2ESNA

The crystal structure of probable transcriptional regulator pa0477 from pseudomonas aeruginosa
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
301
structure length
299
Chain Sequence
PLLRRLDLNLLLVFDALYRHRNVGTAASELAISASAFSHALGRLRQGLDDELFLRQGNRMQPTQRAEHLAAAVAAALRALGEGLEEWRPFVPGQSQRTFVFAATDYTAFALLPPLMNRLQHSAPGVRLRLVNAERKLSVEALASGRIDFALGYDEEHERLPEGIQAHDWFADRYVVVARRDHPRLAGAPTLEGYLAERHAVVTPWNEDSGVIDRLLARSGLRREVAVQLPTVLAALFLAGSTDFLLTAPRHAARALAEAAGLALYPAPFDIPPYVLRLYSHVQGRDAHAWMIGQLKGLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords probable transcriptional regulator
publication title The crystal structure of putative transcriptional regulator Pa0477 from Pseudomonas aeruginosa
rcsb
source organism Pseudomonas aeruginosa
molecule tags Structural genomics, unknown function
total genus 89
structure length 299
sequence length 301
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2esnA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2esnA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2esnA03
4GXAA 3TAJA 4YFNF 5ICGA 4PDKA 5K1YA 1SD7A 1P1OA 1FP2A 3CFXA 3TEPA 1NMUA 2EA4A 3KP3A 4OIPF 2E1CA 4ZZLA 5A5XA 4HDVA 3MBPA 3TDJA 3OXNA 2FA5A 2P5LC 5EEGA 4Y17A 2JZYA 3SZTA 1IXHA 4RB1A 4YAHX 1FSHA 4RS8A 3T96B 3K02A 4IGRA 5E8IA 4NF6A 1HKSA 4EGZA 3JW4A 2VOPA 4AWXB 3RPWA 3ZMVA 4BLAA 3OEMA 3COAC 1XDSA 3SXYA 3KFWX 3GUDA 4CDGA 2YX4A 1FQDA 5H8FA 1F1ZA 1NH8A 2B65A 2CQKA 2XVCA 1LLSA 1B59A 1MDMB 5I84A 3RTWB 1R23A 5JVTA 3DQVC 3A3CA 1SVXB 3N4MA 2O69A 4BYYA 3GFMA 4BDRA 1FPQA 4L0YB 1JGSA 4OWDA 4KCCA 1MXVA 2XXTA 3PMXA 3BWGA 1R22A 3M8EA 1O64A 2Z5UA 1FY7A 1U8RA 2VBXA 3ZSFA 2LSOA 4QLCU 2VOOA 1IQ7A 2GQQA 5ILSA 1DOTA 2P8TA 3M7GA 4EJVA 5FLXK 1R1NA 2D5WA 3PUXE 4QFKA 2UVGA 4ZE8A 4GYGA 4GD5A 3U72A 2QMWA 3WTTC 4GQOA 3RPQA 2XX9A 2MA3A 5I57B 1YTVA 2QMXA 1HSEA 1SD5A 1JQFA 4G6DA 5L3EA 4IHTA 2DTRA 3G3HA 3KCCA 1WRJA 4UV9A 1DDNA 1R1TA 2BYVE 3HRUA 2DP8A 5ISUA 4IHSA 3CO7C 3MUQA 3KLNA 1ATGA 4JB7A 3KLOA 2FSWA 1A40A 2OLBA 4N0BA 4XRFA 3VVDA 1R9QA 3I5UA 3MVWA 2PG4A 2AXLA 2LF8A 3IHUA 4NWCA 3RYPA 2ZCWA 1MY4A 1Y3NA 3RTFB 3WG9A 3FJMA 4U0WA 1G3YA 1R5GA 2HZTA 3HRSA 3B6WA 5DVIA 2LF7A 1OLCA 2RN7A 3J80Z 2QVOA 1LAHE 4HQMA 4DIGA 4M9ZA 3R6UA 4ENMA 2DK8A 3FM3A 5DCMB 4OFJA 4NTLA 5AE4A 5CI5A 3PD9A 1F9BA 5IKBA 4IPAA 4EMSA 2UYEA 3QAXA 3E6MA 1HSTA 2ZKZA 2Q2CA 3LR1A 3DPLC 3CG3A 3NQOA 5ITOA 3R60A 1FX7A 2H9BA 2GHAA 3F8NA 1H44A 1JW4A 1KU2A 4XTCQ 1QKBA 4HW0A 3S2WA 1FZPB 3VXCA 4MEXF 2Y84A 5TRDA 4S04A 5LGTA 3JSPA 3MCZA 2J5PA 1SAXA 1IN5A 3VODA 3WGIA 4LG0B 2CMOA 1LSTA 1RYOA 3FZVA 1QULA 5DYMA 3O97A 3ECHA 3PPOA 3SEYA 1HKTA 3EYIA 5BQTA 1CF7B 1JEVA 3LSLA 3H92A 1UTHB 1BI0A 5BWJA 2RF1A 1KQ9A 1YTYA 3JTGA 1W5TA 1LAFE 1ODDA 3HSEA 4R72A 5ELVA 3MQ0A 4UV8A 2Z8DA 1TWYA 1V4RA 3MEXA 4OESA 3J7AO 3SEXA 3OSQA 3PFIA 2UXXA 5LGUA 4GGGA 2QBYA 2KIMA 1IUDA 1DUXC 2X26A 1NL5A 2PN6A 2ZMBA 4P11A 4HV5A 2QS2A 1EH8A 3TTRA 2W7YA 3PPRA 2YLNA 2KJCA 1YW9A 3H7MA 4XIGQ 2RC9A 3IOTA 5E18F 3RDIA 3REOA 4U7DA 3B7DA 4Q4ZF 3C34A 1EZOA 3GZ6A 2FEZA 1B3GA 1YO5C 4RK2A 4XKQA 3HTUA 1FOKA 2M87A 4QSCA 5HS7A 3ZQ7A 3FM5A 4ESJA 1X3UA 2ZYMA 3IAZA 3IWFA 3U92A 2V25A 3S9EA 2RDPA 3CVGA 4OYVA 5AA2D 1O63A 2UVHA 5AA2B 3HHFA 5DT6A 1JVYA 2PI0A 4OU0A 3RJPA 1B3LA 4JXIA 3FV2A 1PC3A 1FCKA 2XD2A 3IX1A 4GVOA 1MQIA 5E1WA 2M45A 1JNFA 5HDKA 3T0YA 2L4AA 3ZN0A 3U93A 4EF1A 2JTVA 1AIVA 1IN6A 3F6OA 1R9LA 4G8XA 1GVJA 1G3TA 3ABUA 4U0YA 3WTYC 2R7DA 4M73A 4IJAA 2DVCA 3ONMA 4JQFA 4UVAA 3F11A 2GXGA 5J1DA 2O8XA 1MM6A 3R26A 5H6RA 1KYWA 1B5JA 1LFIA 2H25A 1DPPA 3VXBA 1R7JA 1N3WA 3RQTA 3HOTA 2P4WA 2I58A 4MQVA 3CI8A 3PUWE 1EZPA 4ELPA 4ENNA 1ONVA 5BUUA 3C33A 3ILTB 2CO5A 4L5IA 1URDA 1HQCA 2ZFWA 4IO2A 3KOTA 4S05A 4YKPA 1XVXA 5B7DA 1LQ1A 3DP8A 1WWXA 3H3ZA 2VC0A 1SD6A 3CUOA 2EJRA 1Q1HA 5H8SA 4GXSB 5I2KB 4LQ5A 2A5TA 3CDHA 5ERIA 2I4CA 1N0TA 2F78A 4OEVA 5DVFA 3VLVA 3VFZA 3CIJA 4IY6A 2AL5A 1JW1A 5L3DA 4R74A 1J75A 2ANJA 3FVNA 4C1TA 2XASA 4BHPA 2HR3A 3HUGA 4OIRF 5DDGA 3DF8A 4WWCA 3I54A 3CUQC 4JDFA 5K5OA 3E6BA 3F22A 3J81K 2HQNA 1O3RA 2R7FA 1FNNA 1O57A 4IXAA 4HOBA 2I49A 5CVUA 3RIRA 2A61A 2DWIA 3V89B 4ZZDA 2F5DA 4H67A 3CSGA 3M8UA 3CUQB 3KEOA 5HS9A 1FSEA 4U0VA 1LAXA 5DUIA 1AL3A 2G9WA 5CYVA 1ZTYA 1WKMA 4GXOA 4O3BA 4OHNA 3QPHA 4A6EA 1TNTA 3PPQA 1USTA 1Y4CA 2MH9A 2FRHA 1USYH 2G93A 1FWZA 4HLXA 4P0IA 2XHDA 2D45A 2ONRA 3MZBA 4YB6A 3S9MC 4DCYA 3K6UA 2BEOA 4EGYA 4OTEA 1IUYA 1B6AA 1LDJA 2IA4A 3QP6A 1DPEA 1A8FA 1BI1A 1B1XA 2ELHA 4H65A 1Z7UA 2A3SA 2RQPA 4MNUA 2KLFA 1LJ9A 2KIUA 1OIBA 4DXUA 5I2NB 2E0SA 2P5KA 3FMSA 1JVXA 3HSTA 3W15C 3KN3A 3LAJA 5AIPA 3S2VA 2QYOA 2DWAA 3F6VA 4KN7X 3T8RA 2P2AA 2GHBA 3T9XB 3PQJA 4EV0A 1BKAA 1NFTA 3JTHA 5D5XB 4Q8RA 1MM7A 2EV6A 1R1VA 1NNKA 3G3KA 4X1BA 4OQOA 2MH2A 3F21A 5L9MA 3DP4A 2RVCA 4X48A 4IO3A 1IXIA 2DU9A 2IRFG 1US4A 4I9DA 1XCBA 3BZ6A 2ZNTA 1LCFA 3C9HA 3Q5FA 3D5LA 1FP1D 2LAOA 1MPCA 2R6GE 3TUSA 4X1DA 1B1BA 3IO4A 3V83A 1TFAA 2XXXA 4OERA 5DEXA 1W7PA 4P96A 2DLLA 5KDTB 1BC8C 5K2XA 4P0GA 4ECFA 2DI3A 2F2EA 2A68F 3L9FA 1ZMGA 1HKQA 1LNWA 3K01A 4KUMA 3O66A 1KU3A 4POWA 5ITPA 3ODBA 2FXAA 2W84A 1IIWA 2EFWA 4JWYA 1PDAA 1B4AA 4IRGA 2XAGA 2XHKA 2RKHA 1ZHFA 5ED4A 4KPTA 1LEAA 5CVVA 5I56B 3GZ5A 1YQAA 5ICTA 2EFQA 1JETA 3DXJF 1FTJA 2X7PA 1PB7A 2QQBA 1LB2A 3P7NA 2AIXA 1B6HA 1BJAA 5D4SA 1ANFA 1Y9UA 1D3KA 2A5YB 2ACJA 1B5IA 5I59A 3V8JA 5LOMA 2LDUA 5JTYB 1D3YA 2MBFA 2UVJA 4H5GA 3GFIA 5FO5A 3QAHA 4P9UA 2PT2A 3KSJA 3MVZA 4PFWA 4KYSA 4P55A 5CMCA 3L7WA 4RB3C 4XLPF 2O3FA 4M4GA 4ESXA 3ZMSA 4AVPA 4QF9A 3GO5A 1SMYF 4YKKA 3FX3A 4O3CA 4R9GA 4LK1F 2H27A 3BPVA 2PBWA 5EEHA 1YG2A 2QM3A 1LGBC 1TTYA 1FQCA 2O84X 3KP6A 5DTBA 1P4AA 3K9TA 3OENA 4IO5A 3I53A 5F6FA 1PB8A 1FBQA 2FMLA 4L18B 4ZYHA 2IJLA 4NQWA 4GLIA 4NB5A 3IK6B 4KYEA 1K78B 1FTOA 2G7UA 3H6WA 2UWMA 4I1DA 2UYFA 1M5CA 1OKRA 2O6AA 2XXRA 3SEVA 1SW1A 2QL3A 2VD3A 2B3BA 2F34A 4ELQA 5AA1A 1Y1MA 4G2ZA 4TQUQ 3S4UA 2XAFA 4KI0E 4F29A 4WKMA 1N3XA 1YW8A 4OVJA 1Y1ZA 2QQAA 4POXA 3JAMK 3IO6A 1FTKA 4PE5B 1RYXA 2WC2A 2OD5A 2CW0F 4PP0A 5L8DA 3MJNA 4JBZA 3SDFA 3ZPLA 1A04A 3PQKA 4NE4A 4RGUA 2P0SA 1U5TB 5ICCA 3GBBA 3KG2A 1BIBA 4L9NA 1I6XA 2DQVA 1ZRCA 4R6HA 2ZMEA 4U4XA 4OENA 3RT8A 4HF1A 5JFRA 5H8NA 1TQMA 1B58A 2NRAC 4ISUA 1KYZA 4F31B 2F5EA 1PBQA 3Q27A 2ZYNA 2VBZA 3C31A 3RGYA 2AL4A 4YIIA 3EF7A 1J59A 4EJWA 4N9HA 1FQEA 3T22A 1B1HA 4RNSA 4MLVA 1GTKA 2D2WA 1D8KA 1IXRC 3I3VA 4GCVA 4Q5TA 2EWNA 1V3FA 2E1SA 1MY0A 2CZLA 4NF4A 1JW5A 2Y7RA 3DFGA 3D4GA 2O7IA 1SYIA 4P5OA 2DO7A 2ZXTA 4F3SA 3EUHA 1SFUA 2Z9OA 1B9JA 1IXGA 3EDPA 3P7IA 2P7VB 4LZ8A 2M8CA 3WTZA 2ZO4A 4KNYA 3UK4A 3F23A 5CJ9A 4LVQA 5BPDA 4GOTA 3E13X 3RI4A 4QSEA 5JI6A 1PDNC 1W4MA 1QQIA 1Q1KA 4ZE9A 5AA4B 3GXOA 3V8XB 4NF8A 4WXDA 3EHUA 3TO6A 2AS5F 4PETA 5HDGA 3RN8A 1XMAA 3MAMA 3K6XA 1K6OA 4PFTA 1K7AA 3LQRA 1ZRDA 1SI0A 2ZBKA 4LFUA 4FEBA 3R7XA 3IOUA 2PMSA 2Z8FA 2XX8A 3PV0E 2HZKA 3IR1A 3T9VA 1DPRA 2QZ8A 3DELB 2L54A 3EHSA 2FNCA 2VN2A 2HQ0A 4F2OA 3MAJA 1Z91A 1FQFA 5FFZA 3MWBA 3HOSA 1Y20A 5CMKA 4F2QA 2THIA 2PFBA 4M74A 3E3KA 2ALUA 4MGRA 3LSTA 4ZEDA 1OYWA 4ND9A 3FV1A 4AD9A 1I1SA 3I59A 2NXOA 4EQBA 2GFEA 1YYVA 4FX0A 3CTAA 2M5WA 4ESBA 5LEJA 1ZG1A 3RNNA 2H98A 4OIQF 2OZ6A 3M1EA 2IW5A 2NAZA 5DV5A 1STZA 3FIRA 4BHCA 3BPXA 3DLNA 4XSZF 3FJ7A 2GA1A 3GEZA 2G7HA 2VODA 3JSOA 4QRZA 3MZYA 1FC3A 2F35A 1J9IA 5ICFA 3BJAA 4KT5C 1USYE 1S7YA 4KN4X 3FJGA 4B09A 3WGHA 5F1QA 1BI2A 5FTIA 3O29A 2CG4A 4OXVA 1OMIA 3OO7A 4K3FA 4TLLB 5BMZA 2HEUA 1POY1 4WXHA 3KFMA 1P6RA 3JZJA 4G68B 1WODA 3N97A 2PBIA 5L3GA 2P6SA 4KHZE 3P9KA 1BLFA 5F64A 3H06B 4KIFA 4ON0A 4I0BA 2Y7KA 1GGGA 1GVCA 2O1LA 4M71A 4G8HA 2P1SA 1J2XA 4UVCA 4BXUA 3C18A 2OZUA 3OSRA 2IVMA 2XD3A 3EN3A 3C3WA 3EHTA 5FHOA 1IAWA 5A2QZ 1MRPA 1D9VA 1MS7A 3I5OA 3VV5A 1G6NA 3SHFA 1VR5A 2Y75A 3SEUA 4LJZF 3L6GA 2XXPA 1Z1DA 5JHUA 3FASA 3M3FA 5AA3A 5D5WB 1XGOA 1UB9A 1KWHA 4ZH4F 4HS7A 4UACA 1R6ZA 4XLNF 1AH5A 3HRTA 1YIOA 4LD5A 2K86A 2E7XA 3IOVA 4I01A 4WX9A 4H1XA 3L00A 3FUZA 1ZG5A 4KFCA 4DZ1A 4IO4A 1DTGA 2GWRA 3OOPA 4G9YA 2LKPA 1PUEE 4MTDA 3VVEA 1G4DA 5HS8A 2FE3A 3RKXA 2FNPA 2ZNZA 4Q48A 3PGFA 3P9IA 2RC7A 2QRYA 4U21A 4G94A 4F3BA 5L3FA 4L9JA 1PB9A 4R73A 3TOBA 3DEUA 2VONA 2XAQA 4UNOA 4U22A 2GA2A 4LUBA 1UHMA 5I57A 1RKMA 3K0LA 5ILVA 5D6FA 4XKNA 3ZS6A 2Q8KA 4R8HA 5F1RA 2ONSA 4U4SA 2ISYA 2X0LA 3DPTA 3JV9A 2REJA 1ZGAA 4G8MA 1HW5A 2YX7A 4PCQA 2ZYKA 1H3DA 3TCHA 2VOZA 4LLGF 3PMWA 4PFUA 3F8MA 1BIYA 1QUJA 2WKYA 2XAHA 3F8BA 5KCJB 2DE2A 1QNTA 1EH6A 1ZIUA 4Y13A 3QUJA 5H8HB 2Z3YA 5BS6A 3KGCA 3W9VA 4IGTA 4R2BA 1R58A 2HS5A 4LLNA 2V93A 5HLIA 1Y3QA 2NNYA 3N94A 4AIJA 3K1MA 5DCMA 1DP7P 2O0YA 4NF5B 3HV1A 4B8XA 2H4IA 2ESNA 1D4NA 5D5UB 1W5SA 3TTKA 3LSFB 2QS1A 4IF4A 3WTWC 3QSLA 1KQ0A 1VSOA 3TPAA 1MZBA 3PUZE 1D8JA 5E1ZB 2DAOA 3H6TA 3SQNA 1FBSA 1MJ9A 3SEWA 3WAFA 1B0HA 2W57A 3FD3A 4DXCA 3LQQA 1Y4TA 2Z8EA 1P1WA 3O28A 1RI7A 2QLZA 3ZN1A 1P2FA 5I58A 3MVXA 1ZARA 3ELKA 2V1XA 3U9GA 2I3VA 4O3AA 4A5NA 2A6EF 3FHZA 3UORA 4YKJA 3K2DA 3IOWA 3L09A 2IPQX 1R36A 1UTHA 3O6BB 1CE2A 4FIMA 4RGXA 2ZYOA 2DPUA 3BJOA 1MJBA 1AOVA 3HPIA 2EK5A 1OQGA 3OMBA 3TQNA 2FBIA 1S3JA 2YSRA 1Q35A 4FHTA 1EH7A 3TMGA 2Y7PA 3MZ1A 1US5A 4N13A 1WVJA 3QU6A 1YAEA 1ZKBA 4IVNA 1MXZA 3TELA 1QUIA 4C0RA 3W6JB 4THIA 2BJJX 2ESHA 3G3IA 4LZ5A 4YKIA 2Q89A 3SETA 2F97A 3SERA 3Q28A 5L9OA 1N04A 2QUFA 1NKXA 4LGWA 4HX4A 4A2UA 3C36A 1QGPA 3I4PA 3IKVA 1LBCA 2D1HA 3I58A 2QS4A 4F3GA 1TQIA 1R1UA 1O7FA 3DM0A 3F8FA 3ABTA 4GL0A 1I69A 3GYHX 4GIZA 4L9VA 3D4CA 4WF2A 5AA2A 2RGVA 4RYAA 2IEEA 5IAIA 4R9FA 1ZYRF 4O6JA 1M5BA 3R4KA 2ZNUA 3CRBA 3HSFA 4RA1A 3D0SA 4HAMA 3GVAA 2XROA 4JSDA 2NNNA 2DE3A 3TTNA 1ZJLA 3OEKA 3WGGA 5ICEA 2HDCA 5DYHA 5FD5A 4WEPA 1FW0A 4FAJA 3AAFA 4U88A 3KN7A 1LDDA 2F5XA 4G4PA 3HYIA 2K27A 3E5QA 4G7ZF 1QVSA 5TJJA 2XAJA 4KCDA 3ULQB 3F72A 2DYXA 3IL2A 4OMZA 1B52A 1OR7A 5D8LB 5LHIA 1GR2A 3U94A 3CFZA 4BDLA 3RY3A 2OCUA 1H0MA 5HVQC 1KQ8A 1TT1A 5J8CA 1G3WA 1RUNA 1O3SA 1LCTA 4HA8A 1I27A 2Q0OA 1SMTA 2IA2A 3WTSC 4F7ZA 3LSXA 3IKTA 2C6YA 3J81Z 1QZZA 4M9SA 2QENA 4AIHA 1UHWA 2X4HA 1HSJA 1UTBA 3H6UA 4XKRA 3WAEA 3E4RA 3OELA 3E5XA 3JYRA 3DP7A 1IITA 1IXCA 1XN7A 1B5HA 3O6IA 1OQHA 4GF8A 4DCXA 3QXMA 2DWJA 4R75A 2E1NA 2D3IA 3HIFA 3FXRA 4U7BA 1CGPA 1BP5A 3GLBA 4FORA 3B6QA 1MXWA 2DT5A 4NWDA 4M6YA 1M5FA 2L3DA 3IL1B 3OO9A 3TOAA 4F19A 4F39A 4LA9A 1MY1A 5I2KA 2HOEA 2K4JA 1H45A 3LA2A 2HFHA 3MP8A 2H6BA 1D5VA 1IXSB 3FXQA 4M1VA 5H8NB 3MZ9A 3HTSB 2OJTA 1EU8A 1SW2A 2DXRA 2I0BA 3CR9A 1B05A 3RKWA 1FYMA 3TZAA 2ZXJA 4HDUA 5F7VA 1OVBA 1Y0UA 3SFZA 4BAYA 3HSRA 3EETA 4CICA 4YG2F 2CFXA 4HLYA 5CVRA 2Y48A 1YCJA 4Q5SF 1FT9A 4UA8A 3T1BA 3CUQA 2W25A 3KZYA 1QKAA 3GBAA 2ZNSA 5CC2A 2HCAA 1TFDA 2Z33A 4FX4A 2PX1A 1C0WA 1TXFA 2XX7A 2FBKA 3BFUA 2TDXA 2DWHA 2R71A 3L6HA 4OEUA 4I2OA 1NNFA 2BGCA 4DNCA 3N26A 1MKMA 3IWZA 1URSA 3GWZA 5D6EA 1M5EA 3VEPA 2O1MA 2OQRA 3R61A 2HAUA 3WTXC 4EM0B 4EQ7A 4JBAA 1N76A 4X9TA 3WU0A 4LONB 1B3EA 4OZ9A 3QK6A 3KP7A 4HCYA 1AWCA 5I2NA 4LATA 1PP8F 1TW3A 1XSDA 1YLFA 3E5UA 2ZMEB 2XV4S 3KEIA 1T0KA 1FTMA 1H9TA 1VTNC 1FLIA 2PT1A 2JSCA 4PQJA 3USDA 1LFHA 4R1HA 2X7QA 1LB8A 4I0AA 3IB1A 5CM6A 3ZMUA 2A69F 4O5VA 1QJMA 4HX8A 3T66A 3W6KB 5HPQA 4NHJA 4DXBA 4QFOA 2OU2A 3U1DA 4F1UA 2K4BA 5CLSA 2V3UA 3Q29A 1U3EM 2MLKA 1MQHA 1Z9CA 4QFPA 1IEJA 5TU0A 1XCVA 1IF1A 3KE2A 5EHSA 2I0CA 5CMMA 2YR2A 1BOAA 1L0OC 4NF4B 2F5CA 1IN4A 4FJPA 5DUKA 3ECOA 4G7OF 3K1NA 4GWOA 4F18A 2MD5A 2COMA 5DEQA 4JWOA 1ON2A 3T9HB 2OWTA 1GV8A 4LLLA 4G77A 5H6QA 5A5XB 1JXSA 5LGNA 4IY5A 1U5TC 1IW7F 4LB5A 1ZH5A 3V8KA 1BTJA 2OWSA 4NF6B 5HOOA 4R6YA 1QZYA 3AXFA 1B4ZA 3GXAA 3S9LC 1POTA 4A0XA 3V8LA 3PUYE 4NF8B 5H8QA 4YFKF 2O61A 5I56A 3CSBA 5FTHA 3TTLA 2QS3A 1BC7C 5H8FB 1ZN2A 4EVIA 3W9WA 4MH5A 5H20A 3LFKA 2EV0A 4BDMA 2QWWA 5HM4B 1XT8A 3KETA 1ZLJA 3M3KA 2VE9A 2GZWA 3T5XA 1L5TA 2O6GE 1XD7A 1FQBA 2HGCA 1S7AA 3HHHA 4YB7A 3RT6B 3TCFA 4CYDA 5LBQA 4ZECA 5JTYA 5LHHA 4OFLA 5FB2A 3O9PA 2XRNA 1DMBA 2VBWA 3G73A 1A54A 3WODF 2OK2A 2RV8A 1MXUA 3BJ6A 3K4UA 2O03A 1ZREA 3JAMZ 3HCQA 2RCAA 2PLYA 3E97A 5JR3A 2IA0A 2PVUA 3H4ZA 4JWXA 2H09A 3C7JA 2PQ8A 3R6SA 4QHQA 4BHBA 4CXFA 3U2RA 4ZEBA 2D21A 2GRVA 4KDPA 5TPAA 1UIVA 3KP4A 1HSLA 1Z05A 3TKDA 3BDDA 4OIOF 1SYHA 1XDUA 4BH9A 1K78A 5L3CA 4YMBA 4ASNA 4LZ7A 5D4RA 4H0EA 5FHMA 2RC4A 2DQLA 3E6CC 2PMHA 4YICA 3V7SA 4LP2B 1XMKA 5IT9Z 2O7UA 2QSXA 1Z6TA 1EZ9A 4RGRA 2Y7WA 3S9NC 4FECA 4MHGA 1J7KA 4HF0A 3H3GA 4ZYEA 2EFOA 4M6XA 3H03A 1G3SA 1I6AA 3KBRA 3PPNA 3CFLA 1GHCA 1B7UA 4HV6A 4L17A 4ZS9A 2RKMA 3HRMA 4IO7A 5E20A 4IRHA 1P99A 3FVKA 3CJNA 4G8NA 2L4MA 1RNLA 3ROUA 3F8CA 3FMRA 3N6TA 4HW8A 3PUVE 4RK9A 2HEOA 5KK1A 4A12A 1U5TA 3BY6A 4KA4A 1U6GA 3O3KA 1E17A 3OOAA 4ELRA 2XXUA 1SI1A 3EQ1A 4HQEA 3PD8A 3TDZC 1WDNA 2H5YA 2JPCA 3I71A 3BKIB 1MG1A 3GZGA 3O6GA 5DD8A 5LLQA 3I0TA 4ZYGA 1B9NA 3BBRA 3UIFA 3MFKA 1IN7A 1P4XA 2GAUA 1MQGA 4U1ZA 4XKPA 4WEDA 5L3BA 3NEUA 3CO6C 4EM2A 3C32A 4QWQA 2F7CA 3HN0A 5J6XA 1ZAOA 2NOOA 5TP9A 3QU3A 1B3HA 2ADUA 1S9TA 2DVZA 1DPUA 3J80K 2XXYA 1XGNA 1ZG3A 4G68C 2R3SA 1IRFA 2QQ9A 2XXHA 4HF2A 2P6TA 1JEUA 3KJTA 4CHUA 2Z22A 4KQPA 5A2QK 2STTA 2DSFA 4FE8A 1OLAA 1JE8A 2UVIA 3UN6A 2XXWA 3BFTA 2PJPA 2Z23A 3EYYA 2V1UA 1LDKB 1JHHA 2DK5A 1HW2A 3K00A 3UP9A 4DQ2A 2STWA 1BBYA 1P92A 3G3GA 5CBSA 2P7CB 2YPNA 3E3VA 4XBFA 2FNAA 2QBYB 4YIFA 3C4MA 5FLXZ 3HHGA 2CGPA 1TNSA 2XXVA 5AA4A 2XKOA 2W85A 5AIQA 3SZPA 4PFYA 1O7LA 1AMFA 4Q0CA 1ZBMA 3MW0A 5M2VA 1WSUA 2H94A 5ILUA 4ZDMA 1YS7A 2LNBA 3I6VA 3OO6A 4RAYA 2OZZA 3U1OA 4EQ9A 2Q2EA 5EHMA 2WTEA 2YU3A 1MH4A 3VOEA 4E0XA 4EUOA 1MDMA 4XXUA 5KVRA 4MBPA 4I02A 4FEDA 5K5RA 3SKPA 1DTZA 1KGSA 3QIMA 2V6CA 3ZMTA 2FBHA 4HTGA 3M3LA 1ZU0A 2Z99A 3BOQA 1TBXA 1UCRA 4KD5A 3MQ9A 4IRIA 4U2RA 1ULYA 3K69A 4YB5A 2ZNYA 4R2FA 5FGMA 3TYHA 2VT3A 4I7HA 3FF5A 4Q47A 4O3MA 1CB6A 1VE4A 4H8JA 5LRRA 4G7HF 4JK1X 4KICA 4EM1A 4N9IA 5FD6A 5BPIA 3WU1B 4U23A 3LUYA 1E2XA 2L01A 2HXWA 5CBRA 2FF4A 3C35A 2OBPA 5B70A 2KIFA 3O6HA 1FBUA 2DS9A 1MD0A 2J5OA 4Y15A 1T38A 5I58B 4MTEA 1BM9A 1ZRFA 4KYWA 4H8IA 2REGA 3IJOB 1S8NA 1REPC 3R0AA 3V7CA 3QRFF 1B0LA 1T0FA 1HW1A 1NH7A 2H99A 2VT2A 2EFPA 3RUMA 3QYTA 3E6DA 4R79A 1MDP1 3G7WA 4G68A 5D8KB 1MY3A 2ONKE 1PEBA 3TCGA 1A8EA 3Q9VA 2NYXA 1T6SA 3OD7A 1P1QA 1YPNA 5D5VB 4A5MA 2O68A 1EH3A 1QW0A 1B32A 4IO6A 1R00A 2E7WA 3FXUA 3MWMA 4EJUA 2HAVA 5DD4A 1XOCA 1UFMA 1B7ZA 3RPUA 1MPBA 4A6DA 2XUBA 3N6UA 1XSVA 1J0RA 4RPNA 2OQGA 2A5TB 2DOJA 3VFJA 2F36A 2PYYA 4H0WA 4WCGA 1SW5A 1S6LA 4I62A 1ON1A 2I48A 4QSDA 4FATA 1O3TA 1IN8A 1RUOA 4A0ZA 5CMBA 1A55A 2JRTA 3TGNA 1EV7A 2D1VA 1JHFA 2V9VA 4M72A 4ZZAA 5DVJA 5HDNA 3KP5A 1I6QA 3P9CA 3R0JA 3IB0A 4WK8F 4RPOA 1TQPA 2PMUA 1I5ZA 3G3FA 1B46A 1B7HA 1IRGA 4ONYA 1GXPA 3MZHA 2EFNA 4XSXF 2VGQA 4LG0A 4ZEIA 2K02A 3OO8A 3H3UA 1LEBA 3SESA 2F6PA 1N84A 4I8CA 5LEKA 3N5LA 1P1NA 1MQDA 3O2AA 3WTUC 1CF7A 4GFRA 4D0PA 3FVGA 5E1XA 3IB2A 4H6DA 1SBPA 1BIAA 1J5YA 2HKOA 5E8GA 2NVUB 3VVFA 3U8QA 3UA8A 5K5QA 1WQ2A 3B02A 1ZGJA 3B73A 1SFEA 3EPEA 1I6BA 2FQ3A 3IORA 4LQ2A 3WE2A 4OOIA 3KZGA 4GO1A 2EV5A 3GF2A 4AQ4A 1KU7A 3LA3A 1QPMA 1K79A 4ENJA 4ZZEA 1B2HA 4OETA 3BROA 5JEIA 2UXNA 4PGGA 3KOSA 4BDOA 1DSNA 4L5JA 3LWFA 1Z7NE 4BDQA 6PAXA 1UTBB 2M8EA 4LK0F 2Y0MA 3T8TA 5CRYA 5KCJA 1TW2A 4KFQA 4I09A 1LFGA 2KKOA 2DXYA 4EXLA 4OFOA 2H6CA 4RB2C 1OMPA 5H8HA 4C1UA 2VBYA 1T2KA 3IRQA 4EDPA 2IT0A 4UXNA 2AYSA 4F3PA 2I3WA 1Z6RA 4EXKA 4NF5A 2FYIA 3PU5A 3L2CA 1B3FA 3MP1A 1KA8A 4Z2YA 3LA7A 2VC1A 1UIUA 2RNJA 4E70A 4QFLA 4YMAA 4MFIA 1NHAA 2PEXA 1MY2A 4M9XA 3UGWA 3FATA 3RKYA 1WI9A 1SFXA 2BE5F 1I1GA 1W7PD 1PP7U 4ESWA 5DEXB 2A5SA 1W7PB 3VB2A 4EF2A 2IA1A 3QOPA 1L3LA 2XKPA 2CSOA 2B3FA 4GL8A 4K2EA 1J1NA 1O3QA 3G3JA 2V1DA 2DW4A 1MDQA 3DP6A 4KYDA 5L9SA 3OV8A 4MEYF 3KZZA 3IJXB 3ZKLA 2QPQA 3T9UA 1SD4A 3TO9A 2HTJA 2NS0A 3HO7A 5K2YA 4LB6B 2XIGA 4AB6A 3QP5A 2A6HF 4KR5A 3IRRA 4RGSA 4TV7A 1B4HA 1AOYA 2OBGA 3DV8A 3MPKA 2K7LA 5LRSA 1HXDA 4HBLA 2GXBA 3LC8A 4F1VA 1F5TA 2HKXA 3FVOA 4EQQA 2RCBA 3TQLA 5FFXA 4A0YA 4YFXF 3GFLA 3O2PE 3ML6A 4RY1A 3MPLA 1FTLA 3QUFA 4EJTA 1R5HA 3WE3A 4PGHA 2DPDA 1SD3A 4ELOA 1KU9A 1QBJA 1XC1A 1A99A 2M30A 2A07F 5I59B 1T39A 3ILUB 3Q25A 1ELJA 4BQAA 3ZKKA 1QO0D 1XHYA 4TLMB 1OPCA 3CG1A 3M8FA 1YFHA 1S50A 1BN5A 1GXQA 2Q9TA 2HYFA 4HZFA 1U2WA 5CVJA 1UQWA 2L02A 2V79A 2HYGD 2DE4A 2Q88A 5JK4A 5BOXA 2V3TA 1O7TA 4LMYA 3ZMDA 3KSXA 1VFDA 2MC3A 1QUKA 5HLHA 4I98B 4KMFA 2HZLA 2Q2AA 5ICQA 2WV0A 4CZZA 1NNPA 2O51A 1URGA 2YJPA 4QFNA 3G3ZA 3CLOA 2F7BA 1A7LA 4N6PA 3H6VA 4R6KA 1B9MA 1S29A 4EJOA 3PMVA 2NWJA 4TOZA 3KJ7A 1MPDA 2EA2A 2DQRA 3RLFE 3TODA 1MH3A 1OYYA 4CGZA 4UHTA 2I4BA 4L0ZB 1LB9A 2YPRA 3FWEA 3MP6A 3KN8A 3LBSA 2RINA 4NEDA 1Y3PA 3V7RA 2F5FA 1YS6A 3ERED 5EYFA 4DLDA 5J8FA 3WTVC 2XXIA 1XGSA 3ECRA 4OMBA 1H43A 2JT1A 3IC7A 1FYKA 3LAPA 3TQWA 3TDUC 2ETHA 3VLWA 3EQLF 4BDNA 2GH9A 2P5VA 3B6TA 3LSWA 3F3XA 3VE1B 2V3QA 2B0LA 1PBPA 4G6QA 4ESFA 3TFLA 2WWYA 1P1UA 3GW2A 4ENKA 2DBBA 4AB5A 5KZTA 1P4WA 1USSA 1MXXA 4HCWA 5H8QB 3GLXA 4IB2A 4PZJA 2Y7IA 2BV6A 2KJBA 1LBBA 2F7AA 4JSOA 3A3UA 3K6WA 3TO7A 1ZLQA 2F6GA 3THIA 2GIVA 3V5AA 1LVAA 1XS5A 3RYRA 2ZJ2A 2FU4A 2JPBA 4RB0A 4N07A 4RJZA 4YU0A 2ABHA 1XGMA 1XVYA 4ZEFA 3C1DA 1FQAA 1F4KA 1YW7A 4ETSA 1OVTA 4UVBA 1N7WA 1OYIA 2F8DA 3BP8A 2HFBA 4E0WA 3V4GA 3PPPA 4L9TA 1S7OA 5IT3A 1T98A 4OINF 2UXAA 3ISPA 4GYIA 1M5DA 5AONA 1H76A 4ZYDA 2HQRA 1RZ4A 1F9NA 4OMYA 1II5A 2IP2A 1NNTA 3ZMZA 1TLHB 3QPTA 3A09A 4FT8A 5KDTA 3K6VA 3K0VA 3E9XA 3TTMA 2VD2A 5TPAB 2DFIA 2W24A 1N7XA 4H5FA 4RAZA 2ISZA 2CWEA 2FMYA 4Z0IA 4DE8A 4F1YA 3K1PA 4DDDA 1MQJA 4RXLA 5HBCA 1SDXA 2QJEA 4MF3A 4AIKA 4HYEA 4HX7A 3DKWA 3TKYA 2NUVA 4MQ9F 3FGSA 4KIGA 5E17F 2R9JA 2KRFA 1VFEA 5CVIA 4BNCA 3GFJA 3MVYA 1RIOH 4Q30B 4KMUX 4MLQA 1XB4A 1LAGE 3GX4X 1IZ1A 3RTRA 5LHGA 1SW4A 5DCFA 2FA7A 2XXQA 1MJAA 2VXZA 1B51A 1Z7ME 2FOKA 2CYYA 2VHAA 4GRKA 4WXJA 2RC8A 2V84A 4YZZA 1XSXA 3VLUA 2HWVA 3ZP5A 1MXYA 2UZKA 1SQYA 4U1OA 2M1BA 2G29A 3T93B 1HBXG 1D9YA 3I64A 4NMYA 2OA4A 5HLGA 4F22A 2BBYA 4UUVA 3M9AA 2EB7A 5IT9K 4CO8A 2OAZA 2HTSA 3FMQA 2VE8A 2VP1A 3KEQA 2MLGA 1U78A 3K2ZA 2XGXA 1ZLKA 4WXCA 4ZEKA 3MC2A 1MGTA 3I59B 4KIBA 3Q26A 3NRVA 3Q9SA 1H9GA 1BI3A 2Q8JA 5TP9B 4Z7EA 1FYLA 4P9FA 5FHNA 3KP2A 3VDFA 1B40A 2I6EA
chains in the Genus database with same CATH superfamily
3TW6A 4GXAA 3TAJA 3OWTA 4YFNF 4BDYA 5ICGA 4ZDPA 4PDKA 5K1YA 1WJFA 1SD7A 1P1OA 1FP2A 1FPIA 3CFXA 3TEPA 1NMUA 3U21A 2EA4A 3KP3A 1ETWA 4OIPF 2E1CA 3BIGA 2R7UA 1HOMA 4ZZLA 5A5XA 4HDVA 3MBPA 3TDJA 2MFZA 2F4MB 3OXNA 2FA5A 2P5LC 3HOUJ 3DEEA 5EEGA 2JA5J 4Y17A 2JZYA 3S32A 3SZTA 1IXHA 3TP3A 4RB1A 4YAHX 1FSHA 4RS8A 3T96B 3OYJA 2CS3A 3K02A 5E8IA 2E35A 1SPIA 4IGRA 3B6CA 1HKSA 1WJBA 4NF6A 3H5AA 4H4KC 4EGZA 3JW4A 1MSEC 2OWZA 4MFEA 1QA6A 2VOPA 4AWXB 2F4OB 3RPWA 3ZMVA 4BLAA 3OEMA 3COAC 1XDSA 1OJLA 3SXYA 1LFPA 1VQ7I 3KFWX 3GUDA 4CDGA 2YX4A 1FQDA 5H8FA 2R0QC 1FPLA 1ETYA 1F1ZA 4BKXA 1NH8A 2B65A 2CQKA 2XVCA 3AKZA 1LLSA 1B59A 1FBCA 1MDMB 1JKOC 5I84A 5B3SH 3RTWB 4O94A 1R23A 3BG6A 5JVTA 3DQVC 3MMYB 4E7SA 1SVXB 3N4MA 2O69A 3A3CA 4O7MA 4BYYA 3GFMA 4P1LA 4BDRA 2QEXI 3ZRGA 1IGNA 1FPQA 4L0YB 2CFOA 1JGSA 1KA1A 1JKQC 4A3BJ 3LSHA 2JUCA 1TL8A 4OWDA 4KCCA 1GV5A 3HGYA 1MXVA 2XXTA 3BWGA 3PMXA 1R22A 3LSMA 3M8EA 4EEFG 1O64A 2Z5UA 2XWIA 5IGAA 2QVUA 1FY7A 4XKCA 2VBXA 1U8RA 1FJLA 2LSOA 3ZSFA 4QLCU 2VOOA 1IQ7A 1D1CA 2GQQA 5ILSA 1DOTA 2P8TA 5EQ7A 3M7GA 4EJVA 5FLXK 4XKRA 1R1NA 1X1DA 2D5WA 3PUXE 4QFKA 2UVGA 1SC7A 2YUSA 3HZJA 4ZE8A 4GYGA 4GD5A 3U72A 5I5PA 1BR1A 2QMWA 3WTTC 4GQOA 3RPQA 2OX3A 2XX9A 5F27A 1Z3XA 1GT0C 2MA3A 4XIDA 1YTVA 5I57B 2QMXA 1HSEA 1SD5A 3HOZJ 1K6YA 1JQFA 2ZSHB 4G6DA 5L3EA 4ZTFA 3OIPA 1X58A 4IHTA 2DTRA 3G3HA 3KCCA 3BG5A 1WRJA 4UV9A 1DDNA 1R1TA 2BYVE 3HRUA 3GTOJ 2DP8A 5ISUA 4IHSA 2B4MA 2QFLA 3RPLB 3S3MA 3BQZA 3CO7C 1VQMI 4U87A 1XTAA 3KLNA 2P81A 5IOYA 1ATGA 3KLOA 2FSWA 1A40A 2OLBA 3QQAA 4N0BA 4XRFA 3VVDA 1RDZA 2CUFA 3QWLA 1R9QA 3I5UA 3MVWA 1ORKA 2F3BA 2PG4A 3L2VA 4PK4A 2AXLA 2LF8A 1MBGA 3IHUA 4NWCA 3RYPA 2ZCWA 1MY4A 5ET6A 1Y3NA 3A1YA 5FLVA 4QPQA 3RTFB 3WG9A 3FJMA 3IFAA 1R4MB 4U0WA 4I40A 1G3YA 3FXMA 1R5GA 5EJCA 4HG2A 2HZTA 3HRSA 3B6WA 2W48A 2VKEA 1FPEA 5DVIA 2LF7A 1K9ZA 2LKXA 1OLCA 2RN7A 3J80Z 2QVOA 1U0JA 1LAHE 4HQMA 4DIGA 4PBQA 4M9ZA 3R6UA 4FQGA 2GOXB 4ENMA 4BJ5C 2DK8A 3FM3A 5DCMB 5M3FJ 3J7AY 2BW3A 4OFJA 4NTLA 5AE4A 1HDPA 2KHMA 1KONA 3QYFA 1F9BA 3PD9A 5CI5A 4IPAA 4EMSA 5IKBA 5JVGF 4HE2A 2UYEA 3QAXA 3E6MA 5ET5A 5C4XJ 3BZCA 1HSTA 2ZKZA 2Q2CA 3LR1A 1R6RA 3DPLC 3FHNA 2FD5A 4G6TB 3CG3A 2HQ5A 3E78A 5B66C 3NQOA 4XN3A 3R60A 3WHBA 4N15A 1FX7A 5ITOA 2H9BA 2GHAA 3F8NA 3H36A 1H44A 1KU2A 1JW4A 1QKBA 1X19A 4HW0A 5K7ZA 2OCEA 4XTCQ 3S2WA 1FZPB 3VXCA 4MEXF 2DMTA 2Y84A 5TRDA 1SAUA 2OUMA 5LGTA 4S04A 3JSPA 3MCZA 2J5PA 3PSFA 2HI3A 2V1NA 1SAXA 9ANTA 3OYNA 4PTKA 1IN5A 3VODA 1HCRA 4GBWA 3WGIA 4LG0B 2CMOA 1GLNA 1LSTA 1RYOA 4PGNA 3FZVA 5DM7F 3GTPJ 5DYMA 1QULA 2LVSA 1HF0A 4JX4A 3O97A 2M2EA 3ECHA 3PPOA 3SEYA 3A03A 1HKTA 2X1EA 4D7MA 3JRCA 5BQTA 1CF7B 3EYIA 3ZQIA 1JEVA 3LSLA 3H92A 1UTHB 1BI0A 5BWJA 2RF1A 1KQ9A 2DOEA 2PMZA 1YTYA 3JTGA 2XWOA 1PJRA 4P47A 1B72B 1W5TA 2MG4A 1LAFE 5E3OA 1ODDA 3HSEA 4R72A 5ELVA 3MUQA 3MQ0A 4UV8A 2Z8DA 1TWYA 1V4RA 1BK4A 2LG4A 3MEXA 2KMUA 4OESA 3J7AO 2B4LA 3OSQA 3SEXA 3PFIA 2UXXA 5LGUA 4GGGA 2QBYA 2KIMA 1IUDA 1DUXC 2X26A 1NL5A 2PN6A 2EZIA 4H1XA 1ZELA 3K4LA 2ZMBA 4P11A 4HV5A 1SVLA 4BE0A 3OL4A 2QS2A 3PIOF 1EH8A 3TTRA 2W7YA 3FISA 2YLNA 3PPRA 5TISC 2KJCA 3NARA 1YW9A 2FIXA 3H0DA 3H7MA 2VPNA 4XIGQ 2RC9A 3IOTA 5E18F 3RDIA 3REOA 3IUOA 2WY7Q 4U7DA 4Q4ZF 1FBGA 3B7DA 3C34A 1EZOA 5ET8A 5LFAA 3GZ6A 2FEZA 1B3GA 1YO5C 5I3SA 3HM5A 2VJ5A 2EIJH 1D5YA 4RK2A 4XKQA 3HTUA 5EZHA 2M87A 1FOKA 4QSCA 5F24A 5HS7A 3ZQ7A 3FM5A 4N81A 4ESJA 1X3UA 5TGTA 2ZYMA 3IAZA 3IWFA 1RR7A 3G1LA 1MBKA 2V25A 2DA6A 3U92A 2RDPA 2R7WA 3CVGA 4OYVA 5AA2D 4AC0A 3S9EA 1O63A 2UVHA 3J7YJ 5AA2B 3HHFA 1T8IA 5E3LA 1JVYA 3OYCA 2PI0A 4OU0A 2E36A 3RJPA 5EG0A 1B3LA 4JXIA 2CQQA 4B3XA 1WI3A 4BE1A 3FV2A 1PC3A 1DP3A 1FCKA 2VIXA 2XD2A 3BR5A 3IX1A 4GVOA 2HYJA 5E3MA 2WBBA 1MQIA 5E1WA 3ZR8X 3JRHA 2NS7A 2M45A 2QVVA 3S3OA 1JNFA 3CHGA 5HLTA 5HDKA 2L9SA 3T0YA 1OR7C 2L4AA 3ZN0A 4IR8A 2XGDA 3H9JA 3IFCA 5E3NA 3MKZA 3U93A 4EF1A 2JTVA 3HC7A 1IN6A 1AIVA 4PJ0C 4I6ZA 3F6OA 4GWZA 2XXKA 4IX7A 1VQLI 2OPTA 1R9LA 4G8XA 1GVJA 1VI0A 1K4TA 1G3TA 1FOWA 2IS4A 1HC8A 3ABUA 4GRIA 4U0YA 3WTYC 1A6IA 2R7DA 4M73A 4IJAA 4II2A 1LE8B 2DVCA 3ONMA 4JQFA 4UVAA 3F11A 2GXGA 5J1DA 2E60A 2O8XA 3CDIA 3TEDA 4NHBA 1MM6A 3R26A 2F48A 5H6RA 5T3JA 1KYWA 1B5JA 2LKSA 1OQYA 1LFIA 3ZQLA 1DPPA 2H25A 2DDAA 3VXBA 5IZ3A 1R7JA 1N3WA 3PO3J 4BBRJ 3RQTA 2L7FP 3HOTA 2P4WA 2QCOA 3PFYA 2I58A 4MQVA 3CI8A 3PUWE 1EZPA 4Y33A 3ZQGA 4ENNA 4ELPA 1ONVA 4F3QA 2TCTA 5BUUA 3C33A 3ILTB 2CO5A 4L5IA 1URDA 1HQCA 2ZFWA 4IO2A 3KOTA 4S05A 4YKPA 1XVXA 4AU7A 2HVQA 5B7DA 1LQ1A 3DP8A 1UELB 5FKOA 1SVMA 1WWXA 3JRGA 3H3ZA 2VC0A 1SD6A 3CUOA 2EJRA 3WHCA 1Q1HA 5H8SA 4QPOA 4GXSB 5I2KB 4A3JJ 4LQ5A 2A5TA 2X1DA 3CDHA 1Z3YA 5ERIA 5F0FA 2I4CA 4PJNA 1N0TA 2F78A 4OEVA 5DVFA 2KP6A 4HXVA 2IGKA 3VLVA 3VFZA 4Y3OA 3CIJA 4IY6A 1I39A 1S72I 5L3DA 1JW1A 2AL5A 1J75A 2ANJA 4MFDA 4R74A 3I9V2 3FVNA 4C1TA 2XASA 4L18B 4BHPA 2HR3A 3HUGA 4OIRF 5DDGA 2X6WA 3CDLA 3DF8A 4WWCA 3I54A 3HFUA 3CUQC 4JDFA 1X1AA 2LMDA 1WPKA 3E6BA 5K5OA 2E34A 3J81K 1NTCA 2HQNA 3F22A 1O3RA 2R7FA 1FNNA 1O57A 4IXAA 2DYRH 4HOBA 4RM3A 2I49A 5CVUA 1YX3A 3RIRA 2A61A 2DWIA 3V89B 4ZZDA 2N8GA 2B7EA 2PCRA 2F5DA 3A0HC 1RC9A 4H67A 3CSGA 2ID3A 3M8UA 3PUBA 2W82A 3CUQB 3KEOA 1T56A 4PFOA 2E71A 5HS9A 5GTIC 1FSEA 2XWKA 4U0VA 1LAXA 5DUIA 4DBRA 1AL3A 3PNVA 2G9WA 2ECCA 5CYVA 4BY7J 1ZTYA 1I3QJ 1D0XA 1WKMA 1Y1VJ 4GXOA 4O3BA 1SVOA 4X6AJ 4OHNA 1T95A 3PSIA 3QPHA 3ZXSA 4A6EA 4HNUA 1A35A 1TNTA 4IHXA 3PPQA 1USTA 1Y4CA 2MH9A 1ZTRA 1NI9A 2FRHA 3VYUB 5IYCJ 1FWZA 4HLXA 5C3EJ 1USYH 1NV6A 1YHQI 2G93A 4P0IA 5J4YA 2XHDA 2D45A 2ONRA 4ITVA 3L1PA 3MZBA 4YB6A 3S9MC 4DCYA 3K6UA 2BEOA 4EGYA 1SFOJ 4OTEA 1A36A 1IUYA 1B6AA 1LDJA 3MN2A 3I55I 2IA4A 4GX4A 3HKZA 1BA5A 3QP6A 1DPEA 1A8FA 3UNGC 1BI1A 1B1XA 2ELHA 4H65A 1MIJA 1Z7UA 2CEYA 2A3SA 1M1EB 2RQPA 1WZ2A 4MNUA 2XGCA 1MNMC 5FKMA 3OR1C 1LJ9A 1FMVA 2KIUA 1OIBA 2KLFA 2NS8A 4DXUA 5I2NB 3AG4H 2E0SA 2P5KA 5IZ1A 2M4KA 3FMSA 4BXFA 4C3IJ 1JVXA 3HSTA 3RQIA 2QA4I 3W15C 1WHUA 3KN3A 1RKTA 4B47A 5AIPA 3LAJA 2EIMH 3S2VA 2QYOA 2DWAA 4F91B 3F6VA 3HPHA 4KN7X 1OLTA 3T8RA 3OYKA 2P2AA 2E5ZA 2GHBA 3T9XB 3PQJA 4EV0A 3VSKA 1BKAA 1NFTA 3JTHA 5D5XB 2HDDA 4Q8RA 2VQHA 1MM7A 2EV6A 1R1VA 2TRTA 1NNKA 3G3KA 4QBAA 4X1BA 1BOBA 1Y0NA 4OQOA 2MH2A 3F21A 5L9MA 2FX0A 3DP4A 2RVCA 4X48A 4IO3A 3CMMA 1IXIA 2DU9A 5EGOA 2EQRA 2OTLI 1WFXA 2IRFG 1US4A 4I9DA 1XCBA 2Y0SA 3BZ6A 5J1YA 1LCFA 2ZNTA 3C9HA 2LREA 3Q5FA 3D5LA 1FP1D 2EH3A 5J47A 1LVKA 2LAOA 1MPCA 2R6GE 3TUSA 4X1DA 1B1BA 4A3CJ 3IO4A 3W6VA 3V83A 3IJOB 1TFAA 2XXXA 4E7LA 4OERA 5K7HA 2DTZA 1W7PA 4P96A 5DEXA 2HU9A 1NV7A 2DLLA 3L2UA 1ACIA 4FASD 1ZR4A 5KDTB 5CQEA 4BQOA 1BC8C 5K2XA 1YXIA 4P0GA 2KQRA 4ECFA 1JI8A 2DI3A 4DW6A 4BGDA 4BS9A 2F2EA 2A68F 3K7AJ 3L9FA 1ZMGA 1BW5A 1HKQA 3JRDA 4A3LJ 3ZGKA 2DT6A 3W2AA 3GZNB 4GFBA 1PUFA 1LNWA 2D5VA 4KUMA 3K01A 3O66A 3IP4B 1KU3A 4POWA 5ITPA 4XLAA 2FXAA 3D5RC 4EATA 3ODBA 1XS9A 2NOJB 2W84A 1IIWA 2EFWA 4XRSG 4JWYA 1PDAA 1B4AA 2COBA 3SZGA 2E1MC 4IRGA 2ZFUA 2XAGA 2XHKA 3CMYA 2RKHA 4UABA 1ZHFA 5ED4A 4KPTA 3CP2A 1JP4A 1LEAA 2CRGA 5CVVA 5IZZA 4IEJA 3OSGA 5I56B 3FK6A 3GZ5A 1YQAA 5ICTA 1D1AA 1G2HA 3K4NA 4ZDLA 2EFQA 1HDDC 2CQNA 4D5FA 3DXJF 1JETA 1FTJA 2X7PA 3FXKA 1PB7A 2QQBA 1LB2A 3C2GA 4IQ4A 3P7NA 3GTKJ 3S1NJ 3UR3C 2AIXA 1B6HA 1BJAA 5D4SA 1EF4A 1ANFA 1Y9UA 1D3KA 1OCTC 4JB7A 2HPIA 2R7OA 1V54H 2DT7B 3ZQHA 3CJQB 2A5YB 2ACJA 4V2GA 1IRZA 1B5IA 5I59A 3BG7A 3V8JA 5LOMA 2LDUA 3S16J 5JTYB 2AO9A 1D3YA 2MBFA 2UVJA 3DCFA 4H5GA 3GFIA 5FO5A 3QAHA 5FRMA 4RLFA 4P9UA 4BEHB 2PT2A 3KSJA 3MVZA 1UAAA 4PFWA 2ELJA 3EUHC 4KYSA 2MSYA 4P55A 5CMCA 3L7WA 4RB3C 4XLPF 2O3FA 4M4GA 4ESXA 3ZMSA 2ZZWA 4O8MA 3S1RJ 4AVPA 4QF9A 3GO5A 1SMYF 4PGPA 4YKKA 3OYHA 3FX3A 4FTHA 4O3CA 2HPGA 2BVLA 4R9GA 4LK1F 4P9KA 2H27A 3BPVA 2PBWA 4NNJA 5EEHA 1YG2A 3ABMH 3H35A 4CCKA 4OVPA 1UZCA 3RZDJ 2QM3A 5DT6A 2WEFA 5JHFA 1LGBC 3S2DJ 1TTYA 1FQCA 4FETA 2O84X 3KP6A 5DTBA 1P4AA 3K9TA 3OENA 3CESA 3I53A 5IPAA 5F6FA 1PB8A 1FBQA 2FMLA 3G2BA 1NH3A 2JQ7A 4ZYHA 2IJLA 2DDBA 3M07A 3F9KA 4NQWA 4NB5A 4DGWB 3IK6B 3BR2A 4GLIA 4KYEA 1K78B 1ETXA 1FTOA 2G7UA 4XN0A 2MGQA 3H6WA 2UWMA 4I1DA 2UYFA 3EPZA 3MZ8A 1M5CA 1OKRA 2O6AA 2XXRA 3SEVA 1SW1A 2QL3A 2VD3A 2B3BA 2F34A 1AU7A 3AG2H 4ELQA 5AA1A 1Y1MA 4G2ZA 4TQUQ 3S4UA 2XAFA 3BTLA 4KI0E 4F29A 4WKMA 1K9YA 1N3XA 1YW8A 2BXZA 1O4XA 4OVJA 4F18A 1Y1ZA 3EUAA 1VQKI 2QQAA 4POXA 4QIWN 3CCYA 4IO5A 1P9QC 3JAMK 3EKIA 3IO6A 1FTKA 2IXSA 4PE5B 2H1KA 1W36C 3KX2A 1RYXA 2WC2A 1GDTA 2OD5A 4YEJA 4ANJA 3S93A 2CW0F 2LD5A 4PP0A 3MJNA 3CCEI 5L8DA 5GPCA 2BY3A 4JBZA 3SDFA 3ZPLA 1A04A 2CUZA 3PQKA 1LBXA 4NE4A 2OCCH 2I8DA 4RGUA 2P0SA 1U5TB 2CJJA 5IM2A 4JP0A 5ICCA 3GBBA 3L2WA 3KG2A 3DBLB 4OVQA 1YYZA 2W1OA 1W36D 2K9MA 1BIBA 4L9NA 3Q0WA 4XLCA 1I6XA 2DQVA 1ZRCA 4I3YA 4R6HA 3OR2C 2ZMEA 3H5RA 4OENA 4U4XA 4XF5A 3RT8A 4HF1A 3G4SI 5JFRA 4MNPA 5H8NA 1TQMA 1B58A 2ICWG 2XB0X 4A3IJ 2NRAC 4ISUA 1KYZA 4F31B 2F5EA 1PBQA 3Q27A 2ZYNA 2VBZA 3C31A 4ZDOA 2A05A 3RGYA 2AL4A 4YIIA 3EF7A 1J59A 4P56A 3LSJA 4EJWA 4N9HA 1VQPI 4IOAF 1FQEA 3MSTA 3T22A 2OV7A 2QKLB 1B1HA 4RNSA 2DFFA 3OY9A 4MLVA 1ERDA 1W5CC 1GTKA 2PX9A 2D2WA 2RQQA 3JCUC 1D8KA 1IXRC 3QOEA 2LYCA 3I3VA 2IBDA 4GCVA 4Q5TA 4N6DA 2EWNA 1XMXA 1AKHB 1V3FA 2E1SA 4X1EA 3S3NA 1MY0A 2CZLA 4NF4A 5DW8A 1JW5A 1UG0A 3DFGA 2Y7RA 2O7IA 3D4GA 1SYIA 4P5OA 2DO7A 1NK3P 3NAUA 3H3VK 2ZXTA 4F3SA 3EUHA 1MBHA 1SFUA 3S17J 2Z9OA 1B9JA 1IXGA 3CF2A 3EDPA 3P7IA 3DTEA 2P7VB 4LZ8A 3DEWA 2M8CA 3WTZA 3IAM2 2ZO4A 4BL0B 3E1SA 2F4IA 4KNYA 3UK4A 2CZIA 3F23A 5CJ9A 2KPMA 4LVQA 3BTCA 5BPDA 4GOTA 4I3EA 2LBFA 3ABLH 3RI4A 3E13X 4QSEA 3CP8A 5JI6A 1PDNC 1W4MA 1QQIA 1Q1KA 4ZE9A 2KISA 1VQ9I 5AA4B 3GXOA 3HKZN 3V8XB 4NF8A 4LIVA 4I76A 4WXDA 4FISA 3EHUA 5FBPA 3TO6A 2AS5F 1ENHA 4PETA 5HDGA 3RN8A 1H88C 1XMAA 3MAMA 3K6XA 1K6OA 4A3EJ 4PFTA 4E6KG 1K7AA 2WAEA 3LQRA 4CCJA 1ZRDA 1SI0A 2ZBKA 4LFUA 2Q2EB 4FEBA 2R5YB 5B1BH 1BR4A 2KT0A 3R7XA 3IOUA 2HNHA 2PMSA 3GMEA 4ZYAA 2Z8FA 2XX8A 3PV0E 4D9JA 3DLLF 2HZKA 4ZTJA 3IR1A 1TC3C 3QPSA 3ZQFA 4D5CA 2Q74A 3BTJA 4IZZA 2E19A 3T9VA 4JYKA 1DPRA 2QZ8A 2YU9J 3DELB 2BW3B 3E7LA 2L54A 2DA1A 4M6VA 3EHSA 1FPDA 2V7FA 4CCNA 2FNCA 2VN2A 4MO7A 2HQ0A 4H45A 4F2OA 3MAJA 2R7QA 4BDLA 4PDHA 1Z91A 2R7VA 5FFZA 1FQFA 3MWBA 3HOSA 1Y20A 5CMKA 4F2QA 1LKXA 2THIA 2PFBA 4M74A 4XM3A 3E3KA 2ALUA 4MGRA 3LSTA 1DCUA 1QRYA 2Y0SN 4ZEDA 2R7TA 1OYWA 2Z2SB 4ND9A 3PUFA 2EINH 3FV1A 3X2QH 3OS1A 4AD9A 1I1SA 3I59A 2NXOA 4Y4RA 5ET7A 4EQBA 3ONQA 2VB6A 1I6HJ 1T0FC 2GFEA 1YYVA 4FX0A 3CTAA 2M5WA 4ESBA 5LEJA 1ZG1A 2Q8MA 2H98A 2KL4A 4OIQF 2OZ6A 2IGNA 3M1EA 2IW5A 5IP7J 2JA8J 2R93J 2NAZA 5DV5A 1STZA 1FJ9A 2HHMA 5J1UA 1V5GA 3BPXA 4BHCA 3DLNA 3FIRA 4XMYA 5KNLA 4DI3D 5EF6A 4XSZF 2HVSA 3FJ7A 4CYCA 2GA1A 3GEZA 2G7HA 5EDNA 2VODA 3JSOA 1Z21A 2RREA 1FC3A 3MZYA 2F35A 1J9IA 4QRZA 1LUJB 5KAIC 4II3A 5ICFA 3T0JA 3BJAA 3LUZA 2XC7A 4KT5C 1USYE 2HXIA 4KN4X 1S7YA 4B09A 3WGHA 3FJGA 5F1QA 1BI2A 3M3YJ 2CMPA 5FTIA 3VSLA 3O29A 2CG4A 4OXVA 1OMIA 5GAEJ 3OO7A 3OYFA 4K3FA 5BMZA 2ZSIB 1POY1 4WXHA 2HEUA 3KFMA 1P6RA 4NAPA 3JZJA 4G68B 1WODA 3N97A 2PBIA 5L3GA 2P6SA 4KHZE 4B48A 5IOZA 3OYDA 3P9KA 2B9SA 1BLFA 5F64A 4MMPA 3H06B 4KIFA 4XKBA 4ON0A 4I0BA 4UB6C 1ETKA 2JRMA 2Y7KA 1FBFA 1GGGA 1GVCA 2O1LA 4M71A 3VPRA 4G8HA 2P1SA 3SYTA 1J2XA 4UVCA 4BXUA 3C18A 3A2KA 2OZUA 3OSRA 2IVMA 2XD3A 3EN3A 3C3WA 3EHTA 1YI2I 4PF8A 1IAWA 5FHOA 3RPUD 4MHFA 1EYKA 5GPAA 5A2QZ 1MRPA 3TMOA 1D9VA 2P0WA 2K9SA 1MS7A 3I5OA 3VV5A 2RNGA 3CZ6A 1G6NA 4I99C 3SHFA 1VR5A 2Y75A 4B3AA 3OYAA 4XFEA 4LJZF 3L6GA 3SEUA 5M2VA 2K9QA 2XXPA 1Z1DA 5JHUA 3FASA 5LDZA 3M3FA 5AA3A 2WV1A 1MW7A 1UB9A 1XGOA 4ZH4F 5D5WB 1KWHA 4HS7A 1R6ZA 4UACA 4XLNF 1SFKA 1AH5A 3HRTA 2M9HA 4JX6A 1YIOA 2E2HJ 1I3AA 4LD5A 2K86A 3P5JA 2E7XA 3IOVA 4NX1A 4I01A 4XK4A 4QSHA 3L00A 4CCLA 2H1LA 4WX9A 2DN0A 1NUXA 1ZG5A 4KFCA 1WGXA 2EILH 3FUZA 4DZ1A 4IO4A 1DTGA 2GWRA 3OOPA 4G9YA 2LKPA 1PUEE 4MTDA 5FKNA 3HG9A 3VVEA 1G4DA 4N4NB 4PSWA 5HS8A 2FE3A 2RAEA 5EYHA 1I50J 3RKXA 2FNPA 1OCZH 3FXLA 2ZNZA 4Q48A 3KBZA 3PGFA 4NGUA 3P9IA 2KDOA 2RC7A 2QRYA 1E0EA 4U21A 4G94A 1WJDA 4F3BA 1KZHA 4DI4B 5L3FA 4L9JA 4KISA 2AQEA 1PB9A 4R73A 3TOBA 3DEUA 1B8IB 2VONA 4DJAA 2JVGA 3OSFA 2XAQA 4UNOA 1FPKA 1FMWA 4U22A 2CU7A 2GA2A 1UHMA 3E0JB 1NV3A 4LUBA 4OVSA 5I57A 1BJZA 4QTRA 3PO2J 3K0LA 5ILVA 5D6FA 1RKMA 4XKNA 3ZS6A 2Q8KA 3LL7A 4R8HA 5F1RA 2ONSA 4U4SA 2ISYA 2X0LA 3DPTA 2VKHA 3JV9A 2REJA 1ZGAA 1HA8A 4G8MA 2LFBA 1HW5A 2YX7A 4PCQA 3TBIA 1JJ8C 2ZYKA 2X9DA 1H3DA 4PJMA 5IYBJ 4GWYA 2QSHX 2R7XA 3TCHA 4GBVA 1ITYA 1IMBA 5LTCA 2FJ1A 4BE2A 2VOZA 4LLGF 2E2IJ 3PMWA 4PFUA 3F8MA 1BIYA 1QUJA 2G0EA 3ZQQA 2WKYA 4P1WA 2XAHA 3F8BA 5KCJB 2DE2A 3DPUA 1QNTA 1EH6A 1U9OA 3D1RA 2IS2A 2IS1A 2ME0A 3FK7A 2DA4A 1ZIUA 4XNFA 4Y13A 3QUJA 5H8HB 2Z3YA 5BS6A 1FPJA 3KGCA 3W9VA 2LLKA 4IGTA 4R2BA 2V4CA 1R58A 2HS5A 4LLNA 2V93A 5HLIA 1Y3QA 2NNYA 3N94A 4AIJA 3K1MA 3MD2A 4MEVA 1AA7A 5DCMA 1DP7P 1R4NB 2O0YA 4NF5B 2LTPA 4M3BA 1MBFA 3HV1A 4B8XA 2H4IA 2ESNA 1D4NA 5D5UB 3DU5A 1W5SA 4YIRX 2R5ZB 3TTKA 3LSFB 2QS1A 4IF4A 2XWVA 3GTMJ 3WTWC 3QSLA 1KQ0A 2PJRB 1VSOA 3TPAA 3CMEI 1MZBA 4HNTA 3PUZE 5IP9J 1D8JA 5E1ZB 2DAOA 3H6TA 3PTYA 3SQNA 1FBSA 3ZCOA 1LBYA 1MJ9A 4RMNA 3SEWA 5IP6A 3WAFA 2KZVA 1B0HA 2W57A 3LSGA 2DMUA 3FD3A 2QKMB 3OMYA 3LQQA 1Y4TA 2WYKA 4DXCA 1JTYA 4FE7A 3J7ZI 2Z8EA 1P1WA 2I5UA 5FROA 2JWTA 3O28A 2ZJQF 1RI7A 5FRNA 1ETQA 2QLZA 3HEFA 1NK2P 3ZN1A 1P2FA 5I58A 3MVXA 1ZARA 1Y1WJ 3ELKA 2V1XA 2XSDC 3DTKA 3U9GA 1CNQA 4A3MJ 2I3VA 4O3AA 4KT6A 3K6GA 2A6EF 4M3FA 4A5NA 3FHZA 5EQ8A 3UORA 4YKJA 2M3AA 1G8XA 1F43A 3IOWA 3L09A 3K2DA 4P1EA 2IPQX 1R36A 4IKFA 1UTHA 3O6BB 3S14J 5CPRB 1VDWA 1E3PA 4HE1A 3F0CA 1CE2A 1LBVA 4KJZA 3SFIA 4FIMA 4XR6A 4RGXA 1B72A 5EQ9A 2ZYOA 5CKTA 2DPUA 3BJOA 2JJKA 3DWLE 1MJBA 3CCJI 1EYJA 3GYYA 1AOVA 1UMQA 3HPIA 2EK5A 4HSTA 1OQGA 2BZTA 3OMBA 3TQNA 2CQ7A 3SJMA 2FBIA 1NUYA 2GLOA 4D7NA 1S3JA 1YJ9I 2LH9A 2YSRA 3DU6A 1Q35A 4FHTA 1EH7A 3TMGA 2Y7PA 3MZ1A 1US5A 4N13A 1WVJA 3U65A 1EJ9A 3QU6A 1YAEA 1ZKBA 2XPWA 4IVNA 1MXZA 3TELA 1QUIA 2JA7J 3W6JB 4C0RA 3Q3SA 2BJJX 2CZKA 4THIA 2XF5A 2ESHA 1QPIA 5DTDA 3G3IA 4LZ5A 4YKIA 2Q89A 3SETA 2F97A 3SERA 3Q28A 5L9OA 1N04A 2QUFA 2NXNB 3OYEA 1NKXA 4LGWA 4HX4A 4A2UA 4UUSB 3C36A 1QGPA 3I4PA 3IKVA 2BY2A 1LBCA 1V5FA 2XDVA 4PUSA 2D1HA 3I58A 2QS4A 4F3GA 4CSWA 1FBHA 1MNDA 3HDDA 2Q1ZB 4NG7A 4CUGA 1TQIA 1R1UA 1O7FA 3DM0A 3F8FA 3ABTA 4GL0A 2KZGA 1X2NA 2Y31A 1VQ5I 1FSAA 1I69A 3GYHX 2R7RA 3CC2I 4GIZA 2CEXA 4L9VA 1PVEA 3D4CA 4WF2A 5AA2A 2RGVA 3M8JA 3HOWJ 2IEEA 4RYAA 3DTIA 1ZYRF 2XPUA 4R9FA 5IAIA 5EGOB 2OF7A 2Y69H 4XLEA 4L5EA 4O6JA 1M5BA 1ZK8A 3A0BC 3R4KA 1W1WE 2WA0A 2ZNUA 2VXDA 3CRBA 4LN5A 1GUUA 3HSFA 4RA1A 3D0SA 3ESWB 5GAHJ 4HAMA 2XRLA 2EZKA 2GOMA 3CQZJ 3GVAA 2IEKA 2XROA 4JSDA 2NNNA 2DE3A 3TTNA 1ZJLA 2UV1A 3OEKA 3WGGA 5ICEA 2HDCA 5DYHA 5FD5A 1IDZA 4WEPA 4W97A 2IAIA 4NC8A 1FW0A 1MMSA 1LFUP 3AAFA 4U88A 2L9NA 1LDDA 2F5XA 3KN7A 4G4PA 3HYIA 2E2JJ 2K27A 3E5QA 3ZOBA 4G7ZF 1QVSA 2VUMJ 4BQNA 3JRBA 5TJJA 2XAJA 3FIWA 3ULQB 3F72A 5M5XJ 2DYXA 4KCDA 2GBYA 2L5QA 4OMZA 3IL2A 1B52A 1OR7A 1WJEA 2HOTA 4OVTA 2DDKA 5D8LB 5LHIA 1GR2A 3U94A 1LE8A 4RM2A 3CFZA 3RY3A 4F55A 1H0MA 5HVQC 1KQ8A 1WCMJ 2OCUA 3I3LA 1TT1A 5J8CA 1G3WA 1RUNA 3OYLA 1O3SA 1LCTA 3TP0A 1TWCJ 2VJJA 4XOPA 2B63J 4HA8A 3K4BA 2BHYA 1I27A 2ME6A 2HQAA 2Q0OA 1JKPC 1SMTA 2IA2A 3WTSC 3CCUI 2KIQA 1FTZA 4F7ZA 3LSXA 3IKTA 2C6YA 3J81Z 1QZZA 3BR0A 1X3ZB 4M9SA 2QENA 4AIHA 1UHWA 2X4HA 1HSJA 2HOSA 1UTBA 1OCOH 3H6UA 3KC1A 4X04A 3WAEA 3ASNH 2V6EA 3E4RA 2LC2A 3OELA 2W7NA 3E5XA 2JA2A 3JYRA 3DP7A 1IITA 1IXCA 1XN7A 1B5HA 3O6IA 1OQHA 4GF8A 4DCXA 4LITA 3QXMA 2QGUA 2DWJA 2E1NA 2D3IA 1N25A 3HIFA 4DYRA 3CJTB 3FXRA 4R75A 4U7BA 1CGPA 1BP5A 3GLBA 3AL0C 3B6QA 4FORA 1MXWA 2DT5A 2QQ8A 4M6YA 4NWDA 1M5FA 1JUMA 1UJ8A 2L3DA 3IL1B 3FXOA 3OO9A 3TOAA 4F19A 4PDDA 4F39A 4LA9A 1MY1A 5I2KA 3BG9A 2HOEA 1W0TA 2K4JA 3TL4X 5GAGJ 1H45A 3LA2A 1OISA 2HFHA 3MP8A 4BUPA 2H6BA 1GVDA 2CUEA 1D5VA 1IXSB 3FXQA 3AL0B 3HL2A 1NUWA 2JUGA 4M1VA 5H8NB 3MZ9A 3HTSB 2OJTA 4A3KJ 1EU8A 5F0CA 1SW2A 3N05A 3HJEA 2DXRA 2I0BA 3CR9A 1B05A 3RKWA 4ABZA 1FYMA 3TZAA 2ZXJA 4HDUA 1NV2A 4PAKA 5F7VA 3HOVJ 1OVBA 1Y0UA 1WJ5A 3SFZA 4BAYA 1VNDA 1X1PA 3HSRA 3EETA 2V26A 4CICA 4YG2F 2CFXA 4HLYA 2JJ7A 5CVRA 2Y48A 4S0HB 1YCJA 1FRPA 4Q5SF 1FT9A 2VL8A 2CW8A 3KPHA 3A01B 3ASOH 2PMZN 2JA6J 4UA8A 2Y5LA 3T1BA 3CUQA 2W25A 1X4OA 3KZYA 1QKAA 2ZNSA 3GBAA 5CC2A 2HCAA 1TFDA 2Z33A 4FX4A 3I56I 3WU2C 3HOYJ 2PX1A 2LY1A 4AUXA 1C0WA 1TXFA 2FBKA 2XX7A 3BFUA 2TDXA 2DWHA 2R71A 3L6HA 2QVRA 4OEUA 4H46A 4I2OA 5KHDA 1NNFA 2BGCA 2VPOA 4DNCA 3N26A 1MKMA 2ZJPF 5F0HA 3IWZA 1URSA 4RA2A 4KITB 3GWZA 5D6EA 1M5EA 1WH5A 1S9HA 3VEPA 4XRMA 2BHZA 2KDZA 2O1MA 2OQRA 2ID6A 4B1RA 4Y52J 3R61A 2HAUA 3WTXC 4OWRB 3K10A 4EM0B 1FPFA 4EQ7A 3BQYA 4JBAA 2FQ4A 1N76A 5M5YJ 4X9TA 2WY8Q 3WU0A 4LONB 2ELKA 3SEQA 4DOZA 1B3EA 4OZ9A 3QK6A 2XF7A 1FOXA 3KP7A 4HCYA 1HLVA 1VF9A 1MNEA 3BR6A 3OYIA 1AWCA 5I2NA 2KQZA 4LATA 2EZHA 1PP8F 4XKWA 1XPXA 1TW3A 1XSDA 2VKVA 1YLFA 1LPQA 3E5UA 2FVZA 2ZMEB 2XV4S 3KEIA 1T0KA 1FTMA 3LSIA 2XSJC 1H9TA 3CC4I 1XC5A 4PFPA 1VTNC 1YOVB 2JSCA 1FLIA 2PT1A 3RKQA 4R1HA 2X7QA 4PQJA 1LB8A 3USDA 1DQUA 1LFHA 2E1OA 4I0AA 3IB1A 5CM6A 3ZMUA 2A69F 4O5VA 1QJMA 4HX8A 3T66A 3W6KB 5HPQA 3K70C 1ETOA 2K3FA 1H8AC 5F08A 4NHJA 4DXBA 4AS4A 2FHYA 4QFOA 2OU2A 3U1DA 4F1UA 2K4BA 5CLSA 2VJ4A 2V3UA 3Q29A 1U3EM 1AHDP 2V9KA 2MLKA 1MQHA 1Z9CA 3LOCA 1AWBA 4QFPA 1IEJA 1V5EA 4B44A 4G12A 1XCVA 5TU0A 1IF1A 3KE2A 4N8YA 2Y30A 5EHSA 2I0CA 3W2WA 3K70D 5CMMA 2Z16A 1DGRM 4B43A 2YR2A 3JRFA 3OIOA 1BOAA 1L0OC 4NF4B 1UHSA 2F5CA 1ZR2A 1IN4A 2NVYJ 3V42A 4FJPA 2VQCA 5DUKA 2WADA 3ECOA 1DGWY 2VQGA 4G7OF 4MNIA 3HB9A 3K1NA 1VQ4I 2MD5A 1N75A 2DOAA 3CF5F 2COMA 5DEQA 4GWOA 1ON2A 4JWOA 2DMPA 5M3MJ 3T9HB 2OWTA 1GV8A 3MKLA 4LLLA 5H6QA 4G77A 4GX6A 5A5XB 1JXSA 5LGNA 1Q9DA 1U5TC 4IY5A 1IW7F 4LB5A 4RAGA 1ZH5A 2OC6A 3V8KA 3H9QA 4N91A 2JK3A 3JRAA 3A02A 5GTHC 1BTJA 2DA2A 3GTGJ 2OWSA 4NF6B 5HOOA 2IGOA 3MVPA 4R6YA 2Y9ZA 2IS6A 4XQFA 1QZYA 2HZDA 3SEZA 1MMGA 3AXFA 2L7KA 2ZXWH 3RQ4A 4E7KA 2AXTC 2F6CA 1B4ZA 3GXAA 1POTA 4A0XA 3V8LA 3S9LC 3AG1H 3PUYE 4NF8B 1IO2A 4A3GJ 5H8QA 4YFKF 2JMWA 2O61A 5I56A 2L9VA 3CSBA 5FTHA 3TTLA 1R49A 2WB1A 1D1BA 2QS3A 4PF6A 1QVUA 1BC7C 5H8FB 3TW7A 1ZN2A 4M3GA 4EVIA 1Y56A 2M4GA 1LEVA 4PC9A 4PAFA 3W9WA 2K5CA 4J19A 5H20A 3GLLA 3LFKA 4MH5A 2EV0A 4XRSA 2QWWA 4YELA 4BDMA 5HM4B 1XT8A 4MX6A 3KETA 1ZLJA 3CD6I 3S1QJ 3M3KA 2VE9A 2GZWA 3T5XA 1L5TA 2O6GE 1EA3A 1XD7A 5GP9A 2HGCA 1FQBA 2M0MA 1S7AA 3BZKA 3HHHA 4YB7A 1UG2A 3RT6B 3TCFA 1MBEA 4CYDA 3NWSA 5J4VA 5LBQA 4MNCA 3UKGA 4ZECA 5LHHA 5KCMA 4GDFA 4CZCA 5FB2A 1IMDA 2DODA 2XRNA 1OFCX 3O9PA 3K4CA 1DMBA 1Z67A 4CCMA 2VBWA 4HSRA 2VASA 4BEHA 3G73A 1A54A 3WODF 2OK2A 2RV8A 1MXUA 1JT0A 3BJ6A 1IMCA 3CCLI 2ZJRF 2O03A 3OL3A 3K4UA 4E7ZA 4XL9A 1LFBA 1ZREA 4XKVA 3HXLA 1T33A 3C2BA 3FKJA 3JAMZ 1EYIA 3HCQA 2RCAA 2PLYA 3E97A 5JR3A 1JKRC 2IA0A 2PVUA 3H4ZA 4JWXA 2H09A 3C7JA 2PQ8A 1Z7LA 3R6SA 4QHQA 2Y5KA 4BHBA 2X85A 4CXFA 3U2RA 5KAFC 2E5NA 2ZC2A 4AYBA 2GM4A 2D21A 4ZEBA 2GRVA 4KDPA 5TPAA 3ZQCA 1UIVA 1VQNI 2DA7A 3KP4A 1HSLA 2O7OA 1A31A 1Z05A 2BY1A 3TKDA 3BDDA 1TP4A 4OIOF 1XDUA 1SYHA 3KEYA 4C2MJ 4BH9A 4CYCB 1K78A 5L3CA 2WYPA 4FAJA 4YMBA 2AQFA 2FOWA 3KYCB 4LOCA 1NUZA 4ASNA 1YRNA 5D4RA 4H0EA 4OAYA 1KZ8A 3PNTA 2RC4A 4LZ7A 2DQLA 4XICA 1JT6A 3E6CC 4B4CA 2PMHA 4YICA 1WVRA 2DJIA 3V7SA 4LP2B 2F3DA 1XMKA 4RAFA 3M4OJ 5IT9Z 1Z6TA 1EZ9A 4RGRA 2O7UA 2QSXA 2Y7WA 4FECA 4X8RA 4MHGA 4RDUA 1J7KA 1MSFC 1JUSA 1FOYA 1TWGJ 4HF0A 3CCSI 4LG3A 2EFOA 4ZYEA 3HOXJ 3H3GA 4M6XA 5J40A 4RBOA 3GBGA 4NC7A 1G3SA 2QSGX 1I6AA 3H03A 3KBRA 2ZXHA 3PPNA 3CFLA 5J3LA 1GHCA 1B7UA 4HV6A 3DKXA 1NV4A 2XPVA 4L17A 1IRXA 4ZS9A 3QYBA 1BL0A 3OOUA 3HRMA 2RKMA 4IO7A 5E20A 3KIOA 4IRHA 1P99A 3FVKA 5EYGA 3CJNA 4G8NA 2L4MA 1RNLA 3ROUA 4PJJA 2L2OA 3F8CA 3FMRA 3N6TA 4HW8A 3PUVE 2K3PA 4RK9A 5EEAA 2HEOA 5KK1A 4A12A 1RKWA 3H0GJ 1U5TA 3BY6A 1IG7A 4KA4A 1U6GA 3O3KA 1E17A 3OOAA 3BR3A 4ELRA 1MMNA 5C4JJ 3KYLA 4QXDA 3LMMA 2XXUA 1SI1A 3EQ1A 4F52A 4HQEA 3PD8A 2EIKH 2WAQA 3TDZC 5IYDJ 4C30A 1WDNA 3BC8A 3H9GA 3K4KA 2H5YA 2JPCA 3I71A 1J09A 1JTXA 1QHHD 1Y8RB 2HXRA 3BKIB 1MG1A 3GZGA 3O6GA 2WBDA 1TWHJ 5DD8A 5LLQA 3I0TA 4ZYGA 1B9NA 3BBRA 3UIFA 3MFKA 3VYTB 2FUG2 1FEXA 1IN7A 1P4XA 2GAUA 4DZJA 3MKYB 1MQGA 2WBMA 4U1ZA 5L3BA 4WEDA 4XKPA 3RYDA 2NVQJ 3NEUA 1RR8C 3CO6C 4EM2A 3C32A 4QWQA 2F7CA 3HN0A 5J6XA 1ZAOA 2R8TA 4OA4A 2NOOA 5TP9A 3QU3A 1B3HA 2R92J 2ADUA 1FBPA 1S9TA 2DVZA 1Y6IA 2DFEA 3A4CA 4BJTA 4A93J 1NV5A 1DPUA 3J80K 3ERMA 2XXYA 4J01A 1XGNA 1ZG3A 4G68C 2R3SA 5H2FC 1IRFA 3FXJA 1NV0A 4N8GA 3B6AA 2QQ9A 2XXHA 1FBEA 1AKHA 4HF2A 2P6TA 1JEUA 1XI6A 3KJTA 4CHUA 1K4SA 2KRCA 2GIZA 2Z22A 4KQPA 2KRHA 2M8GX 5A2QK 2STTA 2DSFA 1SEUA 4KXPA 4BDZA 4FE8A 1OLAA 3S2HJ 4MCOA 1JE8A 3KZIC 2UVIA 3UN6A 2XXWA 4PE3A 5HODA 3BFTA 2PJPA 2Z23A 2H8RA 3EYYA 2VPRA 2EBIA 2W00A 2V1UA 1LDKB 1JHHA 2DK5A 1HW2A 3K00A 3UP9A 4DQ2A 5K7FA 2STWA 1BBYA 1P92A 5C44J 4V2FA 1YZ0A 3G3GA 1DBZA 2P7CB 5CBSA 2YPNA 3KYDB 3E3VA 4XBFA 2FNAA 2QBYB 2K9LA 4YIFA 3C4MA 5FLXZ 3HHGA 2CGPA 1NV1A 1TNSA 2XXVA 3FXBA 3DLAA 5AA4A 2XKOA 2W85A 5AIQA 3SZPA 2VJIA 1O7LA 4PFYA 1AMFA 4Q0CA 1ZBMA 3S1MJ 3MW0A 4XONA 1WSUA 2H94A 5ILUA 4ZDMA 1YS7A 5FKKA 2L7ZA 2LNBA 4XORA 4HRIA 3I6VA 3OO6A 4RAYA 5F04A 4AVZA 3BLYA 1IJWC 2OZZA 3U1OA 3QMFA 2BOLA 1TT5B 4EQ9A 3RSNA 2Q2EA 2R5YA 2WTEA 3LFUA 1LBZA 5EHMA 2YU3A 1MH4A 3VOEA 4E0XA 5JTYA 4EUOA 1MDMA 3IH3A 5KVRA 3G1OA 4XXUA 4MBPA 1OCRH 2OJED 1SANA 4I02A 3IAS2 5K5RA 2PFZA 4FEDA 1QVTA 2L7MP 3AFHA 4UB8C 1DTZA 3NOHA 1KGSA 3QIMA 3SKPA 2V6CA 3LSPA 3ZMTA 2FBHA 2HVRA 4HTGA 3M3LA 1ZU0A 2Z99A 2QF7A 4DBQA 1W0UA 2EPFA 2VQLA 3VYSB 3BOQA 2MKZA 1TBXA 1UCRA 4IQJA 5EG0B 3MQ9A 4KD5A 4IRIA 4U2RA 1ULYA 3K69A 3MKWB 5EZGA 4YB5A 2ZNYA 4R2FA 5FGMA 3B50A 1VQ6I 3TYHA 4BDNA 2VT3A 4I7HA 2X1CA 3FF5A 4Q47A 4O3MA 1CB6A 1VE4A 4H8JA 5LRRA 1RDYA 4G7HF 4JK1X 3L2RA 2R7ZJ 4KICA 5FKLA 4EM1A 4N9IA 5FD6A 2LK2A 2ZXIA 2OTJI 1S7EA 5BPIA 2X6XA 3CLQA 3WU1B 1EKEA 1Y39A 4U23A 3I4MJ 3LUYA 4C3JJ 4C9YA 1E2XA 2L01A 2M7AA 1ETVA 2HXWA 5CBRA 2FF4A 3ABKH 1TWAJ 3C35A 2CUJA 3QPLA 3Q0UA 2OBPA 5B70A 2KIFA 2K40A 3O6HA 3S8PA 4JX5A 1FBUA 2DS9A 3ROJA 1MD0A 2J5OA 4Y15A 1T38A 5I58B 1X3WB 1BM9A 4MTEA 1ZRFA 3M1CA 3IV5A 4KYWA 5JLWA 2REGA 1S8NA 4ZJZA 3R0AA 3V7CA 2BY0A 3QRFF 1REPC 2CV1A 1B0LA 2CZHA 1T0FA 5HNFA 3RPLA 1HW1A 2LR8A 1NH7A 2H99A 2MW8A 2JSPA 2KLOA 2VT2A 2EFPA 4HNVA 3RUMA 5IZ3B 3QYTA 3E6DA 3QODA 1YJNI 4R79A 1K61A 1MDP1 3G7WA 4G68A 5D8KB 1MY3A 2XA5A 2ONKE 3K4MA 1PEBA 3TCGA 1A8EA 3Q9VA 2NYXA 5GADJ 1T6SA 3OD7A 1P1QA 1YPNA 5D5VB 4A5MA 1H89C 1A5JA 2O68A 5DS9A 1EH3A 1FTAA 1B32A 1QW0A 3JR9A 4IO6A 2WB1N 1R00A 2E7WA 4BY1J 2DXIA 1FBDA 3FXUA 3MWMA 4EJUA 4DYQA 1IC8A 1FTTA 1U8BA 4PFRA 2HAVA 2WX9A 5DD4A 2HXOA 1G0IA 4XLFA 1XOCA 3FBIB 1UFMA 1B7ZA 3RPUA 4OVRA 1MPBA 3FBNB 2XUBA 4A6DA 1XSVA 1J0RA 2O9LA 3N6UA 4RPNA 2OQGA 2A5TB 4DZPA 1DK4A 2DOJA 3VFJA 3EUKL 2F36A 2PYYA 4WCGA 4H0WA 1SW5A 1S6LA 4I62A 4O7IA 1ON1A 3OS0A 4GWXA 2I48A 4QSDA 4FATA 5J16A 1GV2A 2AHQA 1O3TA 1IN8A 2M0CA 1RUOA 3HUGB 2K85A 4A0ZA 4LIUA 1A55A 2JRTA 5JLXA 5CMBA 3TGNA 1IMFA 1EV7A 2D1VA 1JHFA 2DMNA 2V9VA 5HNHA 4M72A 4ZZAA 1E3HA 5DVJA 5HDNA 1IV8A 3KP5A 3P9CA 1I6QA 1VQ8I 4JVIA 3R0JA 3IB0A 2DYSH 2M34A 4WK8F 4RPOA 4OANA 1TQPA 2PMUA 1I5ZA