2ESNA

The crystal structure of probable transcriptional regulator pa0477 from pseudomonas aeruginosa
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
301
structure length
299
Chain Sequence
PLLRRLDLNLLLVFDALYRHRNVGTAASELAISASAFSHALGRLRQGLDDELFLRQGNRMQPTQRAEHLAAAVAAALRALGEGLEEWRPFVPGQSQRTFVFAATDYTAFALLPPLMNRLQHSAPGVRLRLVNAERKLSVEALASGRIDFALGYDEEHERLPEGIQAHDWFADRYVVVARRDHPRLAGAPTLEGYLAERHAVVTPWNEDSGVIDRLLARSGLRREVAVQLPTVLAALFLAGSTDFLLTAPRHAARALAEAAGLALYPAPFDIPPYVLRLYSHVQGRDAHAWMIGQLKGLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords probable transcriptional regulator
publication title The crystal structure of putative transcriptional regulator Pa0477 from Pseudomonas aeruginosa
rcsb
source organism Pseudomonas aeruginosa
total genus 89
structure length 299
sequence length 301
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2esnA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2esnA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2esnA03
4WK8F 1QUIA 2JRTA 3TO7A 2R6GE 3OSQA 4NF4A 4YZZA 3KOTA 2HKOA 5KCJB 2JTVA 3K6VA 3IB0A 3BJ6A 3ZP5A 3ZQ7A 5AIPA 4D0PA 1PBQA 1WKMA 2IPQX 4X1BA 3SHFA 1MDQA 3F8NA 1TQMA 1MXZA 4FEBA 2NS0A 3KE2A 1QULA 1O7FA 4MHGA 3DPLC 5FGMA 4S05A 2KRFA 3RQTA 1I6QA 1BBYA 1MQGA 2BBYA 2QQAA 4LG0A 1YAEA 4IGRA 2Q2AA 3LSLA 1JETA 1EV7A 2EFWA 5I57B 1R9LA 1T38A 1Q1KA 2GHAA 3RPWA 3L6GA 5LEKA 1R00A 1SAXA 1MQDA 1YS6A 1T0KA 1X3UA 3F8BA 3HRTA 1YW9A 2PEXA 4XSZF 1AWCA 1J9IA 3C31A 1ZGJA 5FB2A 3WU0A 4E0WA 1YO5C 4NTLA 4M9SA 3J7AO 5EYFA 3Q27A 3K01A 2HFHA 2HTJA 1Z05A 1AL3A 4E70A 3I53A 1B7ZA 3W9VA 1TXFA 2IA2A 1R58A 4CZZA 1O3RA 3VDFA 2OQGA 3MZ1A 3RKXA 1OLCA 2DK5A 2V79A 4O5VA 1N3XA 3WE3A 3B6TA 4HCYA 3HSTA 1W5SA 3IKVA 5JK4A 3HRSA 1O3SA 2E1SA 4MFIA 4X9TA 3M8EA 3DKWA 1TBXA 2NNNA 3H6WA 2B0LA 1IN8A 3R60A 4U88A 5JHUA 2PG4A 2EK5A 3E6BA 4A5MA 3UIFA 4MQVA 4EVIA 2FYIA 1H43A 5H6QA 2A5SA 2DFIA 3QAXA 4QSEA 1BIYA 4ZS9A 2ZXJA 1BI0A 2O8XA 3H6TA 2D1VA 2Y75A 1KU9A 1TNTA 2QVOA 3FMQA 2CZLA 2QM3A 5JTYB 1W7PD 1Z7ME 3G3KA 3TODA 2E0SA 2HQNA 4A0ZA 1A8EA 1TT1A 1SYHA 3IWFA 5CC2A 4M4GA 1JQFA 1K78B 4ZE9A 5AIQA 4DNCA 2QSXA 2UVHA 4PE5B 3ZPLA 4NWCA 4ZYEA 2I0CA 4PP0A 1B9JA 2MBFA 4KFQA 3WTSC 3W6KB 1XDSA 3Q29A 3EYIA 1O3QA 3T96B 3J81Z 2GRVA 5I58A 2HFBA 3LC8A 4MQ9F 2DE2A 5LGNA 4LLGF 4UACA 5D6FA 2IA0A 2UVIA 2ZYNA 1FTKA 3WU1B 1B05A 3O6HA 2BE5F 3H3ZA 5L3EA 1EU8A 4N9IA 3U1OA 3HRUA 1B5HA 3MJNA 3VOEA 1B5IA 2R71A 3TTKA 1BI2A 1MJ9A 4BHCA 4JSDA 3H6UA 3TQWA 1JHHA 5FFXA 1IUYA 5ILSA 4M9ZA 4OZ9A 2F5XA 2D5WA 1O63A 3CUOA 3MVZA 3T5XA 1L5TA 5CVJA 4F31B 3K1NA 3IRQA 2IEEA 3FVGA 1QPMA 3HUGA 3V7SA 2V93A 2M87A 4M6YA 1IITA 3DXJF 4EUOA 2AS5F 2H5YA 2DS9A 3MZ9A 2ZBKA 4G7ZF 1B1HA 2Q88A 3K02A 5LRRA 3MP1A 1FTOA 4POXA 1LEAA 3ZN1A 1KYWA 3IKTA 2FBKA 5F7VA 3C7JA 3O3KA 4OINF 1PP8F 2O68A 1G3TA 4M72A 2E1CA 1LQ1A 4O3BA 1J5YA 1B46A 1BN5A 4Z0IA 3TKYA 3KFMA 1HQCA 4XTCQ 1H9TA 4G68A 5K2YA 2QWWA 2NRAC 5I2KA 3F6OA 1K7AA 1SD7A 4N13A 4LG0B 1FPQA 1FLIA 1T6SA 4KT5C 1JGSA 2XAJA 4MEXF 2GIVA 2XAGA 3D0SA 1MGTA 1F9NA 3P9IA 4BNCA 1H0MA 4YB5A 4WXCA 1Y1MA 4KR5A 1M5DA 4F19A 1POTA 1XMAA 3RKWA 4N9HA 5CMKA 1ELJA 3K0LA 1YG2A 1DPUA 1AOVA 3KP6A 4QWQA 5JI6A 1JW1A 4OIQF 4GXSB 2P2AA 4GRKA 1DPRA 3O9PA 2OBGA 4JWXA 3IB1A 2ZNYA 3GF2A 4IGTA 3CFXA 2UVJA 1JXSA 2V1XA 3E6CC 4IRIA 5I2NB 4WCGA 3KJ7A 4FORA 2FF4A 3G3HA 2G7UA 2DU9A 2UYEA 3QK6A 3NQOA 1R23A 1Y0UA 1P4XA 3KFWX 3D4GA 2LKPA 4UNOA 3M7GA 4EGYA 3L7WA 4HYEA 1YIOA 2OAZA 5LRSA 4ECFA 4H8IA 3G3FA 1ZAOA 2DPDA 4KIGA 3RPUA 5LHIA 1FBQA 4L5JA 1J75A 1B51A 2B3FA 4R9FA 2DXYA 1JE8A 1UB9A 2HGCA 5HDNA 1LFIA 2XHDA 3ZKKA 4FAJA 5FLXK 4FX4A 4LLNA 1LGBC 4HX4A 3WGGA 2CMOA 4XRFA 1U5TA 1RKMA 3QAHA 1LAHE 4LP2B 5TP9B 4JQFA 4O3AA 3EETA 1B2HA 5D6EA 3SQNA 1S9TA 2CSOA 1PEBA 4XXUA 1D9VA 5D8KB 1FSHA 2PT1A 3Q25A 3V8KA 3BPXA 4PFTA 3T9VA 3OENA 4Q47A 3RI4A 3F72A 1ZRCA 1N84A 2K02A 2DVCA 4U22A 4PETA 1JHFA 2JZYA 1BP5A 2YSRA 2XD2A 4YFXF 5D4RA 4I01A 3CO7C 3VODA 4JBAA 2XAFA 3ABTA 2A61A 1P1QA 1HSEA 4U4SA 2XXWA 2VC0A 5CMBA 4P96A 1D4NA 3DLNA 2RDPA 4IY5A 2DQLA 3UK4A 5I56A 4HX7A 5LOMA 2PMUA 2YPRA 2XXQA 2P0SA 4KN4X 5JR3A 3RY3A 4F3GA 5TPAA 1MQIA 2V25A 3LWFA 2WC2A 4P9FA 1GR2A 1MJAA 3F3XA 3ILUB 4EQ9A 4BDRA 4L18B 5DD4A 4KICA 1A54A 3QPTA 1UTBB 1SD6A 3THIA 3OEKA 4QSDA 3TTMA 1XMKA 2REJA 1W7PA 3PGFA 3ROUA 2XXRA 4AQ4A 1YS7A 2AYSA 2VT3A 1RUOA 2Y7RA 2XAQA 4OHNA 1FOKA 5CBRA 1Z7NE 4TLMB 4M73A 4CGZA 2FA7A 1ON2A 1MXVA 1Z7UA 2HTSA 5HVQC 5HLHA 3D4CA 5LEJA 4R72A 1NL5A 1E2XA 4ZEBA 3H6VA 3IOVA 2XXIA 3R6UA 4G9YA 1EZ9A 3TQLA 2W85A 1MD0A 2RV8A 4F2OA 2O03A 2DT5A 1OPCA 3GUDA 4BLAA 3WTTC 4OIPF 4R2BA 3PPOA 2W57A 3UORA 4DCXA 4KYEA 1A8FA 3U1DA 3LR1A 2Q2CA 1BOAA 4HDVA 3KEIA 2EFNA 3JYRA 1LFGA 2WWYA 4GFRA 3VLUA 5H8NA 3T93B 1TQIA 1DUXC 3M3KA 4OIRF 1OMPA 1PB8A 1YLFA 2RC9A 2OD5A 3QP5A 1WVJA 1J59A 4PGHA 2GQQA 1P99A 1BJAA 2BYVE 2K4BA 2QS3A 3MP8A 4KCDA 3F8FA 4Q0CA 3A09A 1KU2A 3CUQC 4GF8A 3U9GA 5I2KB 2XXHA 3RKYA 3MAJA 1DMBA 3D5LA 5DCMB 1SDXA 1YQAA 4IVNA 2WTEA 2RCAA 3L2CA 4HV5A 2YJPA 3TGNA 4Q5SF 5BWJA 1ZMGA 5JFRA 1M5FA 3I0TA 4EM2A 1O57A 2STWA 4ESBA 2JPCA 1UFMA 2FEZA 1BC7C 3HRMA 2XX9A 1B32A 2HCAA 3KLNA 3A3CA 1FSEA 3DFGA 1RYOA 1HSJA 2DWJA 2P7CB 2ONRA 4FJPA 4AIJA 4L5IA 2RNJA 3GVAA 5DT6A 1QUJA 2V1DA 5DCFA 2PJPA 5DVFA 2NVUB 2H4IA 1WDNA 3RPQA 4G6QA 2QPQA 2FNPA 4IRGA 1KU7A 4WXJA 4BAYA 4PDKA 4EGZA 4MTEA 2VC1A 1SMTA 1ZRDA 4U4XA 2GH9A 4FE8A 3KZZA 4U7DA 3N94A 3H3GA 4KQPA 4OTEA 1FTMA 1HSTA 2I48A 3Q28A 1MQJA 4H6DA 4GXOA 4ELPA 2MA3A 3HN0A 4ONYA 1UCRA 4NF5A 4DXCA 1MS7A 1S7OA 4RY1A 2KLFA 2XXVA 4OENA 1FTJA 4ON0A 1B4ZA 4OXVA 5KDTA 1ZREA 2ZKZA 1AIVA 3S9LC 3C32A 5AE4A 1I1GA 2VXZA 4HZFA 1QW0A 2D2WA 3T0YA 4I8CA 3S2WA 1JEUA 2KJBA 3ECOA 3HO7A 1TW3A 4KYDA 3E3VA 2VOPA 1WODA 1SFXA 3I54A 5ICCA 3MAMA 5FFZA 3V7CA 1LEBA 1R7JA 1DP7P 4EM1A 3OD7A 3W15C 2R3SA 1GVJA 4JDFA 4XKNA 3KP3A 4Z2YA 3OELA 2DI3A 5CJ9A 3BROA 4YKJA 3GLXA 3HOSA 2O0YA 1TFDA 2DE4A 2V3UA 2IJLA 2LF7A 3TDUC 4RK9A 2B65A 3A3UA 2XX7A 1MXYA 4L9VA 2Z5UA 4EXLA 1ZKBA 3F6VA 1SQYA 4L9JA 4HDUA 4HBLA 2VE9A 4HF1A 4Q5TA 3B73A 4H65A 3LQRA 4G8NA 4X1DA 5DVIA 5AA2D 4CO8A 4GD5A 3ZMZA 3V8LA 2V9VA 1IXIA 1ANFA 4A2UA 5ICEA 1LCFA 3C9HA 2YLNA 2H6CA 1ZG1A 3PMWA 3VFJA 1B59A 1IXSB 1LFHA 2FMYA 1JW4A 1W7PB 1B1XA 4R74A 5DD8A 1V3FA 5E1XA 5LGUA 1VTNC 3FXRA 1KYZA 4HF0A 1P1OA 4F22A 2COMA 5FLXZ 1XGSA 1T2KA 5F1RA 4YB7A 4RYAA 5K5OA 6PAXA 1B58A 2OK2A 4R8HA 1II5A 3G3GA 3KN8A 4GYIA 1FCKA 3O2AA 3H92A 1FYMA 4OQOA 4ZZAA 3TOBA 4A6EA 5DUIA 2F6GA 1NFTA 3EUHA 4RJZA 3RT8A 4R6HA 3BPVA 5CM6A 3H7MA 2A3SA 3QUFA 5H8NB 2OLBA 3OOAA 1E17A 4QF9A 2DO7A 4LK0F 1LDKB 4P9UA 2CYYA 4LFUA 3DP8A 2ZYMA 1Z9CA 1A40A 3TELA 3GXOA 2QS4A 5BMZA 3DV8A 2GAUA 3J80K 2V1UA 1XT8A 3L6HA 2XHKA 2O61A 3FGSA 3CTAA 3HSFA 3ZN0A 4TQUQ 2RKMA 1N76A 2PMSA 1SD5A 3TMGA 4WF2A 4UUVA 2O69A 5ERIA 1ONVA 2PYYA 1XVYA 3MVWA 5CMCA 2VONA 1FQDA 2OZUA 4YKKA 1QO0D 1CE2A 4Y15A 3C33A 2GXGA 2ISYA 4GYGA 3FHZA 4QFOA 5A5XA 2ADUA 1U6GA 4M6XA 4YAHX 1WI9A 3M8UA 4BDNA 1IQ7A 4A0YA 1OIBA 3FMRA 4I1DA 3FM3A 3OO6A 4G4PA 3BJOA 4JWYA 4DXUA 1CF7B 1FQAA 4OWDA 4JB7A 1B40A 4NF6A 4MEYF 3CUQB 2I3WA 2P8TA 3NRVA 4MH5A 1UHMA 2VBWA 4U23A 2O6GE 3M3LA 3W9WA 3K2ZA 4F3SA 2VBXA 2I6EA 3MW0A 4X48A 3RTRA 4QHQA 4OEUA 5H8HB 3S9MC 4HW0A 2ZMBA 4DE8A 3VLVA 2O7IA 4IF4A 3H03A 2DP8A 1NH8A 1ZRFA 5JEIA 4KCCA 4GXAA 4RGRA 1ODDA 3PV0E 4LONB 3SEVA 4IHSA 2Z8DA 4IHTA 4Q48A 2QYOA 5BS6A 1OYYA 5ILVA 2HZKA 3RIRA 2F5DA 2A5YB 1FYKA 1MZBA 2X26A 5TJJA 4NE4A 2G93A 1QQIA 2JSCA 3FF5A 2QBYB 3PQJA 4LATA 1NNPA 2D1HA 2Z22A 2L54A 3VXBA 2NYXA 1MXUA 2XV4S 2FQ3A 1D8JA 1OLAA 1H3DA 3OMBA 1DSNA 3SZTA 3TDJA 2XXYA 3PU5A 3RT6B 1OR7A 3F8CA 3V8XB 3OO7A 5ED4A 2XXPA 4FT8A 5DV5A 1B9NA 1YCJA 3H4ZA 3SDFA 3CG3A 3HHFA 4JSOA 1IIWA 2LF8A 2O51A 4LJZF 3TDZC 3GEZA 1UTHB 4KNYA 5H8QB 3E13X 1FBSA 5HS9A 5A2QK 2Q2EA 2UXAA 1SFUA 5IT9K 4F3BA 1ON1A 2L02A 3CSBA 4CICA 4OETA 1MDMA 1FNNA 5HLIA 2ZYOA 3BP8A 4JXIA 1J2XA 3UP9A 1LNWA 4OOIA 1WSUA 2UWMA 1R9QA 3EF7A 2LAOA 3KG2A 5HS7A 1P2FA 2FXAA 5FTHA 1TNSA 4P11A 2ANJA 5M2VA 3P9CA 3ZS6A 3WAEA 4U7BA 1MY1A 2UYFA 4IB2A 1ZU0A 3MUQA 2VBYA 2DQRA 3LAJA 4N07A 4G6DA 2EV5A 1ATGA 1O7TA 1XOCA 3DP7A 4Q4ZF 4M9XA 2YPNA 1LAGE 3PQKA 2X7QA 3OXNA 3ONMA 4Q30B 5AA2A 2H98A 4HLYA 1PB9A 1QJMA 3RTFB 2MLKA 1KQ8A 1LAFE 4RNSA 2PMHA 5F64A 3QRFF 3BJAA 4EXKA 5FO5A 4BXUA 1Y3QA 4G68C 3I59A 1O64A 2PI0A 1D8KA 5E18F 2GWRA 1QBJA 4FHTA 3WTXC 1QNTA 3KGCA 1A55A 4OYVA 2G9WA 3FUZA 2DWAA 4IXAA 3GX4X 2ZJ2A 4O3MA 1FQFA 1MY2A 2I4BA 2XXUA 4NF4B 2KIMA 3ZSFA 2NWJA 1QGPA 3G7WA 4G7HF 5EEHA 5I84A 3WTYC 5LBQA 3RNNA 4RPOA 3WG9A 1TW2A 2O1LA 2O1MA 2QUFA 4LGWA 1LDJA 1BC8C 1KQ0A 1IZ1A 2ABHA 4JK1X 3BBRA 1URGA 2J5OA 2O7UA 5IAIA 1HBXG 3P7IA 3PD9A 3N6TA 1FQBA 2P1SA 2ZCWA 4OEVA 3UA8A 1SI0A 1XC1A 3BZ6A 4KN7X 2H99A 1FC3A 3IK6B 4G94A 3Q26A 4RGUA 3F22A 3WAFA 1ZLQA 3ZMSA 3GLBA 3IAZA 3SKPA 5AA4A 4U0YA 1W5TA 3I64A 4HAMA 4XLPF 1WRJA 2Z33A 1NMUA 4Q8RA 3IOWA 1XD7A 1TLHB 2QMXA 3FX3A 3PUWE 1XGNA 5DYMA 3DPTA 4B09A 4F2QA 4RAZA 1B9MA 3ELKA 4A12A 3DP4A 4NF8A 2H27A 5EEGA 4A0XA 2Z23A 3V7RA 3DM0A 4YMAA 1XCVA 4O3CA 2QQ9A 3I58A 1AMFA 1DPPA 2K27A 2ACJA 4HW8A 2NOOA 1U5TC 4RGXA 1LB2A 4EQBA 2F5EA 1HKQA 4TLLB 1AOYA 1IRGA 4RB1A 2DBBA 2XD3A 3FJMA 3J80Z 1V4RA 1HW5A 1I6XA 1B0HA 4LA9A 4I02A 3LAPA 3C4MA 3O66A 4Y17A 1BKAA 4R9GA 4BDMA 2X7PA 5H8FA 3KZGA 1F1ZA 1FYLA 2R9JA 1YYVA 2OBPA 4NWDA 1B7UA 1ZG3A 1MM6A 3N26A 3ERED 1RNLA 4YIFA 1J1NA 4HQMA 4BH9A 4RA1A 1EH8A 4KFCA 1G3YA 4QFPA 3Q5FA 3HPIA 2RC8A 5FHMA 2HYFA 3V8JA 3G3JA 1TTYA 1T39A 1NNFA 1Y9UA 3ECRA 4M74A 2OZZA 1KA8A 1PC3A 3F11A 2OCUA 4IO7A 4DXBA 2PFBA 1Y1ZA 2HR3A 3EQ1A 1FP1D 1LVAA 2FMLA 2OA4A 5HM4B 3O6BB 2F7BA 3KN7A 3CJNA 1B3GA 2Y7WA 3FJGA 3M3FA 4E0XA 2V3QA 4OFLA 5LHGA 2I58A 2RF1A 4EJOA 3CIJA 1GXPA 2RINA 5CLSA 2A5TA 2UXNA 1PBPA 3JAMK 3GYHX 1U3EM 1T0FA 2R7DA 3TQNA 5L3GA 1ZARA 4M1VA 5I58B 4C1UA 1USYH 3E5QA 1DTGA 1IXRC 3EN3A 1RYXA 3IB2A 2P4WA 2KIUA 3S9NC 4XKRA 1ZLKA 3F21A 4PQJA 3SEXA 3L09A 3LA3A 3VVDA 2A6HF 1XS5A 3WODF 2F78A 2VBZA 1MPCA 4WXHA 3MZYA 2ISZA 4C0RA 1B3FA 1D3KA 4ZH4F 3RYRA 1H45A 4OMBA 3O2PE 3CR9A 3C34A 4G7OF 3B6QA 4XIGQ 4ENKA 3QU3A 1P1UA 1ZYRF 3DELB 2Q0OA 4QFKA 1STZA 1OVBA 2V84A 2RC7A 4Y13A 4ESXA 2CGPA 4H5FA 4ENMA 4R75A 4LMYA 2DWIA 3VE1B 1MH3A 4MTDA 1G6NA 2VHAA 2ONKE 5KVRA 3EQLF 1MQHA 3FATA 2RGVA 4GIZA 2F2EA 1U78A 4ELOA 3TCFA 3MFKA 3QXMA 4UV8A 2QLZA 5CVRA 5A2QZ 2HZTA 3B02A 1FY7A 1SVXB 1HSLA 4EDPA 4AD9A 5IT9Z 4AWXB 4GL8A 4ZYHA 4KHZE 3KBRA 1IRFA 1LCTA 4R1HA 3VVEA 2F34A 3ILTB 3HIFA 1USTA 4I9DA 4G68B 1EH6A 2EV6A 1R36A 3JSPA 3HV1A 5CI5A 4IJAA 1Z1DA 3VVFA 3T8RA 4YFKF 5HS8A 2ZNZA 3ZMDA 5I59A 3E6MA 5CVIA 2F5CA 4FATA 3MEXA 2IVMA 2PBWA 2IA4A 4G2ZA 4XSXF 2RC4A 4R6YA 3HYIA 1QKBA 1FQEA 2F35A 4ZEDA 2DXRA 2Z99A 2YX7A 1L0OC 4HX8A 3RDIA 2UZKA 1OQGA 4PGGA 2RQPA 1LDDA 3PPPA 4LLLA 3VEPA 5KCJA 2AL4A 4Z7EA 3K9TA 3TEPA 2VGQA 2QS2A 3IHUA 1B4HA 1Y20A 4CYDA 4AIHA 2ZNUA 4LB5A 1S29A 5ELVA 2CG4A 3V5AA 1H9GA 2M45A 1MPBA 2H25A 4WEPA 3CLOA 3KJTA 2VD3A 3T9XB 2Y48A 3KP7A 4YFNF 2A69F 4IRHA 3TO9A 2XGXA 3O28A 1ZHFA 1O3TA 2CO5A 1BM9A 2F97A 3K6UA 1ZGAA 1F5TA 2P6SA 1LSTA 5I57A 1B3EA 1ZTYA 4P55A 4KPTA 3KSJA 4LQ5A 3ZMUA 2V3TA 1P92A 1B52A 1DPEA 5L3DA 4L0ZB 5HDGA 4JWOA 2WKYA 1U5TB 3JW4A 5BPIA 1MXXA 1B6HA 2GHBA 5D5XB 4WXDA 4R73A 3M9AA 3TOAA 3U93A 4LZ7A 2Z3YA 4HV6A 4EQ7A 2DTRA 4ESFA 3Q9SA 2O84X 4S04A 2ESHA 1S7YA 3TTRA 4DLDA 3I5UA 2D45A 1TFAA 2KJCA 2GFEA 2EFPA 1SW5A 4LK1F 4KYWA 2VT2A 4IO3A 1H76A 3TKDA 1GGGA 3K4UA 1XSVA 1ULYA 4RGSA 2NAZA 5I56B 1RZ4A 2BV6A 4BYYA 2P5LC 1VFEA 3R7XA 1U8RA 2PVUA 2Y7PA 5TPAB 4AB5A 5FD5A 5B7DA 1WQ2A 3PPNA 5L9MA 4IY6A 3UGWA 2PN6A 3I4PA 1FQCA 5K1YA 2RCBA 3ZMTA 1US4A 3SERA 4I0BA 2XUBA 3K1PA 2HWVA 1IN6A 4TV7A 2DPUA 4XLNF 3HOTA 4ZZLA 5ICGA 4MF3A 3IJOB 4XKQA 1K78A 4H0EA 4WX9A 3FJ7A 4BDQA 2Y0MA 3N4MA 4RAYA 2STTA 1S7AA 2EV0A 5FHOA 2EJRA 3QPHA 3FD3A 1QZYA 3M8FA 5L3FA 4MBPA 2F36A 1BI3A 2KIFA 1NH7A 4GOTA 5ICQA 4U21A 2HKXA 1QVSA 2XXTA 3SEWA 4ESJA 1IXCA 1N7XA 1B6AA 2MH9A 4I7HA 5HOOA 3R0AA 5DYHA 4R79A 3G3IA 4ZECA 2FNAA 4EJTA 3CO6C 4YICA 2AIXA 1UIVA 1I27A 1WWXA 2DAOA 2FE3A 1YTYA 3HTUA 4I09A 3GZGA 2VP1A 2XAHA 4GQOA 3JAMZ 2QENA 2QMWA 2XKOA 4QSCA 1N04A 3BKIB 3LUYA 4N0BA 4BHBA 3GFMA 2D21A 5E17F 4KDPA 3V89B 3I6VA 3TFLA 2CQKA 4LB6B 3IL2A 1H44A 1OMIA 3E5UA 4YG2F 1LBCA 1N3WA 5D5VB 1JEVA 3QOPA 1IAWA 3JZJA 2DW4A 3KEOA 2XX8A 2H9BA 3R4KA 2BJJX 3MPLA 4F18A 1BLFA 5EHSA 5E8GA 1GHCA 3C36A 3OO8A 1HKSA 2YR2A 4ASNA 3GW2A 2OQRA 5DEXA 2H6BA 1MH4A 2Y7IA 2VD2A 1PDNC 2D3IA 3HTSB 4RB0A 3CRBA 2XROA 4H0WA 5DVJA 4AVPA 3N6UA 2L4AA 1R22A 5CRYA 5ISUA 1PB7A 3IC7A 3JV9A 2ELHA 4XKPA 1VE4A 1Q1HA 1JVYA 4BDOA 1F4KA 1D5VA 3ISPA 4P0GA 3DEUA 3ABUA 3GBAA 2G7HA 2L3DA 3V83A 4RB2C 1AH5A 4K2EA 3WTUC 1HW1A 3T9HB 1XGOA 1P4WA 1R6ZA 3C35A 5E20A 2I0BA 3IR1A 2HAVA 3PUVE 5H6RA 3ML6A 2XVCA 4F3PA 4U1OA 1KU3A 1CB6A 2MD5A 3FVKA 1OYIA 3FV1A 1FT9A 4NF5B 1B5JA 3TYHA 4P0IA 2FOKA 4DIGA 2REGA 2ZYKA 5E1ZB 5L9OA 1LAXA 1Q35A 1GV8A 3O6IA 5F1QA 5KDTB 3IO4A 4ENNA 3PPQA 3CFZA 5J1DA 3EPEA 1SFEA 3M1EA 3W6JB 2HEUA 4LUBA 4LD5A 1KQ9A 1P6RA 4U0WA 4YIIA 4FEDA 3DF8A 3FWEA 4EF2A 4KD5A 4QFLA 2V6CA 3T8TA 4EV0A 3RTWB 5D5WB 5I2NA 1A7LA 1SMYF 4UXNA 3KSXA 2KKOA 2F6PA 4YB6A 1XSXA 1PDAA 1Z6RA 3GZ6A 3NEUA 4RB3C 2MLGA 1YTVA 3S2VA 4KUMA 4HTGA 3DP6A 4JBZA 1EZOA 4I62A 3GWZA 2OWSA 2IP2A 3G73A 2GXBA 2OWTA 4UVCA 3MBPA 5AONA 1I69A 1LBBA 2YX4A 3QYTA 2DQVA 4U2RA 2L4MA 3CG1A 4DCYA 2VN2A 5JVTA 3MZBA 4K3FA 2G29A 3S4UA 4H1XA 2Z8FA 4OERA 4KMFA 4YKIA 4ZDMA 1HXDA 3CVGA 5TP9A 5L9SA 5ICFA 2Q89A 2ZXTA 2X4HA 4LQ2A 3O97A 3IRRA 4BQAA 1RI7A 4L9TA 4WKMA 3MQ0A 4G8HA 3RUMA 3JTHA 2IRFG 2FBIA 4ND9A 3H3UA 1FP2A 1OYWA 2P5VA 3TAJA 1EH7A 1HW2A 3ODBA 1N0TA 3G3ZA 4UVBA 1K79A 2DSFA 4R6KA 4ZYDA 2NXOA 2LSOA 3L9FA 3FIRA 5ICTA 3SFZA 1PP7U 1O7LA 2CWEA 3EHUA 1EH3A 1M5BA 1NNTA 4LVQA 1Y4TA 1UIUA 3SESA 2ZO4A 2M8EA 3RYPA 3MP6A 4WEDA 2W84A 4O6JA 3LA7A 4ISUA 3REOA 1I6BA 4P5OA 1XDUA 4RS8A 3E6DA 5L3BA 5CYVA 4A6DA 3P9KA 5ITPA 5H8SA 1R1TA 2Q8KA 4OU0A 2O3FA 3MZHA 1UTBA 3FVNA 1R5GA 2IA1A 3LFKA 4HCWA 2OU2A 1JVXA 3WGIA 4ELQA 5ILUA 4I98B 3QSLA 4I2OA 5LGTA 3MWMA 1IUDA 5B70A 2WV0A 5TRDA 2M5WA 3AXFA 3MC2A 1OKRA 4MNUA 4NQWA 4C1TA 4IO4A 3UN6A 3TUSA 1RIOH 3MVXA 1USSA 4GL0A 1ZIUA 2HZLA 3VB2A 1ZG5A 3CSGA 2EWNA 4M71A 3GFIA 2ZMEA 3LSWA 2H94A 1VSOA 1FW0A 5L3CA 2E7WA 2I3VA 4OVJA 5A5XB 1SBPA 2Y7KA 2K4JA 3WGHA 3WE2A 5DEXB 5EHMA 3HHGA 1R1VA 4BDLA 1DOTA 2CW0F 1IF1A 1XB4A 4KIBA 1MY0A 1MPDA 4NF6B 1I5ZA 2Z9OA 3L00A 1VFDA 1B1BA 2HYGD 3FXUA 4IO6A 2DE3A 2GA2A 4PFYA 1BI1A 1D9YA 4H5GA 4QLCU 3SEYA 3K69A 4L9NA 4EQQA 3K2DA 3B6WA 2E1NA 3N97A 3WTZA 5DCMA 2LNBA 5KK1A 1PUEE 2PX1A 4KIFA 4GO1A 4FX0A 2HQ0A 2W7YA 3BFUA 3K1MA 1YW7A 5FD6A 3R6SA 2PBIA 4PCQA 4PFUA 3KP5A 3I71A 4EJUA 3KP2A 3BFTA 3E97A 2PQ8A 4ZYGA 4H8JA 3VXCA 1TQPA 4I0AA 5BQTA 3T9UA 2QQBA 1P4AA 4AIKA 3SEUA 3FM5A 1MDP1 4ELRA 2QJEA 4UV9A 2PLYA 1IW7F 1A99A 1FBUA 2HS5A 4ZEKA 2HOEA 3FZVA 2FA5A 1I6AA 4MGRA 4HF2A 4YMBA 1IN7A 1USYE 1LJ9A 2VOOA 4NMYA 1Y3PA 5ITOA 3R61A 1YPNA 1MKMA 2NUVA 4IO5A 3R26A 5CBSA 1G4DA 4THIA 4OFJA 3QU6A 1G3WA 2J5PA 2XASA 1SW4A 2M8CA 3EHSA 1IN5A 1MY3A 3H06B 5DTBA 1LB8A 2C6YA 1R1UA 1UHWA 2EB7A 3LQQA 3OV8A 2HXWA 3VLWA 3U2RA 1XVXA 4DZ1A 1J7KA 3TCHA 2P5KA 2X0LA 1B4AA 2JPBA 3TO6A 1URDA 3IOUA 4OESA 4RPNA 2HDCA 3E4RA 2XXXA 4POWA 3RN8A 2ESNA 1REPC 3HHHA 4AB6A 3PD8A 1MDMB 3SZPA 3U94A 3QUJA 1UQWA 2MH2A 3O6GA 2H09A 1XHYA 3KN3A 2TDXA 4ZZEA 4PZJA 3EHTA 2VODA 4QFNA 3S9EA 5DEQA 5H20A 3E3KA 4UA8A 1YW8A 4GCVA 3E5XA 4MLVA 1DDNA 1KWHA 2ETHA 3IOTA 1FTLA 2THIA 3OSRA 2BEOA 1QUKA 2CFXA 4EMSA 3TZAA 1ZLJA 2I4CA 2A07F 1SYIA 4ZEIA 4NHJA 4HLXA 5J6XA 3IL1B 4HA8A 2ZNSA 1JW5A 3JTGA 4GLIA 3FASA 3MWBA 1SD3A 1S50A 3T1BA 3CFLA 4EJWA 2GZWA 5AA2B 3K00A 2AXLA 4DQ2A 4UVAA 2DYXA 5K5RA 5HBCA 3HCQA 1F9BA 1R1NA 1FWZA 3O29A 2FBHA 4ZZDA 2F5FA 3I59B 3MPKA 5IKBA 5K2XA 4OFOA 3IWZA 3FV2A 1B3LA 4OMYA 2P7VB 4U1ZA 4RXLA 1FX7A 1URSA 1XGMA 5LHHA 3LBSA 1MRPA 3FVOA 1W4MA 1CGPA 1GVCA 4F1YA 1BIAA 4CHUA 1ZN2A 4F39A 2ZMEB 3K6XA 1JNFA 3HSRA 1US5A 2Y84A 3LA2A 5AA3A 1L3LA 4B8XA 2XRNA 5DUKA 5BUUA 1FZPB 5K5QA 1S3JA 3U72A 2A6EF 4OIOF 3MQ9A 1BIBA 3GO5A 3Q9VA 1XCBA 3OOPA 2FU4A 2EFOA 1SI1A 2ZFWA 1A04A 1KGSA 5AA4B 1OQHA 2OZ6A 2P6TA 3PUXE 2W24A 2DOJA 4L17A 2OJTA 3KEQA 3V4GA 2DVZA 3PFIA 1HKTA 3CI8A 4NEDA 3KLOA 2EA4A 2I49A 3EDPA 4GWOA 1Z91A 4NF8B 4UHTA 2DLLA 2XIGA 4F1UA 4GVOA 2GA1A 2EA2A 4G8XA 3PPRA 3IJXB 1GTKA 3ULQB 1RUNA 2ONSA 3FMSA 4R2FA 3GBBA 2UVGA 4ETSA 1MG1A 5FTIA 1DTZA 1IEJA 1LLSA 4OMZA 4WWCA 5CMMA 3AAFA 5TU0A 2FSWA 3GFJA 2IW5A 2HEOA 4FECA 3TCGA 3KZYA 3BWGA 4HS7A 2XKPA 2RKHA 1CF7A 3F8MA 4U0VA 5H8FB 4GGGA 3CUQA 4YKPA 1XSDA 3K6WA 4ZEFA 1S6LA 5BOXA 3RLFE 4FIMA 4RK2A 1B3HA 4CDGA 5D8LB 4QRZA 1B7HA 2QZ8A 2QL3A 2NNYA 2Q9TA 3RJPA 2BGCA 3PUYE 1BTJA 3OEMA 1MXWA 5H8HA 5CVVA 2M1BA 1OVTA 3T22A 2O6AA 1IXGA 5J8CA 1P1WA 3J81K 3EYYA 3PUZE 3F23A 1POY1 3PMVA 3SETA 3WTVC 2PT2A 2LDUA 3GFLA 5E1WA 1B0LA 5KZTA 2K86A 3I5OA 2M30A 3C3WA 3IO6A 5BPDA 1C0WA 1I1SA 2QRYA 4H67A 4F1VA 4MLQA 3IORA 4KYSA 2QBYA 3VV5A 2RVCA 2A5TB 1QZZA 5IT3A 3N5LA 4CXFA 4LZ5A 3U92A 4KI0E 1J0RA 5AA1A 1K6OA 4HOBA 3I3VA 4TOZA 4A5NA 3K0VA 1Z6TA 2B3BA 3USDA 3KETA 3C1DA 4EF1A 3ECHA 1ZH5A 3C18A 4ENJA 2HAUA 3ZKLA 5FHNA 4IPAA 3RGYA 1MY4A 1GXQA 1U2WA 1ZBMA 2F8DA 1SW1A 3TTLA 2DWHA 4F29A 3GXAA 1T98A 5JTYA 2Z8EA 2E7XA 2ZNTA 3MVYA 4F7ZA 3LSXA 1UTHA 2L01A 3PMXA 2HQRA 3JSOA 4G8MA 1M5CA 4N6PA 1Y3NA 5H8QA 3KCCA 1Y4CA 3COAC 5DDGA 3QP6A 1YFHA 1P1NA 3WTWC 1TWYA 1D3YA 5HLGA 2DK8A 3DQVC 4L0YB 1S8NA 1SD4A 2VE8A 2MC3A 2R7FA 2FNCA 1NHAA 3FXQA 5HDKA 1N7WA 5LLQA 3OO9A 2W25A 4IO2A 1NNKA 1XN7A 1MM7A 4KA4A 4EJVA 4KMUX 3TTNA 4XBFA 4BHPA 1QKAA 2Q8JA 1IN4A 4HQEA 1ZJLA 2YU3A 3B7DA 3U8QA 3LSTA 3QIMA 3IX1A 3T66A 3SXYA 3KOSA 3ZMVA 1R5HA 1SW2A 2UXXA 3CDHA 2ALUA 5L8DA 3P7NA 5D4SA 1G3SA 5F6FA 4LZ8A 2RN7A 1IXHA 3BY6A 5CVUA 4EM0B 4ZE8A 4G77A 1MJBA 5E8IA 2EFQA 3MCZA 2IT0A 1VR5A 4PFWA 3GZ5A 3KP4A 5HPQA 3TPAA 2K7LA 5J8FA 5I59B 2AL5A 2VOZA 1NKXA 2JT1A 3R0JA 2FRHA 3E9XA 3VFZA 2QS1A 4NB5A 5D5UB 4ESWA 1EZPA 3HSEA 2A68F 4DDDA 1LB9A 2F7CA 3BDDA 3LSFB 1M5EA 4YU0A 3BOQA 2F7AA
chains in the Genus database with same CATH superfamily
4WK8F 1QUIA 2JRTA 3TO7A 5HODA 2R6GE 3OSQA 4NF4A 4YZZA 3KOTA 2HKOA 2AXTC 5KCJB 2JTVA 3K6VA 3IB0A 3F0CA 3BJ6A 3ZP5A 3ZQ7A 5K7HA 1YIJI 4IQJA 3EKIA 3B6CA 2R7ZJ 5AIPA 4D0PA 1PBQA 3DTEA 2COBA 1WKMA 1T33A 2IPQX 5E3MA 3SHFA 4RMNA 3OYGA 1MDQA 4X1BA 3F8NA 1TQMA 1MXZA 4FEBA 2NS0A 3KE2A 5JLWA 1O7FA 1QULA 1LKXA 4MHGA 3DPLC 2M7BA 5FGMA 3SDGA 1WJAA 2KRFA 4S05A 3RQTA 1I6QA 1BBYA 1MQGA 3KC1A 2BBYA 2QQAA 4LG0A 4UUSA 1YAEA 4IGRA 4CYCA 3DU6A 2Q2AA 2HNHA 1FBFA 3LSLA 5CQGA 4N4UA 5KDTA 1JETA 1OCOH 1EV7A 2FHYA 2EFWA 1JUSA 5I57B 1R9LA 2WBDA 1T38A 1Q1KA 2GHAA 2JVGA 3RPWA 3L6GA 5LEKA 1R00A 1SAXA 2DMNA 3IP4B 3BTLA 1YS6A 1MQDA 1T0KA 1X3UA 3F8BA 3HRTA 1YW9A 2E36A 2PEXA 3ABMH 4NC7A 4XSZF 4AYBA 1ZGJA 3IH2A 2Z2SB 3WU0A 5FB2A 1J9IA 2DFEA 2AQEA 1YO5C 4E0WA 1K4SA 4NTLA 2DOAA 4M9SA 3OY9A 3J7AO 3IFCA 3X2QH 5EYFA 3Q27A 3K01A 5B1AH 3CP2A 2BW3A 5CKTA 2HFHA 2HTJA 1Z05A 3AG4H 2X1CA 3GBGA 4E70A 5E3OA 1SAUA 1AL3A 1YOVB 3I53A 1B7ZA 3W9VA 1TXFA 5GADJ 2IA2A 1R58A 4CZZA 4OVSA 3G1OA 2HDWA 3KEYA 4YEJA 1O3RA 3VDFA 2CUZA 2OQGA 3CHGA 3MZ1A 4DI4B 3RKXA 1OLCA 4A3GJ 2DK5A 2ZJQF 2V79A 4XK4A 4GWYA 4RAGA 1VQ7I 3ZQIA 4O5VA 1IGNA 1N3XA 1AWCA 3WE3A 4IOCF 1V5FA 4QIWN 3B6TA 4NNJA 4HCYA 1K9ZA 1W5SA 3IKVA 3HSTA 5F24A 5JK4A 3HRSA 1O3SA 5EYGA 2E1SA 4MFIA 4X9TA 3M8EA 3DKWA 1TBXA 2NNNA 3S16J 3H6WA 3VYRB 2B0LA 1IN8A 2P3NA 3TP0A 3R60A 1GDTA 4ZDPA 4NBQA 1JGGA 4U88A 5JHUA 2PG4A 3RPLA 2EK5A 2ZZXA 3E6BA 4A5MA 3UIFA 3DWLE 4MQVA 4EVIA 1H43A 2FYIA 5H6QA 2R7OA 2A5SA 2DFIA 5IZ1A 2VB6A 3QAXA 4QSEA 1BIYA 4ZS9A 1EYJA 2ZXJA 2LREA 4XOPA 1BI0A 2O8XA 3H6TA 5J4VA 2D1VA 2Y75A 1KU9A 1TNTA 2E2IJ 2QVOA 3HC7A 3FMQA 4OVTA 3NWTA 2CZLA 2QM3A 1NH3A 1LPQA 3FXBA 2E35A 4BEHB 5JTYB 1W7PD 3W2WA 3OR2C 1Z7ME 3G3KA 3TODA 2E0SA 4P1WA 2HQNA 2ZSIB 4A0ZA 1A8EA 1TT1A 1SYHA 3IWFA 5CC2A 2WYPA 3FBPA 4M4GA 1JQFA 1K78B 2K9SA 4ZE9A 5AIQA 4DNCA 2QSXA 4JX5A 2UVHA 4PE5B 2VQGA 4BGDA 3ZPLA 2E71A 2E1MC 3PNVA 4NWCA 4ZYEA 2I0CA 3DBHB 2Q8MA 4PP0A 1ERDA 2MBFA 4E7ZA 1B9JA 3W6KB 3WTSC 4KFQA 3FBIB 1XDSA 3Q29A 3EYIA 1UMQA 4DZJA 1O3QA 3G71I 3T96B 3J81Z 2GRVA 1Z3XA 5I58A 2HFBA 3LC8A 3H9GA 4MQ9F 2DE2A 5LGNA 4LLGF 5IZ3A 4UACA 3GTPJ 3MN2A 3G1LA 2IA0A 4PFPA 5D6FA 4HNUA 1TZLA 1JUPA 1JP4A 4PBHA 2UVIA 3VYSB 2ZYNA 1FTKA 4XEQA 3WU1B 3AKZA 1B05A 4BQOA 4I40A 3O6HA 2BE5F 3H3ZA 5L3EA 1EU8A 4N9IA 3U1OA 3HRUA 1B5HA 3TW7A 3MJNA 3VOEA 1B5IA 2R71A 4XF5A 3TTKA 1BI2A 1A5JA 1MJ9A 2WY7Q 4BHCA 4JSDA 3H6UA 4E7HA 1JHHA 5FFXA 3W2AA 1IUYA 3TQWA 5ILSA 1WGXA 4M9ZA 4OZ9A 2F5XA 4IHWA 1FJ6A 2D5WA 4AS5A 1O63A 4KJZA 3FXJA 3IAM2 5BNGA 3CUOA 4A3FJ 3MVZA 2WBMA 3T5XA 1LFBA 5EZGA 1L5TA 5CVJA 4F31B 1DP3A 3K1NA 3IRQA 2IEEA 1SEUA 3S1NJ 3NWSA 1PYVA 3FVGA 1QPMA 3HUGA 3OIPA 4OAYA 3V7SA 4B4CA 2V93A 2M87A 2RQQA 4M6YA 4BE2A 1IITA 3DXJF 4EUOA 2AS5F 3E79A 2H5YA 3KYCB 3SFIA 2DS9A 2JA5J 1QVTA 1WJBA 2XWKA 3MZ9A 3M1CA 2ZBKA 4G7ZF 1B1HA 2Q88A 4BY1J 3K02A 5LRRA 3MP1A 2EZHA 4FISA 4I6ZA 1RETA 1FTOA 3OYAA 2FX0A 1LBWA 3WHCA 4POXA 1LEAA 4OWRB 3ZN1A 4XFEA 1KYWA 3IKTA 5EYRA 2FBKA 2WAQN 5F7VA 3J7ZI 2MABA 4OXVA 3C7JA 2VKDA 3O3KA 1NV2A 1WODA 4OINF 1PP8F 3A02A 1M1EB 1EJ9A 2O68A 4II2A 1G3TA 5J16A 2G0EA 4M72A 2E1CA 2VJIA 1LQ1A 4O3BA 3OYBA 1J5YA 4YRVA 1B46A 2Y5LA 1BN5A 4Z0IA 3TKYA 3KFMA 1HQCA 3KPHA 1H9TA 4XTCQ 4G68A 5K2YA 2QWWA 2NRAC 5I2KA 3F6OA 1K7AA 1SD7A 4N13A 4LG0B 3GCMA 2B4LA 2DFHA 1FPQA 2W4SA 1XMXA 2EIMH 1FLIA 3KX2A 1NV1A 3G1MA 1T6SA 4NUBA 2KL4A 5J47A 2WV1A 4KT5C 1JGSA 2XAJA 4MEXF 2GIVA 2XAGA 3D0SA 1MGTA 3CF5F 4I3YA 1F9NA 3P9IA 5CQEA 1H0MA 4BNCA 4YB5A 2ZXIA 4WXCA 1MW7A 1Y1MA 4KR5A 1M5DA 4F19A 3Q0VA 2R0QC 1POTA 4GBWA 1XMAA 4P8BA 3HM5A 3OYJA 3RKWA 1V55H 4N9HA 5CMKA 4MNPA 1ELJA 3K0LA 1YG2A 4JVIA 3I4MJ 1DPUA 1AOVA 3KP6A 4QWQA 5JI6A 1JW1A 1IDZA 2HPGA 2BW3B 4OIQF 4FETA 1ETVA 4GXSB 1MMDA 2P2AA 4GRKA 1DPRA 3O9PA 2EIKH 2OBGA 4JWXA 3IB1A 2ZNYA 2JA7J 3GF2A 3IUOA 2MSYA 3UR3C 4IGTA 4PGPA 5EG0A 2HI3A 4P56A 3CFXA 2UVJA 1JXSA 2UUZA 2V1XA 3E6CC 4IRIA 5I2NB 4WCGA 3KJ7A 4FORA 3RQIA 3TP3A 2FF4A 2ZZVA 2G7UA 2DU9A 3HPHA 4BXXJ 2PFYA 2UYEA 3G3HA 3QK6A 3BR6A 4DYCA 2LH9A 3BR2A 4MHFA 3NQOA 4EEFG 1R23A 3AG3H 4J01A 2NOJB 1Y0UA 1P4XA 3FXKA 3KFWX 3NARA 3D4GA 2LKPA 4UNOA 3M7GA 5FLMJ 4EGYA 3L7WA 4HYEA 5FKNA 3GTOJ 3ASNH 4UUTA 1YIOA 2OAZA 5LRSA 4ECFA 4H8IA 3G3FA 1ZAOA 2QEXI 2DPDA 4KIGA 3RPUA 2R7UA 5LHIA 1FBQA 4L5JA 2ZSHB 1J75A 1B51A 2B3FA 3RPLB 2WEFA 2OJED 4R9FA 2DXYA 1JE8A 1UB9A 2HGCA 3IH3A 3S2HJ 5HDNA 1LFIA 2E34A 2XHDA 3ZKKA 1HDDC 5FLXK 4FX4A 4FAJA 3H1CA 4LLNA 2R7WA 1LGBC 5I7IA 4HX4A 3WGGA 2CMOA 1OLTA 1RC9A 2HPMA 1BR1A 4XRFA 3HOYJ 1U5TA 1CNQA 1RKMA 3QAHA 1LAHE 1T8IA 2JJKA 4LP2B 2K85A 4JQFA 5TP9B 4O3AA 4CCMA 3EETA 4LOCA 5D6EA 3SQNA 1B2HA 1S9TA 2CSOA 3PIOF 1PEBA 4XXUA 1D9VA 4B3AA 1DCUA 5D8KB 1FSHA 1FOXA 4C9YA 2PT1A 3V8KA 3BPXA 3Q25A 4PFTA 3T9VA 4BQNA 3OENA 4Q47A 3RI4A 4NHBA 3F72A 1ZRCA 1N84A 2CQQA 2K02A 2DVCA 4U22A 5IP7J 4PETA 2JZYA 1JHFA 3CCQI 1OJLA 1U9OA 2YSRA 1BP5A 4YFXF 1MIJA 1VQMI 5D4RA 4I01A 3CO7C 2XD2A 1EF4A 3VODA 4JBAA 4AYBN 4P9KA 2XAFA 2Y30A 3ABTA 2B7EA 2A61A 1WVRA 1P1QA 1YRNA 1HSEA 4U4SA 2XXWA 1IUFA 2BY3A 2OC6A 2VC0A 4P96A 3PO3J 1D4NA 5CMBA 3DLNA 1OCZH 2RDPA 4IY5A 1JJ8C 4QBAA 2DQLA 3UK4A 5I56A 4HX7A 1TWAJ 5LOMA 1FBCA 4PSWA 5F08A 1FPFA 2PMUA 2YPRA 2XXQA 2P0SA 4KN4X 5JR3A 3RY3A 3AG2H 5M5WJ 3S3NA 5TPAA 1MQIA 2V25A 2DMTA 3LWFA 4F3GA 2DOEA 2YUSA 2WC2A 2NVYJ 4P9FA 1GR2A 1MJAA 3F3XA 1H88C 3ILUB 4EQ9A 4N91A 4BDRA 4L18B 1Q1VA 5DD4A 3JRDA 1AA7A 4KICA 1G0HA 1A54A 3QPTA 1UTBB 1SD6A 3THIA 3OEKA 4QSDA 3TTMA 1XMKA 2Z1DA 3L2WA 2REJA 1W7PA 3PGFA 3ROUA 2DA6A 2XXRA 2E1MB 4B47A 4AQ4A 4HEA2 3ZRGA 1YS7A 2AYSA 2VT3A 4JX6A 4KITB 1RUOA 2FIEA 2IS4A 2Y7RA 2XAQA 4OHNA 1FOKA 5CBRA 4HPQA 1Z7NE 4FTHA 2GXAA 2M34A 4M73A 4TLMB 3S3OA 4CGZA 2FA7A 1ON2A 2VI6A 1UJ8A 1Z7UA 1MXVA 2WBBA 2JUGA 5J1YA 2HTSA 5HVQC 5EQ9A 4BXFA 2DDAA 2ZC2A 5HLHA 3CCVI 3D4CA 5LEJA 4O7MA 1LBYA 4R72A 1NL5A 1E2XA 4ZEBA 3H6VA 5EQ8A 3IOVA 2XXIA 3R6UA 4G9YA 1EZ9A 1VQLI 3TQLA 1RDXA 2V4CA 2W85A 3TL4X 1MD0A 2RV8A 4F2OA 2O03A 2DT5A 1OPCA 2XF7A 3GUDA 4BLAA 3WTTC 4OIPF 3BG3A 4LIVA 3PPOA 2W57A 4R2BA 3UORA 4DCXA 4KYEA 1AU7A 1A8FA 3U1DA 3LR1A 2Q2CA 1BOAA 2BVLA 3RZDJ 4HDVA 3KEIA 2EFNA 1SVOA 1LFGA 3JYRA 3ROJA 2EBIA 1AWBA 2WWYA 4F52A 4GFRA 3VLUA 5H8NA 2JWTA 3T93B 1TQIA 1Y4TA 1AKHB 3ZQFA 1DUXC 3M3KA 4OIRF 4HSRA 1OMPA 1PB8A 1YLFA 2R93J 1HC8A 1LFPA 2RC9A 2OD5A 3QP5A 1WVJA 1J59A 4PGHA 2GQQA 1A35A 1TWGJ 2KT0A 5E3NA 1TL8A 3K6GA 4C2MJ 1P99A 1BJAA 4XKBA 2BYVE 2K4BA 2QS3A 3MP8A 4KCDA 3F8FA 4Q0CA 3A09A 4UB6C 3QOEA 1KU2A 3CUQC 4GF8A 3U9GA 5I2KB 3CCSI 2XXHA 4XMYA 3H35A 3MAJA 3RKYA 1DMBA 3D5LA 3A1YA 5DCMB 4BU2A 1YQAA 1SDXA 1BL0A 4IVNA 2WTEA 2RCAA 1XPXA 3L2CA 4HV5A 2YJPA 4W1UA 2MGQA 3TGNA 4Q5SF 1IMDA 2LTPA 5BWJA 1ZMGA 5JFRA 4RA2A 1M5FA 3I0TA 2X6OA 4EM2A 1O57A 2UV1A 2STWA 1D0YA 4ESBA 2JPCA 1UFMA 2FEZA 1Y1WJ 1BC7C 3HRMA 4MX6A 1JTXA 2XX9A 1B32A 2HCAA 3KLNA 1SFKA 3CJRB 3A3CA 3EPZA 4MMPA 1X3WB 1FSEA 3DFGA 1RYOA 1HSJA 3TTRA 2DWJA 2P7CB 3C2HA 2ONRA 4FJPA 1E3HA 4AIJA 4L5IA 5C3EJ 2I10A 2RNJA 3GVAA 4JX4A 2V1DA 4FE4A 4I76A 5DCFA 2NVUB 1YJ9I 2DA3A 2PJPA 1NV3A 4MJOA 5DVFA 2H4IA 1WDNA 3RPQA 4G6QA 3VSLA 2QPQA 2FNPA 4IRGA 1KU7A 4WXJA 4BAYA 4PDKA 4EGZA 2BVMA 2FOWA 2VC1A 1SMTA 3QPLA 4MTEA 3MKZA 1ZRDA 4N8YA 4U4XA 3H5NA 2GH9A 4FE8A 3KZZA 4U7DA 3B6AA 3N94A 3H3GA 4KQPA 4AC0A 4OTEA 3LMMA 1FTMA 1HSTA 1IDYA 2I48A 3Q28A 1MQJA 4H6DA 4GXOA 4ELPA 3S1QJ 2MA3A 3HN0A 4A3DJ 3IH4A 4FCYA 2M0CA 2LFBA 3U21A 3GTKJ 4ONYA 1UCRA 2L7KA 4NF5A 3BTIA 5DM6F 4DXCA 1MS7A 3FXLA 2W00A 4N17A 2JRMA 1A31A 1S7OA 2XF6A 4RY1A 2KLFA 2XXVA 4OENA 2Y2ZA 4Y3OA 1NUYA 3L2RA 4ON0A 1B4ZA 2AHQA 1FTJA 1ZREA 2ZKZA 1JT6A 3QPSA 2HDDA 3AL0B 3C32A 5AE4A 1I1GA 2VXZA 3S9LC 4HZFA 4GFBA 1QW0A 2D2WA 3T0YA 4MFDA 4I8CA 4JVDA 3S2WA 5TGTA 1D5YA 3HDDA 1JEUA 4PJLA 2KJBA 3ECOA 5B3SH 1TW3A 3HO7A 4JXIA 4NX1A 4KYDA 3E3VA 3CJTB 3U1KA 1SFXA 3I54A 5ICCA 2VOPA 5FFZA 1QZEA 2JUCA 3MAMA 3V7CA 1LEBA 4N4NB 2E5NA 1POGA 1R7JA 4PF6A 1JTYA 1DP7P 2MC4A 2XA5A 4EM1A 3OYFA 3JRFA 1O4XA 3OD7A 1Y0NA 3W15C 2R3SA 1DU6A 3CCJI 4ZDLA 3LUZA 1GVJA 4JDFA 3QYEA 4XKNA 3KP3A 4Z2YA 3OELA 2DI3A 5CJ9A 3BROA 4YKJA 1BOBA 3GLXA 2MG4A 3HOSA 3TEDA 2LY1A 2O0YA 1TFDA 2DE4A 1BW6A 2V3UA 1UELB 2IJLA 2CRGA 2KIQA 2CQNA 1Y56A 2LF7A 2DYSH 3BZKA 3TDUC 2XWVA 4RK9A 3I56I 2CQXA 2VPOA 2B65A 3RQ4A 2M0MA 3A3UA 2XX7A 1MXYA 4L9VA 2Z5UA 4EXLA 1ZKBA 3F6VA 3TMOA 1SQYA 4L9JA 4HDUA 4HBLA 2VE9A 4HF1A 5C44J 4Q5TA 3B73A 4H65A 5KNLA 4N15A 4PAKA 3LQRA 2L7FP 4G8NA 1Y6IA 4X1DA 5DVIA 3S17J 5AA2D 1E0EA 2EINH 4CO8A 4GD5A 1BK4A 2WAFA 3ZMZA 3V8LA 5E3LA 1GV2A 2HOAA 2V9VA 3OMYA 1IXIA 1ANFA 3FISA 4A2UA 2HPIA 4RM3A 5ICEA 3L1PA 1LCFA 2Y5KA 2YLNA 3C9HA 3GTJJ 2H6CA 1ZG1A 3PMWA 2K3FA 4JYKA 4A3IJ 3W3CA 4IO9F 1B59A 1IXSB 3EUHC 2CZHA 3VFJA 1X1DA 2F48A 2FMYA 1W7PB 2L9NA 4HSTA 4DOZA 5DD8A 3SEZA 1V3FA 1B1XA 2OTLI 5E1XA 5LGUA 4R74A 3HXLA 1VTNC 2CW8A 2YU9J 3FXRA 1G0IA 2FUG2 1KYZA 1S9HA 1X4PA 2DA1A 3H0GJ 4HF0A 1P1OA 5FROA 4F22A 2COMA 5FLXZ 1XGSA 1T2KA 5F1RA 5GTHC 1ETWA 1K4TA 4RYAA 4YB7A 4DYQA 2XGDA 4OVQA 3OWTA 2DA5A 5K5OA 5B1BH 1XTAA 6PAXA 1B58A 2OK2A 1Z67A 4XOTA 4R8HA 1II5A 3G3GA 3KN8A 3U65A 2XAUA 4GYIA 4XLEA 1KZHA 4XKCA 2DN0A 1FTZA 1FCKA 3O2AA 3W6VA 3H92A 1FYMA 4OQOA 2CV0A 4ZZAA 3TOBA 4A6EA 1QHHD 5DUIA 3E0JB 2F6GA 1ZR2A 1NFTA 3EUHA 2R7RA 4RJZA 1R49A 3RT8A 4XICA 3F9KA 3BPVA 1ITYA 4R6HA 5CM6A 4QSHA 3CC4I 2JMWA 2A3SA 1WFXA 3H7MA 3QUFA 1X1CA 1E3OC 3E78A 5H8NB 3FIWA 3PFYA 2OLBA 3OOAA 1E17A 4QF9A 1A6IA 2DO7A 5IOYA 1OISA 2L7ZA 4LK0F 1LDKB 4P9UA 2CYYA 4LFUA 3DP8A 2ZYMA 1JKPC 1Z9CA 1A40A 4XQFA 2B63J 3TELA 3GXOA 2KQRA 2QS4A 1INPA 5BMZA 4E4HA 3DV8A 1XG1A 2GAUA 3J80K 2V1UA 1XT8A 2XHKA 1VQKI 3L6HA 2HVSA 2O61A 3FGSA 3CTAA 3HSFA 2V9PA 3ZN0A 2EZKA 4TQUQ 2RKMA 1N76A 2HVRA 2PMSA 1WPKA 1SD5A 1YX3A 3TMGA 4PJNA 4WF2A 3PTYA 3AG1H 4UUVA 2O69A 5ERIA 3VYTB 4IOAF 1ONVA 2PYYA 4GWZA 1DK4A 1XVYA 3MVWA 3RCOA 1FPLA 5CMCA 2GLOA 2VONA 2TRTA 1FQDA 2DDBA 2JK3A 2OZUA 2HQ5A 4YKKA 1QO0D 1CE2A 4Y15A 5M5YJ 3C33A 2GXGA 2ISYA 2AQFA 4GYGA 3FHZA 4QFOA 5A5XA 2ADUA 1U6GA 4M6XA 4YAHX 1WI9A 3M8UA 4BDNA 1IQ7A 4A0YA 1OIBA 3KBZA 3FMRA 4I1DA 3FM3A 3M8JA 5A5LA 3OO6A 4G4PA 2KRHA 4DGWB 3BG6A 3BJOA 4P1LA 4JWYA 4DXUA 3HJEA 2V7FA 1CF7B 2F4IA 1FQAA 4OWDA 5C4XJ 4JB7A 1B40A 4NF6A 4XLFA 1W1WE 4MEYF 3CUQB 2I3WA 2P8TA 3VDXA 3NRVA 4MH5A 1UHMA 2VBWA 2W82A 3JRBA 4U23A 3RPUD 2QKMB 3RKQA 2O6GE 3M3LA 4XKVA 3W9WA 3K2ZA 1S7EA 2O7OA 1Z0XA 2M4GA 4F3SA 1NG7A 2VBXA 5FKKA 1SVLA 2X48A 2I6EA 3MW0A 1F43A 2E1OA 4X48A 3RTRA 4QHQA 4OEUA 4XNFA 3BG9A 5H8HB 4HW0A 2Y9YA 2ZMBA 1NV7A 3VLVA 4DE8A 3S9MC 2O7IA 4IF4A 3H03A 2DP8A 1NH8A 1ZRFA 3K70D 5JEIA 4KCCA 4GXAA 4RGRA 1ODDA 3PV0E 4LONB 3LSPA 3SEVA 4IHSA 2XSDC 2Z8DA 4IHTA 4Q48A 2QYOA 5BS6A 1OYYA 1W36D 5ILVA 1PUFB 2R7SA 3G2BA 4D9JA 3RIRA 2HZKA 2F5DA 2F6CA 5F27A 2A5YB 1FYKA 1MZBA 4N6DA 1MMSA 3DEWA 3FDYA 3KIOA 3LSIA 5TJJA 2X26A 2G93A 4NE4A 2R5ZB 3A01B 1QQIA 2VT5A 2OCCH 2QSFX 2JSCA 3FF5A 2QBYB 3PQJA 4LATA 1NNPA 2D1HA 2Z22A 4U87A 2L54A 3VXBA 2NYXA 1FOWA 2KDOA 2IAIA 4PCDA 5GTIC 3FXMA 3H36A 2K40A 5M3MJ 2XV4S 2LP0A 1VQ9I 3GTMJ 2FQ3A 1MXUA 3K4KA 1D8JA 1OLAA 1H3DA 1RKWA 4X6AJ 3OMBA 5IM2A 1LFUP 1DSNA 3SZTA 1VI0A 3TDJA 4GX6A 4NDLA 2XXYA 3CP8A 3PU5A 4M3GA 1OR7A 3RT6B 4CCLA 3F8CA 2M8GX 5DW8A 3K2AA 3BG5A 5EGOB 3V8XB 3OO7A 5ED4A 2ID3A 1VZ0A 4QTRA 2XXPA 4FT8A 5DV5A 1VQ6I 1B9NA 4C3JJ 2JA8J 1YCJA 3H4ZA 2LG4A 1LBVA 2P3VA 2HZDA 3SDFA 3CG3A 3HHFA 2FJ1A 4JSOA 1IIWA 2LF8A 3SZGA 1APLC 4LJZF 2O51A 2KRCA 3TDZC 1IJWC 3GEZA 4L5EA 1UTHB 3BT9A 3MKWB 4KNYA 3OSGA 2N8GA 2MKZA 3I4NJ 1FBSA 3OOUA 5HS9A 5A2QK 2Q2EA 4G6TB 2OTJI 2UXAA 3E13X 4ZDOA 3DEEA 2X1DA 4C2UA 1SFUA 5IT9K 4F3BA 1ON1A 2L02A 1FBPA 3CSBA 4CICA 1S5LC 3JRGA 1N75A 4OETA 1MDMA 1FNNA 5HLIA 2ZYOA 3BP8A 3FUZA 3K4JA 2VPLA 1LEVA 1J2XA 2X51A 1LNWA 4OOIA 4XR6A 1WSUA 2UWMA 3UP9A 1R9QA 3EF7A 2W7NA 2PFZA 4PJMA 2HVQA 2LAOA 4KISA 1FBEA 3KG2A 5HS7A 3PL8A 5C4JJ 4O7IA 1P2FA 2FXAA 1NUZA 2NS7A 5FTHA 1OCTC 1TNSA 4E7KA 2ANJA 4P11A 3P9CA 5M2VA 2EZIA 1LE8A 3BIHA 1JJ6C 3ZS6A 5HLTA 3WAEA 4U7BA 1MY1A 5IYBJ 2UYFA 1ZU0A 3MUQA 4IB2A 2VBYA 2DQRA 3HOVJ 4RDUA 3LAJA 3WG7H 3CCUI 1FOYA 4N07A 4G6DA 4M3DA 2HOSA 2EV5A 4A3LJ 1ATGA 1O7TA 3O8GA 3PNYA 1QPIA 1XOCA 4GWUA 3DP7A 4Q4ZF 4M9XA 2IGNA 2YPNA 1LAGE 3PQKA 4Y4RA 2X7QA 1UG2A 1HDPA 1X2MA 3OXNA 3ONMA 2R7QA 4Q30B 5AA2A 1XX5A 2H98A 1WI3A 3H0DA 2HXRA 4HLYA 4IHYA 1PB9A 4P1EA 1QJMA 3RTFB 4DJAA 2MLKA 1KQ8A 1BW5A 4N4OB 3DLLF 1LAFE 2VASA 1DGRM 2PMHA 4RNSA 5F64A 3QRFF 3BJAA 2VLAA 5IGAA 2E2HJ 4EXKA 3ASOH 5FO5A 2KMUA 4BXUA 2GOMA 1WH5A 1Y3QA 2V4JC 2VXDA 4G68C 3I59A 1O64A 2PI0A 1D8KA 1B8IA 5E18F 1ZR4A 2GWRA 1QBJA 5J1UA 4FHTA 1QNTA 3WTXC 3KGCA 1A55A 3H9JA 3V42A 4OYVA 2G9WA 3SDBA 4M6VA 2CV2A 3FK7A 5EF6A 2DWAA 4IXAA 3BQYA 2ZJ2A 3GX4X 4O3MA 1FQFA 1MY2A 2I4BA 2XXUA 2KIMA 4NF4B 2NWJA 1QGPA 1WJFA 2HXOA 2GBYA 3G7WA 4BKXA 4G7HF 5EEHA 2CS3A 1NK2P 5I84A 3WTYC 5LBQA 3RNNA 4RPOA 3WG9A 1TW2A 2O1LA 2O1MA 1NG6A 2QUFA 2OV7A 1MBFA 4LGWA 4M3FA 1LDJA 1BC8C 1KQ0A 1IZ1A 2ABHA 4JK1X 4GWXA 4QPQA 3BBRA 1URGA 4S0HB 1OCRH 2J5OA 2O7UA 5IAIA 1HBXG 1ZELA 1YHQI 3P7IA 3PD9A 3E7LA 4M3BA 5K7FA 3N6TA 3I55I 1FQBA 2ZCWA 2P1SA 4OEVA 2CUEA 1SI0A 3UA8A 3IV5A 1XC1A 3BZ6A 4KN7X 2H99A 2PCRA 1FC3A 3A4CA 4UUSB 3IK6B 4JVCA 4G94A 4CYCB 3Q26A 4RGUA 3F22A 3WAFA 1ZLQA 1R4NB 3ZMSA 3GLBA 3IAZA 3SKPA 5AA4A 4U0YA 1W5TA 3DTKA 3I64A 3Q3SA 4PSXA 4PF8A 2X9DA 4HAMA 4XLPF 2DMQA 2LRDA 3ZQQA 1WRJA 2Z33A 1NMUA 2QVUA 4Q8RA 3IOWA 1FMWA 1XD7A 1GT0C 3GTQJ 1TLHB 2QMXA 3FX3A 3PUWE 1XGNA 5DYMA 2DT6A 3DPTA 4B09A 2MW8A 4F2QA 2E19A 4RAZA 2HQAA 1B9MA 3ELKA 4A12A 3DP4A 4NF8A 2H27A 5EEGA 4A0XA 2Z23A 3V7RA 1NK3P 3DM0A 4YMAA 4I99C 1XCVA 4O3CA 2R5YA 4BUPA 2QQ9A 3I58A 4BBSJ 1AMFA 1DPPA 2K27A 2E2JJ 5E79C 2DTZA 2ACJA 2ICWG 4HW8A 2NOOA 1RESA 2QVVA 1U5TC 4RGXA 2QSGX 1NUXA 1LB2A 1YXIA 2F5EA 1HKQA 4AU7A 3K70C 3K4MA 4TLLB 4EQBA 5FKLA 1AOYA 3HEFA 1B72A 1IRGA 4RB1A 2DBBA 4P47A 2XD3A 3M3YJ 3J80Z 1V4RA 2JQ7A 3FJMA 1HW5A 1I6XA 2VQLA 2ZB9A 3N05A 1W36C 2JN6A 4PAFA 1B0HA 2EH3A 3FBNB 3S1RJ 4I02A 3LAPA 4LA9A 3C4MA 3O66A 4Y17A 3WU2C 1BKAA 2A5WA 4R9GA 4BDMA 3W2VA 2X7PA 5H8FA 1YJNI 3CC7I 3KZGA 1F1ZA 1FYLA 3B50A 2R9JA 1YYVA 2OBPA 4DZPA 5FLVA 1SANA 2DMPA 1ZG3A 4IKFA 3GLLA 1B7UA 4NWDA 1MM6A 3N26A 1RNLA 3ERED 4X1EA 4YIFA 1J1NA 4HQMA 4BH9A 4RA1A 1RR8C 1EH8A 2R4GA 4Y7NJ 3PUFA 4F91B 4MAGA 4KFCA 1G3YA 4QFPA 1MNEA 5LD2C 3Q5FA 3HPIA 1TWHJ 2RC8A 5FHMA 2HYFA 3V8JA 3G3JA 1CQTA 1TTYA 1T39A 1NNFA 1Y9UA 2R92J 4M74A 2OZZA 2DODA 1KA8A 5FKMA 4HNTA 1PC3A 3ECRA 2OCUA 3F11A 4IO7A 4NG7A 4DXBA 2PFBA 1JW4A 3HOXJ 2K9NA 1Y1ZA 1X19A 2HR3A 3EQ1A 1FP1D 1LVAA 2FMLA 5F1JA 2OA4A 5GAHJ 5HM4B 3O6BB 2JJ7A 2LC2A 2F7BA 3MKLA 3KN7A 3CJNA 1B3GA 2Y7WA 5HNHA 3FJGA 1U8BA 3M3FA 3ZSFA 4E0XA 3HPGA 2V3QA 4OFLA 3LSHA 5LHGA 2F5VA 1Q9DA 2I58A 2HXIA 4EJOA 1GXPA 2RF1A 2RINA 3CIJA 5CLSA 2L5QA 3ABLH 2UXNA 1GV5A 3JAMK 3GYHX 3UNGC 1U3EM 3AFHA 1PBPA 1T0FA 2K5CA 2R7DA 3TQNA 2B4MA 1JUMA 3JCUC 1ZARA 5L3GA 4M1VA 4CCKA 1FPJA 5I58B 2RREA 4C1UA 1USYH 3E5QA 1Y8RB 5IZ3B 1DTGA 1IXRC 3EN3A 1RYXA 1OCCH 4CCJA 4C30A 3IB2A 2BY0A 2P4WA 2KIUA 4HXVA 1NV6A 3S9NC 1ETYA 4XKRA 1ZLKA 1U0JA 3F21A 4PQJA 3SEXA 4E7SA 4XRSG 2LKXA 4A93J 3L09A 4CZCA 3LA3A 4XLCA 2A6HF 1XS5A 3VVDA 3KC0A 2XWOA 3WODF 2F78A 2VBZA 1MPCA 4WXHA 3MZYA 4XORA 2ID6A 1HF0A 4Z6YA 1QGXA 2ISZA 4C0RA 1B3FA 1D3KA 4ZH4F 2K9LA 3RYRA 1H45A 4OMBA 3O2PE 2QGUA 3OS0A 4D1QA 3CR9A 3HOUJ 3C34A 4G7OF 3B6QA 4XIGQ 1LFHA 4ENKA 3QU3A 1P1UA 1YITI 1ZYRF 3DELB 2Q0OA 2XSJC 4MNCA 4QFKA 1STZA 1OVBA 5EDNA 2V84A 1UZCA 2LBFA 2EIJH 2ELKA 3EUAA 3OSFA 2RC7A 2K9MA 3KYDB 5FBPA 1SC7A 4Y13A 2LK2A 4E6KG 5KHDA 4ESXA 2CGPA 4H5FA 4ENMA 4R75A 3HUGB 4LMYA 4MFEA 2DWIA 3OS2A 3VE1B 1MH3A 4MTDA 1G6NA 2VHAA 2ONKE 2ME6A 5KVRA 3EQLF 2QSHX 1MQHA 3FATA 2RGVA 1A36A 1GUUA 1YZ0A 5ET7A 2Y69H 1QRYA 4GIZA 5M3FJ 2F2EA 1U78A 4ELOA 3TCFA 4LIUA 3OYEA 1I3AA 4AIDA 3MFKA 4NF0A 3QXMA 4UV8A 2QLZA 5CVRA 5A2QZ 2HZTA 3B02A 1FY7A 2P81A 1SVXB 5TISC 4BJTA 1HSLA 4EDPA 4AD9A 2CEYA 3CDLA 1FEXA 5IT9Z 4AWXB 2CH0A 4GL8A 4ZYHA 5DM7F 4A69C 4KHZE 3KBRA 1IRFA 1RRJA 1LCTA 4R1HA 3VVEA 2F34A 3CMEI 2DT7B 3ILTB 1FPEA 1AIVA 3HIFA 1OFCX 3MVPA 1USTA 2CUFA 4I9DA 4G68B 2M7AA 4IL6C 1EH6A 2EV6A 1R36A 2JVHA 3JSPA 3HV1A 5CI5A 1JKQC 4IJAA 1Z1DA 4IHVA 3VVFA 3T8RA 1VF9A 4YFKF 1EA3A 3NAUA 5HS8A 2QFLA 2ZNZA 4PTKA 3ZMDA 5I59A 3E6MA 5CVIA 2F5CA 4FATA 2PX9A 3MEXA 2IVMA 2PBWA 2IA4A 4G2ZA 4DIQA 2WB1A 2RC4A 4XSXF 3HYIA 3HG9A 4R6YA 4XL9A 1QKBA 3D5RC 4NN3A 1FQEA 1LBZA 2F35A 4ZEDA 2RAEA 4MO7A 3CQZJ 2PJRA 2R8TA 4CA0A 1ORKA 3BR3A 2DXRA 3VWBA 2Z99A 2NVQJ 2YX7A 1L0OC 4HX8A 4PJJA 3RDIA 2UZKA 1OQGA 4PGGA 2RQPA 1VQNI 1LDDA 5FRMA 2BHZA 2WY8Q 3BCBA 1X4OA 4KT6A 4LLLA 3VEPA 1FPKA 2AL4A 2XWIA 3PPPA 4Z7EA 2NVTJ 3K9TA 5KCJA 2OPTA 4I3EA 4OVRA 3TEPA 2VGQA 2QS2A 4GWWA 2MYSA 5B5EC 1IC8A 3IHUA 5EG0B 1B4HA 1YX5A 4HE0A 3HGYA 3OS1A 3G6EI 1SFOJ 1Y20A 4YELA 4CYDA 4AIHA 2ZNUA 4A3BJ 2EILH 4LB5A 1S29A 3A0BC 1GVDA 2JA2A 5ELVA 2CG4A 2Y31A 3V5AA 3BLYA 2WX9A 1UHSA 1H9GA 2M45A 4CCOA 1MPBA 2H25A 4WEPA 3CLOA 5KAIC 4MCOA 3FKJA 3KJTA 4PFOA 5KCMA 2VD3A 4D7NA 2Y48A 1G59A 3T9XB 3KP7A 4YFNF 5F0CA 4AS4A 2A69F 4IRHA 3TO9A 2M3AA 2XGXA 3O28A 1ZHFA 3L2QA 1O3TA 2CO5A 2Y0SA 1BM9A 2F97A 3K6UA 1WJ5A 1DGWY 1FRPA 2L9RA 5B66C 1ZGAA 4CUGA 2P6SA 1F5TA 1LSTA 1MBJA 2TCTA 5I57A 4V2GA 1B3EA 1HA8A 4P55A 1ZTYA 4KPTA 3KSJA 2VKHA 3OYKA 3CCYA 3K10A 1FPBA 4LQ5A 3ZMUA 4XONA 2V3TA 1P92A 1B52A 2M2EA 2K3PA 5L3DA 4L0ZB 4A3CJ 1DPEA 5HDGA 4JWOA 4Y52J 2WKYA 2CZKA 1U5TB 3JW4A 2R7TA 1A6QA 1IRZA 1JI8A 5BPIA 3PJRA 1B6HA 1MXXA 1AHDP 2GHBA 5D5XB 4WXDA 5J3LA 1YJWI 1VQ5I 3M9AA 4R73A 1UAAA 4AVZA 3Q0WA 5K7ZA 3TOAA 3BTJA 1XI6A 3U93A 4LZ7A 2Z3YA 1D1AA 4HE2A 4HV6A 4EQ7A 2GOXB 1VDWA 3I3LA 4OANA 2DTRA 1FIPA 4H46A 1FPGA 4DBQA 4F3QA 1PVEA 3HZJA 3A03A 4ESFA 3LSJA 3Q9SA 4PUSA 2O84X 4PE3A 4S04A 2ESHA 4X0GA 1S7YA 3CC2I 1YE9A 1D1CA 2VPNA 3I5UA 2D45A 1TFAA 2KJCA 2GFEA 4DLDA 2EFPA 1SW5A 1YRNB 4E7IA 3S15J 1I3QJ 4LK1F 4KYWA 2VT2A 2JA6J 1W0TA 4IO3A 1H76A 3TKDA 1GGGA 3K4UA 1XSVA 1ULYA 4RGSA 4F93B 1ZTRA 3QYBA 4GBVA 2NAZA 5I56B 1RZ4A 2BV6A 4BYYA 5HNFA 1HCRA 2P5LC 1VFEA 3R7XA 1U8RA 2PVUA 1FBDA 2Y7PA 5TPAB 4RLQA 5FD5A 3TBIA 4UY8I 4AB5A 5B7DA 1WQ2A 3PPNA 4MLOA 5L9MA 4B48A 3GTLJ 4A3MJ 4XLHA 1VQPI 3JRIA 4IY6A 3UGWA 1WCMJ 2PN6A 3I4PA 1FQCA 5K1YA 2RCBA 3RSNA 5ET8A 3ZMTA 1US4A 3SERA 1R71A 4I0BA 3HOWJ 2P0WA 2XUBA 3K1PA 2HWVA 3ZQGA 1IN6A 4BEHA 4TV7A 1WZ2A 3CMYA 2DPUA 4XLNF 3HOTA 4ZZLA 5ICGA 3M07A 4DW6A 3K4NA 2CZIA 4PBQA 3B8BA 5DT6A 4MF3A 3IJOB 4XKQA 1K78A 4H0EA 2R7VA 1TWCJ 4WX9A 3FJ7A 4OFOA 2Y0MA 4BDQA 3N4MA 4RAYA 3S3MA 2STTA 2WAQA 1S7AA 2EV0A 5FHOA 2EJRA 3QPHA 4RLFA 1QZYA 3M8FA 5FRNA 3FD3A 3OIOA 1DQUA 5L3FA 4MBPA 2F36A 4PAIA 1BI3A 2KIFA 2OCEA 1NH7A 3HB9A 2EZLA 4GOTA 5ICQA 4U21A 4HRIA 2HKXA 1VFCA 1QVSA 4PK4A 2XXTA 3SEWA 4ESJA 1IXCA 1N7XA 1B6AA 2MH9A 4I7HA 5HOOA 3R0AA 5DYHA 4R79A 1D0ZA 2PMZA 3G3IA 2IS2A 4ZECA 2FNAA 3K4LA 2NVXJ 4EJTA 1I50J 3CO6C 2QQ8A 2GIZA 4YICA 2AIXA 3MMYB 1UIVA 1I27A 2XXKA 1WWXA 4UB8C 2DAOA 1J09A 2ECBA 2FE3A 2IEKA 2X6WA 4IR8A 1YTYA 3HTUA 4I09A 5JVGF 3BIGA 3GZGA 2VP1A 4GWSA 2V6EA 5J4YA 2XAHA 4GQOA 3JAMZ 2QENA 1RR7A 1N78A 2QMWA 3BQZA 2XKOA 3CESA 4QSCA 1X1BA 1N04A 3BKIB 3LUYA 4N0BA 4BHBA 3GFMA 2D21A 5E17F 2IXSA 3HBLA 4KDPA 2X1EA 3V89B 1XS9A 3I6VA 3KYLA 2CQKA 4LB6B 5ET5A 3TFLA 1E3PA 3IL2A 1R9TJ 1IRXA 4PJ0C 4XKWA 1H44A 1OMIA 2CV1A 3E5UA 1SVMA 3O8HA 4BACA 4YG2F 1LBCA 1N3WA 5D5VB 2DA2A 3SJMA 1JEVA 3QOPA 2H1LA 1UG0A 1IAWA 3JZJA 2DW4A 2A5TA 3KEOA 2XX8A 4OA4A 2H9BA 3R4KA 2BJJX 3MPLA 1VQ4I 4F18A 1BLFA 5EHSA 2M9HA 2RNGA 5E8GA 1WHUA 2XPVA 1GHCA 3C36A 3OO8A 2IS6A 1R5ID 5EJCA 2YR2A 1HKSA 4ASNA 1Z3YA 2OQRA 3GW2A 5DEXA 3PSIA 2H6BA 1MH4A 3WHBA 2QA4I 1PDNC 2VD2A 2Y7IA 3C2BA 4II3A 2MFZA 2D3IA 3HTSB 3PM1A 1P9QC 4RB0A 4GRIA 4XM3A 3CRBA 2XROA 2QF7A 4H0WA 5DVJA 4AVPA 3N6UA 2L4AA 1R22A 2X6XA 5CRYA 5ISUA 4LITA 1PB7A 3IC7A 3JV9A 1W0UA 2ELHA 4XKPA 1VE4A 3MSTA 3S2DJ 4LN5A 1V5GA 1Q1HA 1JVYA 4GX3A 4BDOA 2L7MP 1F4KA 1D5VA 3ISPA 2KR0A 4P0GA 3DEUA 3ABUA 3FHNA 4IHXA 1M5EA 3GBAA 2G7HA 3CDIA 2L3DA 3V83A 2I8DA 4RB2C 1AH5A 4K2EA 3ZQHA 3WTUC 1HW1A 3T9HB 1XGOA 1P4WA 1R6ZA 3C35A 5E20A 3OL3A 4BQQA 1IMAA 2I0BA 1S72I 1N25A 3IR1A 2HAVA 3PUVE 5H6RA 3T0JA 3ML6A 2XVCA 4FQGA 4F3PA 1OR7C 4U1OA 1KU3A 1CB6A 2MD5A 3FVKA 2BXYA 1OYIA 1LBXA 3FV1A 1FT9A 4NF5B 5M5XJ 1B5JA 3TYHA 3OYNA 4P0IA 2FOKA 4DIGA 2REGA 3LSGA 5E1ZB 2ZYKA 5L9OA 2KISA 1LAXA 1Q35A 2VPRA 4NC8A 3O6IA 1GV8A 5F1QA 2BY2A 5EQAA 2XPWA 5KDTB 5LDZA 4HG2A 3IO4A 4ENNA 3PPQA 1X58A 1TWFJ 3CFZA 5J1DA 3EPEA 1SFEA 2IS1A 3M1EA 3W6JB 2YS9A 2MD0A 4JP0A 2HEUA 4LUBA 1VQOI 1IV6A 4LD5A 3D1NI 1KQ9A 1P6RA 2CW7A 4U0WA 4YIIA 5IPAA 4FEDA 3DF8A 3FWEA 4EF2A 3OR1C 3IFAA 4KD5A 4QFLA 2V6CA 3T8TA 4EV0A 2WB1N 3RTWB 5D5WB 5I2NA 1A7LA 1SMYF 2LY2A 4UXNA 2FBPA 1G2HA 3KSXA 2KKOA 2F6PA 4YB6A 3CF2A 3Q0UA 4J19A 4PGNA 1XSXA 1PDAA 1Z6RA 3SYTA 3GZ6A 3NEUA 4RB3C 2MLGA 1JT0A 1YTVA 3S2VA 4KUMA 3JR9A 3VYUB 3M4OJ 4HTGA 3DP6A 4JBZA 1EZOA 4I62A 2KZVA 3GWZA 2OWSA 2IP2A 3G73A 2GXBA 2OWTA 4UVCA 1IMFA 3MBPA 1X1AA 5AONA 2H8RA 1I69A 1LBBA 2ZJPF 3CMMA 2YX4A 3QYTA 2DQVA 1HOMA 4U2RA 2L4MA 3CG1A 1RKTA 2VN2A 5JVTA 4D7MA 4DCYA 3MZBA 3BR1A 2L9SA 3H9QA 4K3FA 3HKZA 2G29A 4P3LA 4BJ6C 3PSFA 2Z8FA 4H1XA 4OERA 4KMFA 2IGOA 3S4UA 2VIXA 5GP9A 3TW6A 4PC9A 4YKIA 4ZDMA 1HXDA 2GQ1A 3CVGA 1ETQA 5ICFA 1ZK8A 5TP9A 5L9SA 2QVRA 3JREA 2Q89A 2X4HA 2ZXWH 2ZXTA 3O97A 3PUBA 3IRRA 4BQAA 1RI7A 3S14J 1X3ZB 1ACIA 4J00A 1KZ8A 4L9TA 2Y0SN 2GM4A 3MQ0A 4B44A 1IMCA 4G8HA 4WKMA 3BZCA 3JTHA 2IRFG 3RUMA 2DOFA 2FBIA 4ND9A 3H3UA 5CPRB 1FP2A 1OYWA 2P5VA 3TAJA 1EH7A 1HW2A 3ODBA 1D0XA 4ANJA 1K9YA 1TP4A 1N0TA 3DBRB 2KHMA 3G3ZA 4UVBA 1K79A 2DSFA 4R6KA 3BCAA 4ZYDA 2NXOA 1MBGA 1T08B 2LSOA 3L9FA 3FIRA 2CU7A 5EEAA 5ICTA 3SFZA 1BR2A 1PP7U 1O7LA 1WH7A 2CWEA 3EHUA 1EH3A 1N77A 5T3JA 1H8AC 1M5BA 2XC7A 1NNTA 4LVQA 2X6YA 3CJQB 2CJJA 2ZXHA 4BJ5C 3G4SI 1TC3C 1T95A 4XN3A 1D9QA 2B9SA 1UIUA 3SESA 2ZO4A 4IEJA 2M8EA 3RYPA 3MP6A 4WEDA 3QWLA 2W84A 4O6JA 4RBOA 3LA7A 4ISUA 2ZMEC 3REOA 1I6BA 4P5OA 1XDUA 4RS8A 1H89C 3E6DA 5L3BA 5CYVA 2F4OB 3P9KA 4A6DA 5H8SA 5ITPA 4C3HJ 1R1TA 2Q8KA 4OAZA 2O3FA 4OU0A 3MZHA 1UTBA 4D5FA 2O9LA 2KZGA 3FVNA 2L0KA 1R5GA 2IA1A 3LFKA 4HCWA 2OU2A 4N6KA 1JVXA 3WGIA 4ELQA 5ILUA 4I98B 2L5VA 3QSLA 2V9KA 4I2OA 5LGTA 3MWMA 1IUDA 5EYHA 5B70A 3JRHA 2WV0A 1R4MB 2M5WA 5TRDA 1Y39A 1MNMC 4GDFA 3AXFA 3MC2A 1OKRA 4MNUA 4NQWA 4C1TA 4IO4A 3UN6A 3TUSA 1I6HJ 2KDZA 1RIOH 4O8MA 3MVXA 1USSA 3BTCA 5IP6A 1ZIUA 4GL0A 2HZLA 3VB2A 3MKYB 1ZG5A 3CSGA 2EWNA 1ENHA 4M71A 3GFIA 2ZMEA 3LSWA 2H94A 2LKSA 3DKXA 1VSOA 4H4KC 3JRCA 5L3CA 2E7WA 1FW0A 2I3VA 2ECCA 4OVJA 5A5XB 1SBPA 2Y7KA 1RPWA 2K4JA 1ZKGA 3WGHA 1F36A 3WE2A 5DEXB 5EHMA 1QVUA 3ABKH 3HHGA 3PO2J 1R1VA 1YYZA 2OWZA 4BDLA 4E7JA 1DOTA 1YI2I 4BE1A 3K4CA 2LMDA 2CW0F 2DFFA 1IF1A 1XB4A 4KIBA 1MY0A 2E60A 1QHGA 1I5ZA 1XC5A 1AKHA 2Z9OA 1MPDA 3HFUA 4NF6B 4IQ4A 3L00A 2CFOA 4O94A 1VFDA 1B1BA 2HYGD 2V1NA 4FASD 5DS9A 3FXUA 1RDZA 4IO6A 1BR4A 2DE3A 9ANTA 2GA2A 4PFYA 1BI1A 3H5AA 2LY9A 4Y33A 1D9YA 4QLCU 3P5JA 4H5GA 3K69A 3SEYA 2PMZN 3FK6A 4L9NA 1ZGWA 2VJ4A 4EQQA 3K2DA 3B6WA 1BJZA 2E1NA 2XGEA 2XRLA 3N97A 4GX4A 2E5ZA 3WTZA 1W5CC 3ESWB 5DCMA 2F3BA 2LNBA 5KK1A 1PUEE 2PX1A 1EKEA 4KIFA 4GO1A 4FX0A 2HQ0A 2W7YA 3BFUA 3K1MA 1YW7A 5FD6A 3R6SA 2PBIA 4PCQA 3ZCOA 4PFUA 3KP5A