3ZKKA

Structure of the xylo-oligosaccharide specific solute binding protein from bifidobacterium animalis subsp. lactis bl-04 in complex with xylotetraose
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
396
structure length
396
Chain Sequence
DDKTITFWHNASAGEGRQYWENLAKSFEEANPGTKVEIQAIQNEDFAGKLQTAMQDPASGPDVFMSLGGAKTKEMIDAGQVMDLTDKISDTVKTDMKTTLSAATFDGKVYGVPVSVEPGGMWYSKDLFKKAGVSDVPATYEELLADAKKLKDSGTDAIALGAKDAWPAAHWYYWLVLRECSPEVYDKSVQDHDFSNACWVNAGKKLQELKDLKVFNDGFLTTTAQQGANSSAGLLANHKAAMELMGAWEPGVLKDLTPDQKPMADLGFFAFPEVAGGEGEPGALMGGVTYFCVNPKASQTSIDFVNYMGEKKNQEDYAKAFSTIPASEPARAVVTDESLKQVIEYLDKAPSMQLWMDTALGTNIGNALNAAVVNMLSGQGSPEDIVKAMQDAAQKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XOS BINDING PROTEIN
publication title Structural Basis for Arabinoxylo-Oligosaccharide Capture by the Probiotic Bifidobacterium Animalis Subsp. Lactis Bl-04
pubmed doi rcsb
source organism Bifidobacterium animalis subsp. lactis bl-04
molecule tags Transport protein
total genus 140
structure length 396
sequence length 396
ec nomenclature
pdb deposition date 2013-01-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3zkkA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3zkkA02
1PDAA 1SD3A 5H8FA 3C4MA 3LC8A 1AMFA 4H0WA 4R73A 4R6YA 1NH7A 4IO5A 1BIYA 4RPNA 3SERA 3EHSA 4ZE9A 2F7CA 1LCFA 4JSDA 4JSOA 2RCBA 3Q26A 4OTEA 1NNPA 3EHTA 1CB6A 2HZKA 3QK6A 1ZBMA 4F3SA 3TTNA 2ZYOA 4XKPA 4G8NA 3QIMA 2ZMBA 1O7TA 3H4ZA 2DE4A 3TQLA 3SEWA 2P2AA 1LLSA 2Z8DA 3KG2A 5KZTA 1JETA 1FQDA 2ZNTA 1OQHA 1LGBC 3MVZA 3SEXA 3V8XB 1JEVA 5ICQA 4OENA 3GZGA 4KYDA 1B2HA 1R6ZA 5AA4B 2ZYMA 3IL1B 3SESA 1MXUA 3MAMA 5DEXA 3U93A 4MH5A 1A99A 3C36A 4U1OA 3QAXA 2LAOA 2V93A 4NWCA 1A8EA 3FXRA 1LBCA 3OO9A 3B6TA 2PBWA 4FECA 2F6PA 5JTYB 2A5TB 1IEJA 3O66A 5J1DA 1MQIA 3HN0A 4DDDA 4EQBA 3H3GA 1N84A 1MPBA 1PEBA 1BKAA 4G68C 5I57B 4JXIA 2DQVA 4PFUA 3W9WA 4F2QA 2HFBA 3A09A 5ITOA 1GR2A 2PT1A 2O7UA 3K1NA 3KBRA 3OXNA 3PPQA 3HCQA 3PD8A 2O84X 1N3WA 4JBZA 4ZEKA 3IJXB 3HO7A 3I5OA 4H5FA 1FCKA 1OVBA 4F1UA 2Y7WA 1IIWA 4ELOA 4ELPA 1JW5A 1FW0A 1FQAA 3M3KA 4TLMB 2O68A 2XX9A 3OSQA 3TUSA 4M4GA 4NF8B 4KYSA 4RY1A 3TMGA 3G3JA 3PMVA 1B5IA 1L5TA 2Z22A 4ESWA 2OZZA 2I3WA 3MWBA 4LZ5A 3TDJA 1MXWA 5H8NA 4ECFA 3V5AA 4ESXA 3CSBA 3FIRA 2AYSA 3G3HA 4L17A 1M5BA 4IY5A 5DT6A 1Z7ME 3H06B 2B3FA 4THIA 5AA4A 4XKNA 3KSJA 2YJPA 2DWJA 1Y3PA 5B70A 5LOMA 2HQ0A 3DLNA 1SDXA 4KYEA 2OCUA 5DYHA 1VSOA 2XXRA 2DS9A 4Z0IA 4QFPA 4F39A 2DWAA 4QSCA 4PETA 1QUIA 2DVZA 4GXAA 5JTYA 3PGFA 3D4GA 2GHBA 4F19A 4BDMA 2XXXA 1IXCA 4H67A 3C33A 3PV0E 4E0XA 1URSA 4YB7A 3FVGA 5I58A 1LAHE 4RJZA 5FTIA 1B5JA 1MQHA 3CVGA 3S9LC 1QUJA 2XXYA 5EHMA 3HV1A 4MBPA 1SW4A 2Q9TA 2NWJA 1MPDA 1II5A 3OEMA 1MY3A 1GV8A 4NE4A 1H43A 3OO7A 3MUQA 2I0BA 1QKBA 3U72A 4N6PA 4X1DA 1UTHB 2VD2A 4F3PA 1B40A 3T96B 4AQ4A 2ZXTA 1ZKBA 2GHAA 1TXFA 1DPPA 1PBQA 3C35A 2Q2CA 3MPKA 4FAJA 4IO4A 3P7IA 2AIXA 1QKAA 4HCWA 3KSXA 2YLNA 1YTVA 5H8QB 1BLFA 4NF8A 2GRVA 4XKQA 2HEUA 2I58A 3JZJA 5F7VA 2UVIA 4YU0A 5BUUA 2ABHA 4O3CA 3FATA 1B58A 1VFDA 3RY3A 4BDOA 4LUBA 4DE8A 4EXKA 1XC1A 2QJEA 1B3HA 2Y7PA 4N13A 2NOOA 3LUYA 3MVYA 3CSGA 5TU0A 2DVCA 4ONYA 4OERA 2I49A 5AA2B 1AL3A 1PB7A 4ELQA 3B6WA 4H8JA 1FTJA 4LA9A 3CG3A 1O64A 2F36A 3GLBA 3TODA 1FTLA 3K2DA 2BJJX 1I6AA 2H5YA 2THIA 3KEIA 4H1XA 1OIBA 3PU5A 4X9TA 4PFWA 2REGA 2DE3A 3DP6A 4G2ZA 3IOTA 1LFIA 4R2FA 1N04A 4RK9A 3IOWA 4C1TA 3K00A 4OZ9A 3CR9A 1TFDA 5H8HA 2HCAA 3MC2A 4IB2A 3FJ7A 3RTFB 4C1UA 1B7ZA 2XXUA 3VVFA 4X1BA 5FTHA 1ATGA 1POTA 4LQ2A 4EDPA 3S9EA 1A7LA 1UTHA 4JWYA 1I69A 2YPNA 2Z8EA 3SEUA 4MLQA 3RNNA 1MY0A 1MQDA 2F6GA 3DP4A 4OETA 1SBPA 3LSLA 3Q29A 1MS7A 2QMWA 1SI0A 1P1UA 2V3UA 2V25A 5F1QA 3TAJA 3K6WA 5JK4A 1IXHA 3QYTA 3VVEA 3V83A 4RYAA 3SETA 5A5XA 1B3EA 1JVYA 2DYXA 1FTMA 3VXCA 1NH8A 3ZS6A 2ZYNA 3IB2A 3KN3A 1XHYA 1XVYA 4IO3A 2V3TA 3GBAA 1ZIUA 1N76A 2UVGA 2ANJA 3T66A 2HAUA 3TFLA 3VXBA 1HSJA 4QFLA 3S4UA 3PPPA 3KJTA 2UVJA 5DVFA 4OXVA 3FXQA 5EYFA 3VV5A 1QULA 4G8MA 3TQWA 1Y1ZA 4GL8A 4DXBA 3OSRA 4GFRA 2DOJA 5ITPA 2UXAA 3IX1A 3FUZA 4LONB 2O51A 2F5XA 5AA1A 1TFAA 5TPAB 3N6TA 3MW0A 1BTJA 1PC3A 2DWHA 3KOSA 4ZDMA 3SDFA 4FJPA 3T9UA 1UIUA 5KDTB 1LCTA 3O28A 4YKJA 3KN7A 1SW2A 4EQ7A 3I6VA 2QS1A 1RYOA 5CI5A 4YZZA 1GGGA 2CMOA 4POWA 5CBSA 1LAFE 3G3FA 1B7HA 1P99A 4KD5A 1WDNA 3IB1A 4PFYA 2ONRA 3QSLA 3GXAA 1MH3A 4ZECA 5DTBA 2XX7A 3OMBA 3PUYE 4OYVA 4P0IA 2RCAA 2O1MA 2ONKE 3ZKKA 5HPQA 1HSLA 1POY1 1URGA 2ZYKA 4LQ5A 3IORA 4U21A 4GRKA 1GTKA 4ISUA 4ZEFA 1B1XA 4IGRA 4XIGQ 4Z7EA 1MXZA 2F8DA 3VVDA 1IQ7A 1JW1A 3PMXA 5I2NA 2I4BA 1JEUA 4KPTA 1ZU0A 3UK4A 3O6HA 1ZJLA 2ONSA 3PUZE 4MFIA 3H7MA 4RK2A 1MDP1 1N3XA 4DCXA 3TZAA 3FJGA 3CFLA 4NF5B 2V84A 1AOVA 2D5WA 2PYYA 1OQGA 5L9OA 3BFUA 3IJOB 2Z23A 3FV2A 4U23A 4YKKA 2XXIA 3RPWA 2F35A 1T0KA 5I84A 1USYH 1D4NA 1R9QA 1US5A 2RC9A 4F3GA 2M8CA 4BDQA 1UTBB 2UYFA 3K1MA 1LAGE 3IO6A 1EZ9A 3UORA 4OMBA 4OFLA 4U4XA 3TTKA 1URDA 4K3FA 3OENA 5TPAA 1A55A 3PMWA 1FQCA 1DSNA 1D9YA 2P0SA 4TOZA 2D21A 4KFQA 1QJMA 3DELB 1ANFA 3AXFA 1MXXA 4TQUQ 1D3KA 3SEVA 3O29A 3TEPA 1B1HA 3ECRA 3L6GA 1B0HA 1N0TA 4ZZEA 4GIZA 3C32A 4AB5A 1IZ1A 4H5GA 1ZTYA 1A54A 4GL0A 4EF2A 3K6VA 3GBBA 1DMBA 3TKDA 2Y7KA 1DTZA 3MVWA 2UVHA 3KFMA 3S2VA 4FE8A 3HPIA 1H45A 5FHMA 3RT6B 4KCCA 2R6GE 1RYXA 1SYIA 1DOTA 2XXQA 4TLLB 3UN6A 3FXUA 1DPEA 3PPNA 3RTWB 4MF3A 5B7DA 1H76A 4RXLA 4IO7A 4ZEDA 4EUOA 3TCHA 5M2VA 3DM0A 3V89B 2A5TA 3M3LA 3U8QA 1MQJA 4YKIA 1VR5A 3Q27A 3BBRA 5I57A 1B3LA 2H99A 4H8IA 4OVJA 2ESNA 4UACA 4QHQA 3CIJA 4KCDA 4NWDA 4ND9A 4BDLA 3MZ1A 1I6QA 4OEVA 3ODBA 2QS2A 4FORA 3O2AA 2ZNSA 3ILUB 3BFTA 1MXYA 4JWOA 4X48A 3FGSA 3CRBA 1H44A 3K01A 3DP8A 4OEUA 2H4IA 1UTBA 4GXSB 4ELRA 4KQPA 3C34A 4YMAA 1Z7NE 3R26A 1A40A 1JNFA 2XD2A 4GD5A 3KOTA 4WXJA 2DE2A 4EF1A 4RA1A 5TP9B 1N7XA 3MPLA 2PVUA 5I2KB 4OFJA 3BKIB 2I3VA 3OO6A 2E0SA 1M5FA 2X7PA 4GVOA 3IOUA 1LFGA 1UIVA 1XT8A 2OBGA 4G8HA 1LSTA 5FHOA 2G29A 3MVXA 4QFNA 1OMPA 4NF6B 5KCJB 3RT8A 4QF9A 5HBCA 3LSXA 4HCYA 1LB9A 3ZKLA 3E13X 1F9BA 3JV9A 1Q1KA 5K2YA 2PX1A 3MZBA 4IGTA 3FASA 1IXGA 1NL5A 1Y9UA 1AIVA 1WODA 4QSEA 1P1NA 2RF1A 1OLCA 5H8SA 1YCJA 3VFJA 5FHNA 3K6XA 3EF7A 4FATA 3WAEA 3N6UA 2XXWA 1NNFA 2XHDA 1B5HA 1FQBA 3USDA 1OVTA 1NNKA 3M3FA 3KZGA 3T22A 3SEYA 2CZLA 3G3GA 4R9GA 4R6KA 4YB5A 1MG1A 4U22A 5CBRA 4R9FA 2FA7A 4R6HA 2V3QA 1JQFA 2Y84A 3W9VA 2OK2A 2RKMA 3TTLA 1B4HA 1PB9A 5IAIA 3H6UA 3LBSA 3VLVA 3S9MC 2WKYA 3H6TA 3LSFB 3PD9A 3MZ9A 1XS5A 2QSXA 4H6DA 4EQ9A 2NXOA 4OQOA 4EXLA 3H03A 2OWSA 3R6UA 5DVJA 3UA8A 1Y4TA 3FZVA 4YKPA 1EU8A 2Q89A 4G77A 3K0VA 3O97A 5H8QA 2AL5A 1I6BA 4BDNA 3KJ7A 4F31B 3A3UA 4MLVA 3OD7A 3HHGA 1MY2A 2F7BA 2B65A 4NEDA 4I8CA 3FD3A 4I1DA 2D3IA 2REJA 1S7YA 3F11A 3W15C 5CRYA 5KCJA 2HAVA 3E3KA 1OLAA 1R1NA 4Q5TA 1B9JA 3VDFA 2DXRA 3O6IA 2AL4A 2F34A 4O3BA 5AA2A 4DXCA 4M1VA 3ZSFA 1B3FA 1NNTA 3CFXA 4PQJA 3RLFE 2P1SA 3MP1A 4OESA 3MP6A 3MP8A 2OWTA 4Q0CA 1B05A 2NUVA 1B7UA 4DZ1A 1XVXA 1IUDA 4PP0A 4DCYA 4QFOA 1XOCA 1MM6A 3D4CA 1PBPA 3U1OA 2GFEA 4LZ8A 1IITA 3EN3A 3FV1A 2G93A 5EHSA 5L8DA 4FEDA 4U2RA 3N5LA 1Y4CA 1MXVA 2F78A 1SQYA 2KLFA 1A8FA 3TCFA 5H8NB 1WVJA 3OOAA 4I9DA 1JVXA 2OJTA 3FVNA 2QRYA 5AA2D 2I48A 4Q8RA 3OO8A 3N26A 3FVOA 4F3BA 4KR5A 4N07A 1IXIA 2A5SA 1US4A 4YICA 1MQGA 4XKRA 3VE1B 4DLDA 2HZLA 4U1ZA 5L9SA 4G68B 2QMXA 4QFKA 4U4SA 1B51A 1LB8A 1MDQA 1MM7A 2FYIA 1MPCA 4NTLA 4HTGA 3RQTA 1R9LA 3R7XA 3I3VA 4BDRA 3IAZA 3ILTB 1P1WA 4WEDA 3PPRA 4WKMA 5I58B 2UYEA 4ZEBA 2DSFA 1NKXA 3LR1A 1ZLQA 3N94A 2ZNUA 3K02A 3G3IA 4IO6A 3VLUA 3O6GA 1B32A 1QUKA 2XD3A 4NF4B 4ZEIA 1N7WA 2W7YA 2DP8A 4F2OA 1VE4A 1SW1A 3LSWA 1SVXB 3UGWA 5CMMA 3HHFA 4GF8A 3PPOA 5I56B 3IOVA 5KDTA 3CG1A 1P1QA 2XXTA 1FQEA 1SW5A 3TTRA 3EPEA 5CMBA 1FQFA 1YPNA 4FIMA 4LP2B 4F18A 1B52A 4F1VA 1UQWA 4IY6A 5I59B 4P0GA 1BP5A 1TWYA 2X7QA 3Q25A 4DIGA 3QUFA 4GLIA 4R2BA 1Y1MA 1MY1A 2O6AA 3UIFA 5CMCA 1GVCA 3MJNA 2F7AA 3B6QA 3TTMA 1B46A 2R9JA 4GOTA 3C31A 3L6HA 2VHAA 3TYHA 5AA3A 2QS3A 2B3BA 3QXMA 4ZZAA 1S9TA 4G68A 1NFTA 3TPAA 2Q2AA 3UP9A 2FNCA 3VLWA 3WAFA 2H9BA 1QW0A 4AB6A 2QS4A 2Y7IA 3S9NC 4NF5A 5L9MA 1SYHA 5CC2A 3K1PA 2Q8JA 2RC7A 1AH5A 4O3AA 1LBBA 3U92A 3G3KA 1O63A 2X26A 5JEIA 1EZOA 2VGQA 3IK6B 4QRZA 4H65A 3T9XB 3MQ9A 1NMUA 5H8HB 4RPOA 1M5DA 3IR1A 1Y3QA 1SI1A 3MBPA 3EHUA 4NF4A 3E4RA 2O69A 4KHZE 3CFZA 3EQ1A 2VOZA 5ELVA 4OWDA 3IO4A 2Y7RA 4YAHX 5ISUA 4I62A 4XXUA 5I56A 1S50A 4QSDA 4OHNA 5ICTA 3K4UA 1TT1A 3PUVE 4R74A 3H6WA 1KWHA 1B4ZA 3A3CA 2XXPA 2VD3A 2O7IA 3U94A 2VP1A 3FJMA 2XX8A 4ZS9A 3Q28A 5A5XB 5I59A 4FEBA 1PB8A 2R71A 1MY4A 3KGCA 3THIA 3PUXE 1M5EA 4POXA 3M8UA 5H8FB 2Z8FA 2DXYA 1QVSA 4GQOA 5K2XA 3KN8A 1MRPA 1EH3A 5CMKA 2IEEA 4HS7A 2I6EA 2XXHA 4JB7A 3ONMA 4YB6A 4G4PA 3C9HA 2HXWA 4UA8A 1VFEA 3TELA 2O1LA 4JDFA 3B7DA 3HSTA 1B0LA 4GWOA 5AE4A 1USYE 1DTGA 4LATA 1Q35A 1ZMGA 3QUJA 4RNSA 2NVUB 4JWXA 3JYRA 3O9PA 3OEKA 3T9VA 1LFHA 3G7WA 1YAEA 3H6VA 2GH9A 2RC8A 2I4CA 4ZE8A 3RGYA 4PFTA 1H3DA 5BWJA 1J1NA 3TCGA 4OFOA 5CM6A 4XTCQ 1Y20A 2XXVA 1HSEA 2RINA 4C0RA 2PMSA 4KI0E 3OELA 4F29A 2IA4A 1P1OA 3E9XA 1FTKA 1Y3NA 1B6HA 3T93B 4R75A 1CE2A 1ELJA 4DXUA 2PT2A 2I0CA 3RN8A 2H98A 4HW8A 5DEXB 4PE5B 3FVKA 4NMYA 1JW4A 2DWIA 5TP9A 4IO2A 2H25A 4F1YA 4P11A 5I2KA 2ALUA 4E0WA 3IB0A 4F22A 5IKBA 2F97A 5DVIA 5I2NB 1EZPA 4WEPA 3PUWE 5HM4B 3SKPA 1D9VA 2QPQA 2QL3A 1RKMA 4NF6A 4BLAA 1B3GA 1LAXA 4YMBA 2E1SA 1FTOA 4LVQA 3K6UA 1M5CA 3RUMA 3T9HB 1MH4A 2OLBA 2Q88A 4LZ7A 4R72A 3CI8A 4Q30B
chains in the Genus database with same CATH superfamily
1PDAA 1SD3A 5H8FA 2DDKA 3C4MA 3LC8A 1AMFA 4H0WA 1NV3A 1DK4A 4R73A 4R6YA 1FJ9A 1NH7A 4IO5A 1BIYA 4RPNA 3SERA 3EHSA 4ZE9A 2F7CA 1LCFA 4JSDA 4JSOA 2RCBA 3Q26A 4OTEA 1NNPA 4P8BA 3EHTA 1CB6A 2HZKA 3QK6A 1ZBMA 4F3SA 3GYYA 2F3BA 3TTNA 2ZYOA 4XKPA 4G8NA 1NV0A 5F24A 3QIMA 2ZMBA 1O7TA 3H4ZA 2DE4A 4NQ8A 3TQLA 3SEWA 1G0IA 2P2AA 1LLSA 2Z8DA 3KG2A 1FPIA 2WYKA 1JETA 1FQDA 5KZTA 2ZNTA 4HE2A 1OQHA 1LGBC 3MVZA 3SEXA 4PGNA 3V8XB 1JEVA 4PF6A 5ICQA 4OENA 3GZGA 4KYDA 1B2HA 1R6ZA 5AA4B 2ZYMA 3IL1B 3SESA 1MXUA 3MAMA 5DEXA 3U93A 4MH5A 1A99A 3C36A 4U1OA 2P3NA 3QAXA 2LAOA 2V93A 4PC9A 1NV1A 4NWCA 1A8EA 3FXRA 1LBCA 2CEYA 5J16A 3OO9A 3B6TA 2PBWA 4FECA 2F6PA 4HE0A 5JTYB 2A5TB 1IEJA 3O66A 5J1DA 1MQIA 3HN0A 4DDDA 4EQBA 3H3GA 1N84A 1MPBA 1PEBA 1BKAA 4G68C 5I57B 3MSTA 4JXIA 2DQVA 4PFUA 4GWXA 3W9WA 4F2QA 2HFBA 3A09A 5ITOA 1GR2A 2PT1A 4N91A 3B8BA 2O7UA 3K1NA 3KBRA 3OXNA 2FIXA 3PPQA 3T1BA 3HCQA 3PD8A 4MCOA 2O84X 5ET5A 3BIGA 1N3WA 4JBZA 4ZEKA 3BIHA 5I5PA 1CNQA 2Y5LA 3IJXB 3HO7A 3I5OA 4H5FA 1FCKA 1OVBA 4F1UA 2Y7WA 1IIWA 1LBYA 4ELOA 2VT5A 4ELPA 4HXVA 1JW5A 1FW0A 1FQAA 3M3KA 4TLMB 2O68A 2XX9A 3OSQA 3TUSA 4M4GA 4NF8B 4KYSA 4RY1A 3TMGA 3G3JA 3PMVA 1B5IA 1FRPA 1L5TA 2Z22A 4ESWA 2OZZA 2I3WA 4P3LA 4N81A 3MWBA 4LZ5A 3TDJA 1MXWA 2XXKA 5H8NA 2CZHA 4ECFA 3V5AA 4ESXA 3CSBA 3FIRA 2AYSA 3G3HA 2WBDA 4L17A 1M5BA 4IY5A 5DT6A 1Z7ME 3H06B 2B3FA 4THIA 1FPDA 1YZ0A 5AA4A 4PBQA 4XKNA 3KSJA 2YJPA 2DWJA 2F3DA 1Y3PA 4IR8A 5B70A 5LOMA 2HQ0A 3DLNA 1SDXA 4KYEA 2OCUA 5DYHA 1VSOA 4X8RA 2XXRA 2DS9A 4Z0IA 4QFPA 4F39A 2DWAA 4QSCA 1FPLA 4PETA 1QUIA 2DVZA 1NV2A 4GXAA 5JTYA 3E79A 4AS4A 3PGFA 5ESYA 3D4GA 2GHBA 3E78A 4F19A 4BDMA 2XXXA 1IXCA 4H67A 3C33A 3PV0E 4E0XA 1URSA 3NOHA 4YB7A 3FVGA 5I58A 1LAHE 4RJZA 5FTIA 1B5JA 1MQHA 3CVGA 3S9LC 1QUJA 2XXYA 5EHMA 3HV1A 4MBPA 1SW4A 1EYJA 2Q9TA 2NWJA 1MPDA 1II5A 3OEMA 1MY3A 1GV8A 4NE4A 1H43A 3OO7A 4NG7A 4MEVA 3MUQA 3ROJA 2I0BA 1QKBA 3U72A 4N6PA 4X1DA 1UTHB 2VD2A 4F3PA 1B40A 3T96B 2XWIA 4AQ4A 2ZXTA 1ZKBA 4GX4A 2GHAA 4MIJA 1TXFA 4N8GA 1DPPA 1PBQA 3C35A 2Q2CA 3MPKA 1FBGA 4FAJA 4IO4A 3P7IA 2AIXA 1QKAA 4HCWA 3KSXA 2YLNA 1YTVA 5H8QB 4NAPA 1BLFA 2Y5KA 4NF8A 2GRVA 1FPGA 4PGPA 4XKQA 5IGAA 2HEUA 1FPJA 1KA0A 2I58A 3JZJA 5F7VA 2UVIA 4YU0A 5BUUA 4O3CA 2ABHA 3FATA 1B58A 1VFDA 3RY3A 4BDOA 4LUBA 3KC1A 2V4CA 4DE8A 1AWBA 4EXKA 2FBPA 1XC1A 3KC0A 2QJEA 1B3HA 2Y7PA 4N13A 2NOOA 3LUYA 3MVYA 3CSGA 2WX9A 5TU0A 2DVCA 4JVIA 4ONYA 1NUZA 4OERA 2I49A 5AA2B 1AL3A 1PB7A 4ELQA 3B6WA 4H8JA 1FBCA 1FTJA 4LA9A 3CG3A 1O64A 4O94A 2F36A 3GLBA 1IMBA 3TODA 1FTLA 3K2DA 2BJJX 1I6AA 2H5YA 2THIA 1IMDA 3KEIA 4H1XA 1OIBA 3PU5A 2HHMA 4I3YA 4X9TA 4PFWA 1IMCA 5EQ9A 5I7IA 1NUWA 2REGA 2DE3A 3DP6A 4G2ZA 3IOTA 1LFIA 4R2FA 1N04A 4RK9A 3IOWA 4C1TA 4HE1A 3K00A 3IFCA 4GBWA 4OZ9A 3CR9A 1TFDA 5H8HA 2HCAA 3MC2A 2ZZVA 4IB2A 3FJ7A 3RTFB 4C1UA 1B7ZA 1LBVA 2XXUA 3VVFA 4X1BA 5FTHA 1ATGA 1POTA 4LQ2A 4GWWA 4EDPA 3S9EA 1A7LA 1UTHA 4JWYA 1I69A 2YPNA 2Z8EA 3QMFA 4MLQA 3SEUA 3RNNA 1MY0A 1MQDA 2F6GA 3DP4A 4OETA 1SBPA 3LSLA 3Q29A 1MS7A 2QMWA 1SI0A 1QGXA 1P1UA 2V3UA 2V25A 5F1QA 3TAJA 3K6WA 5JK4A 1IXHA 3QYTA 3VVEA 3V83A 4RYAA 3SETA 5A5XA 1B3EA 1JVYA 2DYXA 1FTMA 3VXCA 1NH8A 1YYZA 3ZS6A 2ZYNA 3IB2A 3KN3A 1XHYA 1XVYA 4IO3A 2V3TA 3GBAA 1NV4A 1ZIUA 1FJ6A 1N76A 2UVGA 2ANJA 2XWVA 3T66A 2HAUA 3TFLA 3VXBA 4PAIA 1HSJA 4QFLA 3S4UA 2OWZA 3PPPA 3KJTA 4H45A 2UVJA 5DVFA 4OXVA 3FXQA 5EYFA 3VV5A 1QULA 4G8MA 3TQWA 1Y1ZA 1K9ZA 4GL8A 4PFIA 4DXBA 3OSRA 4GFRA 2DOJA 5ITPA 2UXAA 4MNPA 3IX1A 3FUZA 4LONB 2O51A 2F5XA 3EKIA 5AA1A 1TFAA 4PDDA 5TPAB 1KZ8A 3N6TA 3MW0A 1BTJA 1PC3A 2DWHA 3KOSA 4ZDMA 3SDFA 4FJPA 3T9UA 1UIUA 3FBPA 5KDTB 1LCTA 3RYDA 3O28A 1FBFA 1FPEA 5A5LA 4YKJA 3KN7A 1SW2A 4EQ7A 3I6VA 2QS1A 1RYOA 5CI5A 4YZZA 1GGGA 2CMOA 1YXIA 4POWA 5CBSA 1LAFE 2KR0A 3G3FA 1B7HA 1P99A 4KD5A 1WDNA 3IB1A 4PFYA 2ONRA 3QSLA 3GXAA 1MH3A 4ZECA 4OA4A 5DTBA 1SPIA 2XX7A 3OMBA 3PUYE 4OYVA 4P0IA 2RCAA 2O1MA 2ONKE 3ZKKA 3SZPA 5HPQA 1HSLA 1POY1 1URGA 2ZYKA 4LQ5A 3IORA 4U21A 4GRKA 1GTKA 4ISUA 4ZEFA 1B1XA 4IGRA 4XIGQ 4Z7EA 1MXZA 2F8DA 3VVDA 1IQ7A 1JW1A 3PMXA 5I2NA 2I4BA 1JEUA 4KPTA 1ZU0A 3UK4A 4NGUA 1G0HA 3O6HA 1ZJLA 2ONSA 3PUZE 3RPLA 2GQ1A 4MFIA 1LBZA 3H7MA 4RK2A 1MDP1 1N3XA 4DCXA 3TZAA 3FJGA 4PAKA 3CFLA 1RDXA 4NF5B 2V84A 1AOVA 2D5WA 2PYYA 1OQGA 5L9OA 4JVDA 3BFUA 3IJOB 2Z23A 3FV2A 4U23A 4YKKA 2XXIA 3RPWA 2F35A 1T0KA 5I84A 1USYH 1D4NA 1R9QA 1US5A 2RC9A 4F3GA 1NV7A 2M8CA 4BDQA 1UTBB 2UYFA 3K1MA 1LAGE 3IO6A 4UABA 1EZ9A 3UORA 4OMBA 4OFLA 4U4XA 3TTKA 4NF0A 1URDA 4K3FA 3OENA 5TPAA 4OANA 1A55A 3PMWA 1FQCA 1DSNA 1D9YA 2VPOA 4GBVA 2P0SA 4TOZA 2D21A 3B50A 4KFQA 1QJMA 3DELB 4GX6A 1ANFA 3AXFA 1MXXA 4OVPA 2CZKA 4TQUQ 1D3KA 3SEVA 3O29A 3TEPA 4PFRA 1B1HA 3ECRA 3L6GA 1B0HA 1N0TA 4ZZEA 4P9KA 2KQZA 4GIZA 3C32A 4AB5A 1IZ1A 4H5GA 4MNIA 4P56A 3HFUA 1ZTYA 1A54A 4GL0A 4EF2A 3K6VA 2ZZXA 3GBBA 1DMBA 3TKDA 4OVTA 2Y7KA 1DTZA 3MVWA 2UVHA 3KFMA 4PFBA 3S2VA 2QVUA 4FE8A 3HPIA 1H45A 4GWZA 5FHMA 3RT6B 4KCCA 2R6GE 1RYXA 4H46A 1SYIA 1DOTA 2XXQA 4TLLB 3UN6A 3FXUA 1DPEA 3PTYA 3PPNA 3RTWB 4MF3A 5B7DA 5ET6A 1H76A 4RXLA 4IO7A 4ZEDA 4EUOA 3TCHA 5M2VA 3DM0A 3V89B 2A5TA 3M3LA 3U8QA 1MQJA 4YKIA 1VR5A 3Q27A 4DI4B 3BBRA 5I57A 1B3LA 2H99A 4H8IA 4LN5A 4OVJA 2ESNA 4UACA 4QHQA 3CIJA 4KCDA 4NWDA 4ND9A 4BDLA 3MZ1A 1I6QA 4OEVA 3ODBA 2QS2A 4FORA 3O2AA 2ZNSA 3ILUB 3BFTA 1MXYA 4JWOA 4X48A 2L5VA 3FGSA 3CRBA 1H44A 3K01A 3DP8A 4OEUA 2H4IA 1UTBA 4GXSB 4ELRA 4KQPA 3C34A 4YMAA 1Z7NE 3R26A 1A40A 1JNFA 2XD2A 2ZZWA 4OVQA 4XFEA 4GD5A 3KOTA 4WXJA 2DE2A 4EF1A 1NV6A 4O8MA 4RA1A 5TP9B 1N7XA 3MPLA 2PVUA 5I2KB 4OFJA 3BKIB 3CHGA 2I3VA 3OO6A 2E0SA 4NHBA 1M5FA 2X7PA 4GVOA 3IOUA 5EQAA 1LFGA 1UIVA 1XT8A 2OBGA 4G8HA 1LSTA 5FHOA 2FIEA 2G29A 3MVXA 4QFNA 2CEXA 2CZIA 1OMPA 4NF6B 5KCJB 3RT8A 4X04A 4QF9A 5HBCA 3LSXA 4HCYA 1LB9A 1LBXA 3ZKLA 5EQ7A 3E13X 1F9BA 3JV9A 1Q1KA 5K2YA 2PX1A 3MZBA 4IGTA 3FASA 1IXGA 1NL5A 1RDYA 1Y9UA 1AIVA 1WODA 4JVCA 4QSEA 1P1NA 2RF1A 2WYPA 1OLCA 5H8SA 1EYKA 1YCJA 3VFJA 1D9QA 1NV5A 4MHFA 5FHNA 4DI3D 4N15A 3K6XA 3EF7A 4FATA 3WAEA 1EYIA 3N6UA 2XXWA 1NNFA 2XHDA 1B5HA 1FQBA 3USDA 1OVTA 1NNKA 3M3FA 3KZGA 3T22A 2VPNA 1IMAA 3SEYA 2CZLA 3G3GA 4R9GA 4R6KA 4YB5A 1MG1A 4U22A 5CBRA 4R9FA 4PF8A 2FA7A 4R6HA 2V3QA 1JQFA 2Y84A 3W9VA 2OK2A 2RKMA 3TTLA 1B4HA 2WBBA 1PB9A 5IAIA 3H6UA 3LBSA 3VLVA 3S9MC 2WKYA 3H6TA 2XWKA 3LSFB 3PD9A 2WEFA 3MZ9A 1XS5A 2QSXA 4H6DA 4N4UA 3D1RA 4EQ9A 2NXOA 4OQOA 4EXLA 3H03A 2OWSA 3R6UA 2PFYA 5DVJA 3UA8A 5I3SA 1Y4TA 3FZVA 4YKPA 1EU8A 3U65A 2Q89A 4G77A 3K0VA 3O97A 5IZ1A 5H8QA 2AL5A 1IMFA 1I6BA 4BDNA 3KJ7A 3MYUA 5T3JA 4F31B 3A3UA 2Q74A 4MLVA 3OD7A 3HHGA 2QFLA 1NI9A 1MY2A 1VDWA 2F7BA 2B65A 4NEDA 4I8CA 3FD3A 4I1DA 2D3IA 2REJA 1S7YA 3F11A 3W15C 5CRYA 5KCJA 2B4MA 2HAVA 3E3KA 1OLAA 1R1NA 4Q5TA 1B9JA 2BJIA 1FPFA 3VDFA 2DXRA 3O6IA 3T0JA 2XWOA 2AL4A 2F34A 4O3BA 5AA2A 4DXCA 4M1VA 3ZSFA 5EYGA 1RDZA 1B3FA 1NNTA 3CFXA 4PQJA 3RLFE 2P1SA 3MP1A 1DCUA 4OESA 4I40A 3MP6A 3ISPA 3LV0A 3MP8A 2OWTA 4Q0CA 3A29A 5LTCA 1B05A 2NUVA 1B7UA 4DZ1A 1XVXA 1IUDA 4PP0A 4DCYA 4QFOA 1XOCA 1MM6A 3D4CA 1PBPA 3U1OA 2GFEA 4P47A 4LZ8A 1IITA 3EN3A 3FV1A 2G93A 5EHSA 5L8DA 4FEDA 4U2RA 4KXPA 3N5LA 1Y4CA 1MXVA 2F78A 1SQYA 2KLFA 1A8FA 3TCFA 5H8NB 4QXDA 1WVJA 3OOAA 4I9DA 1JVXA 2OJTA 3FVNA 2QRYA 5AA2D 2I48A 4N17A 4Q8RA 3OO8A 1FPBA 3N26A 3FVOA 4F3BA 4KR5A 5LDZA 4N07A 1IXIA 2A5SA 1US4A 4YICA 1MQGA 4XKRA 3VE1B 4DLDA 1XI6A 2HZLA 4U1ZA 5L9SA 4G68B 2QMXA 4QFKA 4U4SA 5ET7A 1B51A 1LB8A 1MDQA 1MM7A 4OVRA 2FYIA 1MPCA 4NTLA 4HTGA 1FBHA 2PCRA 3RQTA 1R9LA 3R7XA 3I3VA 4BDRA 3IAZA 3ILTB 1P1WA 4WEDA 5IM2A 4GWSA 1FPKA 3PPRA 4N8YA 4WKMA 1BK4A 5I58B 2UYEA 4ZEBA 4MX6A 2DSFA 1NKXA 4OVSA 2P3VA 3LR1A 1ZLQA 3N94A 2ZNUA 3K02A 3G3IA 1FTAA 4G61A 4IO6A 3VLUA 3O6GA 1B32A 1QUKA 4XF5A 2XD3A 4NF4B 4ZEIA 1N7WA 2W7YA 4QBAA 2DP8A 4O7MA 4F2OA 1VE4A 1SW1A 3LSWA 1SVXB 3UGWA 4PBHA 5CMMA 5EYHA 3HHFA 5FBPA 4O7IA 4GF8A 4PAFA 3PPOA 5I56B 3IOVA 5KDTA 3CG1A 1P1QA 2XXTA 1FQEA 1K9YA 1SW5A 3TTRA 2XA5A 4GWYA 3EPEA 5CMBA 1FQFA 1YPNA 1DBZA 4FIMA 4LP2B 4F18A 1B52A 4FBPA 4F1VA 1UQWA 4IY6A 5I59B 4P0GA 1BP5A 1TWYA 2X7QA 3Q25A 4DIGA 3QUFA 4GLIA 4R2BA 4PE3A 3FXBA 1Y1MA 1MY1A 2O6AA 2QVVA 1INPA 3UIFA 5CMCA 1GVCA 3MJNA 2F7AA 1Q9DA 3B6QA 1LBWA 3TTMA 1B46A 2R9JA 4GOTA 4NN3A 4XEQA 3C31A 3L6HA 2VHAA 3TYHA 4PDHA 5AA3A 4NX1A 2QS3A 2B3BA 3QXMA 4ZZAA 2OX3A 1S9TA 4G68A 1NFTA 3TPAA 2Q2AA 3UP9A 4MNCA 2FNCA 3VLWA 3WAFA 2H9BA 1FBDA 1QW0A 4AB6A 2QS4A 2Y7IA 3S9NC 4NF5A 5L9MA 4GWUA 1SYHA 5CC2A 3K1PA 2Q8JA 2RC7A 1AH5A 4O3AA 1NUXA 1LBBA 3LUZA 2PFZA 3U92A 3G3KA 1O63A 2X26A 5JEIA 2R8TA 1EZOA 2VGQA 3IK6B 4QRZA 4H65A 3T9XB 3MQ9A 1NMUA 5H8HB 4RPOA 1M5DA 3IR1A 4PTKA 1LEVA 1Y3QA 1SI1A 3MBPA 3EHUA 4NF4A 3E4RA 5DW8A 2O69A 4KHZE 3CFZA 4MAGA 3EQ1A 2VOZA 5ELVA 5IZ3B 4P1EA 4OWDA 3IO4A 2Y7RA 4YAHX 5ISUA 4I62A 4XXUA 5I56A 1S50A 4QSDA 4OHNA 5ICTA 2HPGA 2JJKA 3K4UA 1TT1A 3PUVE 4R74A 3H6WA 1KWHA 4I3EA 1B4ZA 3A3CA 2XXPA 2VD3A 2O7IA 3U94A 2VP1A 4AS5A 3FJMA 2XX8A 4ZS9A 3Q28A 5A5XB 5I59A 4FEBA 1PB8A 2MKZA 2R71A 1MY4A 3KGCA 3KBZA 3THIA 3PUXE 1M5EA 4POXA 3M8UA 5H8FB 2Z8FA 2DXYA 1QVSA 5EQ8A 4GQOA 4N6DA 5K2XA 3KN8A 1MRPA 1EH3A 5CMKA 2IEEA 2QVRA 4HS7A 2I6EA 2XXHA 4JB7A 3ONMA 2FVZA 4YB6A 4G4PA 3C9HA 2HXWA 4UA8A 1VFEA 3TELA 2Q8MA 2O1LA 4JDFA 3B7DA 3HSTA 1B0LA 4GWOA 5AE4A 1USYE 1DTGA 4LATA 1KA1A 1Q35A 1ZMGA 3QUJA 4RNSA 2NVUB 4JWXA 3JYRA 1IMEA 3O9PA 2HXRA 3OEKA 3T9VA 1LFHA 3G7WA 1YAEA 3H6VA 4MJOA 2GH9A 2RC8A 4PCDA 2I4CA 4ZE8A 3RGYA 4PFTA 1H3DA 5BWJA 1J1NA 4MMPA 3TCGA 4OFOA 5CM6A 4XTCQ 1Y20A 2XXVA 1HSEA 2RINA 4C0RA 2PMSA 4KI0E 3OELA 4F29A 1FSAA 2IA4A 1P1OA 3E9XA 1FTKA 1Y3NA 1B6HA 3T93B 4R75A 1CE2A 1ELJA 2FHYA 4DXUA 4GX3A 2PT2A 2I0CA 2B4LA 3RN8A 5IZZA 2H98A 4HW8A 5DEXB 4PE5B 5IZ3A 3FVKA 4NMYA 1JW4A 2DWIA 5TP9A 4IO2A 2H25A 4F1YA 4P11A 5I2KA 1FBEA 2ALUA 4E0WA 1FBPA 1JP4A 3IFAA 3IB0A 4F22A 5IKBA 2F97A 5DVIA 5I2NB 1EZPA 4WEPA 1NUYA 3PUWE 5HM4B 3SKPA 1D9VA 2QPQA 4P1LA 3RPLB 2QL3A 1RKMA 4NF6A 4BLAA 1B3GA 1LAXA 4YMBA 2E1SA 1FTOA 4LVQA 3K6UA 1M5CA 3RUMA 3T9HB 4N6KA 1MH4A 2OLBA 2Q88A 4LZ7A 4R72A 3CI8A 4Q30B 5ET8A
chains in the Genus database with same CATH topology
1PDAA 1SD3A 5H8FA 3C4MA 3LC8A 1AMFA 4H0WA 4R73A 4R6YA 1NH7A 4IO5A 1BIYA 4RPNA 3SERA 3EHSA 4ZE9A 2F7CA 1LCFA 4JSDA 4JSOA 2RCBA 3Q26A 4OTEA 1NNPA 3EHTA 1CB6A 2HZKA 3QK6A 1ZBMA 4F3SA 3TTNA 2ZYOA 4XKPA 4G8NA 3QIMA 2ZMBA 1O7TA 3H4ZA 2DE4A 3TQLA 3SEWA 2P2AA 1LLSA 2Z8DA 3KG2A 5KZTA 1JETA 1FQDA 2ZNTA 1OQHA 1LGBC 3MVZA 3SEXA 3V8XB 1JEVA 5ICQA 4OENA 3GZGA 4KYDA 1B2HA 1R6ZA 5AA4B 2ZYMA 3IL1B 3SESA 1MXUA 3MAMA 5DEXA 3U93A 4MH5A 1A99A 3C36A 4U1OA 3QAXA 2LAOA 2V93A 4NWCA 1A8EA 3FXRA 1LBCA 3OO9A 3B6TA 2PBWA 4FECA 2F6PA 5JTYB 2A5TB 1IEJA 3O66A 5J1DA 1MQIA 3HN0A 4DDDA 4EQBA 3H3GA 1N84A 1MPBA 1PEBA 1BKAA 4G68C 5I57B 4JXIA 2DQVA 4PFUA 3W9WA 4F2QA 2HFBA 3A09A 5ITOA 1GR2A 2PT1A 2O7UA 3K1NA 3KBRA 3OXNA 3PPQA 3HCQA 3PD8A 2O84X 1N3WA 4JBZA 4ZEKA 3IJXB 3HO7A 3I5OA 4H5FA 1FCKA 1OVBA 4F1UA 2Y7WA 1IIWA 4ELOA 4ELPA 1JW5A 1FW0A 1FQAA 3M3KA 4TLMB 2O68A 2XX9A 3OSQA 3TUSA 4M4GA 4NF8B 4KYSA 4RY1A 3TMGA 3G3JA 3PMVA 1B5IA 1L5TA 2Z22A 4ESWA 2OZZA 2I3WA 3MWBA 4LZ5A 3TDJA 1MXWA 5H8NA 4ECFA 3V5AA 4ESXA 3CSBA 3FIRA 2AYSA 3G3HA 4L17A 1M5BA 4IY5A 5DT6A 1Z7ME 3H06B 2B3FA 4THIA 5AA4A 4XKNA 3KSJA 2YJPA 2DWJA 1Y3PA 5B70A 5LOMA 2HQ0A 3DLNA 1SDXA 4KYEA 2OCUA 5DYHA 1VSOA 2XXRA 2DS9A 4Z0IA 4QFPA 4F39A 2DWAA 4QSCA 4PETA 1QUIA 2DVZA 4GXAA 5JTYA 3PGFA 3D4GA 2GHBA 4F19A 4BDMA 2XXXA 1IXCA 4H67A 3C33A 3PV0E 4E0XA 1URSA 4YB7A 3FVGA 5I58A 1LAHE 4RJZA 5FTIA 1B5JA 1MQHA 3CVGA 3S9LC 1QUJA 2XXYA 5EHMA 3HV1A 4MBPA 1SW4A 2Q9TA 2NWJA 1MPDA 1II5A 3OEMA 1MY3A 1GV8A 4NE4A 1H43A 3OO7A 3MUQA 2I0BA 1QKBA 3U72A 4N6PA 4X1DA 1UTHB 2VD2A 4F3PA 1B40A 3T96B 4AQ4A 2ZXTA 1ZKBA 2GHAA 1TXFA 1DPPA 1PBQA 3C35A 2Q2CA 3MPKA 4FAJA 4IO4A 3P7IA 2AIXA 1QKAA 4HCWA 3KSXA 2YLNA 1YTVA 5H8QB 1BLFA 4NF8A 2GRVA 4XKQA 2HEUA 2I58A 3JZJA 5F7VA 2UVIA 4YU0A 5BUUA 2ABHA 4O3CA 3FATA 1B58A 1VFDA 3RY3A 4BDOA 4LUBA 4DE8A 4EXKA 1XC1A 2QJEA 1B3HA 2Y7PA 4N13A 2NOOA 3LUYA 3MVYA 3CSGA 5TU0A 2DVCA 4ONYA 4OERA 2I49A 5AA2B 1AL3A 1PB7A 4ELQA 3B6WA 4H8JA 1FTJA 4LA9A 3CG3A 1O64A 2F36A 3GLBA 3TODA 1FTLA 3K2DA 2BJJX 1I6AA 2H5YA 2THIA 3KEIA 4H1XA 1OIBA 3PU5A 4X9TA 4PFWA 2REGA 2DE3A 3DP6A 4G2ZA 3IOTA 1LFIA 4R2FA 1N04A 4RK9A 3IOWA 4C1TA 3K00A 4OZ9A 3CR9A 1TFDA 5H8HA 2HCAA 3MC2A 4IB2A 3FJ7A 3RTFB 4C1UA 1B7ZA 2XXUA 3VVFA 4X1BA 5FTHA 1ATGA 1POTA 4LQ2A 4EDPA 3S9EA 1A7LA 1UTHA 4JWYA 1I69A 2YPNA 2Z8EA 3SEUA 4MLQA 3RNNA 1MY0A 1MQDA 2F6GA 3DP4A 4OETA 1SBPA 3LSLA 3Q29A 1MS7A 2QMWA 1SI0A 1P1UA 2V3UA 2V25A 5F1QA 3TAJA 3K6WA 5JK4A 1IXHA 3QYTA 3VVEA 3V83A 4RYAA 3SETA 5A5XA 1B3EA 1JVYA 2DYXA 1FTMA 3VXCA 1NH8A 3ZS6A 2ZYNA 3IB2A 3KN3A 1XHYA 1XVYA 4IO3A 2V3TA 3GBAA 1ZIUA 1N76A 2UVGA 2ANJA 3T66A 2HAUA 3TFLA 3VXBA 1HSJA 4QFLA 3S4UA 3PPPA 3KJTA 2UVJA 5DVFA 4OXVA 3FXQA 5EYFA 3VV5A 1QULA 4G8MA 3TQWA 1Y1ZA 4GL8A 4DXBA 3OSRA 4GFRA 2DOJA 5ITPA 2UXAA 3IX1A 3FUZA 4LONB 2O51A 2F5XA 5AA1A 1TFAA 5TPAB 3N6TA 3MW0A 1BTJA 1PC3A 2DWHA 3KOSA 4ZDMA 3SDFA 4FJPA 3T9UA 1UIUA 5KDTB 1LCTA 3O28A 4YKJA 3KN7A 1SW2A 4EQ7A 3I6VA 2QS1A 1RYOA 5CI5A 4YZZA 1GGGA 2CMOA 4POWA 5CBSA 1LAFE 3G3FA 1B7HA 1P99A 4KD5A 1WDNA 3IB1A 4PFYA 2ONRA 3QSLA 3GXAA 1MH3A 4ZECA 5DTBA 2XX7A 3OMBA 3PUYE 4OYVA 4P0IA 2RCAA 2O1MA 2ONKE 3ZKKA 5HPQA 1HSLA 1POY1 1URGA 2ZYKA 4LQ5A 3IORA 4U21A 4GRKA 1GTKA 4ISUA 4ZEFA 1B1XA 4IGRA 4XIGQ 4Z7EA 1MXZA 2F8DA 3VVDA 1IQ7A 1JW1A 3PMXA 5I2NA 2I4BA 1JEUA 4KPTA 1ZU0A 3UK4A 3O6HA 1ZJLA 2ONSA 3PUZE 4MFIA 3H7MA 4RK2A 1MDP1 1N3XA 4DCXA 3TZAA 3FJGA 3CFLA 4NF5B 2V84A 1AOVA 2D5WA 2PYYA 1OQGA 5L9OA 3BFUA 3IJOB 2Z23A 3FV2A 4U23A 4YKKA 2XXIA 3RPWA 2F35A 1T0KA 5I84A 1USYH 1D4NA 1R9QA 1US5A 2RC9A 4F3GA 2M8CA 4BDQA 1UTBB 2UYFA 3K1MA 1LAGE 3IO6A 1EZ9A 3UORA 4OMBA 4OFLA 4U4XA 3TTKA 1URDA 4K3FA 3OENA 5TPAA 1A55A 3PMWA 1FQCA 1DSNA 1D9YA 2P0SA 4TOZA 2D21A 4KFQA 1QJMA 3DELB 1ANFA 3AXFA 1MXXA 4TQUQ 1D3KA 3SEVA 3O29A 3TEPA 1B1HA 3ECRA 3L6GA 1B0HA 1N0TA 4ZZEA 4GIZA 3C32A 4AB5A 1IZ1A 4H5GA 1ZTYA 1A54A 4GL0A 4EF2A 3K6VA 3GBBA 1DMBA 3TKDA 2Y7KA 1DTZA 3MVWA 2UVHA 3KFMA 3S2VA 4FE8A 3HPIA 1H45A 5FHMA 3RT6B 4KCCA 2R6GE 1RYXA 1SYIA 1DOTA 2XXQA 4TLLB 3UN6A 3FXUA 1DPEA 3PPNA 3RTWB 4MF3A 5B7DA 1H76A 4RXLA 4IO7A 4ZEDA 4EUOA 3TCHA 5M2VA 3DM0A 3V89B 2A5TA 3M3LA 3U8QA 1MQJA 4YKIA 1VR5A 3Q27A 3BBRA 5I57A 1B3LA 2H99A 4H8IA 4OVJA 2ESNA 4UACA 4QHQA 3CIJA 4KCDA 4NWDA 4ND9A 4BDLA 3MZ1A 1I6QA 4OEVA 3ODBA 2QS2A 4FORA 3O2AA 2ZNSA 3ILUB 3BFTA 1MXYA 4JWOA 4X48A 3FGSA 3CRBA 1H44A 3K01A 3DP8A 4OEUA 2H4IA 1UTBA 4GXSB 4ELRA 4KQPA 3C34A 4YMAA 1Z7NE 3R26A 1A40A 1JNFA 2XD2A 4GD5A 3KOTA 4WXJA 2DE2A 4EF1A 4RA1A 5TP9B 1N7XA 3MPLA 2PVUA 5I2KB 4OFJA 3BKIB 2I3VA 3OO6A 2E0SA 1M5FA 2X7PA 4GVOA 3IOUA 1LFGA 1UIVA 1XT8A 2OBGA 4G8HA 1LSTA 5FHOA 2G29A 3MVXA 4QFNA 1OMPA 4NF6B 5KCJB 3RT8A 4QF9A 5HBCA 3LSXA 4HCYA 1LB9A 3ZKLA 3E13X 1F9BA 3JV9A 1Q1KA 5K2YA 2PX1A 3MZBA 4IGTA 3FASA 1IXGA 1NL5A 1Y9UA 1AIVA 1WODA 4QSEA 1P1NA 2RF1A 1OLCA 5H8SA 1YCJA 3VFJA 5FHNA 3K6XA 3EF7A 4FATA 3WAEA 3N6UA 2XXWA 1NNFA 2XHDA 1B5HA 1FQBA 3USDA 1OVTA 1NNKA 3M3FA 3KZGA 3T22A 3SEYA 2CZLA 3G3GA 4R9GA 4R6KA 4YB5A 1MG1A 4U22A 5CBRA 4R9FA 2FA7A 4R6HA 2V3QA 1JQFA 2Y84A 3W9VA 2OK2A 2RKMA 3TTLA 1B4HA 1PB9A 5IAIA 3H6UA 3LBSA 3VLVA 3S9MC 2WKYA 3H6TA 3LSFB 3PD9A 3MZ9A 1XS5A 2QSXA 4H6DA 4EQ9A 2NXOA 4OQOA 4EXLA 3H03A 2OWSA 3R6UA 5DVJA 3UA8A 1Y4TA 3FZVA 4YKPA 1EU8A 2Q89A 4G77A 3K0VA 3O97A 5H8QA 2AL5A 1I6BA 4BDNA 3KJ7A 4F31B 3A3UA 4MLVA 3OD7A 3HHGA 1MY2A 2F7BA 2B65A 4NEDA 4I8CA 3FD3A 4I1DA 2D3IA 2REJA 1S7YA 3F11A 3W15C 5CRYA 5KCJA 2HAVA 3E3KA 1OLAA 1R1NA 4Q5TA 1B9JA 3VDFA 2DXRA 3O6IA 2AL4A 2F34A 4O3BA 5AA2A 4DXCA 4M1VA 3ZSFA 1B3FA 1NNTA 3CFXA 4PQJA 3RLFE 2P1SA 3MP1A 4OESA 3MP6A 3MP8A 2OWTA 4Q0CA 1B05A 2NUVA 1B7UA 4DZ1A 1XVXA 1IUDA 4PP0A 4DCYA 4QFOA 1XOCA 1MM6A 3D4CA 1PBPA 3U1OA 2GFEA 4LZ8A 1IITA 3EN3A 3FV1A 2G93A 5EHSA 5L8DA 4FEDA 4U2RA 3N5LA 1Y4CA 1MXVA 2F78A 1SQYA 2KLFA 1A8FA 3TCFA 5H8NB 1WVJA 3OOAA 4I9DA 1JVXA 2OJTA 3FVNA 2QRYA 5AA2D 2I48A 4Q8RA 3OO8A 3N26A 3FVOA 4F3BA 4KR5A 4N07A 1IXIA 2A5SA 1US4A 4YICA 1MQGA 4XKRA 3VE1B 4DLDA 2HZLA 4U1ZA 5L9SA 4G68B 2QMXA 4QFKA 4U4SA 1B51A 1LB8A 1MDQA 1MM7A 2FYIA 1MPCA 4NTLA 4HTGA 3RQTA 1R9LA 3R7XA 3I3VA 4BDRA 3IAZA 3ILTB 1P1WA 4WEDA 3PPRA 4WKMA 5I58B 2UYEA 4ZEBA 2DSFA 1NKXA 3LR1A 1ZLQA 3N94A 2ZNUA 3K02A 3G3IA 4IO6A 3VLUA 3O6GA 1B32A 1QUKA 2XD3A 4NF4B 4ZEIA 1N7WA 2W7YA 2DP8A 4F2OA 1VE4A 1SW1A 3LSWA 1SVXB 3UGWA 5CMMA 3HHFA 4GF8A 3PPOA 5I56B 3IOVA 5KDTA 3CG1A 1P1QA 2XXTA 1FQEA 1SW5A 3TTRA 3EPEA 5CMBA 1FQFA 1YPNA 4FIMA 4LP2B 4F18A 1B52A 4F1VA 1UQWA 4IY6A 5I59B 4P0GA 1BP5A 1TWYA 2X7QA 3Q25A 4DIGA 3QUFA 4GLIA 4R2BA 1Y1MA 1MY1A 2O6AA 3UIFA 5CMCA 1GVCA 3MJNA 2F7AA 3B6QA 3TTMA 1B46A 2R9JA 4GOTA 3C31A 3L6HA 2VHAA 3TYHA 5AA3A 2QS3A 2B3BA 3QXMA 4ZZAA 1S9TA 4G68A 1NFTA 3TPAA 2Q2AA 3UP9A 2FNCA 3VLWA 3WAFA 2H9BA 1QW0A 4AB6A 2QS4A 2Y7IA 3S9NC 4NF5A 5L9MA 1SYHA 5CC2A 3K1PA 2Q8JA 2RC7A 1AH5A 4O3AA 1LBBA 3U92A 3G3KA 1O63A 2X26A 5JEIA 1EZOA 2VGQA 3IK6B 4QRZA 4H65A 3T9XB 3MQ9A 1NMUA 5H8HB 4RPOA 1M5DA 3IR1A 1Y3QA 1SI1A 3MBPA 3EHUA 4NF4A 3E4RA 2O69A 4KHZE 3CFZA 3EQ1A 2VOZA 5ELVA 4OWDA 3IO4A 2Y7RA 4YAHX 5ISUA 4I62A 4XXUA 5I56A 1S50A 4QSDA 4OHNA 5ICTA 3K4UA 1TT1A 3PUVE 4R74A 3H6WA 1KWHA 1B4ZA 3A3CA 2XXPA 2VD3A 2O7IA 3U94A 2VP1A 3FJMA 2XX8A 4ZS9A 3Q28A 5A5XB 5I59A 4FEBA 1PB8A 2R71A 1MY4A 3KGCA 3THIA 3PUXE 1M5EA 4POXA 3M8UA 5H8FB 2Z8FA 2DXYA 1QVSA 4GQOA 5K2XA 3KN8A 1MRPA 1EH3A 5CMKA 2IEEA 4HS7A 2I6EA 2XXHA 4JB7A 3ONMA 4YB6A 4G4PA 3C9HA 2HXWA 4UA8A 1VFEA 3TELA 2O1LA 4JDFA 3B7DA 3HSTA 1B0LA 4GWOA 5AE4A 1USYE 1DTGA 4LATA 1Q35A 1ZMGA 3QUJA 4RNSA 2NVUB 4JWXA 3JYRA 3O9PA 3OEKA 3T9VA 1LFHA 3G7WA 1YAEA 3H6VA 2GH9A 2RC8A 2I4CA 4ZE8A 3RGYA 4PFTA 1H3DA 5BWJA 1J1NA 3TCGA 4OFOA 5CM6A 4XTCQ 1Y20A 2XXVA 1HSEA 2RINA 4C0RA 2PMSA 4KI0E 3OELA 4F29A 2IA4A 1P1OA 3E9XA 1FTKA 1Y3NA 1B6HA 3T93B 4R75A 1CE2A 1ELJA 4DXUA 2PT2A 2I0CA 3RN8A 2H98A 4HW8A 5DEXB 4PE5B 3FVKA 4NMYA 1JW4A 2DWIA 5TP9A 4IO2A 2H25A 4F1YA 4P11A 5I2KA 2ALUA 4E0WA 3IB0A 4F22A 5IKBA 2F97A 5DVIA 5I2NB 1EZPA 4WEPA 3PUWE 5HM4B 3SKPA 1D9VA 2QPQA 2QL3A 1RKMA 4NF6A 4BLAA 1B3GA 1LAXA 4YMBA 2E1SA 1FTOA 4LVQA 3K6UA 1M5CA 3RUMA 3T9HB 1MH4A 2OLBA 2Q88A 4LZ7A 4R72A 3CI8A 4Q30B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PDA A;  1SD3 A;  5H8F A;  3C4M A;  3LC8 A;  1AMF A;  4H0W A;  4R73 A;  4R6Y A;  1NH7 A;  4IO5 A;  1BIY A;  4RPN A;  3SER A;  3EHS A;  4ZE9 A;  2F7C A;  1LCF A;  4JSD A;  4JSO A;  2RCB A;  3Q26 A;  4OTE A;  1NNP A;  3EHT A;  1CB6 A;  2HZK A;  3QK6 A;  1ZBM A;  4F3S A;  3TTN A;  2ZYO A;  4XKP A;  4G8N A;  3QIM A;  2ZMB A;  1O7T A;  3H4Z A;  2DE4 A;  3TQL A;  3SEW A;  2P2A A;  1LLS A;  2Z8D A;  3KG2 A;  5KZT A;  1JET A;  1FQD A;  2ZNT A;  1OQH A;  1LGB C;  3MVZ A;  3SEX A;  3V8X B;  1JEV A;  5ICQ A;  4OEN A;  3GZG A;  4KYD A;  1B2H A;  1R6Z A;  5AA4 B;  2ZYM A;  3IL1 B;  3SES A;  1MXU A;  3MAM A;  5DEX A;  3U93 A;  4MH5 A;  1A99 A;  3C36 A;  4U1O A;  3QAX A;  2LAO A;  2V93 A;  4NWC A;  1A8E A;  3FXR A;  1LBC A;  3OO9 A;  3B6T A;  2PBW A;  4FEC A;  2F6P A;  5JTY B;  2A5T B;  1IEJ A;  3O66 A;  5J1D A;  1MQI A;  3HN0 A;  4DDD A;  4EQB A;  3H3G A;  1N84 A;  1MPB A;  1PEB A;  1BKA A;  4G68 C;  5I57 B;  4JXI A;  2DQV A;  4PFU A;  3W9W A;  4F2Q A;  2HFB A;  3A09 A;  5ITO A;  1GR2 A;  2PT1 A;  2O7U A;  3K1N A;  3KBR A;  3OXN A;  3PPQ A;  3HCQ A;  3PD8 A;  2O84 X;  1N3W A;  4JBZ A;  4ZEK A;  3IJX B;  3HO7 A;  3I5O A;  4H5F A;  1FCK A;  1OVB A;  4F1U A;  2Y7W A;  1IIW A;  4ELO A;  4ELP A;  1JW5 A;  1FW0 A;  1FQA A;  3M3K A;  4TLM B;  2O68 A;  2XX9 A;  3OSQ A;  3TUS A;  4M4G A;  4NF8 B;  4KYS A;  4RY1 A;  3TMG A;  3G3J A;  3PMV A;  1B5I A;  1L5T A;  2Z22 A;  4ESW A;  2OZZ A;  2I3W A;  3MWB A;  4LZ5 A;  3TDJ A;  1MXW A;  5H8N A;  4ECF A;  3V5A A;  4ESX A;  3CSB A;  3FIR A;  2AYS A;  3G3H A;  4L17 A;  1M5B A;  4IY5 A;  5DT6 A;  1Z7M E;  3H06 B;  2B3F A;  4THI A;  5AA4 A;  4XKN A;  3KSJ A;  2YJP A;  2DWJ A;  1Y3P A;  5B70 A;  5LOM A;  2HQ0 A;  3DLN A;  1SDX A;  4KYE A;  2OCU A;  5DYH A;  1VSO A;  2XXR A;  2DS9 A;  4Z0I A;  4QFP A;  4F39 A;  2DWA A;  4QSC A;  4PET A;  1QUI A;  2DVZ A;  4GXA A;  5JTY A;  3PGF A;  3D4G A;  2GHB A;  4F19 A;  4BDM A;  2XXX A;  1IXC A;  4H67 A;  3C33 A;  3PV0 E;  4E0X A;  1URS A;  4YB7 A;  3FVG A;  5I58 A;  1LAH E;  4RJZ A;  5FTI A;  1B5J A;  1MQH A;  3CVG A;  3S9L C;  1QUJ A;  2XXY A;  5EHM A;  3HV1 A;  4MBP A;  1SW4 A;  2Q9T A;  2NWJ A;  1MPD A;  1II5 A;  3OEM A;  1MY3 A;  1GV8 A;  4NE4 A;  1H43 A;  3OO7 A;  3MUQ A;  2I0B A;  1QKB A;  3U72 A;  4N6P A;  4X1D A;  1UTH B;  2VD2 A;  4F3P A;  1B40 A;  3T96 B;  4AQ4 A;  2ZXT A;  1ZKB A;  2GHA A;  1TXF A;  1DPP A;  1PBQ A;  3C35 A;  2Q2C A;  3MPK A;  4FAJ A;  4IO4 A;  3P7I A;  2AIX A;  1QKA A;  4HCW A;  3KSX A;  2YLN A;  1YTV A;  5H8Q B;  1BLF A;  4NF8 A;  2GRV A;  4XKQ A;  2HEU A;  2I58 A;  3JZJ A;  5F7V A;  2UVI A;  4YU0 A;  5BUU A;  2ABH A;  4O3C A;  3FAT A;  1B58 A;  1VFD A;  3RY3 A;  4BDO A;  4LUB A;  4DE8 A;  4EXK A;  1XC1 A;  2QJE A;  1B3H A;  2Y7P A;  4N13 A;  2NOO A;  3LUY A;  3MVY A;  3CSG A;  5TU0 A;  2DVC A;  4ONY A;  4OER A;  2I49 A;  5AA2 B;  1AL3 A;  1PB7 A;  4ELQ A;  3B6W A;  4H8J A;  1FTJ A;  4LA9 A;  3CG3 A;  1O64 A;  2F36 A;  3GLB A;  3TOD A;  1FTL A;  3K2D A;  2BJJ X;  1I6A A;  2H5Y A;  2THI A;  3KEI A;  4H1X A;  1OIB A;  3PU5 A;  4X9T A;  4PFW A;  2REG A;  2DE3 A;  3DP6 A;  4G2Z A;  3IOT A;  1LFI A;  4R2F A;  1N04 A;  4RK9 A;  3IOW A;  4C1T A;  3K00 A;  4OZ9 A;  3CR9 A;  1TFD A;  5H8H A;  2HCA A;  3MC2 A;  4IB2 A;  3FJ7 A;  3RTF B;  4C1U A;  1B7Z A;  2XXU A;  3VVF A;  4X1B A;  5FTH A;  1ATG A;  1POT A;  4LQ2 A;  4EDP A;  3S9E A;  1A7L A;  1UTH A;  4JWY A;  1I69 A;  2YPN A;  2Z8E A;  3SEU A;  4MLQ A;  3RNN A;  1MY0 A;  1MQD A;  2F6G A;  3DP4 A;  4OET A;  1SBP A;  3LSL A;  3Q29 A;  1MS7 A;  2QMW A;  1SI0 A;  1P1U A;  2V3U A;  2V25 A;  5F1Q A;  3TAJ A;  3K6W A;  5JK4 A;  1IXH A;  3QYT A;  3VVE A;  3V83 A;  4RYA A;  3SET A;  5A5X A;  1B3E A;  1JVY A;  2DYX A;  1FTM A;  3VXC A;  1NH8 A;  3ZS6 A;  2ZYN A;  3IB2 A;  3KN3 A;  1XHY A;  1XVY A;  4IO3 A;  2V3T A;  3GBA A;  1ZIU A;  1N76 A;  2UVG A;  2ANJ A;  3T66 A;  2HAU A;  3TFL A;  3VXB A;  1HSJ A;  4QFL A;  3S4U A;  3PPP A;  3KJT A;  2UVJ A;  5DVF A;  4OXV A;  3FXQ A;  5EYF A;  3VV5 A;  1QUL A;  4G8M A;  3TQW A;  1Y1Z A;  4GL8 A;  4DXB A;  3OSR A;  4GFR A;  2DOJ A;  5ITP A;  2UXA A;  3IX1 A;  3FUZ A;  4LON B;  2O51 A;  2F5X A;  5AA1 A;  1TFA A;  5TPA B;  3N6T A;  3MW0 A;  1BTJ A;  1PC3 A;  2DWH A;  3KOS A;  4ZDM A;  3SDF A;  4FJP A;  3T9U A;  1UIU A;  5KDT B;  1LCT A;  3O28 A;  4YKJ A;  3KN7 A;  1SW2 A;  4EQ7 A;  3I6V A;  2QS1 A;  1RYO A;  5CI5 A;  4YZZ A;  1GGG A;  2CMO A;  4POW A;  5CBS A;  1LAF E;  3G3F A;  1B7H A;  1P99 A;  4KD5 A;  1WDN A;  3IB1 A;  4PFY A;  2ONR A;  3QSL A;  3GXA A;  1MH3 A;  4ZEC A;  5DTB A;  2XX7 A;  3OMB A;  3PUY E;  4OYV A;  4P0I A;  2RCA A;  2O1M A;  2ONK E;  3ZKK A;  5HPQ A;  1HSL A;  1POY 1;  1URG A;  2ZYK A;  4LQ5 A;  3IOR A;  4U21 A;  4GRK A;  1GTK A;  4ISU A;  4ZEF A;  1B1X A;  4IGR A;  4XIG Q;  4Z7E A;  1MXZ A;  2F8D A;  3VVD A;  1IQ7 A;  1JW1 A;  3PMX A;  5I2N A;  2I4B A;  1JEU A;  4KPT A;  1ZU0 A;  3UK4 A;  3O6H A;  1ZJL A;  2ONS A;  3PUZ E;  4MFI A;  3H7M A;  4RK2 A;  1MDP 1;  1N3X A;  4DCX A;  3TZA A;  3FJG A;  3CFL A;  4NF5 B;  2V84 A;  1AOV A;  2D5W A;  2PYY A;  1OQG A;  5L9O A;  3BFU A;  3IJO B;  2Z23 A;  3FV2 A;  4U23 A;  4YKK A;  2XXI A;  3RPW A;  2F35 A;  1T0K A;  5I84 A;  1USY H;  1D4N A;  1R9Q A;  1US5 A;  2RC9 A;  4F3G A;  2M8C A;  4BDQ A;  1UTB B;  2UYF A;  3K1M A;  1LAG E;  3IO6 A;  1EZ9 A;  3UOR A;  4OMB A;  4OFL A;  4U4X A;  3TTK A;  1URD A;  4K3F A;  3OEN A;  5TPA A;  1A55 A;  3PMW A;  1FQC A;  1DSN A;  1D9Y A;  2P0S A;  4TOZ A;  2D21 A;  4KFQ A;  1QJM A;  3DEL B;  1ANF A;  3AXF A;  1MXX A;  4TQU Q;  1D3K A;  3SEV A;  3O29 A;  3TEP A;  1B1H A;  3ECR A;  3L6G A;  1B0H A;  1N0T A;  4ZZE A;  4GIZ A;  3C32 A;  4AB5 A;  1IZ1 A;  4H5G A;  1ZTY A;  1A54 A;  4GL0 A;  4EF2 A;  3K6V A;  3GBB A;  1DMB A;  3TKD A;  2Y7K A;  1DTZ A;  3MVW A;  2UVH A;  3KFM A;  3S2V A;  4FE8 A;  3HPI A;  1H45 A;  5FHM A;  3RT6 B;  4KCC A;  2R6G E;  1RYX A;  1SYI A;  1DOT A;  2XXQ A;  4TLL B;  3UN6 A;  3FXU A;  1DPE A;  3PPN A;  3RTW B;  4MF3 A;  5B7D A;  1H76 A;  4RXL A;  4IO7 A;  4ZED A;  4EUO A;  3TCH A;  5M2V A;  3DM0 A;  3V89 B;  2A5T A;  3M3L A;  3U8Q A;  1MQJ A;  4YKI A;  1VR5 A;  3Q27 A;  3BBR A;  5I57 A;  1B3L A;  2H99 A;  4H8I A;  4OVJ A;  2ESN A;  4UAC A;  4QHQ A;  3CIJ A;  4KCD A;  4NWD A;  4ND9 A;  4BDL A;  3MZ1 A;  1I6Q A;  4OEV A;  3ODB A;  2QS2 A;  4FOR A;  3O2A A;  2ZNS A;  3ILU B;  3BFT A;  1MXY A;  4JWO A;  4X48 A;  3FGS A;  3CRB A;  1H44 A;  3K01 A;  3DP8 A;  4OEU A;  2H4I A;  1UTB A;  4GXS B;  4ELR A;  4KQP A;  3C34 A;  4YMA A;  1Z7N E;  3R26 A;  1A40 A;  1JNF A;  2XD2 A;  4GD5 A;  3KOT A;  4WXJ A;  2DE2 A;  4EF1 A;  4RA1 A;  5TP9 B;  1N7X A;  3MPL A;  2PVU A;  5I2K B;  4OFJ A;  3BKI B;  2I3V A;  3OO6 A;  2E0S A;  1M5F A;  2X7P A;  4GVO A;  3IOU A;  1LFG A;  1UIV A;  1XT8 A;  2OBG A;  4G8H A;  1LST A;  5FHO A;  2G29 A;  3MVX A;  4QFN A;  1OMP A;  4NF6 B;  5KCJ B;  3RT8 A;  4QF9 A;  5HBC A;  3LSX A;  4HCY A;  1LB9 A;  3ZKL A;  3E13 X;  1F9B A;  3JV9 A;  1Q1K A;  5K2Y A;  2PX1 A;  3MZB A;  4IGT A;  3FAS A;  1IXG A;  1NL5 A;  1Y9U A;  1AIV A;  1WOD A;  4QSE A;  1P1N A;  2RF1 A;  1OLC A;  5H8S A;  1YCJ A;  3VFJ A;  5FHN A;  3K6X A;  3EF7 A;  4FAT A;  3WAE A;  3N6U A;  2XXW A;  1NNF A;  2XHD A;  1B5H A;  1FQB A;  3USD A;  1OVT A;  1NNK A;  3M3F A;  3KZG A;  3T22 A;  3SEY A;  2CZL A;  3G3G A;  4R9G A;  4R6K A;  4YB5 A;  1MG1 A;  4U22 A;  5CBR A;  4R9F A;  2FA7 A;  4R6H A;  2V3Q A;  1JQF A;  2Y84 A;  3W9V A;  2OK2 A;  2RKM A;  3TTL A;  1B4H A;  1PB9 A;  5IAI A;  3H6U A;  3LBS A;  3VLV A;  3S9M C;  2WKY A;  3H6T A;  3LSF B;  3PD9 A;  3MZ9 A;  1XS5 A;  2QSX A;  4H6D A;  4EQ9 A;  2NXO A;  4OQO A;  4EXL A;  3H03 A;  2OWS A;  3R6U A;  5DVJ A;  3UA8 A;  1Y4T A;  3FZV A;  4YKP A;  1EU8 A;  2Q89 A;  4G77 A;  3K0V A;  3O97 A;  5H8Q A;  2AL5 A;  1I6B A;  4BDN A;  3KJ7 A;  4F31 B;  3A3U A;  4MLV A;  3OD7 A;  3HHG A;  1MY2 A;  2F7B A;  2B65 A;  4NED A;  4I8C A;  3FD3 A;  4I1D A;  2D3I A;  2REJ A;  1S7Y A;  3F11 A;  3W15 C;  5CRY A;  5KCJ A;  2HAV A;  3E3K A;  1OLA A;  1R1N A;  4Q5T A;  1B9J A;  3VDF A;  2DXR A;  3O6I A;  2AL4 A;  2F34 A;  4O3B A;  5AA2 A;  4DXC A;  4M1V A;  3ZSF A;  1B3F A;  1NNT A;  3CFX A;  4PQJ A;  3RLF E;  2P1S A;  3MP1 A;  4OES A;  3MP6 A;  3MP8 A;  2OWT A;  4Q0C A;  1B05 A;  2NUV A;  1B7U A;  4DZ1 A;  1XVX A;  1IUD A;  4PP0 A;  4DCY A;  4QFO A;  1XOC A;  1MM6 A;  3D4C A;  1PBP A;  3U1O A;  2GFE A;  4LZ8 A;  1IIT A;  3EN3 A;  3FV1 A;  2G93 A;  5EHS A;  5L8D A;  4FED A;  4U2R A;  3N5L A;  1Y4C A;  1MXV A;  2F78 A;  1SQY A;  2KLF A;  1A8F A;  3TCF A;  5H8N B;  1WVJ A;  3OOA A;  4I9D A;  1JVX A;  2OJT A;  3FVN A;  2QRY A;  5AA2 D;  2I48 A;  4Q8R A;  3OO8 A;  3N26 A;  3FVO A;  4F3B A;  4KR5 A;  4N07 A;  1IXI A;  2A5S A;  1US4 A;  4YIC A;  1MQG A;  4XKR A;  3VE1 B;  4DLD A;  2HZL A;  4U1Z A;  5L9S A;  4G68 B;  2QMX A;  4QFK A;  4U4S A;  1B51 A;  1LB8 A;  1MDQ A;  1MM7 A;  2FYI A;  1MPC A;  4NTL A;  4HTG A;  3RQT A;  1R9L A;  3R7X A;  3I3V A;  4BDR A;  3IAZ A;  3ILT B;  1P1W A;  4WED A;  3PPR A;  4WKM A;  5I58 B;  2UYE A;  4ZEB A;  2DSF A;  1NKX A;  3LR1 A;  1ZLQ A;  3N94 A;  2ZNU A;  3K02 A;  3G3I A;  4IO6 A;  3VLU A;  3O6G A;  1B32 A;  1QUK A;  2XD3 A;  4NF4 B;  4ZEI A;  1N7W A;  2W7Y A;  2DP8 A;  4F2O A;  1VE4 A;  1SW1 A;  3LSW A;  1SVX B;  3UGW A;  5CMM A;  3HHF A;  4GF8 A;  3PPO A;  5I56 B;  3IOV A;  5KDT A;  3CG1 A;  1P1Q A;  2XXT A;  1FQE A;  1SW5 A;  3TTR A;  3EPE A;  5CMB A;  1FQF A;  1YPN A;  4FIM A;  4LP2 B;  4F18 A;  1B52 A;  4F1V A;  1UQW A;  4IY6 A;  5I59 B;  4P0G A;  1BP5 A;  1TWY A;  2X7Q A;  3Q25 A;  4DIG A;  3QUF A;  4GLI A;  4R2B A;  1Y1M A;  1MY1 A;  2O6A A;  3UIF A;  5CMC A;  1GVC A;  3MJN A;  2F7A A;  3B6Q A;  3TTM A;  1B46 A;  2R9J A;  4GOT A;  3C31 A;  3L6H A;  2VHA A;  3TYH A;  5AA3 A;  2QS3 A;  2B3B A;  3QXM A;  4ZZA A;  1S9T A;  4G68 A;  1NFT A;  3TPA A;  2Q2A A;  3UP9 A;  2FNC A;  3VLW A;  3WAF A;  2H9B A;  1QW0 A;  4AB6 A;  2QS4 A;  2Y7I A;  3S9N C;  4NF5 A;  5L9M A;  1SYH A;  5CC2 A;  3K1P A;  2Q8J A;  2RC7 A;  1AH5 A;  4O3A A;  1LBB A;  3U92 A;  3G3K A;  1O63 A;  2X26 A;  5JEI A;  1EZO A;  2VGQ A;  3IK6 B;  4QRZ A;  4H65 A;  3T9X B;  3MQ9 A;  1NMU A;  5H8H B;  4RPO A;  1M5D A;  3IR1 A;  1Y3Q A;  1SI1 A;  3MBP A;  3EHU A;  4NF4 A;  3E4R A;  2O69 A;  4KHZ E;  3CFZ A;  3EQ1 A;  2VOZ A;  5ELV A;  4OWD A;  3IO4 A;  2Y7R A;  4YAH X;  5ISU A;  4I62 A;  4XXU A;  5I56 A;  1S50 A;  4QSD A;  4OHN A;  5ICT A;  3K4U A;  1TT1 A;  3PUV E;  4R74 A;  3H6W A;  1KWH A;  1B4Z A;  3A3C A;  2XXP A;  2VD3 A;  2O7I A;  3U94 A;  2VP1 A;  3FJM A;  2XX8 A;  4ZS9 A;  3Q28 A;  5A5X B;  5I59 A;  4FEB A;  1PB8 A;  2R71 A;  1MY4 A;  3KGC A;  3THI A;  3PUX E;  1M5E A;  4POX A;  3M8U A;  5H8F B;  2Z8F A;  2DXY A;  1QVS A;  4GQO A;  5K2X A;  3KN8 A;  1MRP A;  1EH3 A;  5CMK A;  2IEE A;  4HS7 A;  2I6E A;  2XXH A;  4JB7 A;  3ONM A;  4YB6 A;  4G4P A;  3C9H A;  2HXW A;  4UA8 A;  1VFE A;  3TEL A;  2O1L A;  4JDF A;  3B7D A;  3HST A;  1B0L A;  4GWO A;  5AE4 A;  1USY E;  1DTG A;  4LAT A;  1Q35 A;  1ZMG A;  3QUJ A;  4RNS A;  2NVU B;  4JWX A;  3JYR A;  3O9P A;  3OEK A;  3T9V A;  1LFH A;  3G7W A;  1YAE A;  3H6V A;  2GH9 A;  2RC8 A;  2I4C A;  4ZE8 A;  3RGY A;  4PFT A;  1H3D A;  5BWJ A;  1J1N A;  3TCG A;  4OFO A;  5CM6 A;  4XTC Q;  1Y20 A;  2XXV A;  1HSE A;  2RIN A;  4C0R A;  2PMS A;  4KI0 E;  3OEL A;  4F29 A;  2IA4 A;  1P1O A;  3E9X A;  1FTK A;  1Y3N A;  1B6H A;  3T93 B;  4R75 A;  1CE2 A;  1ELJ A;  4DXU A;  2PT2 A;  2I0C A;  3RN8 A;  2H98 A;  4HW8 A;  5DEX B;  4PE5 B;  3FVK A;  4NMY A;  1JW4 A;  2DWI A;  5TP9 A;  4IO2 A;  2H25 A;  4F1Y A;  4P11 A;  5I2K A;  2ALU A;  4E0W A;  3IB0 A;  4F22 A;  5IKB A;  2F97 A;  5DVI A;  5I2N B;  1EZP A;  4WEP A;  3PUW E;  5HM4 B;  3SKP A;  1D9V A;  2QPQ A;  2QL3 A;  1RKM A;  4NF6 A;  4BLA A;  1B3G A;  1LAX A;  4YMB A;  2E1S A;  1FTO A;  4LVQ A;  3K6U A;  1M5C A;  3RUM A;  3T9H B;  1MH4 A;  2OLB A;  2Q88 A;  4LZ7 A;  4R72 A;  3CI8 A;  4Q30 B; 
#chains in the Genus database with same CATH topology
 1PDA A;  1SD3 A;  5H8F A;  2DDK A;  3C4M A;  3LC8 A;  1AMF A;  4H0W A;  1NV3 A;  1DK4 A;  4R73 A;  4R6Y A;  1FJ9 A;  1NH7 A;  4IO5 A;  1BIY A;  4RPN A;  3SER A;  3EHS A;  4ZE9 A;  2F7C A;  1LCF A;  4JSD A;  4JSO A;  2RCB A;  3Q26 A;  4OTE A;  1NNP A;  4P8B A;  3EHT A;  1CB6 A;  2HZK A;  3QK6 A;  1ZBM A;  4F3S A;  3GYY A;  2F3B A;  3TTN A;  2ZYO A;  4XKP A;  4G8N A;  1NV0 A;  5F24 A;  3QIM A;  2ZMB A;  1O7T A;  3H4Z A;  2DE4 A;  4NQ8 A;  3TQL A;  3SEW A;  1G0I A;  2P2A A;  1LLS A;  2Z8D A;  3KG2 A;  1FPI A;  2WYK A;  1JET A;  1FQD A;  5KZT A;  2ZNT A;  4HE2 A;  1OQH A;  1LGB C;  3MVZ A;  3SEX A;  4PGN A;  3V8X B;  1JEV A;  4PF6 A;  5ICQ A;  4OEN A;  3GZG A;  4KYD A;  1B2H A;  1R6Z A;  5AA4 B;  2ZYM A;  3IL1 B;  3SES A;  1MXU A;  3MAM A;  5DEX A;  3U93 A;  4MH5 A;  1A99 A;  3C36 A;  4U1O A;  2P3N A;  3QAX A;  2LAO A;  2V93 A;  4PC9 A;  1NV1 A;  4NWC A;  1A8E A;  3FXR A;  1LBC A;  2CEY A;  5J16 A;  3OO9 A;  3B6T A;  2PBW A;  4FEC A;  2F6P A;  4HE0 A;  5JTY B;  2A5T B;  1IEJ A;  3O66 A;  5J1D A;  1MQI A;  3HN0 A;  4DDD A;  4EQB A;  3H3G A;  1N84 A;  1MPB A;  1PEB A;  1BKA A;  4G68 C;  5I57 B;  3MST A;  4JXI A;  2DQV A;  4PFU A;  4GWX A;  3W9W A;  4F2Q A;  2HFB A;  3A09 A;  5ITO A;  1GR2 A;  2PT1 A;  4N91 A;  3B8B A;  2O7U A;  3K1N A;  3KBR A;  3OXN A;  2FIX A;  3PPQ A;  3T1B A;  3HCQ A;  3PD8 A;  4MCO A;  2O84 X;  5ET5 A;  3BIG A;  1N3W A;  4JBZ A;  4ZEK A;  3BIH A;  5I5P A;  1CNQ A;  2Y5L A;  3IJX B;  3HO7 A;  3I5O A;  4H5F A;  1FCK A;  1OVB A;  4F1U A;  2Y7W A;  1IIW A;  1LBY A;  4ELO A;  2VT5 A;  4ELP A;  4HXV A;  1JW5 A;  1FW0 A;  1FQA A;  3M3K A;  4TLM B;  2O68 A;  2XX9 A;  3OSQ A;  3TUS A;  4M4G A;  4NF8 B;  4KYS A;  4RY1 A;  3TMG A;  3G3J A;  3PMV A;  1B5I A;  1FRP A;  1L5T A;  2Z22 A;  4ESW A;  2OZZ A;  2I3W A;  4P3L A;  4N81 A;  3MWB A;  4LZ5 A;  3TDJ A;  1MXW A;  2XXK A;  5H8N A;  2CZH A;  4ECF A;  3V5A A;  4ESX A;  3CSB A;  3FIR A;  2AYS A;  3G3H A;  2WBD A;  4L17 A;  1M5B A;  4IY5 A;  5DT6 A;  1Z7M E;  3H06 B;  2B3F A;  4THI A;  1FPD A;  1YZ0 A;  5AA4 A;  4PBQ A;  4XKN A;  3KSJ A;  2YJP A;  2DWJ A;  2F3D A;  1Y3P A;  4IR8 A;  5B70 A;  5LOM A;  2HQ0 A;  3DLN A;  1SDX A;  4KYE A;  2OCU A;  5DYH A;  1VSO A;  4X8R A;  2XXR A;  2DS9 A;  4Z0I A;  4QFP A;  4F39 A;  2DWA A;  4QSC A;  1FPL A;  4PET A;  1QUI A;  2DVZ A;  1NV2 A;  4GXA A;  5JTY A;  3E79 A;  4AS4 A;  3PGF A;  5ESY A;  3D4G A;  2GHB A;  3E78 A;  4F19 A;  4BDM A;  2XXX A;  1IXC A;  4H67 A;  3C33 A;  3PV0 E;  4E0X A;  1URS A;  3NOH A;  4YB7 A;  3FVG A;  5I58 A;  1LAH E;  4RJZ A;  5FTI A;  1B5J A;  1MQH A;  3CVG A;  3S9L C;  1QUJ A;  2XXY A;  5EHM A;  3HV1 A;  4MBP A;  1SW4 A;  1EYJ A;  2Q9T A;  2NWJ A;  1MPD A;  1II5 A;  3OEM A;  1MY3 A;  1GV8 A;  4NE4 A;  1H43 A;  3OO7 A;  4NG7 A;  4MEV A;  3MUQ A;  3ROJ A;  2I0B A;  1QKB A;  3U72 A;  4N6P A;  4X1D A;  1UTH B;  2VD2 A;  4F3P A;  1B40 A;  3T96 B;  2XWI A;  4AQ4 A;  2ZXT A;  1ZKB A;  4GX4 A;  2GHA A;  4MIJ A;  1TXF A;  4N8G A;  1DPP A;  1PBQ A;  3C35 A;  2Q2C A;  3MPK A;  1FBG A;  4FAJ A;  4IO4 A;  3P7I A;  2AIX A;  1QKA A;  4HCW A;  3KSX A;  2YLN A;  1YTV A;  5H8Q B;  4NAP A;  1BLF A;  2Y5K A;  4NF8 A;  2GRV A;  1FPG A;  4PGP A;  4XKQ A;  5IGA A;  2HEU A;  1FPJ A;  1KA0 A;  2I58 A;  3JZJ A;  5F7V A;  2UVI A;  4YU0 A;  5BUU A;  4O3C A;  2ABH A;  3FAT A;  1B58 A;  1VFD A;  3RY3 A;  4BDO A;  4LUB A;  3KC1 A;  2V4C A;  4DE8 A;  1AWB A;  4EXK A;  2FBP A;  1XC1 A;  3KC0 A;  2QJE A;  1B3H A;  2Y7P A;  4N13 A;  2NOO A;  3LUY A;  3MVY A;  3CSG A;  2WX9 A;  5TU0 A;  2DVC A;  4JVI A;  4ONY A;  1NUZ A;  4OER A;  2I49 A;  5AA2 B;  1AL3 A;  1PB7 A;  4ELQ A;  3B6W A;  4H8J A;  1FBC A;  1FTJ A;  4LA9 A;  3CG3 A;  1O64 A;  4O94 A;  2F36 A;  3GLB A;  1IMB A;  3TOD A;  1FTL A;  3K2D A;  2BJJ X;  1I6A A;  2H5Y A;  2THI A;  1IMD A;  3KEI A;  4H1X A;  1OIB A;  3PU5 A;  2HHM A;  4I3Y A;  4X9T A;  4PFW A;  1IMC A;  5EQ9 A;  5I7I A;  1NUW A;  2REG A;  2DE3 A;  3DP6 A;  4G2Z A;  3IOT A;  1LFI A;  4R2F A;  1N04 A;  4RK9 A;  3IOW A;  4C1T A;  4HE1 A;  3K00 A;  3IFC A;  4GBW A;  4OZ9 A;  3CR9 A;  1TFD A;  5H8H A;  2HCA A;  3MC2 A;  2ZZV A;  4IB2 A;  3FJ7 A;  3RTF B;  4C1U A;  1B7Z A;  1LBV A;  2XXU A;  3VVF A;  4X1B A;  5FTH A;  1ATG A;  1POT A;  4LQ2 A;  4GWW A;  4EDP A;  3S9E A;  1A7L A;  1UTH A;  4JWY A;  1I69 A;  2YPN A;  2Z8E A;  3QMF A;  4MLQ A;  3SEU A;  3RNN A;  1MY0 A;  1MQD A;  2F6G A;  3DP4 A;  4OET A;  1SBP A;  3LSL A;  3Q29 A;  1MS7 A;  2QMW A;  1SI0 A;  1QGX A;  1P1U A;  2V3U A;  2V25 A;  5F1Q A;  3TAJ A;  3K6W A;  5JK4 A;  1IXH A;  3QYT A;  3VVE A;  3V83 A;  4RYA A;  3SET A;  5A5X A;  1B3E A;  1JVY A;  2DYX A;  1FTM A;  3VXC A;  1NH8 A;  1YYZ A;  3ZS6 A;  2ZYN A;  3IB2 A;  3KN3 A;  1XHY A;  1XVY A;  4IO3 A;  2V3T A;  3GBA A;  1NV4 A;  1ZIU A;  1FJ6 A;  1N76 A;  2UVG A;  2ANJ A;  2XWV A;  3T66 A;  2HAU A;  3TFL A;  3VXB A;  4PAI A;  1HSJ A;  4QFL A;  3S4U A;  2OWZ A;  3PPP A;  3KJT A;  4H45 A;  2UVJ A;  5DVF A;  4OXV A;  3FXQ A;  5EYF A;  3VV5 A;  1QUL A;  4G8M A;  3TQW A;  1Y1Z A;  1K9Z A;  4GL8 A;  4PFI A;  4DXB A;  3OSR A;  4GFR A;  2DOJ A;  5ITP A;  2UXA A;  4MNP A;  3IX1 A;  3FUZ A;  4LON B;  2O51 A;  2F5X A;  3EKI A;  5AA1 A;  1TFA A;  4PDD A;  5TPA B;  1KZ8 A;  3N6T A;  3MW0 A;  1BTJ A;  1PC3 A;  2DWH A;  3KOS A;  4ZDM A;  3SDF A;  4FJP A;  3T9U A;  1UIU A;  3FBP A;  5KDT B;  1LCT A;  3RYD A;  3O28 A;  1FBF A;  1FPE A;  5A5L A;  4YKJ A;  3KN7 A;  1SW2 A;  4EQ7 A;  3I6V A;  2QS1 A;  1RYO A;  5CI5 A;  4YZZ A;  1GGG A;  2CMO A;  1YXI A;  4POW A;  5CBS A;  1LAF E;  2KR0 A;  3G3F A;  1B7H A;  1P99 A;  4KD5 A;  1WDN A;  3IB1 A;  4PFY A;  2ONR A;  3QSL A;  3GXA A;  1MH3 A;  4ZEC A;  4OA4 A;  5DTB A;  1SPI A;  2XX7 A;  3OMB A;  3PUY E;  4OYV A;  4P0I A;  2RCA A;  2O1M A;  2ONK E;  3ZKK A;  3SZP A;  5HPQ A;  1HSL A;  1POY 1;  1URG A;  2ZYK A;  4LQ5 A;  3IOR A;  4U21 A;  4GRK A;  1GTK A;  4ISU A;  4ZEF A;  1B1X A;  4IGR A;  4XIG Q;  4Z7E A;  1MXZ A;  2F8D A;  3VVD A;  1IQ7 A;  1JW1 A;  3PMX A;  5I2N A;  2I4B A;  1JEU A;  4KPT A;  1ZU0 A;  3UK4 A;  4NGU A;  1G0H A;  3O6H A;  1ZJL A;  2ONS A;  3PUZ E;  3RPL A;  2GQ1 A;  4MFI A;  1LBZ A;  3H7M A;  4RK2 A;  1MDP 1;  1N3X A;  4DCX A;  3TZA A;  3FJG A;  4PAK A;  3CFL A;  1RDX A;  4NF5 B;  2V84 A;  1AOV A;  2D5W A;  2PYY A;  1OQG A;  5L9O A;  4JVD A;  3BFU A;  3IJO B;  2Z23 A;  3FV2 A;  4U23 A;  4YKK A;  2XXI A;  3RPW A;  2F35 A;  1T0K A;  5I84 A;  1USY H;  1D4N A;  1R9Q A;  1US5 A;  2RC9 A;  4F3G A;  1NV7 A;  2M8C A;  4BDQ A;  1UTB B;  2UYF A;  3K1M A;  1LAG E;  3IO6 A;  4UAB A;  1EZ9 A;  3UOR A;  4OMB A;  4OFL A;  4U4X A;  3TTK A;  4NF0 A;  1URD A;  4K3F A;  3OEN A;  5TPA A;  4OAN A;  1A55 A;  3PMW A;  1FQC A;  1DSN A;  1D9Y A;  2VPO A;  4GBV A;  2P0S A;  4TOZ A;  2D21 A;  3B50 A;  4KFQ A;  1QJM A;  3DEL B;  4GX6 A;  1ANF A;  3AXF A;  1MXX A;  4OVP A;  2CZK A;  4TQU Q;  1D3K A;  3SEV A;  3O29 A;  3TEP A;  4PFR A;  1B1H A;  3ECR A;  3L6G A;  1B0H A;  1N0T A;  4ZZE A;  4P9K A;  2KQZ A;  4GIZ A;  3C32 A;  4AB5 A;  1IZ1 A;  4H5G A;  4MNI A;  4P56 A;  3HFU A;  1ZTY A;  1A54 A;  4GL0 A;  4EF2 A;  3K6V A;  2ZZX A;  3GBB A;  1DMB A;  3TKD A;  4OVT A;  2Y7K A;  1DTZ A;  3MVW A;  2UVH A;  3KFM A;  4PFB A;  3S2V A;  2QVU A;  4FE8 A;  3HPI A;  1H45 A;  4GWZ A;  5FHM A;  3RT6 B;  4KCC A;  2R6G E;  1RYX A;  4H46 A;  1SYI A;  1DOT A;  2XXQ A;  4TLL B;  3UN6 A;  3FXU A;  1DPE A;  3PTY A;  3PPN A;  3RTW B;  4MF3 A;  5B7D A;  5ET6 A;  1H76 A;  4RXL A;  4IO7 A;  4ZED A;  4EUO A;  3TCH A;  5M2V A;  3DM0 A;  3V89 B;  2A5T A;  3M3L A;  3U8Q A;  1MQJ A;  4YKI A;  1VR5 A;  3Q27 A;  4DI4 B;  3BBR A;  5I57 A;  1B3L A;  2H99 A;  4H8I A;  4LN5 A;  4OVJ A;  2ESN A;  4UAC A;  4QHQ A;  3CIJ A;  4KCD A;  4NWD A;  4ND9 A;  4BDL A;  3MZ1 A;  1I6Q A;  4OEV A;  3ODB A;  2QS2 A;  4FOR A;  3O2A A;  2ZNS A;  3ILU B;  3BFT A;  1MXY A;  4JWO A;  4X48 A;  2L5V A;  3FGS A;  3CRB A;  1H44 A;  3K01 A;  3DP8 A;  4OEU A;  2H4I A;  1UTB A;  4GXS B;  4ELR A;  4KQP A;  3C34 A;  4YMA A;  1Z7N E;  3R26 A;  1A40 A;  1JNF A;  2XD2 A;  2ZZW A;  4OVQ A;  4XFE A;  4GD5 A;  3KOT A;  4WXJ A;  2DE2 A;  4EF1 A;  1NV6 A;  4O8M A;  4RA1 A;  5TP9 B;  1N7X A;  3MPL A;  2PVU A;  5I2K B;  4OFJ A;  3BKI B;  3CHG A;  2I3V A;  3OO6 A;  2E0S A;  4NHB A;  1M5F A;  2X7P A;  4GVO A;  3IOU A;  5EQA A;  1LFG A;  1UIV A;  1XT8 A;  2OBG A;  4G8H A;  1LST A;  5FHO A;  2FIE A;  2G29 A;  3MVX A;  4QFN A;  2CEX A;  2CZI A;  1OMP A;  4NF6 B;  5KCJ B;  3RT8 A;  4X04 A;  4QF9 A;  5HBC A;  3LSX A;  4HCY A;  1LB9 A;  1LBX A;  3ZKL A;  5EQ7 A;  3E13 X;  1F9B A;  3JV9 A;  1Q1K A;  5K2Y A;  2PX1 A;  3MZB A;  4IGT A;  3FAS A;  1IXG A;  1NL5 A;  1RDY A;  1Y9U A;  1AIV A;  1WOD A;  4JVC A;  4QSE A;  1P1N A;  2RF1 A;  2WYP A;  1OLC A;  5H8S A;  1EYK A;  1YCJ A;  3VFJ A;  1D9Q A;  1NV5 A;  4MHF A;  5FHN A;  4DI3 D;  4N15 A;  3K6X A;  3EF7 A;  4FAT A;  3WAE A;  1EYI A;  3N6U A;  2XXW A;  1NNF A;  2XHD A;  1B5H A;  1FQB A;  3USD A;  1OVT A;  1NNK A;  3M3F A;  3KZG A;  3T22 A;  2VPN A;  1IMA A;  3SEY A;  2CZL A;  3G3G A;  4R9G A;  4R6K A;  4YB5 A;  1MG1 A;  4U22 A;  5CBR A;  4R9F A;  4PF8 A;  2FA7 A;  4R6H A;  2V3Q A;  1JQF A;  2Y84 A;  3W9V A;  2OK2 A;  2RKM A;  3TTL A;  1B4H A;  2WBB A;  1PB9 A;  5IAI A;  3H6U A;  3LBS A;  3VLV A;  3S9M C;  2WKY A;  3H6T A;  2XWK A;  3LSF B;  3PD9 A;  2WEF A;  3MZ9 A;  1XS5 A;  2QSX A;  4H6D A;  4N4U A;  3D1R A;  4EQ9 A;  2NXO A;  4OQO A;  4EXL A;  3H03 A;  2OWS A;  3R6U A;  2PFY A;  5DVJ A;  3UA8 A;  5I3S A;  1Y4T A;  3FZV A;  4YKP A;  1EU8 A;  3U65 A;  2Q89 A;  4G77 A;  3K0V A;  3O97 A;  5IZ1 A;  5H8Q A;  2AL5 A;  1IMF A;  1I6B A;  4BDN A;  3KJ7 A;  3MYU A;  5T3J A;  4F31 B;  3A3U A;  2Q74 A;  4MLV A;  3OD7 A;  3HHG A;  2QFL A;  1NI9 A;  1MY2 A;  1VDW A;  2F7B A;  2B65 A;  4NED A;  4I8C A;  3FD3 A;  4I1D A;  2D3I A;  2REJ A;  1S7Y A;  3F11 A;  3W15 C;  5CRY A;  5KCJ A;  2B4M A;  2HAV A;  3E3K A;  1OLA A;  1R1N A;  4Q5T A;  1B9J A;  2BJI A;  1FPF A;  3VDF A;  2DXR A;  3O6I A;  3T0J A;  2XWO A;  2AL4 A;  2F34 A;  4O3B A;  5AA2 A;  4DXC A;  4M1V A;  3ZSF A;  5EYG A;  1RDZ A;  1B3F A;  1NNT A;  3CFX A;  4PQJ A;  3RLF E;  2P1S A;  3MP1 A;  1DCU A;  4OES A;  4I40 A;  3MP6 A;  3ISP A;  3LV0 A;  3MP8 A;  2OWT A;  4Q0C A;  3A29 A;  5LTC A;  1B05 A;  2NUV A;  1B7U A;  4DZ1 A;  1XVX A;  1IUD A;  4PP0 A;  4DCY A;  4QFO A;  1XOC A;  1MM6 A;  3D4C A;  1PBP A;  3U1O A;  2GFE A;  4P47 A;  4LZ8 A;  1IIT A;  3EN3 A;  3FV1 A;  2G93 A;  5EHS A;  5L8D A;  4FED A;  4U2R A;  4KXP A;  3N5L A;  1Y4C A;  1MXV A;  2F78 A;  1SQY A;  2KLF A;  1A8F A;  3TCF A;  5H8N B;  4QXD A;  1WVJ A;  3OOA A;  4I9D A;  1JVX A;  2OJT A;  3FVN A;  2QRY A;  5AA2 D;  2I48 A;  4N17 A;  4Q8R A;  3OO8 A;  1FPB A;  3N26 A;  3FVO A;  4F3B A;  4KR5 A;  5LDZ A;  4N07 A;  1IXI A;  2A5S A;  1US4 A;  4YIC A;  1MQG A;  4XKR A;  3VE1 B;  4DLD A;  1XI6 A;  2HZL A;  4U1Z A;  5L9S A;  4G68 B;  2QMX A;  4QFK A;  4U4S A;  5ET7 A;  1B51 A;  1LB8 A;  1MDQ A;  1MM7 A;  4OVR A;  2FYI A;  1MPC A;  4NTL A;  4HTG A;  1FBH A;  2PCR A;  3RQT A;  1R9L A;  3R7X A;  3I3V A;  4BDR A;  3IAZ A;  3ILT B;  1P1W A;  4WED A;  5IM2 A;  4GWS A;  1FPK A;  3PPR A;  4N8Y A;  4WKM A;  1BK4 A;  5I58 B;  2UYE A;  4ZEB A;  4MX6 A;  2DSF A;  1NKX A;  4OVS A;  2P3V A;  3LR1 A;  1ZLQ A;  3N94 A;  2ZNU A;  3K02 A;  3G3I A;  1FTA A;  4G61 A;  4IO6 A;  3VLU A;  3O6G A;  1B32 A;  1QUK A;  4XF5 A;  2XD3 A;  4NF4 B;  4ZEI A;  1N7W A;  2W7Y A;  4QBA A;  2DP8 A;  4O7M A;  4F2O A;  1VE4 A;  1SW1 A;  3LSW A;  1SVX B;  3UGW A;  4PBH A;  5CMM A;  5EYH A;  3HHF A;  5FBP A;  4O7I A;  4GF8 A;  4PAF A;  3PPO A;  5I56 B;  3IOV A;  5KDT A;  3CG1 A;  1P1Q A;  2XXT A;  1FQE A;  1K9Y A;  1SW5 A;  3TTR A;  2XA5 A;  4GWY A;  3EPE A;  5CMB A;  1FQF A;  1YPN A;  1DBZ A;  4FIM A;  4LP2 B;  4F18 A;  1B52 A;  4FBP A;  4F1V A;  1UQW A;  4IY6 A;  5I59 B;  4P0G A;  1BP5 A;  1TWY A;  2X7Q A;  3Q25 A;  4DIG A;  3QUF A;  4GLI A;  4R2B A;  4PE3 A;  3FXB A;  1Y1M A;  1MY1 A;  2O6A A;  2QVV A;  1INP A;  3UIF A;  5CMC A;  1GVC A;  3MJN A;  2F7A A;  1Q9D A;  3B6Q A;  1LBW A;  3TTM A;  1B46 A;  2R9J A;  4GOT A;  4NN3 A;  4XEQ A;  3C31 A;  3L6H A;  2VHA A;  3TYH A;  4PDH A;  5AA3 A;  4NX1 A;  2QS3 A;  2B3B A;  3QXM A;  4ZZA A;  2OX3 A;  1S9T A;  4G68 A;  1NFT A;  3TPA A;  2Q2A A;  3UP9 A;  4MNC A;  2FNC A;  3VLW A;  3WAF A;  2H9B A;  1FBD A;  1QW0 A;  4AB6 A;  2QS4 A;  2Y7I A;  3S9N C;  4NF5 A;  5L9M A;  4GWU A;  1SYH A;  5CC2 A;  3K1P A;  2Q8J A;  2RC7 A;  1AH5 A;  4O3A A;  1NUX A;  1LBB A;  3LUZ A;  2PFZ A;  3U92 A;  3G3K A;  1O63 A;  2X26 A;  5JEI A;  2R8T A;  1EZO A;  2VGQ A;  3IK6 B;  4QRZ A;  4H65 A;  3T9X B;  3MQ9 A;  1NMU A;  5H8H B;  4RPO A;  1M5D A;  3IR1 A;  4PTK A;  1LEV A;  1Y3Q A;  1SI1 A;  3MBP A;  3EHU A;  4NF4 A;  3E4R A;  5DW8 A;  2O69 A;  4KHZ E;  3CFZ A;  4MAG A;  3EQ1 A;  2VOZ A;  5ELV A;  5IZ3 B;  4P1E A;  4OWD A;  3IO4 A;  2Y7R A;  4YAH X;  5ISU A;  4I62 A;  4XXU A;  5I56 A;  1S50 A;  4QSD A;  4OHN A;  5ICT A;  2HPG A;  2JJK A;  3K4U A;  1TT1 A;  3PUV E;  4R74 A;  3H6W A;  1KWH A;  4I3E A;  1B4Z A;  3A3C A;  2XXP A;  2VD3 A;  2O7I A;  3U94 A;  2VP1 A;  4AS5 A;  3FJM A;  2XX8 A;  4ZS9 A;  3Q28 A;  5A5X B;  5I59 A;  4FEB A;  1PB8 A;  2MKZ A;  2R71 A;  1MY4 A;  3KGC A;  3KBZ A;  3THI A;  3PUX E;  1M5E A;  4POX A;  3M8U A;  5H8F B;  2Z8F A;  2DXY A;  1QVS A;  5EQ8 A;  4GQO A;  4N6D A;  5K2X A;  3KN8 A;  1MRP A;  1EH3 A;  5CMK A;  2IEE A;  2QVR A;  4HS7 A;  2I6E A;  2XXH A;  4JB7 A;  3ONM A;  2FVZ A;  4YB6 A;  4G4P A;  3C9H A;  2HXW A;  4UA8 A;  1VFE A;  3TEL A;  2Q8M A;  2O1L A;  4JDF A;  3B7D A;  3HST A;  1B0L A;  4GWO A;  5AE4 A;  1USY E;  1DTG A;  4LAT A;  1KA1 A;  1Q35 A;  1ZMG A;  3QUJ A;  4RNS A;  2NVU B;  4JWX A;  3JYR A;  1IME A;  3O9P A;  2HXR A;  3OEK A;  3T9V A;  1LFH A;  3G7W A;  1YAE A;  3H6V A;  4MJO A;  2GH9 A;  2RC8 A;  4PCD A;  2I4C A;  4ZE8 A;  3RGY A;  4PFT A;  1H3D A;  5BWJ A;  1J1N A;  4MMP A;  3TCG A;  4OFO A;  5CM6 A;  4XTC Q;  1Y20 A;  2XXV A;  1HSE A;  2RIN A;  4C0R A;  2PMS A;  4KI0 E;  3OEL A;  4F29 A;  1FSA A;  2IA4 A;  1P1O A;  3E9X A;  1FTK A;  1Y3N A;  1B6H A;  3T93 B;  4R75 A;  1CE2 A;  1ELJ A;  2FHY A;  4DXU A;  4GX3 A;  2PT2 A;  2I0C A;  2B4L A;  3RN8 A;  5IZZ A;  2H98 A;  4HW8 A;  5DEX B;  4PE5 B;  5IZ3 A;  3FVK A;  4NMY A;  1JW4 A;  2DWI A;  5TP9 A;  4IO2 A;  2H25 A;  4F1Y A;  4P11 A;  5I2K A;  1FBE A;  2ALU A;  4E0W A;  1FBP A;  1JP4 A;  3IFA A;  3IB0 A;  4F22 A;  5IKB A;  2F97 A;  5DVI A;  5I2N B;  1EZP A;  4WEP A;  1NUY A;  3PUW E;  5HM4 B;  3SKP A;  1D9V A;  2QPQ A;  4P1L A;  3RPL B;  2QL3 A;  1RKM A;  4NF6 A;  4BLA A;  1B3G A;  1LAX A;  4YMB A;  2E1S A;  1FTO A;  4LVQ A;  3K6U A;  1M5C A;  3RUM A;  3T9H B;  4N6K A;  1MH4 A;  2OLB A;  2Q88 A;  4LZ7 A;  4R72 A;  3CI8 A;  4Q30 B;  5ET8 A; 
#chains in the Genus database with same CATH homology
 1PDA A;  1SD3 A;  5H8F A;  3C4M A;  3LC8 A;  1AMF A;  4H0W A;  4R73 A;  4R6Y A;  1NH7 A;  4IO5 A;  1BIY A;  4RPN A;  3SER A;  3EHS A;  4ZE9 A;  2F7C A;  1LCF A;  4JSD A;  4JSO A;  2RCB A;  3Q26 A;  4OTE A;  1NNP A;  3EHT A;  1CB6 A;  2HZK A;  3QK6 A;  1ZBM A;  4F3S A;  3TTN A;  2ZYO A;  4XKP A;  4G8N A;  3QIM A;  2ZMB A;  1O7T A;  3H4Z A;  2DE4 A;  3TQL A;  3SEW A;  2P2A A;  1LLS A;  2Z8D A;  3KG2 A;  5KZT A;  1JET A;  1FQD A;  2ZNT A;  1OQH A;  1LGB C;  3MVZ A;  3SEX A;  3V8X B;  1JEV A;  5ICQ A;  4OEN A;  3GZG A;  4KYD A;  1B2H A;  1R6Z A;  5AA4 B;  2ZYM A;  3IL1 B;  3SES A;  1MXU A;  3MAM A;  5DEX A;  3U93 A;  4MH5 A;  1A99 A;  3C36 A;  4U1O A;  3QAX A;  2LAO A;  2V93 A;  4NWC A;  1A8E A;  3FXR A;  1LBC A;  3OO9 A;  3B6T A;  2PBW A;  4FEC A;  2F6P A;  5JTY B;  2A5T B;  1IEJ A;  3O66 A;  5J1D A;  1MQI A;  3HN0 A;  4DDD A;  4EQB A;  3H3G A;  1N84 A;  1MPB A;  1PEB A;  1BKA A;  4G68 C;  5I57 B;  4JXI A;  2DQV A;  4PFU A;  3W9W A;  4F2Q A;  2HFB A;  3A09 A;  5ITO A;  1GR2 A;  2PT1 A;  2O7U A;  3K1N A;  3KBR A;  3OXN A;  3PPQ A;  3HCQ A;  3PD8 A;  2O84 X;  1N3W A;  4JBZ A;  4ZEK A;  3IJX B;  3HO7 A;  3I5O A;  4H5F A;  1FCK A;  1OVB A;  4F1U A;  2Y7W A;  1IIW A;  4ELO A;  4ELP A;  1JW5 A;  1FW0 A;  1FQA A;  3M3K A;  4TLM B;  2O68 A;  2XX9 A;  3OSQ A;  3TUS A;  4M4G A;  4NF8 B;  4KYS A;  4RY1 A;  3TMG A;  3G3J A;  3PMV A;  1B5I A;  1L5T A;  2Z22 A;  4ESW A;  2OZZ A;  2I3W A;  3MWB A;  4LZ5 A;  3TDJ A;  1MXW A;  5H8N A;  4ECF A;  3V5A A;  4ESX A;  3CSB A;  3FIR A;  2AYS A;  3G3H A;  4L17 A;  1M5B A;  4IY5 A;  5DT6 A;  1Z7M E;  3H06 B;  2B3F A;  4THI A;  5AA4 A;  4XKN A;  3KSJ A;  2YJP A;  2DWJ A;  1Y3P A;  5B70 A;  5LOM A;  2HQ0 A;  3DLN A;  1SDX A;  4KYE A;  2OCU A;  5DYH A;  1VSO A;  2XXR A;  2DS9 A;  4Z0I A;  4QFP A;  4F39 A;  2DWA A;  4QSC A;  4PET A;  1QUI A;  2DVZ A;  4GXA A;  5JTY A;  3PGF A;  3D4G A;  2GHB A;  4F19 A;  4BDM A;  2XXX A;  1IXC A;  4H67 A;  3C33 A;  3PV0 E;  4E0X A;  1URS A;  4YB7 A;  3FVG A;  5I58 A;  1LAH E;  4RJZ A;  5FTI A;  1B5J A;  1MQH A;  3CVG A;  3S9L C;  1QUJ A;  2XXY A;  5EHM A;  3HV1 A;  4MBP A;  1SW4 A;  2Q9T A;  2NWJ A;  1MPD A;  1II5 A;  3OEM A;  1MY3 A;  1GV8 A;  4NE4 A;  1H43 A;  3OO7 A;  3MUQ A;  2I0B A;  1QKB A;  3U72 A;  4N6P A;  4X1D A;  1UTH B;  2VD2 A;  4F3P A;  1B40 A;  3T96 B;  4AQ4 A;  2ZXT A;  1ZKB A;  2GHA A;  1TXF A;  1DPP A;  1PBQ A;  3C35 A;  2Q2C A;  3MPK A;  4FAJ A;  4IO4 A;  3P7I A;  2AIX A;  1QKA A;  4HCW A;  3KSX A;  2YLN A;  1YTV A;  5H8Q B;  1BLF A;  4NF8 A;  2GRV A;  4XKQ A;  2HEU A;  2I58 A;  3JZJ A;  5F7V A;  2UVI A;  4YU0 A;  5BUU A;  2ABH A;  4O3C A;  3FAT A;  1B58 A;  1VFD A;  3RY3 A;  4BDO A;  4LUB A;  4DE8 A;  4EXK A;  1XC1 A;  2QJE A;  1B3H A;  2Y7P A;  4N13 A;  2NOO A;  3LUY A;  3MVY A;  3CSG A;  5TU0 A;  2DVC A;  4ONY A;  4OER A;  2I49 A;  5AA2 B;  1AL3 A;  1PB7 A;  4ELQ A;  3B6W A;  4H8J A;  1FTJ A;  4LA9 A;  3CG3 A;  1O64 A;  2F36 A;  3GLB A;  3TOD A;  1FTL A;  3K2D A;  2BJJ X;  1I6A A;  2H5Y A;  2THI A;  3KEI A;  4H1X A;  1OIB A;  3PU5 A;  4X9T A;  4PFW A;  2REG A;  2DE3 A;  3DP6 A;  4G2Z A;  3IOT A;  1LFI A;  4R2F A;  1N04 A;  4RK9 A;  3IOW A;  4C1T A;  3K00 A;  4OZ9 A;  3CR9 A;  1TFD A;  5H8H A;  2HCA A;  3MC2 A;  4IB2 A;  3FJ7 A;  3RTF B;  4C1U A;  1B7Z A;  2XXU A;  3VVF A;  4X1B A;  5FTH A;  1ATG A;  1POT A;  4LQ2 A;  4EDP A;  3S9E A;  1A7L A;  1UTH A;  4JWY A;  1I69 A;  2YPN A;  2Z8E A;  3SEU A;  4MLQ A;  3RNN A;  1MY0 A;  1MQD A;  2F6G A;  3DP4 A;  4OET A;  1SBP A;  3LSL A;  3Q29 A;  1MS7 A;  2QMW A;  1SI0 A;  1P1U A;  2V3U A;  2V25 A;  5F1Q A;  3TAJ A;  3K6W A;  5JK4 A;  1IXH A;  3QYT A;  3VVE A;  3V83 A;  4RYA A;  3SET A;  5A5X A;  1B3E A;  1JVY A;  2DYX A;  1FTM A;  3VXC A;  1NH8 A;  3ZS6 A;  2ZYN A;  3IB2 A;  3KN3 A;  1XHY A;  1XVY A;  4IO3 A;  2V3T A;  3GBA A;  1ZIU A;  1N76 A;  2UVG A;  2ANJ A;  3T66 A;  2HAU A;  3TFL A;  3VXB A;  1HSJ A;  4QFL A;  3S4U A;  3PPP A;  3KJT A;  2UVJ A;  5DVF A;  4OXV A;  3FXQ A;  5EYF A;  3VV5 A;  1QUL A;  4G8M A;  3TQW A;  1Y1Z A;  4GL8 A;  4DXB A;  3OSR A;  4GFR A;  2DOJ A;  5ITP A;  2UXA A;  3IX1 A;  3FUZ A;  4LON B;  2O51 A;  2F5X A;  5AA1 A;  1TFA A;  5TPA B;  3N6T A;  3MW0 A;  1BTJ A;  1PC3 A;  2DWH A;  3KOS A;  4ZDM A;  3SDF A;  4FJP A;  3T9U A;  1UIU A;  5KDT B;  1LCT A;  3O28 A;  4YKJ A;  3KN7 A;  1SW2 A;  4EQ7 A;  3I6V A;  2QS1 A;  1RYO A;  5CI5 A;  4YZZ A;  1GGG A;  2CMO A;  4POW A;  5CBS A;  1LAF E;  3G3F A;  1B7H A;  1P99 A;  4KD5 A;  1WDN A;  3IB1 A;  4PFY A;  2ONR A;  3QSL A;  3GXA A;  1MH3 A;  4ZEC A;  5DTB A;  2XX7 A;  3OMB A;  3PUY E;  4OYV A;  4P0I A;  2RCA A;  2O1M A;  2ONK E;  3ZKK A;  5HPQ A;  1HSL A;  1POY 1;  1URG A;  2ZYK A;  4LQ5 A;  3IOR A;  4U21 A;  4GRK A;  1GTK A;  4ISU A;  4ZEF A;  1B1X A;  4IGR A;  4XIG Q;  4Z7E A;  1MXZ A;  2F8D A;  3VVD A;  1IQ7 A;  1JW1 A;  3PMX A;  5I2N A;  2I4B A;  1JEU A;  4KPT A;  1ZU0 A;  3UK4 A;  3O6H A;  1ZJL A;  2ONS A;  3PUZ E;  4MFI A;  3H7M A;  4RK2 A;  1MDP 1;  1N3X A;  4DCX A;  3TZA A;  3FJG A;  3CFL A;  4NF5 B;  2V84 A;  1AOV A;  2D5W A;  2PYY A;  1OQG A;  5L9O A;  3BFU A;  3IJO B;  2Z23 A;  3FV2 A;  4U23 A;  4YKK A;  2XXI A;  3RPW A;  2F35 A;  1T0K A;  5I84 A;  1USY H;  1D4N A;  1R9Q A;  1US5 A;  2RC9 A;  4F3G A;  2M8C A;  4BDQ A;  1UTB B;  2UYF A;  3K1M A;  1LAG E;  3IO6 A;  1EZ9 A;  3UOR A;  4OMB A;  4OFL A;  4U4X A;  3TTK A;  1URD A;  4K3F A;  3OEN A;  5TPA A;  1A55 A;  3PMW A;  1FQC A;  1DSN A;  1D9Y A;  2P0S A;  4TOZ A;  2D21 A;  4KFQ A;  1QJM A;  3DEL B;  1ANF A;  3AXF A;  1MXX A;  4TQU Q;  1D3K A;  3SEV A;  3O29 A;  3TEP A;  1B1H A;  3ECR A;  3L6G A;  1B0H A;  1N0T A;  4ZZE A;  4GIZ A;  3C32 A;  4AB5 A;  1IZ1 A;  4H5G A;  1ZTY A;  1A54 A;  4GL0 A;  4EF2 A;  3K6V A;  3GBB A;  1DMB A;  3TKD A;  2Y7K A;  1DTZ A;  3MVW A;  2UVH A;  3KFM A;  3S2V A;  4FE8 A;  3HPI A;  1H45 A;  5FHM A;  3RT6 B;  4KCC A;  2R6G E;  1RYX A;  1SYI A;  1DOT A;  2XXQ A;  4TLL B;  3UN6 A;  3FXU A;  1DPE A;  3PPN A;  3RTW B;  4MF3 A;  5B7D A;  1H76 A;  4RXL A;  4IO7 A;  4ZED A;  4EUO A;  3TCH A;  5M2V A;  3DM0 A;  3V89 B;  2A5T A;  3M3L A;  3U8Q A;  1MQJ A;  4YKI A;  1VR5 A;  3Q27 A;  3BBR A;  5I57 A;  1B3L A;  2H99 A;  4H8I A;  4OVJ A;  2ESN A;  4UAC A;  4QHQ A;  3CIJ A;  4KCD A;  4NWD A;  4ND9 A;  4BDL A;  3MZ1 A;  1I6Q A;  4OEV A;  3ODB A;  2QS2 A;  4FOR A;  3O2A A;  2ZNS A;  3ILU B;  3BFT A;  1MXY A;  4JWO A;  4X48 A;  3FGS A;  3CRB A;  1H44 A;  3K01 A;  3DP8 A;  4OEU A;  2H4I A;  1UTB A;  4GXS B;  4ELR A;  4KQP A;  3C34 A;  4YMA A;  1Z7N E;  3R26 A;  1A40 A;  1JNF A;  2XD2 A;  4GD5 A;  3KOT A;  4WXJ A;  2DE2 A;  4EF1 A;  4RA1 A;  5TP9 B;  1N7X A;  3MPL A;  2PVU A;  5I2K B;  4OFJ A;  3BKI B;  2I3V A;  3OO6 A;  2E0S A;  1M5F A;  2X7P A;  4GVO A;  3IOU A;  1LFG A;  1UIV A;  1XT8 A;  2OBG A;  4G8H A;  1LST A;  5FHO A;  2G29 A;  3MVX A;  4QFN A;  1OMP A;  4NF6 B;  5KCJ B;  3RT8 A;  4QF9 A;  5HBC A;  3LSX A;  4HCY A;  1LB9 A;  3ZKL A;  3E13 X;  1F9B A;  3JV9 A;  1Q1K A;  5K2Y A;  2PX1 A;  3MZB A;  4IGT A;  3FAS A;  1IXG A;  1NL5 A;  1Y9U A;  1AIV A;  1WOD A;  4QSE A;  1P1N A;  2RF1 A;  1OLC A;  5H8S A;  1YCJ A;  3VFJ A;  5FHN A;  3K6X A;  3EF7 A;  4FAT A;  3WAE A;  3N6U A;  2XXW A;  1NNF A;  2XHD A;  1B5H A;  1FQB A;  3USD A;  1OVT A;  1NNK A;  3M3F A;  3KZG A;  3T22 A;  3SEY A;  2CZL A;  3G3G A;  4R9G A;  4R6K A;  4YB5 A;  1MG1 A;  4U22 A;  5CBR A;  4R9F A;  2FA7 A;  4R6H A;  2V3Q A;  1JQF A;  2Y84 A;  3W9V A;  2OK2 A;  2RKM A;  3TTL A;  1B4H A;  1PB9 A;  5IAI A;  3H6U A;  3LBS A;  3VLV A;  3S9M C;  2WKY A;  3H6T A;  3LSF B;  3PD9 A;  3MZ9 A;  1XS5 A;  2QSX A;  4H6D A;  4EQ9 A;  2NXO A;  4OQO A;  4EXL A;  3H03 A;  2OWS A;  3R6U A;  5DVJ A;  3UA8 A;  1Y4T A;  3FZV A;  4YKP A;  1EU8 A;  2Q89 A;  4G77 A;  3K0V A;  3O97 A;  5H8Q A;  2AL5 A;  1I6B A;  4BDN A;  3KJ7 A;  4F31 B;  3A3U A;  4MLV A;  3OD7 A;  3HHG A;  1MY2 A;  2F7B A;  2B65 A;  4NED A;  4I8C A;  3FD3 A;  4I1D A;  2D3I A;  2REJ A;  1S7Y A;  3F11 A;  3W15 C;  5CRY A;  5KCJ A;  2HAV A;  3E3K A;  1OLA A;  1R1N A;  4Q5T A;  1B9J A;  3VDF A;  2DXR A;  3O6I A;  2AL4 A;  2F34 A;  4O3B A;  5AA2 A;  4DXC A;  4M1V A;  3ZSF A;  1B3F A;  1NNT A;  3CFX A;  4PQJ A;  3RLF E;  2P1S A;  3MP1 A;  4OES A;  3MP6 A;  3MP8 A;  2OWT A;  4Q0C A;  1B05 A;  2NUV A;  1B7U A;  4DZ1 A;  1XVX A;  1IUD A;  4PP0 A;  4DCY A;  4QFO A;  1XOC A;  1MM6 A;  3D4C A;  1PBP A;  3U1O A;  2GFE A;  4LZ8 A;  1IIT A;  3EN3 A;  3FV1 A;  2G93 A;  5EHS A;  5L8D A;  4FED A;  4U2R A;  3N5L A;  1Y4C A;  1MXV A;  2F78 A;  1SQY A;  2KLF A;  1A8F A;  3TCF A;  5H8N B;  1WVJ A;  3OOA A;  4I9D A;  1JVX A;  2OJT A;  3FVN A;  2QRY A;  5AA2 D;  2I48 A;  4Q8R A;  3OO8 A;  3N26 A;  3FVO A;  4F3B A;  4KR5 A;  4N07 A;  1IXI A;  2A5S A;  1US4 A;  4YIC A;  1MQG A;  4XKR A;  3VE1 B;  4DLD A;  2HZL A;  4U1Z A;  5L9S A;  4G68 B;  2QMX A;  4QFK A;  4U4S A;  1B51 A;  1LB8 A;  1MDQ A;  1MM7 A;  2FYI A;  1MPC A;  4NTL A;  4HTG A;  3RQT A;  1R9L A;  3R7X A;  3I3V A;  4BDR A;  3IAZ A;  3ILT B;  1P1W A;  4WED A;  3PPR A;  4WKM A;  5I58 B;  2UYE A;  4ZEB A;  2DSF A;  1NKX A;  3LR1 A;  1ZLQ A;  3N94 A;  2ZNU A;  3K02 A;  3G3I A;  4IO6 A;  3VLU A;  3O6G A;  1B32 A;  1QUK A;  2XD3 A;  4NF4 B;  4ZEI A;  1N7W A;  2W7Y A;  2DP8 A;  4F2O A;  1VE4 A;  1SW1 A;  3LSW A;  1SVX B;  3UGW A;  5CMM A;  3HHF A;  4GF8 A;  3PPO A;  5I56 B;  3IOV A;  5KDT A;  3CG1 A;  1P1Q A;  2XXT A;  1FQE A;  1SW5 A;  3TTR A;  3EPE A;  5CMB A;  1FQF A;  1YPN A;  4FIM A;  4LP2 B;  4F18 A;  1B52 A;  4F1V A;  1UQW A;  4IY6 A;  5I59 B;  4P0G A;  1BP5 A;  1TWY A;  2X7Q A;  3Q25 A;  4DIG A;  3QUF A;  4GLI A;  4R2B A;  1Y1M A;  1MY1 A;  2O6A A;  3UIF A;  5CMC A;  1GVC A;  3MJN A;  2F7A A;  3B6Q A;  3TTM A;  1B46 A;  2R9J A;  4GOT A;  3C31 A;  3L6H A;  2VHA A;  3TYH A;  5AA3 A;  2QS3 A;  2B3B A;  3QXM A;  4ZZA A;  1S9T A;  4G68 A;  1NFT A;  3TPA A;  2Q2A A;  3UP9 A;  2FNC A;  3VLW A;  3WAF A;  2H9B A;  1QW0 A;  4AB6 A;  2QS4 A;  2Y7I A;  3S9N C;  4NF5 A;  5L9M A;  1SYH A;  5CC2 A;  3K1P A;  2Q8J A;  2RC7 A;  1AH5 A;  4O3A A;  1LBB A;  3U92 A;  3G3K A;  1O63 A;  2X26 A;  5JEI A;  1EZO A;  2VGQ A;  3IK6 B;  4QRZ A;  4H65 A;  3T9X B;  3MQ9 A;  1NMU A;  5H8H B;  4RPO A;  1M5D A;  3IR1 A;  1Y3Q A;  1SI1 A;  3MBP A;  3EHU A;  4NF4 A;  3E4R A;  2O69 A;  4KHZ E;  3CFZ A;  3EQ1 A;  2VOZ A;  5ELV A;  4OWD A;  3IO4 A;  2Y7R A;  4YAH X;  5ISU A;  4I62 A;  4XXU A;  5I56 A;  1S50 A;  4QSD A;  4OHN A;  5ICT A;  3K4U A;  1TT1 A;  3PUV E;  4R74 A;  3H6W A;  1KWH A;  1B4Z A;  3A3C A;  2XXP A;  2VD3 A;  2O7I A;  3U94 A;  2VP1 A;  3FJM A;  2XX8 A;  4ZS9 A;  3Q28 A;  5A5X B;  5I59 A;  4FEB A;  1PB8 A;  2R71 A;  1MY4 A;  3KGC A;  3THI A;  3PUX E;  1M5E A;  4POX A;  3M8U A;  5H8F B;  2Z8F A;  2DXY A;  1QVS A;  4GQO A;  5K2X A;  3KN8 A;  1MRP A;  1EH3 A;  5CMK A;  2IEE A;  4HS7 A;  2I6E A;  2XXH A;  4JB7 A;  3ONM A;  4YB6 A;  4G4P A;  3C9H A;  2HXW A;  4UA8 A;  1VFE A;  3TEL A;  2O1L A;  4JDF A;  3B7D A;  3HST A;  1B0L A;  4GWO A;  5AE4 A;  1USY E;  1DTG A;  4LAT A;  1Q35 A;  1ZMG A;  3QUJ A;  4RNS A;  2NVU B;  4JWX A;  3JYR A;  3O9P A;  3OEK A;  3T9V A;  1LFH A;  3G7W A;  1YAE A;  3H6V A;  2GH9 A;  2RC8 A;  2I4C A;  4ZE8 A;  3RGY A;  4PFT A;  1H3D A;  5BWJ A;  1J1N A;  3TCG A;  4OFO A;  5CM6 A;  4XTC Q;  1Y20 A;  2XXV A;  1HSE A;  2RIN A;  4C0R A;  2PMS A;  4KI0 E;  3OEL A;  4F29 A;  2IA4 A;  1P1O A;  3E9X A;  1FTK A;  1Y3N A;  1B6H A;  3T93 B;  4R75 A;  1CE2 A;  1ELJ A;  4DXU A;  2PT2 A;  2I0C A;  3RN8 A;  2H98 A;  4HW8 A;  5DEX B;  4PE5 B;  3FVK A;  4NMY A;  1JW4 A;  2DWI A;  5TP9 A;  4IO2 A;  2H25 A;  4F1Y A;  4P11 A;  5I2K A;  2ALU A;  4E0W A;  3IB0 A;  4F22 A;  5IKB A;  2F97 A;  5DVI A;  5I2N B;  1EZP A;  4WEP A;  3PUW E;  5HM4 B;  3SKP A;  1D9V A;  2QPQ A;  2QL3 A;  1RKM A;  4NF6 A;  4BLA A;  1B3G A;  1LAX A;  4YMB A;  2E1S A;  1FTO A;  4LVQ A;  3K6U A;  1M5C A;  3RUM A;  3T9H B;  1MH4 A;  2OLB A;  2Q88 A;  4LZ7 A;  4R72 A;  3CI8 A;  4Q30 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...