2ESNA

The crystal structure of probable transcriptional regulator pa0477 from pseudomonas aeruginosa
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
301
structure length
299
Chain Sequence
PLLRRLDLNLLLVFDALYRHRNVGTAASELAISASAFSHALGRLRQGLDDELFLRQGNRMQPTQRAEHLAAAVAAALRALGEGLEEWRPFVPGQSQRTFVFAATDYTAFALLPPLMNRLQHSAPGVRLRLVNAERKLSVEALASGRIDFALGYDEEHERLPEGIQAHDWFADRYVVVARRDHPRLAGAPTLEGYLAERHAVVTPWNEDSGVIDRLLARSGLRREVAVQLPTVLAALFLAGSTDFLLTAPRHAARALAEAAGLALYPAPFDIPPYVLRLYSHVQGRDAHAWMIGQLKGLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of putative transcriptional regulator Pa0477 from Pseudomonas aeruginosa
rcsb
source organism Pseudomonas aeruginosa
molecule tags Structural genomics, unknown function
molecule keywords probable transcriptional regulator
total genus 89
structure length 299
sequence length 301
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2esnA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2esnA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2esnA03
2OD5A 3H06B 3W15C 1JGSA 3C18A 4L5JA 2GXBA 1IQ7A 4NF5B 1R1NA 4KN4X 3SESA 3FV1A 5EHMA 2OZ6A 3A3UA 1ELJA 5L3DA 4GYIA 5H8NB 3CRBA 1FOKA 4NF8A 5FB2A 2V3QA 4OENA 1UIUA 2VXZA 2VOOA 1AIVA 1Q1KA 2UZKA 2IA4A 3QOPA 3WU1B 4EJTA 2PMHA 3E6BA 1SW1A 3O6IA 1CE2A 3KLOA 3GVAA 3TYHA 4AVPA 5IT9Z 1Y1ZA 1Z6TA 4ZS9A 4Z2YA 2F7CA 1MY1A 4AIKA 1MH4A 5HOOA 2M87A 3KLNA 3REOA 4CO8A 3G3GA 4XSXF 5I56A 4DE8A 4FEBA 3S9MC 3MUQA 3ODBA 2LF8A 3GWZA 5KVRA 2XHKA 4AIJA 3SQNA 4L9NA 2L54A 2M45A 3F8FA 5H8SA 5CVRA 2FQ3A 1U2WA 2I49A 3FHZA 4HDVA 4MQ9F 3DP4A 3DM0A 2W24A 5I59B 1FC3A 3FIRA 3I54A 4G2ZA 5HM4B 3I53A 4ENMA 1MS7A 1O7FA 4I0AA 3R7XA 2ZYOA 1IIWA 1MY3A 3N6TA 4QSDA 3KP5A 1J75A 2UYEA 1HW1A 4MEXF 5DD4A 3FXQA 3ERED 5E1ZB 1B9NA 2OWTA 2VBYA 2MD5A 1B4ZA 3MVYA 3BROA 2B65A 3F8CA 3E4RA 3WTVC 4PQJA 3LBSA 5DUKA 5DCMA 5AA2A 4F2OA 2MH9A 3CIJA 1USSA 3MQ9A 3R0AA 3BKIB 3TUSA 5BPIA 2NUVA 4I1DA 1ZYRF 3SEWA 4R74A 1KQ9A 4U7DA 1IAWA 5J8FA 3PD9A 2G93A 2FXAA 1J7KA 2FMYA 1TW3A 3PQKA 1L5TA 4XBFA 4OIRF 1KWHA 2YLNA 2XAJA 1JW5A 5B70A 2RCBA 2XKOA 3DQVC 3IOWA 2HCAA 4OOIA 3O9PA 4U4SA 2PX1A 2XXTA 3H6TA 4IRHA 4LQ5A 1ZG1A 1IN8A 2P8TA 2DSFA 2DS9A 1KQ8A 1PB8A 5L3EA 2UWMA 3M3LA 5BMZA 4MFIA 3LQQA 3ZN1A 2H09A 5JFRA 1MG1A 3MVZA 5I56B 2OQGA 2LDUA 1JXSA 5LHGA 3H4ZA 3PUYE 4TLMB 4O3MA 1P1WA 3WAEA 3KSXA 4QFNA 4DXUA 4L0ZB 4ONYA 2Y7IA 4HTGA 1OR7A 4WK8F 3RDIA 2WV0A 1URDA 1B7ZA 2I3WA 2QRYA 1XSDA 2UYFA 1P4XA 3M7GA 5ICTA 2OBGA 2DWAA 3FXUA 2KJCA 4F31B 1GV8A 4M73A 4KICA 3KFWX 1EZ9A 4Q8RA 2REGA 3MWMA 4NF8B 3O29A 2MA3A 1J9IA 3S9NC 2L01A 1I1SA 4ZZLA 1YW9A 3WTYC 3ROUA 4ELRA 2CZLA 4A5NA 1ZKBA 2Q0OA 3PFIA 1B4HA 4BDNA 5A2QK 4FX0A 1R5GA 1CB6A 1MXWA 4P96A 4BNCA 2X4HA 3MP6A 1R7JA 1BP5A 3IR1A 4ESXA 2ZBKA 1U8RA 1YCJA 2E0SA 4OZ9A 2P2AA 1MXYA 1WWXA 3K69A 3UORA 2K4BA 4HW0A 5EEGA 5F64A 4BHBA 5TRDA 4YAHX 3TMGA 1USYE 2JTVA 4JDFA 4LK1F 1DPRA 3P9IA 3TO7A 2WTEA 1B51A 2F35A 2H9BA 5FD6A 1FSEA 1EH6A 1SFEA 5ICEA 3KP2A 2DYXA 4RJZA 4DNCA 1EU8A 5L3BA 4RAZA 4G8XA 1B3HA 2OLBA 2FBIA 2HAVA 2E1NA 4ZYEA 3PU5A 4JB7A 1MQDA 4HS7A 1BI0A 3IOUA 1ZU0A 3IB0A 4ZE9A 1MJ9A 1BIAA 1XSXA 3FMRA 3GYHX 3JTHA 1FQBA 1QW0A 1VFEA 3NRVA 4IF4A 5KCJA 3LAPA 4KFCA 1UTHA 2GH9A 3HRTA 4L9TA 4HW8A 5AA2D 2DQVA 1B3GA 2O6GE 3HHHA 2W25A 3ZSFA 1QVSA 1N04A 2Y7PA 1I6QA 4A6DA 1OMPA 2DXRA 3OSRA 1IXCA 4Q30B 4U0YA 2HQRA 4EXKA 3FJGA 3EPEA 5AONA 4RYAA 3V89B 3OXNA 5LGNA 5ISUA 1BI1A 4TLLB 2VBZA 3SDFA 4G9YA 1BIYA 2XASA 5JI6A 3RKYA 1VTNC 4WXHA 3ZQ7A 3V8JA 5A5XB 4E70A 2L4AA 3QK6A 4OTEA 2Y75A 4M9ZA 1X3UA 2P7CB 4GXOA 3OO6A 3V7SA 3L9FA 3TO6A 1FTLA 1KA8A 4KA4A 5HVQC 2DXYA 1FTOA 1QUKA 4ZEDA 2Z9OA 3ZPLA 3USDA 2VE8A 1OVTA 3IOTA 3NEUA 1G3SA 4EJOA 2DWJA 4MTDA 4HCYA 2ZJ2A 5HDGA 2ABHA 4I9DA 1O63A 3E6DA 4F1VA 3TTNA 4M6XA 1O64A 3I5OA 1ZRDA 1FBQA 4RB0A 5AA4A 4PP0A 2FYIA 3HHGA 1HKTA 5I58B 2NAZA 2NYXA 4THIA 4E0XA 3RPQA 1MDMA 1EH7A 1NH7A 3UIFA 1B52A 3LSFB 3W9VA 2DP8A 1ODDA 5FHOA 3IL2A 1FTKA 4LA9A 2HYFA 3MFKA 4JSOA 1R1UA 5ITOA 1REPC 1LQ1A 4MLVA 2X7PA 3EHTA 5H20A 4X1BA 1RKMA 5K5RA 2Z3YA 2UVGA 1IF1A 1D8KA 2NRAC 1MQGA 1P1OA 2BBYA 2CW0F 4IJAA 2PMSA 3RJPA 3ONMA 4U7BA 1LDKB 2F5XA 5LEKA 5K1YA 4A12A 2G7HA 2D21A 3I5UA 4OFJA 3N97A 3K6XA 3LA3A 1HW2A 4G68A 4NMYA 2CYYA 4G4PA 1B5JA 4G7ZF 4WWCA 2P7VB 2P5LC 4HF1A 2ELHA 1B5IA 5BUUA 2EA4A 2DVZA 3TDJA 4KQPA 2ZYKA 4L9JA 4NF6B 1SD6A 2XV4S 3DPLC 1NNTA 1Y3NA 1XC1A 3C1DA 2HQ0A 2J5OA 5LHIA 2ALUA 4RXLA 2Z8FA 1EV7A 4EQQA 3F8MA 3KJ7A 1ZARA 4WCGA 1B1HA 3IKTA 3QPHA 3CI8A 5CBSA 1B5HA 1WSUA 2STTA 1FLIA 5E1WA 4RB3C 2XXPA 1YTYA 3M9AA 5L8DA 3E3VA 3O2PE 3TELA 4BAYA 3KZYA 3T0YA 4N6PA 4UACA 2L4MA 2VD2A 1MZBA 1FBSA 3HRMA 1SI1A 2R7DA 3ECRA 3RT6B 2I6EA 2VP1A 5TPAB 2HZTA 3EDPA 2EV5A 3L2CA 2JPCA 1Y3PA 4UHTA 1BI2A 1RYOA 2ONKE 1HSEA 1B0LA 2DW4A 3SERA 2ZXTA 2CWEA 3QRFF 5HBCA 3E13X 1O57A 5FFXA 3KP6A 3T9UA 4EM0B 2K4JA 3LA7A 4TQUQ 4IO4A 1LFHA 3VV5A 2IW5A 4XLNF 5AE4A 2A3SA 2XXIA 1RNLA 4MTEA 5D5UB 5M2VA 4EJUA 3F11A 4M6YA 4LD5A 1H44A 3WE2A 2RV8A 3FWEA 4KDPA 1LCFA 2RVCA 4ESFA 2D5WA 2EFPA 3IC7A 3JSPA 3I0TA 1B1XA 3U1OA 2Z99A 1E2XA 3RLFE 2IVMA 1JEVA 5JEIA 2JSCA 1B32A 4GXAA 1U5TC 2VODA 1A7LA 4QFPA 2GHBA 3PMVA 2ZCWA 3U2RA 2ZMEA 3OENA 4LLNA 3S2VA 5I59A 3ECOA 5EYFA 3TGNA 5F6FA 1SD5A 1POTA 3N5LA 1N76A 1P92A 3EETA 2H6CA 1P1UA 2WKYA 5JTYB 1B3FA 1XHYA 1O7LA 2RC4A 2AXLA 3JYRA 3OEMA 2XUBA 3LFKA 4L17A 4D0PA 1UHMA 3RNNA 1I6AA 2EA2A 1LB9A 1Y4TA 3GXAA 2W84A 3KSJA 4TOZA 1I6BA 1GGGA 4UNOA 5TP9A 2I4BA 5IKBA 4OMYA 2P5VA 2Y7KA 4AWXB 1S6LA 2O1MA 4N0BA 3RYRA 3HYIA 4Q4ZF 1FQAA 1HSTA 1QGPA 2A69F 1JE8A 4EMSA 1OYYA 1YPNA 2Q89A 4JK1X 3GBAA 1D9VA 3OEKA 2CSOA 3VB2A 4IRGA 3GFJA 5AA3A 2OA4A 2O68A 2YU3A 2HQNA 3GFIA 4EVIA 4AIHA 1P1NA 4POWA 4U1OA 3E5XA 1B46A 3CJNA 1LGBC 2QS3A 3C4MA 2HS5A 4NF5A 2NS0A 4GOTA 4CICA 5L3CA 2EFWA 1S7OA 4P5OA 5ILSA 2H27A 4QLCU 4G68B 4OWDA 3TPAA 1J1NA 2DQLA 4N9IA 1FNNA 3D0SA 3F72A 3DP8A 4P0IA 5ICCA 3CO7C 1PB7A 1LCTA 4DXBA 1YW8A 1EZPA 3G3JA 5H6RA 2BE5F 1KU2A 3HSTA 4MLQA 3E9XA 2W85A 3FZVA 4HZFA 3VVEA 2V79A 4R75A 3B6WA 3E3KA 4NHJA 5F1RA 4H1XA 4G8MA 4B09A 3F6OA 2XXQA 1ZTYA 1B58A 3MVWA 3VVFA 1ZLKA 1Y1MA 1ZREA 3HCQA 1K78A 2GA2A 1FQEA 4LG0A 5FLXK 1M5DA 5HS7A 2A07F 4UVAA 3PPOA 1R6ZA 2RKMA 4HDUA 4I09A 5I58A 4A0XA 1GTKA 5AA4B 1SW4A 2DTRA 3FJMA 4LFUA 2HTJA 4F22A 4BDMA 2VBWA 3OO8A 3HSEA 3U92A 5HLGA 3FATA 5FGMA 4FECA 1FZPB 4F1YA 1Z1DA 5JR3A 3WODF 2M30A 4KYSA 4G8HA 4G6DA 4M72A 5HPQA 5E18F 1N3XA 3KEIA 3IK6B 2VE9A 1ZG3A 1FP1D 3M3KA 1B9MA 5I2NA 2RNJA 4N9HA 3E6MA 3CUQC 4R6HA 2ZFWA 5JHUA 4UUVA 3ZP5A 1B05A 2FF4A 1KGSA 2QENA 5TU0A 5CBRA 4YFXF 3ZKLA 4A2UA 5FTIA 2EFNA 4FAJA 2VC1A 3JW4A 4LUBA 1TQMA 3WE3A 2P4WA 3FX3A 3TTLA 5A5XA 3ILUB 4XKRA 2JPBA 1XN7A 4M74A 3G3KA 4IHTA 4ND9A 5DTBA 4F7ZA 3EUHA 3E5QA 1H45A 1BC8C 1K7AA 4FE8A 3GEZA 3JAMK 3T93B 3J80Z 4KNYA 1JNFA 4C1TA 2H94A 5ILUA 4ASNA 4R2BA 3H3GA 2HGCA 1VR5A 2R6GE 2UXNA 1UTHB 1RI7A 2DT5A 1N7WA 1F5TA 1P1QA 3CUOA 1IRFA 2QWWA 2I3VA 2A5SA 4H67A 3HRUA 2VONA 1MDQA 2X26A 3EQ1A 3MZBA 1A40A 1IXSB 3ZMSA 1MJAA 3GZ6A 3JV9A 1SD3A 1XVXA 1UTBA 3FUZA 5L3FA 1YG2A 5H8QB 2HWVA 4R8HA 3IRRA 2V84A 3RKWA 1SVXB 5HLHA 3R26A 2QLZA 2F97A 3WTSC 1JVYA 1XB4A 1LAFE 1KU3A 4YIIA 1TW2A 1US5A 2OJTA 3C33A 3QPTA 2VT2A 5D4RA 1XDUA 1P4AA 4H6DA 3CO6C 1ZGAA 4JQFA 2GRVA 4HF2A 2A68F 4O6JA 1IITA 4KPTA 4IY6A 1A99A 3HV1A 4F39A 5D5VB 1ANFA 4MHGA 1T2KA 1H9GA 1ZIUA 3LSWA 2AIXA 2XXRA 2PEXA 1UQWA 5H8FB 2A5TA 2AYSA 1TWYA 1GXPA 3VEPA 4I7HA 4P11A 5IT9K 1Y0UA 1DTZA 1C0WA 4ECFA 5ICQA 3RGYA 2OK2A 3KCCA 4IO6A 4M9XA 3U72A 1R5HA 4OVJA 4GF8A 3GUDA 3KBRA 1AOYA 3PPRA 4CDGA 2D45A 3PPQA 3GFLA 4U0WA 3I59A 3IWFA 4LLLA 4BDLA 2V1XA 2KLFA 2ZYMA 3GW2A 1LJ9A 2QPQA 4IO3A 4OFOA 3LSTA 4JXIA 4QFKA 5TP9B 5CI5A 4U2RA 4LZ8A 3I3VA 4U21A 5H6QA 1B6HA 3T9VA 3VLVA 5DCFA 2XXVA 4EQBA 3MC2A 4QF9A 4YKJA 3SEXA 5JTYA 1DP7P 4U22A 2UVJA 1SYHA 4XXUA 3SXYA 3GLXA 4Q5TA 1LAGE 4F3PA 1JQFA 5ITPA 2V6CA 1I1GA 3DFGA 3PGFA 2DU9A 1OLCA 4RB1A 2MH2A 3IKVA 3OO9A 2QYOA 2H99A 4NF4B 5K2XA 3M8EA 2VOPA 4FT8A 2HTSA 3L6HA 1U5TA 3V5AA 3DP6A 4WXJA 1FT9A 3TAJA 4Y15A 1SBPA 1XMKA 4OXVA 5K5QA 1BJAA 2Z8DA 3MPKA 2ZKZA 3RKXA 3DELB 3BBRA 5BQTA 2E1CA 3MAJA 4HA8A 1POY1 2B0LA 2XAQA 3KE2A 5DCMB 3J81K 2H4IA 1B40A 3F6VA 1HSLA 4G77A 1SW5A 4E0WA 2V1UA 3O2AA 1W4MA 3TFLA 4RK2A 4KT5C 1T39A 3KN8A 4LZ5A 1JW1A 5AA1A 3O6GA 4KFQA 2Q2AA 4IGTA 3IO6A 4LVQA 2P6SA 2M1BA 2VOZA 4QFLA 4WX9A 4MBPA 2P6TA 2X7QA 4DZ1A 3V83A 2IA1A 1MM6A 4KMFA 2JT1A 3G7WA 2JRTA 3PUWE 5FFZA 2V1DA 2PBIA 2A61A 4ZEFA 4JBZA 3K0VA 2DK8A 1AL3A 1JW4A 2I48A 2HDCA 1EH8A 2XX9A 1T6SA 2VN2A 4KR5A 5E17F 2P0SA 2CMOA 3P7NA 4P55A 4F3BA 3GBBA 2DI3A 2QBYA 2ESHA 4GGGA 4HYEA 4ZYHA 3B6TA 1W7PB 4BH9A 4KCDA 1QZYA 3K0LA 4ESWA 1NKXA 3H3ZA 3DP7A 1A55A 4PZJA 1BI3A 3VLUA 4ZZDA 5DVFA 4Q5SF 1P2FA 3C32A 1BC7C 3KGCA 3PMWA 1S29A 4ELQA 2XRNA 4KIGA 1ON1A 3OV8A 4M9SA 3V4GA 1DPEA 4JWOA 3QUFA 5CVVA 3O66A 5TPAA 2CGPA 4H0WA 1QO0D 2DWIA 2GA1A 4GL0A 2FRHA 3R0JA 1IN6A 1MKMA 1D3YA 1BIBA 2K86A 3HOSA 3RTFB 1FQDA 1S7AA 3BWGA 1B0HA 2G29A 3IJXB 3FVGA 2ZYNA 4G94A 3K1NA 2D1HA 1MGTA 1JETA 1ZJLA 2V3TA 1MY2A 2O69A 1UCRA 3RPUA 2Z22A 5ERIA 5KDTA 1IEJA 1USYH 2V93A 2ANJA 4GVOA 4HQEA 2DE4A 1IUDA 4R6YA 4RAYA 5AIQA 1HKQA 4EQ9A 5ELVA 4P0GA 2OAZA 4BHPA 1ZBMA 4OQOA 1P4WA 1SFXA 3TOBA 3IHUA 1ZH5A 1RIOH 4RPNA 3OO7A 4HF0A 5CVUA 2XKPA 1MM7A 1I27A 3WAFA 2KIUA 3OSQA 2Z5UA 3W9WA 2Y0MA 1PUEE 5IT3A 4F19A 1EH3A 3MAMA 2PYYA 3V8LA 3PUZE 5I2KA 1ATGA 3MQ0A 3CG3A 2WWYA 1FP2A 1MH3A 1RZ4A 3ZN0A 3ILTB 2O0YA 1ZRCA 4MNUA 5DVIA 3FMQA 1XCVA 2DPUA 2FNCA 1TLHB 3DPTA 3FD3A 3FF5A 1UTBB 4Q0CA 1II5A 2R9JA 3CTAA 3M8UA 2A5YB 4QWQA 2GHAA 2DLLA 3QUJA 3U1DA 3RYPA 1YTVA 3KOTA 4OERA 3COAC 2O7IA 3O28A 2UVIA 4ENNA 1SYIA 3DF8A 4DQ2A 3WTUC 1J0RA 1XCBA 1OIBA 2B3BA 3T22A 1W5SA 4PCQA 2ZNUA 2HFHA 3SZPA 1PDNC 1J2XA 1JEUA 2OCUA 1S7YA 2UVHA 5FHNA 3GF2A 1Y20A 5LHHA 2F36A 3I58A 3AXFA 3DLNA 3GLBA 5HS9A 2ONSA 5LOMA 1JHHA 2ZNZA 1SI0A 3VLWA 3MEXA 4PETA 3LR1A 5CM6A 3EHUA 5DD8A 2F2EA 3T5XA 1NMUA 3RN8A 4X9TA 4GQOA 3MJNA 3BDDA 3VFZA 2O7UA 3OOPA 1KYWA 2BEOA 1MQIA 4WEDA 3PQJA 2OBPA 2PLYA 5BOXA 2YX7A 1MDP1 4KIFA 2LNBA 1ZG5A 1FQCA 2V25A 4BQAA 2K27A 3DV8A 4QRZA 3FM3A 3B7DA 4I62A 4F1UA 1Z7ME 3LAJA 5D6EA 4OEVA 3BP8A 4CXFA 1PP8F 1FYLA 3T8TA 4MGRA 4OFLA 1XDSA 4XTCQ 3HRSA 1URGA 4RGSA 2O51A 2QSXA 5ICGA 2P5KA 3ZMDA 3WGIA 2H6BA 1MXZA 3W6KB 1BTJA 5E8IA 3KZZA 2F6PA 3KEOA 3HO7A 4RPOA 3HIFA 3EYIA 1QUJA 2V3UA 4GD5A 3R4KA 1MQHA 3I64A 4BXUA 3CR9A 1LEBA 3JAMZ 3P9KA 2QS1A 1XVYA 5DYHA 3K2DA 1K78B 4ZZEA 2KRFA 4NWCA 2H5YA 1J59A 2F5FA 2EJRA 3RQTA 3RIRA 4UVCA 1MJBA 3HHFA 3THIA 2XVCA 5J1DA 3G3FA 4XIGQ 2KIMA 2RDPA 2ZNYA 3BJ6A 4HCWA 1Z7NE 3QYTA 2DE3A 3HSFA 3T8RA 3WU0A 3H6VA 4ENJA 3U94A 4ESJA 3PUXE 2VT3A 2RC7A 4U88A 2F8DA 4F3GA 4CGZA 3M8FA 4DIGA 1QPMA 4U0VA 4OEUA 1DDNA 3W6JB 1TQPA 3Q29A 4WXCA 5LLQA 1SD7A 2HAUA 1FBUA 5E1XA 1I69A 2O61A 4CZZA 3KP7A 1G3WA 1N0TA 2XGXA 5D4SA 3MCZA 4H65A 2J5PA 4ELOA 1AOVA 2DWHA 3L00A 1LB2A 1DSNA 1R36A 2DAOA 3J81Z 1BKAA 3UN6A 3QU6A 4F2QA 4RB2C 2VD3A 5J8CA 1VSOA 2XAGA 2YR2A 1IXIA 2F5CA 5ICFA 3JTGA 2FMLA 3E6CC 3V8KA 1TNSA 4FX4A 2AS5F 3U93A 1URSA 4BDOA 3K1MA 4R73A 3K1PA 3AAFA 2NVUB 1LBCA 2E7WA 3MZHA 2HZKA 4POXA 5L9SA 4EGYA 4PFYA 4FEDA 3WGGA 4ZECA 5I57A 2OQRA 5H8HB 2KKOA 3Q27A 4MH5A 4X1DA 2O84X 1WRJA 4AD9A 2E1SA 3QSLA 4HX4A 1Y4CA 1ON2A 5I2KB 5B7DA 2HOEA 1XOCA 1TNTA 1Z91A 2E7XA 1SQYA 4RNSA 4YB5A 4EDPA 3E97A 2F6GA 2R7FA 3HTUA 3SEYA 5JVTA 3TTRA 1B3EA 4YB6A 2K02A 3VVDA 5AA2B 4ZYGA 4FIMA 2V9VA 1NHAA 2ZMEB 1HBXG 5JK4A 3MVXA 3B6QA 4TV7A 1LVAA 3TQWA 3ISPA 4H8IA 3J80K 3FXRA 4G6QA 3Q26A 2F7BA 4C0RA 3G3IA 1GXQA 3ML6A 4RA1A 5ILVA 1WODA 2PVUA 5KDTB 4ELPA 4XKNA 5ED4A 1MRPA 1ZN2A 4R2FA 5HDKA 4EJWA 3SKPA 4I98B 1B6AA 1B59A 1YIOA 4KMUX 3SZTA 3WTWC 1QULA 3K6VA 5CYVA 4GWOA 4I2OA 3V7RA 1UB9A 4G7OF 1O3SA 2DQRA 1HKSA 2Z33A 1PBPA 4LATA 1U5TB 2A6EF 3KN7A 4RY1A 4YB7A 4ISUA 3L7WA 3MW0A 1D9YA 1IZ1A 4IO7A 4DDDA 5H8HA 5HDNA 2DFIA 2GZWA 4BYYA 2PJPA 1R58A 3SFZA 2HEUA 4U1ZA 1TT1A 2XAFA 2ZXJA 5D8KB 4HV6A 1DOTA 4O3CA 2STWA 4FATA 2PN6A 4ZEKA 1B7HA 1DUXC 1A8EA 4YU0A 1B4AA 3WTZA 5L3GA 5L9OA 2HR3A 2R3SA 1VFDA 1ZHFA 5LEJA 1BM9A 1QBJA 3T96B 1USTA 4UV8A 3BZ6A 3TZAA 4WEPA 4LB6B 2ISZA 1Z9CA 2BYVE 4Q47A 2O03A 5E20A 1FYMA 1BBYA 4ON0A 1A8FA 1R00A 3JZJA 1TQIA 4DCXA 1PEBA 4U4XA 3RY3A 2XROA 3FV2A 4RGRA 2QS2A 5DV5A 2QL3A 4NF6A 3T1BA 2GIVA 2HYGD 4O3AA 3DEUA 2OZZA 2Q88A 2REJA 2RINA 4IO2A 1MPBA 1PBQA 3IB2A 3T9HB 2A5TB 1XT8A 2FNPA 5KK1A 2O1LA 5FD5A 4LLGF 1PDAA 2QS4A 2HFBA 3E5UA 2DK5A 1O7TA 1D8JA 1W5TA 2QVOA 2QM3A 5DDGA 3H03A 1UFMA 4QSEA 2DO7A 1Y9UA 3C35A 4OU0A 3N94A 1G4DA 3SHFA 2HXWA 2IPQX 4NB5A 5DEQA 2Q8KA 2PG4A 5E8GA 5CRYA 1IN7A 2OWSA 4GFRA 5LRSA 1B1BA 3LSXA 5K2YA 2RF1A 4HX7A 4CHUA 5D8LB 1T0KA 4HX8A 3BFUA 4PFUA 2NNNA 3F23A 2RN7A 4AQ4A 3NQOA 3GXOA 1QQIA 2FBHA 5FTHA 4JBAA 1QJMA 2RGVA 1HW5A 1I6XA 1WDNA 4R9FA 4LGWA 1DMBA 1H43A 2I0CA 1HXDA 3TTMA 1RUOA 1ZMGA 2LF7A 3FVNA 4F29A 4OMZA 3TCGA 1WKMA 3I71A 3S9EA 5HLIA 4UXNA 3BFTA 4XSZF 3RTWB 1FYKA 3BJAA 4GIZA 1YLFA 4OMBA 2A6HF 4LJZF 3HN0A 1W7PD 1PP7U 4R1HA 1TTYA 1R9LA 3V8XB 1XGOA 3DXJF 4ENKA 1DPUA 3T66A 5KZTA 4PDKA 1A54A 2IA0A 1QNTA 4ZYDA 3K4UA 4HQMA 3KP3A 3MP1A 1IXHA 1ZAOA 3WGHA 4M1VA 5CLSA 2HEOA 4R79A 2RCAA 2QQBA 3SEVA 4A5MA 3QP5A 1N84A 4O5VA 3PUVE 4NTLA 1ZRFA 3F8BA 3KFMA 3TDUC 1NFTA 2DE2A 3O3KA 4XKQA 1LEAA 3VODA 1J5YA 4S05A 3CFXA 4A0ZA 5TJJA 1S3JA 4DCYA 2F5DA 2BJJX 5CC2A 4BHCA 2LAOA 4FJPA 1F9BA 2XAHA 3S2WA 2NWJA 2FA7A 3K2ZA 2HZLA 1U6GA 5KCJB 1SW2A 2NXOA 3Q25A 3R6SA 6PAXA 3MWBA 2FSWA 1US4A 3DKWA 3TCFA 1H0MA 3A3CA 3IWZA 1Y3QA 3TQLA 3ZMUA 4KYWA 4OIOF 4A0YA 1GR2A 1B9JA 4YKKA 4GCVA 3OD7A 2L3DA 3WG9A 2XX7A 3ABUA 1F4KA 4OIQF 3CUQB 3D5LA 2ZO4A 3FGSA 2YX4A 2M5WA 3EYYA 2IP2A 5IAIA 3I4PA 1UHWA 4QSCA 1S9TA 4R6KA 1OLAA 4L0YB 4B8XA 3TQNA 4UVBA 1LLSA 2W57A 2M8EA 2ETHA 3UGWA 3N26A 4LK0F 1XSVA 5L9MA 2Y7RA 1XGNA 1PB9A 3CFZA 3SEUA 2FE3A 1V3FA 3QU3A 3EQLF 4KIBA 4K2EA 2CQKA 1WVJA 1D3KA 1P6RA 2TDXA 2BV6A 2YJPA 3F3XA 3TKDA 1F9NA 4Y13A 1H3DA 2XX8A 2GAUA 3CSGA 3VDFA 3IO4A 3QAHA 4PGGA 2RC9A 3H7MA 3BOQA 4KCCA 3QP6A 4YIFA 1OQHA 2VBXA 1NNKA 5BPDA 3H6UA 3TOAA 3TEPA 5LBQA 2D1VA 5LGTA 2O8XA 1FQFA 1IRGA 3KJTA 5I2NB 4GRKA 3KN3A 4KHZE 4IPAA 1BOAA 1SFUA 2D3IA 3KZGA 4UV9A 1YQAA 3BPVA 2PQ8A 3GFMA 2L02A 1O3QA 1M5FA 3H3UA 3S9LC 4P9FA 1GHCA 4BDRA 1LAXA 4OIPF 4EF2A 1FW0A 3B73A 4M71A 3P7IA 3MZYA 3TDZC 2QUFA 2W7YA 5DEXA 2QZ8A 4G7HF 3RUMA 4EGZA 1YYVA 2EFQA 1GVJA 1L0OC 1W7PA 2CO5A 3TKYA 1OVBA 3PV0E 1OYWA 3GX4X 2YSRA 3MP8A 1IW7F 1RUNA 2XIGA 2Q2CA 1G3YA 3O6HA 4ZEBA 2DPDA 4XKPA 4Z0IA 3HUGA 3G73A 3S4UA 2DVCA 3CDHA 3JSOA 1PC3A 2PI0A 2M8CA 1AH5A 4L9VA 2Y7WA 3FMSA 4ETSA 5FO5A 4PFTA 1XS5A 4I01A 2XXYA 3H92A 4DXCA 5CVIA 1K6OA 2B3FA 4L18B 5I84A 2O3FA 1FSHA 1S50A 4ZDMA 5CJ9A 1B3LA 3LWFA 3MBPA 3C3WA 3UK4A 1LB8A 2I4CA 5DT6A 2IEEA 1Z7UA 1B2HA 3IORA 3QAXA 2GWRA 2LSOA 2G9WA 3K00A 3K6WA 3BJOA 1LAHE 2D2WA 4OETA 1FTMA 4HLYA 1OMIA 4WKMA 5CMMA 4C1UA 4JWXA 5BS6A 3H6WA 5DYMA 4EF1A 1M5BA 1GVCA 2ZMBA 5CMKA 4HAMA 1BLFA 1FTJA 3RTRA 3D4CA 3K9TA 2PT1A 3FASA 3BY6A 1XD7A 1HSJA 4F3SA 4MQVA 4PGHA 3L6GA 3R60A 3LUYA 4YKIA 1M5EA 1YS7A 1AWCA 3SETA 2F7AA 3RI4A 3IJOB 1MD0A 3FVOA 2IRFG 2MBFA 1O3RA 2MC3A 2HKOA 1SDXA 3PD8A 2X0LA 3O6BB 4HOBA 3IOVA 2EB7A 2ESNA 4NE4A 3N6UA 2EK5A 1KU7A 5F1QA 1OKRA 1Z6RA 2ADUA 3HTSB 2KIFA 4RGXA 2Q2EA 3ECHA 3FVKA 1TXFA 2EWNA 2FNAA 2QBYB 2EV0A 3ULQB 4I8CA 2UXXA 3IB1A 4YMAA 2PT2A 4XLPF 5D6FA 1F1ZA 2G7UA 1AMFA 1MQJA 2NOOA 5CVJA 4NWDA 4X48A 4HLXA 1JHFA 3I59B 3EN3A 4BDQA 1WQ2A 2RQPA 3K02A 1LDDA 4EM1A 3J7AO 2XXWA 3B02A 3PPNA 4R9GA 1KYZA 3HOTA 3EHSA 1FX7A 4KUMA 4N07A 5H8NA 1OQGA 1ZLJA 1R22A 4F18A 2HKXA 4YZZA 1U3EM 4LMYA 1TBXA 1NNFA 4G68C 2UXAA 4O3BA 4G8NA 2I58A 3F8NA 4AB5A 3PPPA 4OHNA 5LGUA 1RYXA 1ZLQA 1H9TA 3MZ9A 1ZGJA 2LKPA 5DVJA 1R1TA 1NL5A 5FHMA 2XXUA 1UIVA 2I0BA 4YMBA 5D5WB 2O6AA 3ZMZA 2F78A 2AL5A 3MPLA 1A04A 3MZ1A 1LFGA 2R71A 1TFDA 4HBLA 4P9UA 4FORA 2EFOA 1FY7A 5DEXB 2XXXA 1TFAA 5LRRA 3RPWA 5CMCA 4NF4A 5A2QZ 2VHAA 5H8QA 3ZS6A 4LQ2A 3K6UA 5I57B 1MPCA 1IXGA 2ISYA 4ZZAA 1YFHA 2Z8EA 1DTGA 1MDMB 3LA2A 2QMXA 3KOSA 1FWZA 1QUIA 5AIPA 2THIA 2OU2A 4EUOA 3OELA 2JZYA 4FHTA 1NNPA 1D4NA 1R23A 1IUYA 3VE1B 3GO5A 4H0EA 1QKBA 1CGPA 5DUIA 3D4GA 1MXXA 4ZEIA 1IN4A 4KN7X 4WXDA 4LONB 4GYGA 1R9QA 4GO1A 2PBWA 3RT8A 1U78A 4DLDA 1SMYF 2EV6A 4PFWA 3F22A 4ZH4F 1I5ZA 1LBBA 4YFKF 2PFBA 2YPRA 4PE5B 4H5FA 2QQAA 1XMAA 3TO9A 4OINF 1CF7B 4KD5A 3IRQA 4ZE8A 2CFXA 3CLOA 4LB5A 4LP2B 2RKHA 2CG4A 4JSDA 2COMA 4S04A 2ONRA 3TODA 5H8FA 1D5VA 3CUQA 4GLIA 3FJ7A 3Q5FA 2RC8A 4XRFA 1LFIA 1SD4A 3G3HA 2WC2A 1HQCA 4IHSA 2IJLA 4RS8A 3U9GA 3TCHA 1BN5A 1Q35A 4EJVA 1LNWA 1LSTA 1H76A 1K79A 4HV5A 4A6EA 2FA5A 2XXHA 2BGCA 2Z23A 2Q9TA 4IGRA 3OOAA 4KYEA 3LQRA 2GXGA 2F34A 3Q9SA 3KP4A 3HPIA 1O3TA 2DOJA 1N7XA 2P1SA 1NH8A 4MF3A 2Y84A 2C6YA 5D5XB 4EM2A 4WF2A 1XGSA 1YW7A 2XD3A 1V4RA 2ZNTA 4NEDA 2MLKA 3F21A 2FEZA 2H98A 4IVNA 1WI9A 4IB2A 1FCKA 4U23A 3LC8A 4YKPA 3BPXA 3I6VA 3C34A 1MPDA 1XGMA 3N4MA 4OESA 2QJEA 4AB6A 3L09A 4RK9A 4IRIA 3UA8A 4YG2F 2MLGA 4H8JA 2FBKA 4JWYA 4NQWA 2IT0A 3U8QA 2H25A 1MXUA 1DPPA 2ACJA 1L3LA 4I0BA 1IXRC 1MXVA 3LSLA 2QMWA 3V7CA 1LDJA 3TTKA 3UP9A 1S8NA 4I02A 1Z05A 3FM5A 3IX1A 2XD2A 2VC0A 3HSRA 4YFNF 1IN5A 1MY0A 5EHSA 2GQQA 3O97A 3VOEA 2FU4A 3M1EA 3WTXC 1SAXA 1CF7A 1VE4A 2OZUA 1YO5C 3C36A 3G3ZA 5HS8A 4KYDA 3CG1A 4N13A 4MEYF 4OYVA 4Y17A 3VFJA 3C7JA 1G3TA 3GZGA 2KJBA 4EV0A 4IY5A 3QXMA 3ABTA 2QQ9A 2GFEA 1SMTA 5K5OA 2VGQA 3ZMVA 3ELKA 3M3FA 4Z7EA 3WTTC 2Q8JA 4Q48A 1Q1HA 1FPQA 3QIMA 5FLXZ 1KQ0A 1YS6A 5EEHA 1T98A 1M5CA 1QZZA 2YPNA 4BLAA 3VXCA 1KU9A 3VXBA 3KETA 1G6NA 4IXAA 4UA8A 4L5IA 3CSBA 1R1VA 3KG2A 3ZKKA 3IL1B 1OPCA 3K01A 4H5GA 4QHQA 1T0FA 4EXLA 2XHDA 3R61A 3R6UA 3A09A 2NNYA 4LG0B 4YICA 1QKAA 4RGUA 1OYIA 2DBBA 4QFOA 1ONVA 3P9CA 1T38A 3OMBA 5BWJA 4KI0E 2FOKA 2K7LA 1P99A 2ZNSA 5F7VA 4IO5A 5J6XA 1MY4A 3Q9VA 3ZMTA 1E17A 1N3WA 4GL8A 2F5EA 1EZOA 1YAEA 4CYDA 4M4GA 1STZA 3C31A 4ESBA 1ULYA 3CVGA 3KEQA 3IAZA 3T9XB 1JVXA 3PMXA 3Q28A 2AL4A 4EQ7A 2PMUA 4R72A 3GZ5A 5CMBA 4GXSB 3CFLA 2IA2A 2Y48A 1B7UA 3EF7A 4K3FA 3C9HA 4LZ7A
chains in the Genus database with same CATH superfamily
2B9SA 2OD5A 2X1CA 3H06B 3W15C 1JGSA 3C18A 3LSIA 4L5JA 4RMNA 2GXBA 4A3CJ 1IQ7A 4NF5B 1R1NA 4KN4X 5IYDJ 2BJIA 3SESA 3RPLB 1VQOI 1QZEA 3FV1A 5EHMA 1YE9A 3PUBA 2FBPA 2OZ6A 3A3UA 1ELJA 5L3DA 4GYIA 5H8NB 5JLWA 2L9SA 1LPQA 3CRBA 4LITA 1FOKA 4NF8A 5FB2A 1MNEA 3PIOF 2WBBA 2V3QA 4OENA 1YOVB 1UIUA 1WJEA 2R92J 2VXZA 2VOOA 1AIVA 2YU9J 1Q1KA 2UZKA 4KITB 3QOPA 3WU1B 4BDZA 2PMHA 3K4JA 4EJTA 2IA4A 3E6BA 1SW1A 3O6IA 1CE2A 3KLOA 3GVAA 3TYHA 2E1OA 2ZXIA 2JVGA 2VJJA 4AVPA 1FTZA 1I3QJ 5IT9Z 2W7NA 1Z6TA 1Y1ZA 4ZS9A 4Z2YA 4AYBN 2F7CA 1MY1A 3AG1H 2CJJA 2DMQA 4AIKA 1MH4A 5HOOA 2M87A 3KLNA 3REOA 4XOTA 3RKQA 4CO8A 1NUYA 3G3GA 2WV1A 4XSXF 5I56A 2YUSA 2LR8A 2IGMA 4DE8A 4FEBA 3KC1A 3S9MC 4IQJA 3MUQA 3ODBA 4OANA 4GWXA 2LF8A 3GWZA 3BR0A 2XHKA 5KVRA 3SQNA 4AIJA 4D9JA 4L9NA 2KMUA 2L54A 2M45A 3DCFA 1OCTC 3F8FA 5H8SA 5CVRA 1P7JA 3LSJA 4IHWA 2FQ3A 1U2WA 2I49A 3FHZA 4HDVA 2WBMA 4MQ9F 1AU7A 3DP4A 3DM0A 1KA0A 2W24A 4FTHA 4ZDOA 2Q1ZB 5I59B 1FC3A 3FIRA 3BQYA 3I54A 4G2ZA 5HM4B 3I53A 4ENMA 2DMPA 3X2QH 1MS7A 1O7FA 4PSWA 4ZC3A 1ZKGA 4I0AA 4QSHA 3R7XA 2ZYOA 3CP8A 2QA4I 1IIWA 1SANA 1MY3A 3N6TA 4QSDA 1RETA 3KP5A 1J75A 2UYEA 5FHMA 1HW1A 4MEXF 3JRHA 5DD4A 3ZQGA 2ZJPF 1Z7LA 3FXQA 3ERED 5E1ZB 1B9NA 2OWTA 2VBYA 2MD5A 1Y39A 1B4ZA 3MVYA 3BROA 2B65A 3F8CA 3PM1A 1X4PA 3E4RA 5EZGA 3WTVC 4PQJA 1DK4A 3LBSA 5DUKA 5DCMA 5AA2A 4PK4A 5GP9A 4F2OA 2MH9A 4ANJA 1USSA 3CIJA 3MQ9A 1EF4A 1IMBA 4O7IA 3R0AA 2PMZA 3BKIB 3TUSA 5BPIA 2NUVA 4I1DA 1ZYRF 3VYSB 2ZJRF 4N91A 3SEWA 4R74A 1KQ9A 4U7DA 1IAWA 5J8FA 3RYDA 2X51A 1IGNA 2G93A 2FXAA 3BR5A 4FE7A 1J7KA 1TW3A 2FMYA 2PJRA 3PQKA 1L5TA 4XBFA 1PUFA 2HPIA 4OIRF 4I3EA 1KWHA 4RDUA 2XAJA 1JW5A 2YLNA 3BQZA 1R49A 2RCBA 5B70A 1OCZH 2XKOA 3DQVC 2BHYA 4E7KA 3IOWA 2HCAA 3HC7A 4OOIA 3O9PA 4U4SA 3UKGA 3HOUJ 2PX1A 2XXTA 1Y56A 4IRHA 3H6TA 4LQ5A 1V55H 1JT6A 4A3FJ 1ZG1A 1IN8A 2R7UA 2P8TA 3LL7A 3J7YJ 2DS9A 2BY3A 1WH5A 2DSFA 1KQ8A 1PB8A 1NV3A 5L3EA 5EG0B 2UWMA 4MIMA 3M3LA 5BMZA 4GBWA 4MFIA 3LQQA 3OYJA 3ZN1A 2H09A 5JFRA 1MG1A 3MVZA 5I56B 2OQGA 4IZZA 4DI3D 2LDUA 1JXSA 5LHGA 3H4ZA 3PUYE 4TLMB 4O3MA 1P1WA 3PD9A 4M3DA 1DCUA 2VKEA 3WAEA 3KSXA 2CQ7A 2MABA 2V1NA 4QFNA 4DXUA 4L0ZB 4ONYA 2Y7IA 4HTGA 1I39A 3N05A 1OR7A 4WK8F 3RDIA 3BIHA 2WV0A 3G1OA 1URDA 1B7ZA 5ET8A 2LREA 2CU7A 1YI2I 2I3WA 2QRYA 1XSDA 1OJLA 2UYFA 1P4XA 3M7GA 4ZJZA 5ICTA 3H9QA 2OBGA 2DWAA 3T93B 3FXUA 2KJCA 2QVVA 2EZIA 1GV8A 4M73A 4MFEA 4KICA 3KFWX 4F31B 1EZ9A 4Q8RA 2KIQA 2REGA 3MWMA 4NF8B 3O29A 5IYBJ 2KDZA 4H45A 2MA3A 1J9IA 3S9NC 2L01A 1I1SA 4ZZLA 1YW9A 3WTYC 3ROUA 4ELRA 2CZLA 4A5NA 1ZKBA 2Q0OA 2VIXA 1EA3A 2X1EA 3PFIA 1B4HA 4PAFA 3GCMA 1YHQI 4BDNA 5A2QK 4FX0A 4XK4A 3TBIA 1R5GA 1VQ6I 1CB6A 1MXWA 4P96A 4BNCA 2X4HA 2VI6A 1XC5A 2VUMJ 3B50A 2QQ8A 3MP6A 1R7JA 1BP5A 2HVRA 3IR1A 4ESXA 1FTAA 2ZBKA 4L5EA 1U8RA 1YCJA 2E0SA 4OZ9A 2P2AA 4LIUA 1MXYA 1WWXA 3OYAA 3K69A 1LE8A 3UORA 3KIOA 2K4BA 4HW0A 3PSFA 2WYKA 5EEGA 4I76A 5F64A 4BHBA 5TRDA 4P1EA 2K9LA 4N4NB 4YAHX 2Z16A 1USYE 2IXSA 3TMGA 2JTVA 4JDFA 4LK1F 5K7ZA 1DPRA 3P9IA 3TO7A 2WTEA 1B51A 2F35A 3OYCA 2H9BA 5FD6A 1WZ2A 1FSEA 3QWLA 5A5LA 1EH6A 4XLAA 1SFEA 5ICEA 3KP2A 2DYXA 4RJZA 4DNCA 4LG3A 4XONA 1RESA 3H5AA 1EU8A 5L3BA 4RAZA 4G8XA 3PO2J 1B3HA 2OLBA 2FBIA 2HAVA 2E1NA 4ZYEA 3PU5A 4JB7A 1MQDA 3B6AA 3A03A 1AA7A 4HS7A 1BI0A 2VJIA 4N6DA 5EQ8A 3IOUA 2XSJC 1ZU0A 2DFFA 3IB0A 4ZE9A 1MJ9A 1BIAA 1XSXA 3FMRA 5KCMA 3JTHA 4H4KC 3GYHX 1K4TA 1FQBA 3ESWB 1LBZA 1QW0A 2HYJA 3OWTA 1U0JA 3NRVA 5IKBA 4IF4A 5KCJA 3LAPA 1LKXA 4I99C 4KFCA 4C2UA 1UTHA 2GH9A 3HEFA 3HRTA 4IQ4A 4L9TA 2CV0A 4HW8A 5AA2D 2DQVA 4Y4RA 2O6GE 4XR6A 1B3GA 3HHHA 2W25A 4N6KA 3ZSFA 1TL8A 1QVSA 1N04A 1VQ4I 3CC4I 2Y7PA 1I6QA 1PJRA 4A6DA 1OMPA 1IV8A 2L7ZA 3GTPJ 2E34A 2DXRA 3OSRA 1IXCA 2X1DA 3HG9A 4Q30B 4U0YA 2HQRA 4EXKA 2HQAA 1OCOH 3FJGA 3EPEA 5AONA 4RYAA 5EGOB 2E1MC 1P7IA 3V89B 2DCEA 3OXNA 2JWTA 1XMXA 3QPLA 5LGNA 5ISUA 1BI1A 5FRMA 3CMEI 1RDZA 4TLLB 5IOZA 2VBZA 3SDFA 4G9YA 4PUSA 1BIYA 2XASA 5IYCJ 4G6TB 3QQAA 4A3KJ 5JI6A 1QRYA 3RKYA 1VTNC 4WXHA 3ZQ7A 3V8JA 5A5XB 1D0ZA 2NOJB 3DKYA 4E70A 3EKIA 4XF5A 2L4AA 3L2QA 1HDPA 2MSYA 3QK6A 4OTEA 2Y75A 4M9ZA 1X3UA 2P7CB 2WY8Q 4GXOA 3OO6A 2E35A 1W36C 3V7SA 1GV5A 3L9FA 1MBGA 3TO6A 1G0HA 4PBQA 1FTLA 1LVKA 1INPA 1KA8A 1X3WB 4W1UA 3W3CA 1WI3A 5HVQC 4KA4A 2DXYA 1FTOA 2KPMA 2ZZWA 3OOUA 1QUKA 2CZKA 4ZEDA 2Z9OA 2R7XA 3ZPLA 4NC7A 2VE8A 1FBCA 1OVTA 5M3FJ 3IOTA 3USDA 4GFBA 2NS8A 3NEUA 1G3SA 4EJOA 1BL0A 3JRDA 3BCAA 2DWJA 4MTDA 4HCYA 2ZJ2A 4S0HB 5HDGA 2ABHA 4XLEA 3NOHA 4I9DA 1O63A 3E6DA 1X1DA 4F1VA 3TTNA 4M6XA 1O64A 1WJAA 3I5OA 1ZRDA 1FBQA 2JJ7A 3W2VA 4RB0A 5DTDA 4PP0A 3FISA 5AA4A 3CCVI 2FYIA 3HHGA 2AXTC 1HKTA 2ZSHB 2NAZA 5I58B 2NYXA 2ID6A 2P0WA 4THIA 2MC4A 1LBXA 4NAPA 4E0XA 3RPQA 1MDMA 1EH7A 3K70C 4N8YA 3GTQJ 1NH7A 5E79C 4J00A 3UIFA 3CF2A 1B52A 1YRNA 2XAUA 2BW3A 2XWIA 2DP8A 1ODDA 3LSFB 5FHOA 3W9VA 3IL2A 1FTKA 4LA9A 4P0GA 2UUZA 4XKWA 2Y5KA 2DN0A 2HYFA 2HPMA 2VQGA 3MFKA 4JSOA 1R1UA 3I56I 1REPC 2WAFA 1LQ1A 1G0IA 1R4NB 2CEYA 2X7PA 2XA5A 4MLVA 4OAYA 2DJIA 3EHTA 5H20A 4X1BA 1E3HA 2QSFX 5K5RA 1FBDA 1RKMA 2FOWA 2Z3YA 2UVGA 2QGUA 2Y9ZA 1IF1A 1D8KA 2NRAC 4AVZA 1MQGA 1P1OA 1H88C 3K70D 1MBJA 2BBYA 2CW0F 4F52A 3HOVJ 4IJAA 2PMSA 3TL4X 2DT6A 3RJPA 3ONMA 4U7BA 1LDKB 2F5XA 5LEKA 5K1YA 4A12A 2G7HA 2D21A 1T95A 2CW7A 2MW8A 3I5UA 4OFJA 3N97A 3K6XA 3LA3A 1HW2A 2R4GA 4G68A 2CYYA 4BS9A 1UZCA 4G4PA 3PSIA 4NMYA 1B5JA 2W1OA 2JUCA 4G7ZF 4WWCA 2P7VB 4GWSA 2P5LC 4MEVA 4HF1A 4ABZA 2ELHA 2WB1A 2X48A 3JRFA 1FBFA 3LSGA 1ENHA 3K4BA 1B5IA 3CD6I 5BUUA 4HNTA 3O8HA 1FOYA 2EA4A 3S15J 2DVZA 4KQPA 2E36A 4L9JA 4V2FA 2ZYKA 5IPAA 1SD6A 2XV4S 4X6AJ 4H46A 3DKXA 4NF6B 3DPLC 1NNTA 1Y3NA 1XC1A 3C1DA 2HQ0A 2J5OA 5LHIA 1X2NA 2DA3A 2ALUA 3LV0A 2Z8FA 1EV7A 4EQQA 3F8MA 4RXLA 3KJ7A 1ZARA 4WCGA 2JN6A 1B1HA 3IKTA 3QPHA 3CI8A 3PTYA 1B5HA 2E1MB 3K6GA 5CBSA 5GPAA 4QXDA 2WADA 4HG2A 1WSUA 4NC8A 3ASNH 4E7SA 2STTA 1X1AA 1FLIA 1DBZA 3HM5A 5E1WA 4RB3C 3K10A 2XXPA 3CJRB 2HU9A 1YTYA 2LOOA 1FSAA 3MKWB 2ID3A 3M9AA 5L8DA 2M9HA 3E3VA 2LYCA 3E7LA 3O2PE 4BJ5C 4BAYA 3TELA 2PX9A 2PFZA 3KZYA 3T0YA 2R5ZB 1Y1VJ 2DA7A 4N6PA 4UACA 1YX3A 1JKQC 1ETQA 3CMAI 1IDZA 2HPGA 2L4MA 5B1BH 2VD2A 2EH3A 1MZBA 1FBSA 3HRMA 1SI1A 2R7DA 4NQ8A 3ECRA 3RT6B 1ITYA 2DA5A 2I6EA 2VP1A 4XN0A 1JJ6C 2HZTA 5TPAB 2KHMA 3OIPA 2GBYA 3EDPA 3I3LA 2EV5A 2DOAA 4GWUA 2F4OB 2DT7B 3L2CA 2JPCA 5JHFA 4J01A 3FHNA 1Y3PA 4UHTA 1BI2A 2COBA 2XRLA 1RYOA 2ONKE 4D1QA 1HSEA 1B0LA 2UV1A 2DW4A 4CCJA 1VNDA 2Y0SN 2L0KA 3DTKA 2ZXTA 3SERA 2CWEA 3ERMA 1KONA 3QRFF 5HBCA 3E13X 1O57A 3AG2H 3KP6A 5FFXA 4EM0B 3T9UA 2K4JA 3LA7A 1B8IB 4TQUQ 2K40A 1M1EB 4IO4A 4PCDA 1LFHA 2RQQA 3VV5A 2OCEA 2IW5A 2HVSA 1KZHA 2KLOA 4XLNF 3M07A 1NUWA 5AE4A 2A3SA 2V7FA 2XXIA 3OR2C 1RNLA 4MTEA 3NWSA 5D5UB 5M2VA 4EJUA 3CCRI 3F11A 4M6YA 4LD5A 3FXLA 3IFCA 4F55A 1H44A 3WE2A 4DBRA 3S17J 1VFCA 2RV8A 3FWEA 4KDPA 1B72A 4PJMA 1LCFA 1ZQ3P 4AC0A 2RVCA 3M8JA 4RM3A 3JRCA 1ETKA 1MBEA 4ESFA 2D5WA 4NGUA 2EFPA 4JX4A 3IC7A 1NV0A 1JUSA 1MMNA 3F0CA 2X9DA 4M3EA 3JSPA 3I0TA 1N78A 1B1XA 4E6KG 3OYEA 2ZXHA 3U1OA 2Z99A 1E2XA 4G12A 3RLFE 2IVMA 1VQ9I 1JEVA 1MBKA 5JEIA 2JSCA 1B32A 4GXAA 1U5TC 2VODA 1A7LA 4A3IJ 4QFPA 3OYGA 2GHBA 3PMVA 2MYSA 2ZCWA 3U2RA 4QBAA 2KFDA 2ZMEA 4DGWB 4FASD 4LLNA 3OENA 3MD2A 1IRXA 3S2VA 5I59A 3ECOA 5EYFA 2OF7A 3TGNA 4IEJA 3VSLA 4P3LA 5F6FA 1SD5A 1JKRC 4BUPA 1POTA 5FJ8J 1P92A 1POGA 1N76A 3N5LA 3EETA 3CHGA 3BT9A 3G2BA 2H6CA 1P1UA 3E79A 2WKYA 5JTYB 1ZK8A 2LY1A 1B3FA 2LBFB 1Z77A 2R7ZJ 3M3YJ 1O7LA 2RC4A 1XHYA 2AXLA 3HFUA 2A5WA 3JYRA 3OEMA 2XUBA 3LFKA 5H2FC 2JA6J 2JA5J 4D0PA 1UHMA 4HXVA 4L17A 3RNNA 1I6AA 2EA2A 1LB9A 1Y4TA 3GXAA 4FBPA 2W84A 3BG6A 2OCCH 3KSJA 4TOZA 5IZ3B 1I6BA 1GGGA 4UNOA 5TP9A 2K9NA 2I4BA 3IH2A 5ESYA 3EPZA 4OVTA 4OMYA 2P5VA 4CCMA 2VLAA 4AWXB 2Y7KA 1S6LA 3RZOJ 2O1MA 4N0BA 2FHYA 2BHZA 4C2MJ 3RYRA 3HYIA 4Q4ZF 1FQAA 1HSTA 1QGPA 3AG3H 2A69F 3DBHB 1JE8A 1YZ0A 4EMSA 1OYYA 1YPNA 2Q89A 4JK1X 3GBAA 1D9VA 3OEKA 2CSOA 3VB2A 4IRGA 3GFJA 1K9YA 5AA3A 1NK3P 2OA4A 2O68A 2YU3A 3V42A 5F0HA 5FKKA 2HQNA 3GFIA 2LC2A 4EVIA 4AIHA 1P1NA 4POWA 2IBDA 4PGNA 4U1OA 3CJTB 3E5XA 1B46A 1QVUA 3CJNA 3LMMA 3RPLA 1LGBC 2QS3A 3C4MA 2HS5A 4NF5A 2NS0A 4GOTA 4CCNA 4CICA 5L3CA 1IMDA 1WJDA 1S7OA 4P5OA 5ILSA 2EFWA 4QLCU 2H27A 4G68B 4OWDA 1J1NA 2DQLA 3TPAA 3ABLH 1R4MB 4N9IA 1A5JA 1FNNA 3D0SA 3F72A 3DP8A 4P0IA 3S3OA 4Y3OA 5ICCA 3CO7C 1PB7A 1LCTA 4DXBA 4KISA 3M4OJ 1IDYA 1YW8A 1EZPA 2HDDA 2E71A 2QSGX 3G3JA 1TWHJ 5H6RA 1JI8A 2BE5F 1KU2A 3HSTA 5IP7J 4MLQA 4MNPA 3E9XA 2W85A 3FZVA 4HZFA 4X1EA 3O8GA 3VVEA 3S32A 2V79A 5KAIC 4R75A 4OVRA 3B6WA 3DLLF 3E3KA 3UNGC 4NHJA 1NV2A 5F1RA 4H1XA 4OVSA 4G8MA 4B09A 3F6OA 2XXQA 3IAM2 5HNFA 1A6QA 1MMSA 1ZTYA 1B58A 3MVWA 4MLOA 1ZLKA 3VVFA 1Y1MA 1ZREA 3HCQA 1K78A 2GA2A 3OL3A 1FQEA 4GX4A 4LG0A 5FLXK 1M5DA 5HS7A 2A07F 4UVAA 1KZ8A 3PPOA 1R6ZA 2RKMA 4HDUA 1OCRH 4I09A 5I58A 2DJNA 3TW6A 2LK2A 4A0XA 1GTKA 4D5FA 5AA4B 1SW4A 2DTRA 3FJMA 2PCRA 3DTEA 4LFUA 1IRZA 2HTJA 5FLVA 2L9RA 2L9NA 4F22A 2L5VA 4BDMA 3RSNA 2VBWA 3OO8A 3CMMA 3HSEA 4A3DJ 3U92A 4B3XA 5HLGA 1GDTA 5FGMA 3FATA 1FZPB 3K2AA 4FECA 4F1YA 1Z1DA 5JR3A 3WODF 2DMUA 4BEHB 2M30A 3QMFA 1D1CA 4G8HA 4KYSA 4G6DA 4HSTA 4M72A 5HPQA 5E18F 2LKSA 1N3XA 3KEIA 3IK6B 3HOYJ 2VE9A 4GWZA 1ZG3A 1FP1D 3M3KA 1B9MA 5I2NA 1W0TA 2RNJA 4N9HA 3E6MA 3CUQC 4R6HA 2ZFWA 5JHUA 3GTLJ 2L2OA 4UUVA 1FIAA 1XI6A 3ZP5A 4MMPA 1B05A 2FF4A 1KGSA 2QENA 5TU0A 5CBRA 2DMTA 4YFXF 2DOEA 1GLNA 2ELJA 3ZKLA 4A2UA 1ERDA 3JR9A 5FTIA 2EFNA 4FAJA 2NVYJ 2VC1A 3JW4A 3IFAA 4LUBA 1TQMA 1WJFA 3WE3A 4PJJA 2P4WA 3FX3A 4QTRA 3TTLA 4UB8C 5A5XA 3ILUB 5ET6A 4XKRA 2JPBA 1XN7A 4M74A 1IC8A 3G3KA 4IHTA 4ND9A 5DTBA 4F7ZA 5B5EC 3EUHA 3E5QA 1H45A 3KZIC 5J1RA 1BC8C 1K7AA 2IGOA 4IKFA 2LY9A 3I4NJ 3HOZJ 4MNIA 4FE8A 3GEZA 3JAMK 3FKIJ 3SJMA 2LH9A 3J80Z 4KNYA 1JNFA 2DA2A 2K9MA 1RPWA 2H94A 2Y30A 4ASNA 5ILUA 4R2BA 3DBRB 4I6ZA 2K5CA 3FBNB 4Y52J 3H3GA 3E78A 4M3GA 2WB1N 1HOMA 2HGCA 1VR5A 3G71I 2Y69H 1N77A 4AS5A 1IO2A 2R6GE 2UXNA 1UTHB 1QA6A 1RI7A 2DT5A 1FEXA 1N7WA 1F5TA 1LUJB 1P1QA 4O94A 4N4OB 3CUOA 1IRFA 2QWWA 2I3VA 2A5SA 4H67A 4OA4A 3HRUA 4F3QA 2VONA 1MDQA 3CCQI 2W4SA 2X26A 1H89C 3EQ1A 3LSHA 3MZBA 1A40A 5BNGA 1X4OA 4LIVA 1IXSB 2VKDA 1ZELA 3ZMSA 1LBYA 4AM3A 4XKCA 1MJAA 2VKVA 4RAFA 3GZ6A 3JV9A 3TP3A 2NXNB 4PDDA 3OS0A 1SD3A 1XVXA 2OTLI 1UTBA 2CUEA 4JOMA 1I50J 3FUZA 5L3FA 1YG2A 5H8QB 2DDBA 2HWVA 4R8HA 1VZ0A 3IRRA 3C2HA 3FKJA 4XICA 3RPUD 4BDYA 1F43A 2V84A 2Y9YA 4E4HA 3RKWA 4MX6A 2QKLB 1SVXB 5HLHA 3R26A 4YEJA 1TWAJ 2QLZA 2F97A 4XRSA 3WTSC 1JVYA 1Z21A 3OYKA 1XB4A 2QKMB 1KU3A 1LAFE 4YIIA 1TW2A 2MKZA 1VFEA 2R8TA 1US5A 2OJTA 3C33A 3QPTA 1XTAA 2VT2A 1XDUA 3H36A 1P4AA 3TP0A 5D4RA 3L2RA 2KT0A 4H6DA 3CO6C 1ZGAA 3BR2A 3OMYA 5FLMJ 4JQFA 2XWOA 2GRVA 4HF2A 2A68F 4O6JA 1IITA 2FIXA 4IY6A 1A99A 3HV1A 4KPTA 4IHYA 4F39A 1XOCA 5D5VB 1ANFA 4NF4B 4OVPA 4MHGA 5IZZA 1T2KA 1H9GA 1ZIUA 3LSWA 2AIXA 2XXRA 4HE1A 2PEXA 1UQWA 5H8FB 2A5TA 2AYSA 1TWYA 1GXPA 3VEPA 4I7HA 4P11A 5IT9K 1Y0UA 1H8AC 4BQNA 1CNQA 1DTZA 1C0WA 2K85A 4JX6A 4ECFA 5EDNA 5ICQA 3A4CA 3RGYA 2OK2A 1MMAA 3KCCA 3LOCA 2GQ1A 4IO6A 3HOWJ 4M9XA 1DU6A 3U72A 2BXZA 1R5HA 3MKZA 1Z3YA 4OVJA 1ORKA 4GF8A 5FROA 5J1UA 3B6CA 3GUDA 3KBRA 1AOYA 2ZZXA 3PPRA 4CDGA 2GXAA 2D45A 3PPQA 3GFLA 3KYCB 4U0WA 1JGGA 3I59A 3IWFA 3LFUA 4BE1A 4LLLA 3CMYA 3OYIA 2QEXI 4BDLA 2V1XA 2VXDA 3Q0WA 2KLFA 2ZYMA 1W0UA 3GW2A 1LJ9A 2BY0A 5F04A 2QPQA 3BC8A 4IO3A 3LSTA 4JXIA 4OFOA 4QFKA 5TP9B 3HJEA 3CJQB 5IZ3A 2EINH 1MBHA 5CI5A 4YELA 2Q2EB 4N15A 4U2RA 5F0CA 2Q2CA 4MNCA 2HOTA 4LZ8A 1EJ9A 3I3VA 4U21A 1ETVA 5H6QA 1B6HA 1SAUA 3CF5F 5DCFA 1TC3C 2XXVA 3T9VA 3VLVA 4EQBA 2LBFA 3WHBA 3MC2A 4P8BA 4QF9A 4YKJA 3SEXA 2QCOA 5JTYA 2FJ1A 1DP7P 4U22A 2UVJA 1SYHA 9ANTA 3SXYA 1FPJA 4XXUA 3GLXA 4Q5TA 1LAGE 2VASA 4F3PA 1JQFA 3GTJJ 3RZDJ 3J7AY 1UG2A 5ITPA 2V6CA 3DFGA 1I1GA 5LFAA 2DU9A 1OLCA 2M8GX 3PGFA 4RB1A 2MH2A 3AKZA 3IKVA 3OO9A 2QYOA 2H99A 3F9KA 3AL0B 3M8EA 2VOPA 5IY5H 2MD0A 4FT8A 4JVIA 2I8DA 4A93J 2HTSA 2DYRH 1U5TA 2R7TA 3L6HA 3V5AA 2P81A 1E3OC 3SFIA 3DP6A 4WXJA 1FT9A 4CH7A 1YITI 4Y15A 2F3BA 1SBPA 2WEFA 3TAJA 3AL0C 1XMKA 2XWVA 4OXVA 5K5QA 5DW8A 4NX1A 1BJAA 2Z8DA 3A01B 3MPKA 2OC6A 2OWZA 1YX5A 2ZKZA 3RKXA 3DELB 5J47A 1E3PA 3BBRA 5BQTA 2E1CA 3MAJA 4HA8A 1POY1 2B0LA 2XAQA 3KE2A 5DCMB 3J81K 4XKBA 2H4IA 1NV4A 5E3OA 1B40A 1D9QA 3F6VA 1HSLA 1B72B 3CCYA 1RKTA 4G77A 1SW5A 4E0WA 2V1UA 3O2AA 1W4MA 2HOSA 3TFLA 4RK2A 4KT5C 1T39A 3KN8A 4LZ5A 1JW1A 5AA1A 3O6GA 3OYDA 4KFQA 2Q2AA 1YIJI 4IGTA 4P1WA 3IO6A 2LG4A 2P6SA 2M1BA 2AO9A 2XF5A 2JA7J 2VOZA 1N75A 4WX9A 4MBPA 4QFLA 2P6TA 2X7QA 4DZ1A 1VI0A 2IA1A 5DM7F 1NV7A 3V83A 1MM6A 4KMFA 1NUZA 2JT1A 3G7WA 2JRTA 1B8IA 4N8GA 3PUWE 5FFZA 4E7ZA 3BG3A 2V1DA 2PBIA 2A61A 4ZEFA 2GIZA 4JBZA 3K0VA 2DK8A 3VPRA 4CYCA 1MIJA 1AL3A 1JW4A 2I48A 2HDCA 1E0EA 1EH8A 2XX9A 4OVQA 2RNGA 1T6SA 2VN2A 4BGDA 2MFZA 2VJ5A 5M5YJ 1ZTRA 4KR5A 5E17F 2P0SA 2CMOA 3LSMA 3P7NA 4P55A 4F3BA 1FMVA 4JVCA 3GBBA 4B48A 2DI3A 2XF6A 3JCUC 2ESHA 2QBYA 4GGGA 3ZKKA 4HYEA 4ZYHA 2O5RA 3WU2C 1I6HJ 4U87A 3B6TA 1W7PB 5EQ9A 4BH9A 4KCDA 3MYUA 1QZYA 3K0LA 4ESWA 4XNFA 1NKXA 4MFDA 3DWLE 3H3ZA 3DP7A 5FKLA 1A55A 3HKZN 4PZJA 3G1MA 1BI3A 3VLUA 2F5VA 4ZZDA 5DVFA 4M6VA 4Q5SF 1P2FA 3C32A 3JRAA 3HGGA 1BC7C 2EZKA 3KGCA 3FK7A 4BBSJ 1Z67A 3I4MJ 3PMWA 1S29A 3OYNA 4ELQA 2XRNA 4X04A 4KIGA 1ON1A 3OV8A 4M9SA 3V4GA 1OFCX 2PMZN 1DPEA 4JWOA 3QUFA 5CVVA 2EIKH 3ZOBA 2IEKA 3O66A 2XF7A 3EUHC 2CGPA 5TPAA 4H0WA 1QO0D 2DWIA 2GA1A 4GL0A 2FRHA 3R0JA 5EZHA 2VPOA 1IN6A 2KL4A 2CUJA 1MKMA 1D3YA 1BIBA 2K86A 3H1CA 3HOSA 3RTFB 1FQDA 1S7AA 3FXOA 2R5ZA 3S2DJ 3BWGA 1FOWA 1B0HA 1ACIA 2G29A 1WJBA 3IJXB 3JRIA 2P3VA 3FVGA 3KX2A 4G94A 1FMWA 1MMGA 2ZYNA 3K1NA 2D1HA 4B44A 3OYBA 1MGTA 4MIJA 4Z6YA 4P47A 1V5FA 2CQNA 1JETA 1ZJLA 2V3TA 1SC7A 1MY2A 2O69A 1UCRA 4BXFA 3AFHA 3RPUA 2Z22A 5ERIA 1Y8RB 2V26A 3TDJA 5KDTA 1IEJA 2L7MP 1USYH 2V93A 5CQGA 2ANJA 1ZR2A 4GVOA 3CCMI 4HQEA 2DE4A 1IUDA 2XXKA 4R6YA 3MMYB 4RAYA 5AIQA 1HKQA 1D0XA 2ZXWH 4EQ9A 2LY2A 5ELVA 1QHHD 2OAZA 4BHPA 4BE0A 4DZJA 1ZBMA 4OQOA 1P4WA 1SFXA 4JP0A 3G6EI 3TOBA 3IHUA 4N81A 3NAUA 1ZH5A 2WX9A 2WYPA 1TP4A 1RIOH 4PFBA 2CV2A 4RPNA 3OO7A 4HF0A 1DU0A 2XGCA 2CZHA 5CVUA 2RAEA 2XKPA 1MM7A 1I27A 4RLFA 2KIUA 1SFOJ 3OSQA 2EQRA 3WAFA 3QOEA 2KZGA 2Z5UA 3MP8A 2BXYA 2EIJH 5IOYA 2E5NA 3W9WA 1JP4A 2Y0MA 1PUEE 2JA8J 2JSPA 4DOZA 5IT3A 1JTXA 4F19A 1EH3A 2PFYA 2WAQN 3MAMA 2PYYA 1FPGA 3V8LA 3PUZE 5I2KA 3BG7A 1ATGA 3MQ0A 3CG3A 2WWYA 1FP2A 1MH3A 1RZ4A 3ZN0A 3ILTB 2O0YA 2Y0SA 3SEZA 2Y31A 4MNUA 2LTPA 1DQUA 1ZRCA 5DVIA 2FX0A 3FMQA 4FCYA 1K61A 1XCVA 1TWFJ 2LRDA 5ET7A 2DPUA 2FNCA 1TLHB 3DPTA 3LSPA 3OSGA 3FF5A 1UTBB 3FD3A 4Q0CA 1II5A 1BA5A 2R9JA 4YIRX 1S7EA 3CTAA 2ME6A 3M8UA 2A5YB 4QWQA 2GHAA 2DLLA 3QPSA 3QUJA 1FPKA 1IMFA 3U1DA 3RYPA 1YTVA 1NH3A 2BY1A 3KOTA 3COAC 4OERA 2K3PA 2O7IA 2R7OA 4ENNA 2UVIA 3O28A 4II2A 3S14J 3BTJA 1SYIA 4AU7A 2CMPA 4GBVA 3DF8A 2DYSH 4DQ2A 3WTUC 1J0RA 1XCBA 3ZQHA 1OIBA 2B3BA 1W5SA 4PCQA 3T22A 2ZNUA 2KP6A 2HFHA 5C44J 2ICWG 3SZPA 1PDNC 1J2XA 1UHSA 1JEUA 3GTGJ 2OCUA 1AHDP 5C4XJ 1S7YA 2UVHA 4PF8A 5FHNA 5FKNA 2IGNA 3GF2A 1Y20A 4MHFA 1T08B 3G4SI 5LHHA 2F36A 3I58A 2XB5A 3AXFA 3DLNA 3GLBA 5HS9A 2R5YB 2ONSA 5LOMA 1JHHA 2ZNZA 2CFOA 3DEEA 4UUTA 1SI0A 3VLWA 3MEXA 4PETA 2DXIA 2W48A 3CCLI 4IHVA 5HNHA 3LR1A 4BKXA 5CM6A 3EHUA 5DD8A 4LN5A 2F2EA 3T5XA 1NMUA 3RN8A 5TGTA 2QVRA 4X9TA 4GQOA 3MJNA 3BDDA 1WFXA 5J4VA 1N25A 3VFZA 4HNVA 2O7UA 2F6CA 3OOPA 1KYWA 1FPLA 2BEOA 3A02A 1JKOC 1MQIA 4WEDA 1IUFA 3ASOH 4DW6A 3PQJA 3Q3SA 4BJ6C 1IMEA 2OBPA 2PLYA 5BOXA 2YX7A 4BACA 1MDP1 4DZPA 4KIFA 2LNBA 1ZG5A 1FQCA 3B8BA 2V25A 3TMOA 3OYMA 2CUFA 2K27A 3DV8A 4BQAA 4QRZA 4FE4A 3FM3A 1XS9A 3B7DA 4I62A 4F1UA 1Z7ME 2R0QC 3LAJA 5D6EA 4OEVA 3BP8A 4CXFA 1PP8F 1FYLA 3T8TA 2IS1A 4MGRA 4OFLA 1XDSA 2DA6A 4XTCQ 3HRSA 1URGA 2OX3A 1NV5A 4RGSA 2K9QA 4XQFA 4C3JJ 2O51A 2QSXA 2ZFUA 5ICGA 2P5KA 5E3MA 3S1RJ 3ZMDA 3WGIA 3PNVA 2H6BA 1MXZA 3HPGA 4GWWA 3W6KB 1BTJA 3FXJA 5E8IA 3KZZA 2F6PA 3KEOA 1G2HA 1SPIA 3ZGKA 2DFHA 3HO7A 4NNJA 4RPOA 2JMWA 5HODA 3HIFA 3EYIA 3HZJA 1QUJA 3BZKA 2V3UA 4GD5A 3R4KA 4HPQA 1HDDC 1K83J 3I64A 1MQHA 4BXUA 3CR9A 3GTMJ 3H5RA 1LEBA 3A29A 2OJED 5GAEJ 3P9KA 3JAMZ 2QS1A 1XVYA 5DYHA 3K2DA 1K78B 4ZZEA 1DGWY 2DDKA 2Q74A 2KRFA 1DGRM 2MG4A 4NWCA 3DU6A 2H5YA 5F27A 4NHBA 2QF7A 3W2AA 2HXRA 2XGEA 1J59A 2F5FA 2EJRA 3BG9A 4DIQA 5F0FA 3RQTA 1WJ5A 3RIRA 4UVCA 5KNLA 1MJBA 2JK3A 3BTIA 3HHFA 2XVCA 3THIA 5J1DA 3G3FA 4XIGQ 2KIMA 2RDPA 2ZNYA 3BJ6A 1LBVA 4HCWA 1Z7NE 3QYTA 3IAS2 2DE3A 1BR1A 3HSFA 3T8RA 3WU0A 1JKPC 3H6VA 4ENJA 3U94A 4ESJA 3PUXE 3TW7A 1I3AA 2VT3A 2RC7A 4U88A 4AYBA 2F8DA 4PFRA 4UB6C 3ZQFA 4CGZA 1AKHB 3M8FA 4NC6A 4P1LA 4DIGA 1SVLA 1LFPA 1QPMA 3QYBA 4U0VA 4OEUA 1DDNA 1LE8B 3W6JB 1TQPA 1K9ZA 4UABA 3DLAA 4A3EJ 3Q29A 5EJCA 4WXCA 5LLQA 1SD7A 2HAUA 1FBUA 5E1XA 1BR4A 4XLHA 3MKYB 1MSEC 4CZZA 2O61A 3KP7A 1G3WA 1I69A 4OAZA 1N0TA 2XGXA 4E7LA 5D4SA 4MJOA 3MCZA 4H65A 2J5PA 4ELOA 1AOVA 2DWHA 3L00A 1LB2A 2LKXA 1DSNA 1R36A 2DAOA 5FKMA 3J81Z 1BKAA 3UN6A 2KQRA 3QU6A 4F2QA 4QPOA 4RB2C 5E3LA 1FPBA 2VD3A 4BBRJ 5J8CA 4BY1J 1VSOA 2XAGA 2YR2A 1IXIA 1KA1A 1VF9A 2F5CA 2Z1DA 3PO3J 4JYKA 2KQZA 2F4MB 5ICFA 3JTGA 4CCOA 2FMLA 3E6CC 3V8KA 1TNSA 5GPCA 4FX4A 2AS5F 1URSA 3U93A 5M3MJ 4BDOA 3K1MA 4R73A 5M5WJ 3K1PA 4B43A 2NVUB 3AAFA 1LBCA 2E7WA 1R71A 3MZHA 2HZKA 4ZDPA 4POXA 5L9SA 4EGYA 4PFYA 2HZDA 2AQEA 4FEDA 3WGGA 4ZECA 5EYRA 3S3NA 5I57A 3WHCA 5T3JA 2OQRA 5H8HB 4P56A 2KKOA 2VQCA 3Q27A 2L9VA 4MH5A 2VB6A 4X1DA 1Y8QB 5IP6A 2ZJQF 2O84X 1WRJA 4AD9A 3K7AJ 2E1SA 3QSLA 1XPXA 1R9TJ 4G61A 4HX4A 1Y4CA 1ON2A 4MCOA 2HVQA 5I2KB 4W97A 2HOEA 1QHGA 1TNTA 1Z91A 2E7XA 4BQQA 4UUSA 2L7KA 4DYRA 1SQYA 4RNSA 2CH0A 3E97A 4YB5A 2F6GA 4EDPA 2R7FA 3HTUA 3SEYA 1FOXA 5JVTA 2M2EA 3TTRA 1B3EA 4YB6A 4A3JJ 4I3YA 2K02A 2KRHA 3L1PA 2R7VA 3VVDA 5AA2B 4P9KA 4ZYGA 4FIMA 4A69C 4N4UA 4KXPA 2V9VA 1NHAA 3SZGA 2ZMEB 1HBXG 5JK4A 1FBEA 3MVXA 1PUFB 5CKTA 3B6QA 3A2KA 4TV7A 1LVAA 3TQWA 3ISPA 4H8IA 4JVDA 5HLTA 3FXRA 3J80K 4V19K 4G6QA 1T0FC 1TZLA 3Q26A 3T0JA 2F7BA 1OISA 3A0HC 2ME0A 4C0RA 3G3IA 4XL9A 1GXQA 5IP9J 3ML6A 2X85A 4RA1A 5ILVA 1WODA 2PVUA 3OIQA 5KDTB 1HC8A 4ELPA 1UJ8A 4XKNA 5ED4A 4NDLA 1MRPA 1ZN2A 4IR8A 4R2FA 2GLOA 3CDIA 4ITVA 3NARA 4QIWN 5HDKA 4EJWA 3SKPA 4I98B 5DM6F 3CDLA 1B6AA 1B59A 1YIOA 3FXMA 3K4NA 4KMUX 3SZTA 3WTWC 5CYVA 1BK4A 3EUAA 4I2OA 1QULA 3OY9A 3K6VA 3V7RA 1UB9A 4C2TA 4G7OF 1O3SA 5F08A 2VT5A 4BU2A 2DQRA 1GUUA 1A36A 1Q9DA 5K7HA 4UUSB 1HKSA 3BZCA 3SYTA 2Z33A 4EATA 1PBPA 2W82A 4LATA 1U5TB 2A6EF 4CCKA 3KN7A 4RY1A 3UR3C 2K3FA 4YB7A 5I3SA 4ISUA 3L7WA 2JVHA 3MW0A 4RA2A 1D9YA 1IZ1A 4IO7A 4DDDA 3PFYA 3ZQQA 5H8HA 5HDNA 2IS2A 2EPFA 5TISC 2DFIA 2GZWA 2ECBA 3ABMH 2HHMA 4HE2A 4BYYA 2PJPA 1R58A 2JQ7A 3SFZA 1OLTA 2HEUA 4U1ZA 1TT1A 2XAFA 2ZXJA 5D8KB 4HV6A 1DOTA 1LFBA 2STWA 4O3CA 4FATA 4AIDA 2PN6A 1P9QC 4ZEKA 2L7FP 1B7HA 1DUXC 1IJWC 3S1MJ 1A8EA 3CESA 4YU0A 2V4CA 1B4AA 2I5UA 4NBQA 3WTZA 2JRMA 3FK6A 2H8RA 3CP2A 5L3GA 5L9OA 2HR3A 2R3SA 1VFDA 5LD2C 1ZHFA 5LEJA 1BM9A 3CCUI 1QBJA 3H35A 1EYJA 3T96B 4PAKA 1USTA 4UV8A 3BZ6A 1OCCH 3TZAA 1APLC 4WEPA 2LLKA 4LB6B 3VYUB 3OS1A 2ISZA 5I2NB 2BYVE 4Q47A 5B3SH 2O03A 1Z9CA 1VQLI 4IX7A 5E20A 1FYMA 2VPLA 1Z3XA 1BBYA 4ZTFA 2HOAA 4ON0A 1A8FA 1R00A 4LVQA 1HA8A 4X8RA 3JZJA 1TQIA 1JJ8C 4DCXA 4B1RA 2FQ4A 4C30A 1PEBA 2M3AA 2E2IJ 4U4XA 4ZDLA 1X58A 4HEA2 3PJRA 2VL8A 3RY3A 2XROA 3FV2A 4RGRA 4XLCA 5DV5A 2QL3A 2QS2A 4NF6A 3T1BA 2GIVA 2M4KA 2HYGD 3FDYA 1VQ8I 4PGPA 4O3AA 3I9V2 3DEUA 2O9LA 1ZGWA 2OZZA 3VYTB 2Q88A 2REJA 2RINA 1GT0C 4IO2A 1MPBA 1PBQA 3IB2A 3T9HB 4IL6C 2A5TB 2JUGA 1XT8A 2FNPA 5KK1A 2O1LA 5FD5A 4LLGF 2IGKA 3CCJI 1PDAA 2QS4A 4GRIA 2HFBA 3E5UA 2DK5A 3MKLA 4RAGA 2OTJI 1D8JA 1O7TA 1W5TA 2QVOA 2QM3A 5DDGA 3H03A 1UFMA 2DDAA 4QSEA 2DO7A 1Y9UA 3C35A 4OU0A 3N94A 4BJTA 1G4DA 3SHFA 2HXWA 2VPNA 2IPQX 4NB5A 5DEQA 2Q8KA 2PG4A 5E8GA 3A01A 3S16J 5CRYA 1IN7A 1D5YA 2OWSA 1GV2A 1RDYA 4GFRA 5J16A 5LRSA 1B1BA 3LSXA 5K2YA 3VDXA 3ZQCA 2CRGA 4HX7A 2RF1A 3K4CA 5D8LB 1BR2A 4CHUA 1FJ6A 4XEQA 1T0KA 4HX8A 4XOPA 4DBQA 3BFUA 4PFUA 2NNNA 3F23A 2RN7A 2KR0A 3NQOA 2E60A 1QQIA 2ECCA 2FBHA 1G8XA 3GXOA 4AQ4A 4MAGA 4PDHA 3CC7I 2RREA 4JBAA 1QJMA 5FTHA 2B63J 2RGVA 3H9JA 1HW5A 1I6XA 5J1YA 2CV1A 3H0GJ 1WDNA 1YRNB 4R9FA 4LGWA 2R7WA 1DMBA 1H43A 2I0CA 1HXDA 3TTMA 4RBOA 5FRNA 1S72I 3OIOA 3IH4A 1RUOA 1ZMGA 2LF7A 3A1YA 1IMCA 3FVNA 4GWOA 3KEYA 4DI4B 1QGXA 3GZNB 4F29A 1AWBA 4OMZA 1ETOA 2A05A 1BOBA 2M0MA 3U1KA 4HRIA 3TCGA 3QODA 2LD5A 1WKMA 1JTYA 3I71A 1FJLA 3S9EA 5HLIA 3VYRB 4F92B 3CLQA 4UXNA 3BFTA 4BQOA 4XSZF 5IZ1A 2NS7A 3RTWB 1FYKA 1RDXA 3BJAA 4GIZA 1OCPA 1YLFA 2HXOA 4OMBA 4F91B 2A6HF 4LJZF 5CPRB 2KRCA 3E1SA 2R7RA 2XSDC 1W7PD 3HN0A 2H1LA 1WCMJ 2LMDA 1U8BA 3BG5A 4D7NA 1BW6A 1PP7U 4R1HA 1TTYA 1R9LA 3V8XB 1XGOA 3DXJF 4ENKA 1DPUA 2FIEA 3T66A 5KZTA 4BXXJ 3KPHA 4PDKA 5K2XA 1A54A 2IA0A 1QNTA 4ZYDA 3K4UA 4HQMA 3KP3A 4NUBA 2XPWA 1IXHA 3S3MA 1ZAOA 3MVPA 3WGHA 3MP1A 5CLSA 4M1VA 2HEOA 4R79A 2RCAA 4PTKA 4BY7J 1NI9A 5ET5A 3Q0VA 2QQBA 3SEVA 4A5MA 3QP5A 4BE2A 1UAAA 1N84A 4O5VA 3PUVE 4NTLA 1YYZA 2F4IA 5EGOA 1ZRFA 3F8BA 4A3BJ 3NWTA 3TDUC 3BIGA 3KFMA 4E7HA 1NFTA 2DE2A 3ZR8X 4ZTJA 3DBLB 3VWBA 3O3KA 2ZSIB 4XKQA 1LEAA 1VQ5I 3VODA 2E5ZA 4DYQA 1J5YA 4S05A 1J09A 4A0ZA 5TJJA 3CFXA 1S3JA 4DCYA 2F5DA 2BJJX 2DODA 5CC2A 4BHCA 2LAOA 2ZMEC 4FJPA 4ZYAA 1F9BA 2XAHA 3S2WA 4Y33A 2NWJA 3D5SC 2FA7A 3K2ZA 1T33A 2HZLA 2EBIA 2B7EA 1U6GA 3PL8A 5KCJB 2X6YA 4X0GA 1SW2A 2NXOA 1RC9A 4QPQA 2I10A 3CC2I 3R6SA 6PAXA 3Q25A 5KAFC 4FETA 3MWBA 2FSWA 3GTKJ 1US4A 3DKWA 2TRTA 3TCFA 1VDWA 1H0MA 3A3CA 2NOGA 1MW7A 3IWZA 1Y3QA 3TQLA 3E0JB 3ZMUA 1HLVA 4KYWA 4OIOF 1X1BA 4A0YA 1GR2A 1UMQA 1B9JA 2O8KA 3S1QJ 4YKKA 4GCVA 3OD7A 4NG7A 2L3DA 3WG9A 4B4CA 1Y1WJ 4RLQA 3JRBA 2EZHA 2XX7A 3ABUA 1F4KA 2CS3A 4OIQF 2QFLA 3CUQB 3OSFA 3D5LA 3BCBA 2ZO4A 3FGSA 2YX4A 2M5WA 3EYYA 2IP2A 2VKHA 5IAIA 3I4PA 1UHWA 3ZCOA 3CCSI 4PSXA 2ZB9A 1S9TA 4QSCA 4R6KA 1OLAA 4L0YB 4B3AA 4B8XA 3TQNA 4UVBA 1LLSA 2N8GA 2W57A 2CUZA 2M8EA 3BTLA 2ETHA 3UGWA 2M0CA 1W1WE 4LK0F 1XSVA 3N26A 2Y7RA 1XGNA 5L9MA 1PB9A 1K6YA 3CFZA 3SEUA 2HNHA 3BLYA 3KBZA 2FE3A 5FKOA 1V3FA 3BR3A 2DFEA 3QU3A 2DA4A 2XPUA 3EQLF 4KIBA 4K2EA 3S2HJ 1JUMA 1WVRA 2CQKA 1WVJA 4MO7A 1A31A 1OR7C 5GTIC 4A3GJ 1P6RA 2TDXA 1D3KA 4PF6A 2BV6A 2O7OA 3F3XA 4HSRA 3LSRA 1QPIA 2YJPA 3TKDA 1F9NA 3IV5A 2WBDA 1FRPA 4Y13A 1H3DA 2XX8A 5C3EJ 2GAUA 3CSGA 3VDFA 4IOCF 2WAQA 2W00A 3IO4A 3QAHA 4PGGA 2RC9A 3H7MA 3BOQA 4KCCA 3QP6A 3DU5A 4YIFA 3HKZA 1OQHA 1SVMA 2VBXA 1NNKA 5BPDA 2R7SA 3H6UA 3TOAA 3U65A 1DP3A 1K4SA 3TEPA 5LBQA 2D1VA 5LGTA 2O8XA 3JRGA 1IRGA 4XRMA 1FQFA 4A3LJ 3KJTA 2XDVA 2CW8A 4IPAA 1BOAA 3VSKA 3KN3A 4GRKA 4KHZE 4IHXA 1SFUA 2AQFA 2D3IA 3S8PA 3KZGA 4UV9A 4C3HJ 1YQAA 3BPVA 2PQ8A 3GFMA 2FVZA 2L02A 3W2WA 1O3QA 1M5FA 3H3UA 1A35A 5EF6A 4J19A 3S9LC 4P9FA 2V4JC 3OYLA 5GAHJ 1GHCA 4BDRA 1LAXA 4OIPF 4EF2A 1FW0A 3B73A 4M71A 3ONQA 2BY2A 3MZYA 3TDZC 1IG7A 3P7IA 2QUFA 4IOAF 2W7YA 5DEXA 2QZ8A 4G7HF 3RUMA 4EGZA 2M4GA 1YYVA 2EFQA 1GVJA 1L0OC 1FPFA 1W7PA 3MN2A 2CO5A 3FXKA 3TKYA 1OVBA 3PV0E 1OYWA 3GX4X 1JT0A 1TT0A 2YSRA 3P5JA 3SDGA 1IW7F 1V54H 1Y6IA 2XIGA 4HNUA 5EG0A 2VPRA 4E7IA 3DEWA 1G3YA 1RUNA 1NV1A 4CCLA 2DPDA 3O6HA 3GLLA 4XKPA 4ZEBA 4Z0IA 5GAGJ 3HUGA 4DJAA 2EILH 5JVGF 3G73A 3S4UA