2ESNA

The crystal structure of probable transcriptional regulator pa0477 from pseudomonas aeruginosa
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
301
structure length
299
Chain Sequence
PLLRRLDLNLLLVFDALYRHRNVGTAASELAISASAFSHALGRLRQGLDDELFLRQGNRMQPTQRAEHLAAAVAAALRALGEGLEEWRPFVPGQSQRTFVFAATDYTAFALLPPLMNRLQHSAPGVRLRLVNAERKLSVEALASGRIDFALGYDEEHERLPEGIQAHDWFADRYVVVARRDHPRLAGAPTLEGYLAERHAVVTPWNEDSGVIDRLLARSGLRREVAVQLPTVLAALFLAGSTDFLLTAPRHAARALAEAAGLALYPAPFDIPPYVLRLYSHVQGRDAHAWMIGQLKGLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of putative transcriptional regulator Pa0477 from Pseudomonas aeruginosa
rcsb
source organism Pseudomonas aeruginosa
molecule tags Structural genomics, unknown function
molecule keywords probable transcriptional regulator
total genus 89
structure length 299
sequence length 301
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2esnA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2esnA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2esnA03
2XXRA 4XLPF 4G68B 2I0CA 2I48A 2LSOA 4A6EA 5IKBA 3E97A 3FJMA 3O29A 4OFOA 1LB9A 3ECRA 4WF2A 2OWTA 1SFUA 3WTVC 2QJEA 2JPBA 5E17F 4JBAA 4UVBA 1LJ9A 4BDLA 1FX7A 5DUIA 3PPRA 4UXNA 3N5LA 3ILTB 3WTXC 5JVTA 3FM5A 1P1QA 3E6DA 1YTVA 2M87A 4EDPA 1Y3QA 5LRRA 3T9HB 3I5OA 1ODDA 2UXXA 3EN3A 4MLVA 1IRFA 1FNNA 4ECFA 5L9MA 3DKWA 2HOEA 2JSCA 1YG2A 1VE4A 4LB6B 1BC8C 2A5YB 1P1OA 2KRFA 4XBFA 3FIRA 3FUZA 4KD5A 3GXAA 1H9TA 3DFGA 2FOKA 1YLFA 1MQIA 4ESXA 3TDUC 4AQ4A 3MW0A 2HAVA 2GA1A 4IRGA 3RYRA 3ZMUA 3QU3A 4OYVA 2QQAA 2QUFA 1NNKA 4IVNA 2Y7WA 3PV0E 3MP8A 4DXUA 1R36A 5JI6A 1S7OA 4ESJA 4XXUA 3IWZA 4A5MA 4R2BA 1SFXA 1ZGJA 2J5PA 1XSVA 2Z8DA 3OO7A 4F3PA 4G8XA 1BP5A 1BBYA 2VOZA 1PEBA 2ALUA 4KYEA 3S9MC 3MP1A 3JTHA 2YX7A 1OQGA 4TOZA 4HF2A 2Z8EA 3KEIA 4HBLA 2V1XA 4M9ZA 1TFAA 1RUOA 2UWMA 3BY6A 1XSXA 2VXZA 3E4RA 3K6WA 4Z2YA 3VB2A 3E6MA 3E3KA 3MWBA 3RQTA 3HYIA 3V8LA 4Q8RA 3JSOA 3LSWA 3SEXA 2XVCA 2G9WA 2L4MA 1O64A 4R75A 4BDQA 3M1EA 3IRQA 2STWA 2DWIA 2EA2A 5FLXK 2VHAA 3EHUA 4A0YA 1H76A 3BPVA 3H6VA 3IOUA 3SHFA 3REOA 1Y4CA 3O6IA 3U1OA 1VTNC 4EJTA 1M5CA 3C1DA 1DSNA 4OIQF 5I56A 2Q8JA 4WX9A 2QBYB 1YW7A 1V3FA 5ICFA 1L0OC 5FB2A 1Z7NE 4X1DA 3UA8A 4XKNA 4F18A 4ZECA 3KFMA 2EFQA 3KP7A 4NF4A 1YO5C 4KIFA 3R26A 4F1YA 4JDFA 2Y48A 4KYDA 2HEUA 4GXOA 2EFWA 2IJLA 1FPQA 2X0LA 1MH3A 1RI7A 2FNCA 4R74A 3WG9A 3G3GA 5FO5A 1B5JA 4PP0A 1POY1 4F3BA 1SD5A 3PQJA 1I6QA 3TQNA 1PBQA 3GFJA 4P96A 1OLCA 1TT1A 2ONRA 3FVGA 3TOAA 1AH5A 2J5OA 4QLCU 1L3LA 1OPCA 4ONYA 1SYHA 4A5NA 4CDGA 3RT6B 4YFKF 4EJVA 1U5TC 4QSDA 1Z91A 3U1DA 1MM6A 1ZKBA 5H8QB 1U8RA 4K3FA 4YKJA 1G3YA 1A8EA 4ZEIA 5DYMA 1XCBA 1BI1A 4L0YB 5HVQC 1P2FA 1JXSA 2TDXA 2FYIA 3HN0A 1B59A 1SW5A 2VD3A 2DI3A 1MQJA 3TELA 1XDUA 2H99A 2O68A 3V5AA 5HS8A 3PD8A 1MPDA 5K2YA 4F2QA 3BJAA 4ENKA 2O7UA 4EQQA 5TJJA 3O6HA 4QFOA 3WTTC 2UVJA 1P1UA 4F31B 3OD7A 2IEEA 1I6XA 4HX7A 2O1LA 2QS3A 5AA1A 4ELPA 4PGGA 3TTMA 1LAXA 4GYIA 1UTHA 1WSUA 3HOTA 4WEDA 4H67A 3H6WA 1SMYF 2VBWA 4MH5A 4I2OA 2R3SA 1FP1D 1R1TA 3LAPA 1CE2A 4O3CA 2RQPA 1SYIA 4JSOA 2CGPA 4RY1A 2FNAA 5K5OA 2I58A 3Q26A 4M72A 1Z1DA 3I71A 1GHCA 1MY0A 1XDSA 3IB1A 1XMKA 4R73A 3WAFA 4IRIA 4NF4B 2VONA 2QMXA 2H6BA 2ZO4A 2PI0A 2R71A 5I59A 5DTBA 1QBJA 3CO6C 2RGVA 1DTGA 1YPNA 2DFIA 2HS5A 5EEHA 1QVSA 3LUYA 1A54A 5LHIA 3IOTA 4M4GA 4KDPA 1B40A 3TO6A 4U2RA 4BAYA 1NKXA 3CUQA 4HCWA 2JT1A 1JGSA 2EB7A 2OAZA 1Z9CA 1P99A 3ZN1A 3DV8A 1B9JA 4L17A 4CO8A 2XAHA 3FGSA 3QSLA 1LFHA 2RC8A 4BLAA 3QPHA 5FHNA 4OEVA 5D5XB 2B3FA 2P5LC 2Y75A 1YW8A 3TAJA 1UHWA 4WXJA 4YB6A 4YKKA 1S8NA 1R7JA 1MH4A 1GR2A 3IJXB 5D8KB 4HDVA 1FTJA 3U92A 3E3VA 2YJPA 3W9WA 5AE4A 3FASA 3FM3A 4OIPF 3T96B 3ABUA 2KIUA 1UIUA 5EHSA 3G3JA 4FECA 1F9NA 4UHTA 1T0FA 4OXVA 2P4WA 1LAHE 1XVXA 3C34A 3TKYA 4ZZEA 1BTJA 3ZMSA 1KU2A 2EFPA 1MY1A 2DT5A 2DPDA 4G4PA 2ZYNA 4G77A 4U4SA 1QULA 2JZYA 4LVQA 3R7XA 5LRSA 5A5XA 5CLSA 2ISZA 1KWHA 1W7PD 1FTMA 1Z05A 3K02A 2GH9A 3F3XA 4QRZA 4KMFA 4IY5A 2HQRA 4BDMA 4P11A 4A2UA 4DCXA 3FJ7A 3HSTA 3QUJA 1YS7A 3IB0A 3BJOA 3WU1B 1RYOA 3ILUB 2DXRA 3TGNA 3GFLA 5DDGA 1IQ7A 1OYWA 2GHBA 5KDTB 4D0PA 4ZYEA 4R6YA 1T2KA 3B6WA 1UQWA 2BJJX 4CHUA 1ZRDA 1USSA 2PMUA 4MEYF 1KYWA 1FCKA 4LONB 4EVIA 1MDP1 2HYFA 2PBIA 1UTBA 1IZ1A 2ZNYA 1MZBA 2MH9A 1ZRFA 3BDDA 2P1SA 1H0MA 2COMA 5A2QK 1JW5A 2VT3A 5FLXZ 3T1BA 3V7CA 4EJUA 4L9VA 1UTHB 3OSQA 1R22A 3TPAA 2XKPA 4ON0A 4DXCA 3F22A 3TQLA 1NNTA 3FMRA 3EYYA 3OSRA 4YB7A 3HV1A 2YPRA 4Q48A 1JETA 3KOTA 1E2XA 2XXTA 3OELA 3PMVA 4QFPA 4YIIA 3WTUC 2QVOA 4Y15A 3ECOA 3Q9VA 2HXWA 4LMYA 4M71A 4AVPA 4N13A 1VFDA 3A09A 4RB2C 3LBSA 1Y0UA 1UHMA 2GA2A 1DP7P 4TLMB 5KCJB 1JVYA 3ZSFA 5KDTA 3N94A 1IW7F 4HV6A 2HZTA 4OERA 4YKPA 4EXKA 5K5RA 1LFIA 5BMZA 2VOPA 4GLIA 1T0KA 2F5FA 3J81K 3O66A 2Q2EA 4AIJA 3EUHA 2OJTA 2DQLA 4GVOA 3PPQA 3PQKA 3KETA 2NS0A 4LA9A 3KJ7A 3CFXA 1F1ZA 2V1DA 3I4PA 2ZYOA 1N04A 2HTSA 2GRVA 4OEUA 4OESA 5HS7A 2VODA 1K78B 4KR5A 3H06B 1MGTA 2V3UA 2ZBKA 1MXWA 3TQWA 2RC9A 4L18B 5TP9B 3TO7A 3ZMDA 4ENJA 2PVUA 1IN7A 4BHPA 2ZMEB 3C32A 4EJOA 2CZLA 3PMXA 2VE9A 5FD5A 2XX9A 2BE5F 1K7AA 3HSRA 2ZNSA 5H8NB 1O3QA 4S05A 1XCVA 4GCVA 4NF5B 2F5EA 3CFLA 1IXGA 4NF8B 2CWEA 2NRAC 1J9IA 3F6OA 4OMZA 2IVMA 1FYMA 1O63A 3SXYA 4GL8A 3F21A 1N0TA 2ZXTA 4MQ9F 5L3CA 2UXAA 1FC3A 2GQQA 2EV6A 1RKMA 2W24A 4M1VA 3K6VA 2P5KA 5KVRA 3C7JA 4GRKA 1W5SA 1H9GA 2WWYA 2Z33A 5ILUA 5H8QA 3F11A 3CRBA 5LGTA 2V79A 2YSRA 5EYFA 3ODBA 2W57A 4G68A 2NUVA 2DBBA 5FHMA 4U0VA 3MVWA 2QYOA 1UTBB 1B3FA 1DPEA 2V9VA 1ON2A 1SMTA 4B8XA 4KIBA 1J59A 3H3GA 5D8LB 4E70A 4FHTA 2ISYA 1QZYA 3I59B 3KE2A 2ZKZA 3V8KA 1GGGA 3MVZA 3M8EA 4I1DA 1SFEA 1CB6A 1XB4A 4RXLA 4HF0A 3TTNA 1XN7A 3GVAA 1FT9A 5HDNA 4HF1A 1FYKA 4HV5A 2AYSA 5DVFA 1OYIA 1TXFA 3LR1A 4QF9A 2DE4A 2AS5F 2M8EA 1KQ8A 2IA1A 3I54A 1FOKA 2OZZA 5LHGA 3R0AA 3PUWE 2YLNA 1HKSA 1O57A 2O84X 2XX7A 3GBAA 2LF8A 4LFUA 4ZEDA 3ZKLA 1LBCA 2VOOA 3VVDA 4FORA 4UACA 5AONA 3DPLC 3LQQA 3UGWA 1DTZA 3Q29A 5DCMA 3M8FA 1ZBMA 3O2AA 1LDJA 2Z8FA 3TDZC 1MXZA 3HOSA 3HHHA 2PG4A 3KSJA 3LWFA 3FMSA 2HGCA 3FATA 4NF6A 3W15C 2G7HA 2IPQX 4PFUA 3K69A 5ICGA 5LGNA 4UUVA 4ELRA 3MWMA 2REJA 4G2ZA 2QS1A 3RDIA 4HQMA 5L3GA 3KG2A 3TUSA 1ZRCA 1F9BA 2O51A 1JQFA 2Z99A 3K0LA 4AB5A 3FF5A 5CJ9A 1IITA 2RN7A 1G4DA 3KJTA 5I2NA 4BH9A 2Z22A 3F72A 1R5GA 2IT0A 5ILSA 1J7KA 2DE3A 2H9BA 3WE3A 2OZ6A 2MLGA 1XSDA 2VBZA 1UB9A 1A99A 1N7WA 2HYGD 3U9GA 4KHZE 5KZTA 4GF8A 3IL2A 1PP7U 1BLFA 3F8BA 4UVCA 5FFZA 3GF2A 1FW0A 2V3TA 3M8UA 3VFJA 1RZ4A 4RGXA 2IA4A 3Q27A 5H6QA 1H44A 2XAQA 1MDMB 4BHCA 3IR1A 1B2HA 3LFKA 5A2QZ 4F39A 3PUVE 3MBPA 1OIBA 2QL3A 3JTGA 1SBPA 2HKXA 1LNWA 2UVHA 3S2VA 1ZGAA 4ZH4F 4WCGA 1FQBA 1H43A 3EF7A 1KA8A 4NB5A 4YZZA 1LQ1A 3RPWA 4O5VA 3G3KA 3I5UA 3R4KA 2LKPA 4RGSA 3KCCA 3KN7A 3TFLA 2Q88A 3RNNA 5DYHA 4YICA 5JEIA 2ANJA 4ESFA 1P1NA 1QQIA 4R8HA 3E13X 4HZFA 4EQ9A 4IB2A 1ZLJA 2L4AA 1CF7A 2A3SA 3GEZA 1KQ9A 1ON1A 2XUBA 3O6BB 1DOTA 4HQEA 4WWCA 4RNSA 1TLHB 2FRHA 4I0BA 4RJZA 3HCQA 3RN8A 3IRRA 4LUBA 4OWDA 3KZYA 3GZGA 1FSEA 1B4AA 2JTVA 2XAGA 2OU2A 1TNTA 4ZYDA 2BEOA 3MQ0A 3COAC 2ZMBA 5I56B 2K4BA 2ADUA 5HBCA 4TQUQ 1LB8A 2V25A 1K79A 5K1YA 3DLNA 3H92A 3TO9A 1NMUA 2HKOA 3JAMK 1HW5A 2HQNA 1A55A 4MEXF 4CXFA 2DQVA 3BKIB 2G29A 4XKQA 1QJMA 3T9UA 4DNCA 2FMYA 2UVGA 1G3WA 3EQ1A 3UP9A 1LSTA 4HAMA 5B7DA 3PFIA 3U94A 3VE1B 1FBQA 2GXGA 2PJPA 2HTJA 1HSJA 1ZYRF 2E1NA 3OENA 2PT1A 3QOPA 3H6TA 3OO6A 2AL5A 4U23A 2XXPA 4XIGQ 1EH7A 1JE8A 3EPEA 5FHOA 3DELB 1Q35A 2Z3YA 4BHBA 2THIA 3D4CA 4P5OA 3C18A 4ESBA 3W6JB 1JW4A 1FQFA 3K9TA 2FA5A 4IF4A 3T5XA 4AWXB 1URSA 3C9HA 3KBRA 1OLAA 3T9VA 1HSTA 2MBFA 2JRTA 5AA4A 2XXVA 2ZNTA 4IO5A 3RYPA 4KYWA 2FMLA 1FQEA 4AD9A 1BN5A 4UV8A 1MXUA 4U21A 3KFWX 3MVXA 1IXCA 2B3BA 3L6GA 3IOWA 1IN5A 1LDDA 1IXSB 5JHUA 5L3DA 1E17A 1JW1A 4N6PA 2H94A 3H3UA 2VN2A 3FV2A 4NQWA 4XSZF 5ERIA 4RB3C 2V3QA 3VXBA 4RGRA 1PDNC 1OMIA 1USYH 4WK8F 1FYLA 3I3VA 3MVYA 5LGUA 4ZS9A 3HSFA 4OIRF 4A12A 4KIGA 4EF2A 1LEAA 3GYHX 2H4IA 3PPOA 5B70A 5D5VB 4NF8A 4Q5SF 1I6AA 1LAGE 4IO3A 5CI5A 4FX0A 1USYE 2G93A 3DP7A 3IC7A 3A3CA 3KOSA 3OOAA 2IW5A 3L6HA 5CVVA 4FX4A 4JWXA 1LBBA 3J80K 3IKTA 4ZE8A 5E1XA 2O0YA 3ELKA 3L7WA 4H0WA 3SEYA 4F22A 1YFHA 1U78A 3FZVA 1XOCA 1ZTYA 3ZKKA 5D5UB 1AOVA 2H98A 1N84A 4OINF 5H8HB 2F35A 2DS9A 1O3SA 4FAJA 1K78A 2I4CA 4GQOA 2M8CA 4UVAA 2OCUA 1BM9A 4ENNA 5FTHA 2O6GE 1SD3A 5ISUA 2P8TA 3HHFA 3OEMA 3C3WA 2F6PA 1PBPA 1YCJA 2XIGA 2MC3A 1AOYA 4MHGA 1GVJA 2Y7RA 5I2KA 5K5QA 3RJPA 3PGFA 4OENA 1Z7UA 3R0JA 4EGZA 1ZARA 2ZCWA 2DK5A 2QQBA 1A8FA 5ICQA 3HRTA 2EJRA 3RKWA 2FA7A 5TPAA 4EGYA 1SW2A 3R6UA 5CVJA 3WODF 4OFJA 3ULQB 3KP4A 4JWYA 1DPRA 1B32A 1OVBA 3S2WA 5I59B 2BBYA 4ZZDA 1M5FA 1FLIA 3TCGA 1IXRC 5HLGA 3AAFA 4I09A 3C35A 1R1UA 2XXQA 3MZYA 4C1TA 4LLLA 2QM3A 3OV8A 1MY3A 1R9QA 1G6NA 3NEUA 3FVNA 4IHSA 1Y9UA 3IOVA 1N3WA 3RY3A 3PUZE 2KIFA 2YR2A 5F1RA 1T98A 2OA4A 1U5TB 3JYRA 4DLDA 1B46A 3O6GA 5KK1A 4EV0A 3TOBA 1M5EA 1P4XA 4G8NA 3GUDA 4X9TA 5J1DA 2Y7KA 3WGGA 5TPAB 5DD4A 2KJBA 2NVUB 3C4MA 2D2WA 3G3HA 1BC7C 5TU0A 5BPIA 2F7AA 5CVIA 2Y84A 1K6OA 4N9HA 3DM0A 1MG1A 4PETA 4HLYA 2VT2A 4O6JA 3KLOA 4WXHA 2XAFA 3FX3A 3K00A 4LZ5A 4LZ8A 3GBBA 1NH7A 2VC0A 1NH8A 3VV5A 4U0YA 2I0BA 3CDHA 2DXYA 2R6GE 1PP8F 4DDDA 3F23A 5A5XB 1WDNA 3LQRA 2F2EA 3QU6A 4JWOA 4HW0A 2QRYA 1B6AA 3ABTA 1D4NA 3PPPA 4DIGA 3PU5A 2I4BA 1LEBA 2LDUA 2O1MA 3S4UA 4I02A 2O69A 1SD6A 3G3FA 2W85A 3I6VA 3I53A 3P9CA 4LK0F 4RS8A 2DPUA 3AXFA 5LBQA 2I49A 3KLNA 4G6DA 3WTSC 1URDA 3O28A 4I8CA 4BDNA 4H0EA 4P0GA 2QS2A 2A68F 2F5DA 4OMYA 1RUNA 5FFXA 4JXIA 5DVIA 3DXJF 3RUMA 2CYYA 3GWZA 3ZN0A 2W7YA 4JB7A 1Y4TA 4L0ZB 4LGWA 1B4ZA 1MPBA 2EV5A 4EJWA 4G7ZF 1B9NA 1REPC 3WAEA 1ZAOA 1WRJA 3GFIA 3MQ9A 5ILVA 4U88A 2HFBA 2DO7A 2ZYKA 5I57B 1B0LA 1TBXA 4IRHA 4MNUA 3IO6A 4ETSA 3GXOA 5KCJA 4OQOA 5I84A 3CFZA 2RNJA 1QO0D 4RB0A 3VDFA 4UV9A 3HRSA 4U1ZA 3CR9A 3MFKA 5I57A 1S29A 3LC8A 3K1PA 2EA4A 2ZMEA 1S7AA 5K2XA 3KEQA 5E8GA 4HLXA 2OZUA 1BI2A 5CRYA 4E0WA 3B6TA 5H8FB 3O97A 3W9VA 1O7LA 4I01A 2IA2A 2FBKA 5LEKA 1R1NA 1L5TA 2XAJA 2R9JA 1S6LA 1U2WA 4WXDA 1BOAA 3HUGA 2Q89A 2XX8A 2B65A 3M3FA 1YS6A 5HS9A 3VODA 3QAHA 4HCYA 2DWHA 4FT8A 3ERED 1EH6A 5F1QA 1QNTA 1WWXA 4M6XA 3FXRA 4YU0A 4ZEFA 2DOJA 2ACJA 5L3EA 1QUJA 1T39A 3QP5A 2XXHA 3RKXA 2EFOA 4R72A 3D4GA 2DTRA 3BFUA 4H1XA 3EDPA 4GL0A 3U93A 4M9XA 2RV8A 3LA2A 3ONMA 2DVZA 1ZG5A 3C31A 3TYHA 5D5WB 3P7NA 2CQKA 3IAZA 1IN8A 4HTGA 3G73A 2C6YA 4ZYHA 2XRNA 1SDXA 1QGPA 4P9FA 1B0HA 4MF3A 1LVAA 1FWZA 3RTWB 2HCAA 4EF1A 2G7UA 2QPQA 1W5TA 1QKAA 3MZHA 4YKIA 5J8CA 4XKPA 3VVFA 1FP2A 3CJNA 3L2CA 5ITOA 1GVCA 3N26A 3VFZA 1TQIA 3KEOA 3VLWA 5L3BA 5L8DA 2XGXA 2V93A 1HKQA 2HDCA 2DQRA 5CBRA 3BJ6A 5AA2B 3QXMA 1SW1A 2PBWA 4G9YA 1AL3A 4Q47A 4GIZA 3DP6A 3VXCA 4H8JA 2YU3A 2Q2AA 2P0SA 2F6GA 5BPDA 1B3GA 3MC2A 4GYGA 2P5VA 1MQHA 2YPNA 5E20A 4MTDA 3RLFE 3T93B 1LFGA 3LA7A 3MZ1A 1G3TA 5AA2A 4KI0E 3ZMZA 1J1NA 4ZEBA 1MY4A 2QZ8A 4H8IA 2Q8KA 3MAMA 1MPCA 1XT8A 3BBRA 3P9IA 4XTCQ 4RAZA 2P7VB 3K1NA 2DE2A 3TZAA 2QMWA 2EFNA 2M45A 5CMBA 4PFTA 3FHZA 1YTYA 4IHTA 2DAOA 4C0RA 4CZZA 4A0XA 3THIA 4ZZAA 4KQPA 3HHGA 1ZHFA 1PC3A 4XRFA 2PYYA 4BYYA 1O3RA 2K86A 4PDKA 1B58A 1H3DA 5HOOA 1B1HA 1VSOA 2HR3A 2OBPA 4RB1A 4GXSB 5IAIA 1S3JA 2FU4A 1P6RA 2RC4A 3T8TA 3KSXA 4QSCA 4EM1A 5ELVA 5IT3A 4ISUA 1ZIUA 4A0ZA 4R6KA 5FD6A 2LF7A 2PT2A 1MQDA 4KCDA 3J7AO 1US4A 2ELHA 4UA8A 5M2VA 1WI9A 1D3YA 2MA3A 1ZMGA 3H4ZA 3BROA 4WXCA 5D4SA 2UZKA 3KN8A 4GOTA 3FVOA 2RC7A 3EQLF 2GXBA 3FMQA 3CG1A 4O3BA 2ZNUA 1B6HA 2E0SA 5ICCA 3MZ9A 5D4RA 3MEXA 4IGRA 2I6EA 4NMYA 1XD7A 5LOMA 1ZJLA 4RYAA 5LLQA 2RINA 1JVXA 4LG0B 1W4MA 1I69A 1LB2A 1B7UA 2H6CA 3MCZA 4L9JA 4IO2A 1YIOA 2PX1A 5CVRA 2ZNZA 3UORA 3H7MA 3CI8A 4QFNA 4A6DA 4CICA 1B1BA 5BQTA 5JR3A 3NQOA 2FEZA 4GFRA 2DU9A 2PFBA 3U72A 1VR5A 4GGGA 3E5XA 3EYIA 2QWWA 4QHQA 2EWNA 3WE2A 3O2PE 1HBXG 2Q0OA 3KP3A 2M30A 4PGHA 4LLNA 3V83A 3HTUA 1AIVA 1LAFE 5H6RA 1FTLA 4PFYA 1CGPA 2FBIA 3RTFB 4U0WA 4CYDA 4U22A 3G3ZA 4LLGF 2W84A 3T0YA 3C33A 3Q28A 4IJAA 1D5VA 1URGA 2D1VA 5E18F 2VBXA 2ZFWA 5LHHA 2KKOA 2UYFA 1A04A 2IRFG 2GZWA 4L5JA 4CGZA 5DCFA 6PAXA 1LGBC 1TW3A 2K02A 1MDQA 3Q5FA 3UK4A 2X4HA 5J8FA 3H03A 2FQ3A 3F8CA 4C1UA 1ZU0A 2P6TA 2VE8A 2O3FA 1W7PA 1TQPA 2WV0A 3EHTA 3K6UA 5BS6A 3FXQA 1TNSA 4U7BA 3TMGA 2ETHA 3QPTA 3F6VA 1WODA 3HRUA 2ONKE 4NTLA 3OO8A 5BOXA 3C36A 3HIFA 1FTOA 4AIKA 3WTYC 2E7XA 3L09A 3IB2A 1ZLKA 2AL4A 4JBZA 1P92A 4OFLA 3LAJA 1LDKB 1AWCA 4XSXF 2XXWA 1TTYA 1X3UA 5D6EA 2AIXA 4ELOA 3M7GA 1SI0A 3IJOB 2QENA 4Z0IA 2L01A 1PUEE 5IT9Z 2XXXA 1B4HA 3Q9SA 2DWAA 3T22A 3RTRA 2LAOA 4ZZLA 5EHMA 1N7XA 4R1HA 4F7ZA 2I3VA 1XGOA 2X7PA 2CSOA 5E1WA 4H65A 4XLNF 5TP9A 3SKPA 3QIMA 5CMKA 1BIAA 2FF4A 2M1BA 2A61A 1KQ0A 1XVYA 3MUQA 5F6FA 2EK5A 2FNPA 1EU8A 4LQ5A 5H8FA 4THIA 4YMAA 1BI0A 5D6FA 1MJ9A 1LLSA 1VFEA 3WTZA 4GO1A 1R9LA 4MQVA 3B7DA 4KNYA 2LNBA 1B3EA 1EZOA 2NNYA 4LATA 4P9UA 1OQHA 3P7IA 4OVJA 2A5TA 1D9YA 2XASA 3ISPA 4JSDA 3E9XA 1SD7A 1ONVA 3IL1B 5AA3A 3QK6A 3WGHA 2XROA 2RVCA 3K2DA 4FATA 3IK6B 1I1SA 4F1UA 2XXYA 3E6CC 3TTLA 4HX4A 2AXLA 5CMCA 3GZ5A 4R9FA 1MJBA 1B7ZA 2OD5A 4WEPA 3CO7C 2W25A 1SQYA 2H5YA 1ZN2A 3CVGA 3WGIA 1IUYA 5LEJA 2VC1A 4EM0B 1YAEA 1U6GA 1TWYA 2RCBA 4YMBA 1ZLQA 2ESHA 2ZYMA 4I98B 2GFEA 1Z7ME 1FBUA 4BQAA 1J75A 5HDGA 2WC2A 2Q2CA 3CG3A 1TQMA 3MJNA 3N97A 1MXVA 4G8HA 1P4WA 3QAXA 1EZPA 1ULYA 3IX1A 5DV5A 4OTEA 1RIOH 4F3GA 2A69F 3O9PA 1ZH5A 1UIVA 5CVUA 3JV9A 3ZS6A 2OQGA 2D5WA 5L3FA 2FSWA 4Y17A 1ZG3A 3JZJA 4DE8A 1KU7A 1AMFA 4EQBA 4WKMA 4GXAA 3LSTA 2MD5A 1B52A 2PMHA 4M73A 2XXUA 1DPPA 4Y13A 4LP2B 2GIVA 2MH2A 3IKVA 2D21A 3PUXE 3VEPA 5CMMA 3TCFA 2QBYA 2PLYA 4G6QA 1NNFA 1A40A 4OETA 5E8IA 3EETA 2FE3A 2WTEA 1PB9A 1ELJA 1IXHA 1TFDA 4DCYA 2CW0F 2E1CA 1KGSA 3KP5A 2F7CA 4HS7A 3SEWA 3T66A 5I2KB 3B02A 3ZP5A 1Y20A 2DP8A 3MP6A 1N76A 4BDOA 4R9GA 2HQ0A 2F8DA 1YYVA 4OOIA 3FV1A 1WQ2A 4PE5B 5DCMB 2OK2A 3L9FA 4MLQA 4IO6A 2L3DA 2NNNA 2DVCA 3V7RA 4BDRA 1HSLA 1US5A 4U1OA 2KIMA 4RPOA 4DXBA 4XKRA 3W6KB 4HDUA 1B3HA 4KPTA 4YB5A 3MPLA 4PCQA 5E1ZB 4JQFA 3WU0A 1OYYA 2BYVE 4MTEA 4JK1X 4ASNA 1WVJA 3S9NC 5AIQA 4RK9A 1B5IA 2YX4A 2HFHA 2MLKA 4OU0A 3N6TA 5I58B 3K1MA 1MXYA 2PMSA 3E5UA 2O61A 1JEVA 4PQJA 2CMOA 4Z7EA 1IF1A 2F7BA 2UXNA 1P4AA 1DPUA 4YIFA 1MKMA 3J81Z 3PD9A 4LQ2A 1D9VA 3USDA 4EUOA 4H5GA 2GAUA 2XD2A 5I58A 1D8JA 1BI3A 1USTA 4OMBA 5AA2D 4KN7X 1XHYA 3CSGA 4RAYA 4ZEKA 1EV7A 2NAZA 3D5LA 2REGA 1MRPA 1S9TA 3UIFA 1M5DA 1RNLA 2R7DA 1I5ZA 2NYXA 3V89B 4G7HF 1R1VA 1KU9A 1HKTA 3GLXA 1JNFA 1WKMA 1C0WA 1M5BA 1HW2A 3J80Z 4I0AA 3S9LC 3QP6A 1Y1ZA 5BUUA 1MY2A 3NRVA 5ED4A 5DD8A 4BNCA 5EEGA 1GXQA 1OR7A 4LJZF 2I3WA 2A07F 3D0SA 2H09A 5H8HA 4TLLB 1SVXB 1NL5A 2L02A 4ZYGA 1XMAA 3CSBA 1DUXC 3SDFA 4L9NA 3R61A 1ATGA 2WKYA 1QKBA 4Q5TA 3WTWC 1H45A 4RGUA 3DQVC 4B09A 1UCRA 2DW4A 4I7HA 2F36A 3HTSB 4L5IA 2A6HF 2F97A 1B7HA 1JEUA 1YW9A 2DK8A 3BWGA 4R2FA 1PB8A 2HZKA 1T38A 3K0VA 1CF7B 2DLLA 1B1XA 3ML6A 3QYTA 3SEVA 4S04A 2IA0A 1R6ZA 3K6XA 4L9TA 1MM7A 5HLIA 3TTKA 3TTRA 3R60A 3SERA 3V7SA 5IT9K 4NEDA 2K4JA 4IGTA 1Y1MA 4KYSA 4F3SA 3F8NA 2XV4S 2QSXA 3T9XB 2QLZA 3KZZA 3GLBA 3A3UA 3KP6A 4O3MA 1HW1A 2O7IA 4HOBA 4KN4X 4HW8A 4ND9A 4M6YA 3VLVA 1PDAA 1F4KA 1EZ9A 1GV8A 2O8XA 2CO5A 3IWFA 3CUQB 1IAWA 1IRGA 3RI4A 2Y7IA 1QZZA 3ZMTA 4QFLA 1JHFA 2O03A 4M9SA 2E7WA 1OMPA 4M74A 2P7CB 4N07A 2XHDA 2STTA 1EH8A 5TRDA 2HWVA 1Q1HA 1J0RA 4Q30B 3F8FA 2QS4A 1QUKA 1Z6RA 3RT8A 1I6BA 4AB6A 3M3KA 3TKDA 4AIHA 4OZ9A 1J2XA 3ECHA 1MQGA 4RPNA 5AA4B 4YFNF 2F34A 4EQ7A 1XGMA 3N6UA 1FTKA 3Q25A 4LB5A 1U5TA 4HA8A 4IPAA 1BKAA 2P2AA 4ENMA 4KICA 1BIYA 4OHNA 3SEUA 3S9EA 4PFWA 5HPQA 1PB7A 4O3AA 4LZ7A 2FXAA 2VP1A 2Y0MA 3G7WA 3CUQC 2EV0A 3BP8A 1FSHA 3BPXA 1SW4A 3OOPA 4HYEA 3SESA 1XS5A 3SFZA 2UYEA 3KGCA 3B6QA 5JTYB 3KN3A 3IORA 2OQRA 1TW2A 1HXDA 4KFQA 1IN6A 5HM4B 2PEXA 4Q0CA 4IO4A 3LSFB 4QFKA 4LK1F 1FQAA 2HAUA 2A6EF 3HPIA 3M3LA 3DP4A 1YQAA 1B51A 2OLBA 3N4MA 2CG4A 4U7DA 1JHHA 2BV6A 2DSFA 3B73A 3LSLA 3RPQA 1B9MA 3FD3A 1MXXA 1HQCA 1QPMA 5DEQA 3EHSA 3GX4X 1W7PB 4G68C 5DEXA 1POTA 1QUIA 5ICEA 2OBGA 4TV7A 1FQDA 3KZGA 3U8QA 1D8KA 4E0XA 5HDKA 1Y3PA 2O6AA 1R00A 2Z5UA 1Q1KA 1IEJA 1F5TA 5L9SA 1R23A 2FBHA 4U4XA 3OMBA 4UNOA 4F29A 1B5HA 4DZ1A 2HEOA 4YFXF 1II5A 3K01A 3SQNA 2D45A 3V4GA 5CBSA 2KLFA 4POWA 2K7LA 2L54A 4FJPA 4I62A 2D3IA 1FQCA 2B0LA 2VGQA 2UVIA 4H5FA 2R7FA 1XGSA 4F19A 3CIJA 5CC2A 1SAXA 5J6XA 1KYZA 5HLHA 1DDNA 2CFXA 3HO7A 4ELQA 3RGYA 3U2RA 3SZPA 5ICTA 4KT5C 3GO5A 5FTIA 1U3EM 3GW2A 4Q4ZF 2PQ8A 4ZE9A 3JSPA 3M9AA 3FJGA 1OVTA 1EH3A 3PMWA 2M5WA 1T6SA 4POXA 5FGMA 4F1VA 4EMSA 2F5CA 3CUOA 4GD5A 1A7LA 3DP8A 4X1BA 3GZ6A 5CYVA 1GTKA 1GXPA 1I1GA 1KU3A 2DWJA 2F78A 4RA1A 3R6SA 2D1HA 4K2EA 1OKRA 4LG0A 1IIWA 3OO9A 2OWSA 2V1UA 2KJCA 2PN6A 4R6HA 4NWDA 2HZLA 1O7FA 4X48A 1N3XA 3K2ZA 4MBPA 4KCCA 3T8RA 5H8SA 1RYXA 2QQ9A 1R58A 3TODA 2X26A 3JAMZ 3CLOA 4FE8A 1V4RA 3RIRA 4LD5A 4N0BA 3CTAA 4G7OF 3I58A 3F8MA 4IXAA 4GWOA 2V6CA 2V84A 2XKOA 3FXUA 1D3KA 4MFIA 2BGCA 2VBYA 4NHJA 1SI1A 3TDJA 4YG2F 3K4UA 1LCTA 4P55A 1ZG1A 3MAJA 5JK4A 1IUDA 3UN6A 1B3LA 1MDMA 1I27A 5ITPA 1J5YA 5DEXB 1SD4A 4QSEA 4YAHX 4G8MA 2H27A 4FEBA 4BXUA 4N9IA 1R5HA 1FBSA 1IN4A 1G3SA 1QW0A 4I9DA 1STZA 2E1SA 2NWJA 5JTYA 5L9OA 2RKHA 2F5XA 3TEPA 3E6BA 2ZJ2A 2XHKA 2ABHA 1MJAA 2GWRA 2IP2A 4MGRA 5H20A 2JPCA 2ONSA 3OXNA 1NHAA 4KFCA 1IXIA 3KP2A 2H25A 2NOOA 2DYXA 4QWQA 2XD3A 5BWJA 1ANFA 1B05A 4EM2A 3SETA 3I59A 3ZPLA 1O7TA 4R79A 3BFTA 1FZPB 3VVEA 5CM6A 5F64A 2Q9TA 3PPNA 1P1WA 3P9KA 2K27A 1BJAA 1ZREA 4OIOF 3ROUA 3HRMA 4F2OA 2GHAA 1Y3NA 5F7VA 3JW4A 4EXLA 3E5QA 2RKMA 4KA4A 4FEDA 4DQ2A 3HSEA 1XGNA 3MPKA 2ESNA 4NE4A 2NXOA 2Z23A 5DVJA 3V8JA 3FWEA 2A5SA 3PUYE 2P6SA 3RKYA 1XC1A 4IY6A 4ZDMA 3I64A 4HX8A 3MZBA 3ZQ7A 4G94A 1MS7A 4P0IA 1BIBA 5AIPA 3IHUA 1Z6TA 3DPTA 3LA3A 2XXIA 5H8NA 3QRFF 4KMUX 4PZJA 3VLUA 2RDPA 1NNPA 5JFRA 3DEUA 2RF1A 3LSXA 1MD0A 4NWCA 3H6UA 4NF5A 2Y7PA 4IO7A 2VD2A 4H6DA 2RCAA 3L00A 3H3ZA 1S50A 1UFMA 3VOEA 2X7QA 2A5TB 3OEKA 3V8XB 3ZMVA 1LCFA 3TCHA 1DMBA 3GFMA 2ZXJA 3FVKA 3BOQA 3DF8A 3I0TA 3RPUA 1S7YA 3BZ6A 4RK2A 3O3KA 3SZTA 4ESWA 4KUMA 3IO4A 1NFTA 3QUFA 5DUKA 1HSEA 2Z9OA 1O3TA 3G3IA 4FIMA 1FY7A 4NF6B 5I2NB 5DT6A
chains in the Genus database with same CATH superfamily
2XXRA 4XM3A 1IV8A 4XLPF 4G68B 2I0CA 5ET7A 2I48A 3FXBA 2LSOA 4A6EA 5IKBA 2OTJI 3HOVJ 3E97A 4BE1A 2XGDA 3FJMA 3O29A 4N8YA 4OFOA 1LB9A 3ECRA 4BDLA 4WF2A 2OWTA 3LSIA 5C44J 1SFUA 5FKOA 5HNHA 3WTVC 2JPBA 1VF9A 2QJEA 5E17F 3LSHA 4JBAA 4UVBA 1LJ9A 4NQ8A 5F24A 3WU2C 3ZCOA 1FX7A 1XC5A 3OIQA 5DUIA 1HF0A 3PPRA 4UXNA 3N5LA 1R4NB 3ILTB 3WTXC 4PF6A 5JVTA 3FM5A 1P1QA 3OYNA 3E6DA 4HE2A 1YTVA 4A3CJ 4MNPA 3TEDA 3CD6I 1FBFA 2M87A 5K7FA 4EDPA 2CV2A 4X0GA 2L9RA 1Y3QA 2F4MB 5LRRA 3T9HB 3I5OA 1ODDA 2UXXA 3EN3A 4MLVA 1IRFA 3E7LA 1FNNA 2HPMA 1FMVA 1FJ9A 5L9MA 2RAEA 4ECFA 3DKWA 5J16A 5J4YA 2HOEA 2JSCA 1YG2A 1VE4A 1R4MB 4LB6B 1BC8C 1AHDP 2A5YB 1P1OA 2KRFA 4XBFA 3FIRA 3FUZA 1NUXA 1FBEA 4KD5A 2HPIA 3GXAA 4M3BA 1H9TA 2E2HJ 3DFGA 2FOKA 1F36A 3IP4B 1PVEA 1YLFA 1MQIA 1SAUA 3HKZN 2DA6A 4ESXA 3TDUC 4AQ4A 1MBKA 5M5WJ 3MW0A 2IGNA 2HAVA 2GA1A 4IRGA 3RYRA 3ZMUA 2WBBA 3QU3A 4OYVA 2QQAA 2QUFA 1NNKA 4IVNA 1K61A 2Y7WA 3PV0E 1NV7A 3MP8A 4DXUA 1R36A 2JUGA 5JI6A 1S7OA 4Y4RA 4ESJA 4XXUA 3IWZA 4A5MA 4BDYA 4R2BA 1SFXA 2EZIA 1ZGJA 3H5NA 3OMYA 2J5PA 1XSVA 2W00A 1FOXA 2Z8DA 3OO7A 4G8XA 1BP5A 1BBYA 2VOZA 4F3PA 1YXIA 1PEBA 1ZR2A 2ALUA 4KYEA 3S9MC 1TP4A 2O8KA 2JA8J 3MP1A 3JTHA 2YX7A 1OQGA 4UUSB 4TOZA 4HF2A 2Z8EA 3KEIA 3OOUA 4HBLA 2V1XA 4M9ZA 2HVSA 1RUOA 1WHUA 2UWMA 1TFAA 3VWBA 3BY6A 1XSXA 2VXZA 3E4RA 3K6WA 4Z2YA 3VB2A 3E6MA 1ETOA 3TP3A 1DCUA 3E3KA 3MWBA 4LOCA 3HYIA 3RQTA 3V8LA 4Q8RA 3JSOA 3LSWA 3SEXA 2XVCA 2G9WA 2ZC2A 2L4MA 4E7SA 1O64A 2F5VA 3IFCA 4R75A 2IEKA 3M1EA 5ET6A 1ZR4A 4BDQA 3IRQA 2STWA 2X1CA 1P7IA 2DWIA 2EA2A 2Y30A 5FLXK 4G61A 2VHAA 3EHUA 5GAGJ 4A0YA 3B8BA 2DFFA 1H76A 3BPVA 3H6VA 3IOUA 3HPGA 3SHFA 1DGRM 3E1SA 3REOA 1Y4CA 2L9NA 3O6IA 4NX1A 2R4GA 1VTNC 4PBQA 3U1OA 4EJTA 1M5CA 3C1DA 3DBHB 1DSNA 4OIQF 5I56A 1R6RA 2CV0A 1WJDA 4PTKA 4WX9A 1YW7A 2QBYB 1V3FA 2Q8JA 4MO7A 5ICFA 3DTIA 1L0OC 2XSJC 5FB2A 3G4SI 1Z7NE 4X1DA 3UA8A 4XKNA 4RDUA 1K4SA 4F18A 5IPAA 3GTGJ 3KFMA 4ZECA 2EFQA 3KP7A 4NF4A 3GTLJ 1VQOI 1YO5C 1FPFA 1D1BA 2VLAA 1JUPA 2BY0A 4KIFA 2JJ7A 3S8PA 3R26A 4F1YA 4RM2A 4JDFA 2Y48A 5EYGA 4KYDA 2HEUA 3RPLA 4GXOA 2EFWA 2IJLA 1NK3P 1FPQA 5IZ1A 2X0LA 3LOCA 1X2MA 4NC8A 1MH3A 5IM2A 1RI7A 3QWLA 2FNCA 4R74A 2DA3A 1PUFA 2CQNA 5JVGF 3A1YA 3WG9A 5JHFA 3G3GA 4GBWA 5FO5A 4DZJA 4CZCA 1B5JA 4PP0A 1POY1 3A2KA 1SD5A 4F3BA 3PQJA 4MIJA 1QZEA 3H5RA 1VQPI 1I6QA 4JVCA 3H35A 3TQNA 3AKZA 1PBQA 2OWZA 1MW7A 2LMDA 3GFJA 4P96A 2DYSH 2VPLA 1OLCA 1TT1A 2ONRA 2XWIA 1LBYA 3FVGA 3TOAA 1APLC 4HSRA 2J5OA 4QLCU 1L3LA 1AH5A 5LDZA 1WJEA 1JJ8C 4BUPA 4Z6YA 1OPCA 1RETA 3OWTA 3CCLI 1SYHA 4A5NA 4ONYA 4CDGA 3RT6B 3K4CA 4YFKF 4EJVA 1U5TC 3IH4A 4QSDA 1Z91A 3U1DA 2DFEA 1MM6A 1ZKBA 5GAEJ 3LSKA 2P3NA 5H8QB 1U8RA 4K3FA 3SJMA 2CUFA 4YKJA 1G3YA 1A8EA 2V6EA 4ZEIA 5DYMA 1M1EB 1XCBA 1BI1A 2XPWA 4LG3A 5HVQC 4L0YB 1P2FA 1UG2A 1JXSA 2TDXA 2FYIA 3HN0A 1B59A 1SW5A 5CQGA 2DI3A 1CNQA 2DJNA 2V1NA 4CCOA 1MQJA 2VD3A 1XDUA 4X6AJ 3E79A 2H99A 2O68A 3V5AA 3O8HA 1BW5A 4PFIA 5HS8A 1QVUA 1FPLA 3MYUA 1MPDA 3CDLA 5IP6A 3FDYA 3PD8A 3BTJA 3L2RA 1VQKI 5K2YA 4F2QA 3BJAA 4ENKA 2O7UA 4EQQA 1WCMJ 4NDLA 2LH9A 3LSJA 5TJJA 3O6HA 4QFOA 3WTTC 2LRDA 2UVJA 3CCSI 1P1UA 2VT5A 4F31B 2COBA 2MW8A 2L9SA 2IS6A 1FOYA 3OD7A 2IEEA 1I6XA 4HX7A 2O1LA 2QS3A 5AA1A 4ELPA 1G8XA 4PGGA 1X1BA 1R71A 2LFBA 4D7NA 4OWRB 3TTMA 1LAXA 3A4CA 4GYIA 3IUOA 1UTHA 1WSUA 4XKBA 3HOTA 4WEDA 3CF2A 4H67A 3H6WA 4NNJA 1SMYF 2VBWA 2HHMA 4MH5A 4I2OA 2XF5A 2R3SA 2HU9A 4XKVA 1FP1D 1R1TA 3LAPA 3ZQHA 1WPKA 1S72I 1CE2A 4O3CA 2RQPA 3L1PA 2CU7A 1SYIA 3DPUA 4JSOA 2CGPA 4RY1A 2DOEA 2FNAA 5K5OA 2I58A 3Q26A 4M72A 1Z1DA 4A3MJ 3BR1A 3I71A 3K10A 1GHCA 5A5LA 1MY0A 1XDSA 3IB1A 1XMKA 4R73A 1LBXA 4IRIA 3WAFA 2JA7J 2VONA 4NF4B 1YI2I 2X9DA 2ZJQF 2WY7Q 2QMXA 1TWGJ 2H6BA 2ZO4A 3IH2A 2PI0A 2R71A 3MSTA 5I59A 5DTBA 1QBJA 3CO6C 2RGVA 4GWUA 4GX3A 1DTGA 4GDFA 1YPNA 1BW6A 2DFIA 1TZLA 2HS5A 2V7FA 5EEHA 1QVSA 3LUYA 4A3FJ 1A54A 5LHIA 3IOTA 4G6TB 4E7IA 4KDPA 4M4GA 2Q1ZB 3KC1A 1B40A 3ZGKA 4NHBA 3TO6A 4U2RA 4DI3D 1FJLA 4A69C 3G1MA 4BAYA 1P9QC 5GPAA 3CUQA 5LFAA 1NKXA 2JT1A 1JGSA 2DA7A 2EB7A 2OAZA 3DCFA 1Z9CA 1AKHA 1P99A 3ZN1A 3MKZA 3OYJA 3DV8A 1B9JA 4H4KC 4L17A 2L7KA 2XAHA 4CO8A 2R5ZA 3FGSA 3QSLA 4OVRA 4IOAF 2HOAA 1LFHA 2RC8A 4BLAA 3K6GA 3QPHA 4DYQA 1GDTA 5FHNA 4OEVA 5D5XB 1NV0A 2E1MC 2B3FA 4PUSA 2P5LC 3MD2A 4BU2A 2Y75A 1YW8A 3TAJA 1UHWA 4WXJA 4YB6A 4YKKA 1S8NA 1R7JA 3VYTB 1MH4A 1GR2A 3IJXB 5D8KB 4HDVA 5IP9J 1FTJA 2ZXIA 3U92A 3E3VA 2YJPA 1FBPA 3RPLB 3W9WA 5AE4A 3I4NJ 3FASA 3FM3A 3U1KA 4OIPF 3T96B 3ABUA 2EIKH 1YOVB 2BHZA 1MSFC 2KIUA 1FPEA 1UIUA 3G3JA 4FECA 5EHSA 1F9NA 2Y2ZA 4UHTA 1T0FA 5C4XJ 2P4WA 1LAHE 1XVXA 3C34A 4OXVA 4X8RA 3TKYA 4ZZEA 1BTJA 4BJTA 1SEUA 3ZMSA 1KU2A 1VI0A 2GOXB 1YX5A 2EFPA 1MY1A 2DT5A 2E5ZA 2DPDA 4G4PA 3MKYB 2ZYNA 4G77A 4BL0B 2BW3B 4U4SA 1QULA 2PJRA 2JZYA 4LVQA 3R7XA 5LRSA 3S1MJ 3HL2A 5A5XA 5CLSA 1RRJA 2ISZA 1KWHA 1W7PD 1FTMA 1Z05A 3K02A 1BL0A 4N91A 2IXSA 1Y39A 3F3XA 2GH9A 4QRZA 4KMFA 4IY5A 2HQRA 1TWAJ 4BDMA 4P11A 1H89C 4A2UA 1ETKA 5FRNA 3CCRI 1LKXA 4DCXA 3FJ7A 3HSTA 4FBPA 3QUJA 1SVOA 3W2AA 3S17J 1YS7A 3IB0A 5FKLA 1BR2A 3BJOA 2AO9A 3WU1B 2VASA 5E3OA 1RYOA 1MMSA 2E1MB 3BTLA 2DXRA 3ILUB 3TGNA 3NWSA 3GFLA 5DDGA 3LV0A 5DS9A 1IQ7A 1OYWA 2GHBA 2R7UA 5KDTB 3OR1C 4D0PA 4II3A 2R7QA 4ZYEA 4R6YA 1NV4A 1T2KA 2M2EA 1FPJA 3B6WA 4IO9F 2OX3A 1UQWA 1W0UA 5F27A 4C2TA 2BJJX 3NARA 4CHUA 4F55A 1ZRDA 2LP0A 1USSA 2KT0A 3VYSB 2PMUA 4MEYF 5FLMJ 4BBRJ 1KYWA 1HC8A 1MNDA 1FCKA 4LONB 4EVIA 1G0IA 1MDP1 3FHNA 2HYFA 2PBIA 2W7NA 1UTBA 1IZ1A 1Y8RB 2ZNYA 1IRZA 1MZBA 4BJ5C 2MH9A 1ZRFA 2MSYA 3ZQCA 3BDDA 3OYHA 2P1SA 1H0MA 5IOYA 1YJNI 2XA5A 1TT0A 2COMA 2LR8A 5A2QK 4IHXA 2VT3A 5FLXZ 1JW5A 4OA4A 3T1BA 3V7CA 4EJUA 4L9VA 4X1EA 1UTHB 3OSQA 4HXVA 1R22A 3TPAA 2XKPA 1O4XA 2VPRA 4ON0A 2HNHA 4ZJZA 5EEAA 4DXCA 3F22A 3TQLA 1NNTA 3FMRA 2XDVA 3EYYA 3OSRA 4NG7A 2JWTA 4YB7A 3HV1A 2YPRA 2LK2A 4Q48A 2JVGA 1JETA 4D1QA 1E2XA 2XXTA 3KOTA 3OELA 4JX5A 1B72A 3PMVA 4QFPA 4YIIA 3WTUC 2QVOA 4P47A 4DXBA 4Y15A 3ECOA 1ENHA 3Q9VA 2HXWA 4LMYA 4M71A 4AVPA 3HC7A 4N13A 1VFDA 1QPIA 4RB2C 3JRDA 1X1AA 3VPRA 1XS9A 3A09A 1Y0UA 1UHMA 2GA2A 5LD2C 1DP7P 3LBSA 4TLMB 4MFDA 3PPNA 1JVYA 5KCJB 2GOMA 5DW8A 3ZSFA 1JT0A 5FJ8J 5KDTA 3N94A 1IW7F 4HV6A 3BCBA 2HZTA 4OERA 2CQQA 1YYZA 4YKPA 2RQQA 4EXKA 5K5RA 3PNYA 1VQ9I 4RM3A 5IZ3B 5IGAA 1LFIA 5BMZA 2QFLA 2X51A 3F0CA 3OYBA 2WX9A 2VOPA 4GLIA 1T0KA 4Y7NJ 2F5FA 3J81K 3CMYA 2Q2EA 2LD5A 3O66A 2KZVA 3EPZA 4AIJA 3EUHA 2OJTA 2DQLA 4RAGA 1TWFJ 3PQKA 3PPQA 4GVOA 3KETA 3D5RC 2NS0A 4LA9A 1FTAA 3KJ7A 3CMMA 4CCJA 1IC8A 1WJAA 3CFXA 1F1ZA 2V1DA 3I4PA 2ZYOA 1N04A 2FUG2 2HTSA 5EJCA 2GRVA 4OEUA 9ANTA 4OESA 5HS7A 2VODA 1K78B 4KR5A 4PF8A 1ETWA 3H06B 1MGTA 2V3UA 2ZBKA 2JJKA 1MXWA 3TQWA 2RC9A 1X19A 2L5QA 2NOGA 2LY2A 4L18B 4S0HB 2Q8MA 2DT6A 5TP9B 1GVDA 3TO7A 3ZMDA 4ENJA 2PVUA 2VL8A 4XQFA 1IN7A 4BHPA 3KYLA 2BHYA 2ZMEB 2Z16A 3C32A 4EJOA 2CZLA 2V3TA 2VE9A 3PMXA 2R5YA 1V55H 1S7EA 2M0CA 1FTZA 5FD5A 1AU7A 2XX9A 2BE5F 1K7AA 2L9VA 2Z2SB 3HSRA 4B3AA 1Y56A 2ZNSA 5H8NB 1O3QA 4S05A 1XCVA 3H3VK 5EG0B 4UB8C 3I4MJ 3JRBA 4DI4B 4GCVA 1D0YA 3I3LA 2F5EA 3CFLA 4NF5B 2K3PA 1IXGA 4NF8B 4DZPA 2CWEA 1XTAA 1HLVA 2NRAC 1J9IA 3F6OA 4OMZA 2IVMA 1FYMA 1O63A 4PCDA 4PC9A 3SXYA 5E3LA 3K2AA 5IZ3A 3HB9A 2WA0A 4GL8A 3F21A 1N0TA 2ZXTA 4MQ9F 4XKCA 5L3CA 2UXAA 1FC3A 2GQQA 2EV6A 1RKMA 2W24A 4M1VA 1MBJA 3K6VA 4F22A 2E60A 3BR5A 2P5KA 5KVRA 3C7JA 3WHBA 3FXJA 1W5SA 2D5VA 1H9GA 3OYEA 4GRKA 2WWYA 2Z33A 5ILUA 4YEJA 5H8QA 2WAEA 2PFYA 3F11A 2WAQA 1KZ8A 3CRBA 3F9KA 1B8IB 5LGTA 5J40A 2V79A 2YSRA 5EYFA 3ODBA 3FK7A 3KPHA 2W57A 4G68A 2MABA 2NUVA 2DBBA 3CC4I 4F91B 5FHMA 4U0VA 2B4MA 3MVWA 2QYOA 1UTBB 4B3XA 1B3FA 1DPEA 4PGPA 2Y0SA 2V9VA 1ON2A 1SMTA 4B8XA 4KIBA 4ZTFA 1J59A 5D8LB 4E70A 1IO2A 4FHTA 2ISYA 3H3GA 1QZYA 2DA2A 2OF7A 4PDDA 1B8IA 3I59B 3KE2A 2ZKZA 3V8KA 1GGGA 3MVZA 4AIDA 1Y1VJ 3M8EA 4I1DA 1SFEA 2BY2A 1CB6A 1XB4A 1FIPA 3BR0A 4HF0A 3M07A 3ONQA 4RXLA 4OAYA 3TTNA 1XN7A 3GVAA 1FT9A 2DYRH 5JLXA 5HDNA 2AHQA 1IV6A 4HF1A 1FYKA 4HV5A 4BQNA 2AYSA 5DVFA 1OYIA 4BY7J 1TXFA 3LR1A 4QF9A 2DE4A 5FBPA 2JA6J 3B6AA 2AS5F 2E19A 2DFHA 2M8EA 4A3DJ 1KQ8A 2IA1A 3H0GJ 1GLNA 3I54A 1FOKA 1FIAA 3PJRA 2OZZA 5LHGA 3GTKJ 3Q3SA 3R0AA 3PUWE 1X3WB 2YLNA 1HKSA 1O57A 1JP4A 2O84X 2XX7A 3GBAA 2LF8A 4LFUA 4ZEDA 3ZKLA 1LBCA 2E34A 3PNTA 2VOOA 1LEVA 4FORA 3VVDA 1MNMC 5IY5H 4UACA 5AONA 3DPLC 3LQQA 3UGWA 1DTZA 5EGOA 3Q29A 2M3AA 1X4OA 3DLAA 4AS5A 4DW6A 2V26A 5DCMA 4HSTA 2Q74A 3M8FA 1T8IA 1ZBMA 3O2AA 1LDJA 2Z8FA 2F4IA 3TDZC 1MXZA 2ZFUA 5H2FC 5J1RA 3HOSA 1WFXA 3HHHA 4GWWA 2PG4A 3KSJA 3LWFA 1ETQA 3FMSA 2HGCA 3FATA 4NF6A 4PJNA 3TELA 3W15C 2G7HA 3S3NA 2IPQX 4B43A 1DQUA 4PFUA 2DOAA 3BQYA 3K69A 5TGTA 5ICGA 5LGNA 4UUVA 4BE2A 4ELRA 3MWMA 1DU6A 2LC2A 2R5YB 1K9YA 4PJLA 3Q0VA 2REJA 4PFOA 4G2ZA 2QS1A 3RDIA 4BQQA 4HQMA 5L3GA 4XMYA 3KG2A 3TUSA 5E79C 4GWXA 1ZRCA 4E7ZA 1F9BA 2O51A 4GWYA 1JQFA 1X3ZB 2Z99A 3K0LA 4AB5A 3FF5A 5CJ9A 1IITA 2M8GX 2RN7A 1G4DA 4HNUA 3KJTA 5I2NA 1PYVA 4A93J 4GWSA 3S2DJ 4BH9A 3AG4H 2Y9ZA 2Z22A 3F72A 1R5GA 2IT0A 5ILSA 3JR9A 1J7KA 5DTDA 3OYGA 1Z0XA 2DE3A 2H9BA 1D1CA 2V4JC 3WE3A 2OZ6A 2MLGA 1XSDA 2VBZA 2CW7A 3QYEA 4JP0A 1UB9A 4AVZA 2HI3A 1NV2A 1A99A 3ERMA 1N7WA 1ZGWA 2HYGD 4XN0A 3RTFB 3U9GA 2X6OA 4KHZE 1POGA 2GXAA 2KDOA 3G1LA 3KEYA 5KZTA 2XF6A 4GF8A 3SEZA 3IL2A 2IS1A 3H5AA 4MNCA 1PP7U 1BLFA 3F8BA 4UVCA 5FFZA 3GF2A 4KJZA 3ABKH 1FW0A 1GV5A 1RZ4A 2E36A 4RGXA 4XICA 1RDXA 2IA4A 3Q27A 5H6QA 4IX7A 1H44A 3H9GA 3HJEA 2XAQA 2ID3A 1MDMB 4BHCA 3IR1A 1B2HA 1WJ5A 3LFKA 5A2QZ 4F39A 3JRFA 4PE3A 2KP6A 2ZSIB 3PUVE 3MBPA 1OIBA 2QL3A 3JTGA 1SBPA 3HOUJ 4BXFA 2DJIA 2HKXA 3JRCA 2QVUA 2I8DA 1LNWA 2UVHA 3PL8A 3S2VA 1ZGAA 1FOWA 4ZH4F 4P1WA 4WCGA 1MSEC 1FQBA 1OCCH 1Y6IA 1H43A 1NUYA 3EF7A 1KA8A 4NB5A 4YZZA 1Y8QB 3K70D 1LQ1A 3RPWA 4O5VA 3G3KA 5FROA 4CYCB 3I5UA 3R4KA 4ZDMA 2LKPA 4RGSA 3KCCA 1RDYA 3KN7A 3TFLA 2KZGA 3HKZA 2Q88A 4YICA 1JKOC 5DYHA 2AXTC 3RNNA 3LSPA 5JEIA 2ANJA 4ESFA 1P1NA 1QQIA 1A35A 4R8HA 3E13X 4HZFA 4EQ9A 1ZTRA 1ZLJA 4IB2A 2L4AA 1CF7A 2OV7A 2XB5A 4NAPA 2A3SA 1KA1A 3GEZA 1KQ9A 1ON1A 2XUBA 3O6BB 1DOTA 4HQEA 4WWCA 1YITI 4RNSA 3W2VA 4V2GA 1K6YA 1TLHB 2FRHA 4I0BA 2R7WA 4RJZA 1XPXA 3HCQA 3RN8A 3IRRA 2ID6A 2JUCA 2X6XA 4XLHA 4LUBA 1YRNA 4OWDA 1WH5A 1Q1VA 3G6EI 3KZYA 3GZGA 1B4AA 1FSEA 2JTVA 2XAGA 3D5SC 1E3PA 2OU2A 2MKZA 1TNTA 4ZYDA 2BEOA 3MQ0A 3COAC 2ZMBA 5I56B 2K4BA 1H8AC 2ADUA 5HBCA 4TQUQ 2XPUA 4GWZA 4FE8A 1LB8A 2V25A 3PO2J 2JQ7A 2NS7A 1K79A 5K1YA 3DLNA 3H92A 3TO9A 1NMUA 4G7OF 2HKOA 3JAMK 1HW5A 2MD0A 2HQNA 2V9PA 1MIJA 1A55A 1FJ6A 4MEXF 4CXFA 4IL6C 2DQVA 2G29A 3BKIB 4XKQA 1YHQI 2VI6A 4E4HA 1QJMA 3T9UA 4DNCA 2FMYA 2NS8A 2KPMA 1G3WA 3PO3J 2GBYA 2UVGA 3EQ1A 3UP9A 3PSIA 5J47A 1LSTA 3G71I 4HAMA 5B7DA 1BR1A 3PFIA 3SZGA 3ZRGA 1MBFA 3U94A 3VE1B 4FISA 1LE8A 3J7YJ 2JSPA 4FE4A 1FBQA 2GXGA 2PJPA 2HTJA 1HSJA 1ZYRF 2E1NA 3OENA 2PT1A 3QOPA 1ZQ3P 3H6TA 5E3MA 3OO6A 2AL5A 2CZHA 2XXPA 4U23A 4PFYA 4XIGQ 1EH7A 1JE8A 3EPEA 1VNDA 3DELB 2P0WA 5FHOA 1Q35A 2Z3YA 5ET8A 4C2MJ 4BHBA 2THIA 3D4CA 4P5OA 3C18A 4N6DA 4ESBA 3W6JB 1JW4A 3AL0C 3BIHA 5JLWA 1FQFA 3K9TA 2FA5A 4IF4A 3T5XA 4AWXB 1URSA 3C9HA 3KBRA 5KAIC 1OLAA 3PTYA 1HSTA 3T9VA 2MBFA 2JRTA 3D1NI 5AA4A 2XXVA 2ZNTA 4IO5A 3RYPA 4KYWA 2FMLA 1FQEA 1EKEA 1MMAA 1BN5A 4AD9A 4UV8A 1MXUA 4U21A 3KFWX 3MVXA 5E3NA 1IXCA 2B3BA 5ESYA 4JX6A 3L6GA 3IOWA 1IN5A 2ZXHA 1LDDA 1IXSB 2ECCA 5JHUA 5L3DA 1E17A 1JW1A 4N6PA 2H94A 3H3UA 2VN2A 4UB6C 4AUXA 4NQWA 4V19K 3FV2A 2QSGX 4XSZF 3S1NJ 3GCMA 4BS9A 5ERIA 4RB3C 2V3QA 3VXBA 4RGRA 3RYDA 1PDNC 1OMIA 5IYDJ 1OCRH 5LTCA 1USYH 3S1QJ 1EJ9A 4WK8F 1FYLA 2B7EA 4QTRA 3I3VA 3MVYA 5LGUA 2L5VA 5GPCA 1MBEA 3HSFA 2CW8A 4OIRF 1MMGA 4KIGA 3CMEI 4A12A 2LREA 4RLQA 2KISA 4EF2A 1LEAA 4AC0A 5EYHA 3GYHX 2H4IA 3PPOA 4PFBA 5B70A 4NQWB 1E3OC 5D5VB 3BG3A 4NF8A 4Q5SF 1I6AA 1LAGE 4IO3A 1QU3A 4FX0A 4FCYA 1XI6A 5CI5A 1USYE 2G93A 5GADJ 3DP7A 2FVZA 3IC7A 3BC8A 3A3CA 3E0JB 3KOSA 3OOAA 2IW5A 3L2UA 2HQAA 3L6HA 2BOLA 5CVVA 4FX4A 3MMYB 3P5JA 1LBBA 3J80K 4JWXA 3IKTA 4ZE8A 5E1XA 1R49A 2O0YA 3ELKA 3L7WA 3JREA 4H0WA 3SEYA 4I99C 1YFHA 4AS4A 3DBRB 3FZVA 1QHHD 1U78A 1XOCA 1ZTYA 4X1BA 3ZKKA 5D5UB 2L7FP 1MMNA 3BCAA 1AOVA 2H98A 1N84A 4OINF 4FASD 4I3EA 5H8HB 2F35A 2DS9A 4PAFA 1O3SA 4FAJA 1K78A 2I4CA 1X2NA 3HPHA 4GQOA 2M8CA 4UVAA 3PIPF 1BM9A 2JK3A 4ENNA 2OCUA 3PUYE 1JKQC 5FTHA 2BY1A 2O6GE 1SD3A 5ISUA 3BLYA 1JI8A 2P8TA 3HHFA 3OEMA 3C3WA 2F6PA 1PBPA 2VJIA 3SDBA 2XIGA 1YCJA 1OISA 1R5ID 5IZZA 2XGCA 2PMZA 2BXYA 2MC3A 1ZELA 1AOYA 4MHGA 1T0FC 4MFEA 1GVJA 2FQ4A 2Y7RA 5I2KA 2WB1A 5K5QA 3RJPA 3PGFA 4OENA 1Z7UA 3ZR8X 3R0JA 4EGZA 1ZARA 2ZCWA 2DK5A 2QQBA 1A8FA 5ICQA 2RNGA 3HRTA 2EJRA 1D0ZA 2L7MP 3EUKL 3RKWA 2KR0A 2FA7A 5TPAA 4D7MA 1IDYA 4EGYA 1TT5B 1SW2A 3R6UA 5CVJA 3WODF 1Z77A 4OFJA 2K9QA 1YX3A 4OAZA 3KP4A 3FIWA 4MIMA 3ULQB 5M3MJ 1VQLI 1DPRA 3H9QA 1LVKA 4II2A 1B32A 1OVBA 3S2WA 2DXIA 1WJFA 3GYYA 2BBYA 5I59B 4ZZDA 1M5FA 1YE9A 1FLIA 3TCGA 1IXRC 5KNLA 5HLGA 3AAFA 4I09A 3C35A 1R1UA 2XXQA 3MZYA 4C1TA 1E3HA 4LLLA 2QM3A 3OV8A 3K70C 1MY3A 1R9QA 1G6NA 3NEUA 5K7HA 3FVNA 4IHSA 1Y9UA 3IOVA 1N3WA 3RY3A 2BVMA 2LY9A 3PUZE 1DGWY 2KIFA 2M4KA 2M4GA 2YR2A 5F1RA 1T98A 2OA4A 1U5TB 3JYRA 4DLDA 1B46A 3J7AY 3O6GA 5KK1A 4C3HJ 4EV0A 3TOBA 1M5EA 1P4XA 2B4LA 4BACA 4G8NA 3GUDA 4BBSJ 4X9TA 5J1DA 2Y7KA 2YUSA 2F48A 2KMUA 3WGGA 5TPAB 5DD4A 4F92B 2E2JJ 2KJBA 2NVUB 4E7JA 3S93A 2XWVA 3DLLF 3C4MA 2VIXA 2D2WA 3G3HA 1BC7C 5TU0A 5BPIA 2F7AA 5CVIA 2Y84A 3FBIB 1K6OA 2O5RA 3QYFA 2DDKA 4N9HA 3DM0A 2VJ4A 1IMAA 4DYRA 5HODA 4F93B 1MG1A 2KLOA 1NUZA 3OS0A 2VT2A 4HLYA 4PETA 4O6JA 4DYCA 3KLOA 4WXHA 2CJJA 2XAFA 3FX3A 4BXXJ 2AQFA 4OANA 3K00A 4LZ5A 4LZ8A 3GBBA 1NH7A 3CJQB 2VC0A 3ESWB 2DMQA 4A3BJ 1NH8A 3VV5A 4U0YA 2I0BA 3CDHA 2DXYA 3CC7I 2R6GE 1V5EA 1PP8F 1X1DA 3F23A 1NG6A 4DDDA 5A5XB 1WDNA 3LQRA 1A36A 2F2EA 2MYSA 3QU6A 4JWOA 4HW0A 2QRYA 1B6AA 3ABTA 1D4NA 3PPPA 4DIGA 3PU5A 4F52A 2NVTJ 3HOZJ 2GM4A 4LITA 2I4BA 1LEBA 1LFBA 4JX4A 2LDUA 2O1MA 3S4UA 4I02A 2LTPA 2O69A 1SD6A 3A03A 3G3FA 2W85A 3I6VA 2K9MA 3I53A 3P9CA 4LK0F 4RS8A 3CCQI 5B3SH 2DPUA 3AXFA 3DEEA 3H0DA 2FJ1A 4NBQA 3K7AJ 4W1UA 5LBQA 2I49A 3KLNA 4LIVA 4G6DA 3WTSC 1FPDA 1URDA 3O28A 4I8CA 4H0EA 4BDNA 2DDAA 4P0GA 2XC7A 4RAFA 2QS2A 2BY3A 2CMPA 2A68F 5EQ7A 2CV1A 3GTPJ 2HDDA 2F5DA 4IZZA 4GBVA 1RR8C 1RUNA 4OMYA 5FFXA 1W0TA 2HPGA 4YRVA 4JXIA 5DVIA 3ZQLA 3DXJF 3RUMA 2CYYA 3GWZA 4D9JA 3ZN0A 1K9ZA 2W7YA 4JB7A 4MLOA 1Y4TA 2E1OA 1HDDC 4L0ZB 4LGWA 1B4ZA 1MPBA 2EV5A 4EJWA 1KONA 4M3GA 4G7ZF 1B9NA 4C2UA 1G0HA 1REPC 3WAEA 2CFOA 4F3QA 1ZAOA 1WRJA 2X48A 3GFIA 3MQ9A 5ILVA 4U88A 2HFBA 2DO7A 2ZYKA 2Y5LA 2XF7A 5I57B 1B0LA 2OTLI 1TBXA 4IRHA 4MNUA 1UG0A 4C3JJ 3S3OA 2R7ZJ 3S14J 4ETSA 1FBDA 3IO6A 1VDWA 1BOBA 2WV1A 3GXOA 1I3QJ 4IOCF 5KCJA 4OQOA 2MGQA 5I84A 2DODA 3CFZA 2RNJA 2H8RA 4A3GJ 1QO0D 1TWCJ 2XB0X 4RB0A 3VDFA 2CUEA 4DJAA 3IH3A 4MNIA 4UV9A 3HRSA 3UNGC 3CR9A 3MFKA 1GV2A 2W1OA 4U1ZA 5I57A 2YU9J 1S29A 4XONA 3LC8A 3K1PA 1SFOJ 1IMCA 1QGXA 2EA4A 2ZMEA 3DTKA 1S7AA 5K2XA 3KEQA 5E8GA 4HLXA 2OZUA 1BI2A 5CRYA 4CCKA 2WAFA 4E0WA 3B6TA 5H8FB 4C3IJ 3O97A 3K4NA 1O7LA 4I01A 3W9VA 2IA2A 2FBKA 5LEKA 1XG1A 1R1NA 1L5TA 2XAJA 2KRHA 3FXLA 3BG6A 1S6LA 1U2WA 4WXDA 2R9JA 1BOAA 3HUGA 1JUSA 3OS2A 3UR3C 1G2HA 2Q89A 2XX8A 2B65A 3M3FA 4ZDOA 1YS6A 5HS9A 3VODA 1JTXA 4PFPA 3QAHA 4HCYA 2DWHA 1RR7A 3CQZJ 4FT8A 3ERED 1EH6A 2Q2EB 4O94A 1QNTA 5F1QA 4PJMA 1IJWC 1WWXA 4M6XA 4PK4A 4BDZA 5J1UA 3S1RJ 2OJED 1FMWA 1N75A 3FXRA 4YU0A 4ZEFA 2DOJA 1K83J 3JRGA 2ACJA 4XRSG 5L3EA 1QUJA 1T39A 3HUGB 3QP5A 4RMNA 2XXHA 3RKXA 3B6CA 5EZHA 2EFOA 3OYCA 4R72A 1WH7A 4M6VA 5EF6A 5M3FJ 3D4GA 2DTRA 3BFUA 4HE0A 4H1XA 3EDPA 1FPGA 2VQCA 4J00A 2CEXA 1QVTA 4GL0A 3U93A 4XLAA 4M9XA 2RV8A 3LA2A 4XRSA 3ZXSA 2DVZA 3ONMA 2VKVA 1ZG5A 2CZKA 3QPSA 3C31A 3TYHA 5D5WB 2X85A 3P7NA 1IGNA 2CQKA 1SVMA 3IAZA 1IN8A 3GMEA 3B50A 3G73A 4HTGA 2C6YA 2FD5A 4ZYHA 2XRNA 4N4UA 1SDXA 2QVRA 5IOZA 1QGPA 2R7OA 3CJRB 4P9FA 1B0HA 4MF3A 1LVAA 3CCMI 1FWZA 3CLQA 4N4NB 4B4CA 1JJ6C 3RTWB 3GZNB 2BVLA 1X1PA 4XOTA 2HCAA 5HNFA 4EF1A 2G7UA 2QPQA 1W5TA 1QKAA 3CCVI 1NV6A 1NV3A 3MZHA 4YKIA 5J8CA 4XKPA 3VVFA 1FP2A 3CJNA 3ASNH 4D5CA 3L2CA 1HA8A 4N8GA 5C3EJ 5ITOA 1GVCA 3G1OA 3N26A 3VFZA 1TQIA 3KEOA 3VLWA 4A3JJ 5L3BA 5L8DA 2XGXA 2V93A 2R0QC 1QRYA 1HKQA 1QA6A 1ITYA 2HDCA 2DQRA 5CBRA 3BJ6A 5EQ9A 5AA2B 2DA5A 3QXMA 2BW3A 1SW1A 2LLKA 2H1LA 4G9YA 2PBWA 2E71A 4OVTA 1AL3A 4Q47A 3OSGA 4GIZA 5DM6F 1EYJA 3DP6A 4P1EA 3VXCA 4H8JA 3HOXJ 3OSFA 3OIOA 2K85A 2DMPA 2YU3A 4KITB 1YJ9I 2P0SA 2Q2AA 2F6GA 1NI9A 5J3LA 3SDGA 5BPDA 1B3GA 3D1RA 3MC2A 4GYGA 2P5VA 1W36D 1MQHA 2KDZA 2YPNA 4XF5A 5E20A 2EH3A 4MTDA 3OYKA 3RLFE 3T93B 2W48A 1LFGA 2F3BA 1ZK8A 3LA7A 1G3TA 3MZ1A 5AA2A 4KI0E 3RCOA 3ZMZA 3TP0A 4BE0A 3I56I 1J1NA 4ZEBA 3HM5A 1PJRA 3CCEI 1MY4A 3CP8A 2QZ8A 2LVSA 4H8IA 2Q8KA 1P7JA 3QODA 3ZQGA 3MAMA 1MPCA 5EGOB 1XT8A 3P9IA 3BBRA 4XTCQ 4RAZA 2P7VB 3K1NA 2DE2A 2M7AA 3NOHA 3TZAA 2QKLB 2EFNA 2M45A 2QMWA 5CMBA 4PFTA 3FHZA 1YTYA 4IHTA 2DAOA 4H46A 3T0JA 4C0RA 4CZZA 4A0XA 2GLOA 3THIA 2ZZWA 3A0BC 4ZZAA 3OYIA 1HCRA 4KQPA 3HHGA 1ZHFA 3PIOF 4ANJA 1AKHB 4XKWA 1PC3A 4QSHA 4M3FA 4RBOA 3HOWJ 4XRFA 3AFHA 2PYYA 2M0MA 2M34A 2HZDA 4BYYA 5B1AH 1O3RA 2K86A 4PDKA 2R7SA 1B58A 5HOOA 3OS1A 1B1HA 1H3DA 2HR3A 2OBPA 4RB1A 4DIQA 1TC3C 1VSOA 4GXSB 5IAIA 1T33A 1RPWA 1S3JA 2FU4A 3LSRA 4O8MA 1P6RA 2RC4A 3T8TA 3KSXA 2KQRA 4QSCA 4EM1A 5ELVA 4E7HA 5IT3A 4ISUA 1ZIUA 1TL8A 5K7ZA 2H1KA 4A0ZA 4R6KA 5FD6A 4QBAA 1X58A 4B44A 4OVSA 1OJLA 4HG2A 4IHWA 3AL0B 4O3BA 4XNFA 2LF7A 3M1CA 2PT2A 1MQDA 4KCDA 3J7AO 2LYCA 1US4A 1I50J 2ELHA 5I5PA 1S5LC 2BXZA 4CSWA 4UA8A 5M2VA 4MEVA 1WI9A 3ZQQA 1D3YA 3OYMA 2DMTA 2MA3A 3VYRB 1ZMGA 3H4ZA 2ZXWH 3BROA 4WXCA 1Z67A 2F6CA 5D4SA 2UZKA 3KN8A 3FVOA 4XR6A 2RC7A 4GOTA 3EQLF 2GXBA 4MMPA 3FMQA 3CG1A 4PSXA 2ZNUA 1B6HA 2VQGA 5ICCA 2IS2A 2E0SA 3CCJI 1IMDA 5D4RA 3MZ9A 3MEXA 4IGRA 3DTEA 4JYKA 2I6EA 4NMYA 1XD7A 2QQ8A 5LOMA 1JKPC 1ZJLA 5FKKA 4RYAA 5LLQA 2RINA 1JVXA 1QHGA 4LG0B 1W4MA 1I69A 4OVPA 1LB2A 1B7UA 2H6CA 1K4TA 4AYBA 3MCZA 2P81A 4L9JA 4IO2A 1YIOA 2PX1A 2ELJA 5CVRA 5HLTA 2ZNZA 3UORA 2FX0A 3H7MA 4H45A 5FRMA 3CI8A 4QFNA 4A6DA 3E78A 4CICA 1B1BA 2OCEA 2KFDA 3SYTA 5BQTA 3FKJA 5JR3A 3CF5F 3NQOA 2W4SA 2FEZA 2R7RA 4GFRA 2DU9A 5I7IA 2NOJB 2PFBA 4CA0A 2EILH 3U72A 2QEXI 4GGGA 1VR5A 3E5XA 3EYIA 2QWWA 1WZ2A 4QHQA 3WHCA 2EWNA 2LY1A 3WE2A 3O2PE 1HBXG 2Q0OA 3KP3A 2M30A 4PGHA 4LLNA 2DA1A 2WYKA 3V83A 4QPOA 3HTUA 5GTIC 1LAFE 1AIVA 5H6RA 1FTLA 3CESA 2DT7B 1CGPA 2FBIA 1JKRC 4U0WA 4CYDA 1OR7C 2CUZA 4C30A 1Y0NA 3PUBA 3G3ZA 2R7TA 3I9V2 4U22A 4LLGF 2W84A 3T0YA 3I55I 3C33A 3Q28A 3G2BA 4IJAA 1D5VA 2D1VA 1URGA 5E18F 2VBXA 2Q9TA 2ZFWA 5LHHA 2KKOA 2VUMJ 2UYFA 1A04A 2IRFG 1UZCA 2GZWA 4L5JA 4XIDA 4CGZA 5DCFA 2ZZXA 1J09A 4GFBA 6PAXA 1LGBC 1TW3A 2K02A 1MDQA 2A5WA 3HBLA 3Q5FA 3UK4A 1VQ4I 2VJ5A 1FBCA 2X4HA 4NC6A 5J8FA 1X1CA 1N25A 1RDZA 3H03A 3O8GA 2FQ3A 1NH3A 4N15A 3F8CA 2JN6A 5F0HA 4C1UA 3EKIA 1ZU0A 1IMBA 4DBRA 4Y52J 2P6TA 4XLFA 2VE8A 2O3FA 3CHGA 3UKGA 2R7XA 1W7PA 1TQPA 2WV0A 2EPFA 3EHTA 3K6UA 1MNEA 3QPLA 5BS6A 4I40A 1OQYA 3FXQA 1TNSA 4U7BA 3OL3A 3TMGA 2ETHA 1OLTA 3QPTA 3F6VA 1WODA 3HRUA 2ONKE 2OPTA 4NTLA 3OO8A 5BOXA 3C36A 2IGMA 3HIFA 1FTOA 4AIKA 3WTYC 2E7XA 3IV5A 3BR3A 2PX9A 3L09A 4IHVA 3IB2A 3MKLA 5EQ8A 1MBHA 1UELB 2JMWA 1ZLKA 2AL4A 3IAM2 4JBZA 3DKXA 3FK6A 1P92A 4OFLA 3LAJA 4P3LA 1LDKB 1AWCA 2VKHA 4XSXF 2XXWA 1TTYA 1X3UA 5D6EA 2AIXA 4ELOA 3BZCA 3M7GA 1EYKA 1SI0A 1AA7A 2QENA 3S32A 4B48A 1V5GA 2L01A 1PUEE 3IJOB 4PDHA 4Z0IA 5IT9Z 2XXXA 1B4HA 3Q9SA 2N8GA 1D9QA 1ORKA 2DWAA 3RTRA 4UUTA 1T56A 4IKFA 3T22A 2LAOA 3CP2A 4ZZLA 3M3YJ 5F08A 3PFYA 4XFEA 1Q9DA 5EHMA 3LMMA 1N7XA 4E7KA 4MJOA 4R1HA 3OIPA 4C9YA 4F7ZA 2Y0SN 4N6KA 2I3VA 1XGOA 2X7PA 2CSOA 5E1WA 3DU5A 3QOEA 4XLEA 5BNGA 4H65A 4XLNF 5TP9A 3SKPA 3QIMA 5CMKA 1LFPA 1BIAA 4ITVA 2FF4A 2WBMA 1CQTA 2M1BA 1GUUA 2UV1A 2A61A 2K9NA 5CQEA 1T95A 1KQ0A 1XVYA 3MUQA 5F6FA 5B66C 2XGEA 2EK5A 2FNPA 3A02A 1EU8A 4LQ5A 5H8FA 2EIJH 3BQZA 4THIA 4YMAA 1BI0A 4Y3OA 1MJ9A 5D6FA 1FPIA 3WTZA 1LLSA 1VFEA 3LUZA 4GO1A 1R9LA 4MQVA 3HGYA 3TMOA 3B7DA 4G12A 4KNYA 2LNBA 1IUFA 1B3EA 1FPKA 3KZIC 2NNYA 1EZOA 4LATA 2X6WA 4I3YA 3CC2I 4P9UA 1OQHA 4A3KJ 3P7IA 1RKWA 3RQIA 1E0EA 1VQMI 2A5TA 4OVJA 4IHYA 1D9YA 2VPNA 2XASA 3ISPA 4JSDA 3E9XA 1SD7A 5F0FA 3CCYA 1V5FA 3OYAA 1ONVA 3IL1B 5AA3A 3QK6A 3WGHA 2L2OA 2RVCA 2XROA 3K2DA 4FATA 3IK6B 1I1SA 4BEHB 2XXYA 3ROJA 4F1UA 3E6CC 3TTLA 1FEXA 3PSFA 3HDDA 4HX4A 2AXLA 5CMCA 2EBIA 3TW6A 3GZ5A 1ERDA 4R9FA 1MJBA 1B7ZA 2OD5A 2HXIA 4FQGA 4WEPA 3CMAI 3CO7C 2W25A 2EINH 1SQYA 2H5YA 1ZN2A 3CVGA 3WGIA 3PM1A 1IUYA 5LEJA 2VC1A 4EM0B 3RIRA 5IP7J 1YAEA 4JVIA 1U6GA 4KXPA 1TWYA 2RCBA 4YMBA 2L7ZA 1ZLQA 1LUJB 2ESHA 1DBZA 4MX6A 2ZYMA 4HEA2 4I98B 3JRHA 2GFEA 1Z7ME 1FBUA 1N77A 4BQAA 1VZ0A 2TRTA 1J75A 5HDGA 2WC2A 2P3VA 2Q2CA 3CG3A 1TQMA 3JRIA 3N97A 1MXVA 3MJNA 4G8HA 1P4WA 3QAXA 3K4LA 1EZPA 3CDIA 1ULYA 3IX1A 2X1DA 5DV5A 4OTEA 1RIOH 3VSLA 4F3GA 3OYDA 4NGUA 1U9OA 2A69F 1HOMA 2DMNA 4CUGA 1UMQA 3RZDJ 2OC6A 2CH0A 1VQ8I 3O9PA 1ZH5A 1UIVA 2QF7A 5CVUA 1YZ0A 1Z7LA 4IEJA 3JV9A 3ZS6A 2OQGA 4UUSA 2D5WA 3QMFA 2G0EA 5L3FA 2FSWA 2OUMA 4J19A 1ZG3A 4Y17A 3JZJA 4DE8A 1KU7A 1AMFA 3W6VA 4EQBA 4WKMA 4GXAA 3LSTA 1FPBA 2MD5A 4B1RA 1RC9A 2E5NA 2PMHA 3GLLA 4M73A 1B52A 1DPPA 4Y13A 3C2GA 2ICWG 2XXUA 4LP2B 2XWOA 2GIVA 2MH2A 2B9SA 3IKVA 1OCOH 3WG7H 4AU7A 2D21A 3PUXE 2F4OB 3LL7A 3VEPA 2LKXA 5CMMA 3TCFA 4RLFA 2QBYA 2PLYA 2XRLA 4G6QA 1A40A 1NNFA 4OETA 2B63J 5E8IA 3EETA 2FE3A 3OYFA 2WTEA 1PB9A 2MC4A 3NWTA 2HOTA 2JA2A 1IXHA 1ELJA 1TFDA 4DCYA 2CW0F 4I6ZA 2E1CA 1W36C 1KGSA 3KP5A 5M5XJ 2F7CA 4CCNA 3VYUB 4FTHA 4HS7A 4M3DA 5GAHJ 3SEWA 2K9SA 5I2KB 3T66A 4IQJA 3B02A 1GT0C 3ZP5A 1Y20A 2DP8A 3MP6A 1N76A 2FBPA 4MAGA 4R9GA 2HQ0A 4BDOA 1KA0A 1OCTC 2F8DA 1YYVA 4OOIA 3FV1A 4P8BA 1WQ2A 4PE5B 5DCMB 2WEFA 3ZQIA 3EUAA 3BIGA 2OK2A 3L9FA 3JCUC 4M3EA 1LBZA 2DCEA 3MVPA 4MLQA 4IO6A 2L3DA 1YRNB 2NNNA 1G59A 2DVCA 3V7RA 4BDRA 1HSLA 4YIRX 1US5A 2KIMA 4RPOA 4U1OA 4XKRA 1OFCX 3W6KB 4HDUA 1B3HA 2DDBA 4KPTA 4YB5A 2HVQA 1Y1WJ 3MPLA 5J4VA 3GTOJ 1SPIA 4PCQA 2RREA 3RSNA 5E1ZB 1NK2P 3W2WA 4JQFA 3WU0A 4PGNA 1OYYA 2BYVE 4MTEA 4JK1X 4ASNA 1WVJA 3S9NC 1XX5A 5AIQA 4RK9A 1B5IA 3ASOH 2YX4A 4J01A 2HFHA 2DOFA 5TISC 2MLKA 5ET5A 4OU0A 4DOZA 5DM7F 1JT6A 2JRMA 3N6TA 1MMDA 2O7OA 4QIWN 5I58B 2FIXA 3K1MA 1N78A 1MXYA 3BZKA 2PMSA 4W97A 3E5UA 2O61A 3VFJA 4YELA 3M8UA 2ZZVA 4KISA 1JEVA 4PQJA 2CMOA 4Z7EA 1IF1A 2F7BA 3QQAA 2UXNA 1P4AA 1PUFB 1DPUA 4YIFA 1MKMA 3J81Z 3PD9A 4LQ2A 1D9VA 3USDA 4EUOA 4E7LA 2BZTA 2XWKA 4N0BA 2GAUA 1VQ5I 1INPA 1FSAA 2XD2A 4H5GA 4NN3A 5I58A 1D8JA 1BI3A 1USTA 3BG5A 3FBPA 4OMBA 2DA4A 5AA2D 4KN7X 1XHYA 5I2NB 3CSGA 4RAYA 4HCWA 1WJCA 1VQ6I 1EV7A 2NAZA 3D5LA 2REGA 4ZEKA 1MRPA 4BKXA 1S9TA 3UIFA 3LSMA 5GTHC 1FBHA 4XN3A 4HNVA 2XSDC 2R92J 1RNLA 2R7DA 1M5DA 1I5ZA 1Z3YA 2NYXA 2VKEA 1BA5A 3V89B 4G7HF 1R1VA 1KU9A 4P56A 2HOSA 1HKTA 3GLXA 1UHSA 1JNFA 1WKMA 1C0WA 2BJIA 2HXRA 1M5BA 3M4OJ 3BR2A 1HW2A 2X1EA 3J80Z 4I0AA 1LFUP 3S9LC 3QP6A 1Y1ZA 5BUUA 1MY2A 3NRVA 5ED4A 5DD8A 4BNCA 5EEGA 1GXQA 2OCCH 1OR7A 4LJZF 2I3WA 2WY8Q 2A07F 3D0SA 2H09A 4BGDA 5H8HA 4A3EJ 2CQ7A 3RZOJ 2QGUA 2NVQJ 4TLLB 1SVXB 1NL5A 4HNTA 2L02A 4ZYGA 4GRIA 1XMAA 3CSBA 1DUXC 1RESA 3OL4A 3SDFA 4L9NA 3R61A