3ZKKA

Structure of the xylo-oligosaccharide specific solute binding protein from bifidobacterium animalis subsp. lactis bl-04 in complex with xylotetraose
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
396
structure length
396
Chain Sequence
DDKTITFWHNASAGEGRQYWENLAKSFEEANPGTKVEIQAIQNEDFAGKLQTAMQDPASGPDVFMSLGGAKTKEMIDAGQVMDLTDKISDTVKTDMKTTLSAATFDGKVYGVPVSVEPGGMWYSKDLFKKAGVSDVPATYEELLADAKKLKDSGTDAIALGAKDAWPAAHWYYWLVLRECSPEVYDKSVQDHDFSNACWVNAGKKLQELKDLKVFNDGFLTTTAQQGANSSAGLLANHKAAMELMGAWEPGVLKDLTPDQKPMADLGFFAFPEVAGGEGEPGALMGGVTYFCVNPKASQTSIDFVNYMGEKKNQEDYAKAFSTIPASEPARAVVTDESLKQVIEYLDKAPSMQLWMDTALGTNIGNALNAAVVNMLSGQGSPEDIVKAMQDAAQKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords XOS BINDING PROTEIN
publication title Structural Basis for Arabinoxylo-Oligosaccharide Capture by the Probiotic Bifidobacterium Animalis Subsp. Lactis Bl-04
pubmed doi rcsb
source organism Bifidobacterium animalis subsp. lactis bl-04
total genus 140
structure length 396
sequence length 396
ec nomenclature
pdb deposition date 2013-01-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3zkkA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3zkkA02
3LR1A 1MY1A 1JW5A 3K1NA 1JETA 5HPQA 3RNNA 4P0IA 5J1DA 4KQPA 5I58A 1M5FA 3OSQA 1RKMA 2YJPA 2GFEA 1US5A 4I62A 4OXVA 4E0XA 1OMPA 1B05A 3PUYE 3H06B 2ZYOA 1PBQA 3RUMA 1XS5A 3FVNA 4GIZA 2HXWA 4PQJA 4JWYA 3DELB 3FXRA 2E0SA 2R6GE 2V84A 4NF4A 1MXUA 2RKMA 1QULA 4F3PA 4DE8A 3R7XA 3MVXA 1P1NA 3UP9A 1O7TA 3FV1A 5DVFA 3FJMA 5TPAA 2V3UA 3IOTA 1B5HA 3RT8A 1LB9A 3OOAA 5DYHA 1KWHA 3B6TA 1H3DA 1XVXA 3KN7A 4QFOA 2PMSA 3R6UA 5L9MA 2UVHA 2ZNSA 2RINA 1MQJA 4I8CA 4FORA 4LQ2A 2O69A 4YKKA 3T93B 2F7BA 4MBPA 5L8DA 2Z23A 3V8XB 1MRPA 3C33A 4OESA 5F1QA 1OQHA 1MDP1 2Y7WA 1SW2A 4H65A 3S2VA 4BDNA 1EU8A 1LGBC 1R9LA 3ECRA 3TEPA 1M5EA 1SYHA 2G93A 4YICA 4PFWA 2ZYKA 1MG1A 3E4RA 4EF2A 1PB9A 3EN3A 1B6HA 1MPDA 2OLBA 4GVOA 2Y7RA 1I6BA 3ZKLA 3HO7A 1MXZA 4QFLA 3VLVA 3VVEA 3K01A 4O3CA 3RLFE 1I6AA 2ANJA 4LONB 3H4ZA 2D21A 2ESNA 2I6EA 4IO6A 4ZEDA 3LC8A 1QJMA 3KG2A 2GH9A 4HS7A 4G8MA 4G2ZA 4EF1A 4ZDMA 4BDOA 2O84X 4U1OA 4XKNA 3PPPA 4GFRA 1B3GA 1IUDA 2F5XA 4ZEBA 2P2AA 2X7PA 1LAGE 2YPNA 3VXBA 1SW5A 4NEDA 4PETA 3FJGA 1DPPA 1SD3A 3C34A 1QW0A 4YAHX 3O9PA 2PBWA 2F7AA 2PT2A 3TTNA 4OTEA 3K1MA 1ZLQA 1WODA 3GXAA 4TLLB 2O51A 3TCGA 4UACA 4GXSB 4OHNA 4R2FA 2NVUB 2ONSA 3LSLA 2V25A 3Q28A 2X7QA 3SDFA 1B9JA 1OLAA 1Y3QA 3KOSA 3IJXB 4OFOA 1N0TA 4Q8RA 1B0LA 2I4CA 4JSDA 4LVQA 1DSNA 1ZBMA 3O6GA 2F97A 5IAIA 1GVCA 3KEIA 3HCQA 4IY6A 1MXXA 3LBSA 2B3BA 2V3TA 3TCFA 2DQVA 4RPOA 3VLUA 2UXAA 1DTGA 4MFIA 4IO3A 2I48A 1MPBA 4NWDA 5I56A 3UN6A 2OBGA 3Q27A 4F18A 1DPEA 3MP6A 4M4GA 4QFPA 5EYFA 2W7YA 4H67A 3TFLA 1S50A 1USYE 3PUZE 4ELOA 1SVXB 1FTKA 2NXOA 1MS7A 2XXVA 4OWDA 2V3QA 4Z0IA 3TQWA 3N94A 1IXGA 4OETA 4C1UA 2HAVA 3M3LA 3FASA 5EHMA 5AA4A 4O3BA 4NF6B 4JSOA 4R6YA 3ZS6A 3U72A 1JEUA 2QS2A 4U21A 1D9VA 4OFLA 1JNFA 5ITPA 2Q88A 1S7YA 3TODA 5CBRA 3VVFA 3MBPA 2QS3A 4FATA 3UIFA 3K6XA 3TYHA 2XXTA 3HHGA 2FA7A 2XXWA 2F36A 4H8JA 3G3JA 5FHNA 1O63A 5FHOA 3O2AA 2BJJX 1MQGA 2O6AA 3G3FA 2PVUA 4F2QA 3K0VA 3TQLA 2H98A 3IL1B 3TELA 3TKDA 4I9DA 3VFJA 3IOVA 1JQFA 4IO7A 2VD2A 3K6VA 1A55A 2HZKA 3I6VA 1A99A 4XXUA 3C4MA 3CIJA 1TFAA 3TMGA 1B32A 3ZKKA 1SDXA 1A8FA 2DP8A 1SW1A 3OD7A 3QSLA 2AL5A 4OMBA 1EH3A 4EDPA 4IY5A 5DVIA 2IA4A 4GF8A 3HN0A 2THIA 2O1MA 3VLWA 2P0SA 3PMXA 1QKAA 3N26A 1A8EA 1LBBA 1BLFA 1LBCA 1DOTA 2GHAA 1UQWA 4G68B 3MZ9A 3RGYA 4IGTA 5JTYB 1LCFA 1MPCA 4NMYA 1ATGA 1NNKA 1B5JA 4F31B 2DE4A 4JWXA 5H8FB 3T9UA 1ANFA 4ZZEA 5KCJA 4FAJA 2ZXTA 2DE3A 3DP8A 5HBCA 4IO4A 4QRZA 3SERA 4XKPA 4KFQA 3G3IA 3TCHA 4WKMA 3G7WA 1WVJA 4OZ9A 3ILUB 5L9OA 3JV9A 4OENA 1B1HA 4R6HA 2F78A 2RC9A 3FZVA 1R6ZA 1NMUA 3ILTB 4KCCA 4X48A 1TWYA 3B6WA 4EUOA 3H6UA 4R2BA 3LSFB 1EZOA 5ITOA 1LB8A 3QUFA 1TXFA 4F22A 2RF1A 4FEBA 4THIA 4ELRA 4FJPA 3U1OA 2Y7PA 1ZKBA 4KPTA 1LLSA 3H7MA 1CB6A 2Z8EA 4R72A 1Q1KA 1B4HA 1FW0A 5KCJB 4QSEA 5A5XB 4YU0A 4GD5A 3RT6B 4WXJA 5B70A 2XXUA 4LQ5A 2HQ0A 1MQHA 3QIMA 1ZIUA 2P1SA 4YB6A 4NF8B 5I57B 5ICTA 3FVKA 5DVJA 3JYRA 4QFKA 1SI0A 4L17A 3VVDA 1CE2A 3CFXA 2A5TA 3T9VA 1PC3A 4ZEKA 1IITA 3QYTA 3KJ7A 2VP1A 4H5FA 4EQ9A 4QSCA 1M5DA 2NUVA 1FQAA 2XD2A 1B46A 3FD3A 5F7VA 4POWA 5I2KB 1MDQA 1P1OA 4RY1A 1P1WA 5ICQA 1POY1 1UTHB 2HZLA 5CRYA 1USYH 4RJZA 3PGFA 3OMBA 4TQUQ 1US4A 1P1QA 4DDDA 4LZ7A 1DMBA 3CFZA 2DXYA 3FVOA 3FGSA 1MH4A 2Z22A 5L9SA 4F3SA 2DWAA 3IB0A 1UIVA 4U4XA 2YLNA 2X26A 1QUKA 1YAEA 2PX1A 4ZE8A 2F34A 2A5TB 2UYFA 1NNFA 3KGCA 2LAOA 1J1NA 5M2VA 4IO2A 1BIYA 3SEXA 3OO6A 1NH7A 2REGA 2I0BA 4GXAA 2AIXA 2REJA 1MM6A 3LUYA 5I59B 4H1XA 3C9HA 4FECA 3KZGA 1XT8A 3U94A 2DXRA 4LUBA 2Y84A 4U22A 4EXKA 1BTJA 2NWJA 2XHDA 1B7UA 2DS9A 4GLIA 4ESXA 1N7XA 4P11A 1HSEA 2UVIA 3D4GA 3IO4A 3C31A 2QPQA 2A5SA 5CBSA 1MY0A 5IKBA 1B7HA 3M3KA 1EZ9A 3Q29A 3O28A 4LATA 1RYOA 3H3GA 3H03A 3WAFA 1UIUA 2V93A 4DXUA 1POTA 4NF6A 3IJOB 2PT1A 2DWJA 5CC2A 3L6HA 4MH5A 1YCJA 3K6WA 3RTFB 3K02A 3FIRA 5ISUA 3I3VA 1SQYA 3ZSFA 1N76A 1B51A 3HPIA 3TDJA 2DYXA 1N3WA 3OENA 5TP9A 2QMWA 1Y3NA 2OJTA 3G3KA 1JW4A 2I3WA 2OWTA 3CVGA 1GTKA 3OSRA 1ZMGA 3MVWA 1P99A 4DCYA 2ABHA 3HSTA 3EHTA 3R26A 4OEUA 3B7DA 2H99A 2Z8DA 4YKIA 1VFEA 2FNCA 4KI0E 1UTBB 1OVTA 4X1DA 2Y7KA 1H44A 3IK6B 3LSWA 3TTMA 3K1PA 5H8QB 3KN3A 1N7WA 4R9GA 3EPEA 1GV8A 3UGWA 3TTLA 1XVYA 2UYEA 2XXRA 2RCAA 3LSXA 3VE1B 1ZTYA 3S9NC 3B6QA 3OXNA 5CMBA 3OEKA 4IGRA 3PU5A 2RC8A 3RY3A 3KSXA 1H45A 3MWBA 4ECFA 2GHBA 2O7IA 2Y7IA 1URDA 1B3LA 2F6PA 4LZ8A 3MZBA 1NH8A 4G68A 2M8CA 1SW4A 5TP9B 3UK4A 1HSLA 1B3EA 3F11A 4YMAA 2QMXA 3C36A 1T0KA 5JTYA 2HAUA 4BDRA 1JW1A 4GOTA 1NKXA 3E9XA 5AA1A 5H8FA 4Q30B 3M8UA 1Z7ME 2F6GA 1MXYA 4KYEA 1NL5A 4JB7A 2ALUA 4Q0CA 2KLFA 3RPWA 1LCTA 4AQ4A 4ELQA 1IEJA 4R9FA 3WAEA 1ELJA 3Q25A 1N84A 4EQBA 1FQEA 4ZZAA 3GLBA 1QVSA 3GZGA 4XTCQ 3DLNA 3IB2A 4WEPA 3DM0A 4H5GA 2RCBA 5I2NB 4E0WA 2QL3A 2ZNUA 4OEVA 5H8NB 1VSOA 4LZ5A 3T22A 2HFBA 5H8HA 4H6DA 1FTLA 3PMVA 2OZZA 3T96B 2H5YA 4GL0A 1P1UA 3Q26A 4MLVA 1VR5A 2I3VA 3MVZA 1IQ7A 5JK4A 1MY4A 4RA1A 2DWIA 1N3XA 5DEXA 2XX7A 4Q5TA 3KFMA 3CG1A 3SESA 3EHUA 4NF5B 4YB7A 5A5XA 2VGQA 3BFUA 1YPNA 3FUZA 3U8QA 4R74A 2O7UA 1XHYA 3O66A 3OO8A 5K2YA 4IB2A 3FXQA 2WKYA 2I49A 3I5OA 1LAHE 2F7CA 1YTVA 4NF8A 5I57A 3C32A 4ND9A 4IO5A 3FXUA 4U4SA 4LA9A 4U2RA 1B5IA 2Q2AA 2XXXA 1JEVA 3IR1A 4C0RA 3QUJA 2DVCA 1MM7A 1Y1MA 1MXWA 1Y4TA 2AYSA 2QS1A 1URSA 3H6TA 4KYSA 5H8HB 3SEUA 1URGA 2XXQA 5I2KA 3SEVA 3MP1A 3TPAA 1AOVA 1UTHA 1II5A 5DEXB 3E13X 1LFGA 4FEDA 1D4NA 4PE5B 1MH3A 3GBBA 3OO7A 4ELPA 1A7LA 1TT1A 4F3BA 1R1NA 3EF7A 5EHSA 1MXVA 1EZPA 3KSJA 1VFDA 3MW0A 3MZ1A 3QK6A 2QJEA 2VOZA 3V5AA 2D5WA 4YB5A 3A3UA 4XKRA 3VXCA 4KCDA 1PB8A 1VE4A 4NTLA 5AA2B 5DT6A 3PUVE 4ZEFA 3S9MC 3CG3A 3RTWB 4BLAA 5I59A 1Y4CA 2H9BA 2QS4A 3RN8A 4P0GA 5BUUA 4X1BA 2OWSA 2CMOA 4F3GA 2AL4A 3HV1A 1XC1A 2F35A 3C35A 4G68C 4ZEIA 4OERA 4EXLA 4BDQA 2O68A 3JZJA 3O6IA 1Y20A 1JVXA 2FYIA 5FTHA 3FJ7A 1QKBA 5JEIA 4QFNA 1FTJA 1B40A 4U23A 4GWOA 1FTOA 2I4BA 1AIVA 4DZ1A 3TUSA 3W15C 3SKPA 1IXIA 3FVGA 3QAXA 2QRYA 4OQOA 3H6VA 2UVGA 4MLQA 5KDTA 5I58B 2ZYNA 4G77A 2B3FA 1OVBA 1QUIA 3PUXE 3T9XB 2Q8JA 3O97A 3TTKA 2HEUA 1WDNA 4N13A 1NFTA 1LSTA 3MAMA 2ONRA 3CSGA 3U93A 4BDMA 2B65A 1SYIA 3MJNA 1IZ1A 1B4ZA 4NE4A 2Q89A 1AL3A 3GBAA 3MUQA 4YZZA 1Y1ZA 2Q9TA 3OO9A 4NF4B 4F2OA 1L5TA 1BKAA 1M5CA 2D3IA 2XD3A 5TPAB 1N04A 4QSDA 1PDAA 3PPQA 3U92A 2R9JA 4TOZA 5CMMA 1B1XA 2XX8A 1UTBA 1OLCA 4GQOA 4Z7EA 1R9QA 3W9WA 4N6PA 4R6KA 1Z7NE 1OQGA 4DCXA 3CRBA 5H8QA 1LFHA 1NNTA 5CMKA 1S9TA 2HCAA 3DP6A 4PP0A 3K00A 4PFTA 3N6UA 3OEMA 3IOUA 1B7ZA 3T66A 3KBRA 5KDTB 1PB7A 3S9LC 3CFLA 1Q35A 1PEBA 4HTGA 2R71A 4R75A 1QUJA 1D9YA 3FATA 1B52A 4DXCA 3TZAA 1Y3PA 2Q2CA 1B0HA 4FE8A 3AXFA 4O3AA 3THIA 1I6QA 4RK2A 1AH5A 3KJTA 4F1VA 3IX1A 4DIGA 1ZU0A 3EHSA 4XKQA 1MQIA 4G8NA 4DXBA 1LFIA 2CZLA 3CR9A 5ELVA 1FCKA 1MQDA 1LAXA 2O1LA 4RXLA 4KR5A 3MC2A 1MY3A 4PFYA 2DVZA 2ZYMA 3MPKA 3ONMA 4KHZE 3USDA 5BWJA 3K6UA 3A3CA 4YKPA 4H8IA 4HCWA 1FQFA 3MPLA 1A54A 4I1DA 4HCYA 5CI5A 5FHMA 5LOMA 5H8SA 3L6GA 3DP4A 3TTRA 3O6HA 4F19A 3PD8A 3IORA 1F9BA 4RK9A 3KOTA 5HM4B 1H43A 5I2NA 4YMBA 3MVYA 5H8NA 3FV2A 1I69A 3QXMA 2GRVA 3MP8A 2H25A 1D3KA 3D4CA 3V89B 4AB5A 5FTIA 3CSBA 3M3FA 4N07A 1OIBA 3UA8A 4G4PA 1IXCA 1Y9UA 1B58A 4LP2B 1AMFA 2ONKE 2I0CA 2XX9A 2DSFA 4XIGQ 3OELA 1SBPA 1MY2A 4NF5A 1FTMA 5I84A 3CI8A 4H0WA 5AA3A 4FIMA 4YKJA 3RQTA 4ONYA 4U1ZA 4BDLA 5AE4A 4RYAA 4JXIA 1HSJA 3T9HB 2DOJA 4ZE9A 3VV5A 4X9TA 5I56B 1FQBA 3SEYA 1O64A 4NWCA 1ZJLA 4F1UA 3BKIB 4POXA 1LAFE 1GGGA 5DTBA 4JBZA 3IOWA 4MF3A 3HHFA 4EQ7A 2VD3A 3S9EA 2I58A 3K2DA 2G29A 4GL8A 2RC7A 1M5BA 5TU0A 1PBPA 1FQDA 3PV0E 1H76A 1FQCA 1NNPA 4DLDA 4JDFA 2XXHA 2XXIA 4TLMB 5K2XA 2F8DA 5AA4B 3G3HA 4K3FA 1DTZA 3PPNA 2OCUA 4KD5A 3PPOA 5CM6A 1JVYA 4JWOA 5B7DA 1B3FA 3N5LA 2ZNTA 2XXYA 3A09A 1B3HA 4ZS9A 2PYYA 1TFDA 3K4UA 1IIWA 2Z8FA 4R73A 4UA8A 4RNSA 3G3GA 3TAJA 4OYVA 3W9VA 3H6WA 1SI1A 3KN8A 3S4UA 3IAZA 4OVJA 1GR2A 3P7IA 4ESWA 2UVJA 3IB1A 1RYXA 2NOOA 3N6TA 1B2HA 5KZTA 2QSXA 3SEWA 4F1YA 5AA2A 4OFJA 2E1SA 3E3KA 4PFUA 3VDFA 3PMWA 3PUWE 4QF9A 3BFTA 3BBRA 5AA2D 4ISUA 4G8HA 2OK2A 3IO6A 1A40A 4F29A 4AB6A 3SETA 4M1VA 4RPNA 1XOCA 3UORA 3O29A 2ZMBA 4KYDA 5CMCA 2VHAA 4C1TA 4F39A 3ODBA 4QHQA 1IXHA 1BP5A 4WEDA 2XXPA 4HW8A 3PPRA 3EQ1A 2DE2A 3PD9A 4GRKA 3MQ9A 3V83A 2IEEA 4ZECA 2DWHA 2H4IA
chains in the Genus database with same CATH superfamily
3LR1A 1MY1A 1JW5A 3K1NA 1JETA 5HPQA 3RNNA 4P0IA 5J1DA 4KQPA 5I58A 1M5FA 3OSQA 1NV3A 1RKMA 4N81A 2YJPA 2GFEA 1US5A 4I62A 4AS4A 4OXVA 4E0XA 1OMPA 1B05A 3PUYE 4O8MA 3H06B 2ZYOA 1PBQA 3RUMA 1XS5A 3E79A 2BJIA 3FVNA 4O7MA 4GIZA 2VPNA 2HXWA 4PQJA 4JWYA 3DELB 4GWWA 3FXRA 2GQ1A 2E0SA 2R6GE 1YYZA 2V84A 1NUZA 4NF4A 1MXUA 2RKMA 1QULA 4F3PA 4DE8A 3R7XA 3MVXA 1P1NA 4PDDA 3UP9A 1O7TA 3FV1A 5DVFA 3FJMA 5TPAA 2V3UA 3IOTA 1B5HA 1NUXA 3RT8A 1LB9A 3OOAA 5DYHA 1KWHA 4N17A 5IM2A 2XWOA 3B6TA 1G0HA 1H3DA 1XVXA 3KN7A 4QFOA 2PMSA 3R6UA 5L9MA 2UVHA 2ZNSA 2RINA 1MQJA 4I8CA 2Q74A 4FORA 1RDZA 4LQ2A 2O69A 4YKKA 2PFYA 3T93B 2F7BA 4MBPA 4P1EA 5L8DA 2Z23A 3V8XB 1MRPA 3C33A 4OESA 5F1QA 1OQHA 1NV0A 1MDP1 2Y7WA 1SW2A 2CEYA 4H65A 3S2VA 4BDNA 4PFBA 1EU8A 1LGBC 1R9LA 3ECRA 3TEPA 1M5EA 1SYHA 2G93A 4YICA 4PFWA 2HPGA 2ZYKA 1MG1A 3E4RA 4EF2A 1PB9A 3EN3A 1B6HA 1MPDA 2OLBA 4GVOA 2Y7RA 1I6BA 3ZKLA 3HO7A 1MXZA 4QFLA 3VLVA 4JVCA 3VVEA 3K01A 4O3CA 3RLFE 1I6AA 2ANJA 4LONB 4OVPA 3H4ZA 2D21A 2ESNA 2I6EA 4IO6A 3RPLA 4ZEDA 2QFLA 3LC8A 1QJMA 3KG2A 2GH9A 4MEVA 2P3VA 4HS7A 4G8MA 4X8RA 4G2ZA 4EF1A 4ZDMA 4BDOA 2O84X 4U1OA 4XKNA 3B50A 4N8YA 3PPPA 4GFRA 1B3GA 1IUDA 2F5XA 4ZEBA 2P2AA 2X7PA 1LAGE 2YPNA 5ET8A 3VXBA 1FBEA 1SW5A 4NEDA 1FBCA 4PETA 3FJGA 1DPPA 2P3NA 1SD3A 1FPEA 1K9YA 3C34A 1QW0A 4PFRA 4YAHX 3O9PA 2PBWA 2F7AA 2PT2A 3TTNA 4OTEA 3K1MA 1ZLQA 1WODA 3IFCA 4MIJA 3GXAA 4TLLB 2O51A 3TCGA 4UACA 4GXSB 4OHNA 4R2FA 2NVUB 2ONSA 2WEFA 3LSLA 2JJKA 4MX6A 2V25A 3Q28A 4OVRA 4PCDA 2QVRA 2X7QA 3SDFA 1B9JA 1OLAA 5EQAA 1Y3QA 3KOSA 3IJXB 4PF8A 5IZ3B 1IMEA 4OFOA 1N0TA 4Q8RA 1B0LA 1FBFA 1EYJA 2I4CA 1EYKA 4JSDA 4LVQA 5FBPA 1DSNA 1ZBMA 3O6GA 2F97A 5IAIA 1GVCA 2F3BA 1IMAA 3KEIA 3HCQA 4IY6A 1MXXA 3LBSA 1NI9A 2B3BA 2V3TA 3TCFA 2DQVA 4RPOA 3VLUA 2UXAA 1DTGA 4MFIA 4IO3A 2I48A 1MPBA 4NWDA 5I56A 3UN6A 2OBGA 3Q27A 4F18A 1SPIA 1DPEA 4P9KA 3MP6A 4M4GA 4QFPA 5EYFA 4O94A 2W7YA 4H67A 3TFLA 1S50A 1USYE 3PUZE 4ELOA 1SVXB 2FHYA 1FTKA 2NXOA 1MS7A 2XXVA 4OWDA 2V3QA 4Z0IA 3TQWA 3N94A 1IXGA 5EQ7A 4OETA 4C1UA 2HAVA 3M3LA 3FASA 5EHMA 4O3BA 5AA4A 4NF6B 3MYUA 4JSOA 3E78A 4R6YA 3ZS6A 3FBPA 1JEUA 3U72A 2QS2A 3KBZA 4U21A 1D9VA 4OFLA 1JNFA 5ITPA 2Q88A 4N6KA 1S7YA 3TODA 5CBRA 3VVFA 3MBPA 1FPJA 4HXVA 2QS3A 5ET5A 4FATA 3UIFA 3K6XA 4OVTA 3TYHA 2XXTA 3HHGA 2FA7A 2MKZA 2XXWA 2F36A 4H8JA 3G3JA 1VDWA 1DBZA 5FHNA 1O63A 5FHOA 3O2AA 2BJJX 1NV1A 1MQGA 2O6AA 3G3FA 2PVUA 4F2QA 3K0VA 3TQLA 2H98A 1IMDA 3IL1B 3TELA 3TKDA 4I9DA 3VFJA 1FTAA 3IOVA 1JQFA 4IO7A 2VD2A 4GX6A 3K6VA 1A55A 1AWBA 2HZKA 3I6VA 1A99A 4PC9A 4XXUA 3C4MA 3CIJA 1TFAA 3TMGA 1B32A 3ZKKA 1SDXA 1A8FA 1G0IA 2DP8A 1SW1A 3OD7A 3QSLA 2AL5A 4OMBA 4GWUA 1EH3A 4EDPA 4IY5A 5DVIA 2IA4A 4GF8A 3HN0A 4XFEA 2THIA 4H46A 1XI6A 2O1MA 3VLWA 2P0SA 4NGUA 3PMXA 1QKAA 3N26A 1A8EA 1CNQA 1LBBA 1BLFA 1LBCA 1DOTA 2GHAA 4PAKA 1UQWA 4G68B 3MZ9A 1LBVA 3RGYA 4IGTA 5JTYB 1LCFA 1MPCA 4NMYA 1ATGA 1NNKA 1B5JA 4F31B 2DE4A 4JWXA 5H8FB 4QBAA 3T9UA 1ANFA 4ZZEA 5KCJA 4FAJA 2ZXTA 3LUZA 4P8BA 2DE3A 3DP8A 5HBCA 4IO4A 4QRZA 3SERA 4X04A 4XKPA 4KFQA 3LV0A 3G3IA 3TCHA 4WKMA 4HE0A 3G7WA 1WVJA 4OZ9A 3ILUB 5L9OA 3JV9A 4OENA 1B1HA 2V4CA 4O7IA 4R6HA 2F78A 2RC9A 3FZVA 1R6ZA 1NMUA 3ILTB 4KCCA 4X48A 1NV5A 1Q9DA 1TWYA 3B6WA 4EUOA 3H6UA 4R2BA 2CEXA 3LSFB 1EZOA 5ITOA 1LB8A 3QUFA 1TXFA 4F22A 2RF1A 4PDHA 4FEBA 4THIA 4ELRA 4FJPA 4PTKA 3U1OA 2Y7PA 1ZKBA 1YXIA 5T3JA 2KQZA 1FPLA 4KPTA 1LLSA 3H7MA 1CB6A 2Z8EA 4R72A 1Q1KA 4PGPA 1B4HA 1FW0A 5KCJB 4QSEA 5A5XB 4YU0A 3KC1A 4GD5A 3RT6B 4WXJA 5B70A 2XXUA 4LQ5A 2HQ0A 1MQHA 3QIMA 1ZIUA 2P1SA 4YB6A 4NF8B 5I57B 5ICTA 3FVKA 5DVJA 3JYRA 4QFKA 1SI0A 4L17A 3VVDA 1CE2A 3CFXA 2A5TA 3T9VA 1PC3A 1FPKA 4ZEKA 1IITA 3QYTA 3KJ7A 2VP1A 4H5FA 4EQ9A 4QSCA 1M5DA 2VPOA 2NUVA 1FQAA 2XD2A 2WYKA 1B46A 3FD3A 5F7VA 5LDZA 4POWA 4GWYA 1FBHA 4N8GA 5I2KB 1MDQA 1P1OA 4RY1A 1P1WA 5ICQA 1POY1 1UTHB 4H45A 2HZLA 4GWSA 1USYH 5CRYA 4RJZA 4XF5A 1D9QA 3PGFA 3OMBA 4TQUQ 1US4A 1P1QA 4DDDA 4LZ7A 2XWVA 1DMBA 3CFZA 2DXYA 3FVOA 3FGSA 1MH4A 2Z22A 5L9SA 3IFAA 4NF0A 1JP4A 4F3SA 2DWAA 3IB0A 1UIVA 4U4XA 2YLNA 2X26A 1QUKA 1YAEA 2PX1A 4ZE8A 2F34A 2A5TB 2XWIA 2UYFA 1NNFA 3KGCA 2LAOA 1J1NA 5M2VA 4IO2A 4PAFA 1BIYA 3SEXA 3OO6A 5IZ3A 1NH7A 2REGA 2I0BA 4GX4A 2AIXA 4GXAA 2REJA 1MM6A 3LUYA 5I59B 4H1XA 5EYHA 3C9HA 4FECA 3KZGA 1XT8A 1RDYA 3U94A 2DXRA 4LUBA 2Y84A 4U22A 1FPFA 4EXKA 1BTJA 2NWJA 2XHDA 1B7UA 2DS9A 1NUWA 4GLIA 4ESXA 1N7XA 2L5VA 4P11A 1HSEA 2UVIA 3D4GA 3IO4A 3C31A 2QPQA 2A5SA 5CBSA 1MY0A 5IKBA 4DI4B 1B7HA 3M3KA 1EZ9A 3Q29A 3O28A 4IR8A 4NX1A 4LATA 1RYOA 3H3GA 3H03A 3WAFA 1NV7A 4PE3A 4P56A 1UIUA 2V93A 4DXUA 1POTA 4NF6A 3IJOB 5EYGA 2PT1A 2DWJA 5CC2A 4P3LA 3L6HA 4MH5A 1YCJA 3K6WA 3RTFB 3K02A 3FIRA 5ISUA 2F3DA 4N4UA 3I3VA 1SQYA 3ZSFA 1N76A 5EQ9A 1B51A 4LN5A 3HPIA 3TDJA 2DYXA 3RYDA 1N3WA 2CZHA 3OENA 5TP9A 2QMWA 1Y3NA 2OJTA 3G3KA 1JW4A 2I3WA 2OWTA 3CVGA 1GTKA 3OSRA 1ZMGA 3MVWA 2XWKA 1P99A 4DCYA 2ABHA 3HSTA 3EHTA 3R26A 4OEUA 3B7DA 2H99A 2Z8DA 4YKIA 1INPA 2WBDA 1VFEA 1RDXA 2FNCA 4KI0E 1UTBB 1OVTA 4X1DA 4FBPA 2Y7KA 1H44A 3IK6B 1FPGA 3LSWA 3TTMA 1FSAA 3K1PA 5H8QB 3KN3A 1N7WA 4R9GA 3EPEA 1GV8A 2CZIA 3GYYA 3UGWA 3TTLA 1XVYA 2UYEA 2XXRA 2RCAA 3ISPA 3LSXA 3VE1B 1ZTYA 3S9NC 3B6QA 3OXNA 5CMBA 3OEKA 4IGRA 3PU5A 2RC8A 1K9ZA 4DI3D 3RY3A 3KSXA 1H45A 3MWBA 4ECFA 2GHBA 3B8BA 2O7IA 2Y7IA 1URDA 5DW8A 1B3LA 2F6PA 4LZ8A 4MMPA 3MZBA 1NH8A 2HHMA 4G68A 2M8CA 1SW4A 2FBPA 5TP9B 3UK4A 5ET7A 5I3SA 1HSLA 1B3EA 3F11A 4YMAA 2QMXA 3C36A 1T0KA 5JTYA 2HAUA 4BDRA 1JW1A 2FVZA 1NKXA 2QVUA 4GOTA 3E9XA 5AA1A 5H8FA 4Q30B 3M8UA 1Z7ME 2F6GA 1MXYA 5F24A 2FIEA 4KYEA 1NL5A 2Q8MA 4JB7A 2ALUA 4MAGA 4NAPA 4Q0CA 2KLFA 3RPWA 1LCTA 5J16A 4AQ4A 4ELQA 1IEJA 1FRPA 1DK4A 4R9FA 3MSTA 3WAEA 1ELJA 3Q25A 1FPBA 1N84A 4EQBA 1FQEA 2Y5KA 4ZZAA 1KA1A 3D1RA 3GLBA 1QVSA 3GZGA 4MNPA 4XTCQ 2CZKA 3DLNA 3IB2A 4WEPA 3DM0A 4H5GA 4PGNA 2RCBA 5I2NB 4E0WA 4GWXA 2QL3A 2ZNUA 4OEVA 5H8NB 1VSOA 4LZ5A 3T22A 5LTCA 2HFBA 5H8HA 4H6DA 1FTLA 3PMVA 2OZZA 4PBHA 3T96B 2H5YA 4GL0A 1P1UA 1KA0A 5I5PA 3Q26A 4MLVA 1VR5A 2I3VA 3MVZA 1IQ7A 5JK4A 1MY4A 4RA1A 2DWIA 3ROJA 1N3XA 5DEXA 2XX7A 3BIGA 4XEQA 4Q5TA 3KFMA 3CG1A 3SESA 3EHUA 4NF5B 4YB7A 5A5XA 2VGQA 3BFUA 1YPNA 3FUZA 3U8QA 4R74A 2O7UA 4OVQA 1XHYA 3BIHA 2WYPA 3O66A 3OO8A 5K2YA 4IB2A 3FXQA 2WKYA 2I49A 2PFZA 1LAHE 3I5OA 2F7CA 5EQ8A 1YTVA 4NF8A 5I57A 3C32A 4ND9A 4IO5A 2XA5A 3FXUA 4U4SA 4LA9A 4U2RA 1B5IA 4JVDA 2Q2AA 2XXXA 1JEVA 3IR1A 4C0RA 3QUJA 2DVCA 1MM7A 4NQ8A 1Y1MA 1YZ0A 1MXWA 1Y4TA 2AYSA 2QS1A 1URSA 3H6TA 4KYSA 5H8HB 3SEUA 5IGAA 1URGA 2XXQA 4P1LA 5I2KA 3SEVA 3MP1A 3TPAA 1AOVA 1UTHA 1II5A 4KXPA 5DEXB 4PFIA 3E13X 1LFGA 4FEDA 1D4NA 4PE5B 1MH3A 3GBBA 3OO7A 4ELPA 1A7LA 3PTYA 1TT1A 4F3BA 1R1NA 3EF7A 2PCRA 5EHSA 1MXVA 1EZPA 3KSJA 4I40A 1VFDA 1FJ9A 3MW0A 1FBPA 3MZ1A 3QK6A 2QJEA 2VOZA 3V5AA 4I3EA 2D5WA 4YB5A 3A3UA 2B4MA 4OVSA 3NOHA 4XKRA 3VXCA 4KCDA 1PB8A 1IMCA 1VE4A 4NTLA 4N6DA 5AA2B 5DT6A 3PUVE 2ZZVA 4ZEFA 1IMBA 4JVIA 3S9MC 3CG3A 3RTWB 4BLAA 2VT5A 5I59A 3T0JA 1Y4CA 2H9BA 2QS4A 3RN8A 4P0GA 2ZZXA 5BUUA 4X1BA 2OWSA 2CMOA 4F3GA 2AL4A 3HV1A 1XC1A 2F35A 3C35A 3CHGA 4G68C 4ZEIA 4OERA 4EXLA 4BDQA 2O68A 3JZJA 3O6IA 1Y20A 1JVXA 2FYIA 5FTHA 3FJ7A 1DCUA 1QKBA 5JEIA 4QFNA 1FTJA 1B40A 4U23A 4GWOA 1FTOA 2I4BA 1AIVA 4DZ1A 1IMFA 3TUSA 3W15C 3SKPA 1IXIA 3HFUA 3FVGA 3QAXA 2QRYA 4OQOA 3H6VA 2UVGA 4MLQA 5KDTA 1KZ8A 5I58B 2ZYNA 2KR0A 4G77A 2B3FA 1OVBA 1NV4A 1QUIA 3PUXE 3T9XB 2Q8JA 3O97A 3TTKA 2WX9A 2HEUA 1WDNA 4N13A 1NFTA 1LSTA 3MAMA 2ONRA 4HE1A 3CSGA 3U93A 4BDMA 2B65A 1SYIA 3MJNA 1IZ1A 1B4ZA 4NE4A 2Q89A 1AL3A 3GBAA 1LBYA 3MUQA 1FBDA 4YZZA 3U65A 1Y1ZA 2Q9TA 3OO9A 4NF4B 4F2OA 1L5TA 1BKAA 1M5CA 2D3IA 1LEVA 4GBVA 4OANA 2XD3A 5TPAB 1N04A 4QSDA 1PDAA 3PPQA 1FPIA 3U92A 2R9JA 4TOZA 5CMMA 1B1XA 2XX8A 1UTBA 1OLCA 4GQOA 4Z7EA 4PAIA 1R9QA 3W9WA 4N6PA 1NV2A 4R6KA 1Z7NE 1OQGA 3T1BA 4DCXA 3CRBA 2B4LA 5H8QA 1LFHA 1NNTA 5CMKA 1S9TA 4NG7A 2HCAA 3DP6A 4MHFA 4PP0A 3K00A 4PFTA 3N6UA 3OEMA 3IOUA 1QGXA 1B7ZA 3T66A 3KBRA 5KDTB 1PB7A 3S9LC 1NUYA 3SZPA 3CFLA 1Q35A 1PEBA 1NV6A 4HTGA 2R71A 4R75A 1QUJA 1D9YA 3FATA 1B52A 1LBWA 4DXCA 4MCOA 3TZAA 1Y3PA 2Q2CA 1B0HA 4FE8A 3AXFA 4O3AA 3THIA 1I6QA 4RK2A 1AH5A 3KJTA 4F1VA 3IX1A 4DIGA 4QXDA 1ZU0A 3EHSA 2WBBA 2OX3A 4XKQA 1MQIA 4G8NA 4P47A 4DXBA 1LFIA 2CZLA 3CR9A 5ELVA 2FIXA 1FCKA 1MQDA 1LAXA 2O1LA 4RXLA 4KR5A 1FPDA 3MC2A 1MY3A 4UABA 4PFYA 2DVZA 2ZYMA 3MPKA 3ONMA 4KHZE 3USDA 5BWJA 3K6UA 3A3CA 4YKPA 4H8IA 4HCWA 1FQFA 2DDKA 3MPLA 1A54A 4I1DA 3RPLB 1BK4A 4HCYA 4I3YA 5CI5A 5FHMA 5LOMA 5H8SA 3L6GA 3DP4A 3TTRA 3O6HA 4F19A 5IZ1A 3PD8A 3IORA 1LBXA 1F9BA 4RK9A 3KOTA 5HM4B 1H43A 5ET6A 4HE2A 5I2NA 4YMBA 3MVYA 5H8NA 3FV2A 2XXKA 1I69A 3QXMA 2GRVA 3MP8A 2H25A 1D3KA 3D4CA 3V89B 4MNIA 4AB5A 5FTIA 3CSBA 3M3FA 4N07A 2QVVA 1OIBA 3UA8A 4MJOA 4G4PA 1IXCA 1Y9UA 1B58A 4LP2B 4OA4A 1AMFA 2ONKE 2I0CA 3EKIA 2XX9A 2DSFA 4XIGQ 3OELA 1SBPA 5IZZA 3A29A 1MY2A 4NF5A 1FTMA 1LBZA 5I84A 3CI8A 4H0WA 4NHBA 5AA3A 4FIMA 4YKJA 3RQTA 4ONYA 4U1ZA 3FXBA 2R8TA 4BDLA 5ESYA 5AE4A 4GBWA 4RYAA 4JXIA 1HSJA 3T9HB 2DOJA 4NN3A 4ZE9A 3VV5A 4X9TA 5I56B 1FQBA 3SEYA 1O64A 5A5LA 2ZZWA 4NWCA 1ZJLA 4F1UA 3BKIB 4POXA 1LAFE 1GGGA 5DTBA 4N15A 4JBZA 3IOWA 4MF3A 3HHFA 4EQ7A 2VD3A 3S9EA 2I58A 3K2DA 2G29A 4GL8A 2RC7A 1M5BA 5TU0A 1PBPA 1FQDA 3QMFA 3PV0E 1H76A 1FQCA 1NNPA 4DLDA 4AS5A 4JDFA 4GWZA 4PF6A 2XXHA 2XXIA 4TLMB 5K2XA 4MNCA 2F8DA 5AA4B 3G3HA 4K3FA 1DTZA 3PPNA 2OCUA 1FBGA 4KD5A 3PPOA 5CM6A 4GX3A 1JVYA 4JWOA 5B7DA 1B3FA 3N5LA 2ZNTA 2OWZA 2XXYA 5I7IA 3A09A 1B3HA 4ZS9A 2PYYA 1TFDA 3K4UA 1IIWA 2Z8FA 4R73A 4UA8A 4RNSA 4N91A 3G3GA 3TAJA 4OYVA 4PBQA 3W9VA 3H6WA 1SI1A 3KN8A 3S4UA 3IAZA 4OVJA 1GR2A 3P7IA 4ESWA 2UVJA 3IB1A 1RYXA 2NOOA 3N6TA 1B2HA 5KZTA 2QSXA 3SEWA 4F1YA 1EYIA 5AA2A 4OFJA 2E1SA 3E3KA 4PFUA 2HXRA 3VDFA 3PMWA 3PUWE 4QF9A 3BFTA 3BBRA 5AA2D 3KC0A 4ISUA 4G8HA 2OK2A 3IO6A 1A40A 4F29A 4AB6A 2Y5LA 3SETA 4M1VA 1FJ6A 4RPNA 4G61A 1XOCA 3UORA 3O29A 2ZMBA 4KYDA 5CMCA 2VHAA 4C1TA 4F39A 3ODBA 4QHQA 1IXHA 1BP5A 4WEDA 2XXPA 4HW8A 3PPRA 3EQ1A 2DE2A 3PD9A 4GRKA 3MQ9A 3V83A 2IEEA 4ZECA 2DWHA 2H4IA
chains in the Genus database with same CATH topology
3LR1A 1MY1A 1JW5A 3K1NA 1JETA 5HPQA 3RNNA 4P0IA 5J1DA 4KQPA 5I58A 1M5FA 3OSQA 1RKMA 2YJPA 2GFEA 1US5A 4I62A 4OXVA 4E0XA 1OMPA 1B05A 3PUYE 3H06B 2ZYOA 1PBQA 3RUMA 1XS5A 3FVNA 4GIZA 2HXWA 4PQJA 4JWYA 3DELB 3FXRA 2E0SA 2R6GE 2V84A 4NF4A 1MXUA 2RKMA 1QULA 4F3PA 4DE8A 3R7XA 3MVXA 1P1NA 3UP9A 1O7TA 3FV1A 5DVFA 3FJMA 5TPAA 2V3UA 3IOTA 1B5HA 3RT8A 1LB9A 3OOAA 5DYHA 1KWHA 3B6TA 1H3DA 1XVXA 3KN7A 4QFOA 2PMSA 3R6UA 5L9MA 2UVHA 2ZNSA 2RINA 1MQJA 4I8CA 4FORA 4LQ2A 2O69A 4YKKA 3T93B 2F7BA 4MBPA 5L8DA 2Z23A 3V8XB 1MRPA 3C33A 4OESA 5F1QA 1OQHA 1MDP1 2Y7WA 1SW2A 4H65A 3S2VA 4BDNA 1EU8A 1LGBC 1R9LA 3ECRA 3TEPA 1M5EA 1SYHA 2G93A 4YICA 4PFWA 2ZYKA 1MG1A 3E4RA 4EF2A 1PB9A 3EN3A 1B6HA 1MPDA 2OLBA 4GVOA 2Y7RA 1I6BA 3ZKLA 3HO7A 1MXZA 4QFLA 3VLVA 3VVEA 3K01A 4O3CA 3RLFE 1I6AA 2ANJA 4LONB 3H4ZA 2D21A 2ESNA 2I6EA 4IO6A 4ZEDA 3LC8A 1QJMA 3KG2A 2GH9A 4HS7A 4G8MA 4G2ZA 4EF1A 4ZDMA 4BDOA 2O84X 4U1OA 4XKNA 3PPPA 4GFRA 1B3GA 1IUDA 2F5XA 4ZEBA 2P2AA 2X7PA 1LAGE 2YPNA 3VXBA 1SW5A 4NEDA 4PETA 3FJGA 1DPPA 1SD3A 3C34A 1QW0A 4YAHX 3O9PA 2PBWA 2F7AA 2PT2A 3TTNA 4OTEA 3K1MA 1ZLQA 1WODA 3GXAA 4TLLB 2O51A 3TCGA 4UACA 4GXSB 4OHNA 4R2FA 2NVUB 2ONSA 3LSLA 2V25A 3Q28A 2X7QA 3SDFA 1B9JA 1OLAA 1Y3QA 3KOSA 3IJXB 4OFOA 1N0TA 4Q8RA 1B0LA 2I4CA 4JSDA 4LVQA 1DSNA 1ZBMA 3O6GA 2F97A 5IAIA 1GVCA 3KEIA 3HCQA 4IY6A 1MXXA 3LBSA 2B3BA 2V3TA 3TCFA 2DQVA 4RPOA 3VLUA 2UXAA 1DTGA 4MFIA 4IO3A 2I48A 1MPBA 4NWDA 5I56A 3UN6A 2OBGA 3Q27A 4F18A 1DPEA 3MP6A 4M4GA 4QFPA 5EYFA 2W7YA 4H67A 3TFLA 1S50A 1USYE 3PUZE 4ELOA 1SVXB 1FTKA 2NXOA 1MS7A 2XXVA 4OWDA 2V3QA 4Z0IA 3TQWA 3N94A 1IXGA 4OETA 4C1UA 2HAVA 3M3LA 3FASA 5EHMA 5AA4A 4O3BA 4NF6B 4JSOA 4R6YA 3ZS6A 3U72A 1JEUA 2QS2A 4U21A 1D9VA 4OFLA 1JNFA 5ITPA 2Q88A 1S7YA 3TODA 5CBRA 3VVFA 3MBPA 2QS3A 4FATA 3UIFA 3K6XA 3TYHA 2XXTA 3HHGA 2FA7A 2XXWA 2F36A 4H8JA 3G3JA 5FHNA 1O63A 5FHOA 3O2AA 2BJJX 1MQGA 2O6AA 3G3FA 2PVUA 4F2QA 3K0VA 3TQLA 2H98A 3IL1B 3TELA 3TKDA 4I9DA 3VFJA 3IOVA 1JQFA 4IO7A 2VD2A 3K6VA 1A55A 2HZKA 3I6VA 1A99A 4XXUA 3C4MA 3CIJA 1TFAA 3TMGA 1B32A 3ZKKA 1SDXA 1A8FA 2DP8A 1SW1A 3OD7A 3QSLA 2AL5A 4OMBA 1EH3A 4EDPA 4IY5A 5DVIA 2IA4A 4GF8A 3HN0A 2THIA 2O1MA 3VLWA 2P0SA 3PMXA 1QKAA 3N26A 1A8EA 1LBBA 1BLFA 1LBCA 1DOTA 2GHAA 1UQWA 4G68B 3MZ9A 3RGYA 4IGTA 5JTYB 1LCFA 1MPCA 4NMYA 1ATGA 1NNKA 1B5JA 4F31B 2DE4A 4JWXA 5H8FB 3T9UA 1ANFA 4ZZEA 5KCJA 4FAJA 2ZXTA 2DE3A 3DP8A 5HBCA 4IO4A 4QRZA 3SERA 4XKPA 4KFQA 3G3IA 3TCHA 4WKMA 3G7WA 1WVJA 4OZ9A 3ILUB 5L9OA 3JV9A 4OENA 1B1HA 4R6HA 2F78A 2RC9A 3FZVA 1R6ZA 1NMUA 3ILTB 4KCCA 4X48A 1TWYA 3B6WA 4EUOA 3H6UA 4R2BA 3LSFB 1EZOA 5ITOA 1LB8A 3QUFA 1TXFA 4F22A 2RF1A 4FEBA 4THIA 4ELRA 4FJPA 3U1OA 2Y7PA 1ZKBA 4KPTA 1LLSA 3H7MA 1CB6A 2Z8EA 4R72A 1Q1KA 1B4HA 1FW0A 5KCJB 4QSEA 5A5XB 4YU0A 4GD5A 3RT6B 4WXJA 5B70A 2XXUA 4LQ5A 2HQ0A 1MQHA 3QIMA 1ZIUA 2P1SA 4YB6A 4NF8B 5I57B 5ICTA 3FVKA 5DVJA 3JYRA 4QFKA 1SI0A 4L17A 3VVDA 1CE2A 3CFXA 2A5TA 3T9VA 1PC3A 4ZEKA 1IITA 3QYTA 3KJ7A 2VP1A 4H5FA 4EQ9A 4QSCA 1M5DA 2NUVA 1FQAA 2XD2A 1B46A 3FD3A 5F7VA 4POWA 5I2KB 1MDQA 1P1OA 4RY1A 1P1WA 5ICQA 1POY1 1UTHB 2HZLA 5CRYA 1USYH 4RJZA 3PGFA 3OMBA 4TQUQ 1US4A 1P1QA 4DDDA 4LZ7A 1DMBA 3CFZA 2DXYA 3FVOA 3FGSA 1MH4A 2Z22A 5L9SA 4F3SA 2DWAA 3IB0A 1UIVA 4U4XA 2YLNA 2X26A 1QUKA 1YAEA 2PX1A 4ZE8A 2F34A 2A5TB 2UYFA 1NNFA 3KGCA 2LAOA 1J1NA 5M2VA 4IO2A 1BIYA 3SEXA 3OO6A 1NH7A 2REGA 2I0BA 4GXAA 2AIXA 2REJA 1MM6A 3LUYA 5I59B 4H1XA 3C9HA 4FECA 3KZGA 1XT8A 3U94A 2DXRA 4LUBA 2Y84A 4U22A 4EXKA 1BTJA 2NWJA 2XHDA 1B7UA 2DS9A 4GLIA 4ESXA 1N7XA 4P11A 1HSEA 2UVIA 3D4GA 3IO4A 3C31A 2QPQA 2A5SA 5CBSA 1MY0A 5IKBA 1B7HA 3M3KA 1EZ9A 3Q29A 3O28A 4LATA 1RYOA 3H3GA 3H03A 3WAFA 1UIUA 2V93A 4DXUA 1POTA 4NF6A 3IJOB 2PT1A 2DWJA 5CC2A 3L6HA 4MH5A 1YCJA 3K6WA 3RTFB 3K02A 3FIRA 5ISUA 3I3VA 1SQYA 3ZSFA 1N76A 1B51A 3HPIA 3TDJA 2DYXA 1N3WA 3OENA 5TP9A 2QMWA 1Y3NA 2OJTA 3G3KA 1JW4A 2I3WA 2OWTA 3CVGA 1GTKA 3OSRA 1ZMGA 3MVWA 1P99A 4DCYA 2ABHA 3HSTA 3EHTA 3R26A 4OEUA 3B7DA 2H99A 2Z8DA 4YKIA 1VFEA 2FNCA 4KI0E 1UTBB 1OVTA 4X1DA 2Y7KA 1H44A 3IK6B 3LSWA 3TTMA 3K1PA 5H8QB 3KN3A 1N7WA 4R9GA 3EPEA 1GV8A 3UGWA 3TTLA 1XVYA 2UYEA 2XXRA 2RCAA 3LSXA 3VE1B 1ZTYA 3S9NC 3B6QA 3OXNA 5CMBA 3OEKA 4IGRA 3PU5A 2RC8A 3RY3A 3KSXA 1H45A 3MWBA 4ECFA 2GHBA 2O7IA 2Y7IA 1URDA 1B3LA 2F6PA 4LZ8A 3MZBA 1NH8A 4G68A 2M8CA 1SW4A 5TP9B 3UK4A 1HSLA 1B3EA 3F11A 4YMAA 2QMXA 3C36A 1T0KA 5JTYA 2HAUA 4BDRA 1JW1A 4GOTA 1NKXA 3E9XA 5AA1A 5H8FA 4Q30B 3M8UA 1Z7ME 2F6GA 1MXYA 4KYEA 1NL5A 4JB7A 2ALUA 4Q0CA 2KLFA 3RPWA 1LCTA 4AQ4A 4ELQA 1IEJA 4R9FA 3WAEA 1ELJA 3Q25A 1N84A 4EQBA 1FQEA 4ZZAA 3GLBA 1QVSA 3GZGA 4XTCQ 3DLNA 3IB2A 4WEPA 3DM0A 4H5GA 2RCBA 5I2NB 4E0WA 2QL3A 2ZNUA 4OEVA 5H8NB 1VSOA 4LZ5A 3T22A 2HFBA 5H8HA 4H6DA 1FTLA 3PMVA 2OZZA 3T96B 2H5YA 4GL0A 1P1UA 3Q26A 4MLVA 1VR5A 2I3VA 3MVZA 1IQ7A 5JK4A 1MY4A 4RA1A 2DWIA 1N3XA 5DEXA 2XX7A 4Q5TA 3KFMA 3CG1A 3SESA 3EHUA 4NF5B 4YB7A 5A5XA 2VGQA 3BFUA 1YPNA 3FUZA 3U8QA 4R74A 2O7UA 1XHYA 3O66A 3OO8A 5K2YA 4IB2A 3FXQA 2WKYA 2I49A 3I5OA 1LAHE 2F7CA 1YTVA 4NF8A 5I57A 3C32A 4ND9A 4IO5A 3FXUA 4U4SA 4LA9A 4U2RA 1B5IA 2Q2AA 2XXXA 1JEVA 3IR1A 4C0RA 3QUJA 2DVCA 1MM7A 1Y1MA 1MXWA 1Y4TA 2AYSA 2QS1A 1URSA 3H6TA 4KYSA 5H8HB 3SEUA 1URGA 2XXQA 5I2KA 3SEVA 3MP1A 3TPAA 1AOVA 1UTHA 1II5A 5DEXB 3E13X 1LFGA 4FEDA 1D4NA 4PE5B 1MH3A 3GBBA 3OO7A 4ELPA 1A7LA 1TT1A 4F3BA 1R1NA 3EF7A 5EHSA 1MXVA 1EZPA 3KSJA 1VFDA 3MW0A 3MZ1A 3QK6A 2QJEA 2VOZA 3V5AA 2D5WA 4YB5A 3A3UA 4XKRA 3VXCA 4KCDA 1PB8A 1VE4A 4NTLA 5AA2B 5DT6A 3PUVE 4ZEFA 3S9MC 3CG3A 3RTWB 4BLAA 5I59A 1Y4CA 2H9BA 2QS4A 3RN8A 4P0GA 5BUUA 4X1BA 2OWSA 2CMOA 4F3GA 2AL4A 3HV1A 1XC1A 2F35A 3C35A 4G68C 4ZEIA 4OERA 4EXLA 4BDQA 2O68A 3JZJA 3O6IA 1Y20A 1JVXA 2FYIA 5FTHA 3FJ7A 1QKBA 5JEIA 4QFNA 1FTJA 1B40A 4U23A 4GWOA 1FTOA 2I4BA 1AIVA 4DZ1A 3TUSA 3W15C 3SKPA 1IXIA 3FVGA 3QAXA 2QRYA 4OQOA 3H6VA 2UVGA 4MLQA 5KDTA 5I58B 2ZYNA 4G77A 2B3FA 1OVBA 1QUIA 3PUXE 3T9XB 2Q8JA 3O97A 3TTKA 2HEUA 1WDNA 4N13A 1NFTA 1LSTA 3MAMA 2ONRA 3CSGA 3U93A 4BDMA 2B65A 1SYIA 3MJNA 1IZ1A 1B4ZA 4NE4A 2Q89A 1AL3A 3GBAA 3MUQA 4YZZA 1Y1ZA 2Q9TA 3OO9A 4NF4B 4F2OA 1L5TA 1BKAA 1M5CA 2D3IA 2XD3A 5TPAB 1N04A 4QSDA 1PDAA 3PPQA 3U92A 2R9JA 4TOZA 5CMMA 1B1XA 2XX8A 1UTBA 1OLCA 4GQOA 4Z7EA 1R9QA 3W9WA 4N6PA 4R6KA 1Z7NE 1OQGA 4DCXA 3CRBA 5H8QA 1LFHA 1NNTA 5CMKA 1S9TA 2HCAA 3DP6A 4PP0A 3K00A 4PFTA 3N6UA 3OEMA 3IOUA 1B7ZA 3T66A 3KBRA 5KDTB 1PB7A 3S9LC 3CFLA 1Q35A 1PEBA 4HTGA 2R71A 4R75A 1QUJA 1D9YA 3FATA 1B52A 4DXCA 3TZAA 1Y3PA 2Q2CA 1B0HA 4FE8A 3AXFA 4O3AA 3THIA 1I6QA 4RK2A 1AH5A 3KJTA 4F1VA 3IX1A 4DIGA 1ZU0A 3EHSA 4XKQA 1MQIA 4G8NA 4DXBA 1LFIA 2CZLA 3CR9A 5ELVA 1FCKA 1MQDA 1LAXA 2O1LA 4RXLA 4KR5A 3MC2A 1MY3A 4PFYA 2DVZA 2ZYMA 3MPKA 3ONMA 4KHZE 3USDA 5BWJA 3K6UA 3A3CA 4YKPA 4H8IA 4HCWA 1FQFA 3MPLA 1A54A 4I1DA 4HCYA 5CI5A 5FHMA 5LOMA 5H8SA 3L6GA 3DP4A 3TTRA 3O6HA 4F19A 3PD8A 3IORA 1F9BA 4RK9A 3KOTA 5HM4B 1H43A 5I2NA 4YMBA 3MVYA 5H8NA 3FV2A 1I69A 3QXMA 2GRVA 3MP8A 2H25A 1D3KA 3D4CA 3V89B 4AB5A 5FTIA 3CSBA 3M3FA 4N07A 1OIBA 3UA8A 4G4PA 1IXCA 1Y9UA 1B58A 4LP2B 1AMFA 2ONKE 2I0CA 2XX9A 2DSFA 4XIGQ 3OELA 1SBPA 1MY2A 4NF5A 1FTMA 5I84A 3CI8A 4H0WA 5AA3A 4FIMA 4YKJA 3RQTA 4ONYA 4U1ZA 4BDLA 5AE4A 4RYAA 4JXIA 1HSJA 3T9HB 2DOJA 4ZE9A 3VV5A 4X9TA 5I56B 1FQBA 3SEYA 1O64A 4NWCA 1ZJLA 4F1UA 3BKIB 4POXA 1LAFE 1GGGA 5DTBA 4JBZA 3IOWA 4MF3A 3HHFA 4EQ7A 2VD3A 3S9EA 2I58A 3K2DA 2G29A 4GL8A 2RC7A 1M5BA 5TU0A 1PBPA 1FQDA 3PV0E 1H76A 1FQCA 1NNPA 4DLDA 4JDFA 2XXHA 2XXIA 4TLMB 5K2XA 2F8DA 5AA4B 3G3HA 4K3FA 1DTZA 3PPNA 2OCUA 4KD5A 3PPOA 5CM6A 1JVYA 4JWOA 5B7DA 1B3FA 3N5LA 2ZNTA 2XXYA 3A09A 1B3HA 4ZS9A 2PYYA 1TFDA 3K4UA 1IIWA 2Z8FA 4R73A 4UA8A 4RNSA 3G3GA 3TAJA 4OYVA 3W9VA 3H6WA 1SI1A 3KN8A 3S4UA 3IAZA 4OVJA 1GR2A 3P7IA 4ESWA 2UVJA 3IB1A 1RYXA 2NOOA 3N6TA 1B2HA 5KZTA 2QSXA 3SEWA 4F1YA 5AA2A 4OFJA 2E1SA 3E3KA 4PFUA 3VDFA 3PMWA 3PUWE 4QF9A 3BFTA 3BBRA 5AA2D 4ISUA 4G8HA 2OK2A 3IO6A 1A40A 4F29A 4AB6A 3SETA 4M1VA 4RPNA 1XOCA 3UORA 3O29A 2ZMBA 4KYDA 5CMCA 2VHAA 4C1TA 4F39A 3ODBA 4QHQA 1IXHA 1BP5A 4WEDA 2XXPA 4HW8A 3PPRA 3EQ1A 2DE2A 3PD9A 4GRKA 3MQ9A 3V83A 2IEEA 4ZECA 2DWHA 2H4IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LR1 A;  1MY1 A;  1JW5 A;  3K1N A;  1JET A;  5HPQ A;  3RNN A;  4P0I A;  5J1D A;  4KQP A;  5I58 A;  1M5F A;  3OSQ A;  1RKM A;  2YJP A;  2GFE A;  1US5 A;  4I62 A;  4OXV A;  4E0X A;  1OMP A;  1B05 A;  3PUY E;  3H06 B;  2ZYO A;  1PBQ A;  3RUM A;  1XS5 A;  3FVN A;  4GIZ A;  2HXW A;  4PQJ A;  4JWY A;  3DEL B;  3FXR A;  2E0S A;  2R6G E;  2V84 A;  4NF4 A;  1MXU A;  2RKM A;  1QUL A;  4F3P A;  4DE8 A;  3R7X A;  3MVX A;  1P1N A;  3UP9 A;  1O7T A;  3FV1 A;  5DVF A;  3FJM A;  5TPA A;  2V3U A;  3IOT A;  1B5H A;  3RT8 A;  1LB9 A;  3OOA A;  5DYH A;  1KWH A;  3B6T A;  1H3D A;  1XVX A;  3KN7 A;  4QFO A;  2PMS A;  3R6U A;  5L9M A;  2UVH A;  2ZNS A;  2RIN A;  1MQJ A;  4I8C A;  4FOR A;  4LQ2 A;  2O69 A;  4YKK A;  3T93 B;  2F7B A;  4MBP A;  5L8D A;  2Z23 A;  3V8X B;  1MRP A;  3C33 A;  4OES A;  5F1Q A;  1OQH A;  1MDP 1;  2Y7W A;  1SW2 A;  4H65 A;  3S2V A;  4BDN A;  1EU8 A;  1LGB C;  1R9L A;  3ECR A;  3TEP A;  1M5E A;  1SYH A;  2G93 A;  4YIC A;  4PFW A;  2ZYK A;  1MG1 A;  3E4R A;  4EF2 A;  1PB9 A;  3EN3 A;  1B6H A;  1MPD A;  2OLB A;  4GVO A;  2Y7R A;  1I6B A;  3ZKL A;  3HO7 A;  1MXZ A;  4QFL A;  3VLV A;  3VVE A;  3K01 A;  4O3C A;  3RLF E;  1I6A A;  2ANJ A;  4LON B;  3H4Z A;  2D21 A;  2ESN A;  2I6E A;  4IO6 A;  4ZED A;  3LC8 A;  1QJM A;  3KG2 A;  2GH9 A;  4HS7 A;  4G8M A;  4G2Z A;  4EF1 A;  4ZDM A;  4BDO A;  2O84 X;  4U1O A;  4XKN A;  3PPP A;  4GFR A;  1B3G A;  1IUD A;  2F5X A;  4ZEB A;  2P2A A;  2X7P A;  1LAG E;  2YPN A;  3VXB A;  1SW5 A;  4NED A;  4PET A;  3FJG A;  1DPP A;  1SD3 A;  3C34 A;  1QW0 A;  4YAH X;  3O9P A;  2PBW A;  2F7A A;  2PT2 A;  3TTN A;  4OTE A;  3K1M A;  1ZLQ A;  1WOD A;  3GXA A;  4TLL B;  2O51 A;  3TCG A;  4UAC A;  4GXS B;  4OHN A;  4R2F A;  2NVU B;  2ONS A;  3LSL A;  2V25 A;  3Q28 A;  2X7Q A;  3SDF A;  1B9J A;  1OLA A;  1Y3Q A;  3KOS A;  3IJX B;  4OFO A;  1N0T A;  4Q8R A;  1B0L A;  2I4C A;  4JSD A;  4LVQ A;  1DSN A;  1ZBM A;  3O6G A;  2F97 A;  5IAI A;  1GVC A;  3KEI A;  3HCQ A;  4IY6 A;  1MXX A;  3LBS A;  2B3B A;  2V3T A;  3TCF A;  2DQV A;  4RPO A;  3VLU A;  2UXA A;  1DTG A;  4MFI A;  4IO3 A;  2I48 A;  1MPB A;  4NWD A;  5I56 A;  3UN6 A;  2OBG A;  3Q27 A;  4F18 A;  1DPE A;  3MP6 A;  4M4G A;  4QFP A;  5EYF A;  2W7Y A;  4H67 A;  3TFL A;  1S50 A;  1USY E;  3PUZ E;  4ELO A;  1SVX B;  1FTK A;  2NXO A;  1MS7 A;  2XXV A;  4OWD A;  2V3Q A;  4Z0I A;  3TQW A;  3N94 A;  1IXG A;  4OET A;  4C1U A;  2HAV A;  3M3L A;  3FAS A;  5EHM A;  5AA4 A;  4O3B A;  4NF6 B;  4JSO A;  4R6Y A;  3ZS6 A;  3U72 A;  1JEU A;  2QS2 A;  4U21 A;  1D9V A;  4OFL A;  1JNF A;  5ITP A;  2Q88 A;  1S7Y A;  3TOD A;  5CBR A;  3VVF A;  3MBP A;  2QS3 A;  4FAT A;  3UIF A;  3K6X A;  3TYH A;  2XXT A;  3HHG A;  2FA7 A;  2XXW A;  2F36 A;  4H8J A;  3G3J A;  5FHN A;  1O63 A;  5FHO A;  3O2A A;  2BJJ X;  1MQG A;  2O6A A;  3G3F A;  2PVU A;  4F2Q A;  3K0V A;  3TQL A;  2H98 A;  3IL1 B;  3TEL A;  3TKD A;  4I9D A;  3VFJ A;  3IOV A;  1JQF A;  4IO7 A;  2VD2 A;  3K6V A;  1A55 A;  2HZK A;  3I6V A;  1A99 A;  4XXU A;  3C4M A;  3CIJ A;  1TFA A;  3TMG A;  1B32 A;  3ZKK A;  1SDX A;  1A8F A;  2DP8 A;  1SW1 A;  3OD7 A;  3QSL A;  2AL5 A;  4OMB A;  1EH3 A;  4EDP A;  4IY5 A;  5DVI A;  2IA4 A;  4GF8 A;  3HN0 A;  2THI A;  2O1M A;  3VLW A;  2P0S A;  3PMX A;  1QKA A;  3N26 A;  1A8E A;  1LBB A;  1BLF A;  1LBC A;  1DOT A;  2GHA A;  1UQW A;  4G68 B;  3MZ9 A;  3RGY A;  4IGT A;  5JTY B;  1LCF A;  1MPC A;  4NMY A;  1ATG A;  1NNK A;  1B5J A;  4F31 B;  2DE4 A;  4JWX A;  5H8F B;  3T9U A;  1ANF A;  4ZZE A;  5KCJ A;  4FAJ A;  2ZXT A;  2DE3 A;  3DP8 A;  5HBC A;  4IO4 A;  4QRZ A;  3SER A;  4XKP A;  4KFQ A;  3G3I A;  3TCH A;  4WKM A;  3G7W A;  1WVJ A;  4OZ9 A;  3ILU B;  5L9O A;  3JV9 A;  4OEN A;  1B1H A;  4R6H A;  2F78 A;  2RC9 A;  3FZV A;  1R6Z A;  1NMU A;  3ILT B;  4KCC A;  4X48 A;  1TWY A;  3B6W A;  4EUO A;  3H6U A;  4R2B A;  3LSF B;  1EZO A;  5ITO A;  1LB8 A;  3QUF A;  1TXF A;  4F22 A;  2RF1 A;  4FEB A;  4THI A;  4ELR A;  4FJP A;  3U1O A;  2Y7P A;  1ZKB A;  4KPT A;  1LLS A;  3H7M A;  1CB6 A;  2Z8E A;  4R72 A;  1Q1K A;  1B4H A;  1FW0 A;  5KCJ B;  4QSE A;  5A5X B;  4YU0 A;  4GD5 A;  3RT6 B;  4WXJ A;  5B70 A;  2XXU A;  4LQ5 A;  2HQ0 A;  1MQH A;  3QIM A;  1ZIU A;  2P1S A;  4YB6 A;  4NF8 B;  5I57 B;  5ICT A;  3FVK A;  5DVJ A;  3JYR A;  4QFK A;  1SI0 A;  4L17 A;  3VVD A;  1CE2 A;  3CFX A;  2A5T A;  3T9V A;  1PC3 A;  4ZEK A;  1IIT A;  3QYT A;  3KJ7 A;  2VP1 A;  4H5F A;  4EQ9 A;  4QSC A;  1M5D A;  2NUV A;  1FQA A;  2XD2 A;  1B46 A;  3FD3 A;  5F7V A;  4POW A;  5I2K B;  1MDQ A;  1P1O A;  4RY1 A;  1P1W A;  5ICQ A;  1POY 1;  1UTH B;  2HZL A;  5CRY A;  1USY H;  4RJZ A;  3PGF A;  3OMB A;  4TQU Q;  1US4 A;  1P1Q A;  4DDD A;  4LZ7 A;  1DMB A;  3CFZ A;  2DXY A;  3FVO A;  3FGS A;  1MH4 A;  2Z22 A;  5L9S A;  4F3S A;  2DWA A;  3IB0 A;  1UIV A;  4U4X A;  2YLN A;  2X26 A;  1QUK A;  1YAE A;  2PX1 A;  4ZE8 A;  2F34 A;  2A5T B;  2UYF A;  1NNF A;  3KGC A;  2LAO A;  1J1N A;  5M2V A;  4IO2 A;  1BIY A;  3SEX A;  3OO6 A;  1NH7 A;  2REG A;  2I0B A;  4GXA A;  2AIX A;  2REJ A;  1MM6 A;  3LUY A;  5I59 B;  4H1X A;  3C9H A;  4FEC A;  3KZG A;  1XT8 A;  3U94 A;  2DXR A;  4LUB A;  2Y84 A;  4U22 A;  4EXK A;  1BTJ A;  2NWJ A;  2XHD A;  1B7U A;  2DS9 A;  4GLI A;  4ESX A;  1N7X A;  4P11 A;  1HSE A;  2UVI A;  3D4G A;  3IO4 A;  3C31 A;  2QPQ A;  2A5S A;  5CBS A;  1MY0 A;  5IKB A;  1B7H A;  3M3K A;  1EZ9 A;  3Q29 A;  3O28 A;  4LAT A;  1RYO A;  3H3G A;  3H03 A;  3WAF A;  1UIU A;  2V93 A;  4DXU A;  1POT A;  4NF6 A;  3IJO B;  2PT1 A;  2DWJ A;  5CC2 A;  3L6H A;  4MH5 A;  1YCJ A;  3K6W A;  3RTF B;  3K02 A;  3FIR A;  5ISU A;  3I3V A;  1SQY A;  3ZSF A;  1N76 A;  1B51 A;  3HPI A;  3TDJ A;  2DYX A;  1N3W A;  3OEN A;  5TP9 A;  2QMW A;  1Y3N A;  2OJT A;  3G3K A;  1JW4 A;  2I3W A;  2OWT A;  3CVG A;  1GTK A;  3OSR A;  1ZMG A;  3MVW A;  1P99 A;  4DCY A;  2ABH A;  3HST A;  3EHT A;  3R26 A;  4OEU A;  3B7D A;  2H99 A;  2Z8D A;  4YKI A;  1VFE A;  2FNC A;  4KI0 E;  1UTB B;  1OVT A;  4X1D A;  2Y7K A;  1H44 A;  3IK6 B;  3LSW A;  3TTM A;  3K1P A;  5H8Q B;  3KN3 A;  1N7W A;  4R9G A;  3EPE A;  1GV8 A;  3UGW A;  3TTL A;  1XVY A;  2UYE A;  2XXR A;  2RCA A;  3LSX A;  3VE1 B;  1ZTY A;  3S9N C;  3B6Q A;  3OXN A;  5CMB A;  3OEK A;  4IGR A;  3PU5 A;  2RC8 A;  3RY3 A;  3KSX A;  1H45 A;  3MWB A;  4ECF A;  2GHB A;  2O7I A;  2Y7I A;  1URD A;  1B3L A;  2F6P A;  4LZ8 A;  3MZB A;  1NH8 A;  4G68 A;  2M8C A;  1SW4 A;  5TP9 B;  3UK4 A;  1HSL A;  1B3E A;  3F11 A;  4YMA A;  2QMX A;  3C36 A;  1T0K A;  5JTY A;  2HAU A;  4BDR A;  1JW1 A;  4GOT A;  1NKX A;  3E9X A;  5AA1 A;  5H8F A;  4Q30 B;  3M8U A;  1Z7M E;  2F6G A;  1MXY A;  4KYE A;  1NL5 A;  4JB7 A;  2ALU A;  4Q0C A;  2KLF A;  3RPW A;  1LCT A;  4AQ4 A;  4ELQ A;  1IEJ A;  4R9F A;  3WAE A;  1ELJ A;  3Q25 A;  1N84 A;  4EQB A;  1FQE A;  4ZZA A;  3GLB A;  1QVS A;  3GZG A;  4XTC Q;  3DLN A;  3IB2 A;  4WEP A;  3DM0 A;  4H5G A;  2RCB A;  5I2N B;  4E0W A;  2QL3 A;  2ZNU A;  4OEV A;  5H8N B;  1VSO A;  4LZ5 A;  3T22 A;  2HFB A;  5H8H A;  4H6D A;  1FTL A;  3PMV A;  2OZZ A;  3T96 B;  2H5Y A;  4GL0 A;  1P1U A;  3Q26 A;  4MLV A;  1VR5 A;  2I3V A;  3MVZ A;  1IQ7 A;  5JK4 A;  1MY4 A;  4RA1 A;  2DWI A;  1N3X A;  5DEX A;  2XX7 A;  4Q5T A;  3KFM A;  3CG1 A;  3SES A;  3EHU A;  4NF5 B;  4YB7 A;  5A5X A;  2VGQ A;  3BFU A;  1YPN A;  3FUZ A;  3U8Q A;  4R74 A;  2O7U A;  1XHY A;  3O66 A;  3OO8 A;  5K2Y A;  4IB2 A;  3FXQ A;  2WKY A;  2I49 A;  3I5O A;  1LAH E;  2F7C A;  1YTV A;  4NF8 A;  5I57 A;  3C32 A;  4ND9 A;  4IO5 A;  3FXU A;  4U4S A;  4LA9 A;  4U2R A;  1B5I A;  2Q2A A;  2XXX A;  1JEV A;  3IR1 A;  4C0R A;  3QUJ A;  2DVC A;  1MM7 A;  1Y1M A;  1MXW A;  1Y4T A;  2AYS A;  2QS1 A;  1URS A;  3H6T A;  4KYS A;  5H8H B;  3SEU A;  1URG A;  2XXQ A;  5I2K A;  3SEV A;  3MP1 A;  3TPA A;  1AOV A;  1UTH A;  1II5 A;  5DEX B;  3E13 X;  1LFG A;  4FED A;  1D4N A;  4PE5 B;  1MH3 A;  3GBB A;  3OO7 A;  4ELP A;  1A7L A;  1TT1 A;  4F3B A;  1R1N A;  3EF7 A;  5EHS A;  1MXV A;  1EZP A;  3KSJ A;  1VFD A;  3MW0 A;  3MZ1 A;  3QK6 A;  2QJE A;  2VOZ A;  3V5A A;  2D5W A;  4YB5 A;  3A3U A;  4XKR A;  3VXC A;  4KCD A;  1PB8 A;  1VE4 A;  4NTL A;  5AA2 B;  5DT6 A;  3PUV E;  4ZEF A;  3S9M C;  3CG3 A;  3RTW B;  4BLA A;  5I59 A;  1Y4C A;  2H9B A;  2QS4 A;  3RN8 A;  4P0G A;  5BUU A;  4X1B A;  2OWS A;  2CMO A;  4F3G A;  2AL4 A;  3HV1 A;  1XC1 A;  2F35 A;  3C35 A;  4G68 C;  4ZEI A;  4OER A;  4EXL A;  4BDQ A;  2O68 A;  3JZJ A;  3O6I A;  1Y20 A;  1JVX A;  2FYI A;  5FTH A;  3FJ7 A;  1QKB A;  5JEI A;  4QFN A;  1FTJ A;  1B40 A;  4U23 A;  4GWO A;  1FTO A;  2I4B A;  1AIV A;  4DZ1 A;  3TUS A;  3W15 C;  3SKP A;  1IXI A;  3FVG A;  3QAX A;  2QRY A;  4OQO A;  3H6V A;  2UVG A;  4MLQ A;  5KDT A;  5I58 B;  2ZYN A;  4G77 A;  2B3F A;  1OVB A;  1QUI A;  3PUX E;  3T9X B;  2Q8J A;  3O97 A;  3TTK A;  2HEU A;  1WDN A;  4N13 A;  1NFT A;  1LST A;  3MAM A;  2ONR A;  3CSG A;  3U93 A;  4BDM A;  2B65 A;  1SYI A;  3MJN A;  1IZ1 A;  1B4Z A;  4NE4 A;  2Q89 A;  1AL3 A;  3GBA A;  3MUQ A;  4YZZ A;  1Y1Z A;  2Q9T A;  3OO9 A;  4NF4 B;  4F2O A;  1L5T A;  1BKA A;  1M5C A;  2D3I A;  2XD3 A;  5TPA B;  1N04 A;  4QSD A;  1PDA A;  3PPQ A;  3U92 A;  2R9J A;  4TOZ A;  5CMM A;  1B1X A;  2XX8 A;  1UTB A;  1OLC A;  4GQO A;  4Z7E A;  1R9Q A;  3W9W A;  4N6P A;  4R6K A;  1Z7N E;  1OQG A;  4DCX A;  3CRB A;  5H8Q A;  1LFH A;  1NNT A;  5CMK A;  1S9T A;  2HCA A;  3DP6 A;  4PP0 A;  3K00 A;  4PFT A;  3N6U A;  3OEM A;  3IOU A;  1B7Z A;  3T66 A;  3KBR A;  5KDT B;  1PB7 A;  3S9L C;  3CFL A;  1Q35 A;  1PEB A;  4HTG A;  2R71 A;  4R75 A;  1QUJ A;  1D9Y A;  3FAT A;  1B52 A;  4DXC A;  3TZA A;  1Y3P A;  2Q2C A;  1B0H A;  4FE8 A;  3AXF A;  4O3A A;  3THI A;  1I6Q A;  4RK2 A;  1AH5 A;  3KJT A;  4F1V A;  3IX1 A;  4DIG A;  1ZU0 A;  3EHS A;  4XKQ A;  1MQI A;  4G8N A;  4DXB A;  1LFI A;  2CZL A;  3CR9 A;  5ELV A;  1FCK A;  1MQD A;  1LAX A;  2O1L A;  4RXL A;  4KR5 A;  3MC2 A;  1MY3 A;  4PFY A;  2DVZ A;  2ZYM A;  3MPK A;  3ONM A;  4KHZ E;  3USD A;  5BWJ A;  3K6U A;  3A3C A;  4YKP A;  4H8I A;  4HCW A;  1FQF A;  3MPL A;  1A54 A;  4I1D A;  4HCY A;  5CI5 A;  5FHM A;  5LOM A;  5H8S A;  3L6G A;  3DP4 A;  3TTR A;  3O6H A;  4F19 A;  3PD8 A;  3IOR A;  1F9B A;  4RK9 A;  3KOT A;  5HM4 B;  1H43 A;  5I2N A;  4YMB A;  3MVY A;  5H8N A;  3FV2 A;  1I69 A;  3QXM A;  2GRV A;  3MP8 A;  2H25 A;  1D3K A;  3D4C A;  3V89 B;  4AB5 A;  5FTI A;  3CSB A;  3M3F A;  4N07 A;  1OIB A;  3UA8 A;  4G4P A;  1IXC A;  1Y9U A;  1B58 A;  4LP2 B;  1AMF A;  2ONK E;  2I0C A;  2XX9 A;  2DSF A;  4XIG Q;  3OEL A;  1SBP A;  1MY2 A;  4NF5 A;  1FTM A;  5I84 A;  3CI8 A;  4H0W A;  5AA3 A;  4FIM A;  4YKJ A;  3RQT A;  4ONY A;  4U1Z A;  4BDL A;  5AE4 A;  4RYA A;  4JXI A;  1HSJ A;  3T9H B;  2DOJ A;  4ZE9 A;  3VV5 A;  4X9T A;  5I56 B;  1FQB A;  3SEY A;  1O64 A;  4NWC A;  1ZJL A;  4F1U A;  3BKI B;  4POX A;  1LAF E;  1GGG A;  5DTB A;  4JBZ A;  3IOW A;  4MF3 A;  3HHF A;  4EQ7 A;  2VD3 A;  3S9E A;  2I58 A;  3K2D A;  2G29 A;  4GL8 A;  2RC7 A;  1M5B A;  5TU0 A;  1PBP A;  1FQD A;  3PV0 E;  1H76 A;  1FQC A;  1NNP A;  4DLD A;  4JDF A;  2XXH A;  2XXI A;  4TLM B;  5K2X A;  2F8D A;  5AA4 B;  3G3H A;  4K3F A;  1DTZ A;  3PPN A;  2OCU A;  4KD5 A;  3PPO A;  5CM6 A;  1JVY A;  4JWO A;  5B7D A;  1B3F A;  3N5L A;  2ZNT A;  2XXY A;  3A09 A;  1B3H A;  4ZS9 A;  2PYY A;  1TFD A;  3K4U A;  1IIW A;  2Z8F A;  4R73 A;  4UA8 A;  4RNS A;  3G3G A;  3TAJ A;  4OYV A;  3W9V A;  3H6W A;  1SI1 A;  3KN8 A;  3S4U A;  3IAZ A;  4OVJ A;  1GR2 A;  3P7I A;  4ESW A;  2UVJ A;  3IB1 A;  1RYX A;  2NOO A;  3N6T A;  1B2H A;  5KZT A;  2QSX A;  3SEW A;  4F1Y A;  5AA2 A;  4OFJ A;  2E1S A;  3E3K A;  4PFU A;  3VDF A;  3PMW A;  3PUW E;  4QF9 A;  3BFT A;  3BBR A;  5AA2 D;  4ISU A;  4G8H A;  2OK2 A;  3IO6 A;  1A40 A;  4F29 A;  4AB6 A;  3SET A;  4M1V A;  4RPN A;  1XOC A;  3UOR A;  3O29 A;  2ZMB A;  4KYD A;  5CMC A;  2VHA A;  4C1T A;  4F39 A;  3ODB A;  4QHQ A;  1IXH A;  1BP5 A;  4WED A;  2XXP A;  4HW8 A;  3PPR A;  3EQ1 A;  2DE2 A;  3PD9 A;  4GRK A;  3MQ9 A;  3V83 A;  2IEE A;  4ZEC A;  2DWH A;  2H4I A; 
#chains in the Genus database with same CATH topology
 3LR1 A;  1MY1 A;  1JW5 A;  3K1N A;  1JET A;  5HPQ A;  3RNN A;  4P0I A;  5J1D A;  4KQP A;  5I58 A;  1M5F A;  3OSQ A;  1NV3 A;  1RKM A;  4N81 A;  2YJP A;  2GFE A;  1US5 A;  4I62 A;  4AS4 A;  4OXV A;  4E0X A;  1OMP A;  1B05 A;  3PUY E;  4O8M A;  3H06 B;  2ZYO A;  1PBQ A;  3RUM A;  1XS5 A;  3E79 A;  2BJI A;  3FVN A;  4O7M A;  4GIZ A;  2VPN A;  2HXW A;  4PQJ A;  4JWY A;  3DEL B;  4GWW A;  3FXR A;  2GQ1 A;  2E0S A;  2R6G E;  1YYZ A;  2V84 A;  1NUZ A;  4NF4 A;  1MXU A;  2RKM A;  1QUL A;  4F3P A;  4DE8 A;  3R7X A;  3MVX A;  1P1N A;  4PDD A;  3UP9 A;  1O7T A;  3FV1 A;  5DVF A;  3FJM A;  5TPA A;  2V3U A;  3IOT A;  1B5H A;  1NUX A;  3RT8 A;  1LB9 A;  3OOA A;  5DYH A;  1KWH A;  4N17 A;  5IM2 A;  2XWO A;  3B6T A;  1G0H A;  1H3D A;  1XVX A;  3KN7 A;  4QFO A;  2PMS A;  3R6U A;  5L9M A;  2UVH A;  2ZNS A;  2RIN A;  1MQJ A;  4I8C A;  2Q74 A;  4FOR A;  1RDZ A;  4LQ2 A;  2O69 A;  4YKK A;  2PFY A;  3T93 B;  2F7B A;  4MBP A;  4P1E A;  5L8D A;  2Z23 A;  3V8X B;  1MRP A;  3C33 A;  4OES A;  5F1Q A;  1OQH A;  1NV0 A;  1MDP 1;  2Y7W A;  1SW2 A;  2CEY A;  4H65 A;  3S2V A;  4BDN A;  4PFB A;  1EU8 A;  1LGB C;  1R9L A;  3ECR A;  3TEP A;  1M5E A;  1SYH A;  2G93 A;  4YIC A;  4PFW A;  2HPG A;  2ZYK A;  1MG1 A;  3E4R A;  4EF2 A;  1PB9 A;  3EN3 A;  1B6H A;  1MPD A;  2OLB A;  4GVO A;  2Y7R A;  1I6B A;  3ZKL A;  3HO7 A;  1MXZ A;  4QFL A;  3VLV A;  4JVC A;  3VVE A;  3K01 A;  4O3C A;  3RLF E;  1I6A A;  2ANJ A;  4LON B;  4OVP A;  3H4Z A;  2D21 A;  2ESN A;  2I6E A;  4IO6 A;  3RPL A;  4ZED A;  2QFL A;  3LC8 A;  1QJM A;  3KG2 A;  2GH9 A;  4MEV A;  2P3V A;  4HS7 A;  4G8M A;  4X8R A;  4G2Z A;  4EF1 A;  4ZDM A;  4BDO A;  2O84 X;  4U1O A;  4XKN A;  3B50 A;  4N8Y A;  3PPP A;  4GFR A;  1B3G A;  1IUD A;  2F5X A;  4ZEB A;  2P2A A;  2X7P A;  1LAG E;  2YPN A;  5ET8 A;  3VXB A;  1FBE A;  1SW5 A;  4NED A;  1FBC A;  4PET A;  3FJG A;  1DPP A;  2P3N A;  1SD3 A;  1FPE A;  1K9Y A;  3C34 A;  1QW0 A;  4PFR A;  4YAH X;  3O9P A;  2PBW A;  2F7A A;  2PT2 A;  3TTN A;  4OTE A;  3K1M A;  1ZLQ A;  1WOD A;  3IFC A;  4MIJ A;  3GXA A;  4TLL B;  2O51 A;  3TCG A;  4UAC A;  4GXS B;  4OHN A;  4R2F A;  2NVU B;  2ONS A;  2WEF A;  3LSL A;  2JJK A;  4MX6 A;  2V25 A;  3Q28 A;  4OVR A;  4PCD A;  2QVR A;  2X7Q A;  3SDF A;  1B9J A;  1OLA A;  5EQA A;  1Y3Q A;  3KOS A;  3IJX B;  4PF8 A;  5IZ3 B;  1IME A;  4OFO A;  1N0T A;  4Q8R A;  1B0L A;  1FBF A;  1EYJ A;  2I4C A;  1EYK A;  4JSD A;  4LVQ A;  5FBP A;  1DSN A;  1ZBM A;  3O6G A;  2F97 A;  5IAI A;  1GVC A;  2F3B A;  1IMA A;  3KEI A;  3HCQ A;  4IY6 A;  1MXX A;  3LBS A;  1NI9 A;  2B3B A;  2V3T A;  3TCF A;  2DQV A;  4RPO A;  3VLU A;  2UXA A;  1DTG A;  4MFI A;  4IO3 A;  2I48 A;  1MPB A;  4NWD A;  5I56 A;  3UN6 A;  2OBG A;  3Q27 A;  4F18 A;  1SPI A;  1DPE A;  4P9K A;  3MP6 A;  4M4G A;  4QFP A;  5EYF A;  4O94 A;  2W7Y A;  4H67 A;  3TFL A;  1S50 A;  1USY E;  3PUZ E;  4ELO A;  1SVX B;  2FHY A;  1FTK A;  2NXO A;  1MS7 A;  2XXV A;  4OWD A;  2V3Q A;  4Z0I A;  3TQW A;  3N94 A;  1IXG A;  5EQ7 A;  4OET A;  4C1U A;  2HAV A;  3M3L A;  3FAS A;  5EHM A;  4O3B A;  5AA4 A;  4NF6 B;  3MYU A;  4JSO A;  3E78 A;  4R6Y A;  3ZS6 A;  3FBP A;  1JEU A;  3U72 A;  2QS2 A;  3KBZ A;  4U21 A;  1D9V A;  4OFL A;  1JNF A;  5ITP A;  2Q88 A;  4N6K A;  1S7Y A;  3TOD A;  5CBR A;  3VVF A;  3MBP A;  1FPJ A;  4HXV A;  2QS3 A;  5ET5 A;  4FAT A;  3UIF A;  3K6X A;  4OVT A;  3TYH A;  2XXT A;  3HHG A;  2FA7 A;  2MKZ A;  2XXW A;  2F36 A;  4H8J A;  3G3J A;  1VDW A;  1DBZ A;  5FHN A;  1O63 A;  5FHO A;  3O2A A;  2BJJ X;  1NV1 A;  1MQG A;  2O6A A;  3G3F A;  2PVU A;  4F2Q A;  3K0V A;  3TQL A;  2H98 A;  1IMD A;  3IL1 B;  3TEL A;  3TKD A;  4I9D A;  3VFJ A;  1FTA A;  3IOV A;  1JQF A;  4IO7 A;  2VD2 A;  4GX6 A;  3K6V A;  1A55 A;  1AWB A;  2HZK A;  3I6V A;  1A99 A;  4PC9 A;  4XXU A;  3C4M A;  3CIJ A;  1TFA A;  3TMG A;  1B32 A;  3ZKK A;  1SDX A;  1A8F A;  1G0I A;  2DP8 A;  1SW1 A;  3OD7 A;  3QSL A;  2AL5 A;  4OMB A;  4GWU A;  1EH3 A;  4EDP A;  4IY5 A;  5DVI A;  2IA4 A;  4GF8 A;  3HN0 A;  4XFE A;  2THI A;  4H46 A;  1XI6 A;  2O1M A;  3VLW A;  2P0S A;  4NGU A;  3PMX A;  1QKA A;  3N26 A;  1A8E A;  1CNQ A;  1LBB A;  1BLF A;  1LBC A;  1DOT A;  2GHA A;  4PAK A;  1UQW A;  4G68 B;  3MZ9 A;  1LBV A;  3RGY A;  4IGT A;  5JTY B;  1LCF A;  1MPC A;  4NMY A;  1ATG A;  1NNK A;  1B5J A;  4F31 B;  2DE4 A;  4JWX A;  5H8F B;  4QBA A;  3T9U A;  1ANF A;  4ZZE A;  5KCJ A;  4FAJ A;  2ZXT A;  3LUZ A;  4P8B A;  2DE3 A;  3DP8 A;  5HBC A;  4IO4 A;  4QRZ A;  3SER A;  4X04 A;  4XKP A;  4KFQ A;  3LV0 A;  3G3I A;  3TCH A;  4WKM A;  4HE0 A;  3G7W A;  1WVJ A;  4OZ9 A;  3ILU B;  5L9O A;  3JV9 A;  4OEN A;  1B1H A;  2V4C A;  4O7I A;  4R6H A;  2F78 A;  2RC9 A;  3FZV A;  1R6Z A;  1NMU A;  3ILT B;  4KCC A;  4X48 A;  1NV5 A;  1Q9D A;  1TWY A;  3B6W A;  4EUO A;  3H6U A;  4R2B A;  2CEX A;  3LSF B;  1EZO A;  5ITO A;  1LB8 A;  3QUF A;  1TXF A;  4F22 A;  2RF1 A;  4PDH A;  4FEB A;  4THI A;  4ELR A;  4FJP A;  4PTK A;  3U1O A;  2Y7P A;  1ZKB A;  1YXI A;  5T3J A;  2KQZ A;  1FPL A;  4KPT A;  1LLS A;  3H7M A;  1CB6 A;  2Z8E A;  4R72 A;  1Q1K A;  4PGP A;  1B4H A;  1FW0 A;  5KCJ B;  4QSE A;  5A5X B;  4YU0 A;  3KC1 A;  4GD5 A;  3RT6 B;  4WXJ A;  5B70 A;  2XXU A;  4LQ5 A;  2HQ0 A;  1MQH A;  3QIM A;  1ZIU A;  2P1S A;  4YB6 A;  4NF8 B;  5I57 B;  5ICT A;  3FVK A;  5DVJ A;  3JYR A;  4QFK A;  1SI0 A;  4L17 A;  3VVD A;  1CE2 A;  3CFX A;  2A5T A;  3T9V A;  1PC3 A;  1FPK A;  4ZEK A;  1IIT A;  3QYT A;  3KJ7 A;  2VP1 A;  4H5F A;  4EQ9 A;  4QSC A;  1M5D A;  2VPO A;  2NUV A;  1FQA A;  2XD2 A;  2WYK A;  1B46 A;  3FD3 A;  5F7V A;  5LDZ A;  4POW A;  4GWY A;  1FBH A;  4N8G A;  5I2K B;  1MDQ A;  1P1O A;  4RY1 A;  1P1W A;  5ICQ A;  1POY 1;  1UTH B;  4H45 A;  2HZL A;  4GWS A;  1USY H;  5CRY A;  4RJZ A;  4XF5 A;  1D9Q A;  3PGF A;  3OMB A;  4TQU Q;  1US4 A;  1P1Q A;  4DDD A;  4LZ7 A;  2XWV A;  1DMB A;  3CFZ A;  2DXY A;  3FVO A;  3FGS A;  1MH4 A;  2Z22 A;  5L9S A;  3IFA A;  4NF0 A;  1JP4 A;  4F3S A;  2DWA A;  3IB0 A;  1UIV A;  4U4X A;  2YLN A;  2X26 A;  1QUK A;  1YAE A;  2PX1 A;  4ZE8 A;  2F34 A;  2A5T B;  2XWI A;  2UYF A;  1NNF A;  3KGC A;  2LAO A;  1J1N A;  5M2V A;  4IO2 A;  4PAF A;  1BIY A;  3SEX A;  3OO6 A;  5IZ3 A;  1NH7 A;  2REG A;  2I0B A;  4GX4 A;  2AIX A;  4GXA A;  2REJ A;  1MM6 A;  3LUY A;  5I59 B;  4H1X A;  5EYH A;  3C9H A;  4FEC A;  3KZG A;  1XT8 A;  1RDY A;  3U94 A;  2DXR A;  4LUB A;  2Y84 A;  4U22 A;  1FPF A;  4EXK A;  1BTJ A;  2NWJ A;  2XHD A;  1B7U A;  2DS9 A;  1NUW A;  4GLI A;  4ESX A;  1N7X A;  2L5V A;  4P11 A;  1HSE A;  2UVI A;  3D4G A;  3IO4 A;  3C31 A;  2QPQ A;  2A5S A;  5CBS A;  1MY0 A;  5IKB A;  4DI4 B;  1B7H A;  3M3K A;  1EZ9 A;  3Q29 A;  3O28 A;  4IR8 A;  4NX1 A;  4LAT A;  1RYO A;  3H3G A;  3H03 A;  3WAF A;  1NV7 A;  4PE3 A;  4P56 A;  1UIU A;  2V93 A;  4DXU A;  1POT A;  4NF6 A;  3IJO B;  5EYG A;  2PT1 A;  2DWJ A;  5CC2 A;  4P3L A;  3L6H A;  4MH5 A;  1YCJ A;  3K6W A;  3RTF B;  3K02 A;  3FIR A;  5ISU A;  2F3D A;  4N4U A;  3I3V A;  1SQY A;  3ZSF A;  1N76 A;  5EQ9 A;  1B51 A;  4LN5 A;  3HPI A;  3TDJ A;  2DYX A;  3RYD A;  1N3W A;  2CZH A;  3OEN A;  5TP9 A;  2QMW A;  1Y3N A;  2OJT A;  3G3K A;  1JW4 A;  2I3W A;  2OWT A;  3CVG A;  1GTK A;  3OSR A;  1ZMG A;  3MVW A;  2XWK A;  1P99 A;  4DCY A;  2ABH A;  3HST A;  3EHT A;  3R26 A;  4OEU A;  3B7D A;  2H99 A;  2Z8D A;  4YKI A;  1INP A;  2WBD A;  1VFE A;  1RDX A;  2FNC A;  4KI0 E;  1UTB B;  1OVT A;  4X1D A;  4FBP A;  2Y7K A;  1H44 A;  3IK6 B;  1FPG A;  3LSW A;  3TTM A;  1FSA A;  3K1P A;  5H8Q B;  3KN3 A;  1N7W A;  4R9G A;  3EPE A;  1GV8 A;  2CZI A;  3GYY A;  3UGW A;  3TTL A;  1XVY A;  2UYE A;  2XXR A;  2RCA A;  3ISP A;  3LSX A;  3VE1 B;  1ZTY A;  3S9N C;  3B6Q A;  3OXN A;  5CMB A;  3OEK A;  4IGR A;  3PU5 A;  2RC8 A;  1K9Z A;  4DI3 D;  3RY3 A;  3KSX A;  1H45 A;  3MWB A;  4ECF A;  2GHB A;  3B8B A;  2O7I A;  2Y7I A;  1URD A;  5DW8 A;  1B3L A;  2F6P A;  4LZ8 A;  4MMP A;  3MZB A;  1NH8 A;  2HHM A;  4G68 A;  2M8C A;  1SW4 A;  2FBP A;  5TP9 B;  3UK4 A;  5ET7 A;  5I3S A;  1HSL A;  1B3E A;  3F11 A;  4YMA A;  2QMX A;  3C36 A;  1T0K A;  5JTY A;  2HAU A;  4BDR A;  1JW1 A;  2FVZ A;  1NKX A;  2QVU A;  4GOT A;  3E9X A;  5AA1 A;  5H8F A;  4Q30 B;  3M8U A;  1Z7M E;  2F6G A;  1MXY A;  5F24 A;  2FIE A;  4KYE A;  1NL5 A;  2Q8M A;  4JB7 A;  2ALU A;  4MAG A;  4NAP A;  4Q0C A;  2KLF A;  3RPW A;  1LCT A;  5J16 A;  4AQ4 A;  4ELQ A;  1IEJ A;  1FRP A;  1DK4 A;  4R9F A;  3MST A;  3WAE A;  1ELJ A;  3Q25 A;  1FPB A;  1N84 A;  4EQB A;  1FQE A;  2Y5K A;  4ZZA A;  1KA1 A;  3D1R A;  3GLB A;  1QVS A;  3GZG A;  4MNP A;  4XTC Q;  2CZK A;  3DLN A;  3IB2 A;  4WEP A;  3DM0 A;  4H5G A;  4PGN A;  2RCB A;  5I2N B;  4E0W A;  4GWX A;  2QL3 A;  2ZNU A;  4OEV A;  5H8N B;  1VSO A;  4LZ5 A;  3T22 A;  5LTC A;  2HFB A;  5H8H A;  4H6D A;  1FTL A;  3PMV A;  2OZZ A;  4PBH A;  3T96 B;  2H5Y A;  4GL0 A;  1P1U A;  1KA0 A;  5I5P A;  3Q26 A;  4MLV A;  1VR5 A;  2I3V A;  3MVZ A;  1IQ7 A;  5JK4 A;  1MY4 A;  4RA1 A;  2DWI A;  3ROJ A;  1N3X A;  5DEX A;  2XX7 A;  3BIG A;  4XEQ A;  4Q5T A;  3KFM A;  3CG1 A;  3SES A;  3EHU A;  4NF5 B;  4YB7 A;  5A5X A;  2VGQ A;  3BFU A;  1YPN A;  3FUZ A;  3U8Q A;  4R74 A;  2O7U A;  4OVQ A;  1XHY A;  3BIH A;  2WYP A;  3O66 A;  3OO8 A;  5K2Y A;  4IB2 A;  3FXQ A;  2WKY A;  2I49 A;  2PFZ A;  1LAH E;  3I5O A;  2F7C A;  5EQ8 A;  1YTV A;  4NF8 A;  5I57 A;  3C32 A;  4ND9 A;  4IO5 A;  2XA5 A;  3FXU A;  4U4S A;  4LA9 A;  4U2R A;  1B5I A;  4JVD A;  2Q2A A;  2XXX A;  1JEV A;  3IR1 A;  4C0R A;  3QUJ A;  2DVC A;  1MM7 A;  4NQ8 A;  1Y1M A;  1YZ0 A;  1MXW A;  1Y4T A;  2AYS A;  2QS1 A;  1URS A;  3H6T A;  4KYS A;  5H8H B;  3SEU A;  5IGA A;  1URG A;  2XXQ A;  4P1L A;  5I2K A;  3SEV A;  3MP1 A;  3TPA A;  1AOV A;  1UTH A;  1II5 A;  4KXP A;  5DEX B;  4PFI A;  3E13 X;  1LFG A;  4FED A;  1D4N A;  4PE5 B;  1MH3 A;  3GBB A;  3OO7 A;  4ELP A;  1A7L A;  3PTY A;  1TT1 A;  4F3B A;  1R1N A;  3EF7 A;  2PCR A;  5EHS A;  1MXV A;  1EZP A;  3KSJ A;  4I40 A;  1VFD A;  1FJ9 A;  3MW0 A;  1FBP A;  3MZ1 A;  3QK6 A;  2QJE A;  2VOZ A;  3V5A A;  4I3E A;  2D5W A;  4YB5 A;  3A3U A;  2B4M A;  4OVS A;  3NOH A;  4XKR A;  3VXC A;  4KCD A;  1PB8 A;  1IMC A;  1VE4 A;  4NTL A;  4N6D A;  5AA2 B;  5DT6 A;  3PUV E;  2ZZV A;  4ZEF A;  1IMB A;  4JVI A;  3S9M C;  3CG3 A;  3RTW B;  4BLA A;  2VT5 A;  5I59 A;  3T0J A;  1Y4C A;  2H9B A;  2QS4 A;  3RN8 A;  4P0G A;  2ZZX A;  5BUU A;  4X1B A;  2OWS A;  2CMO A;  4F3G A;  2AL4 A;  3HV1 A;  1XC1 A;  2F35 A;  3C35 A;  3CHG A;  4G68 C;  4ZEI A;  4OER A;  4EXL A;  4BDQ A;  2O68 A;  3JZJ A;  3O6I A;  1Y20 A;  1JVX A;  2FYI A;  5FTH A;  3FJ7 A;  1DCU A;  1QKB A;  5JEI A;  4QFN A;  1FTJ A;  1B40 A;  4U23 A;  4GWO A;  1FTO A;  2I4B A;  1AIV A;  4DZ1 A;  1IMF A;  3TUS A;  3W15 C;  3SKP A;  1IXI A;  3HFU A;  3FVG A;  3QAX A;  2QRY A;  4OQO A;  3H6V A;  2UVG A;  4MLQ A;  5KDT A;  1KZ8 A;  5I58 B;  2ZYN A;  2KR0 A;  4G77 A;  2B3F A;  1OVB A;  1NV4 A;  1QUI A;  3PUX E;  3T9X B;  2Q8J A;  3O97 A;  3TTK A;  2WX9 A;  2HEU A;  1WDN A;  4N13 A;  1NFT A;  1LST A;  3MAM A;  2ONR A;  4HE1 A;  3CSG A;  3U93 A;  4BDM A;  2B65 A;  1SYI A;  3MJN A;  1IZ1 A;  1B4Z A;  4NE4 A;  2Q89 A;  1AL3 A;  3GBA A;  1LBY A;  3MUQ A;  1FBD A;  4YZZ A;  3U65 A;  1Y1Z A;  2Q9T A;  3OO9 A;  4NF4 B;  4F2O A;  1L5T A;  1BKA A;  1M5C A;  2D3I A;  1LEV A;  4GBV A;  4OAN A;  2XD3 A;  5TPA B;  1N04 A;  4QSD A;  1PDA A;  3PPQ A;  1FPI A;  3U92 A;  2R9J A;  4TOZ A;  5CMM A;  1B1X A;  2XX8 A;  1UTB A;  1OLC A;  4GQO A;  4Z7E A;  4PAI A;  1R9Q A;  3W9W A;  4N6P A;  1NV2 A;  4R6K A;  1Z7N E;  1OQG A;  3T1B A;  4DCX A;  3CRB A;  2B4L A;  5H8Q A;  1LFH A;  1NNT A;  5CMK A;  1S9T A;  4NG7 A;  2HCA A;  3DP6 A;  4MHF A;  4PP0 A;  3K00 A;  4PFT A;  3N6U A;  3OEM A;  3IOU A;  1QGX A;  1B7Z A;  3T66 A;  3KBR A;  5KDT B;  1PB7 A;  3S9L C;  1NUY A;  3SZP A;  3CFL A;  1Q35 A;  1PEB A;  1NV6 A;  4HTG A;  2R71 A;  4R75 A;  1QUJ A;  1D9Y A;  3FAT A;  1B52 A;  1LBW A;  4DXC A;  4MCO A;  3TZA A;  1Y3P A;  2Q2C A;  1B0H A;  4FE8 A;  3AXF A;  4O3A A;  3THI A;  1I6Q A;  4RK2 A;  1AH5 A;  3KJT A;  4F1V A;  3IX1 A;  4DIG A;  4QXD A;  1ZU0 A;  3EHS A;  2WBB A;  2OX3 A;  4XKQ A;  1MQI A;  4G8N A;  4P47 A;  4DXB A;  1LFI A;  2CZL A;  3CR9 A;  5ELV A;  2FIX A;  1FCK A;  1MQD A;  1LAX A;  2O1L A;  4RXL A;  4KR5 A;  1FPD A;  3MC2 A;  1MY3 A;  4UAB A;  4PFY A;  2DVZ A;  2ZYM A;  3MPK A;  3ONM A;  4KHZ E;  3USD A;  5BWJ A;  3K6U A;  3A3C A;  4YKP A;  4H8I A;  4HCW A;  1FQF A;  2DDK A;  3MPL A;  1A54 A;  4I1D A;  3RPL B;  1BK4 A;  4HCY A;  4I3Y A;  5CI5 A;  5FHM A;  5LOM A;  5H8S A;  3L6G A;  3DP4 A;  3TTR A;  3O6H A;  4F19 A;  5IZ1 A;  3PD8 A;  3IOR A;  1LBX A;  1F9B A;  4RK9 A;  3KOT A;  5HM4 B;  1H43 A;  5ET6 A;  4HE2 A;  5I2N A;  4YMB A;  3MVY A;  5H8N A;  3FV2 A;  2XXK A;  1I69 A;  3QXM A;  2GRV A;  3MP8 A;  2H25 A;  1D3K A;  3D4C A;  3V89 B;  4MNI A;  4AB5 A;  5FTI A;  3CSB A;  3M3F A;  4N07 A;  2QVV A;  1OIB A;  3UA8 A;  4MJO A;  4G4P A;  1IXC A;  1Y9U A;  1B58 A;  4LP2 B;  4OA4 A;  1AMF A;  2ONK E;  2I0C A;  3EKI A;  2XX9 A;  2DSF A;  4XIG Q;  3OEL A;  1SBP A;  5IZZ A;  3A29 A;  1MY2 A;  4NF5 A;  1FTM A;  1LBZ A;  5I84 A;  3CI8 A;  4H0W A;  4NHB A;  5AA3 A;  4FIM A;  4YKJ A;  3RQT A;  4ONY A;  4U1Z A;  3FXB A;  2R8T A;  4BDL A;  5ESY A;  5AE4 A;  4GBW A;  4RYA A;  4JXI A;  1HSJ A;  3T9H B;  2DOJ A;  4NN3 A;  4ZE9 A;  3VV5 A;  4X9T A;  5I56 B;  1FQB A;  3SEY A;  1O64 A;  5A5L A;  2ZZW A;  4NWC A;  1ZJL A;  4F1U A;  3BKI B;  4POX A;  1LAF E;  1GGG A;  5DTB A;  4N15 A;  4JBZ A;  3IOW A;  4MF3 A;  3HHF A;  4EQ7 A;  2VD3 A;  3S9E A;  2I58 A;  3K2D A;  2G29 A;  4GL8 A;  2RC7 A;  1M5B A;  5TU0 A;  1PBP A;  1FQD A;  3QMF A;  3PV0 E;  1H76 A;  1FQC A;  1NNP A;  4DLD A;  4AS5 A;  4JDF A;  4GWZ A;  4PF6 A;  2XXH A;  2XXI A;  4TLM B;  5K2X A;  4MNC A;  2F8D A;  5AA4 B;  3G3H A;  4K3F A;  1DTZ A;  3PPN A;  2OCU A;  1FBG A;  4KD5 A;  3PPO A;  5CM6 A;  4GX3 A;  1JVY A;  4JWO A;  5B7D A;  1B3F A;  3N5L A;  2ZNT A;  2OWZ A;  2XXY A;  5I7I A;  3A09 A;  1B3H A;  4ZS9 A;  2PYY A;  1TFD A;  3K4U A;  1IIW A;  2Z8F A;  4R73 A;  4UA8 A;  4RNS A;  4N91 A;  3G3G A;  3TAJ A;  4OYV A;  4PBQ A;  3W9V A;  3H6W A;  1SI1 A;  3KN8 A;  3S4U A;  3IAZ A;  4OVJ A;  1GR2 A;  3P7I A;  4ESW A;  2UVJ A;  3IB1 A;  1RYX A;  2NOO A;  3N6T A;  1B2H A;  5KZT A;  2QSX A;  3SEW A;  4F1Y A;  1EYI A;  5AA2 A;  4OFJ A;  2E1S A;  3E3K A;  4PFU A;  2HXR A;  3VDF A;  3PMW A;  3PUW E;  4QF9 A;  3BFT A;  3BBR A;  5AA2 D;  3KC0 A;  4ISU A;  4G8H A;  2OK2 A;  3IO6 A;  1A40 A;  4F29 A;  4AB6 A;  2Y5L A;  3SET A;  4M1V A;  1FJ6 A;  4RPN A;  4G61 A;  1XOC A;  3UOR A;  3O29 A;  2ZMB A;  4KYD A;  5CMC A;  2VHA A;  4C1T A;  4F39 A;  3ODB A;  4QHQ A;  1IXH A;  1BP5 A;  4WED A;  2XXP A;  4HW8 A;  3PPR A;  3EQ1 A;  2DE2 A;  3PD9 A;  4GRK A;  3MQ9 A;  3V83 A;  2IEE A;  4ZEC A;  2DWH A;  2H4I A; 
#chains in the Genus database with same CATH homology
 3LR1 A;  1MY1 A;  1JW5 A;  3K1N A;  1JET A;  5HPQ A;  3RNN A;  4P0I A;  5J1D A;  4KQP A;  5I58 A;  1M5F A;  3OSQ A;  1RKM A;  2YJP A;  2GFE A;  1US5 A;  4I62 A;  4OXV A;  4E0X A;  1OMP A;  1B05 A;  3PUY E;  3H06 B;  2ZYO A;  1PBQ A;  3RUM A;  1XS5 A;  3FVN A;  4GIZ A;  2HXW A;  4PQJ A;  4JWY A;  3DEL B;  3FXR A;  2E0S A;  2R6G E;  2V84 A;  4NF4 A;  1MXU A;  2RKM A;  1QUL A;  4F3P A;  4DE8 A;  3R7X A;  3MVX A;  1P1N A;  3UP9 A;  1O7T A;  3FV1 A;  5DVF A;  3FJM A;  5TPA A;  2V3U A;  3IOT A;  1B5H A;  3RT8 A;  1LB9 A;  3OOA A;  5DYH A;  1KWH A;  3B6T A;  1H3D A;  1XVX A;  3KN7 A;  4QFO A;  2PMS A;  3R6U A;  5L9M A;  2UVH A;  2ZNS A;  2RIN A;  1MQJ A;  4I8C A;  4FOR A;  4LQ2 A;  2O69 A;  4YKK A;  3T93 B;  2F7B A;  4MBP A;  5L8D A;  2Z23 A;  3V8X B;  1MRP A;  3C33 A;  4OES A;  5F1Q A;  1OQH A;  1MDP 1;  2Y7W A;  1SW2 A;  4H65 A;  3S2V A;  4BDN A;  1EU8 A;  1LGB C;  1R9L A;  3ECR A;  3TEP A;  1M5E A;  1SYH A;  2G93 A;  4YIC A;  4PFW A;  2ZYK A;  1MG1 A;  3E4R A;  4EF2 A;  1PB9 A;  3EN3 A;  1B6H A;  1MPD A;  2OLB A;  4GVO A;  2Y7R A;  1I6B A;  3ZKL A;  3HO7 A;  1MXZ A;  4QFL A;  3VLV A;  3VVE A;  3K01 A;  4O3C A;  3RLF E;  1I6A A;  2ANJ A;  4LON B;  3H4Z A;  2D21 A;  2ESN A;  2I6E A;  4IO6 A;  4ZED A;  3LC8 A;  1QJM A;  3KG2 A;  2GH9 A;  4HS7 A;  4G8M A;  4G2Z A;  4EF1 A;  4ZDM A;  4BDO A;  2O84 X;  4U1O A;  4XKN A;  3PPP A;  4GFR A;  1B3G A;  1IUD A;  2F5X A;  4ZEB A;  2P2A A;  2X7P A;  1LAG E;  2YPN A;  3VXB A;  1SW5 A;  4NED A;  4PET A;  3FJG A;  1DPP A;  1SD3 A;  3C34 A;  1QW0 A;  4YAH X;  3O9P A;  2PBW A;  2F7A A;  2PT2 A;  3TTN A;  4OTE A;  3K1M A;  1ZLQ A;  1WOD A;  3GXA A;  4TLL B;  2O51 A;  3TCG A;  4UAC A;  4GXS B;  4OHN A;  4R2F A;  2NVU B;  2ONS A;  3LSL A;  2V25 A;  3Q28 A;  2X7Q A;  3SDF A;  1B9J A;  1OLA A;  1Y3Q A;  3KOS A;  3IJX B;  4OFO A;  1N0T A;  4Q8R A;  1B0L A;  2I4C A;  4JSD A;  4LVQ A;  1DSN A;  1ZBM A;  3O6G A;  2F97 A;  5IAI A;  1GVC A;  3KEI A;  3HCQ A;  4IY6 A;  1MXX A;  3LBS A;  2B3B A;  2V3T A;  3TCF A;  2DQV A;  4RPO A;  3VLU A;  2UXA A;  1DTG A;  4MFI A;  4IO3 A;  2I48 A;  1MPB A;  4NWD A;  5I56 A;  3UN6 A;  2OBG A;  3Q27 A;  4F18 A;  1DPE A;  3MP6 A;  4M4G A;  4QFP A;  5EYF A;  2W7Y A;  4H67 A;  3TFL A;  1S50 A;  1USY E;  3PUZ E;  4ELO A;  1SVX B;  1FTK A;  2NXO A;  1MS7 A;  2XXV A;  4OWD A;  2V3Q A;  4Z0I A;  3TQW A;  3N94 A;  1IXG A;  4OET A;  4C1U A;  2HAV A;  3M3L A;  3FAS A;  5EHM A;  5AA4 A;  4O3B A;  4NF6 B;  4JSO A;  4R6Y A;  3ZS6 A;  3U72 A;  1JEU A;  2QS2 A;  4U21 A;  1D9V A;  4OFL A;  1JNF A;  5ITP A;  2Q88 A;  1S7Y A;  3TOD A;  5CBR A;  3VVF A;  3MBP A;  2QS3 A;  4FAT A;  3UIF A;  3K6X A;  3TYH A;  2XXT A;  3HHG A;  2FA7 A;  2XXW A;  2F36 A;  4H8J A;  3G3J A;  5FHN A;  1O63 A;  5FHO A;  3O2A A;  2BJJ X;  1MQG A;  2O6A A;  3G3F A;  2PVU A;  4F2Q A;  3K0V A;  3TQL A;  2H98 A;  3IL1 B;  3TEL A;  3TKD A;  4I9D A;  3VFJ A;  3IOV A;  1JQF A;  4IO7 A;  2VD2 A;  3K6V A;  1A55 A;  2HZK A;  3I6V A;  1A99 A;  4XXU A;  3C4M A;  3CIJ A;  1TFA A;  3TMG A;  1B32 A;  3ZKK A;  1SDX A;  1A8F A;  2DP8 A;  1SW1 A;  3OD7 A;  3QSL A;  2AL5 A;  4OMB A;  1EH3 A;  4EDP A;  4IY5 A;  5DVI A;  2IA4 A;  4GF8 A;  3HN0 A;  2THI A;  2O1M A;  3VLW A;  2P0S A;  3PMX A;  1QKA A;  3N26 A;  1A8E A;  1LBB A;  1BLF A;  1LBC A;  1DOT A;  2GHA A;  1UQW A;  4G68 B;  3MZ9 A;  3RGY A;  4IGT A;  5JTY B;  1LCF A;  1MPC A;  4NMY A;  1ATG A;  1NNK A;  1B5J A;  4F31 B;  2DE4 A;  4JWX A;  5H8F B;  3T9U A;  1ANF A;  4ZZE A;  5KCJ A;  4FAJ A;  2ZXT A;  2DE3 A;  3DP8 A;  5HBC A;  4IO4 A;  4QRZ A;  3SER A;  4XKP A;  4KFQ A;  3G3I A;  3TCH A;  4WKM A;  3G7W A;  1WVJ A;  4OZ9 A;  3ILU B;  5L9O A;  3JV9 A;  4OEN A;  1B1H A;  4R6H A;  2F78 A;  2RC9 A;  3FZV A;  1R6Z A;  1NMU A;  3ILT B;  4KCC A;  4X48 A;  1TWY A;  3B6W A;  4EUO A;  3H6U A;  4R2B A;  3LSF B;  1EZO A;  5ITO A;  1LB8 A;  3QUF A;  1TXF A;  4F22 A;  2RF1 A;  4FEB A;  4THI A;  4ELR A;  4FJP A;  3U1O A;  2Y7P A;  1ZKB A;  4KPT A;  1LLS A;  3H7M A;  1CB6 A;  2Z8E A;  4R72 A;  1Q1K A;  1B4H A;  1FW0 A;  5KCJ B;  4QSE A;  5A5X B;  4YU0 A;  4GD5 A;  3RT6 B;  4WXJ A;  5B70 A;  2XXU A;  4LQ5 A;  2HQ0 A;  1MQH A;  3QIM A;  1ZIU A;  2P1S A;  4YB6 A;  4NF8 B;  5I57 B;  5ICT A;  3FVK A;  5DVJ A;  3JYR A;  4QFK A;  1SI0 A;  4L17 A;  3VVD A;  1CE2 A;  3CFX A;  2A5T A;  3T9V A;  1PC3 A;  4ZEK A;  1IIT A;  3QYT A;  3KJ7 A;  2VP1 A;  4H5F A;  4EQ9 A;  4QSC A;  1M5D A;  2NUV A;  1FQA A;  2XD2 A;  1B46 A;  3FD3 A;  5F7V A;  4POW A;  5I2K B;  1MDQ A;  1P1O A;  4RY1 A;  1P1W A;  5ICQ A;  1POY 1;  1UTH B;  2HZL A;  5CRY A;  1USY H;  4RJZ A;  3PGF A;  3OMB A;  4TQU Q;  1US4 A;  1P1Q A;  4DDD A;  4LZ7 A;  1DMB A;  3CFZ A;  2DXY A;  3FVO A;  3FGS A;  1MH4 A;  2Z22 A;  5L9S A;  4F3S A;  2DWA A;  3IB0 A;  1UIV A;  4U4X A;  2YLN A;  2X26 A;  1QUK A;  1YAE A;  2PX1 A;  4ZE8 A;  2F34 A;  2A5T B;  2UYF A;  1NNF A;  3KGC A;  2LAO A;  1J1N A;  5M2V A;  4IO2 A;  1BIY A;  3SEX A;  3OO6 A;  1NH7 A;  2REG A;  2I0B A;  4GXA A;  2AIX A;  2REJ A;  1MM6 A;  3LUY A;  5I59 B;  4H1X A;  3C9H A;  4FEC A;  3KZG A;  1XT8 A;  3U94 A;  2DXR A;  4LUB A;  2Y84 A;  4U22 A;  4EXK A;  1BTJ A;  2NWJ A;  2XHD A;  1B7U A;  2DS9 A;  4GLI A;  4ESX A;  1N7X A;  4P11 A;  1HSE A;  2UVI A;  3D4G A;  3IO4 A;  3C31 A;  2QPQ A;  2A5S A;  5CBS A;  1MY0 A;  5IKB A;  1B7H A;  3M3K A;  1EZ9 A;  3Q29 A;  3O28 A;  4LAT A;  1RYO A;  3H3G A;  3H03 A;  3WAF A;  1UIU A;  2V93 A;  4DXU A;  1POT A;  4NF6 A;  3IJO B;  2PT1 A;  2DWJ A;  5CC2 A;  3L6H A;  4MH5 A;  1YCJ A;  3K6W A;  3RTF B;  3K02 A;  3FIR A;  5ISU A;  3I3V A;  1SQY A;  3ZSF A;  1N76 A;  1B51 A;  3HPI A;  3TDJ A;  2DYX A;  1N3W A;  3OEN A;  5TP9 A;  2QMW A;  1Y3N A;  2OJT A;  3G3K A;  1JW4 A;  2I3W A;  2OWT A;  3CVG A;  1GTK A;  3OSR A;  1ZMG A;  3MVW A;  1P99 A;  4DCY A;  2ABH A;  3HST A;  3EHT A;  3R26 A;  4OEU A;  3B7D A;  2H99 A;  2Z8D A;  4YKI A;  1VFE A;  2FNC A;  4KI0 E;  1UTB B;  1OVT A;  4X1D A;  2Y7K A;  1H44 A;  3IK6 B;  3LSW A;  3TTM A;  3K1P A;  5H8Q B;  3KN3 A;  1N7W A;  4R9G A;  3EPE A;  1GV8 A;  3UGW A;  3TTL A;  1XVY A;  2UYE A;  2XXR A;  2RCA A;  3LSX A;  3VE1 B;  1ZTY A;  3S9N C;  3B6Q A;  3OXN A;  5CMB A;  3OEK A;  4IGR A;  3PU5 A;  2RC8 A;  3RY3 A;  3KSX A;  1H45 A;  3MWB A;  4ECF A;  2GHB A;  2O7I A;  2Y7I A;  1URD A;  1B3L A;  2F6P A;  4LZ8 A;  3MZB A;  1NH8 A;  4G68 A;  2M8C A;  1SW4 A;  5TP9 B;  3UK4 A;  1HSL A;  1B3E A;  3F11 A;  4YMA A;  2QMX A;  3C36 A;  1T0K A;  5JTY A;  2HAU A;  4BDR A;  1JW1 A;  4GOT A;  1NKX A;  3E9X A;  5AA1 A;  5H8F A;  4Q30 B;  3M8U A;  1Z7M E;  2F6G A;  1MXY A;  4KYE A;  1NL5 A;  4JB7 A;  2ALU A;  4Q0C A;  2KLF A;  3RPW A;  1LCT A;  4AQ4 A;  4ELQ A;  1IEJ A;  4R9F A;  3WAE A;  1ELJ A;  3Q25 A;  1N84 A;  4EQB A;  1FQE A;  4ZZA A;  3GLB A;  1QVS A;  3GZG A;  4XTC Q;  3DLN A;  3IB2 A;  4WEP A;  3DM0 A;  4H5G A;  2RCB A;  5I2N B;  4E0W A;  2QL3 A;  2ZNU A;  4OEV A;  5H8N B;  1VSO A;  4LZ5 A;  3T22 A;  2HFB A;  5H8H A;  4H6D A;  1FTL A;  3PMV A;  2OZZ A;  3T96 B;  2H5Y A;  4GL0 A;  1P1U A;  3Q26 A;  4MLV A;  1VR5 A;  2I3V A;  3MVZ A;  1IQ7 A;  5JK4 A;  1MY4 A;  4RA1 A;  2DWI A;  1N3X A;  5DEX A;  2XX7 A;  4Q5T A;  3KFM A;  3CG1 A;  3SES A;  3EHU A;  4NF5 B;  4YB7 A;  5A5X A;  2VGQ A;  3BFU A;  1YPN A;  3FUZ A;  3U8Q A;  4R74 A;  2O7U A;  1XHY A;  3O66 A;  3OO8 A;  5K2Y A;  4IB2 A;  3FXQ A;  2WKY A;  2I49 A;  3I5O A;  1LAH E;  2F7C A;  1YTV A;  4NF8 A;  5I57 A;  3C32 A;  4ND9 A;  4IO5 A;  3FXU A;  4U4S A;  4LA9 A;  4U2R A;  1B5I A;  2Q2A A;  2XXX A;  1JEV A;  3IR1 A;  4C0R A;  3QUJ A;  2DVC A;  1MM7 A;  1Y1M A;  1MXW A;  1Y4T A;  2AYS A;  2QS1 A;  1URS A;  3H6T A;  4KYS A;  5H8H B;  3SEU A;  1URG A;  2XXQ A;  5I2K A;  3SEV A;  3MP1 A;  3TPA A;  1AOV A;  1UTH A;  1II5 A;  5DEX B;  3E13 X;  1LFG A;  4FED A;  1D4N A;  4PE5 B;  1MH3 A;  3GBB A;  3OO7 A;  4ELP A;  1A7L A;  1TT1 A;  4F3B A;  1R1N A;  3EF7 A;  5EHS A;  1MXV A;  1EZP A;  3KSJ A;  1VFD A;  3MW0 A;  3MZ1 A;  3QK6 A;  2QJE A;  2VOZ A;  3V5A A;  2D5W A;  4YB5 A;  3A3U A;  4XKR A;  3VXC A;  4KCD A;  1PB8 A;  1VE4 A;  4NTL A;  5AA2 B;  5DT6 A;  3PUV E;  4ZEF A;  3S9M C;  3CG3 A;  3RTW B;  4BLA A;  5I59 A;  1Y4C A;  2H9B A;  2QS4 A;  3RN8 A;  4P0G A;  5BUU A;  4X1B A;  2OWS A;  2CMO A;  4F3G A;  2AL4 A;  3HV1 A;  1XC1 A;  2F35 A;  3C35 A;  4G68 C;  4ZEI A;  4OER A;  4EXL A;  4BDQ A;  2O68 A;  3JZJ A;  3O6I A;  1Y20 A;  1JVX A;  2FYI A;  5FTH A;  3FJ7 A;  1QKB A;  5JEI A;  4QFN A;  1FTJ A;  1B40 A;  4U23 A;  4GWO A;  1FTO A;  2I4B A;  1AIV A;  4DZ1 A;  3TUS A;  3W15 C;  3SKP A;  1IXI A;  3FVG A;  3QAX A;  2QRY A;  4OQO A;  3H6V A;  2UVG A;  4MLQ A;  5KDT A;  5I58 B;  2ZYN A;  4G77 A;  2B3F A;  1OVB A;  1QUI A;  3PUX E;  3T9X B;  2Q8J A;  3O97 A;  3TTK A;  2HEU A;  1WDN A;  4N13 A;  1NFT A;  1LST A;  3MAM A;  2ONR A;  3CSG A;  3U93 A;  4BDM A;  2B65 A;  1SYI A;  3MJN A;  1IZ1 A;  1B4Z A;  4NE4 A;  2Q89 A;  1AL3 A;  3GBA A;  3MUQ A;  4YZZ A;  1Y1Z A;  2Q9T A;  3OO9 A;  4NF4 B;  4F2O A;  1L5T A;  1BKA A;  1M5C A;  2D3I A;  2XD3 A;  5TPA B;  1N04 A;  4QSD A;  1PDA A;  3PPQ A;  3U92 A;  2R9J A;  4TOZ A;  5CMM A;  1B1X A;  2XX8 A;  1UTB A;  1OLC A;  4GQO A;  4Z7E A;  1R9Q A;  3W9W A;  4N6P A;  4R6K A;  1Z7N E;  1OQG A;  4DCX A;  3CRB A;  5H8Q A;  1LFH A;  1NNT A;  5CMK A;  1S9T A;  2HCA A;  3DP6 A;  4PP0 A;  3K00 A;  4PFT A;  3N6U A;  3OEM A;  3IOU A;  1B7Z A;  3T66 A;  3KBR A;  5KDT B;  1PB7 A;  3S9L C;  3CFL A;  1Q35 A;  1PEB A;  4HTG A;  2R71 A;  4R75 A;  1QUJ A;  1D9Y A;  3FAT A;  1B52 A;  4DXC A;  3TZA A;  1Y3P A;  2Q2C A;  1B0H A;  4FE8 A;  3AXF A;  4O3A A;  3THI A;  1I6Q A;  4RK2 A;  1AH5 A;  3KJT A;  4F1V A;  3IX1 A;  4DIG A;  1ZU0 A;  3EHS A;  4XKQ A;  1MQI A;  4G8N A;  4DXB A;  1LFI A;  2CZL A;  3CR9 A;  5ELV A;  1FCK A;  1MQD A;  1LAX A;  2O1L A;  4RXL A;  4KR5 A;  3MC2 A;  1MY3 A;  4PFY A;  2DVZ A;  2ZYM A;  3MPK A;  3ONM A;  4KHZ E;  3USD A;  5BWJ A;  3K6U A;  3A3C A;  4YKP A;  4H8I A;  4HCW A;  1FQF A;  3MPL A;  1A54 A;  4I1D A;  4HCY A;  5CI5 A;  5FHM A;  5LOM A;  5H8S A;  3L6G A;  3DP4 A;  3TTR A;  3O6H A;  4F19 A;  3PD8 A;  3IOR A;  1F9B A;  4RK9 A;  3KOT A;  5HM4 B;  1H43 A;  5I2N A;  4YMB A;  3MVY A;  5H8N A;  3FV2 A;  1I69 A;  3QXM A;  2GRV A;  3MP8 A;  2H25 A;  1D3K A;  3D4C A;  3V89 B;  4AB5 A;  5FTI A;  3CSB A;  3M3F A;  4N07 A;  1OIB A;  3UA8 A;  4G4P A;  1IXC A;  1Y9U A;  1B58 A;  4LP2 B;  1AMF A;  2ONK E;  2I0C A;  2XX9 A;  2DSF A;  4XIG Q;  3OEL A;  1SBP A;  1MY2 A;  4NF5 A;  1FTM A;  5I84 A;  3CI8 A;  4H0W A;  5AA3 A;  4FIM A;  4YKJ A;  3RQT A;  4ONY A;  4U1Z A;  4BDL A;  5AE4 A;  4RYA A;  4JXI A;  1HSJ A;  3T9H B;  2DOJ A;  4ZE9 A;  3VV5 A;  4X9T A;  5I56 B;  1FQB A;  3SEY A;  1O64 A;  4NWC A;  1ZJL A;  4F1U A;  3BKI B;  4POX A;  1LAF E;  1GGG A;  5DTB A;  4JBZ A;  3IOW A;  4MF3 A;  3HHF A;  4EQ7 A;  2VD3 A;  3S9E A;  2I58 A;  3K2D A;  2G29 A;  4GL8 A;  2RC7 A;  1M5B A;  5TU0 A;  1PBP A;  1FQD A;  3PV0 E;  1H76 A;  1FQC A;  1NNP A;  4DLD A;  4JDF A;  2XXH A;  2XXI A;  4TLM B;  5K2X A;  2F8D A;  5AA4 B;  3G3H A;  4K3F A;  1DTZ A;  3PPN A;  2OCU A;  4KD5 A;  3PPO A;  5CM6 A;  1JVY A;  4JWO A;  5B7D A;  1B3F A;  3N5L A;  2ZNT A;  2XXY A;  3A09 A;  1B3H A;  4ZS9 A;  2PYY A;  1TFD A;  3K4U A;  1IIW A;  2Z8F A;  4R73 A;  4UA8 A;  4RNS A;  3G3G A;  3TAJ A;  4OYV A;  3W9V A;  3H6W A;  1SI1 A;  3KN8 A;  3S4U A;  3IAZ A;  4OVJ A;  1GR2 A;  3P7I A;  4ESW A;  2UVJ A;  3IB1 A;  1RYX A;  2NOO A;  3N6T A;  1B2H A;  5KZT A;  2QSX A;  3SEW A;  4F1Y A;  5AA2 A;  4OFJ A;  2E1S A;  3E3K A;  4PFU A;  3VDF A;  3PMW A;  3PUW E;  4QF9 A;  3BFT A;  3BBR A;  5AA2 D;  4ISU A;  4G8H A;  2OK2 A;  3IO6 A;  1A40 A;  4F29 A;  4AB6 A;  3SET A;  4M1V A;  4RPN A;  1XOC A;  3UOR A;  3O29 A;  2ZMB A;  4KYD A;  5CMC A;  2VHA A;  4C1T A;  4F39 A;  3ODB A;  4QHQ A;  1IXH A;  1BP5 A;  4WED A;  2XXP A;  4HW8 A;  3PPR A;  3EQ1 A;  2DE2 A;  3PD9 A;  4GRK A;  3MQ9 A;  3V83 A;  2IEE A;  4ZEC A;  2DWH A;  2H4I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...