2ESNA

The crystal structure of probable transcriptional regulator pa0477 from pseudomonas aeruginosa
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
301
structure length
299
Chain Sequence
PLLRRLDLNLLLVFDALYRHRNVGTAASELAISASAFSHALGRLRQGLDDELFLRQGNRMQPTQRAEHLAAAVAAALRALGEGLEEWRPFVPGQSQRTFVFAATDYTAFALLPPLMNRLQHSAPGVRLRLVNAERKLSVEALASGRIDFALGYDEEHERLPEGIQAHDWFADRYVVVARRDHPRLAGAPTLEGYLAERHAVVTPWNEDSGVIDRLLARSGLRREVAVQLPTVLAALFLAGSTDFLLTAPRHAARALAEAAGLALYPAPFDIPPYVLRLYSHVQGRDAHAWMIGQLKGLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of putative transcriptional regulator Pa0477 from Pseudomonas aeruginosa
rcsb
source organism Pseudomonas aeruginosa
molecule tags Structural genomics, unknown function
molecule keywords probable transcriptional regulator
total genus 89
structure length 299
sequence length 301
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2esnA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2esnA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2esnA03
2GHBA 3WTWC 2I58A 5ILVA 1IXRC 2O1LA 1FWZA 1RI7A 2CMOA 5CMKA 4GFRA 5CI5A 1RUOA 5ILSA 3S9LC 2WTEA 5JHUA 1L5TA 1IQ7A 4THIA 3LSWA 1AH5A 3K2ZA 4HDUA 3KEOA 2IP2A 3I5UA 3I5OA 4OOIA 3MVYA 4IVNA 4QWQA 4KDPA 4X9TA 1H3DA 2KIUA 2FBIA 1MJBA 2YR2A 5AA2A 3QP5A 4KICA 2A5YB 4IXAA 3ECRA 4GYIA 1USSA 1PB9A 4E0XA 4RGXA 2V1UA 2STTA 3WTUC 1W7PB 2O61A 2B65A 4G68B 5IT9Z 4XBFA 1GGGA 5L9OA 4ZS9A 4ELQA 3KOTA 3HPIA 1RZ4A 3DQVC 4TLMB 3BP8A 3FD3A 4TV7A 2ELHA 3PPNA 3Q27A 3CDHA 1SD7A 2Q2EA 2XHDA 2XROA 1I69A 1YAEA 2DXYA 2UYEA 1LFIA 3CIJA 3CVGA 3IRRA 2DS9A 5DT6A 3ZMZA 2D1VA 2MH9A 4ZYEA 5AIPA 5JTYA 1IF1A 2VE9A 4I2OA 2HYFA 1GXPA 1Z1DA 3NRVA 3CJNA 5I56B 1S50A 5DEXA 5KCJA 1YFHA 3TQNA 1STZA 2OD5A 1P4AA 1Q1KA 1FSHA 3FX3A 3RPWA 4KFCA 3TZAA 2VOPA 5H8NB 1FX7A 3FVNA 3O97A 3JAMZ 4WXJA 3E3VA 3WGHA 1A99A 3I59A 3DELB 3MAJA 4O3AA 1SFXA 4Q5SF 1F5TA 1BN5A 3U93A 2IW5A 1DDNA 3F8CA 1IITA 3CUQC 5DVIA 4M4GA 1ZYRF 1XGMA 2PBIA 2FQ3A 2I4BA 3MVZA 3PUZE 4GVOA 4PETA 1MQHA 1WODA 1O64A 1SBPA 2P5KA 2V93A 3OO7A 3AXFA 3E6DA 4YZZA 3PPOA 4R1HA 2QS3A 1MJ9A 1P1UA 4MHGA 2DO7A 5H8FA 3SEYA 3CRBA 1SMYF 2M45A 1J1NA 2K27A 1Y4CA 1PB7A 1J7KA 1W7PA 3KEIA 3VV5A 2XXIA 1LCTA 3T8TA 1BI0A 3KN3A 3PPRA 2H6CA 1S29A 1ZARA 1F1ZA 4MFIA 2IA4A 2HWVA 3CSBA 2XX9A 2RVCA 3OO6A 3BFTA 1EZPA 3GX4X 2W24A 4OMZA 2QENA 4MQ9F 3M3FA 1FNNA 3M8UA 2HXWA 1WDNA 4I01A 3MZYA 1P4WA 3N4MA 4ESFA 4AB6A 5I59B 3QXMA 3LA7A 2IVMA 4ONYA 5TP9A 2STWA 4F3SA 4Q4ZF 1XSDA 1D5VA 4Q30B 3UA8A 1IXGA 3TO6A 1ZREA 2VHAA 2COMA 1SVXB 1ULYA 2IJLA 3KN8A 4OEUA 3TTLA 4S05A 5HM4B 2Z23A 3RUMA 3KCCA 3RN8A 4XKPA 3C4MA 2Q88A 4P5OA 2ONRA 3OEKA 1LDDA 4RY1A 1R1TA 3JAMK 4F31B 1MY1A 3USDA 1B7UA 3ZS6A 4GWOA 1IZ1A 3FGSA 4YMAA 4HAMA 4MGRA 2GIVA 3GBAA 2DTRA 3UIFA 2CGPA 4XLPF 2O3FA 2NRAC 1Z6TA 4G6DA 2O6GE 3IOVA 4IF4A 1FOKA 1P1NA 5H6RA 2GWRA 3JW4A 1V3FA 1B58A 4FX0A 1LAXA 4ETSA 3A09A 4N0BA 3DPLC 3GLXA 2JPBA 3GFLA 2AXLA 4R8HA 1ATGA 5DDGA 4KIFA 4MNUA 2OAZA 1IN7A 2Q2CA 4DXCA 3TCGA 1D8KA 4IO4A 2THIA 1UQWA 4WX9A 1U5TB 4NWCA 3U8QA 5CVRA 3KSXA 2NOOA 2H6BA 2QWWA 1MY4A 3HN0A 2AS5F 3HRSA 3P9IA 4H5GA 3N6UA 4H0WA 3TO7A 3MP1A 4YIIA 4X1DA 3SEXA 4WKMA 4O6JA 4EJVA 1WWXA 3F22A 4GXSB 1Y20A 4U0YA 1AIVA 2CFXA 3E5UA 4HYEA 3C35A 1SW4A 2EFOA 4EVIA 2XKPA 4ZEKA 4A0ZA 2Z9OA 4AQ4A 1B3EA 2H25A 3SXYA 5L3FA 1PBPA 3QPHA 3IHUA 5I2NB 1X3UA 1AWCA 1XN7A 1OIBA 4YFNF 2KJBA 3PPQA 3SEVA 4BHPA 2F78A 3FMRA 1YW8A 2EV5A 1REPC 5JFRA 5BUUA 5E1XA 1MPDA 3B73A 3RDIA 3MQ0A 1VTNC 4NF6A 4KIBA 1YW7A 1ONVA 2FRHA 3VLWA 5K5OA 4KN7X 3ELKA 2QL3A 1MXZA 5D6EA 4KPTA 1US4A 3FJMA 2QS2A 2I0BA 1NNTA 2UYFA 5I56A 1NKXA 3BKIB 3TELA 4DQ2A 5L3GA 4Q8RA 3KFMA 3C31A 4ZE8A 3ZMDA 1IXHA 2FNAA 5I58B 1XC1A 1ON1A 2L4AA 4DE8A 1ZGJA 4K3FA 5A2QK 4U22A 3OV8A 1DTGA 2BEOA 1SW2A 5H8FB 1ZTYA 4N9IA 3CR9A 1J9IA 1Y9UA 1Z05A 3DP7A 5DV5A 3FVOA 2ZMBA 4G8XA 3C1DA 3MWBA 2LKPA 4GRKA 3ZKKA 5EHMA 1YS7A 3PD8A 4GYGA 3JSOA 2Y7WA 3FWEA 1BIAA 2OBPA 3OELA 2W57A 3RTWB 1B7ZA 2EFQA 3QUFA 3FXQA 3K4UA 3V8XB 2DXRA 4HDVA 3CUOA 4F1UA 4YAHX 5LOMA 4A6EA 2ZKZA 3TDJA 2M30A 2DVZA 2EJRA 1YIOA 2RINA 3U9GA 2MBFA 2HKOA 1FPQA 3J7AO 5BWJA 2O68A 1XMKA 4PFWA 3MP6A 4JXIA 4NF6B 2O51A 1GHCA 2EFPA 1ODDA 3C34A 2MA3A 2PX1A 2RC8A 1B5JA 2FE3A 4YMBA 2O84X 2H4IA 1VR5A 3FZVA 2HDCA 4TQUQ 2W85A 3KZGA 3RJPA 4RYAA 1J0RA 4GGGA 3SDFA 2EFNA 3RTRA 3CTAA 1FZPB 2ANJA 2FMLA 4EUOA 2BBYA 3WE2A 4NF8A 4RB2C 4ENMA 4ISUA 3LSXA 4HLYA 4HS7A 1R6ZA 1B9NA 3T9HB 5HS8A 1MD0A 2PFBA 2P1SA 1Z6RA 4M71A 1QW0A 3S2VA 1QBJA 4HBLA 2OLBA 2DYXA 3I4PA 1II5A 5FD6A 2ZYNA 5E17F 1F4KA 3GXAA 3VOEA 1K79A 5HDGA 2O03A 3ZPLA 2F97A 5IKBA 1FP1D 4RS8A 4P55A 4KYDA 3T93B 5DD4A 1JEUA 3KLOA 3IKTA 2QQ9A 2PI0A 3BZ6A 1MDMB 3O6IA 1SD6A 4B09A 4KCCA 3K1NA 3FHZA 1SQYA 3OSRA 2DWJA 1LB2A 2K4JA 3N6TA 3PFIA 5AA2D 1JGSA 3FMQA 4EGZA 3QIMA 2D1HA 2RKHA 2F6PA 4BDRA 3F8FA 1TBXA 3HSRA 3G3HA 4YFXF 1EH7A 1QQIA 3FF5A 3TTMA 3WTYC 2M8EA 3HHGA 5HDKA 1ZN2A 1MDMA 1B32A 1G3SA 1N76A 1SFEA 3RI4A 4I62A 2HQ0A 1LBBA 1B46A 5L9MA 4RJZA 3T1BA 1LSTA 3RNNA 2DSFA 3LFKA 2VONA 1JNFA 3K6WA 3SEUA 5D4RA 3LQQA 2FYIA 2HOEA 4EGYA 2ZMEB 2RN7A 1Y3NA 5JI6A 2OA4A 4UVAA 3C33A 4LQ5A 4HLXA 1R23A 3ECHA 1O3TA 2FA7A 5DYMA 3TQLA 2OJTA 4KA4A 4OU0A 1XVYA 3F72A 2A61A 2E7WA 4BHBA 2ONSA 1JW5A 3K6UA 3ZMVA 1NFTA 4OFJA 2D21A 5CLSA 1M5EA 5CBRA 3TKDA 2G7HA 1O3RA 4ZEIA 1I5ZA 1PUEE 4BH9A 5LBQA 3HOSA 2F5FA 2FBKA 4POWA 1O63A 3F21A 3ZQ7A 4FORA 3I0TA 3E4RA 3IO6A 3GBBA 5ICGA 1G4DA 1T2KA 1YG2A 2VGQA 3LQRA 1BLFA 4G6QA 4ENKA 3E6MA 1URSA 3T9VA 4EQQA 4RB3C 1KA8A 3HRMA 3MWMA 2ISZA 3WAEA 1WVJA 4LMYA 1F9NA 5DUIA 5I58A 4UHTA 4GLIA 5KK1A 5JR3A 2CO5A 3WTTC 1JE8A 1IXIA 5I84A 1ZGAA 4DIGA 4F2OA 3MEXA 3GZGA 4FHTA 1S9TA 5ED4A 1FBSA 3V8JA 5BPIA 1IUYA 4JDFA 1PEBA 2QBYB 5BS6A 3KEQA 3LA3A 3NQOA 1XOCA 4JBZA 1OMIA 1TTYA 4ZYGA 3QAHA 3K01A 2LNBA 3GEZA 5FTHA 4G8HA 5L3CA 4RGRA 4A5MA 1SI0A 4Q47A 1RIOH 2DVCA 2PYYA 3O6HA 1QJMA 2ZNSA 5I2KA 1B9JA 2L01A 4H6DA 1URGA 4EQ7A 3V7CA 1WKMA 3EQLF 4GL0A 5M2VA 1FCKA 4P9UA 3TOBA 1B4ZA 5K2XA 4G77A 4F29A 5ICTA 4BDMA 3HRUA 1R1UA 1LLSA 4AIHA 2V25A 2Z8DA 4FECA 2L02A 4LVQA 3DV8A 2OZZA 2QZ8A 2EV6A 3QSLA 1FTMA 4RAYA 4ESXA 2JRTA 4P11A 2UVJA 4KR5A 3VB2A 2E7XA 1SMTA 5L9SA 1UTHA 4DZ1A 3C18A 1LAFE 5HLGA 4U4SA 1QNTA 2ZBKA 4QSEA 3E6CC 1IN8A 2Q89A 4LD5A 3ONMA 3VLVA 2HTJA 1MM7A 1T39A 4XLNF 4JBAA 2X7PA 3PV0E 1QGPA 5L8DA 2L4MA 2V6CA 2XKOA 3S9EA 3R61A 3MZ9A 4FE8A 4BAYA 4IRGA 4M73A 5HPQA 2YU3A 3HSEA 1UIUA 3RYPA 3H03A 3KE2A 1TNTA 1CGPA 2DK8A 3W6KB 2XAHA 4JWOA 2EB7A 4M1VA 3R0JA 4LZ7A 3ZP5A 3THIA 4ZZLA 3OENA 4UV8A 4ZZDA 5LHGA 3G3FA 1V4RA 3G3KA 4EM0B 4GL8A 1S3JA 4P96A 1T0FA 4F22A 1ZG5A 2GRVA 2PT1A 4WCGA 2DK5A 2I48A 3OO9A 4OWDA 5LEJA 4KN4X 4H0EA 3K0VA 2Z3YA 2F2EA 2RQPA 1MGTA 1MY3A 1ZRFA 4AVPA 4YKPA 2XHKA 2M5WA 1S7OA 3CO6C 1XCBA 2DLLA 2ZNZA 4NQWA 5HLHA 1N7XA 3FM5A 3T8RA 3O2AA 1B2HA 1ZLQA 5TPAA 1D3KA 1HSEA 3K6VA 3HHHA 2ZMEA 5ITOA 5LRRA 3TTKA 3IWFA 3DKWA 4PGHA 2GA2A 3VODA 1H43A 3G73A 1UFMA 1JEVA 2ZNTA 3L7WA 3T22A 3FXRA 2K7LA 3U1OA 1QO0D 1MQGA 3K1MA 2OQRA 1R00A 3K2DA 1T98A 4QHQA 2QJEA 4RNSA 3E5QA 4BQAA 4Z0IA 1BKAA 2Z8EA 2HAUA 4L9TA 4U88A 3H92A 4PFTA 2F34A 4L9NA 1KU3A 1WI9A 4JWXA 4GQOA 1OLAA 2WC2A 3T96B 1TXFA 3HV1A 2ZO4A 4IPAA 4UA8A 1Y4TA 3DP6A 4TOZA 5KDTA 1O57A 1I6QA 2QYOA 1W5SA 4U0WA 3HHFA 2R7DA 4CHUA 3QYTA 1BJAA 4LG0B 2GFEA 1VSOA 1R36A 3Q9SA 2FSWA 4HW8A 3PPPA 4Y15A 1DPUA 1KGSA 1NMUA 5AA1A 3K0LA 3TTRA 3I3VA 5KVRA 4I1DA 2XV4S 2ZXTA 2WV0A 3Q28A 1IEJA 2RF1A 1M5DA 4D0PA 1B5IA 5H8QA 2HQRA 3M3KA 3FXUA 2CSOA 2JPCA 2DE2A 1HKTA 4ZEDA 2P2AA 3TODA 2RCBA 1MKMA 3HIFA 2EA4A 4F3PA 5D8LB 4H8JA 2IRFG 3GF2A 3HSFA 5CVJA 3MFKA 2O7UA 3HSTA 1S7AA 4Q48A 3PU5A 2QRYA 4N6PA 3TPAA 2A68F 1USYE 4I02A 2PMHA 3IJOB 1IXCA 2X7QA 1OR7A 1URDA 3F8BA 4OIRF 1FY7A 1MQIA 1NNPA 4XSXF 1WQ2A 1ELJA 3TQWA 3IB0A 3RKYA 1IN6A 2HAVA 3C36A 2IA1A 4OYVA 4ESWA 1ZKBA 2EFWA 4DXUA 1ZIUA 1ZMGA 2XXXA 3E13X 3PUYE 1ZRCA 4L5JA 2K4BA 3I54A 3SZTA 1XVXA 3ROUA 1MDP1 4BDQA 3QRFF 2DWIA 2OQGA 2H09A 5JEIA 2VBZA 1OQHA 3L2CA 2MC3A 2JZYA 2DPUA 3I6VA 2PJPA 1PDAA 4ASNA 1S6LA 2P4WA 2CYYA 2OZ6A 4YFKF 4YKIA 5F7VA 3CG3A 4ENNA 4EF2A 1MQDA 2LAOA 1TFDA 3FMSA 2QS4A 1DSNA 4IO7A 4RB0A 5FLXZ 5JTYB 3DP4A 2XXRA 3GZ6A 3MZBA 1VE4A 3I59B 5DCFA 5LEKA 1FBQA 2IT0A 4XTCQ 1MY0A 3W9WA 4PGGA 4DLDA 3V83A 4QLCU 4NHJA 3ISPA 4LZ8A 4R73A 4HV6A 3WU1B 4BXUA 1UCRA 2UZKA 2GXGA 1CB6A 2XXQA 4LA9A 5H8NA 5ICFA 1J2XA 2MLKA 4LB6B 5EHSA 1JVYA 3G3JA 1P1QA 1XT8A 3WAFA 4LATA 4M6YA 4KNYA 4HA8A 2QSXA 1WSUA 2H94A 3ERED 3TEPA 3E9XA 2Z99A 3WG9A 3TOAA 1P1OA 3V5AA 3COAC 3IOUA 4YU0A 1O7LA 5JVTA 4AB5A 3FASA 4YB5A 4PCQA 4I7HA 3J81K 2D45A 3MPKA 5L3DA 2ADUA 4IJAA 3PQKA 1O3QA 3GO5A 2X0LA 5DVFA 3KP2A 2F8DA 1TLHB 4LK0F 1LDJA 3IK6B 4H5FA 1ZU0A 3N26A 2KJCA 1NL5A 3T9UA 3I64A 2Y0MA 1I6XA 5FO5A 5J6XA 4FIMA 4OEVA 5K2YA 1MPBA 1US5A 2G7UA 1Y0UA 2RDPA 3LSTA 1XCVA 2DT5A 4QF9A 3MZHA 2ZYOA 4KYEA 4NF4B 2XXWA 1A04A 3JTHA 4DDDA 4HW0A 1RNLA 4CO8A 1OYWA 3UORA 1FT9A 5F1RA 3F6OA 4L0YB 3F6VA 2XGXA 1LEAA 3GFMA 3MPLA 2F5DA 1PBQA 1ZBMA 5L3BA 2R3SA 5D4SA 4ZE9A 3LAPA 1G3WA 3Q9VA 4EMSA 3LSFB 3MQ9A 5J8CA 1U78A 4NTLA 4F3GA 3IJXB 5E8IA 3BROA 5ERIA 4YG2F 1KQ0A 3FUZA 2CG4A 2OWTA 1GTKA 4U23A 3MCZA 2F7CA 3IB2A 2XD3A 1NH7A 3KP3A 4HZFA 4HOBA 2REJA 3IO4A 4FEBA 3H6VA 2DU9A 3PUXE 2AL4A 1QZYA 3RTFB 1G6NA 4G68C 4KMUX 1PP7U 3KGCA 5HBCA 3M9AA 4OTEA 1TFAA 1LDKB 1ZH5A 1P4XA 3S4UA 4CYDA 3IAZA 4WEDA 4M6XA 4HX7A 1TQPA 1P1WA 4F2QA 2P6TA 3DF8A 4IO2A 1FYKA 1T0KA 5LGUA 5FLXK 2G29A 5CMMA 2RC4A 2YPRA 5EEGA 2J5PA 1D9YA 3R6UA 4QFNA 3KP4A 4U4XA 5IAIA 3JTGA 4M9XA 3ZN1A 2F35A 1R1VA 4MBPA 2I3WA 4N9HA 3MZ1A 1TW2A 1BC7C 1XSXA 1KWHA 2AL5A 1Z91A 4BDNA 3MVXA 4MTDA 2O6AA 1LJ9A 2VOOA 1N0TA 2R9JA 3L9FA 4POXA 2PT2A 2VE8A 1LQ1A 3TDUC 3KJ7A 2P0SA 1QUKA 1AMFA 5BQTA 5FTIA 2YSRA 1SYIA 1TNSA 5LLQA 2Y84A 2MH2A 4L17A 4C1UA 2HQNA 5LRSA 3CI8A 2DP8A 2W7YA 3F11A 4OETA 1UTBB 5F1QA 1J5YA 4IB2A 2ETHA 4HF1A 3ZSFA 1D3YA 3R4KA 3FVKA 1H45A 2KRFA 2FBHA 1YPNA 3MW0A 3EETA 4LB5A 5CC2A 1PP8F 1LFGA 1P2FA 4IO5A 2LF7A 2H27A 4KIGA 1OLCA 4R2BA 2A3SA 4R6KA 3UP9A 1YYVA 1YO5C 4OINF 1OMPA 2F7AA 3LR1A 2V79A 2ACJA 3P7NA 3OD7A 2YPNA 1M5BA 2BJJX 1DP7P 3PMVA 3IC7A 1O7FA 2XASA 4E70A 1GR2A 1HXDA 3IWZA 1N7WA 1QUJA 3TCHA 2E1NA 2P5VA 4BLAA 2Z33A 3GYHX 4QFOA 3DEUA 1A40A 4N13A 3O2PE 1RYXA 3MJNA 2XAFA 1BBYA 3H06B 3KLNA 1Y3QA 3JSPA 3E97A 5AA4A 5DTBA 4IHSA 5LGTA 2F5XA 4EV0A 3OSQA 3TAJA 5L3EA 2RGVA 4G4PA 4EM1A 2P5LC 4IO6A 1PDNC 4G94A 3ZMTA 4WK8F 5BMZA 1OYIA 3WTSC 3O66A 3Q29A 1MH4A 1LNWA 4Z2YA 4I0AA 2HZTA 3LC8A 3Q26A 2FF4A 2KIFA 2V9VA 3T0YA 4HX4A 1XGNA 1B3HA 1HKQA 1ZAOA 4IRIA 1B9MA 2DAOA 1Z7ME 1ZJLA 3RPQA 3EQ1A 3VXBA 4GF8A 2BE5F 3WGGA 4Y17A 5B7DA 3JZJA 2DQRA 1KU9A 1MPCA 3BBRA 1M5CA 3KP6A 3KZZA 4IO3A 2CWEA 3OEMA 2ZYMA 5E18F 3LAJA 3I58A 3LUYA 4H8IA 3GZ5A 2DOJA 2UVIA 4NF4A 1QKBA 2ONKE 5KZTA 1A8FA 1B1BA 4RK9A 1FTLA 1BTJA 2RC9A 4RA1A 2ZXJA 4XKNA 1AOYA 4XSZF 3MAMA 4M72A 2Q9TA 4M9ZA 1H0MA 2A6HF 4A0YA 5CVUA 3HTSB 4HCYA 3V7RA 5E8GA 5H6QA 1UTHB 1FBUA 1EZ9A 3V4GA 2Q0OA 5CM6A 4QRZA 3RYRA 4FAJA 4KT5C 4OFLA 3RY3A 1NNKA 2H98A 3KN7A 2XAJA 2IEEA 3E3KA 3RQTA 1AOVA 3ZMSA 5K1YA 3N5LA 4OENA 4E0WA 4PZJA 2DW4A 2OCUA 2KKOA 2REGA 3BJAA 3DPTA 5KDTB 5ICCA 3QUJA 3O6BB 4EJUA 5E1ZB 3SESA 4NMYA 4RPOA 3SERA 2I49A 2PEXA 2FOKA 4RPNA 1VFEA 3FV2A 2GZWA 1T6SA 4HX8A 4K2EA 2Q2AA 3FM3A 1OYYA 1S8NA 1R5GA 2OZUA 3SQNA 4F1YA 2QVOA 1HW5A 1SI1A 4BNCA 3A3UA 3Q25A 1SW5A 1QZZA 4P9FA 4O3CA 1BC8C 2F36A 3ABUA 1GVJA 3JYRA 1JW4A 1I6BA 3MUQA 4RAZA 4JQFA 1YTVA 4GO1A 3L6GA 4JB7A 4ZH4F 4F1VA 2FMYA 1B3GA 3HUGA 3P9CA 2EA2A 2Y7IA 4X1BA 1MQJA 5J1DA 3KZYA 4LGWA 2W25A 1P99A 2FU4A 1YCJA 4O3MA 3HO7A 3O28A 4FEDA 4RXLA 3MVWA 3SZPA 2JT1A 5E1WA 1FYLA 3BWGA 3VVFA 4JWYA 2DWAA 1LB8A 4U1OA 3V8KA 3WU0A 2QS1A 5D5XB 2GH9A 4Z7EA 1B5HA 2R71A 5EEHA 1JVXA 3J80K 1FSEA 5H8QB 2HZKA 1DTZA 1D9VA 4FT8A 1HKSA 4R9GA 5AONA 3LSLA 3CG1A 3F3XA 1O3SA 2BV6A 5IT9K 4G9YA 2A5SA 5ITPA 2G9WA 3PUWE 1G3YA 2ZNYA 5TU0A 2Z8FA 3KOSA 2PQ8A 1IN5A 4NE4A 2WKYA 4R72A 2O69A 3GXOA 3HRTA 3WGIA 1B6HA 3IKVA 2Y7RA 2G93A 4WF2A 1R22A 5F64A 2YX4A 4EJOA 4AWXB 2XX7A 3GW2A 4G2ZA 2V1DA 2FNCA 3R0AA 4LQ2A 5CJ9A 3W6JB 2VBXA 1LCFA 1TW3A 2Z22A 3WE3A 2O0YA 3BFUA 4P0IA 1B1XA 3KBRA 2EWNA 4R6HA 4FJPA 3K9TA 5DEQA 5HVQC 3F23A 1H44A 1I27A 5FB2A 4OERA 2EV0A 1YLFA 1U2WA 2PBWA 1FC3A 1FQBA 2XRNA 1EU8A 3C7JA 3TO9A 3S9NC 2BGCA 2DQLA 5DCMB 1DPRA 3IB1A 2QUFA 1HBXG 5HLIA 5TJJA 1USYH 1FQDA 1B0LA 2XXHA 1AL3A 2VT3A 3B6QA 3P9KA 3IR1A 3D5LA 3OOAA 2Y7KA 5D6FA 3QP6A 5ILUA 1LVAA 2C6YA 5K5QA 1NNFA 1MH3A 2HEOA 1CF7A 3A3CA 3OOPA 4EF1A 4JSDA 2BYVE 2LDUA 4NF5A 4UUVA 1B52A 3WTVC 4EXKA 3AAFA 4KYWA 2F6GA 3I71A 5TP9B 2RCAA 3DXJF 3PQJA 2RKMA 4QFPA 1YQAA 5LGNA 3QU6A 2I4CA 2PMUA 4KMFA 2E1SA 4HTGA 2HEUA 4ELPA 1TQMA 1B1HA 1FP2A 2ABHA 1XDUA 2KLFA 5LHHA 3LBSA 3IX1A 3TKYA 4O3BA 4PE5B 2UXNA 1BIBA 1SYHA 4UNOA 5I57B 6PAXA 2CZLA 1YW9A 5K5RA 2GQQA 1GV8A 3BPVA 4I9DA 3VDFA 5DYHA 5FHOA 2CW0F 3ECOA 4NEDA 4G7HF 2VD3A 1MRPA 1BI2A 3V89B 4L9JA 1SW1A 2XXUA 4U7BA 1JW1A 3DM0A 4JSOA 1TQIA 2NUVA 5CMBA 1B7HA 2XAGA 4RGUA 2UWMA 3RKWA 3OXNA 1G3TA 3MBPA 4WWCA 5ICEA 5H8SA 1EV7A 4N07A 4I98B 1SFUA 2M8CA 5H8HA 3I53A 1IAWA 2ZFWA 2NAZA 1POTA 3BJ6A 3K69A 2XXTA 5HOOA 4CZZA 4F18A 4M74A 1FLIA 2IA0A 1MG1A 2OU2A 1WRJA 2VN2A 5CYVA 2O1MA 3EHTA 3PD9A 3HOTA 1OPCA 4BDOA 3FJ7A 4Q5TA 4ENJA 3EPEA 2E1CA 5A2QZ 3VFJA 4WEPA 2O8XA 4U1ZA 2F5CA 3VE1B 4QSCA 1KU2A 3UN6A 5D5UB 1U6GA 4QSDA 3WTXC 4GOTA 1XGSA 5BPDA 2PN6A 1JHFA 2NNYA 4MQVA 2DI3A 1BM9A 3VFZA 2MLGA 2DE3A 2J5OA 3H3ZA 4I8CA 4YB6A 4RB1A 1POY1 4R74A 2RV8A 2OWSA 1LEBA 4GXOA 5E20A 1LBCA 2ISYA 2R7FA 1A7LA 3TYHA 1SD3A 3V7SA 1D8JA 3U72A 1FTJA 4IGTA 3CUQA 1U8RA 1HSLA 3T9XB 1FQEA 1XGOA 1Y3PA 4ESBA 3EYIA 3SHFA 2D3IA 1RUNA 4AIJA 4EDPA 1IRGA 5CMCA 4OIPF 4U2RA 4ZEBA 4MH5A 1KYZA 3REOA 3L00A 2NWJA 1MXVA 3TTNA 3ODBA 2NYXA 3G7WA 3JV9A 2TDXA 1CE2A 1UB9A 2Y48A 4EJWA 1Y1ZA 3KFWX 3UGWA 4YKKA 4FX4A 2M87A 4OHNA 4MLVA 3CUQB 1ZLJA 3O3KA 5JK4A 3QAXA 3SEWA 1H9TA 1L0OC 3H4ZA 4XKRA 1RKMA 4EM2A 3ABTA 3M8FA 2YLNA 4QFKA 1EZOA 2XIGA 4BYYA 3EHSA 3U1DA 3D4GA 3QPTA 1K7AA 1A54A 1Q35A 3RIRA 2Q8KA 1HW2A 5J8FA 2B3BA 2EK5A 1XD7A 2XUBA 1B4HA 2H9BA 4ZECA 3P7IA 3H3GA 3CFLA 1EH8A 4WXCA 4S04A 1U5TC 1ZG1A 2YX7A 2DWHA 2GA1A 4EJTA 3MP8A 4IGRA 5FHMA 2L54A 5ISUA 2FXAA 3PMXA 3RKXA 1R58A 4R2FA 4ZEFA 3CFZA 3W15C 2Z5UA 2QQAA 1USTA 3TUSA 4OIOF 5D5VB 2ZJ2A 2K02A 1T38A 5AA2B 2OBGA 4I09A 2FNPA 4YKJA 4F19A 4ELRA 4MEYF 1FQCA 3TDZC 1N3WA 3C3WA 3GUDA 2R6GE 2ZNUA 1FQAA 2IPQX 3ZMUA 2F7BA 3T66A 1UHMA 3E5XA 1KQ9A 3O29A 4NF5B 3E6BA 2P7VB 1B40A 4IRHA 2CQKA 4KQPA 2A5TB 1SAXA 1FTOA 1I1SA 1KQ8A 5EYFA 4O5VA 3TCFA 4Q0CA 2O7IA 3FV1A 4OFOA 1B6AA 2ESNA 3M8EA 3NEUA 4G8MA 4F39A 1B05A 2XX8A 1FQFA 3V8LA 5DVJA 1H76A 3D4CA 3GFIA 4HQEA 1FW0A 1QUIA 1R9LA 1N04A 1OVTA 2FEZA 1O7TA 1IW7F 5DEXB 2VC1A 4AD9A 2E0SA 3K00A 4OQOA 4ZDMA 2HZLA 4DCYA 2IA2A 2KIMA 4MTEA 1ANFA 3PUVE 3F8NA 1ZHFA 4OMYA 3MC2A 5AA3A 5AE4A 3B02A 1LFHA 2HGCA 3S9MC 1K78B 4RK2A 2GAUA 1KYWA 3BJOA 1OQGA 2H99A 4KHZE 1MXWA 4OIQF 4IY5A 3ML6A 2PMSA 4A5NA 4MEXF 5HDNA 2DBBA 1MJAA 3ILTB 3DFGA 3EUHA 5I57A 1QVSA 1BI3A 3U92A 2VD2A 5FFZA 4XXUA 1MDQA 4NF8B 1XB4A 1HW1A 4UVBA 3IL1B 1W5TA 1LB9A 1MM6A 2VBWA 3EN3A 4A2UA 4KUMA 4CXFA 3HTUA 2UVHA 2V3TA 4ELOA 1IIWA 2A69F 3BDDA 1N3XA 4LLGF 4HF0A 3B6WA 1ON2A 1DPPA 4LUBA 5AIQA 1K78A 4NB5A 3RT8A 3G3ZA 1W4MA 2DQVA 3ZKLA 1Z7UA 4LZ5A 1SD5A 1KU7A 4XRFA 2UXAA 1BP5A 4Y13A 3BPXA 1JQFA 3IRQA 1A55A 4F7ZA 3ZN0A 2V1XA 2UXXA 5D8KB 1XDSA 4A0XA 4ECFA 5DUKA 3KSJA 3BY6A 1DPEA 5F6FA 2V84A 2ZCWA 4EXLA 4U0VA 3PGFA 4KFQA 4G68A 4LONB 2AIXA 1MXYA 5D5WB 3C32A 4G8NA 1IRFA 5HS9A 4CDGA 1Y1MA 4LLNA 3VVEA 3R6SA 1CF7B 3TGNA 1L3LA 4DNCA 4PP0A 3KETA 1XSVA 1JXSA 4LLLA 5H20A 2A6EF 4FATA 1B51A 4KD5A 3SFZA 2Q8JA 1PB8A 1B3LA 2V3UA 3UK4A 2VP1A 5B70A 5TPAB 1LAHE 3J81Z 5FFXA 3IOTA 4IY6A 3QU3A 1Z9CA 2B3FA 2AYSA 1N84A 3GLBA 3RLFE 4H1XA 2HS5A 4UVCA 3U94A 4RGSA 3GVAA 4OXVA 3VVDA 4BDLA 1UHWA 5IT3A 4OESA 1A8EA 1DMBA 3IORA 2NXOA 1ZG3A 3K1PA 3QOPA 1GXQA 2B0LA 2NVUB 3SETA 2VOZA 2Y75A 1BIYA 2P8TA 3TFLA 3ILUB 4HF2A 1K6OA 3EF7A 5CVVA 4ZZAA 4OZ9A 3K02A 1SDXA 3N94A 2OK2A 1DUXC 1HQCA 3ULQB 3DLNA 3HCQA 1VFDA 4R79A 2PVUA 4HV5A 2GHAA 4WXDA 2NNNA 4L18B 1LGBC 2Y7PA 1B4AA 2V3QA 2D5WA 1OVBA 3F8MA 5I2NA 4KCDA 1YS6A 1FYMA 5CVIA 3IL2A 4GCVA 4PFUA 2P6SA 4GXAA 3KG2A 1YTYA 3WTZA 1R1NA 3H7MA 2LF8A 4M9SA 2QMWA 4KI0E 2QBYA 1W7PD 3B7DA 3L09A 4I0BA 3RGYA 4R9FA 1UIVA 3Q5FA 3FIRA 1BI1A 2HFBA 4OVJA 4R75A 3OO8A 5I2KB 2NS0A 1QKAA 3R60A 2JTVA 4IHTA 4ESJA 3IOWA 1B3FA 2XAQA 5FGMA 4GIZA 4DCXA 3W9VA 4ZZEA 3FATA 4YIFA 1XHYA 2I3VA 4EQBA 1JETA 4F3BA 2HTSA 3H6UA 3RPUA 4ON0A 4L9VA 1R7JA 2DFIA 1UTBA 4X48A 2UVGA 3N97A 1ZLKA 5CRYA 5DCMA 1D4NA 3PMWA 5DD8A 1ZRDA 2F5EA 4HQMA 1RYOA 4OMBA 1LAGE 2VODA 2XD2A 2W84A 2XXYA 1P92A 1MS7A 4QFLA 2XVCA 1MXUA 1MZBA 3R7XA 3BOQA 2ALUA 2FA5A 4A12A 1OKRA 4LP2B 2WWYA 2VXZA 5A5XB 3J80Z 2QMXA 3B6TA 4C0RA 3M3LA 5HS7A 2LSOA 1I1GA 4C1TA 4ZYHA 4XIGQ 4H65A 2QM3A 4CICA 2QPQA 3M1EA 2M1BA 1IN4A 1DOTA 4ZYDA 2XXPA 5CBSA 3RT6B 3LA2A 3KP7A 4G7OF 1PC3A 4JK1X 4H67A 1E2XA 4EQ9A 2PLYA 1J59A 2A07F 4GD5A 1C0WA 4KYSA 3VXCA 4UACA 2I6EA 3WODF 1IXSB 4MF3A 2P7CB 3TMGA 4U21A 4PFYA 2YJPA 4YICA 3GWZA 3CO7C 1NH8A 4MLQA 1SD4A 3VEPA 4P0GA 5FD5A 1HSTA 3HYIA 2X26A 3DP8A 2DPDA 5LHIA 4L0ZB 3S2WA 4DXBA 5AA4B 2HR3A 4NWDA 1TWYA 4AIKA 1NHAA 1B0HA 3FJGA 2GXBA 4LK1F 2XXVA 5ELVA 2QLZA 3H6WA 4G7ZF 2ZYKA 1P6RA 1EH3A 1HSJA 2HFHA 4XKQA 1J75A 3O6GA 4L5IA 4YB7A 4B8XA 2VBYA 4UV9A 2VC0A 5H8HB 1I6AA 3CSGA 5BOXA 4R6YA 2VT2A 3LWFA 1BOAA 1IUDA 3L6HA 5FHNA 3OMBA 2RNJA 4UXNA 1U3EM 1R9QA 2A5TA 2MD5A 2HKXA 3D0SA 3G3GA 3SKPA 4LJZF 5A5XA 3VLUA 1QULA 3R26A 3KP5A 3K6XA 3H6TA 4LFUA 1S7YA 5I59A 4CGZA 2QQBA 3GFJA 4LG0A 4U7DA 2RC7A 3O9PA 5TRDA 1Q1HA 4PQJA 1EH6A 3CLOA 1XS5A 3KJTA 1TT1A 3FVGA 2X4HA 2K86A 1MY2A 2PG4A 2HCAA 1JHHA 2D2WA 1QPMA 2I0CA 1MXXA 3EHUA 2HYGD 3U2RA 1R5HA 5ICQA 1F9BA 3M7GA 3H3UA 3C9HA 4HCWA 1H9GA 2JSCA 3EDPA 3CFXA 2DE4A 5KCJB 4BHCA 3EYYA 3T5XA 1Z7NE 4A6DA 4ND9A 4WXHA 2H5YA 1E17A 2L3DA 2ESHA 1M5FA 1U5TA 1B59A 1XMAA 4TLLB 4PDKA 1GVCA 1FTKA 3G3IA 3QK6A
chains in the Genus database with same CATH superfamily
3TAJA 2GHBA 3WTWC 2I58A 2DA4A 5ILVA 2B4MA 4E6KG 1IXRC 2V4CA 1ETXA 4RMNA 1FWZA 1RI7A 2CMOA 2O1LA 1G0HA 4GFRA 1VQPI 5CMKA 5CI5A 1RUOA 5ILSA 3S9LC 2KL4A 2WTEA 5JHUA 1JT0A 1AKHB 1L5TA 4H45A 4XL9A 2BY2A 1T33A 1IQ7A 3LSWA 4THIA 1RPWA 1AH5A 3K2ZA 4HDUA 4XN3A 1FBCA 3GBGA 3KEOA 2IP2A 3I5UA 1Q1VA 3I5OA 2DDAA 4MFDA 4OOIA 1JJ6C 1A35A 5TGTA 3MVYA 4IVNA 4QWQA 4KDPA 4PBHA 4X9TA 1H3DA 2KIUA 2FBIA 1MJBA 2ID6A 2YR2A 3QP5A 5AA2A 4KICA 2E35A 2A5YB 4IXAA 3ECRA 4GYIA 1USSA 1PB9A 4E0XA 4RGXA 2V1UA 2STTA 3WTUC 1W7PB 3CCUI 2O61A 2B65A 3BR6A 4A3KJ 4G68B 5IT9Z 4Y7NJ 4XBFA 1JTXA 4C3IJ 1GGGA 5L9OA 4ZS9A 4JOMA 4ELQA 2L7FP 3KOTA 3HPIA 1RZ4A 3DQVC 4TLMB 3ZQHA 4N17A 3BP8A 3FD3A 4TV7A 4GWZA 2ELHA 3PPNA 3Q27A 3CDHA 1SD7A 2Q2EA 1ENHA 2XHDA 2XROA 1KZHA 1I69A 1YAEA 2DXYA 1LFIA 2UYEA 3CIJA 3CVGA 3IRRA 4OVQA 4PF8A 2DS9A 3K7AJ 5DT6A 2BY3A 5ET7A 3ZMZA 2D1VA 2MH9A 4ZYEA 4I3YA 5FROA 5JVGF 1K6YA 5AIPA 5JTYA 1LBVA 4M3DA 1IF1A 2VE9A 4I2OA 1MNMC 2HYFA 1GXPA 2WX9A 1Z1DA 2B63J 2HNHA 3NRVA 4PDHA 3CJNA 3OR1C 4AS4A 5I56B 2DTZA 3I56I 1S50A 2R7VA 5DEXA 5KCJA 1YFHA 3TQNA 1STZA 1LBZA 4HPQA 1UG0A 2OD5A 2FVZA 1P4AA 1Q1KA 1FSHA 4FBPA 1LKXA 2YUSA 3FX3A 3RPWA 3BTLA 3OYHA 4KFCA 3TZAA 2VOPA 3IV5A 5H8NB 5BNGA 1FX7A 3FVNA 3O97A 3JAMZ 2CJJA 1B72B 4WXJA 3E3VA 3WGHA 2OCCH 3J7AY 3I59A 1A99A 1FPGA 3MAJA 2DYSH 5B1AH 3DELB 2KT0A 2NXNB 1SFXA 4O3AA 4Q5SF 2VKVA 4N15A 1F5TA 1BN5A 3U93A 2IW5A 1DDNA 3F8CA 1IITA 3CUQC 2IS2A 1FPEA 3JRHA 4M4GA 5DVIA 1ZYRF 3BLYA 1HCRA 5IP6A 1XGMA 2QCOA 2PBIA 1LPQA 2FQ3A 3GTQJ 2I4BA 3MVZA 3PUZE 4GVOA 4PETA 1MQHA 2L9SA 3K4BA 2R7SA 1O64A 1WODA 1SBPA 2EIJH 2P5KA 2WY8Q 2V93A 3AXFA 3OO7A 1TWGJ 3E6DA 4YZZA 3PPOA 2XPUA 2COBA 4PC9A 4R1HA 2QS3A 1MJ9A 1P1UA 4MHGA 4BS9A 2DO7A 4MIMA 5H8FA 4GWXA 3CRBA 2GLOA 3SEYA 1I3QJ 1SMYF 2M45A 2Y2ZA 1J1NA 2K27A 1SVMA 1Y4CA 2P3VA 1PB7A 1J7KA 1W7PA 1VZ0A 3KEIA 3VV5A 1IRZA 2XXIA 2LFBA 2F48A 3AG4H 1LCTA 3T8TA 3BQZA 1BI0A 5J4VA 4IR8A 3KN3A 2ZJPF 3MMYB 3PPRA 2H6CA 1S29A 1ZARA 3GMEA 1F1ZA 4RAFA 1LE8B 3C2HA 3OYAA 4MFIA 4BY7J 2HWVA 2IA4A 3CSBA 2XX9A 2RVCA 2E1MC 3NWSA 2R8TA 3OO6A 3BFTA 1EZPA 3GX4X 3S17J 4KT6A 4I3EA 1N75A 1OFCX 2W24A 4HSRA 2JJ7A 4OMZA 5FKKA 2QENA 4MQ9F 3M3FA 1FNNA 3M8UA 1EA3A 3LMMA 2HXWA 1WDNA 4I01A 2A5WA 1P4WA 3MZYA 3N4MA 1TT0A 2M34A 2VASA 4ESFA 4AB6A 4JYKA 3LL7A 2R7TA 2O8KA 5J1RA 5I59B 2V7FA 3FK7A 2W82A 1GLNA 1XTAA 1EYJA 1IMEA 4IL6C 3QXMA 5F08A 3LA7A 2IVMA 1JT6A 4ONYA 3UNGC 5TP9A 2STWA 4F3SA 4Q4ZF 1Z3XA 1XSDA 1EKEA 3SDBA 1OR7C 3S2HJ 2LY2A 1D5VA 4Q30B 1X4PA 3UA8A 2E60A 1IXGA 2DJIA 3TO6A 1ZREA 3TBIA 2E2JJ 2VHAA 4OVSA 2XXKA 2COMA 3MKYB 1SVXB 1ULYA 2IJLA 3KN8A 1Y8QB 1E3OC 2IS1A 4OEUA 4PDDA 3TTLA 4S05A 5HM4B 2E5ZA 2Z23A 3RUMA 3KCCA 4XOTA 3IAM2 4CCKA 4XKPA 3RN8A 2R92J 1DU0A 3C4MA 4BXXJ 2Q88A 2KISA 1SANA 2HPMA 4P5OA 2ONRA 2Y69H 3OEKA 1LDDA 4RY1A 1R1TA 2M7AA 4HSTA 3JAMK 2DA2A 4F31B 2PMZA 1MY1A 3USDA 1B7UA 3ZS6A 2BZTA 1HDPA 3RKQA 1IZ1A 4GWOA 3FGSA 1K83J 4HAMA 2A6TA 4MGRA 4YMAA 3SEZA 1OJLA 2GIVA 2Y30A 3S1RJ 1FBGA 2DTRA 3GBAA 4MNPA 4NQWB 2CGPA 2QVUA 3UIFA 4XLPF 2O3FA 2NRAC 5I2KB 1Z6TA 4G6DA 4AUXA 2O6GE 3I4MJ 3IOVA 4IF4A 3WHCA 1GDTA 1FOKA 3DTEA 4XKVA 1P1NA 1MNEA 2GWRA 5H6RA 3HJEA 3JW4A 3OSGA 1V3FA 1B58A 2VPNA 1KONA 4FX0A 4GFBA 3SJMA 1LAXA 4ETSA 2H1KA 3A09A 4N0BA 3DPLC 5EF6A 3GLXA 2JPBA 3GFLA 4GDFA 2AXLA 3PL8A 3ERMA 4R8HA 3HM5A 2L7MP 4BGDA 5DDGA 4KIFA 1ATGA 4XEQA 4MNUA 5J1UA 4JBZA 2OAZA 1IN7A 1V5FA 2L9RA 3A01A 2Q2CA 3TCGA 4DXCA 1D8KA 4ABZA 3IFAA 4IO4A 2THIA 2DCEA 1UQWA 4WX9A 1U5TB 4BDZA 4NWCA 3U8QA 4AC0A 2GOMA 3JRIA 1VNDA 3B6CA 1VDWA 2O9LA 5CVRA 3KSXA 4E7LA 2NOOA 2H6BA 2QWWA 1MY4A 3HN0A 3CDLA 3HRSA 3P9IA 2AS5F 4H5GA 3N6UA 3KEYA 2EH3A 2XB5A 3TO7A 4H0WA 3MP1A 4P9KA 4YIIA 4X1DA 1JP4A 3SEXA 4WKMA 4M3BA 2DFHA 3HC7A 4O6JA 4DYRA 4EJVA 3OYEA 1WWXA 4PSWA 3F22A 4GXSB 3VSKA 1Y20A 4U0YA 1AIVA 2CFXA 1SEUA 2DN0A 1EJ9A 3E5UA 4HYEA 3WHBA 4J19A 4LG3A 1HA8A 5C4XJ 3C35A 4MX6A 2P81A 1SW4A 2EFOA 2R0QC 2EZIA 4EVIA 2IGOA 2XKPA 4A93J 4ZEKA 4A0ZA 2Z9OA 4AQ4A 1B3EA 2H25A 3SXYA 5L3FA 1JI8A 1FPKA 1NV5A 3QPHA 3IHUA 1PBPA 5I2NB 3W2WA 3JCUC 1X3UA 1AWCA 1XN7A 1BR2A 1OIBA 4YFNF 2KJBA 1ETOA 2M7BA 3PPQA 3SEVA 2DT7B 4BHPA 1ITYA 2F78A 3FMRA 1YW8A 1PUFB 3S16J 3MKWB 2EV5A 1REPC 3B8BA 5JFRA 5BUUA 5E1XA 1MPDA 3B73A 2VQGA 3MQ0A 3RDIA 1VTNC 3S1QJ 1MMSA 4NF6A 4KIBA 1YW7A 3PTYA 1ONVA 4BXFA 3LUZA 2FRHA 3VLWA 1E3PA 2RQQA 5K5OA 4BBSJ 4KN7X 3ELKA 2QL3A 1MXZA 1BL0A 1QPIA 5D6EA 3IH4A 4KPTA 3M4OJ 2FJ1A 1BW5A 1US4A 3FJMA 2MGQA 2QS2A 4XRSA 2I0BA 1NNTA 2UYFA 5I56A 1NKXA 4LITA 1HOMA 3BKIB 3TELA 4DQ2A 5L3GA 4Q8RA 2OC6A 3KFMA 4II2A 1LEVA 4ZTJA 3B50A 3IUOA 3C31A 4ZE8A 3ZMDA 1IXHA 5FBPA 2XB0X 2FNAA 5I58B 1XC1A 1ON1A 2L4AA 4DE8A 1ZGJA 4PJMA 3A29A 4K3FA 5A2QK 4U22A 3OV8A 1DTGA 2K9LA 2BEOA 1SW2A 3GTJJ 1IG7A 5H8FB 4PUSA 1ZTYA 1S9HA 4N9IA 3CR9A 3JRFA 1J9IA 1Y9UA 3FXLA 2KDZA 1Z05A 3DP7A 5DV5A 3FVOA 2E34A 3CZ6A 1ERDA 4CZCA 3D5SC 2ZMBA 3DU5A 4G8XA 3K4KA 3IFCA 3C1DA 3MWBA 2LKPA 2X9DA 4GRKA 3ZKKA 1NTCA 2LH9A 4NUBA 2HOTA 4Y33A 3BG9A 5F0CA 1XS9A 3K4NA 2V9PA 1YS7A 1NV1A 3PD8A 4GYGA 3JSOA 2R7XA 2Y7WA 3FWEA 1BIAA 2OBPA 3CC7I 3D5RC 4NGUA 3OELA 3QMFA 2W57A 1FOWA 3RTWB 1YRNA 1B7ZA 2EFQA 3F9KA 5IOYA 3QUFA 3FXQA 3N05A 3OYBA 3SZGA 3K4UA 2DXRA 1DP3A 3V8XB 1K9ZA 4HDVA 3CUOA 2YS9A 4XK4A 4YAHX 4F1UA 5LOMA 4A6EA 2ZKZA 2XF5A 3TDJA 2M30A 2DVZA 2EJRA 1YIOA 1H89C 2RINA 3U9GA 2K9NA 2MBFA 1ZKGA 2HKOA 1FPQA 3FXKA 4FE4A 3J7AO 3MVPA 1FPIA 5BWJA 2XDVA 2O68A 1XMKA 4PFWA 3MP6A 4JXIA 3OYDA 2CEYA 2O51A 4NF6B 3NAUA 1GHCA 2EFPA 4XKBA 4UUSB 4RM3A 1MBEA 1YJWI 4UABA 5FRMA 1ODDA 3C34A 2MA3A 3I55I 2PX1A 2RC8A 1B5JA 5JLXA 2FE3A 1YZ0A 1FJ9A 2W1OA 2O84X 2H4IA 1VR5A 4YMBA 3FZVA 2HDCA 4TQUQ 2W85A 1R4MB 3RJPA 3KZGA 4RYAA 4P47A 3H03A 3UR3C 1J0RA 4GGGA 1T8IA 1H88C 4MO7A 4GX3A 3SDFA 3L2WA 2EFNA 2LY1A 2BVLA 3RTRA 1X19A 3CTAA 1FZPB 1VQLI 2ANJA 3KZIC 5T3JA 2FMLA 2GBYA 2JA2A 4EUOA 2BBYA 5FKOA 4FTHA 3WE2A 4NF8A 4RB2C 4ENMA 4ISUA 3LSXA 4HLYA 4HS7A 1R6ZA 1B9NA 3T9HB 5HS8A 1MD0A 2PFBA 2ZXHA 2P1SA 2P3NA 2AXTC 4MCOA 2XF7A 4NHBA 1Z6RA 4M71A 1QW0A 3S2VA 2NOJB 4HBLA 1QBJA 1VQ7I 2OLBA 2DYXA 3I4PA 1II5A 2CW8A 5FD6A 2ZYNA 5E17F 3H1CA 4HE2A 1F4KA 4GBWA 3GXAA 5KCMA 1N78A 3VOEA 1K79A 5HDGA 1V5EA 5B5EC 2O03A 1YITI 2KR0A 3ZPLA 2F97A 5IKBA 4CCNA 1FP1D 3OIQA 4P55A 4RS8A 1FMVA 5DD4A 4KYDA 3T93B 2X48A 3BT9A 3KLOA 3IKTA 1JEUA 2VJJA 2QQ9A 2L9NA 3E7LA 3BZ6A 3RCOA 5GTIC 1MDMB 2PI0A 3O6IA 2XRLA 1SD6A 2L9VA 4B09A 2PFZA 4KCCA 3K1NA 3FHZA 1SQYA 1R5ID 3OSRA 4D7MA 2DWJA 1ETYA 1LB2A 4CCJA 2K4JA 4DBRA 3N6TA 3BCAA 3PFIA 4PFOA 1D1BA 1U9NA 2JN6A 4PFPA 1FMWA 3FMQA 1JGSA 4F92B 2IGKA 3KYLA 2D1HA 2RKHA 4EGZA 1K9YA 3QIMA 4KXPA 2FUG2 2K3FA 2F6PA 4BDRA 3F8FA 1TBXA 2IXSA 2KLOA 3HSRA 3G3HA 1NG6A 4YFXF 1EH7A 4UB6C 1IJWC 4E7HA 1ETVA 4DJAA 1QQIA 1I3AA 3FF5A 2DA5A 2HPGA 1MMNA 2R5ZB 3TP3A 3WTYC 2M8EA 3BG3A 3HHGA 1ZN2A 5HDKA 3JRDA 1G3SA 1MDMA 1SFEA 3RI4A 1B32A 4I62A 2HQ0A 4JX4A 3BIGA 2D5VA 1LBBA 1B46A 5L9MA 4RJZA 3T1BA 1LSTA 3RNNA 2DSFA 5ET6A 3LFKA 2VONA 3UKGA 1JNFA 3K6WA 3SEUA 5D4RA 3LQQA 2FYIA 2HOEA 4EGYA 1PUFA 2ZMEB 2RN7A 4J01A 1FTTA 1Y3NA 5JI6A 2OA4A 4UVAA 3C33A 4LQ5A 4YRVA 2L5QA 4HLXA 3S8PA 1R23A 1ZTRA 3ECHA 2A05A 1O3TA 2FA7A 5DYMA 3TQLA 2OJTA 5LDZA 4KA4A 4OU0A 4QPOA 1XVYA 3F72A 3H35A 2E7WA 2LOOA 2A61A 4BHBA 1JW5A 2ONSA 3K6UA 3LFUA 3GTGJ 3ZMVA 4FETA 3OSFA 1NFTA 4OFJA 2D21A 4B3AA 5CLSA 1FTZA 1M5EA 3TKDA 2G7HA 1O3RA 4ZEIA 1LFUP 5CBRA 4X0GA 1I5ZA 2Q2EB 4BH9A 5LBQA 3HOSA 2R5YA 1PUEE 1DCUA 2F5FA 2FBKA 2Q1ZB 4JX6A 4CYCA 1VQ9I 4POWA 1MBJA 3HL2A 1O63A 3CMAI 4MNCA 1D0YA 1V5GA 4E7SA 1Z3YA 3H9QA 2HU9A 3F21A 3ZQ7A 4FORA 2I5UA 2EIMH 3LSRA 1E3HA 3I0TA 3E4RA 3S15J 3OS0A 2XPWA 3IO6A 1XG1A 4HNVA 4CCMA 3GBBA 5ICGA 2JJKA 1G4DA 4XORA 3HB9A 1FBFA 2CQNA 4C3HJ 2DOEA 5J4YA 2Z16A 3CP2A 1I39A 1YG2A 3HGYA 4NNJA 2R7RA 1T2KA 2VGQA 3LQRA 2DA3A 1BLFA 1R49A 4G6QA 4ENKA 3E6MA 1YOVB 1URSA 4EQQA 3K4MA 4RB3C 1KA8A 3T9VA 1RR7A 1RC9A 2WAFA 3HRMA 4PFIA 3MWMA 3T0JA 2ISZA 4CYCB 3WAEA 1NI9A 1WVJA 5M5XJ 2K9QA 4LMYA 2XPVA 3PFYA 1F9NA 1NV0A 5DUIA 3H5AA 3FKIJ 4XF5A 5I58A 4UHTA 2KZVA 1AKHA 4M3GA 4GLIA 5KK1A 5JR3A 2BW3A 2ZMEC 2CO5A 3WTTC 1JE8A 1IXIA 5I84A 4C2UA 1ZGAA 4DIGA 4F2OA 2CQQA 2RREA 2FHYA 1V54H 3FBNB 3MEXA 2QKLB 4NG7A 3GZGA 1R6RA 4FHTA 1S9TA 3QYBA 5ED4A 1FBSA 3V8JA 5BPIA 1IUYA 4JDFA 2YU9J 5BS6A 2QBYB 3KEQA 3LA3A 3NQOA 1PEBA 1XOCA 1OMIA 1TTYA 2XGDA 3VDXA 2X6OA 3QAHA 4ZYGA 3K01A 2LNBA 2O5RA 4LOCA 3GEZA 5FTHA 1JKOC 3G71I 5ET5A 2IGNA 2KRCA 4DI3D 2H8WA 3FXBA 3L2VA 4G8HA 3ZQCA 1SAUA 5L3CA 4RGRA 5B66C 1QGXA 4XIDA 3W6VA 3S14J 4NC7A 1FPDA 4A5MA 4GWSA 1SI0A 1FRPA 4Q47A 1RIOH 2DVCA 2PYYA 3O6HA 4YIRX 1QJMA 2ELJA 2ZNSA 5I2KA 3ZGKA 1B9JA 2L01A 4H6DA 4PSXA 2VUMJ 4L5EA 3V7CA 1VQNI 1URGA 4LIVA 1WKMA 3EQLF 2CZKA 4GL0A 3OS2A 4OANA 3HG9A 5M2VA 1FCKA 4P9UA 3TOBA 1B4ZA 1A31A 1MBKA 1FIAA 5K2XA 4G77A 4F29A 4ZDOA 3PIPF 1IDZA 4BDMA 3HRUA 4XKWA 1WCMJ 1NUYA 5ICTA 3C2GA 1R1UA 2Z1DA 3HZJA 1LLSA 4AIHA 1A6QA 2V25A 2Z8DA 2L02A 4FECA 4LVQA 3DV8A 2OZZA 4PJNA 2QZ8A 2EV6A 3QSLA 1FTMA 2K3PA 4RAYA 2VL8A 2JRTA 4ESXA 4P11A 2UVJA 4H4KC 4KR5A 3VB2A 1QA6A 5F0HA 3AG1H 2E7XA 4ITVA 1SMTA 3CF2A 2LREA 3GTPJ 1UTHA 4DZ1A 5L9SA 3C18A 4OVRA 2LLKA 1LAFE 5HLGA 3W2VA 4U4SA 1QNTA 2ZBKA 4QSEA 2JUCA 3E6CC 1IN8A 3BG6A 1UG2A 2Q89A 3QQAA 3K4JA 4LD5A 3K70C 3ONMA 3VLVA 3JRBA 2HTJA 1MM7A 1T39A 2KDOA 2Y0SN 4JBAA 4XLNF 2X7PA 3PV0E 4MHFA 2HVSA 1QGPA 2OV7A 2DA6A 2HXRA 1VQ5I 5L8DA 2L4MA 2V6CA 2XKOA 3S9EA 3R61A 3FK6A 3MZ9A 4ZTFA 4FE8A 4BAYA 4IRGA 4M73A 5HPQA 1JKRC 3CESA 2YU3A 3HSEA 1UIUA 3RYPA 2LK2A 4BJ6C 3QWLA 2NVTJ 3KE2A 1TNTA 1UELB 3H0DA 2ZJQF 1CGPA 2DK8A 3W6KB 2XAHA 1B8IB 2EB7A 5GPAA 3R0JA 4JWOA 3ZP5A 2Y9ZA 4LZ7A 4ZZLA 4M1VA 3THIA 3OENA 3CCYA 3PO2J 1NG7A 4UV8A 4ZZDA 4PFRA 2HI3A 5LHGA 3G3FA 1V4RA 1X4OA 3G3KA 4EM0B 4GL8A 1S3JA 2W48A 1T0FA 1M1EB 1W5CC 2G0EA 4P96A 1ZG5A 2GRVA 4F22A 2PT1A 2HQ5A 4WCGA 2DK5A 2DMPA 1MIJA 4I76A 2I48A 1O4XA 3OO9A 5DM6F 4OWDA 5LEJA 4KN4X 4H0EA 4A3BJ 2Z3YA 1RDYA 3K0VA 2F2EA 2RQPA 3M8JA 4RBOA 3X2QH 2CUZA 4B44A 1MGTA 1MY3A 1ZRFA 4AVPA 4GX6A 4YKPA 4UY8I 1SVOA 2XHKA 2KIQA 2Y31A 2DA7A 3RQIA 3RSNA 2M5WA 1S7OA 3CO6C 1BJZA 2NVYJ 1XCBA 2DLLA 2ZNZA 4NQWA 5HLHA 1MSFC 1N7XA 3FM5A 3T8RA 3O2AA 1B2HA 2ECCA 3HOWJ 1ZLQA 2L7KA 3JRAA 5IM2A 1D3KA 4N8GA 5TPAA 3ONQA 3VYTB 1HSEA 3K6VA 1ORKA 3LSJA 1RKWA 3HHHA 2ZMEA 4G6TB 1BOBA 5ITOA 5LRRA 3TTKA 3IWFA 2AHQA 3DKWA 1TP4A 4PGHA 2WBBA 2GA2A 1VFCA 3VODA 1H43A 5EEAA 5E3OA 3G73A 1UFMA 1JEVA 2ZNTA 5HNFA 3L7WA 3LSGA 4DW6A 3T22A 3FXRA 2K7LA 3U1OA 1QO0D 1MQGA 3K1MA 2OQRA 1R00A 3K2DA 1T98A 4GWWA 4QHQA 2QJEA 4RNSA 3E5QA 4BQAA 5DW8A 2CZIA 4Z0IA 5EZHA 4XM3A 2F4MB 1BKAA 2Z8EA 2HAUA 5AA2D 3RPLA 3AG3H 4L9TA 4U88A 3H92A 4PFTA 5EYHA 2MG4A 3TW7A 4UUSA 1WJAA 1P7JA 1X2MA 4RLQA 2F34A 4L9NA 1KU3A 1WI9A 2K9MA 3CMYA 1OLAA 4GQOA 2WC2A 4JWXA 3T96B 1TXFA 3HV1A 3LSMA 2ZO4A 4IPAA 4UA8A 1Y4TA 3DP6A 5EYRA 4TOZA 3CHGA 5KDTB 3A02A 5KDTA 1O57A 4PGNA 2FIEA 1G2HA 1I6QA 2QYOA 1W5SA 4GRIA 2ME6A 4U0WA 1GUUA 3HHFA 2R7DA 4NDLA 2CW7A 4A3EJ 4CHUA 1BJAA 4LG0B 1EYKA 2GFEA 1VSOA 1R36A 3QYTA 2HXOA 3Q9SA 1U8BA 1X1DA 2FSWA 4HW8A 1T08B 4Y15A 1DPUA 1KGSA 3PPPA 1NMUA 1BK4A 5AA1A 3K0LA 4V2GA 3TTRA 3I3VA 5KVRA 4I1DA 2XV4S 4N4NB 2ZXTA 5EGOA 2WV0A 3Q28A 4M6VA 1IEJA 5J40A 2RF1A 1M5DA 4D0PA 1IMFA 1B5IA 3IP4B 1JUMA 4D7NA 2OWZA 2HQRA 3BZCA 5H8QA 3M3KA 3FXUA 2LG4A 2CSOA 2JPCA 3J7YJ 2CZHA 2DE2A 1HKTA 2VKDA 4X1EA 5IY5H 1E0EA 4ZEDA 4B3XA 1JGGA 5FLMJ 2P2AA 3TODA 2DMUA 1YI2I 3Q0VA 1IMAA 2R7ZJ 2RCBA 4MLOA 1MKMA 3HIFA 2I8DA 2EA4A 2VPLA 1ZR4A 4F3PA 5D8LB 1MSEC 4H8JA 2IRFG 3GF2A 3HSFA 5CVJA 5IOZA 3MFKA 1VQ6I 2O7UA 4MIJA 3HSTA 1S7AA 4Q48A 5CPRB 2LBFB 3PU5A 3K10A 2QRYA 4N6PA 3TPAA 3DPUA 2KHMA 3G6EI 2A68F 1USYE 4I02A 2L2OA 2PMHA 3IJOB 1IXCA 4LN5A 2X7QA 2JWTA 1OR7A 2BOLA 1URDA 3F8BA 4OIRF 1FY7A 1MQIA 1DGRM 4XSXF 1NNPA 1W36C 1WQ2A 1LFBA 1RDZA 1ELJA 1LVKA 3IB0A 3TQWA 3RKYA 1IN6A 2DA1A 3FISA 2HAVA 3C36A 2LYCA 2IA1A 2X1CA 4OYVA 4ESWA 1ZKBA 2EFWA 4DXUA 1ZIUA 1ZMGA 2F6CA 2XXXA 3E13X 1MBHA 3VSLA 3PUYE 1ZRCA 4L5JA 2K4BA 2LY9A 3GYYA 1RETA 3I54A 3SZTA 1XVXA 3CCEI 1ETKA 2F4IA 1ETQA 3ROUA 1MDP1 3QRFF 4CCOA 4BDQA 2DWIA 1POGA 2OQGA 2H09A 5JEIA 2VBZA 4BEHB 1OQHA 1Y0NA 3L2CA 2K85A 2MC3A 2VJIA 4YB6A 5IZ3A 2JZYA 2DPUA 3I6VA 2PJPA 1IMCA 1PDAA 5EDNA 3L2UA 4IO9F 3KBZA 4ASNA 1S6LA 2P4WA 2CYYA 2NOGA 1X2NA 2OZ6A 4DZPA 4YFKF 3FBPA 4YKIA 3CG3A 5F7VA 4ENNA 4A3FJ 1MQDA 2LAOA 1TFDA 4IZZA 4EF2A 1YRNB 2XSJC 1VQ8I 3FMSA 2QS4A 1YYZA 1DSNA 4IO7A 4RB0A 5FLXZ 5E3MA 5JTYB 4QPQA 3DP4A 5IYCJ 2M0CA 4OVTA 3GTKJ 2F3DA 2XXRA 3GZ6A 3MZBA 1VE4A 3I59B 5DCFA 5ET8A 2BJIA 4B1RA 4HXVA 5LEKA 3HDDA 1FBQA 2IT0A 4XTCQ 4V19K 1DK4A 1MY0A 3W9WA 4PGGA 5F1JA 1V55H 4DLDA 1MMDA 5CQGA 3ISPA 4QLCU 4NHJA 3V83A 5E79C 4LZ8A 4R73A 4HV6A 3QYEA 3WU1B 2NS7A 3TTMA 4BXUA 3AL0B 1UCRA 4A3LJ 2UZKA 2GXGA 1CB6A 2XXQA 2EINH 3FBIB 5ICFA 4LA9A 1J2XA 5H8NA 2MLKA 4LB6B 3HOXJ 5EHSA 1JVYA 3G3JA 1P1QA 1IMDA 1XT8A 3WAFA 4LATA 4M6YA 4KNYA 5IYDJ 1INPA 4HA8A 2QSXA 1WSUA 2H94A 3ERED 1EYIA 3TEPA 1JKQC 3E9XA 3PNVA 2XC7A 2Z99A 3WG9A 3TOAA 1P1OA 2VPRA 3CJQB 2E2IJ 3COAC 3BTJA 2DT6A 3IOUA 3V5AA 4XQFA 4YU0A 1O7LA 5JVTA 4AB5A 3FASA 5IP7J 4PCQA 4Y4RA 4YB5A 4I7HA 2WAQN 3DLAA 5J47A 3J81K 4M3EA 2ADUA 5L3DA 2D45A 3MPKA 2X1DA 4IQ4A 4IJAA 3PQKA 4HNTA 1O3QA 1QU3A 4O7MA 3GO5A 2X0LA 5DVFA 3KP2A 2F8DA 4ZJZA 1TLHB 2GQ1A 4LK0F 3LOCA 1LDJA 2B9SA 3BR1A 3IK6B 4H5FA 4B48A 4C2MJ 1ZU0A 3N26A 4NBQA 2KJCA 1NL5A 4IHYA 3T9UA 3I64A 4PE3A 5E3LA 1OISA 1I6XA 2Y0MA 5FO5A 3WG7H 5J6XA 4FIMA 4OEVA 3PJRA 2JUGA 1MPBA 5K2YA 1US5A 2G7UA 1Y0UA 1NUZA 1TZLA 2RDPA 3SYTA 1ZQ3P 3LSTA 1TL8A 1NUWA 3M07A 4D5FA 2V1NA 3PM1A 1XCVA 2DT5A 3ZQQA 3MZHA 4QF9A 5ESYA 2ZYOA 4KYEA 4NF4B 2XXWA 1A04A 2HZDA 3JTHA 3RYDA 3DU6A 1FBEA 4DDDA 4HW0A 1RNLA 4CO8A 1SC7A 1OYWA 3UORA 1FT9A 4JX5A 5F1RA 1VQMI 3F6OA 4L0YB 3VYUB 3ZQIA 3F6VA 2XGXA 1LEAA 2LKSA 3GFMA 3MPLA 2F5DA 1AHDP 3U65A 1PBQA 3LSKA 3HKZA 3EKIA 1ZBMA 2CH0A 5L3BA 4P1LA 3L2QA 2R3SA 4XLAA 5D4SA 2DMQA 3LAPA 2MKZA 4ZE9A 1G3WA 1IRXA 4BBRJ 4JVIA 2OTJI 3Q9VA 4EMSA 3LSFB 3MQ9A 5J8CA 1U78A 4NTLA 4F3GA 3IJXB 5E8IA 3BROA 5EJCA 5ERIA 2QEXI 4YG2F 1KQ0A 3FUZA 2CG4A 2OWTA 1GTKA 4U23A 3MCZA 2F7CA 1LUJB 2X51A 3CD6I 3IB2A 2XD3A 5DM7F 1NH7A 2LR8A 3KP3A 4HZFA 4HOBA 2REJA 3IO4A 2EZHA 4E7ZA 4FEBA 3H6VA 5EG0A 2DU9A 3PUXE 2XA5A 1XPXA 2AL4A 1QZYA 3RTFB 1MMAA 1G6NA 2X85A 4KMUX 1PP7U 2VPOA 4G68C 3KGCA 5HBCA 2EPFA 3M9AA 4OTEA 1TFAA 1LDKB 1ZH5A 1P4XA 3S4UA 3CF5F 2KZGA 4CYDA 4MMPA 2WA0A 3IAZA 4WEDA 4M6XA 2R7WA 4HX7A 1TQPA 1P1WA 4F2QA 3GZNB 1YX3A 2P6TA 3DF8A 2LBFA 3K70D 4IO2A 1FYKA 1T0KA 5LGUA 5FLXK 2G29A 1OCOH 3Q0UA 2HVQA 4D5CA 5CMMA 2RC4A 2YPRA 5EEGA 2J5PA 1EF4A 5F0FA 1D9YA 3KP4A 3U21A 3R6UA 4QFNA 4U4XA 3JTGA 1JUPA 5IAIA 3FXJA 1DQUA 4M9XA 3ZN1A 4O8MA 2F35A 1R1VA 3L1PA 4MBPA 2I3WA 4N9HA 1FBPA 3MZ1A 1IUFA 2IBDA 2JK3A 3RQ4A 3E1SA 3S3NA 1TW2A 2ID3A 1XSXA 1BC7C 1WH7A 3FDYA 1KWHA 1Z91A 2AL5A 4BDNA 2DMTA 3DBRB 2CEXA 3MVXA 4MTDA 1WI3A 2O6AA 1LJ9A 2VOOA 1N0TA 2QVVA 2R9JA 3L9FA 4NC8A 4IOAF 2PT2A 4POXA 2VE8A 1LQ1A 1FJ6A 3TDUC 5I7IA 4FCYA 3KJ7A 2P0SA 1QUKA 1AMFA 5BQTA 5FTIA 4N81A 2YSRA 2M0MA 1SYIA 3QYFA 5DS9A 1TNSA 1IGNA 5LLQA 4PFBA 2Y84A 3K6GA 2MH2A 3K4LA 2X6XA 4L17A 4C1UA 2HQNA 5LRSA 2EILH 3CI8A 1Z77A 2DP8A 3CC4I 2W7YA 3BR3A 3MD2A 3F11A 4OETA 1UTBB 5F1QA 1MMGA 4B4CA 1J5YA 4IB2A 2ETHA 3H9GA 4HF1A 1D3YA 3R4KA 3ZSFA 3FVKA 1H45A 2KRFA 2FBHA 2OF7A 2CMPA 1YPNA 2HVRA 2EZLA 3SFIA 3MW0A 3EETA 4LB5A 5CC2A 4N8YA 1PP8F 1LFGA 3ESWB 3AFHA 3G1LA 1FEXA 3OR2C 1P2FA 4IO5A 1IDYA 2LF7A 4KIGA 2H27A 1JTYA 2A3SA 1OLCA 4R2BA 4PBQA 4R6KA 1YYVA 1YO5C 1PVEA 2CQ7A 2LP0A 4OINF 5EG0B 4BACA 1OMPA 2F7AA 2M3AA 3LR1A 2V79A 2ACJA 1T56A 3P7NA 3OD7A 2YPNA 4P1WA 4CUGA 1M5BA 2BJJX 1DP7P 3PMVA 3IC7A 1O7FA 2QQ8A 1WJBA 2XASA 4E70A 3I4NJ 2KQZA 1GR2A 1HXDA 3IWZA 1N7WA 1QUJA 4I8CA 4EQ7A 3TCHA 2E1NA 2P5VA 4I6ZA 1VQKI 4BLAA 4QIWN 2Z33A 3GYHX 4BY1J 2VIXA 2QF7A 3FXMA 4QFOA 3DEUA 1A40A 2BHYA 2EZKA 4N13A 3O2PE 1FPJA 1RYXA 1ZGWA 1D0XA 2XAFA 3MJNA 2MW8A 1BBYA 5J16A 2VJ4A 4F55A 2WB1A 3H06B 3AL0C 3KLNA 1Y3QA 3G2BA 3JSPA 3E97A 5AA4A 3K4CA 2VQLA 1RESA 2ME0A 5C44J 5DTBA 4IHSA 5LGTA 2F5XA 3F0CA 4EV0A 3OSQA 2F4OB 5L3EA 2RGVA 1X3WB 3H9JA 3CCLI 2VKEA 3LSIA 4G4PA 4EM1A 2CQXA 2P5LC 1RRJA 4IO6A 4G94A 3ZMTA 4WK8F 1PDNC 5BMZA 1OYIA 2W00A 3WTSC 1WVRA 1S72I 3O66A 1VF9A 3QOEA 4AYBA 3Q29A 1LBXA 4O94A 1MH4A 3AKZA 5I5PA 4GBVA 1LNWA 4Z2YA 4I0AA 2HZTA 2H1LA 4RM2A 2PX9A 3LC8A 3Q26A 2FF4A 2KIFA 2V9VA 4HE1A 3D1RA 3T0YA 3IH2A 4HX4A 3HGGA 1XGNA 2R5ZA 1B3HA 1HKQA 1ZAOA 4IRIA 4BQOA 1B9MA 2DAOA 4HEA2 1Z7ME 3RPQA 1ZJLA 3EQ1A 2ZZWA 1H8AC 3VXBA 4GF8A 2BE5F 3WGGA 4Y17A 5B7DA 2L0KA 3JZJA 2DQRA 2WB1N 4HG2A 1KU9A 1MPCA 3BBRA 1M5CA 3KP6A 3KZZA 4IO3A 4UUTA 4XLFA 2CWEA 3OEMA 2ZYMA 2QVRA 1D1AA 2VB6A 4BQNA 5E18F 3LAJA 3BC8A 3I58A 3LUYA 4H8IA 3GZ5A 3OS1A 1YXIA 2DOJA 2UVIA 4NF4A 1QKBA 2ONKE 5KZTA 1A8FA 1B1BA 4RK9A 2E71A 1FTLA 1I6HJ 1FSAA 4B47A 1BTJA 3OL4A 2ZXJA 2RC9A 4RA1A 1AOYA 4XSZF 1GVDA 2CS3A 4XKNA 3MAMA 1ZELA 4M72A 3P5JA 1Y6IA 4M9ZA 2Q9TA 1H0MA 2A6HF 4RAGA 1IMBA 4A0YA 5CVUA 3HTSB 3KC1A 4HCYA 1D0ZA 3V7RA 5E8GA 5H6QA 4CH7A 4AM3A 1WH5A 1UTHB 4A3MJ 1FBUA 1EZ9A 2M8GX 4G12A 3V4GA 2Q0OA 4NF0A 4H46A 5CM6A 3J7ZI 4QRZA 3RYRA 4FAJA 4N91A 4KT5C 4OFLA 3A0BC 3RY3A 1NNKA 1QVTA 2H98A 3KN7A 3UP9A 3OMYA 2XWIA 2XAJA 2IEEA 3E3KA 1NK3P 3RQTA 1AOVA 3ZMSA 5K1YA 3N5LA 4OENA 4E0WA 4PZJA 3G1OA 2DW4A 3VYSB 1TC3C 1FTAA 2KKOA 1GT0C 3BJAA 3DPTA 3DTKA 1G0IA 2OCUA 5ICCA 2JA7J 2REGA 2ZXWH 3QUJA 3I3LA 4QBAA 1D9QA 3O6BB 4EJUA 1TWFJ 2PMZN 5E1ZB 1KA1A 4NMYA 4RPOA 3SESA 1ACIA 3EUHC 3SERA 2I49A 3OYLA 2PEXA 2OX3A 5GADJ 2HQAA 2FOKA 3H36A 3DWLE 4RPNA 4C9YA 4A3JJ 1VFEA 3FV2A 2GZWA 2BHZA 1T6SA 4HX8A 1BA5A 1YJ9I 4K2EA 2Q2AA 5CQEA 2R7UA 2R4GA 4XONA 3FM3A 1OYYA 4RDUA 3E78A 1S8NA 1GV2A 1R5GA 2OZUA 3SQNA 4F1YA 2V4JC 2QVOA 1HW5A 1PYVA 1SI1A 4XMYA 4BNCA 3A3UA 3Q25A 3ZXSA 3KX2A 1SW5A 4XRSG 5EHMA 1QZZA 4P9FA 3H5NA 1G8XA 3BG5A 4O3CA 1BC8C 4IHVA 3HOVJ 5F24A 2F36A 3ABUA 4ZYAA 1GVJA 1U0JA 3JYRA 1JW4A 4MFEA 1HLVA 1I6BA 4RAZA 3MUQA 1Y1VJ 4JQFA 5EQ9A 5IGAA 1YTVA 4GO1A 3L6GA 4JB7A 2R93J 1TWHJ 4ZH4F 2ZB9A 3ASNH 2JVHA 1OCCH 4F1VA 2FMYA 2HYJA 1B3GA 3HUGA 3P9CA 2EA2A 2Y7IA 4XRMA 4X1BA 1MQJA 5J1DA 4DBQA 3RZDJ 4PAFA 1R71A 3KZYA 4LGWA 5B3SH 1SVLA 2W25A 1P99A 2FU4A 1YCJA 4O3MA 1MBGA 4D9JA 3HO7A 3O28A 3W3CA 4FEDA 4RXLA 1S5LC 3DCFA 1WJCA 3MVWA 3SZPA 2JT1A 5E1WA 3VWBA 3DEWA 1FYLA 1TT5B 3BWGA 4XOPA 3DLLF 2B4LA 3VVFA 4JWYA 2DWAA 1LB8A 4U1OA 3HOUJ 3V8KA 4XN0A 3WU0A 5H2FC 2QS1A 1BW6A 5D5XB 2GH9A 4Z7EA 2FD5A 1B5HA 2R71A 2X6WA 5EEHA 3KYCB 2E1OA 4E7JA 1JVXA 3J80K 4NC6A 1FSEA 5H8QB 2HZKA 4BE2A 2DJNA 4S0HB 1DTZA 1D9VA 4FT8A 3S93A 1HKSA 5KAIC 1Z21A 5AONA 5E3NA 1TWAJ 3GLLA 3LSLA 4R9GA 3CG1A 3F3XA 1O3SA 2BV6A 5IT9K 4G9YA 3S1NJ 2A5SA 5ITPA 2G9WA 2Y5KA 3MZ8A 3PUWE 3CCQI 1G3YA 2ZNYA 5TU0A 2Z8FA 1S7EA 3KOSA 3ROJA 2PQ8A 1IN5A 3KIOA 4NE4A 2WKYA 4E4HA 4R72A 2O69A 1IO2A 3GXOA 2I10A 5EGOB 3HRTA 3WGIA 1B6HA 4DI4B 3IKVA 2Y7RA 3VPRA 2G93A 4WF2A 1R22A 5F64A 2WAEA 5C3EJ 2YX4A 4EJOA 4A3IJ 2BXYA 4AWXB 2O7OA 2V26A 2GOXB 1YIJI 2CV0A 2XX7A 3GW2A 4G2ZA 2V1DA 2CFOA 4BEHA 1B8IA 2FNCA 3R0AA 4LQ2A 2JQ7A 5CJ9A 3W6JB 5EQAA 3LSHA 2VBXA 1LCFA 1TW3A 2Z22A 1QZEA 3SEQA 3CQZJ 2O0YA 3WE3A 3EPZA 2AQFA 3BFUA 1XC5A 3H0GJ 1B1XA 4P0IA 1LBYA 3KBRA 5FKNA 2EWNA 4R6HA 4FJPA 1D1CA 2QKMB 3BZKA 3K9TA 5DEQA 5HVQC 3G4SI 3F23A 2CU7A 2NVXJ 3HUGB 1H44A 2Y5LA 1I27A 2FX0A 5FB2A 4OERA 4BE1A 2R7QA 2DOFA 2EV0A 1YLFA 5LFAA 1U2WA 2EBIA 2V9KA 2N8GA 3BCBA 1D5YA 2PBWA 1FC3A 1UJ8A 1FQBA 3EUAA 2XRNA 4C3JJ 3C7JA 3TO9A 1EU8A 2BGCA 3S9NC 2DQLA 5DCMB 1DPRA 3IB1A 4M3FA 2QUFA 1HBXG 5HLIA 2JA8J 5TJJA 1USYH 1FQDA 3S3MA 2HPIA 1B0LA 2XXHA 1BR4A 1AL3A 2VT3A 3B6QA 3P9KA 3IR1A 3D5LA 3OOAA 1K4SA 2Y7KA 5D6FA 3QP6A 2K40A 2BVMA 1LVAA 2ECBA 5ILUA 2C6YA 3M1CA 5JHFA 4KISA 5K5QA 3TP0A 1NNFA 1MH3A 2IAIA 2HEOA 1WJEA 2WYKA 1CF7A 2FOWA 3A3CA 4G61A 1UZCA 1QHGA 1A6IA 3OOPA 4Y3OA 4EF1A 4JSDA 2BYVE 4II3A 2LDUA 2GXAA 4NF5A 3OYKA 2JA6J 4UUVA 1B52A 3WTVC 1KZ8A 4EXKA 1WPKA 2M4KA 4HRIA 4DIQA 3AAFA 3BR5A 4KYWA 2HXIA 2F6GA 3I71A 5TP9B 2RCAA 3DXJF 3PQJA 4B43A 2RKMA 2V6EA 4QFPA 1YQAA 2MD0A 5LGNA 3QU6A 1CQTA 2I4CA 2PMUA 4KMFA 2E1SA 4HTGA 2HEUA 4ELPA 1TQMA 1B1HA 1FP2A 2ABHA 1XDUA 2WAQA 2KLFA 1I50J 5LHHA 3E79A 5HNHA 3LBSA 2QGUA 3IX1A 1WJFA 3TKYA 4O3BA 4PE5B 2UXNA 1BIBA 4F3QA 1SYHA 4UNOA 2DDKA 5I57B 4V2FA 6PAXA 2CZLA 1YW9A 5K5RA 2GQQA 1GV8A 2GIZA 3BPVA 2HOAA 4I9DA 3VDFA 3OIOA 5DYHA 5FHOA 2CW0F 3ECOA 5FLVA 2HDDA 4G7HF 4NEDA 2F3BA 2VD3A 5HLTA 1MRPA 1BI2A 1W0TA 4L9JA 3V89B 1SW1A 2XXUA 2PJRB 5GTHC 4U7BA 3MKZA 1JW1A 4NN3A 1UHSA 3DM0A 4JSOA 1TQIA 2CV1A 2NUVA 5CMBA 1B7HA 2XAGA 4RGUA 3HFUA 3OIPA 2UWMA 3RKWA 3OXNA 1G3TA 4HNUA 3MBPA 4WWCA 5ICEA 5H8SA 1EV7A 1RR8C 4N07A 4I98B 1NV4A 1YHQI 1SFUA 1WGXA 2M8CA 3MSTA 3I53A 1JKPC 2ZFWA 1IAWA 5H8HA 2NAZA 1POTA 4N6KA 3C2BA 3BJ6A 3K69A 2XXTA 5HOOA 2WADA 4CZZA 5LD2C 1FOYA 4F18A 4M74A 1FLIA 2IA0A 5KAFC 1A5JA 3CCVI 1MG1A 1W36D 2OU2A 1WRJA 2VN2A 3PNTA 5CYVA 2O1MA 3EHTA 3PD9A 3OWTA 2B7EA 1FIPA 3HEFA 4X6AJ 3PO3J 3HOTA 1Z7LA 1OPCA 3BR2A 4XKCA 4BDYA 3FJ7A 4ENJA 4PJJA 4Q5TA 4BDOA 3EPEA 4BJ5C 1X1PA 2E1CA 5A2QZ 2Z2SB 2ELKA 5I3SA 3VFJA 3FHNA 1WHUA 3CCSI 4WEPA 2O8XA 4U1ZA 2F5CA 1FPBA 3VE1B 4QSCA 1KU2A 3GTOJ 2LVSA 5D5UB 5CKTA 1U6GA 4N4UA 3WTXC 4QSDA 3UN6A 2VJ5A 5FJ8J 4N4OB 2EQRA 4GOTA 1XGSA 3ZR8X 5BPDA 2PN6A 1JHFA 2NNYA 4MQVA 2DI3A 5IZ1A 3JR9A 1BM9A 3VFZA 2X1EA 2MLGA 5IPAA 2J5OA 3H3ZA 3NARA 2BW3B 5HODA 2NVQJ 1AWBA 2DE3A 1AA7A 3OOUA 4RB1A 1POY1 4R74A 2RV8A 2OWSA 1LEBA 5A5LA 3PIOF 4GXOA 1OQYA 5E20A 1LBCA 3ABMH 2DFEA 2EIKH 4MEVA 2ISYA 2R7FA 5LTCA 1A7LA 4AU7A 1VI0A 2WBMA 3PNYA 2DXIA 5GAGJ 3K2AA 3TYHA 1SD3A 3ZQFA 3V7SA 4A3CJ 1D8JA 3U72A 3ZQLA 1FTJA 5FRNA 4IGTA 3CUQA 1U8RA 1DBZA 1HSLA 3T9XB 1FQEA 1XGOA 1Y3PA 3WU2C 3HKZN 2ZSIB 4ESBA 3EYIA 3SHFA 1KA0A 2D3IA 1RUNA 1MNDA 4PJ0C 4AIJA 4JVCA 1IRGA 4EDPA 5CMCA 5J3LA 3A0HC 4OIPF 2LC2A 5FKLA 1R9TJ 4MH5A 4U2RA 1KYZA 4ZEBA 3REOA 3L00A 4P1EA 2NWJA 4PCDA 1MXVA 5M5WJ 3TTNA 2XGCA 3ODBA 2WV1A 5KHDA 4RLFA 2PFYA 2NYXA 1SFOJ 2UV1A 3G7WA 3JV9A 2MABA 2MFZA 3FIWA 2TDXA 2LMDA 1Y39A 1CE2A 2IGMA 1UB9A 2Y48A 4EJWA 1MBFA 1Y1ZA 3KFWX 4XNFA 4EATA 4YKKA 3BTIA 2M87A 4FX4A 4OHNA 3UGWA 4MLVA 3CUQB 1ZLJA 1APLC 3O8HA 3O3KA 3Q0WA 5JK4A 3QAXA 3SEWA 1Y56A 1H9TA 1L0OC 3H4ZA 4XKRA 2E5NA 4PK4A 4EM2A 3ABTA 3M8FA 4KITB 3OYNA 3FXOA 1RKMA 2YLNA 4QFKA 1EZOA 1WFXA 2XIGA 4XLEA 4BYYA 3EHSA 3U1DA 2XWKA 4IHXA 3D4GA 3QPTA 1K7AA 2E1MB 4OAZA 1A54A 1Q35A 3RIRA 2Q8KA 4XFEA 5F04A 1LBWA 2VI6A 2ZFUA 1HW2A 2IS6A 4BJTA 4DOZA 5J8FA 1B72A 2B3BA 4E7IA 2EK5A 1XD7A 2XUBA 3LNQA 1B4HA 2H9BA 4ZECA 3GCMA 2QFLA 3H3GA 3CFLA 3P7IA 1EH8A 1W1WE 2AQEA 4WXCA 2E19A 4S04A 1U5TC 1ZG1A 2YX7A 3I9V2 2XF6A 2DWHA 2GA1A 4EJTA 3MP8A 1X1AA 4IGRA 5FHMA 2L54A 5ISUA 2FXAA 3PMXA 3RKXA 4UB8C 1R58A 4R2FA 3NWTA 1UAAA 4ZEFA 3CFZA 3W15C 4XICA 2WEFA 2Z5UA 2QQAA 1USTA 3TUSA 4OIOF 5D5VB 2ZJ2A 2K02A 1T38A 1QVUA 3OYMA 5AA2B 2OBGA 4BUPA 4ANJA 4I09A 1SFKA 2FNPA 2VXDA 1XMXA 4QSHA 4YKJA 4MEYF 1FQCA 4ELRA 3DTIA 4F19A 3A03A 3TDZC 5KNLA 1NV7A 2MYSA 1N3WA 3C3WA 3GUDA 2R6GE 2ZNUA 2JVGA 1FQAA 2IPQX 4YEJA 3ZMUA 2F7BA 1AU7A 3H5RA 4IHWA 3T66A 3CJTB 1UHMA 2R7OA 3AG2H 1KQ9A 3A1YA 3E5XA 4PJLA 4XLCA 1JJ8C 3E6BA 3O29A 4NF5B 3DBLB 2P7VB 1B40A 4CA0A 4IRHA 2LRDA