2ESNA

The crystal structure of probable transcriptional regulator pa0477 from pseudomonas aeruginosa
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
301
structure length
299
Chain Sequence
b'PLLRRLDLNLLLVFDALYRHRNVGTAASELAISASAFSHALGRLRQGLDDELFLRQGNRMQPTQRAEHLAAAVAAALRALGEGLEEWRPFVPGQSQRTFVFAATDYTAFALLPPLMNRLQHSAPGVRLRLVNAERKLSVEALASGRIDFALGYDEEHERLPEGIQAHDWFADRYVVVARRDHPRLAGAPTLEGYLAERHAVVTPWNEDSGVIDRLLARSGLRREVAVQLPTVLAALFLAGSTDFLLTAPRHAARALAEAAGLALYPAPFDIPPYVLRLYSHVQGRDAHAWMIGQLKGLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords probable transcriptional regulator
publication title The crystal structure of putative transcriptional regulator Pa0477 from Pseudomonas aeruginosa
rcsb
source organism Pseudomonas aeruginosa
molecule tags Structural genomics, unknown function
total genus 89
structure length 299
sequence length 301
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2esnA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2esnA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2esnA03
1BI0A 4NB5A 5EYFA 1OKRA 3VOEA 2QENA 2UZKA 4JBZA 4WKMA 1ZGJA 1IUYA 3SHFA 3B6WA 1W7PD 2W57A 4GOTA 3L9FA 1B1HA 4UV8A 1SI1A 1KU3A 3TCGA 3DLNA 4FX4A 2ALUA 3H6WA 3TODA 3LFKA 2HFBA 2FMLA 4OIRF 4JWOA 4MBPA 3LQQA 1HBXG 4R9GA 1B0LA 1D9VA 4GL8A 4Y17A 2I4BA 2XASA 2OK2A 2FBHA 4U22A 2HGCA 1T6SA 4E0XA 2Q8JA 1B4HA 4OIPF 1FYMA 3V8XB 1XSVA 1N0TA 3RY3A 4AD9A 1B9JA 3C33A 1EZOA 2I6EA 2OJTA 4C0RA 4GCVA 4FEBA 2W85A 5HVQC 1FSHA 1HW5A 2RKHA 3SZTA 4EF2A 3Q29A 4MEYF 4RNSA 4XRFA 1TW2A 1TXFA 1BP5A 4RY1A 1MQIA 3MWMA 5JK4A 1W5SA 4R2BA 1M5CA 5K2YA 1A7LA 5D4SA 5HPQA 1H9GA 3RYRA 3ELKA 5L3BA 1J7KA 4X1DA 2E1NA 3BWGA 3HYIA 4KI0E 4M9XA 2F8DA 3IOTA 1OQGA 3F8CA 5CVIA 1MXVA 4ZEBA 2HYFA 3TCFA 3ZPLA 2XXIA 2Y7IA 3LWFA 1XMAA 4KMFA 2M8EA 4HTGA 1WDNA 2Z8EA 3IO4A 4F3GA 1FP1D 5KCJB 5CMMA 4M71A 1WKMA 1URSA 1WSUA 2EWNA 3DP6A 4I02A 1R9QA 4HV6A 2GQQA 2VHAA 2JRTA 4Q30B 2XXTA 3C1DA 1IXSB 5AA3A 3N5LA 4HDUA 5I57A 2ZNSA 4HYEA 3PMXA 3SEVA 1K79A 3K0VA 3G3FA 2EB7A 3RDIA 4PFYA 5DUKA 2YSRA 4KIFA 4HCYA 4GFRA 4KYWA 3SETA 5H6QA 1PDNC 1KQ9A 3A09A 1P92A 3OXNA 1SFEA 1Z05A 4LGWA 4CGZA 2BEOA 4O6JA 3HCQA 1P1WA 3K1PA 4UUVA 3EDPA 1XOCA 3E9XA 3ABUA 2KIMA 5HS8A 1IN4A 3ZKKA 4OMZA 3S2WA 5E17F 4PETA 2FOKA 4XIGQ 1Y4TA 1ZYRF 1EH6A 3KSXA 5J6XA 1HKQA 1JETA 4WXJA 2BJJX 4ESBA 2PN6A 4RPNA 4GGGA 2Q89A 2JPCA 2GHAA 1IITA 1IXIA 4THIA 2F5CA 2J5OA 3WU1B 1OQHA 4R74A 3KFWX 3U9GA 4BDMA 4Q4ZF 4RB3C 4IO6A 1R36A 4EMSA 3Q5FA 1ZMGA 3JSOA 1R58A 1N7WA 5EHSA 4CXFA 1MJAA 2WV0A 5D6FA 1LFIA 2FSWA 1Z1DA 1T38A 1B0HA 2XAQA 3E13X 2A6HF 2KRFA 4NF8A 4RGXA 5AA2D 1BN5A 5DEQA 3EYIA 5H8NB 3CUQA 3N6TA 3QXMA 3FUZA 4HA8A 4L0ZB 1US4A 2GH9A 4ISUA 3R0AA 4GF8A 3UIFA 5AA1A 4CZZA 3I5UA 5HLHA 3KP5A 2KKOA 3SQNA 3WGIA 5DCFA 3EUHA 1FC3A 5ERIA 1EH3A 4MGRA 2I49A 4LP2B 4KIBA 4O5VA 4WCGA 3K2DA 4EJWA 1ONVA 4E70A 4YIFA 3QAXA 2REJA 3PPNA 3HRUA 3SEYA 4HQEA 2P6TA 3HHFA 3KBRA 2ZCWA 3RTRA 4UACA 1IXGA 2X7QA 1US5A 2Q2EA 3QU3A 3M3LA 2VC0A 3O3KA 2OBGA 3MCZA 1BIYA 1J9IA 5FB2A 4Y15A 4OHNA 4RYAA 1H0MA 3C34A 3CLOA 2GRVA 3KP3A 4NF6A 3TMGA 5FHNA 3TOAA 5ILVA 2QS4A 1B40A 4KUMA 2OQRA 5JTYB 2GFEA 3KLNA 5L3FA 1U2WA 5BMZA 2PEXA 2D21A 4LQ5A 4WX9A 4RGSA 5IAIA 5A2QK 4G68C 4X48A 3OSRA 1YCJA 1H3DA 5D5UB 4OQOA 5LBQA 1FYLA 4HV5A 5I2NB 2ZMBA 2RVCA 4I0AA 2DXRA 1UCRA 2MA3A 5CVVA 4ZYDA 2RC9A 3T9HB 3HOSA 1B58A 1QW0A 1IN5A 4IO5A 1DUXC 4JDFA 2IP2A 2XV4S 4KA4A 2CWEA 5K5OA 1K6OA 1LB2A 2G93A 2K02A 3M9AA 4GYGA 4U0WA 2ZJ2A 5DEXB 2QRYA 3WTSC 4H1XA 1B6AA 2DSFA 1IIWA 3OO9A 3R61A 1OYIA 4OEVA 1PB8A 4XKPA 5I56A 4O3BA 2Q2AA 1CF7B 1LLSA 4G68B 1KWHA 5H8QA 1REPC 3FMQA 1Z9CA 4HX7A 2G7HA 3HRSA 1USTA 2IA0A 2XKPA 2RF1A 1B7HA 3QIMA 5ED4A 2O61A 1HW2A 3WTZA 1URGA 3UP9A 3N94A 5I59A 3UK4A 1XDSA 1MY4A 5D5XB 4CYDA 1H43A 4LG0A 2AXLA 4NF4B 1MS7A 2LSOA 4KQPA 4YIIA 2GZWA 2CZLA 2LF7A 1W7PB 5E8IA 4LLNA 2AIXA 2HAVA 4AQ4A 3MEXA 4LLLA 4QSCA 1Y1ZA 4YB5A 2DW4A 4XBFA 1JXSA 2EFOA 4ELQA 3LSWA 5HDNA 1A54A 3K9TA 3KETA 2I4CA 1U5TA 5BUUA 2LDUA 5LHGA 4OZ9A 4EV0A 3FXUA 3HTUA 4BXUA 4Q0CA 2X4HA 3H6VA 1ATGA 2B3BA 4FIMA 1AOYA 3OELA 3K6VA 3GLXA 3LBSA 3TO9A 4FAJA 1B3EA 1B2HA 1EH7A 1LBBA 1B9MA 2D2WA 2KJCA 4BHPA 3C7JA 1GTKA 4PGHA 3T66A 2OLBA 2CQKA 1X3UA 4RAZA 4ZYEA 5IT3A 2BYVE 1OMPA 3I59B 1MQDA 3MVWA 5CMCA 1O7LA 3WTYC 5HDGA 1O3TA 4RPOA 4ELPA 2OQGA 5CVRA 1U78A 3DPLC 4WWCA 3E3VA 2EV0A 3QRFF 2F7AA 1UFMA 2MC3A 1A8EA 1DSNA 2ABHA 2XHDA 3TDJA 4L9TA 1RYOA 5I58A 2XAGA 1FSEA 1UTHB 2ZYMA 4XXUA 5CI5A 4ONYA 2H9BA 4IXAA 4M4GA 3P9CA 3E6BA 3P7NA 4IY5A 3S4UA 3BY6A 4RB0A 3CG3A 1MPDA 4P96A 5L8DA 4P9FA 2KIUA 2WTEA 3NEUA 4OYVA 4U1ZA 2F2EA 1R23A 1DPRA 4PZJA 3G3GA 3V5AA 1FBUA 1KYZA 1P1OA 4GVOA 3PQJA 3FVGA 3L00A 3KJ7A 5CBSA 4MLVA 2OBPA 3TGNA 4EQBA 2PVUA 3OEMA 3ECOA 2A07F 1LFHA 3FV2A 1L3LA 3T5XA 1FP2A 5FFZA 1R1NA 1SD3A 4KD5A 4KDPA 5ICQA 4YB6A 3C35A 5J8CA 3F8MA 5A5XA 1HSEA 3EF7A 1SD7A 4N13A 1HSTA 2L54A 2RC4A 4L18B 2H99A 3JYRA 5AONA 2Y7KA 1NHAA 5DTBA 5HBCA 4HAMA 4M6YA 4WEDA 4OFJA 3M3FA 3VODA 2ZMEB 3MVXA 5AA4A 3E97A 4ZZEA 5FHOA 4EDPA 5JFRA 4G77A 3VDFA 3QP6A 3HRMA 3SZPA 4F19A 3IR1A 2X26A 5BOXA 2IRFG 2RGVA 2CO5A 1GHCA 2XXUA 1FQCA 1XVYA 4NF5A 1VFEA 4I8CA 3EETA 3WTVC 1ZBMA 1Y3PA 1ZG3A 5JHUA 5TRDA 1QVSA 3LC8A 2HQNA 1BJAA 3THIA 2V93A 2HKOA 3B7DA 3MC2A 4LONB 2CFXA 1QZYA 3OD7A 3L7WA 2A61A 1TT1A 1SMYF 2D1HA 2ZNZA 3IL2A 1RUOA 1MM6A 2GIVA 1NL5A 4ZEFA 4L9JA 5LGNA 1LEBA 1MQGA 4JB7A 1Z6RA 2XXXA 3ABTA 4NQWA 2ZXTA 4DXBA 1H9TA 1YTVA 3G3HA 1MY2A 2W24A 5TPAB 3GVAA 2EFQA 1FQBA 3GXOA 3MP8A 4OU0A 1KA8A 3JAMZ 1ZREA 2XXRA 4GYIA 2F97A 3WGGA 3TUSA 3GXAA 5B70A 2DQVA 2BGCA 4EF1A 4ZE8A 1D3KA 4YAHX 1FT9A 4BQAA 3PUWE 1FLIA 4I9DA 5IKBA 1XC1A 1MRPA 5H8HA 3SKPA 1M5FA 4FATA 3RIRA 4HZFA 2DT5A 3FGSA 2ONSA 4QFOA 3WTUC 2GXGA 1UTBA 2XD3A 1DPUA 2H6CA 4R73A 3S9MC 3HUGA 5E1WA 3KZYA 4A0ZA 3FWEA 4KNYA 3LSTA 3FD3A 1XHYA 1O3SA 4UA8A 3TQNA 4ESWA 2X0LA 1JHFA 2PBWA 3RTWB 1TW3A 2P6SA 3O6BB 4H67A 1N84A 1AIVA 1WRJA 3KLOA 1MKMA 3HSEA 5E20A 3TTNA 2HZTA 1MDQA 3HN0A 2RCAA 4ON0A 2ZBKA 1KU9A 1KU7A 3ILUB 5H8FA 1K78B 4NEDA 4AVPA 3GZ5A 1LVAA 1F9NA 4BYYA 2VC1A 5L3CA 5D8KB 2PT1A 4GLIA 1HW1A 3IKVA 4I98B 1Z7UA 3HOTA 1IZ1A 2OZ6A 2YPRA 3E5XA 2PI0A 1EU8A 3T9UA 5LHHA 4F1UA 1UIVA 3Q28A 4BDQA 5LOMA 2UXXA 4XLNF 1QKAA 4FECA 3IX1A 2AS5F 5DD4A 5EEGA 1FQDA 1IN6A 2RN7A 2Q2CA 3B6TA 4GD5A 2QPQA 4FORA 1FX7A 3GX4X 3V8KA 1PBPA 2QBYB 2COMA 1T39A 2IPQX 2RV8A 3KN3A 4K2EA 4ELRA 2DO7A 3O29A 2DXYA 3IB0A 3I5OA 3T8RA 3M7GA 2JT1A 1Z91A 3C3WA 1LDJA 1ZJLA 3IB2A 3IOVA 4JQFA 1SI0A 4WXHA 4DDDA 2RKMA 3T96B 2ACJA 3P7IA 1OVTA 4ZECA 3GFLA 1ULYA 4FE8A 2OU2A 2ADUA 4RAYA 5D8LB 4YU0A 4IO4A 1MDMA 1YW7A 4WXDA 2NNYA 2ONRA 2K27A 3TTRA 3RKWA 2ISZA 3DQVC 3M8FA 2VT3A 1SVXB 4R9FA 3IJOB 3R26A 3RYPA 2I3WA 1VE4A 4O3CA 4M6XA 3RN8A 2QLZA 3LUYA 1RI7A 5TU0A 1MXZA 5DD8A 2EA4A 2F6PA 1TQIA 5ITOA 3ZQ7A 3V7SA 1BKAA 2V25A 5HLIA 1D4NA 2B3FA 5BPDA 3TOBA 3HO7A 3WE3A 5KCJA 1BIBA 3HPIA 1O3QA 2XXVA 1BOAA 4G6DA 1FNNA 3IO6A 2Z23A 5M2VA 5F64A 4LMYA 1OMIA 4LD5A 4LVQA 2VD2A 3IAZA 4R2FA 3LA2A 3QUFA 2ONKE 2QS3A 3F72A 2B65A 1I1GA 4G2ZA 3GFMA 5DCMA 5D4RA 4DNCA 5FHMA 4MH5A 5DV5A 4EJOA 2HAUA 4A6DA 3FVNA 4ZDMA 1B5JA 4EQQA 5B7DA 2Y48A 3DP8A 1R5GA 1JGSA 1OR7A 2K7LA 3LA3A 5FLXZ 1XGMA 2OWSA 3EHTA 3SEUA 4OMBA 2GHBA 3EHSA 1P4AA 2VXZA 2PG4A 4OWDA 4E0WA 1ZIUA 3MAMA 5BPIA 2JSCA 1FW0A 4PE5B 2FEZA 4AIHA 3ISPA 1A99A 4OESA 3MBPA 3IRRA 1FYKA 4HX8A 5CMKA 3CFZA 3OOAA 4HW8A 1Y0UA 1GV8A 2YR2A 4QLCU 1R22A 1FOKA 2I0CA 3N26A 2H5YA 2RC7A 3GO5A 4KFQA 3V7RA 4HDVA 2MH9A 5DDGA 1R1VA 3RKXA 3FJ7A 4KCDA 2R7DA 1QO0D 4KYSA 1SYIA 4L9NA 2PLYA 3F21A 3B02A 2XGXA 4L5IA 2VE9A 1N76A 3GFJA 3H92A 2I3VA 1P6RA 5J1DA 2CGPA 1B7UA 4HQMA 2HYGD 3FV1A 1PP7U 2CYYA 1JQFA 4UXNA 1SYHA 2ZYOA 3RUMA 2YU3A 5EEHA 4GIZA 2R3SA 2F35A 3ECRA 1BI2A 5FD5A 2VONA 1SQYA 2LF8A 3PMVA 3IORA 1LQ1A 4TLLB 2V6CA 3RTFB 3LQRA 1EZ9A 1Z7ME 2HR3A 4G8MA 1PEBA 1GVJA 3PUVE 2VGQA 4ZEDA 3G73A 3D0SA 3FF5A 4ZH4F 4ESJA 4KR5A 4LJZF 1IRGA 4DZ1A 1ODDA 3VXCA 5CM6A 3VVDA 3BROA 2DS9A 1QULA 1N3WA 2UVJA 3T0YA 5ITPA 2P1SA 4F39A 5ICTA 1P4XA 4AB5A 3EN3A 3UGWA 1KQ8A 2G29A 2Z3YA 1SAXA 4G94A 2NWJA 2ZYNA 5L3EA 1P2FA 1QJMA 1LNWA 3QAHA 2VBXA 4Z7EA 1RIOH 3DEUA 1OIBA 3U93A 1YS7A 4YFNF 4RJZA 1MQHA 1N7XA 4A5NA 2MLKA 2AL4A 5DYHA 1XCVA 5ICCA 4LB6B 1IAWA 1GXQA 2ZNUA 4G8HA 3MAJA 3BOQA 5JTYA 2UXAA 1E17A 4MQVA 2A5TB 3BP8A 2QWWA 2ETHA 4H0WA 2ISYA 5L9SA 2G9WA 3S9NC 1FZPB 1B3GA 5I57B 4IO7A 1H76A 3H7MA 4Q48A 5TP9A 4EQ7A 3C36A 1J59A 3BKIB 4A12A 1MJ9A 5L9MA 3MUQA 2Q9TA 2HZKA 3LA7A 2PMHA 3T1BA 2I0BA 1Z6TA 5HM4B 3PPQA 4RGUA 1I6AA 5KK1A 4ZZAA 1TFAA 4YKIA 2VE8A 1QNTA 1ZGAA 3CFXA 3FMRA 4N6PA 2Y7WA 1LAXA 3F8FA 2FE3A 1FTLA 2Q8KA 2WKYA 4G68A 3CJNA 1JVYA 4IJAA 1ZG5A 1VSOA 1PBQA 3O2AA 5E1ZB 2DK5A 2YJPA 1HSLA 4XKNA 1NH7A 1DOTA 5LLQA 3EQ1A 3QPHA 1TLHB 2UYFA 4BAYA 3IOUA 1TBXA 2RNJA 4WF2A 1O7TA 3J81Z 3W9VA 3V83A 3PPPA 2PMSA 4RA1A 4NF8B 2NAZA 3MWBA 1PB9A 1QQIA 2O6AA 4OFLA 3CUQB 4ENNA 1P1NA 3DPTA 2FBIA 2PYYA 1MPBA 3GFIA 2F5DA 1HKTA 1OLCA 3MQ9A 2L4AA 4IRGA 2VBZA 1TNTA 1PUEE 4LB5A 2A6EF 1MG1A 1Y20A 4KPTA 4RXLA 4YMAA 1BI3A 1F4KA 4M9ZA 4AIJA 3O2PE 5E8GA 1YQAA 2OD5A 1OYYA 3OOPA 5I2KA 4QFNA 3PUYE 2V3UA 1B32A 3E5UA 3WU0A 2DWHA 2XX8A 1KGSA 4AIKA 4S05A 2P7VB 3L2CA 3F6OA 4IGTA 3I0TA 1ANFA 4KCCA 4A0YA 1XGNA 3MPLA 1G4DA 4P11A 3FJMA 1T0KA 5L3GA 4YKJA 3O6GA 3OENA 5HS7A 4UV9A 2UVIA 3C31A 3GWZA 1N04A 5H8SA 3RPQA 1IXHA 1B5HA 4IHSA 4UVAA 2PMUA 1BI1A 4JBAA 5KZTA 2QSXA 3FVOA 3NQOA 3K01A 3KJTA 3R0JA 3MZ1A 2A69F 5L9OA 1NNPA 2DWAA 2DI3A 2PT2A 1T98A 1FTKA 4ZE9A 5LGTA 4NF6B 1FTOA 4YICA 2XAJA 4BDLA 2M8CA 1Q35A 4FJPA 3ULQB 5K1YA 2V1DA 3CFLA 3ZKLA 4F22A 3JAMK 1LDDA 4ZZDA 3DF8A 2O03A 5KDTA 2M1BA 3EQLF 4LQ2A 1UTHA 1GVCA 2YX4A 3I71A 3K02A 2MD5A 4YFXF 4I01A 1UB9A 3I54A 3O66A 3QP5A 3R6UA 3T22A 4R6HA 1QUKA 1ZHFA 3OO6A 3DP4A 2ZNYA 4R8HA 4L5JA 4Y13A 1ON1A 3W6JB 1USYH 1IUDA 2EFPA 3TPAA 1J5YA 2YX7A 4G4PA 4L17A 5LEKA 1LAGE 3FX3A 3MVYA 3FM3A 5ICGA 4NWCA 4CDGA 2NS0A 3C4MA 1KYWA 2Z5UA 1RZ4A 1Y1MA 4Q5SF 4GL0A 3TZAA 2ZFWA 4UHTA 1DTZA 3TYHA 1XN7A 2V79A 3JZJA 3VVFA 1EZPA 1XVXA 1DDNA 1MD0A 3LAJA 3ECHA 4L9VA 3HSTA 3VLUA 5I56B 2UYEA 1U5TC 3P9IA 4X1BA 5CMBA 3SDFA 4TOZA 4OOIA 1DPPA 4NHJA 3D4CA 5F6FA 2A5YB 2F36A 1R9LA 1LCTA 2ZMEA 3I64A 5H8QB 1U3EM 3KG2A 3JW4A 3S9EA 2FXAA 3WTTC 1YS6A 3MZBA 4H65A 1MY0A 5E1XA 5ILSA 1I6XA 3U1DA 4IB2A 3H6TA 1BC7C 1P1UA 3IWZA 4LG0B 3J80Z 1S50A 2F34A 1FPQA 1YW9A 3WG9A 4YKKA 5IT9Z 4IO2A 4ASNA 1WI9A 3G3KA 3ML6A 1S3JA 1II5A 2DU9A 2F5FA 1OLAA 3MZ9A 2QQBA 4OIQF 2MH2A 1R6ZA 4YG2F 2DE3A 1FTMA 3JTGA 2ZNTA 2JTVA 1LEAA 3IWFA 1DPEA 4GQOA 1U5TB 1BM9A 1RYXA 5ISUA 5AA2A 2FBKA 2VD3A 1B05A 1J0RA 4NWDA 2HOEA 1L0OC 1Y3QA 1YYVA 1FTJA 3H3GA 3OO7A 2M30A 1DMBA 4DLDA 3QK6A 1YIOA 3H6UA 4FEDA 3WGHA 1XGSA 3TO7A 1WQ2A 3ZP5A 1JW1A 1I1SA 4XSZF 4M72A 1CB6A 1MXWA 3PV0E 3TCHA 1IN7A 3K6UA 4I62A 4R72A 3LR1A 4WXCA 2D3IA 1XGOA 1O7FA 2O68A 2XAHA 3H06B 1QGPA 1NNKA 2GWRA 1LDKB 2R71A 4HOBA 1LGBC 3B6QA 3E6CC 5K2XA 1J2XA 4RB1A 5DVIA 5I58B 2FU4A 1YO5C 2HZLA 2H27A 3TQLA 1AH5A 3TDZC 3GEZA 5HS9A 2CG4A 1S7OA 4TV7A 5FO5A 5BS6A 4PP0A 1XDUA 1W5TA 4IY6A 1TNSA 4WEPA 3FJGA 1YAEA 5FLXK 3Q25A 1Q1KA 1USSA 4YFKF 3QU6A 2NVUB 1IXCA 2VT2A 4I1DA 4A6EA 3C32A 2REGA 2IW5A 4R6YA 1B5IA 3HHHA 1ON2A 4A0XA 2RDPA 1B1BA 4G9YA 2ZXJA 3FHZA 3D4GA 2FMYA 1LAFE 5FTHA 5K5RA 2FNPA 2QVOA 2IEEA 3CIJA 3VFZA 4U7BA 2HKXA 2X7PA 2RCBA 4KFCA 5TJJA 2I58A 3FATA 1POTA 1Y9UA 4R75A 1O57A 4IO3A 4QSEA 2A68F 2DE2A 2NRAC 2KLFA 4LFUA 3J7AO 3BPVA 4H8IA 3WTXC 4YZZA 3U92A 2DP8A 2XXQA 2P5LC 2D1VA 3S9LC 3V8LA 5A5XB 3R6SA 2ZKZA 4TLMB 4GO1A 4ESFA 4F2QA 2L02A 4MFIA 5FD6A 2F6GA 3PPOA 2DBBA 4N07A 5JVTA 3N4MA 2O1LA 4JWYA 3U1OA 3FVKA 5CYVA 5CJ9A 5AA4B 3BJ6A 3ILTB 5F7VA 3EHUA 3F8NA 5CRYA 4M74A 3EPEA 2ELHA 1QKBA 3DFGA 1K7AA 1IQ7A 3OMBA 4IPAA 5DVFA 1UQWA 3F8BA 4H6DA 4NF5B 4HX4A 1BBYA 4DXCA 4OTEA 5I84A 2K86A 1JW4A 3BPXA 1CGPA 3FXRA 1O63A 2A3SA 2IT0A 4H5GA 1MXXA 2PX1A 2L01A 4LATA 4R79A 4MTEA 3ZMTA 3S2VA 3FASA 5AIPA 4G7HF 2I48A 4PFTA 1HXDA 4A5MA 3H3ZA 3VEPA 1J75A 2O6GE 3E3KA 2HS5A 4EGYA 2XX7A 3SEXA 2HCAA 3ZSFA 3VB2A 3O28A 1F1ZA 1QPMA 4C1TA 2ANJA 4ELOA 1YPNA 1MJBA 2DOJA 2XKOA 3DM0A 4DIGA 4LK0F 3O6HA 3UORA 2H6BA 2QQAA 3RLFE 1M5EA 1IW7F 3BZ6A 2Y0MA 1V3FA 2O1MA 3IOWA 1CE2A 4XKRA 2H25A 1HKSA 3TO6A 4MF3A 2DVCA 5H8HB 3CO7C 3KEIA 4F3PA 1UTBB 2RQPA 1S29A 2G7UA 2QUFA 4B09A 3GYHX 2P0SA 4U7DA 1B3HA 4KYDA 1ZKBA 4HW0A 5LGUA 1SBPA 3CVGA 5H6RA 3KGCA 4KT5C 1QUIA 2D5WA 1LAHE 3KCCA 3K4UA 2Z8FA 2AYSA 1LJ9A 4PFWA 3N6UA 1F5TA 3CSGA 1JVXA 3Q9SA 1Q1HA 2UXNA 1D8JA 3PFIA 2FA5A 1WVJA 1JHHA 2OCUA 2V84A 3CG1A 3Q27A 3PPRA 3CSBA 2F78A 1D8KA 2Y75A 4RGRA 4Q5TA 4N9IA 2W84A 2XXHA 3KE2A 2YLNA 3GLBA 5H8FB 4MNUA 3IL1B 1AOVA 1EV7A 1M5DA 2DAOA 1H44A 2K4JA 4EUOA 3ZMUA 3I58A 3WE2A 3Q9VA 4EJVA 3VVEA 1MXUA 4G8NA 1Y4CA 4L0YB 1P4WA 5HDKA 3ZS6A 1Y3NA 4HF2A 1JE8A 2H4IA 2EV6A 4EGZA 4XLPF 4GXOA 4OMYA 2GXBA 3TTKA 4I09A 3VE1B 4BDRA 1SW4A 2Y7RA 4DCYA 2LNBA 3TTMA 3L09A 3MW0A 3BDDA 3PGFA 2XAFA 3G3JA 1DP7P 1B46A 2OAZA 3KZGA 1L5TA 3P9KA 4ETSA 4H8JA 3ZMDA 1SW1A 5ILUA 3VLVA 2BV6A 3LSLA 4ENJA 5JR3A 1UIUA 3J81K 4IF4A 3E6DA 3H4ZA 3R7XA 4LZ7A 1GXPA 4F29A 3LSXA 3SXYA 4EM1A 4MEXF 1ZG1A 1W4MA 3PUZE 3KP6A 1FCKA 2V3TA 1XD7A 1MDP1 1MDMB 3FMSA 2VOOA 3CO6C 2R9JA 4ZEKA 3TFLA 4BHBA 3U8QA 4EXLA 3O6IA 5FTIA 4ENMA 1G3SA 2GAUA 2O7IA 2NNNA 4X9TA 5AIQA 4KN4X 3OSQA 2QS1A 1I69A 3I53A 3RJPA 1UHMA 5E18F 1EH8A 2F7CA 4F3BA 3IHUA 4JXIA 4P55A 2XRNA 4G8XA 4GWOA 4JWXA 5DYMA 1D5VA 1QZZA 3GZGA 3M1EA 3WODF 2HEUA 4PFUA 3TQWA 2XD2A 3KOTA 2BE5F 3PMWA 5H8NA 2NYXA 3F11A 4ECFA 2A5TA 3NRVA 5BWJA 4UNOA 3TAJA 1ZLJA 3PD8A 1WWXA 1V4RA 5DCMB 3E6MA 4U88A 4EVIA 4DQ2A 3UA8A 4I0BA 4YB7A 4R1HA 2CMOA 4EJTA 3CUOA 1USYE 4NTLA 3HIFA 1FQAA 3O97A 3PUXE 3C18A 1JEUA 5CBRA 6PAXA 2Y84A 3CTAA 2UVGA 3M3KA 4QFKA 2NUVA 4U4XA 1KQ0A 2HQ0A 2DVZA 1O64A 3Q26A 4DXUA 1TTYA 1QBJA 4QWQA 2IJLA 3KZZA 1MH4A 1ZLQA 2QMXA 2FRHA 1ZARA 2QZ8A 2DTRA 1JNFA 2A5SA 5ICEA 2DQLA 2P7CB 4TQUQ 1SFXA 2FF4A 4LK1F 2M45A 4U1OA 2P5VA 2V9VA 1PP8F 3E5QA 3KN7A 3DV8A 2E1CA 1B1XA 2THIA 3WTWC 4EM0B 2Z99A 3F3XA 4ZYGA 3TEPA 5FFXA 4PQJA 2XVCA 4IVNA 4OINF 5H20A 2QQ9A 3RPWA 1I5ZA 3DKWA 5I2NA 5F1QA 3A3CA 3GF2A 1IXRC 3MZYA 4P0IA 2H94A 4N0BA 3HSFA 4I7HA 3RNNA 2FNCA 3EYYA 2O8XA 3ZMZA 4WK8F 2NOOA 1ZU0A 1JEVA 1AMFA 3CUQC 1JW5A 3QPTA 4G7ZF 1SMTA 2CSOA 2MLGA 4AWXB 2P2AA 3K0LA 4U0VA 3L6HA 3ODBA 1MH3A 5DEXA 4JSOA 4OENA 4AB6A 1SDXA 1D3YA 3J80K 3R60A 2O0YA 4XTCQ 5IT9K 4BNCA 4IRHA 1G3YA 1CF7A 1FQFA 4U4SA 3HSRA 5HOOA 2PBIA 4OVJA 3AAFA 2DYXA 2DWIA 1Z7NE 2FYIA 1BLFA 1ZH5A 3AXFA 2J5PA 1FBSA 3RGYA 1ELJA 4OIOF 1LB8A 3TTLA 1SD4A 3HV1A 4BDNA 2EK5A 4M9SA 4R6KA 4HBLA 4G7OF 2W7YA 2LKPA 1NMUA 4I2OA 5EHMA 2QMWA 4QRZA 4XSXF 1ZTYA 3TKYA 2QM3A 4D0PA 2RC8A 4NF4A 3QYTA 2DFIA 1KU2A 2DK8A 2ESNA 1W7PA 3RQTA 1NNFA 2B0LA 4KN7X 2PQ8A 2EV5A 2F5XA 2XROA 1PB7A 3MFKA 2VODA 2XUBA 3OV8A 1QUJA 1POY1 4MTDA 5TP9B 3IC7A 2HFHA 1FQEA 4LZ8A 4P0GA 4UVBA 4KIGA 2E0SA 2KJBA 4HF0A 2O84X 2ESHA 4GXAA 3VFJA 3REOA 4XKQA 3E4RA 2OA4A 3V7CA 4Z2YA 4CICA 3F6VA 4OETA 5AE4A 3DELB 2O51A 1VTNC 4BDOA 2OZUA 2R6GE 2O3FA 3FIRA 4YKPA 2DLLA 4RK2A 2M5WA 3KSJA 1R5HA 3JTHA 2Y7PA 2ZYKA 3KOSA 1LSTA 4RK9A 2GA2A 2PJPA 4O3AA 3I59A 4LA9A 2PFBA 2Z33A 1IRFA 3KFMA 2QJEA 1P99A 4F3SA 3IK6B 3ZMSA 1XSDA 2AL5A 2O69A 4U21A 4C1UA 1T0FA 4O3MA 1XS5A 3O9PA 1ZRFA 3K6XA 4YMBA 3M8EA 5JI6A 1MM7A 5DUIA 5L3DA 1B6HA 3R4KA 1GGGA 3ERED 2FNAA 4M73A 4F1YA 3HTSB 2XXPA 4POWA 4FX0A 3RPUA 2EA2A 2W25A 2STTA 5CVUA 1FWZA 4PCQA 4MHGA 2HEOA 1ZRCA 2Z9OA 1B3LA 4K3FA 1VR5A 3D5LA 2JZYA 4Z0IA 2QL3A 2V1XA 2EFNA 5HLGA 3MVZA 3HHGA 2EJRA 4MLQA 2DWJA 3W9WA 3DXJF 4RB2C 4LZ5A 3CRBA 1S6LA 3M8UA 3ONMA 5I2KB 3OO8A 4QFPA 1NH8A 2ZO4A 1UHWA 5DT6A 2L3DA 3IKTA 2VBWA 1TWYA 5LHIA 2IA4A 4HLXA 3BFUA 4H0EA 1O3RA 3IJXB 1VFDA 3CDHA 3IB1A 2QS2A 4CO8A 2HXWA 4DCXA 4NE4A 2IA1A 3KP2A 2E7XA 3GBBA 4IRIA 1YFHA 4BH9A 3TDUC 4LLGF 4GRKA 3SERA 3QSLA 3RT8A 1I6QA 3TELA 1ZN2A 2Z8DA 4HCWA 2V3QA 1R7JA 2UVHA 4FHTA 1ZLKA 3W15C 3ZMVA 1LFGA 3SESA 4Q8RA 2VOPA 3PD9A 1ZRDA 2DQRA 2V1UA 3F23A 5I59B 1MXYA 3KEOA 3UN6A 1SD5A 3VV5A 4HF1A 5KDTB 1B3FA 2TDXA 1YG2A 1FY7A 4Q47A 4CHUA 3KN8A 3T9XB 1XCBA 4LUBA 5J8FA 3C9HA 1ZAOA 3B73A 4HLYA 4JSDA 1XB4A 1NKXA 2M87A 3SFZA 4EJUA 1URDA 2KIFA 4F1VA 3RKYA 1WODA 2IVMA 1MPCA 4IGRA 2NXOA 2YPNA 3V89B 1PC3A 2L4MA 5ELVA 3MPKA 5TPAA 2EFWA 1SD6A 3I4PA 2OZZA 4QHQA 2UWMA 5JEIA 3CR9A 1C0WA 3W6KB 3GZ6A 1PDAA 2DE4A 2RINA 5A2QZ 2C6YA 4ZS9A 3PU5A 3K6WA 2XX9A 3BJAA 1B7ZA 5D5WB 3KP4A 1E2XA 1I6BA 3K1NA 4PGGA 5ICFA 3QOPA 3RT6B 3K1MA 1BC8C 5K5QA 5D6EA 1B9NA 4OERA 4QF9A 1MQJA 1BTJA 3K00A 1R00A 1G6NA 1HQCA 3MJNA 4A2UA 3IRQA 3H03A 3QUJA 2K4BA 1FBQA 4RS8A 1RNLA 3K2ZA 2BBYA 2F5EA 4N9HA 4HS7A 4POXA 4NMYA 1A8FA 2DPDA 4P9UA 1XSXA 4EQ9A 1OVBA 3KEQA 1S9TA 2QYOA 4FT8A 3SEWA 4ND9A 5LRSA 3CI8A 1K78A 2FA7A 1TQMA 1H45A 3GBAA 1MZBA 1RUNA 1B51A 3LSFB 1NFTA 2XXWA 3JV9A 1MY3A 5LEJA 5KVRA 2DPUA 3U72A 4EM2A 4IHTA 1N3XA 1G3WA 4PDKA 3G7WA 1MY1A 4OXVA 1D9YA 3BFTA 2JPBA 1MGTA 1DTGA 2D45A 2F7BA 2XHKA 1S7AA 2HTJA 3H3UA 2OWTA 3VXBA 1HSJA 2P8TA 1LCFA 1TFDA 2MBFA 5F1RA 2XXYA 5AA2B 1OPCA 4ZYHA 3GW2A 3MZHA 1SW2A 2LAOA 4QSDA 2VN2A 2WWYA 2QBYA 3LAPA 2Q0OA 3V4GA 3N97A 3MQ0A 3OEKA 1R1TA 4KYEA 1S7YA 2HDCA 5BQTA 2HWVA 4ZEIA 3PQKA 4ZZLA 1AWCA 1XT8A 3V8JA 2WC2A 5CC2A 4GXSB 1SFUA 1LB9A 1IEJA 1U6GA 3TKDA 4ESXA 3GUDA 1I27A 5DVJA 3COAC 4BHCA 3BBRA 2HTSA 5LRRA 4MQ9F 3T9VA 3K69A 4U0YA 2H98A 4DE8A 2IA2A 3FXQA 3F22A 3MP1A 4F2OA 3WAFA 4UVCA 4B8XA 1A55A 4P5OA 2R7FA 2Q88A 3FZVA 1TQPA 3G3ZA 4F18A 1XMKA 1GR2A 1B4AA 4KHZE 1YTYA 2O7UA 4M1VA 3DP7A 3VLWA 3WAEA 2P5KA 3RI4A 1F9BA 3JSPA 4U2RA 4U23A 5D5VB 4BLAA 1B59A 1R1UA 3ZN0A 4H5FA 2VBYA 4G6QA 1S8NA 3I6VA 5CLSA 1BIAA 1AL3A 1G3TA 1NNTA 2FQ3A 3ROUA 3T93B 2HQRA 4S04A 1J1NA 2Z22A 5FGMA 3HRTA 4F31B 3BJOA 2CW0F 1B4ZA 3FM5A 2VP1A 1STZA 1A40A 2STWA 4ENKA 1IN8A 4KMUX 1A04A 5CVJA 1T2KA 1LBCA 1OYWA 3KP7A 3T8TA 4EXKA 2GA1A 3U94A 1M5BA 1IF1A 4F7ZA 1YW8A 3I3VA 2E1SA 1P1QA 3MP6A 4QFLA 3U2RA 2XIGA 2H09A 3USDA 3G3IA 4OEUA 1U8RA 3ZN1A 3L6GA 1RKMA 4JK1X 1B52A 3A3UA 2E7WA 1SW5A 4OFOA 2P4WA 4KICA 1YLFA 2VOZA
chains in the Genus database with same CATH superfamily
2PJRB 3H5RA 1BI0A 4NB5A 5EYFA 1OKRA 3VOEA 4GWSA 2QENA 2UZKA 4JBZA 4WKMA 4MAGA 3CMEI 1XS9A 1ZGJA 1IUYA 4P1LA 2WV1A 3SHFA 3KIOA 3B6WA 1W7PD 2W57A 1AU7A 4GOTA 3L9FA 1B1HA 4UV8A 1SI1A 1YXIA 1KU3A 3TCGA 1FJ6A 3DLNA 4FX4A 2HDWA 2ALUA 3A01A 4IZZA 3H6WA 3TODA 3GTKJ 3LFKA 4N4OB 4YEJA 2HFBA 5IZ3B 2FMLA 4OIRF 1VQOI 4JWOA 4MBPA 3LQQA 1HBXG 4R9GA 1B0LA 1D9VA 3Q0UA 4GL8A 4Y17A 2VQLA 2I4BA 3IH2A 2XASA 2OK2A 1TP4A 5LFAA 1ORKA 2FBHA 4U22A 4A3EJ 2HGCA 2MSYA 1T6SA 4E0XA 2Q8JA 1B4HA 3GTJJ 2BXYA 3LV0A 1WHUA 4OIPF 1FYMA 4BEHB 3V8XB 1XSVA 1N0TA 2WBMA 3RY3A 4AD9A 1B9JA 1QHHD 3C33A 2V4CA 1VQ7I 2I6EA 1EZOA 3FBNB 2NVYJ 2OJTA 4C0RA 1WH5A 4GCVA 4FEBA 2OF7A 2W85A 5HVQC 2IS6A 1HW5A 1FSHA 1XG1A 2BY3A 1GUUA 2RKHA 3SZTA 3Q29A 4EF2A 4MEYF 1X2MA 2ID6A 3ERMA 4RNSA 4XRFA 2CZHA 1TW2A 1TXFA 5EQ7A 1BP5A 4RY1A 2NOJB 1MQIA 3MWMA 5JK4A 4UUSB 4YIRX 1W5SA 2ZXHA 4R2BA 2V26A 4M6VA 1M5CA 2VASA 5K2YA 1A7LA 5D4SA 4AS4A 1X4OA 1H9GA 5HPQA 3RYRA 4FISA 3ELKA 3VYRB 4PK4A 5L3BA 4XICA 3I56I 1FBPA 1J7KA 4X1DA 1XX5A 2E1NA 1NTCA 3BWGA 3HYIA 2EIMH 4J01A 4KI0E 4M9XA 2F8DA 3IOTA 4QTRA 1OQGA 3F8CA 5CVIA 4N81A 3CDLA 3DU6A 1MXVA 4ZEBA 2HYFA 1MSEC 3TCFA 3IH4A 3FKIJ 1NK2P 3ZPLA 2XXIA 2Y7IA 3RPUD 3LWFA 1XMAA 3W6VA 4KMFA 3OWTA 2M8EA 4HTGA 3CF2A 1WDNA 2Z8EA 3IO4A 1FP1D 4F3GA 5KCJB 5CMMA 2R5YB 4M71A 1WKMA 1URSA 1WSUA 2EWNA 1XC5A 2V9KA 3DP6A 4I02A 1R9QA 2CUEA 1FIPA 4HV6A 1ZGWA 4A3CJ 4C2UA 2HOTA 2GQQA 2VHAA 2JRTA 4Q30B 2XXTA 3C1DA 1IXSB 3OYKA 1YITI 3N5LA 3FK7A 3OMYA 4HDUA 5AA3A 5DM6F 5I57A 2XPVA 2ZNSA 4HYEA 3PMXA 1VQPI 3SEVA 1PUFB 4H46A 3BG5A 3FXJA 4MIMA 1K79A 4H45A 3K0VA 3G3FA 4DGWB 2EB7A 3RDIA 4PFYA 5DUKA 3CZ6A 2YSRA 4KIFA 4HCYA 1HC8A 4GFRA 4KYWA 4DIQA 3SETA 5H6QA 1PDNC 1KQ9A 2HXOA 4RAGA 3A09A 1P92A 2F3BA 3OXNA 1UZCA 3ZQCA 1SFEA 1Z05A 1Y1WJ 3H3VK 4LGWA 4CGZA 1LPQA 2BEOA 4O6JA 3HCQA 1P1WA 4PBQA 3HGGA 5EGOB 3K1PA 4HNTA 2DA6A 4UUVA 3EDPA 3S15J 1XOCA 1H8AC 3E9XA 3AG1H 3ABUA 2KIMA 2MC4A 5HS8A 1IN4A 4IO9F 4OMZA 1JP4A 3ZKKA 3BTJA 3S2WA 3AFHA 2ZXIA 5E17F 4PETA 2FOKA 4XIGQ 3HKZN 1Y4TA 3VYTB 2KDOA 3CJTB 3DLLF 1NV6A 1ZYRF 2VXDA 3EUAA 1EH6A 2ZJPF 4KXPA 4HE2A 4A3FJ 1FPEA 3A4CA 3KSXA 5J6XA 1HKQA 1JETA 2O5RA 2BJJX 4WXJA 4ESBA 2PN6A 4RPNA 4GGGA 2Q89A 2JPCA 3JRDA 1IITA 1IXIA 2GHAA 4THIA 1D0YA 2F5CA 5M3FJ 4GWYA 1UAAA 2J5OA 4P47A 3WU1B 1OQHA 2KR0A 4R74A 3KFWX 3U9GA 4BDMA 4Q4ZF 1N78A 2IGKA 4RB3C 2Y5KA 4EMSA 4IO6A 3Q5FA 1ZMGA 4OAZA 3FDYA 3JSOA 1R58A 2IS4A 1N7WA 4QPQA 4HSTA 5EHSA 1TWAJ 4CXFA 1MJAA 2WV0A 5D6FA 1LFIA 2FSWA 1Z1DA 2L9VA 1T38A 2XAQA 3HPHA 1B0HA 2CUZA 3E13X 3MKLA 3EPZA 2A6HF 2KRFA 2JA7J 1SAUA 4NF8A 2CQQA 2M2EA 4RGXA 5AA2D 1OCZH 2E1OA 4RM2A 1MSFC 1BN5A 1EA3A 5DEQA 3EYIA 3CUQA 5H8NB 3DTEA 3KBZA 3N6TA 3QXMA 3FUZA 4HA8A 4L0ZB 1WJBA 1US4A 2GH9A 4ISUA 3R0AA 3WU2C 4GF8A 3UIFA 5AA1A 4CZZA 3I5UA 4XRMA 4DOZA 1EKEA 5HLHA 1BL0A 2XDVA 3KP5A 1NUZA 2KKOA 3SQNA 3WGIA 5DCFA 3EUHA 4XF5A 1FC3A 5ERIA 2G0EA 3ASOH 1EH3A 1X3ZB 2JA6J 4MGRA 4PTKA 2KMUA 2OTLI 2I49A 4LP2B 2DOFA 2GLOA 4KIBA 4O5VA 5J47A 1ETKA 4WCGA 2R92J 3K2DA 4EJWA 1ONVA 1FPJA 4E70A 2PMZA 4YIFA 3QAXA 5LD2C 2REJA 2E5ZA 3HRUA 3JR9A 3PPNA 2ZZVA 4XLAA 3SEYA 4HQEA 4PJJA 2P6TA 3MYUA 3HHFA 2KLOA 3KBRA 1FMWA 2ZCWA 3RTRA 4BXXJ 1IXGA 4UACA 2X7QA 1US5A 4BE0A 2Q2EA 1V5FA 3QU3A 4XN0A 3M3LA 2VC0A 3O3KA 2OBGA 4JX4A 3MCZA 4E7HA 1BIYA 1J9IA 2OC6A 3G71I 5FB2A 4Y15A 4OHNA 1YYZA 1H0MA 4RYAA 2A5WA 2OCCH 1SVMA 3BIGA 3C34A 3CLOA 2Z2SB 2GRVA 2M4KA 3KP3A 2LMDA 4NF6A 3TMGA 1LFPA 3QODA 5FHNA 1INPA 4GRIA 3TOAA 5ILVA 2JA5J 3QYBA 4CCLA 2QS4A 2HYJA 3IUOA 1B40A 4KUMA 4XLHA 2OQRA 3DTKA 5JTYB 2GFEA 3KLNA 5L3FA 1U2WA 1K4TA 5EG0A 5BMZA 2H8RA 2LTPA 2PEXA 2D21A 4LQ5A 4WX9A 4RGSA 5IAIA 5A2QK 1LBWA 4G68C 2L0KA 4X48A 1RR8C 3OSRA 1YCJA 2NVXJ 4B4CA 1H3DA 5D5UB 4OQOA 2BW3B 5LBQA 1FYLA 4HV5A 2NVTJ 5I2NB 2ZMBA 3FKJA 2RVCA 5JLWA 4I0AA 5KNLA 5EYGA 3HZJA 4O7IA 2DXRA 3LSMA 1UCRA 2MKZA 2MA3A 5CVVA 4ZYDA 2RC9A 3NOHA 3QPSA 3HOSA 2HZDA 3T9HB 1B58A 1QW0A 2JK3A 3SEQA 3O29A 1IN5A 1NUWA 1ZK8A 1VNDA 3ZQIA 4IO5A 5T3JA 1DUXC 4JDFA 3BCBA 5F04A 2IP2A 4GBVA 2AO9A 2XV4S 4KA4A 1ZKGA 4IQ4A 2CWEA 3LFUA 3X2QH 5K5OA 1K6OA 1LB2A 2G93A 2K02A 3M9AA 3BCAA 3PSIA 4GYGA 1MBGA 4U0WA 2ZJ2A 5DEXB 2QRYA 1TWHJ 3FISA 3WTSC 3OYLA 4H1XA 1B6AA 2EILH 2DSFA 2CQ7A 1IIWA 3OO9A 3R61A 1OYIA 3G2BA 5FROA 3VSLA 4OEVA 1PB8A 4XKPA 5I56A 4O3BA 2Q2AA 1X3WB 1WJDA 1MMDA 2W48A 1CF7B 1LLSA 3PJRA 4G68B 1KWHA 1D1AA 3MZ8A 5H8QA 3L2VA 3FMQA 1Z9CA 1REPC 2L5VA 4HX7A 1YI2I 2G7HA 3HRSA 1USTA 2EINH 2IA0A 3RPLB 3K4JA 3E0JB 1WFXA 2XKPA 2LG4A 1JKOC 2RF1A 1B7HA 2QVVA 1UHSA 3AL0B 5ED4A 3QIMA 3VYSB 4KISA 2O61A 1HW2A 3WTZA 4N91A 3S8PA 1URGA 3UP9A 2EPFA 3N94A 5I59A 3UK4A 1XDSA 1MY4A 5D5XB 3FXMA 4CYDA 1H43A 4LG0A 2AXLA 1VI0A 4IOCF 2LSOA 1MS7A 3GYYA 4KQPA 4YIIA 3FXOA 4NF4B 2ME0A 3BR0A 2X1DA 3ZQGA 2GZWA 5JLXA 2LF7A 1RDYA 2QSGX 2CZLA 1W7PB 5E8IA 4BQNA 4LLNA 2AIXA 2HAVA 4AQ4A 3MEXA 4LLLA 1UJ8A 4QSCA 1Y1ZA 2XSJC 4NDLA 4YB5A 2DW4A 3DKYA 4XBFA 1JXSA 1Z21A 2EFOA 5IZ1A 3LSWA 4ELQA 5HDNA 1A54A 2K40A 3GMEA 3K9TA 1QVUA 4N8GA 2GOMA 3KETA 3OS2A 2I4CA 1U5TA 5BUUA 4JX6A 1Z3XA 2LDUA 1OCCH 5LHGA 4OZ9A 4EV0A 1D5YA 3FXUA 3HTUA 3S93A 4BXUA 4Q0CA 2X4HA 3KYDB 3JRBA 1ATGA 2B3BA 1X58A 4BY7J 1AOYA 1RDXA 3H6VA 3K6VA 3OELA 4FIMA 5K7FA 3GLXA 3LBSA 3KYCB 3TO9A 4ZDOA 2JN6A 2XC7A 4OWRB 1B3EA 1B2HA 4FAJA 1EH7A 1LBBA 1B9MA 4H4KC 2OV7A 2RREA 3OIPA 4OVRA 2D2WA 2E2HJ 3LNQA 3VDXA 2KJCA 4BHPA 3C7JA 3G1OA 2L5QA 1GTKA 1IMCA 4PGHA 1JKRC 3T66A 4GX4A 2OLBA 4XLCA 3LUZA 1MMAA 2CQKA 2DYSH 1X3UA 4RAZA 2XB5A 3BR5A 4ZYEA 2JUCA 5IT3A 1FOYA 2BYVE 1OMPA 3IFAA 3I59B 1MQDA 3MVWA 5CMCA 1O7LA 3WTYC 5HDGA 1O3TA 4RPOA 4ELPA 2OQGA 5CVRA 3NWTA 1U78A 3DPLC 4WWCA 3E3VA 2DT7B 2HOSA 2EV0A 3QRFF 2F7AA 1UFMA 3D1RA 2MC3A 3HXLA 3GTMJ 1A8EA 3L2RA 1DSNA 2ABHA 4L9TA 1RYOA 2XHDA 2XAGA 3TDJA 5I58A 1FSEA 1UG0A 1UTHB 2ZYMA 4XXUA 3BQZA 5CI5A 1B8IB 4ONYA 2AXTC 3RKQA 5J3LA 2H9BA 4IHYA 4IXAA 4M4GA 3P9CA 5FKMA 4N6KA 3E6BA 3A2KA 3P7NA 3S14J 4B47A 1IMAA 4IY5A 2ZMEC 4FBPA 3S4UA 2O7OA 3BY6A 4RB0A 4F3QA 3CG3A 1MPDA 4FETA 4P96A 5L8DA 4P9FA 2TRTA 3PO3J 2KIUA 2WTEA 3NEUA 3J7AY 4OYVA 4U1ZA 2GBYA 5FKOA 2F2EA 1R23A 3OR2C 3L2QA 3HFUA 1FMVA 1DPRA 4PZJA 3G3GA 4MHFA 3V5AA 1FBUA 1KYZA 2E2IJ 1P1OA 3MVPA 1IUFA 4GVOA 2VKEA 2VPOA 3PQJA 3FVGA 2LBFA 3L00A 3KJ7A 1K61A 5CBSA 4PSWA 5B3SH 4MLVA 2OBPA 3TGNA 4EQBA 1TL8A 2PVUA 3OEMA 3ECOA 2A07F 3CCYA 3A03A 1ITYA 1LFHA 4BXFA 1VQ6I 3FV2A 1L3LA 3T5XA 1FP2A 5FFZA 1R1NA 1SD3A 4IX7A 5GAHJ 4KD5A 4KDPA 1FOWA 5ICQA 1D1BA 1EF4A 4YB6A 3C35A 4C3JJ 2K9NA 3K6GA 3F8MA 5J8CA 3ZSFA 2P0WA 3CMAI 4PC9A 5A5XA 1HSEA 3EF7A 1SD7A 4N13A 1HSTA 1X1CA 2L54A 2RC4A 4L18B 4MX6A 2H99A 4BU2A 1BOBA 5M5XJ 5AONA 2Y7KA 3JYRA 1NHAA 1VQ4I 4X1EA 4F55A 5DTBA 1D0XA 5HBCA 4HAMA 4M6YA 4WEDA 1A31A 4OFJA 3M3FA 4G6TB 3BR1A 3VODA 2ZMEB 3S2HJ 3MVXA 1NI9A 3E97A 5AA4A 1SC7A 4ZZEA 5FHOA 4EDPA 2VL8A 5GADJ 5JFRA 4G77A 1X4PA 3VDFA 2DA5A 1R4MB 2DJIA 3QP6A 3HRMA 3CCRI 5J1RA 3SZPA 4X0GA 4F19A 1ZR2A 3IR1A 2X26A 5FJ8J 1X1PA 5BOXA 1ENHA 2IRFG 2RGVA 2CO5A 4S0HB 1GHCA 2XXUA 5ET7A 1FQCA 1XVYA 2FUG2 1VFEA 3RCOA 2QSHX 4I8CA 4NF5A 3EETA 2Y30A 1LFUP 3K4CA 3WTVC 4Z6YA 1ZBMA 3S1QJ 1LUJB 1Y8QB 1ZG3A 3CC2I 1Y3PA 5JHUA 5TRDA 1QVSA 3LC8A 3ZRGA 1XTAA 1BJAA 1WJFA 2HQNA 3THIA 2V93A 2HKOA 3B7DA 3MC2A 4LONB 2CFXA 1OISA 1QZYA 2N8GA 3HG9A 1HCRA 3BTLA 3L7WA 3OD7A 2A61A 2CV1A 1TT1A 1SMYF 2AQEA 2D1HA 2ZNZA 3IL2A 1RUOA 1MM6A 2P3NA 4PBHA 2GIVA 2VI6A 2KIQA 1NL5A 4ZEFA 4L9JA 5LGNA 2GM4A 1LEBA 1MQGA 4JB7A 1Z6RA 2XXXA 3ABTA 4NQWA 2ZXTA 4DXBA 3OR1C 2ICWG 3MN2A 1H9TA 2LYCA 1YTVA 3G3HA 1MY2A 2W24A 5TPAB 2CV2A 3GVAA 2EFQA 1FQBA 3GXOA 4ZJZA 1TT5B 4DBQA 3MP8A 4OU0A 1KA8A 3JAMZ 2DMUA 1N77A 4GYIA 1ZREA 2F97A 2XXRA 3WGGA 3TUSA 3OYFA 3GXAA 5B70A 2DQVA 2BGCA 4EF1A 3RYDA 4ZE8A 1D3KA 4YAHX 1FT9A 4BQAA 3PUWE 1FLIA 4HE1A 4I9DA 5IKBA 1RDZA 1XC1A 2LVSA 3OYNA 1MRPA 5H8HA 4RA2A 3SKPA 1M5FA 3SYTA 3RIRA 4FATA 4HZFA 2DT5A 3WHCA 2ONSA 3FGSA 2PFYA 4QFOA 3WTUC 2GXGA 4D1QA 1UTBA 2WAFA 2XD3A 1DPUA 3ZQFA 2VJIA 2H6CA 1DU6A 4R73A 3S9MC 3HUGA 1SVOA 5E1WA 3KZYA 4A0ZA 4DBRA 3FWEA 4KNYA 3LSTA 3FD3A 2GXAA 1XHYA 2FVZA 3H0GJ 1O3SA 1NV0A 4UA8A 2MYSA 3TQNA 4ESWA 2E19A 2X0LA 1JHFA 2PBWA 4PGPA 3RTWB 1TW3A 2P6SA 3O6BB 4H67A 1V5EA 1N84A 1SVLA 4DYRA 1AIVA 1WRJA 1XI6A 3KLOA 4A3BJ 1MKMA 3HSEA 5E20A 3TTNA 2HZTA 1MDQA 3HN0A 2I5UA 2EZKA 2RCAA 2RNGA 5TISC 2ZBKA 1KU9A 4ON0A 1KU7A 3ILUB 5H8FA 1IRXA 1K78B 4NEDA 4AVPA 2M3AA 1LVAA 1F9NA 2HOAA 3GZ5A 4BYYA 2VC1A 4CCMA 5L3CA 4NF0A 5D8KB 3RZDJ 4F91B 5FKKA 4NUBA 2PT1A 4GLIA 4O8MA 1HW1A 5BNGA 3IKVA 3RQIA 2XF7A 1Z7UA 2DFEA 4I98B 3HOTA 1IZ1A 2OZ6A 2YPRA 3E5XA 1XPXA 2PI0A 4CZCA 1EU8A 1KA0A 5EQ9A 2OX3A 5LHHA 3T9UA 1UIVA 5CQGA 4F1UA 1DBZA 2DYRH 4PE3A 3E1SA 5HLTA 3Q28A 4MNCA 4BDQA 5LOMA 2UXXA 4XLNF 4B3XA 1QKAA 3IX1A 2M7BA 4FECA 2XF5A 2AS5F 1DQUA 5DD4A 5EEGA 1IN6A 2RN7A 3OIQA 3UR3C 1FQDA 2Q2CA 3B6TA 2QPQA 3PNTA 1OCTC 4GD5A 4G61A 4FORA 2XPUA 1FX7A 4KT6A 3GX4X 1VQ5I 3TBIA 2JVHA 4DZJA 3D1NI 4HRIA 2Z16A 3V8KA 1QRYA 1FTTA 2QBYB 1PBPA 2COMA 1T39A 2IGNA 4ANJA 3SDBA 2IPQX 2RV8A 3KN3A 4K2EA 4MMPA 4ELRA 2DO7A 4DZPA 3IV5A 2DXYA 3IB0A 3I5OA 3T8RA 3M7GA 2JT1A 1Z91A 3C3WA 1LDJA 4B43A 2HDDA 1X2NA 1ZJLA 1AA7A 3PSFA 1FIAA 4JQFA 1SI0A 3ZCOA 4WXHA 3IOVA 2RKMA 4DDDA 3T96B 2ACJA 3P7IA 1OVTA 3H5NA 4ZECA 1EYKA 3GFLA 2O9LA 4NBQA 1ULYA 4FE8A 4PFRA 3ZGKA 2OU2A 2WEFA 1H89C 2ADUA 4RAYA 4NGUA 5D8LB 3WAFA 4A3MJ 4YU0A 2PCRA 4IO4A 2K3FA 1MDMA 1YW7A 4WXDA 2NNYA 1MBEA 2LKSA 2ONRA 2K27A 3QYEA 3TTRA 4ITVA 3BLYA 3RKWA 1SANA 3DQVC 3M8FA 2ISZA 1D1CA 2Q1ZB 2VT3A 1SVXB 4R9FA 4XN3A 3IJOB 4IQJA 1T33A 2MG4A 3R26A 3RYPA 1XMXA 2I3WA 1S9HA 1VE4A 2IGMA 3IB2A 4O3CA 4M6XA 2JMWA 3RN8A 2QLZA 4QSHA 2CQXA 1YZ0A 1FTZA 1RI7A 3I4MJ 3LUYA 5TU0A 1MXZA 3C2BA 5DD8A 2EA4A 2F6PA 2D5VA 1TQIA 5ITOA 3ZQ7A 2GOXB 3V7SA 3CF5F 5HLIA 1BKAA 4CH7A 1NH3A 1D4NA 2B3FA 5BPDA 3TOBA 3HO7A 2VPRA 3WE3A 4BDZA 3M3YJ 5KCJA 1BIBA 3H9GA 2R7RA 1O3QA 1LEVA 1BOAA 2XXVA 4G6DA 3HPIA 1FNNA 3IO6A 1RKTA 1WZ2A 2Z23A 5F64A 5M2VA 4LMYA 1OMIA 4LD5A 1IO2A 1FRPA 4LVQA 2VD2A 3IAZA 3OIOA 2FBPA 4R2FA 3LA2A 3QUFA 3OYDA 4A3LJ 2ONKE 2QS3A 3FXBA 1S5LC 3F72A 3F9KA 1F36A 1I1GA 2B65A 4G2ZA 3GFMA 5DCMA 5D4RA 1X19A 2QEXI 4DNCA 2KL4A 4MH5A 5FHMA 5DV5A 4EJOA 1DP3A 1MBHA 1WJCA 4BY1J 4Y33A 2HAUA 2ZXWH 4A6DA 4I6ZA 3FVNA 4GWZA 2E1MB 3ZQHA 4ZDMA 1B5JA 4EQQA 4BKXA 4PJNA 1IG7A 5B7DA 2Y48A 3DP8A 1R5GA 2ELKA 1JGSA 1OR7A 2QVUA 2K7LA 3LA3A 5LTCA 3BG3A 5FLXZ 1XGMA 1ETOA 2OWSA 3EHTA 3SEUA 4OMBA 1TWCJ 2GHBA 3GTQJ 3EHSA 5J4VA 1P4AA 2K9QA 3CC4I 1FPKA 2VXZA 2PG4A 1YRNA 2JUGA 2PFZA 3QPLA 2HXRA 4OWDA 4E0WA 1ZIUA 5B1BH 3MAMA 5BPIA 2JSCA 1FW0A 4PE5B 1SFKA 2FEZA 2HQ5A 2I10A 4AIHA 2X6XA 5IP7J 3ISPA 3CLQA 2GIZA 1A99A 3IRRA 1FYKA 3MBPA 4OESA 4HX8A 5CMKA 3CFZA 2LY2A 3OOAA 4BJTA 4P3LA 2BOLA 5C44J 3IAS2 1Y0UA 4HW8A 1Y6IA 3E79A 1GV8A 2YR2A 4QLCU 1R22A 2L7KA 4BGDA 1FOKA 5GTHC 3H1CA 2I0CA 3N26A 3W2AA 2H5YA 2DDKA 3DBHB 1KZ8A 2RC7A 3GO5A 3H5AA 4KFQA 3CCVI 2LOOA 4CCJA 3V7RA 3M07A 4HDVA 2MH9A 5DDGA 1BR1A 2PX9A 1R1VA 5C4XJ 1FPFA 4XOPA 3RKXA 3FIWA 3FJ7A 4KCDA 2R7DA 1QO0D 1AKHA 2X6OA 5J1UA 4KYSA 1FJ9A 1SYIA 2X1EA 4L9NA 3A01B 2PLYA 3F21A 3B02A 2XGXA 4L5IA 2MD0A 2VE9A 2OWZA 3D5SC 1N76A 3B6AA 3GFJA 4XK4A 3H92A 2I3VA 1P6RA 5J1DA 2CGPA 1B7UA 4HQMA 2HYGD 3K4MA 5E3LA 3OYHA 1FBCA 1PP7U 3FV1A 2DOAA 5CKTA 2CYYA 1JQFA 2VKHA 4UXNA 1SYHA 2ZYOA 3RUMA 2YU3A 2FX0A 5EEHA 5F0CA 3H9QA 2V4JC 2R3SA 1YX3A 2F35A 1LBVA 3ECRA 4GIZA 2XGDA 4DYCA 1R4NB 1ETWA 1TWFJ 1BI2A 5FD5A 4FQGA 2VONA 1SQYA 2LF8A 1JKQC 2DDAA 4A3DJ 3PMVA 3IORA 1LQ1A 4TLLB 2V6CA 3RTFB 2EQRA 2FOWA 3CJQB 3LQRA 3S1RJ 1EZ9A 4KICA 2BY2A 2HR3A 1PEBA 1Z7ME 4G8MA 4C3HJ 1GVJA 1M1EB 3KC0A 3BTIA 2Y5LA 3PUVE 4HPQA 2VGQA 4ZEDA 5IYBJ 4E7JA 3KX2A 1MBJA 2BHZA 3G73A 2ECBA 3D0SA 3FF5A 4ZH4F 4ESJA 4XQFA 5IP9J 2F3DA 2L9SA 4KR5A 4LJZF 1IRGA 4DZ1A 1ODDA 4XM3A 3VXCA 2ME6A 5ET6A 5CM6A 3HBLA 3VVDA 3BROA 4XLFA 2DS9A 1QULA 5GTIC 1N3WA 2ZC2A 2UVJA 3T0YA 5ITPA 3QQAA 2IXSA 2P1SA 4F39A 5IOZA 5ICTA 1P4XA 1K83J 4PF8A 5EYHA 3EN3A 4AB5A 3UGWA 1KQ8A 2G29A 4PJMA 2Z3YA 1SAXA 4G94A 2NWJA 2Z1DA 3GCMA 3VYUB 1Q9DA 5L3EA 2HVSA 2ZYNA 3CHGA 1P2FA 4KITB 1QJMA 1LNWA 3CP8A 3QAHA 3Q3SA 2VBXA 4M3FA 1VQLI 4Z7EA 4M3DA 3JCUC 1RIOH 3DEUA 1OIBA 3U93A 1YS7A 4YFNF 4RJZA 4PAKA 1MQHA 1N7XA 3CCMI 4A5NA 2MLKA 2AL4A 5DYHA 1XCVA 3RSNA 4LB6B 5ICCA 1GXQA 1IAWA 2ZNUA 4G8HA 1BW5A 3MAJA 3BOQA 5JTYA 2UXAA 1E17A 4BQQA 4MQVA 2A5TB 3DEEA 1Y39A 3PL8A 3OYEA 3HOUJ 3BP8A 2QWWA 2ETHA 4H0WA 2LH9A 2ISYA 2ZJQF 5L9SA 2AHQA 2G9WA 2WADA 4RMNA 1LE8A 3S9NC 1FZPB 3ABMH 1B3GA 5I57B 4IO7A 1H76A 3H7MA 4MFDA 3I4NJ 4Q48A 5TP9A 4EQ7A 5CPRB 3C36A 1J59A 2CH0A 3BKIB 4A12A 4F52A 1MJ9A 1MMGA 1POGA 2LR8A 5L9MA 1O4XA 3MUQA 3AG3H 2Q9TA 2HZKA 3LA7A 2PMHA 3T1BA 2I0BA 3S1NJ 2FJ1A 5C4JJ 1D9QA 3CESA 3HOXJ 4OANA 1Z6TA 5HM4B 3MKWB 4RGUA 3PPQA 1I6AA 5IZZA 3ZQQA 1JUSA 5KK1A 4ZZAA 4NAPA 2QFLA 1RR7A 1TFAA 4MFEA 4YKIA 2VE8A 1P7JA 2X1CA 4MCOA 1QNTA 3OS1A 1ZGAA 3SDGA 3CFXA 1JI8A 1P7IA 3FMRA 1WCMJ 5FKNA 4UY8I 4AYBA 2XA5A 1OJLA 4II3A 3BZKA 1W0UA 4N6PA 1JT6A 2EBIA 3EUHC 2OJED 2LKXA 2Y7WA 3HOZJ 1LAXA 3F8FA 1LBYA 1UMQA 2BVLA 3DLAA 5F24A 2FE3A 1FTLA 2Q8KA 4Y3OA 2WKYA 4G68A 3CJNA 1JVYA 4JX5A 4IJAA 1ZG5A 1VSOA 2WYPA 1PBQA 3CMMA 3O2AA 2CQNA 3U1KA 5E1ZB 2DK5A 2YJPA 4I3YA 1HSLA 4XKNA 1NH7A 3LSIA 2QF7A 1DOTA 5LLQA 1FBDA 3EQ1A 2KRHA 2KHMA 3AG4H 3QPHA 1TLHB 2UYFA 4BAYA 3IOUA 1TBXA 2RNJA 3W2VA 2JQ7A 1AWBA 2VJ5A 4WF2A 1FBHA 1NUXA 1O7TA 2ZJRF 3J81Z 3K4LA 1OLTA 2BY0A 1KZHA 2XXKA 3PPPA 3W9VA 3V83A 2PMSA 4RA1A 1HDDC 2NAZA 4NF8B 1PJRA 3MWBA 1PB9A 1QQIA 2O6AA 4JOMA 4BE1A 4OFLA 3CUQB 2DJNA 3AL0C 1GV5A 4UB8C 4ENNA 1P1NA 3NAUA 3DPTA 2FBIA 4FASD 3ESWB 2PYYA 1MPBA 3GFIA 2F5DA 1HKTA 4LIVA 1OLCA 3OYCA 2CFOA 3MQ9A 2L4AA 4IRGA 2VBZA 1TNTA 1MMNA 2FHYA 1PUEE 4LB5A 2A6EF 1MG1A 1Y20A 4XFEA 1ERDA 2OCEA 4XIDA 2CZKA 4KPTA 4RXLA 4YMAA 1BI3A 1F4KA 4M9ZA 4HXVA 1YIJI 4AIJA 3O2PE 2E5NA 3MMYB 5E8GA 1YQAA 2OD5A 1OYYA 3OOPA 3HDDA 4A93J 4QFNA 5I2KA 3PUYE 4OVPA 3TP0A 1D0ZA 1IDZA 2V3UA 1B32A 3E5UA 3G4SI 3TEDA 3WU0A 4E7LA 1W1WE 1KGSA 2DA2A 4C2MJ 4AIKA 2DWHA 2XX8A 4S05A 2P7VB 3K4NA 3L2CA 3F6OA 1MBKA 4IGTA 3I0TA 5FRMA 1ANFA 4KCCA 2HU9A 4A0YA 1XGNA 3MPLA 1G4DA 1G2HA 4P11A 3FJMA 1T0KA 5L3GA 3K4BA 4YKJA 3O6GA 3OENA 5HS7A 1APLC 4UV9A 2UVIA 1V5GA 2XF6A 3GWZA 1N04A 2DA7A 3C31A 5H8SA 3RPQA 1IXHA 2Q2EB 1B5HA 4IHSA 4UVAA 2PMUA 1BK4A 1BI1A 1QVTA 5DM7F 2BZTA 4JBAA 2VT5A 1LFBA 1JKPC 5IYDJ 5KZTA 2QSXA 3FVOA 3KYLA 3NQOA 3K01A 4BBRJ 3KJTA 1U8BA 3R0JA 3MZ1A 2A69F 2EIJH 2HQAA 3DTIA 3V42A 1CNQA 1NNPA 2DWAA 2DI3A 1ZTRA 2L7ZA 1T98A 1FTKA 2PT2A 4ZE9A 3C2GA 5LGTA 4NF6B 4BL0B 2IBDA 1R9TJ 1FTOA 2XAJA 4YICA 4BDLA 2M8CA 1Q35A 3A02A 4FJPA 3ULQB 5K1YA 2V1DA 3CFLA 3ZKLA 4F22A 3JAMK 3BT9A 2FIEA 1LDDA 5GPAA 4ZZDA 3DF8A 3GLLA 2O03A 4MEVA 5KDTA 2M1BA 3EQLF 4LQ2A 1UTHA 4N6DA 1GVCA 2YX4A 1KA1A 4N17A 1LVKA 3I71A 3K02A 2MD5A 4YFXF 2DOEA 1UB9A 3I54A 4I01A 3O66A 1T0FC 2AQFA 3QP5A 3R6UA 3T22A 4R6HA 1IC8A 1QUKA 1ZHFA 3OO6A 4GX6A 3OYIA 3MKZA 3DP4A 2F6CA 2ZNYA 4L5JA 4R8HA 4Y13A 3GZNB 1ZR4A 4IOAF 1ON1A 3W6JB 1RPWA 1USYH 3BR2A 3S16J 2JJKA 1IUDA 4CCKA 2EFPA 3TPAA 1J5YA 2YX7A 4G4PA 5ESYA 3M1CA 4P1WA 4L17A 5LEKA 1X1DA 1LAGE 3TP3A 3FX3A 3KC1A 3A0HC 3MVYA 3FM3A 2DMPA 5ICGA 4NWCA 1EYJA 3ONQA 1Z67A 2ZSIB 4CDGA 2E35A 2NS0A 4I99C 2IEKA 2QQ8A 3C4MA 1KYWA 4O7MA 2Z5UA 1RZ4A 1FTAA 1Y1MA 1Y1VJ 1G59A 4Q5SF 2HXIA 3PUBA 4GL0A 2HPMA 3TZAA 2BY1A 2ZFWA 4UHTA 1DTZA 1FEXA 3TYHA 1XN7A 4D5CA 2V79A 3JZJA 3T0JA 3VVFA 1EZPA 2R7QA 1XVXA 1DDNA 1ZQ3P 1MD0A 3LAJA 3ECHA 4L9VA 3HSTA 4LN5A 3VLUA 2VQCA 5I56B 2UYEA 2M4GA 3BIHA 4HSRA 1U5TC 2Q8MA 3P9IA 1X1BA 2YS9A 4X1BA 3PTYA 1B72A 5CMBA 3SDFA 2JJ7A 4TOZA 4YELA 4OOIA 1DPPA 4NHJA 2Y0SA 5F6FA 2A5YB 2F36A 3H35A 1R9LA 3D4CA 4IHWA 3HPGA 2ZMEA 3I64A 1EJ9A 1LCTA 3GTOJ 5H8QB 2COBA 1U3EM 1IGNA 3KG2A 4N15A 4RLFA 3JW4A 3S9EA 2FXAA 2VIXA 4AC0A 4F92B 3WTTC 1YS6A 3PIPF 4CCNA 3MZBA 3CCQI 4H65A 1MY0A 5E1XA 5ILSA 1I6XA 3U1DA 3K70D 4IB2A 2R5ZA 2XGEA 1ETYA 2WX9A 3H6TA 1BC7C 1FOXA 1P1UA 3IWZA 4LG0B 2XB0X 3J80Z 1S50A 2F34A 2EZLA 3GTLJ 1FPQA 1YW9A 2DA4A 3WG9A 2KP6A 4YKKA 2KT0A 4CYCB 1VZ0A 5IT9Z 1P9QC 4IO2A 4ASNA 1WI9A 3G3KA 3K10A 1S3JA 3ML6A 2WAQA 1II5A 3OS0A 4QBAA 2ZFUA 3SZGA 2K9SA 2DU9A 2F5FA 1NV2A 1OLAA 2QQBA 4OIQF 3MZ9A 1MNDA 2MH2A 5EJCA 4YG2F 1R6ZA 3DKXA 2DE3A 1FTMA 3PIOF 2E60A 2YU9J 3JTGA 2ZNTA 2JTVA 1QZEA 1LEAA 3IWFA 3S3MA 1DPEA 4GQOA 1I3QJ 1U5TB 1BM9A 4J00A 1RYXA 5ISUA 2WB1A 2GQ1A 2Q74A 1NV3A 5AA2A 2KFDA 2FBKA 2VD3A 1B05A 1J0RA 4NWDA 3QMFA 2HOEA 1L0OC 1Y3QA 1IMDA 4PUSA 1YYVA 1FTJA 3H3GA 3OO7A 2M30A 1DMBA 4DLDA 2I8DA 3ABLH 3QK6A 1YIOA 3H6UA 1WVRA 4A3GJ 5EYRA 4FEDA 1VQNI 3WGHA 4QIWN 1XGSA 3TO7A 1WQ2A 3ZP5A 1JW1A 4PF6A 1I1SA 4XSZF 2R8TA 4XL9A 4M72A 3S3NA 1CB6A 1MXWA 3PV0E 4JVIA 3TCHA 4BS9A 2R7ZJ 1IN7A 3K6UA 2R7SA 2WY8Q 4I62A 1NUYA 4R72A 3LR1A 2VLAA 4DI4B 2X48A 3FHNA 2IS2A 4WXCA 2D3IA 1XGOA 2KQRA 4X8RA 1O7FA 4ZC3A 3NARA 4FE4A 2O68A 2XAHA 3H06B 3TL4X 1QGPA 5M5YJ 2GWRA 2LY9A 1LDKB 5EDNA 1NNKA 1Y8RB 4HOBA 1LGBC 1W5CC 3E6CC 2R71A 1Y56A 3B6QA 3OYMA 3HJEA 5K2XA 1J2XA 2L7FP 3VSKA 4RB1A 5DVIA 5I58B 2FU4A 1YO5C 4P8BA 2HZLA 2XWKA 2H27A 3ZXSA 3TQLA 1AH5A 3TDZC 2KISA 3GEZA 5HS9A 2CG4A 1S7OA 3G1LA 4TV7A 5FO5A 5BS6A 4PP0A 1XDUA 1W5TA 4IY6A 1TNSA 4WEPA 3FJGA 1YAEA 5FLXK 2NVQJ 3BG7A 3Q25A 4JVDA 1Q1KA 5IPAA 5E79C 3MSTA 1USSA 4YFKF 5EZHA 3QU6A 2NVUB 1IXCA 2VT2A 4I1DA 4A6EA 4OVSA 3C32A 2REGA 2IW5A 4R6YA 1Y0NA 1B5IA 3HHHA 1ON2A 2F4MB 1V55H 2RDPA 2RQQA 2WAEA 1B1BA 4G9YA 5EZGA 3SEZA 4A0XA 2ZXJA 4PDDA 1U9OA 2K5CA 4LG3A 3FHZA 4P1EA 2V25A 3D4GA 2FMYA 3BZCA 1VQ8I 5K5RA 1LAFE 5FTHA 2FNPA 2QVOA 2B9SA 2IEEA 3VFZA 3CIJA 4U7BA 2HKXA 3BTCA 2LBFB 2RCBA 2X7PA 4XORA 5TJJA 4KFCA 2I58A 3FATA 1POTA 1Y9UA 1UG2A 4R75A 3K2AA 1O57A 4IO3A 4QSEA 3CQZJ 2A68F 4B1RA 2NRAC 4ZDPA 2DE2A 2KLFA 4LFUA 4D9JA 3BPVA 3J7AO 4H8IA 3WTXC 5F0HA 4YZZA 3U92A 1JGGA 2DP8A 3K4KA 2P5LC 2D1VA 2XXQA 3S9LC 2QVRA 3V8LA 5A5XB 4FCYA 5F08A 2R93J 3R6SA 2ZKZA 4GDFA 4TLMB 4GO1A 3D5RC 1RC9A 4ESFA 3PO2J 2WBBA 2L02A 3VWBA 4F2QA 4MFIA 2B4LA 5FD6A 2F6GA 3PPOA 2DBBA 4N07A 5JVTA 2JA2A 3N4MA 2O1LA 2CMPA 3ROJA 2F4IA 2XWVA 4JWYA 4D5FA 1R5ID 3DBLB 3U1OA 3FVKA 5CYVA 5CJ9A 2XWIA 5JHFA 5AA4B 5FLVA 3BJ6A 3ILTB 5F7VA 3EHUA 3F8NA 4E7KA 2UV1A 5C3EJ 4B44A 4M74A 5CRYA 2PJRA 4NHBA 3EPEA 4MNPA 2ELHA 1QKBA 2CUFA 3DFGA 5E3OA 4N8YA 1K7AA 1IQ7A 3OMBA 1Z77A 2NXNB 1WJ5A 4IPAA 5DVFA 2CU7A 2JSPA 2UUZA 1UQWA 1W36D 3F8BA 2Y2ZA 4H6DA 4NF5B 4HX4A 2L9NA 3AG2H 3EKIA 1BBYA 4DXCA 4OTEA 5I84A 2K86A 1JW4A 3BPXA 1CGPA 3FXRA 4B3AA 2A05A 1O63A 2A3SA 2IT0A 1G0HA 2A6TA 4MLOA 2WA0A 4H5GA 1MXXA 1NG7A 1DU0A 2PX1A 2L01A 1MBFA 4LATA 4IKFA 1I6HJ 1BA5A 2E34A 4R79A 4MTEA 3ZMTA 4NG7A 3BQYA 3S17J 3FASA 5AIPA 5IZ3A 3S2VA 4G7HF 3HB9A 2I48A 4PFTA 3FK6A 4XKVA 1HXDA 4A5MA 1EYIA 2V1NA 2H8WA 3H3ZA 3VEPA 1J75A 2O6GE 1I3AA 2M0MA 4IEJA 3W3CA 3E3KA 2HS5A 3OL3A 4EGYA 2XX7A 2ELJA 2HCAA 4IL6C 3VB2A 3OYGA 2IGOA 3SEXA 4NQWB 4O94A 3O28A 5K7HA 2MW8A 1TC3C 1F1ZA 1QPMA 2LFBA 3B8BA 2ANJA 3DPUA 4C1TA 4ELOA 4EATA 2DCEA 1MJBA 4XKBA 4BEHA 2XKOA 1YPNA 2DOJA 3DM0A 5GP9A 4DIGA 4LK0F 3O6HA 3UORA 2H6BA 2QQAA 3P5JA 3RLFE 1M5EA 1IW7F 1VF9A 4AM3A 3BZ6A 2Y0MA 1V3FA 2MABA 2W82A 1FPGA 2O1MA 2ZZXA 3O8HA 1U0JA 2NS7A 3TMOA 3HM5A 3IOWA 1CE2A 4XONA 4XKRA 4KJZA 1HKSA 5E3NA 2H25A 3TO6A 4MF3A 2DVCA 5H8HB 3O8GA 3CO7C 3S1MJ 2IS1A 3KEIA 2LP0A 4F3PA 1UTBB 2E1MC 1S29A 2G7UA 2K3PA 2QUFA 2RQPA 2VQHA 3UNGC 4B09A 2F5VA 4UUSA 4U7DA 2XSDC 3GYHX 1B3HA 4KYDA 1ZKBA 4HW0A 5LGUA 1SBPA 3CVGA 3L2WA 5H6RA 2H1KA 1GV2A 3DBRB 4KT5C 1QUIA 2D5WA 3KGCA 5M3MJ 3CCUI 1HA8A 3ZR8X 5CQEA 1LAHE 3KCCA 3K4UA 2Z8FA 2AYSA 1LJ9A 4PFWA 3N6UA 1F5TA 1A36A 5AA2B 3CSGA 1JVXA 3Q9SA 1Q1HA 2UXNA 1D8JA 3PFIA 2FA5A 1WVJA 1JHHA 2OCUA 2V84A 3CG1A 3Q27A 5J40A 3PPRA 3CSBA 4RM3A 2CW7A 4DI3D 2F78A 2R7XA 1D8KA 2Y75A 4RGRA 2HPIA 4Q5TA 4N9IA 1JT0A 2W84A 2XXHA 3KE2A 2R5YA 2BJIA 2DDBA 2YLNA 3GLBA 5H8FB 2HPGA 4MNUA 3DWLE 3IL1B 4C3IJ 1OQYA 3L2UA 5KCMA 1AOVA 1EV7A 1WPKA 5IM2A 1M5DA 2DAOA 1H44A 4AU7A 3HC7A 2K4JA 4EUOA 3ZMUA 2DA1A 2OPTA 3I58A 3WE2A 4BJ5C 1G8XA 3Q9VA 1MMSA 4EJVA 5J1YA 1MXUA 3VVEA 4G8NA 1Y4CA 4L0YB 1P4WA 2Y69H 5HDKA 3ZS6A 1R71A 4HF2A 1PUFA 1Y3NA 1JE8A 2VKDA 5IY5H 2H4IA 2EV6A 1TZLA 4Y52J 2HNHA 2XAUA 1LKXA 3LMMA 4JYKA 4EGZA 1A5JA 4XLPF 4GXOA 4OMYA 4GFBA 2GXBA 3TTKA 5KAFC 5IYCJ 3A0BC 3A29A 2EIKH 4I09A 2KRCA 4OAYA 3VE1B 1IJWC 2O8KA 1SW4A 2Y7RA 4BDRA 4DCYA 2LNBA 4C2TA 3TTMA 3L09A 3MW0A 3BDDA 3PGFA 5ET5A 1R6RA 2XAFA 3G3JA 1DP7P 1B46A 3K70C 5EGOA 2OAZA 3KZGA 1L5TA 2M7AA 3P9KA 4ETSA 3QWLA 4H8JA 3ZMDA 1SW1A 5ILUA 3C2HA 2BV6A 3VLVA 3LSLA 4ENJA 5JR3A 1MNMC 3J81K 4NC6A 4IF4A 3E6DA 1UIUA 3H4ZA 3R7XA 4LZ7A 1GXPA 4F29A 1NK3P 1OCPA 3LSXA 3BR3A 4BACA 3SXYA 5DTDA 4EM1A 3AKZA 1ZG1A 4MEXF 1W4MA 4PAIA 3I9V2 3IAM2 3PUZE 3FBIB 2QSFX 3KP6A 2DODA 1FCKA 2V3TA 2ZB9A 1XD7A 1K6YA 2QKLB 1MDMB 1MDP1 3FMSA 2F48A 3CO6C 2V6EA 2W4SA 2VOOA 2R9JA 4BHBA 4HNVA 1FBEA 4ZEKA 3TFLA 3U8QA 3GBGA 3O6IA 3WHBA 5FTIA 4EXLA 1OR7C 4BUPA 1G3SA 1Z0XA 2GAUA 4ENMA 2O7IA 2NNNA 2KQZA 1HF0A 1PYVA 4X9TA 4N4UA 3GTGJ 3G1MA 5AIQA 1T8IA 4KN4X 1VQMI 3OSQA 2QS1A 1ZELA 1S72I 3I53A 3RJPA 1UHMA 1I69A 5F0FA 5E18F 1EH8A 2F7CA 4F3BA 3IHUA 3I55I 1IV8A 4YRVA 4JXIA 4P55A 2XRNA 4G8XA 4GWOA 3KEYA 4JWXA 5DYMA 1D5VA 2E71A 1QZZA 4GWXA 4HG2A 1W0TA 3M1EA 5GPCA 3GZGA 3WODF 5K7ZA 2HEUA 4PFUA 3TQWA 2XD2A 3KOTA 2BE5F 3PMWA 5H8NA 4OVTA 2X6WA 3OOUA 2NYXA 3F11A 4ECFA 3PUFA 2A5TA 1N25A 3LSGA 3NRVA 5BWJA 2L2OA 4UNOA 3TAJA 1ZLJA 3LSJA 3PD8A 1FJLA 1WWXA 4NC7A 3LSHA 2BHYA 2M34A 1V4RA 1GLNA 4XEQA 5DCMB 9ANTA 3E6MA 1J09A 4U88A 5TGTA 4EVIA 2VQGA 4DQ2A 3UA8A 4I0BA 4YB7A 1QA6A 4R1HA 4ABZA 2CMOA 4EJTA 3CUOA 3FXKA 5B1AH 1USYE 4NN3A 4NTLA 3U65A 3HIFA 2EZIA 1FQAA 3O97A 3PUXE 4V2GA 3C18A 3JRIA 1JEUA 1SPIA 1YJ9I 3DEWA 5CBRA 1YRNB 6PAXA 3CTAA 5IOYA 2Y84A 2UVGA 1BR2A 5HODA 3M3KA 2NUVA 4QFKA 3PM1A 4U4XA 1KQ0A 4A69C 2DTZA 2HQ0A 5GAGJ 4I3EA 2K9MA 1E3HA 1X1AA 4BDYA 2JWTA 2DVZA 1O64A 2ZZWA 3Q26A 1TTYA 1QBJA 4QWQA 4DXUA 2IJLA 1MH4A 3B6CA 3KZZA 2ECCA 1ZLQA 2QMXA 2FRHA 4PFOA 1ZARA 2QZ8A 2DTRA 1JNFA 2A5SA 5ICEA 2DQLA 2P7CB 1OCRH 1SFXA 4TQUQ 3E78A 4V19K 2FF4A 4LK1F 2M45A 4U1OA 2P5VA 3HKZA 3UKGA 4U87A 3U21A 2V9VA 1PP8F 1JJ6C 4GBWA 2E36A 3E5QA 3KN7A 3DV8A 4ZYAA 2E1CA 1B1XA 2X85A 2THIA 3WTWC 1VDWA 4UUTA 4NNJA 4EM0B 2Z99A 3F3XA 4ZYGA 3TEPA 5FFXA 4PQJA 2XVCA 1OCOH 1AKHB 4IVNA 4OINF 3CMYA 5H20A 3M4OJ 2QQ9A 2TCTA 4HEA2 3RPWA 1I5ZA 2BW3A 1FBFA 2WYKA 4NX1A 2PMZN 5ET8A 3DKWA 5I2NA 1QPIA 4NQ8A 5F1QA 3A3CA 3GF2A 1IXRC 3MZYA 4P0IA 1G0IA 2H94A 4N0BA 4XKWA 3JRCA 3HSFA 4I7HA 1A6QA 3RNNA 1BR4A 3OYBA 3L1PA 2FNCA 4PDHA 2DMNA 3EYYA 3A1YA 2O8XA 3ZMZA 4WK8F 2NOOA 1NV7A 1ZU0A 4PAFA 1T56A 1JEVA 3WG7H 3S32A 1AMFA 3BR6A 3MKYB 3CUQC 1JW5A 4FE7A 4AYBN 2HHMA 3QPTA 1W36C 2EZHA 4G7ZF 1SMTA 2CSOA 2MLGA 4AWXB 2LLKA 3HGYA 4Y4RA 1TT0A 4E6KG 2B4MA 3K0LA 4U0VA 1DK4A 2P2AA 1MH3A 3L6HA 3ODBA 5DEXA 4JSOA 1IMFA 1I39A 4OENA 4AB6A 2FD5A 1SDXA 1D3YA 3J80K 3S2DJ 1YHQI 4RBOA 4PJ0C 4V2FA 2R7TA 3R60A 2O0YA 4PFPA 3H0DA 3VPRA 4XTCQ 5IT9K 4XLEA 4BNCA 4IRHA 4OVQA 1G3YA 2MGQA 2QA4I 1CF7A 1FQFA 2DMQA 4XKCA 3HSRA 4U4SA 5HOOA 2PBIA 2OUMA 4W1UA 4XOTA 4OVJA 1KONA 4AS5A 3AAFA 4E7SA 2DYXA 4Y7NJ 2DWIA 1Z7NE 1CQTA 3N05A 1BLFA 2FYIA 1ZH5A 1SFOJ 3RQ4A 2J5PA 1FBSA 3AXFA 3RGYA 4UB6C 3RPLA 1ELJA 4OIO