1;  3PMV A;  3TTL A;  2F97 A;  1OIB A;  2KLF A;  3FUZ A;  1US5 A;  1BP5 A;  3TTN A;  4KD5 A;  1FQB A;  3WAE A;  3LUY A;  3Q29 A;  3CG3 A;  2V25 A;  3B6W A;  1B40 A;  4IO2 A;  4U2R A;  1EU8 A;  3T9U A;  3O97 A;  4OES A;  3RT8 A;  2V3U A;  1B7H A;  2VD2 A;  4H67 A;  3OMB A;  1PB8 A;  4LQ2 A;  5A5X B;  3R6U A;  3C4M A;  2OBG A;  3EN3 A;  5KDT A;  4O3C A;  1CE2 A;  3G3J A;  5CC2 A;  1YPN A;  3D4C A;  1Y4C A;  2Y7R A;  3B6T A;  2I4B A;  4KFQ A;  4FED A;  2H4I A;  3I3V A;  3CI8 A;  1O7T A;  3IOR A;  4HCW A;  3U92 A;  4JWO A;  2ZNU A;  4YB6 A;  1N04 A;  2Y7P A;  3PUV E;  3V89 B;  3KJT A;  3PD8 A;  2O68 A;  2HAU A;  1NNK A;  4GL0 A;  3N6T A;  3LSW A;  2OCU A;  3QYT A;  4F31 B;  2GHA A;  3A09 A;  2Q89 A;  5DVJ A;  3VXC A;  2VGQ A;  1AIV A;  3IO4 A;  3PPP A;  2G93 A;  3OEN A;  3CSB A;  4Q8R A;  4PQJ A;  4NF6 B;  2XXQ A;  3O9P A;  4RJZ A;  4RPN A;  4PE5 B;  3T96 B;  4LON B;  4ECF A;  1LFH A;  4ELP A;  1P1Q A;  4FAJ A;  1MXY A;  1B52 A;  3IB2 A;  1PBQ A;  3RUM A;  1LB9 A;  3GLB A;  2CMO A;  4Q30 B;  1D9Y A;  3S4U A;  4OFO A;  3T9H B;  4TLL B;  1B32 A;  4Z7E A;  3KJ7 A;  4QSD A;  2Y7K A;  4U22 A;  5ICQ A;  5JTY A;  2ZYO A;  3PPR A;  1ZMG A;  4TLM B;  1Y3Q A;  4YAH X;  1IQ7 A;  3B7D A;  4QFK A;  2O7I A;  3RPW A;  1GVC A;  3PGF A;  5AA2 B;  4G2Z A;  3W9W A;  4OYV A;  3N6U A;  1P1N A;  5CBR A;  4HTG A;  5KCJ A;  2NOO A;  3ZKK A;  1ATG A;  2Y84 A;  4KYD A;  4ZE9 A;  4JWY A;  3LR1 A;  3AXF A;  1H76 A;  3HST A;  3MVW A;  1M5E A;  3PPQ A;  3TEL A;  5L9M A;  4H8J A;  4C0R A;  4F18 A;  1A54 A;  3HV1 A;  3VLU A;  5H8Q B;  4QFL A;  3TQL A;  4OFJ A;  3W15 C;  1QW0 A;  4P11 A;  2XXX A;  4PFU A;  4MF3 A;  2IEE A;  2F78 A;  3FVN A;  3G3F A;  2VOZ A;  2NVU B;  1TFA A;  1DOT A;  3TPA A;  2HEU A;  1B3E A;  4NED A;  3M3F A;  4GF8 A;  3K4U A;  2H5Y A;  2OWT A;  3VVD A;  3IOW A;  3TYH A;  1ZJL A;  1FQA A;  1USY H;  4THI A;  1LLS A;  1B3H A;  3MBP A;  1UIU A;  3DM0 A;  4F1Y A;  2P0S A;  2X7P A;  4DDD A;  3MP1 A;  1VE4 A;  5H8N B;  2UVH A;  3LSL A;  5FTH A;  3FD3 A;  5HBC A;  4XKQ A;  4ZZA A;  4RPO A;  3GBA A;  5H8F A;  1OVT A;  3S9E A;  1B51 A;  2DXY A;  4GVO A;  4PFW A;  5ITO A;  2AIX A;  1B7U A;  5FHO A;  4MLV A;  3MZ9 A;  3KSJ A;  2XX9 A;  2OZZ A;  1VR5 A;  4WKM A;  4U21 A;  4G4P A;  4GXA A;  2I48 A;  4X48 A;  3UK4 A;  1IUD A;  4L17 A;  1JVY A;  3DP6 A;  5HPQ A;  3H6T A;  2OWS A;  2H9B A;  3DEL B;  4QSC A;  1IZ1 A;  3KOT A;  3QXM A;  3PPO A;  3UA8 A;  2XXY A;  2ABH A;  4H1X A;  2RC8 A;  3CIJ A;  4Q0C A;  1M5D A;  5LOM A;  4R9G A;  2A5T A;  3IJO B;  4OQO A;  3IOT A;  1HSE A;  3CRB A;  5B7D A;  2O1M A;  3LC8 A;  2B3B A;  2XXH A;  2RCB A;  4GXS B;  3TCH A;  4EF1 A;  3FVK A;  3O66 A;  1BLF A;  4YU0 A;  4XIG Q;  2RCA A;  1PBP A;  4BLA A;  3R26 A;  1MDP 1;  4QRZ A;  1XOC A;  1N3X A;  3FXQ A;  1SYH A;  5I84 A;  4P0G A;  3A3U A;  1I6A A;  4F29 A;  2F8D A;  4HW8 A;  5DEX B;  3OEM A;  5HM4 B;  1JQF A;  4AQ4 A;  3I5O A;  3HO7 A;  1EH3 A;  2F7B A;  2GFE A;  1SYI A;  4R72 A;  3IOU A;  2UYF A;  1NH8 A;  2BJJ X;  5BUU A;  2Q88 A;  3S9L C;  3R7X A;  4KYE A;  3BKI B;  3TTR A;  1I69 A;  4KPT A;  3IO6 A;  1GV8 A;  3L6G A;  2IA4 A;  3OOA A;  4FE8 A;  4FEC A;  1B1X A;  4PFT A;  1P99 A;  4BDO A;  3EHT A;  3SKP A;  4ZEK A;  5ITP A;  3RGY A;  3H06 B;  4EXL A;  1SW1 A;  3CFL A;  1R9L A;  1H45 A;  2PT2 A;  3IOV A;  1T0K A;  1B3G A;  4M1V A;  5FHM A;  3L6H A;  2I4C A;  4FOR A;  3KBR A;  4IO5 A;  4EQB A;  2O7U A;  4POW A;  4YKP A;  5CRY A;  1FTJ A;  2F6G A;  4KCD A;  3B6Q A;  1IIW A;  2QS2 A;  5KCJ B;  2O69 A;  2YLN A;  3V83 A;  4R9F A;  5ICT A;  4LZ5 A;  2P1S A;  1ZU0 A;  1M5B A;  4N13 A;  4YB7 A;  1SW5 A;  2V93 A;  1B5I A;  4E0X A;  3Q28 A;  2Y7W A;  4XTC Q;  4F3P A;  3TTM A;  3TQW A;  4QSE A;  3UP9 A;  3O28 A;  3KZG A;  4LZ8 A;  4NWC A;  4FIM A;  3K1M A;  2Q2A A;  3PMW A;  1N0T A;  2B3F A;  1NNT A;  2R71 A;  4TOZ A;  4LQ5 A;  4XXU A;  3LBS A;  3K1P A;  4YKK A;  4MH5 A;  3MAM A;  2VP1 A;  3VV5 A;  4LZ7 A;  1LB8 A;  2E1S A;  5L9S A;  4NTL A;  1NL5 A;  2FNC A;  1LST A;  4LAT A;  2XXR A;  3FJG A;  4O3B A;  4GFR A;  3EHS A;  2Q9T A;  4EF2 A;  1FTL A;  5FHN A;  3K6W A;  2F36 A;  4H65 A;  2PX1 A;  1TT1 A;  3K0V A;  4YZZ A;  4R2B A;  4F39 A;  3ODB A;  3DP8 A;  4ZEC A;  1JW5 A;  2ZYN A;  3K2D A;  5DVI A;  1SI1 A;  3N94 A;  3TDJ A;  5I56 A;  1MG1 A;  4RA1 A;  4F1U A;  3N26 A;  1N3W A;  2RF1 A;  1XT8 A;  3W9V A;  1P1W A;  3GZG A;  5H8H B;  1MQD A;  3H7M A;  3SEU A;  2ZYK A;  1SI0 A;  4JWX A;  1PEB A;  2XXV A;  3QSL A;  3KSX A;  4NF4 B;  1IXI A;  4DXB A;  1O63 A;  4Q5T A;  4ZEB A;  4FJP A;  1ELJ A;  5I57 A;  1B5J A;  1A8F A;  4ELO A;  4TQU Q;  3T9X B;  2ONR A;  1JNF A;  1P1U A;  4LA9 A;  1AMF A;  4OER A;  1ZKB A;  2PMS A;  2REJ A;  1IXC A;  4RY1 A;  3OO7 A;  2XD3 A;  3A3C A;  2ZMB A;  2DVC A;  3VXB A;  2ZNT A;  4U1Z A;  1YCJ A;  1IIT A;  3M3L A;  3V8X B;  2M8C A;  3OO6 A;  1B3L A;  5CMM A;  4PP0 A;  1ZLQ A;  1NMU A;  1A99 A;  4JSO A;  4MFI A;  1JVX A;  4KYS A;  1MXX A;  1S9T A;  1EZ9 A;  1FTM A;  1VSO A;  4C1U A;  2HZK A;  5I2N A;  5IAI A;  1B58 A;  1USY E;  2ZYM A;  1FW0 A;  1OQG A;  1II5 A;  3RY3 A;  1N84 A;  1NFT A;  3EF7 A;  1AH5 A;  4XKR A;  4BDL A;  2ALU A;  5ELV A;  2F7C A;  3DP4 A;  4EXK A;  3PMX A;  3RLF E;  3UIF A;  4EDP A;  3PPN A;  3EHU A;  5KZT A;  2AL5 A;  4BDN A;  1ZBM A;  2YJP A;  4IO6 A;  3PV0 E;  1UTH A;  2PBW A;  3BFU A;  3VVE A;  1MQJ A;  1JW4 A;  1SQY A;  1BKA A;  1DTZ A;  1B4H A;  4NF5 B;  5J1D A;  3QK6 A;  1D9V A;  4RNS A;  2V3T A;  3HCQ A;  4U1O A;  2DSF A;  1R9Q A;  1QKA A;  4G68 A;  4G8H A;  4IB2 A;  4NE4 A;  3MQ9 A;  5I58 B;  3UGW A;  2A5S A;  3GXA A;  1RKM A;  3U8Q A;  3KG2 A;  2D21 A;  1NNP A;  5FTI A;  3PUW E;  1QUK A;  3MW0 A;  5TPA B;  1KWH A;  3G3I A;  5I59 A;  3IK6 B;  3SEX A;  1B9J A;  1WOD A;  1Y20 A;  1N7W A;  1MY3 A;  1Q1K A;  1DPP A;  5AA2 D;  3O6H A;  1LAH E;  4M4G A;  3I6V A;  2DQV A;  3JYR A;  4G68 C;  4ZEF A;  2DYX A;  1URD A;  3TCF A;  2DXR A;  2THI A;  4GWO A;  2WKY A;  2NUV A;  2UVG A;  2ONS A;  3RTF B;  1F9B A;  3C33 A;  4JB7 A;  1B3F A;  2HFB A;  4YKJ A;  1HSL A;  3M3K A;  3TAJ A;  3C9H A;  3T93 B;  4O3A A;  4U23 A;  3SEV A;  3CG1 A;  1D4N A;  3F11 A;  4DXC A;  1TFD A;  2I3W A;  2DE3 A;  3IX1 A;  4OFL A;  3OSR A;  1MS7 A;  4F3G A;  4UA8 A;  3G3G A;  2RIN A;  4QFP A;  1R6Z A;  3FXR A;  2DWI A;  3HHG A;  2CZL A;  2HXW A;  4F19 A;  3THI A;  3H3G A;  2O6A A;  4KCC A;  4GIZ A;  3USD A;  2O1L A;  3VFJ A;  2O84 X;  5KDT B;  3MVZ A;  3CFX A;  4IY5 A;  1XC1 A;  2PVU A;  5K2X A;  1QUI A;  2XX8 A;  1TWY A;  2V84 A;  1LGB C;  1LFG A;  5F1Q A;  2OLB A;  5CI5 A;  4QFN A;  2H25 A;  5EHM A;  4IO4 A;  2UXA A;  1SW2 A;  4I62 A;  1LCT A;  3K6X A;  1YTV A;  2F34 A;  2DE2 A;  1B5H A;  2I49 A;  3ONM A;  5I57 B;  2I3V A;  1OQH A;  4I8C A;  1IXG A;  3OXN A;  3OO9 A;  3MWB A;  4H5G A;  3OEK A;  4QHQ A;  1QJM A;  2ONK E;  3T9V A;  3G3K A;  3TKD A;  3SER A;  5I2K A;  1MXU A;  2NWJ A;  1LFI A;  4POX A;  3MUQ A;  3RN8 A;  1I6B A;  3FJM A;  3G3H A;  5TP9 A;  2QSX A;  3MC2 A;  3MP8 A;  3MP6 A;  4X1D A;  1B0L A;  4OWD A;  2XXT A;  4XKP A;  3WAF A;  5DTB A;  3IB1 A;  4YMA A;  5AA2 A;  1OLC A;  5JTY B;  5DT6 A;  3CFZ A;  3FV1 A;  1L5T A;  3MZ1 A;  2UYE A;  4DXU A;  1H43 A;  5BWJ A;  3PUZ E;  4U4X A;  4QFO A;  4KHZ E;  3EQ1 A;  3RNN A;  1MXW A;  3H6V A;  1WVJ A;  4UAC A;  4ZE8 A;  3RQT A;  3T22 A;  3CR9 A;  3BFT A;  1PB9 A;  2DP8 A;  2E0S A;  3HN0 A;  5H8Q A;  3S9N C;  2XXP A;  2D5W A;  3G7W A;  1N76 A;  2B65 A;  1UTH B;  2PYY A;  4ESW A;  1FQD A;  2GRV A;  1MPD A;  1I6Q A;  3LSF B;  3SET A;  4GD5 A;  1B6H A;  1PB7 A;  2UVJ A;  4R2F A;  3C34 A;  4YIC A;  4G68 B;  3OEL A;  3RT6 B;  2GHB A;  3ECR A;  3FVO A;  5CM6 A;  3FV2 A;  5L8D A;  2Y7I A;  1MH3 A;  4H5F A;  5I59 B;  4GL8 A;  2F7A A;  3K00 A;  1FTO A;  1QUL A;  4OEU A;  3PU5 A;  3U93 A;  4IY6 A;  3KN7 A;  2Z22 A;  3JV9 A;  4YKI A;  1RYX A;  1GGG A;  5EHS A;  3C36 A;  4EQ9 A;  3T66 A;  2LAO A;  4F22 A;  1MPC A;  4AB6 A;  2DVZ A;  1MRP A;  3OSQ A;  2QL3 A;  3CVG A;  3O6G A;  1LAF E;  1ANF A;  1MDQ A;  2F35 A;  3HPI A;  2P2A A;  1SD3 A;  4OEN A;  4ISU A;  3JZJ A;  3TEP A;  3ZKL A;  2XXW A;  3HHF A;  1A7L A;  1URG A;  3Q26 A;  5H8F B;  1UTB A;  3ZSF A;  3VLW A;  3VE1 B;  1B1H A;  2F5X A;  1URS A;  4BDM A;  2XD2 A;  1DPE A;  3E4R A;  4H8I A;  1FCK A;  3EPE A;  4XKN A;  2XXU A;  1HSJ A;  2Z23 A;  5ISU A;  4C1T A;  3PD9 A;  1QVS A;  2X7Q A;  2H98 A;  4ESX A;  3SEY A;  2Q2C A;  4G77 A;  4KI0 E;  1A40 A;  2G29 A;  1JET A;  5IKB A;  3C31 A;  1B46 A;  1H3D A;  2AYS A;  2FA7 A;  2QMW A;  4ND9 A;  4OTE A;  3H4Z A;  2A5T B;  1MXV A;  2GH9 A;  3O2A A;  1JW1 A;  4NWD A;  2HZL A;  1PC3 A;  3MZB A;  1MY4 A;  3K6V A;  2REG A;  4E0W A;  4DZ1 A;  2FYI A;  5DEX A;  2DWA A;  2DS9 A;  2PT1 A;  3S2V A;  1VFE A;  4EQ7 A;  1LBC A;  3C32 A;  1MQG A;  3KOS A;  1B2H A;  3FAT A;  2V3Q A;  4PET A;  1GTK A;  1SDX A;  1Z7N E;  2HCA A;  1B7Z A;  3N5L A;  3IJX B;  4ZED A;  4GLI A;  3BBR A;  3FIR A;  3IAZ A;  2DWJ A;  2VHA A;  4NMY A;  1MQH A;  4H6D A;  4RXL A;  2HAV A;  3KFM A;  4X9T A;  1O64 A;  3E3K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...