3ZKKA

Structure of the xylo-oligosaccharide specific solute binding protein from bifidobacterium animalis subsp. lactis bl-04 in complex with xylotetraose
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
396
structure length
396
Chain Sequence
DDKTITFWHNASAGEGRQYWENLAKSFEEANPGTKVEIQAIQNEDFAGKLQTAMQDPASGPDVFMSLGGAKTKEMIDAGQVMDLTDKISDTVKTDMKTTLSAATFDGKVYGVPVSVEPGGMWYSKDLFKKAGVSDVPATYEELLADAKKLKDSGTDAIALGAKDAWPAAHWYYWLVLRECSPEVYDKSVQDHDFSNACWVNAGKKLQELKDLKVFNDGFLTTTAQQGANSSAGLLANHKAAMELMGAWEPGVLKDLTPDQKPMADLGFFAFPEVAGGEGEPGALMGGVTYFCVNPKASQTSIDFVNYMGEKKNQEDYAKAFSTIPASEPARAVVTDESLKQVIEYLDKAPSMQLWMDTALGTNIGNALNAAVVNMLSGQGSPEDIVKAMQDAAQKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Arabinoxylo-Oligosaccharide Capture by the Probiotic Bifidobacterium Animalis Subsp. Lactis Bl-04
pubmed doi rcsb
source organism Bifidobacterium animalis subsp. lactis bl-04
molecule tags Transport protein
molecule keywords XOS BINDING PROTEIN
total genus 140
structure length 396
sequence length 396
ec nomenclature
pdb deposition date 2013-01-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3zkkA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3zkkA02
3MUQA 4H8JA 1SBPA 2ZYMA 3M3KA 1MXZA 3K6UA 2RINA 2HXWA 1QW0A 1VFEA 4OFLA 1SDXA 4R6KA 1B5JA 3IJXB 3FXRA 1JEVA 4OFOA 4TOZA 3EHTA 1OIBA 1Y3NA 2VHAA 1MQHA 4ELQA 1R9LA 4OXVA 4XKRA 1XHYA 1VE4A 4G68C 2ZYOA 4N6PA 3C9HA 1OVBA 1OLAA 2X7PA 4LZ8A 2F5XA 2RC9A 3PU5A 4IO6A 4H5FA 4WKMA 5AA2A 3TQLA 3PMWA 4FIMA 4Q5TA 3K1PA 4R73A 1XC1A 3I5OA 4GQOA 4EDPA 3KG2A 4R6HA 1MY0A 1UTBB 3T9VA 4H1XA 4R9GA 3CSGA 1MQGA 2FYIA 4DXUA 4KQPA 4PFUA 3KEIA 3P7IA 3LC8A 4PE5B 4RPNA 1TXFA 3FZVA 4XIGQ 1LB9A 2XXTA 3TEPA 4QHQA 3C33A 4G77A 1GR2A 5L9OA 3G3IA 1TT1A 1ANFA 3VLVA 4F2OA 1VFDA 5CRYA 2O69A 4ZECA 5KDTB 4YMBA 1FCKA 5ISUA 3GZGA 4OEVA 3N6TA 3FVOA 2AL5A 1FQCA 3TMGA 1UTBA 3HN0A 1Y3QA 4G68B 3SEUA 1PEBA 2OZZA 1MQIA 4KCDA 2AL4A 4R9FA 3AXFA 4HW8A 1P99A 1UIUA 3B6WA 3CFZA 1B52A 4LZ7A 3FGSA 5CI5A 3LSFB 2NVUB 4Q8RA 5I2NB 2XX9A 2DVCA 2NWJA 1NMUA 1JETA 2F7AA 3OO9A 3C34A 1N3XA 4MLQA 4PFTA 4LUBA 1GVCA 4I1DA 1USYH 3OSQA 3IB2A 3K00A 4IO5A 3U92A 4DCYA 5BUUA 3V8XB 5BWJA 4GFRA 2RCBA 1BP5A 1MY1A 3S9NC 3C36A 4YKKA 3OELA 2RCAA 3Q26A 3C35A 1YPNA 2Q9TA 4H65A 2NXOA 4BDNA 1Y1MA 3K4UA 3O28A 5I2NA 3UGWA 1PB9A 4ZZAA 1NKXA 2Y84A 1Q35A 1JEUA 2V3UA 5KDTA 1MDQA 1MXXA 3RTWB 3MVYA 1DTGA 4JWYA 1B3HA 2KLFA 4NF8A 2HQ0A 3FV2A 1D9VA 2ONKE 1AH5A 1FQAA 1S9TA 4C1UA 4EXKA 3B7DA 1FQBA 3DELB 1JVXA 2HZKA 1IXGA 2ONRA 4HCWA 4OQOA 1ATGA 3ECRA 4H5GA 3ZKLA 5DTBA 3S9EA 3SERA 5AE4A 1DTZA 4GRKA 3IAZA 1L5TA 5HPQA 1FTOA 1POY1 3Q25A 1N0TA 4G4PA 3FV1A 1BIYA 4DLDA 3QAXA 2GHAA 3O97A 5I2KB 4ELPA 4EQ9A 1POTA 4U21A 3LSWA 3U72A 2HZLA 2D3IA 5AA4B 3IOWA 3O66A 2O1MA 4X48A 1S7YA 4XKNA 5LOMA 4F2QA 4LVQA 3OSRA 3HCQA 1RKMA 5EHSA 3EQ1A 1Q1KA 4MH5A 4X1DA 4GWOA 2BJJX 1S50A 3VVFA 2HFBA 1JW4A 3E9XA 4GL0A 4P0GA 5H8HA 1CE2A 5IKBA 3JV9A 2Y7RA 3E3KA 2X7QA 3KSJA 4G2ZA 4DXBA 4ZDMA 5H8FB 1XVYA 4QFLA 2OBGA 1SYHA 1DPPA 1M5BA 1RYXA 1EH3A 2UVJA 4IGRA 1GGGA 1MH3A 2Y7KA 5DEXA 5F1QA 3TELA 2F8DA 4RPOA 5DT6A 1MPBA 1D9YA 1FTKA 3K01A 2QMWA 2QPQA 4QSDA 4EQBA 2D5WA 1OVTA 4R72A 4R6YA 1XT8A 2XD3A 3ILUB 4LONB 2W7YA 4FAJA 4GVOA 3CRBA 4IO4A 3MBPA 5A5XA 4U1OA 2GRVA 4F29A 1ZLQA 2A5SA 2XXXA 3FVNA 4R2BA 2XX7A 2IA4A 3OO6A 3Q27A 1LBCA 1FW0A 3I6VA 4KYSA 2XXQA 2ZMBA 4FECA 4JDFA 4H0WA 3RTFB 2H4IA 3TCFA 4Z7EA 5L9MA 3GXAA 1GTKA 1MQDA 4G8MA 3KSXA 2ANJA 3SESA 4MFIA 3UORA 4ISUA 3MPLA 2PYYA 1MXWA 3BBRA 3HSTA 3TTRA 3TTKA 2GFEA 5AA2B 2I4BA 5AA2D 1QULA 3GBBA 4L17A 1ZKBA 2I49A 3H6UA 1MY3A 4NTLA 1B0HA 1Y4CA 3LSXA 2DE3A 3MC2A 4RXLA 4EUOA 4H6DA 4BDMA 2A5TB 4AQ4A 5B7DA 1UTHB 3MP8A 4N07A 3RT6B 3DP4A 4F3PA 1MM6A 1HSEA 3H03A 5I59A 3KJTA 2X26A 5TPAB 4OYVA 1FTMA 2Q2CA 3R6UA 2ZNTA 1MXUA 3C4MA 3ODBA 3IB1A 3VLUA 3D4GA 4LP2B 4KYEA 4ONYA 1N84A 3HPIA 1IUDA 1OMPA 1B3EA 1JQFA 2YLNA 3E4RA 1ZU0A 3H06B 4P11A 1H3DA 2OJTA 1LB8A 5A5XB 3HHGA 5ICQA 3IK6B 3QIMA 2XHDA 1RYOA 1H43A 2XD2A 3BKIB 4NF8B 1NL5A 3B6TA 4E0XA 4GD5A 1PDAA 1B7UA 3VVEA 3G3KA 3PMXA 4KI0E 2HAVA 3PD9A 4JXIA 4YICA 4F3GA 3QUFA 1B3GA 2O7UA 1P1OA 2ESNA 4TQUQ 3D4CA 1IITA 1N3WA 4QSEA 4LA9A 1P1WA 5F7VA 4BDOA 4BLAA 5ITPA 4F3SA 2NOOA 2QJEA 3IO6A 4ELRA 1MH4A 3EPEA 1O63A 2DOJA 1NFTA 4LZ5A 4F1VA 1B7ZA 2V84A 2DWJA 3GLBA 3IOTA 3WAEA 4ESWA 3S9MC 2GH9A 1FQEA 4FORA 3LR1A 3MVWA 3I3VA 4RK9A 3U8QA 1EZOA 1B6HA 3SEXA 1I6BA 3LSLA 1URDA 2FA7A 4C1TA 1UQWA 4TLLB 5H8NB 3TODA 1LCTA 3FASA 1IXIA 4LQ5A 1NH7A 4FE8A 3KN8A 3IOVA 5DEXB 3SEWA 5CMKA 4OMBA 1CB6A 2RC7A 4KFQA 3L6HA 2REGA 4NWDA 3MJNA 3PUZE 2Z8FA 4FATA 1WVJA 1SW5A 3H6TA 3PUWE 4DE8A 3QXMA 1LLSA 4F18A 1MY4A 5I58A 1LFGA 1LAFE 3MAMA 4R75A 1MDP1 2H25A 2XXRA 2DWIA 3UA8A 2UVIA 1NNPA 1SYIA 2P0SA 1LAHE 3EN3A 1LBBA 4IO7A 1B7HA 3IX1A 4OWDA 3U1OA 1EU8A 1AOVA 3EHUA 4U23A 1H45A 4F22A 4OVJA 1LFIA 4IGTA 2O68A 1LAGE 1I6AA 3G3GA 3N5LA 4EXLA 3THIA 2DWHA 3RGYA 1DPEA 1B40A 2ZNUA 1AMFA 4K3FA 3S2VA 1N04A 4YZZA 1J1NA 1QUJA 2B3FA 3IO4A 4M4GA 3ILTB 3K6WA 2WKYA 5TP9B 4GXSB 2F78A 3OD7A 3IORA 3PD8A 5CMBA 1B3FA 2V3TA 5I56B 1M5EA 1DMBA 5CC2A 3FVKA 5L8DA 4DZ1A 1FTLA 1LFHA 3IOUA 3RY3A 3N6UA 5HM4B 4ZEIA 3U93A 4RJZA 3K2DA 1PBPA 3QK6A 3G3JA 4FJPA 1VSOA 4RA1A 1B1XA 5TPAA 2DXYA 3O6HA 4F39A 5IAIA 1MS7A 2G29A 4AB6A 2Z22A 4U4SA 5I59B 3T22A 3DLNA 3H7MA 4EQ7A 2Q8JA 2I4CA 3OEMA 3KJ7A 3TCGA 4QFOA 3OEKA 3G3FA 4JSDA 4PQJA 3KGCA 4EF1A 1B1HA 2ZYNA 5FHOA 1XVXA 3TFLA 2UVGA 3N94A 4PFWA 3TUSA 3RPWA 1MY2A 3KN7A 3KOTA 3TAJA 4GF8A 2QS4A 4X1BA 1Z7ME 4QSCA 3U94A 1B3LA 1N7WA 1SQYA 3T96B 1US5A 2FNCA 3K0VA 4R74A 2UYFA 1SW1A 2HAUA 4ZEFA 2F97A 4GXAA 4WEPA 2DWAA 5JTYA 3TQWA 1B46A 3MP1A 4P0IA 2I6EA 1P1UA 2VGQA 3KBRA 4ND9A 3S9LC 2F6PA 2F36A 2PBWA 4I9DA 2QRYA 1F9BA 1P1NA 2ALUA 2V3QA 4POWA 5B70A 5I57A 1IXHA 1R6ZA 3FJGA 2REJA 4JBZA 3OO7A 1Z7NE 4Q30B 4YU0A 1H44A 3F11A 3FVGA 2I0CA 4NF4B 1SI0A 4FEBA 3VVDA 1P1QA 4AB5A 2XXYA 2THIA 4OEUA 1PB7A 3CG1A 2XXUA 2DSFA 3OMBA 2Y7PA 1MM7A 4OZ9A 1M5FA 3O6IA 1EZ9A 3V83A 1B05A 1ZTYA 4YB5A 1QUIA 4IY5A 2ONSA 5H8QA 1NNFA 1USYE 3O2AA 1MRPA 2XX8A 1B58A 4GOTA 3MZBA 3PPOA 5CMMA 3FXUA 2PMSA 3HO7A 3C31A 4ZE9A 2OWSA 1M5DA 1OQGA 1A8EA 1TFDA 2XXPA 2LAOA 4QFPA 4XKQA 3KZGA 3OXNA 2DQVA 1I69A 2H9BA 1JW5A 5H8HB 4RK2A 5DYHA 3DP8A 4F31B 1DSNA 3TCHA 1Y1ZA 4PFYA 3FATA 4FEDA 2D21A 1WODA 2V93A 2H99A 2F6GA 4ZE8A 3V89B 1KWHA 3VLWA 2R6GE 5I57B 5M2VA 1ZIUA 2O51A 3FJ7A 3DM0A 3VDFA 3G7WA 4OETA 4ECFA 1YAEA 3RQTA 2XXVA 1N76A 1JVYA 3RUMA 4XXUA 5AA4A 3MZ1A 1FTJA 1MPCA 1O7TA 2CZLA 3JYRA 4JB7A 1BTJA 4ZS9A 4JWOA 5AA1A 4C0RA 3CSBA 1PC3A 4Z0IA 2Q88A 2IEEA 1BKAA 2QL3A 1QJMA 3K1MA 3TTNA 5K2YA 3Q28A 3IB0A 4QRZA 4BDQA 4ESXA 1XS5A 3MP6A 3VV5A 3EHSA 2DP8A 3T9XB 4YKPA 3GBAA 1MPDA 3QSLA 4JSOA 3W9WA 3RN8A 3A3UA 1B51A 1DOTA 1SW4A 1Y4TA 5I58B 3SDFA 1YTVA 3TKDA 3RT8A 1YCJA 4F3BA 3SKPA 1Y3PA 2R9JA 4KPTA 3USDA 5ICTA 1II5A 5CM6A 4I8CA 4XKPA 1B2HA 1ZJLA 2CMOA 2I0BA 2O7IA 2DE4A 2OK2A 2P2AA 2V25A 3FUZA 3VXCA 3ZKKA 1MXVA 3TYHA 5ELVA 5H8NA 3MWBA 1IQ7A 1PBQA 3H3GA 5DVIA 1Y20A 2UYEA 1B4ZA 3RNNA 4IO2A 3E13X 1QVSA 4YKIA 4NF4A 2QS3A 4G8HA 3UK4A 5TP9A 5CBSA 3PPQA 1QKAA 5FTIA 3KOSA 3FXQA 3WAFA 4U4XA 4OENA 3UN6A 4G8NA 1Y9UA 1IIWA 4F1UA 1VR5A 5EHMA 5CMCA 3MQ9A 5JTYB 1EZPA 4WXJA 1B5IA 4O3CA 4ZZEA 2F7BA 3V5AA 2GHBA 2E0SA 4KHZE 1JNFA 3O6GA 2VD2A 3TTMA 4GIZA 3SEYA 4KYDA 4N13A 3L6GA 3VXBA 1URSA 3MZ9A 1LGBC 1LSTA 2B65A 3MVZA 3O9PA 3W9VA 3OO8A 2DS9A 2Y7WA 1MG1A 2YPNA 3KN3A 4NWCA 4NF6A 4R2FA 3T66A 2NUVA 3PUVE 2HEUA 4NE4A 4POXA 3KFMA 5EYFA 4JWXA 3K02A 3T93B 4DXCA 1IZ1A 1B5HA 5DVFA 3UIFA 3M8UA 3K6XA 5KZTA 4WEDA 1A99A 1XOCA 4RYAA 1HSJA 2DE2A 3DP6A 4H67A 4ZEBA 3TDJA 4YMAA 2PT1A 2RKMA 2UVHA 2QS1A 3CI8A 2R71A 3PUYE 5FTHA 1UTHA 3PMVA 1SD3A 1WDNA 3HV1A 3JZJA 2AIXA 3MW0A 2OCUA 1ZMGA 2E1SA 2Q2AA 2RC8A 3PUXE 4HS7A 5ITOA 3T9HB 5H8FA 5JK4A 1TFAA 1ELJA 4XTCQ 4ZEKA 2H98A 1B4HA 4UA8A 2DXRA 2O6AA 1R1NA 3VE1B 3N26A 5J1DA 2Y7IA 1A54A 3MVXA 2B3BA 3R26A 1FQFA 4GL8A 3TPAA 2OLBA 4KD5A 4DIGA 1JW1A 1B0LA 2ZXTA 4OFJA 3A09A 4PETA 5I56A 3OENA 3R7XA 2VP1A 2HCAA 3IJOB 5TU0A 1H76A 4M1VA 4NEDA 4NF5B 4E0WA 4OERA 5I2KA 4G68A 2PVUA 3H6VA 3LUYA 2H5YA 5KCJB 1AL3A 1SVXB 2RF1A 2XXWA 3C32A 3HHFA 4NF5A 4YKJA 5K2XA 3VFJA 2Z8EA 1M5CA 1QUKA 5HBCA 3S4UA 4ZEDA 1D3KA 4LATA 4YAHX 5FHNA 3RLFE 2UXAA 1OQHA 3MPKA 4QF9A 4THIA 5FHMA 2O84X 1MQJA 2ZYKA 3H4ZA 4EF2A 1IEJA 1HSLA 2I3WA 2P1SA 1SW2A 4LQ2A 2I58A 5JEIA 1A7LA 2ABHA 3IR1A 3K6VA 2AYSA 3FD3A 3IL1B 4O3BA 4YB7A 4F1YA 1NNTA 3ONMA 3BFTA 5DVJA 2Z23A 1I6QA 3H6WA 2F7CA 2A5TA 2ZNSA 4RY1A 1IXCA 2QMXA 3FJMA 2G93A 3CFLA 1B9JA 2VOZA 3PGFA 3T9UA 1FQDA 3LBSA 3PPRA 4QFNA 4TLMB 3W15C 4NF6B 1B32A 2VD3A 4MLVA 4NMYA 4O3AA 4RNSA 3M3LA 5L9SA 1URGA 4IB2A 2DYXA 3PPNA 4ELOA 4GLIA 3SETA 2F35A 2XXIA 3A3CA 3CR9A 3PV0E 4Q0CA 4UACA 3TTLA 2O1LA 1LAXA 3CIJA 1US4A 4I62A 3B6QA 3FIRA 3SEVA 1AIVA 1ZBMA 3Q29A 2PT2A 4IO3A 2YJPA 1A8FA 2DVZA 1A40A 2Q89A 3CG3A 4QFKA 4X9TA 4U1ZA 2OWTA 4KR5A 2QS2A 3TZAA 2I3VA 4BDLA 3CFXA 4PP0A 2PX1A 4HTGA 1BLFA 3CVGA 1A55A 2I48A 3EF7A 1TWYA 1QKBA 4MF3A 4OESA 2QSXA 4BDRA 5I84A 4H8IA 2XXHA 1NH8A 1OLCA 3BFUA 4KCCA 4OTEA 4DDDA 3ZS6A 5CBRA 4IY6A 3OOAA 1UIVA 3QUJA 2Z8DA 1MXYA 3QYTA 1N7XA 1SI1A 3K1NA 3M3FA 2M8CA 4HCYA 4MBPA 4OHNA 4U2RA 1PB8A 3UP9A 5H8SA 1O64A 3ZSFA 1T0KA 4DCXA 5KCJA 1D4NA 1GV8A 3O29A 1LCFA 1R9QA 3PPPA 3G3HA 5H8QB 4YB6A 4F19A 1NNKA 2F34A 5AA3A 4U22A
chains in the Genus database with same CATH superfamily
3M3KA 3K6UA 4OFLA 1SDXA 4R6KA 4TOZA 4PDHA 4G68C 5AA2A 3PU5A 4IO6A 1XC1A 1UTBB 4DXUA 3LC8A 5IM2A 4PE5B 3TEPA 2XXTA 4N6DA 4QHQA 1TT1A 1ANFA 5KDTB 1NUXA 3N6TA 3FVOA 3TMGA 2HHMA 4KCDA 3AXFA 3CFZA 5I2NB 1FSAA 2NVUB 2DVCA 1NMUA 3OO9A 4PFTA 4MLQA 4I1DA 3OSQA 3K00A 4GFRA 1BP5A 4N91A 2NXOA 3CHGA 4BDNA 1Y1MA 3UGWA 1FPJA 1FPGA 4ZZAA 2GQ1A 1NKXA 4OVPA 1Q35A 1MXXA 2KLFA 2ONKE 1FQAA 1FQBA 2HZKA 4UABA 4OQOA 1NV5A 3ECRA 3ZKLA 5DTBA 3SERA 4H45A 5HPQA 1L5TA 1FTOA 1RDZA 1BIYA 4PTKA 5I2KB 4ELPA 4U21A 4XKNA 4GWOA 1JW4A 4GL0A 5H8HA 3E3KA 3KSJA 4ZDMA 1SYHA 1DPPA 1RYXA 2CZIA 1EH3A 2UVJA 5DEXA 2Y7KA 4PAIA 2F8DA 1OVTA 4FAJA 3CRBA 3FVNA 4R2BA 1FW0A 3I6VA 2JJKA 4Z7EA 4JDFA 4MMPA 1RDXA 1VDWA 4ISUA 3TTRA 3HSTA 2GFEA 1MY3A 4RXLA 5IZ3B 4H6DA 5DW8A 4BDMA 4AQ4A 1UTHB 3MP8A 2X26A 4I3EA 1INPA 1FTMA 3IB1A 4KYEA 4MNPA 1ZU0A 3IK6B 4I3YA 2HXRA 1H43A 3MYUA 4GD5A 2XWIA 3PD9A 4BDOA 1IITA 4O94A 4MHFA 3WAEA 3IOTA 4ESWA 2GH9A 1EZOA 4FORA 4RK9A 1I6BA 2FA7A 4N8YA 2KR0A 1FPBA 3IOVA 3MJNA 2Z8FA 3H6TA 3KC1A 3PUWE 4P1LA 5I58A 4R75A 3E79A 1MDP1 2H25A 2XXRA 2P0SA 3EN3A 1LAHE 3IX1A 3EHUA 4F22A 2O68A 3THIA 2DWHA 2ZNUA 4YZZA 1J1NA 1QUJA 2B3FA 2OX3A 3ILTB 5TP9B 2WKYA 3PD8A 3IORA 1B3FA 1M5EA 5CC2A 3FVKA 1JP4A 1LFHA 3IOUA 4ZEIA 3G3JA 4FJPA 1B1XA 3OEMA 4GWXA 3OEKA 4PQJA 1YYZA 4HE0A 2UVGA 3N94A 4PF8A 4QSCA 1SQYA 2HAUA 4I9DA 1P1NA 2V3QA 5I57A 5EQ9A 1R6ZA 3FJGA 4JBZA 3T9UA 3TTKA 1H44A 4NF4B 1SI0A 3KC0A 4OEUA 2DSFA 1MM7A 1M5FA 3V83A 4KXPA 2ONSA 3W9WA 3PPOA 5CMMA 3FXUA 1FRPA 1OQGA 3RGYA 2XXPA 3KZGA 1IMAA 3DP8A 4F31B 3TCHA 1Y1ZA 1WODA 2D21A 3V89B 1KWHA 1ZIUA 4ECFA 4MIJA 2XXVA 4XXUA 3BIGA 4JVDA 1MPCA 1O7TA 4JB7A 4C0RA 4JWOA 1PC3A 2ZZXA 2IEEA 1BKAA 4GBVA 3IB0A 4QRZA 4YKPA 4JSOA 3TKDA 3RT8A 4PGPA 5ICTA 5CM6A 4XKPA 2CMOA 2V25A 2I0BA 3IFCA 4NF0A 4YKIA 2QS3A 4G8HA 4U4XA 5CMCA 3MQ9A 4WXJA 2GHBA 4KHZE 1JNFA 3VXBA 1URSA 2B65A 3MVZA 4MAGA 4R2FA 5EYFA 4WEDA 1XOCA 2DE2A 2UVHA 2R71A 3PUYE 5FTHA 1UTHA 3HV1A 4HS7A 3PUXE 1TFAA 4ZEKA 3VE1B 2QVVA 1FQFA 2OLBA 4PETA 2XA5A 5ET8A 4NN3A 3R7XA 5TU0A 2HCAA 3GYYA 3C32A 3HHFA 3S4UA 4ZEDA 4YAHX 3MPKA 4QF9A 1LBYA 4LQ2A 3K6VA 4O3BA 2AYSA 2WEFA 4F1YA 1NNTA 5DVJA 3H6WA 2ZNSA 1K9ZA 1IMCA 1B9JA 2VOZA 3PGFA 1FQDA 4QFNA 3PPRA 4MLVA 5L9SA 2DYXA 4ELOA 4UACA 4Q0CA 3B6QA 1ZBMA 2PT2A 4IO3A 2YJPA 1A8FA 3CG3A 4X9TA 4U1ZA 3CVGA 5I84A 4BDRA 4H8IA 4KCCA 5AA1A 3QUJA 2Z8DA 4LN5A 3UP9A 1O64A 1D4NA 1GV8A 5H8QB 4YB6A 1Y3NA 2F34A 1NNKA 5AA3A 3MUQA 1SBPA 1QW0A 1VFEA 1B5JA 3IJXB 4OFOA 1DBZA 2VHAA 5J16A 2ZYOA 3C9HA 2F5XA 4WKMA 1FBHA 3PMWA 4FIMA 4R9GA 3CSGA 4PFUA 3P7IA 4RPNA 4JVIA 1GR2A 4AS5A 1FPKA 4FBPA 3GZGA 2AL5A 5ET6A 1UTBA 3HN0A 1Y3QA 3SEUA 2OZZA 4HW8A 4R9FA 1UIUA 3B6WA 1FBGA 4Q8RA 1NUWA 3C34A 1N3XA 4LUBA 4QBAA 3U92A 4HE2A 4YKKA 4NGUA 2RCAA 3C35A 1NV3A 3K4UA 2VPOA 1PB9A 1RDYA 3RPLA 5KDTA 1MDQA 3MVYA 4GWUA 1DTGA 4JWYA 4NF8A 4C1UA 1JVXA 1IXGA 4HCWA 1NV1A 5AE4A 4GRKA 1POY1 2CZHA 4HE1A 3QAXA 3O97A 3IOWA 2O1MA 4X48A 5LOMA 4LVQA 3OSRA 5EHSA 5ET7A 3EQ1A 1YZ0A 2HFBA 2XXKA 3JV9A 4G2ZA 2OBGA 1M5BA 4PFWA 5F1QA 1G0IA 4RPOA 1MPBA 1FTKA 2WYPA 2QMWA 2QPQA 2D5WA 4R72A 1XT8A 2W7YA 4IO4A 4GWZA 4MJOA 5A5XA 1ZLQA 1NUYA 3Q27A 4PBQA 2ZMBA 2H4IA 5L9MA 3GXAA 1GTKA 1MQDA 4G8MA 3KSXA 2ANJA 4MFIA 3MPLA 2PYYA 2I4BA 1QULA 1ZKBA 2DDKA 3H6UA 1B0HA 4DI3D 3LSXA 4EUOA 2ZZVA 2A5TB 5B7DA 4F3PA 3RT6B 5I59A 1MM6A 1HSEA 3FXBA 3KJTA 3T0JA 3QMFA 4OYVA 3C4MA 4LP2B 4F19A 1B3EA 3E4RA 3H06B 1H3DA 1NV4A 1LB8A 5ICQA 1FBCA 2XHDA 2XD2A 3BKIB 1NL5A 4E0XA 3NOHA 3VVEA 3PMXA 4LA9A 4PDDA 1O63A 2DOJA 1NFTA 4LZ5A 1NV2A 1Q9DA 2V84A 1FQEA 3LR1A 3I3VA 3SEXA 3LSLA 3T1BA 1LBWA 1LCTA 4LQ5A 4FE8A 4PFIA 5CMKA 2RC7A 4NWDA 3PUZE 4PAFA 4DE8A 3QXMA 1MY4A 2DWIA 1B7HA 1EU8A 4U23A 1LFIA 4IGTA 1LAGE 3N5LA 1B40A 1AMFA 2QVRA 4M4GA 4GXSB 5CMBA 2V3TA 5L8DA 4RJZA 4F39A 1MS7A 4U4SA 2Q8JA 2I4CA 3KJ7A 4NG7A 4JSDA 4I40A 1B1HA 4X1BA 3U94A 1US5A 4NX1A 4PE3A 4WEPA 1B46A 3MP1A 4P0IA 2I6EA 1P1UA 3KBRA 4ND9A 4O7MA 3S9LC 2F6PA 1F9BA 2ALUA 5B70A 4Q30B 4YU0A 1LBXA 3VVDA 1P1QA 1PB7A 2Y7PA 1ZTYA 4IY5A 1USYE 1MRPA 1B58A 3HO7A 1M5DA 4QFPA 2LAOA 2H9BA 1JW5A 4RK2A 1DSNA 4ZE8A 2H99A 2XWOA 5EYHA 3FJ7A 3G7WA 1JVYA 3JYRA 4ZS9A 4GWWA 4BDQA 3MP6A 3T9XB 1MPDA 3QSLA 3A3UA 1B51A 4P3LA 4F3BA 4KPTA 2R9JA 1II5A 2DE4A 1G0HA 4N15A 3FUZA 1MXVA 3TYHA 5H8NA 3MWBA 3RNNA 4NAPA 4NQ8A 4MCOA 1QVSA 5CBSA 3PPQA 3FXQA 3B50A 2P3VA 3UN6A 4G8NA 1Y9UA 5EHMA 4O3CA 2F7BA 3O6GA 3L6GA 2FBPA 3OO8A 1MG1A 2NUVA 3PUVE 4PCDA 4POXA 3KFMA 3K02A 4XF5A 1NI9A 1B5HA 3UIFA 4N4UA 5KZTA 3DP6A 4YMAA 2MKZA 1LBZA 2RKMA 3PMVA 4NEDA 2AIXA 2RC8A 4UA8A 1B4HA 2O6AA 1R1NA 2Y7IA 3R26A 4GL8A 3TPAA 4DIGA 2ZXTA 1B0LA 4OFJA 3OENA 4E0WA 4OERA 1SVXB 2XXWA 4OVSA 4YKJA 1QUKA 2QFLA 1AWBA 1OQHA 3H4ZA 4EF2A 2P1SA 1SW2A 3FD3A 3IL1B 4YB7A 3ONMA 2L5VA 1I6QA 2QMXA 3FJMA 4O7IA 2G93A 4RNSA 3M3LA 4IB2A 2F35A 2FIEA 3CR9A 4X8RA 3TTLA 5IZ1A 2WBBA 4PFBA 3CIJA 3FIRA 3SEVA 2Q89A 4XKRA 5AA4A 4BDLA 4HTGA 4MF3A 4OESA 2QSXA 5F24A 2XXHA 3OOAA 3QYTA 1MXYA 4U2RA 1N7XA 3ZSFA 5KCJA 2ZZWA 4AS4A 2Y5KA 1MXZA 2HXWA 5IZ3A 3EHTA 1OIBA 1MQHA 4OXVA 1XHYA 1OVBA 2X7PA 2RC9A 1DCUA 4H5FA 4DI4B 3TQLA 4MNCA 3I5OA 4EDPA 3KG2A 1MY0A 1EYJA 1MQGA 4KQPA 3KEIA 1FPEA 4GX3A 3KBZA 1LB9A 3C33A 5L9OA 3G3IA 3VLVA 4F2OA 5CRYA 4N17A 4YMBA 4OEVA 2Q74A 4LZ7A 3FGSA 2XX9A 5T3JA 1JETA 2F7AA 1GVCA 4JVCA 2WYKA 5BWJA 2RCBA 1MY1A 3S9NC 3OELA 3Q26A 1YPNA 1JEUA 4N6KA 2HQ0A 3FV2A 1D9VA 4GWSA 3B7DA 3DELB 2XWVA 1ATGA 4H5GA 3FV1A 4DLDA 4EQ9A 3U72A 2HZLA 2D3IA 1S7YA 4F2QA 5ET5A 1RKMA 1Q1KA 5IKBA 2X7QA 5H8FB 1GGGA 1MH3A 5DT6A 5FBPA 1D9YA 3K01A 2WX9A 4QSDA 4R6YA 4LONB 4P1EA 2B4LA 2GRVA 4U1OA 2A5SA 2XX7A 4KYSA 3OO6A 1LBCA 2XXQA 3RTFB 1LBVA 3LUZA 3SESA 3UORA 3BBRA 5AA2B 3GBBA 4L17A 2I49A 2DE3A 3MC2A 1LEVA 3B8BA 3HFUA 3DP4A 5TPAB 4P9KA 3R6UA 3ODBA 3D4GA 4ONYA 3HPIA 4RY1A 3T22A 1IMFA 1FBEA 3QIMA 1RYOA 3B6TA 3G3KA 2HAVA 4JXIA 4F3GA 3QUFA 1B3GA 2O7UA 1P1OA 2KQZA 4TQUQ 3D4CA 4QSEA 1P1WA 5F7VA 2NOOA 4F1VA 2DWJA 3GLBA 3S9MC 1DK4A 3U8QA 5IGAA 4PAKA 5I5PA 1URDA 4C1TA 4TLLB 3TODA 1IXIA 3KN8A 5DEXB 4OMBA 2REGA 4FATA 1WVJA 1SW5A 1LAFE 4OVQA 2UVIA 1NNPA 3U65A 1FPFA 2FVZA 1I6AA 5IZZA 1DPEA 4K3FA 1N04A 3IO4A 1FTLA 3RY3A 3N6UA 5HM4B 3U93A 3K2DA 4PC9A 1PBPA 4OA4A 1VSOA 5TPAA 3O6HA 2G29A 2Z22A 4EQ7A 3H7MA 3TCGA 3G3FA 3KGCA 3TFLA 3RPWA 3KOTA 4GF8A 2QS4A 1Z7ME 1N7WA 2FNCA 4R74A 2DWAA 2BJIA 2F36A 2QRYA 1IXHA 1Z7NE 4FEBA 2XXYA 3OMBA 1B05A 1YXIA 1QUIA 5BUUA 3O2AA 4GOTA 2Q8MA 3MZBA 2PMSA 4ZE9A 2OWSA 4XKQA 3OXNA 5DYHA 4PFYA 3FATA 4FEDA 2F6GA 2R6GE 5M2VA 3DM0A 1YAEA 3RQTA 1N76A 1FTJA 2CZLA 1BTJA 3CSBA 2Q88A 3K1MA 4QXDA 5K2YA 4ESXA 3EHSA 3GBAA 3RN8A 2VPNA 1DOTA 1SW4A 3SDFA 1Y3PA 3USDA 4I8CA 1B2HA 3ZKKA 3VXCA 2P2AA 1IQ7A 2UYEA 1B4ZA 2VT5A 3IFAA 1QKAA 3KOSA 1IIWA 4F1UA 4GWYA 3V5AA 3TTMA 4GIZA 4N8GA 1LGBC 3O9PA 2Y7WA 3KN3A 4NWCA 1KZ8A 2YPNA 4NE4A 1IZ1A 5DVFA 1IMEA 3K6XA 4RYAA 1HSJA 4H67A 4ZEBA 1SD3A 1ZMGA 2E1SA 2Q2AA 5H8FA 1ELJA 4XTCQ 2H98A 1XI6A 2CZKA 3N26A 5LTCA 3MVXA 2B4MA 4KD5A 5I56A 3A09A 2VP1A 3IJOB 1H76A 4M1VA 5I2KA 1IMBA 3H6VA 3LUYA 2H5YA 5KCJB 5K2XA 1M5CA 4P8BA 5FHNA 5FHMA 2O84X 1IEJA 2I3WA 2I58A 5JEIA 1A7LA 3IR1A 3FBPA 1IXCA 1KA1A 3LBSA 4TLMB 4NF6B 1B32A 2VD3A 4NMYA 3PPNA 4GLIA 3SETA 3PV0E 4MX6A 4I62A 1US4A 3Q29A 2OWTA 2QS2A 3CFXA 4PP0A 1FBDA 2PX1A 1A55A 2HPGA 2PFZA 1NH8A 4OTEA 4DDDA 1UIVA 2F3BA 1SI1A 3M3FA 4MBPA 1PB8A 5H8SA 4DCXA 3O29A 1LCFA 3PPPA 3G3HA 1LBBA 1FQCA 4H8JA 2ZYMA 3D1RA 2RINA 1FJ9A 3FXRA 1JEVA 3A29A 4X04A 4ELQA 1R9LA 1VE4A 4N6PA 1OLAA 4LZ8A 4Q5TA 3SZPA 3K1PA 4R73A 4GQOA 4R6HA 2F3DA 3T9VA 4H1XA 2FYIA 1TXFA 3FZVA 4XIGQ 4G77A 1VFDA 2O69A 4GX4A 4ZECA 1FCKA 5ISUA 4G68B 1PEBA 1MQIA 2AL4A 1P99A 1B52A 3BIHA 3LSFB 5CI5A 4PFRA 2NWJA 1USYH 2P3NA 4IO5A 3IB2A 4DCYA 3V8XB 3C36A 2Q9TA 4H65A 3O28A 5I2NA 2Y84A 2V3UA 3ISPA 3RTWB 1B3HA 1S9TA 1AH5A 4OVRA 4EXKA 2ONRA 3S9EA 1DTZA 3IAZA 3Q25A 1N0TA 4G4PA 2GHAA 1POTA 5AA4B 3LSWA 3O66A 4NHBA 3HCQA 4X1DA 4MH5A 3VVFA 2BJJX 1S50A 3E9XA 4P0GA 1CE2A 2Y7RA 4DXBA 1XVYA 4QFLA 4IGRA 3TELA 4EQBA 4PBHA 2XD3A 3ILUB 5EQ8A 4GVOA 5LDZA 3MBPA 4F29A 2XXXA 2IA4A 1FBFA 5I7IA 4FECA 3TCFA 4H0WA 1MXWA 5AA2D 4NTLA 1Y4CA 1FPLA 4N07A 3H03A 2Q2CA 2ZNTA 1MXUA 3VLUA 1N84A 4P11A 1IUDA 1OMPA 2YLNA 1JQFA 5A5XB 2OJTA 3HHGA 4NF8B 1PDAA 1B7UA 4KI0E 4YICA 2ESNA 1N3WA 5ITPA 4BLAA 4F3SA 2QJEA 3IO6A 4ELRA 1MH4A 3EPEA 1B7ZA 3MVWA 1B6HA 2FHYA 1UQWA 5H8NB 3FASA 3RYDA 1FPDA 1NH7A 5EQ7A 3SEWA 1IMDA 1CB6A 4KFQA 3L6HA 1LLSA 4F18A 1LFGA 3MAMA 3UA8A 1SYIA 4IO7A 4OWDA 3U1OA 1AOVA 1H45A 4OVJA 2OWZA 3G3GA 4EXLA 2WBDA 2V4CA 3VDFA 3K6WA 2F78A 3OD7A 5I56B 3EKIA 1DMBA 4DZ1A 3QK6A 4RA1A 2DXYA 1NV7A 5IAIA 4AB6A 1EYKA 5I59B 4XFEA 3DLNA 4PGNA 4QFOA 2Y5LA 4EF1A 2ZYNA 5FHOA 1XVXA 3TUSA 1MY2A 3KN7A 1NV0A 3TAJA 1B3LA 4HXVA 3T96B 3K0VA 2UYFA 1SW1A 4ZEFA 5JTYA 2F97A 4GXAA 3MSTA 3TQWA 2VGQA 2XWKA 2PBWA 4POWA 1CNQA 1NV6A 2FIXA 2REJA 3OO7A 3F11A 3FVGA 2I0CA 4AB5A 2THIA 3CG1A 2XXUA 4P56A 4OZ9A 3O6IA 1EZ9A 4YB5A 5I3SA 1FBPA 1D9QA 5H8QA 1NNFA 2XX8A 1FJ6A 3C31A 1TFDA 1A8EA 1SPIA 4N81A 2DQVA 1I69A 5H8HB 1K9YA 2V93A 3VLWA 5I57B 2O51A 4OETA 3RUMA 3MZ1A 2CEXA 4Z0IA 1FPIA 3TTNA 2QL3A 1QJMA 3Q28A 1XS5A 3VV5A 2DP8A 1Y4TA 5I58B 5EYGA 1YTVA 1YCJA 3SKPA 5CBRA 1ZJLA 2O7IA 2OK2A 3RPLB 5ELVA 3PTYA 1PBQA 3H3GA 5DVIA 1Y20A 4IO2A 3E13X 4H46A 4NF4A 3UK4A 5TP9A 4MNIA 5FTIA 3WAFA 4OENA 1VR5A 1EZPA 5JTYB 4P47A 1B5IA 4ZZEA 2E0SA 3LV0A 2VD2A 1EYIA 3SEYA 4KYDA 4N13A 3MZ9A 3W9VA 1LSTA 2DS9A 4NF6A 3T66A 2HEUA 4JWXA 3T93B 4DXCA 3M8UA 1A99A 3TDJA 2PT1A 4IR8A 3CI8A 2QS1A 1WDNA 3JZJA 3MW0A 4GX6A 2OCUA 3T9HB 5JK4A 5ITOA 2R8TA 2DXRA 5J1DA 1A54A 2B3BA 1JW1A 4G61A 4NF5B 4XEQA 4G68A 2PVUA 3E78A 1AL3A 2RF1A 4NF5A 3ROJA 3VFJA 2Z8EA 5HBCA 1D3KA 4LATA 3RLFE 1FTAA 5ESYA 2UXAA 4THIA 1MQJA 2ZYKA 4O8MA 5A5LA 1HSLA 2QVUA 2ABHA 1BK4A 3BFTA 2Z23A 2F7CA 2A5TA 5EQAA 3CFLA 3W15C 4O3AA 1QGXA 1URGA 1KA0A 2XXIA 3A3CA 2O1LA 4GBWA 1LAXA 1NUZA 1AIVA 2CEYA 4QFKA 2DVZA 1A40A 3TZAA 2PCRA 4KR5A 4OANA 2I3VA 1BLFA 2I48A 3EF7A 1TWYA 1QKBA 1OLCA 3BFUA 4PF6A 3ZS6A 4IY6A 4MEVA 3K1NA 4OHNA 2M8CA 4HCYA 4OVTA 1T0KA 1R9QA 3S2VA 2PFYA 4U22A
chains in the Genus database with same CATH topology
3MUQA 4H8JA 1SBPA 2ZYMA 3M3KA 1MXZA 3K6UA 2RINA 2HXWA 1QW0A 1VFEA 4OFLA 1SDXA 4R6KA 1B5JA 3IJXB 3FXRA 1JEVA 4OFOA 4TOZA 3EHTA 1OIBA 1Y3NA 2VHAA 1MQHA 4ELQA 1R9LA 4OXVA 4XKRA 1XHYA 1VE4A 4G68C 2ZYOA 4N6PA 3C9HA 1OVBA 1OLAA 2X7PA 4LZ8A 2F5XA 2RC9A 3PU5A 4IO6A 4H5FA 4WKMA 5AA2A 3TQLA 3PMWA 4FIMA 4Q5TA 3K1PA 4R73A 1XC1A 3I5OA 4GQOA 4EDPA 3KG2A 4R6HA 1MY0A 1UTBB 3T9VA 4H1XA 4R9GA 3CSGA 1MQGA 2FYIA 4DXUA 4KQPA 4PFUA 3KEIA 3P7IA 3LC8A 4PE5B 4RPNA 1TXFA 3FZVA 4XIGQ 1LB9A 2XXTA 3TEPA 4QHQA 3C33A 4G77A 1GR2A 5L9OA 3G3IA 1TT1A 1ANFA 3VLVA 4F2OA 1VFDA 5CRYA 2O69A 4ZECA 5KDTB 4YMBA 1FCKA 5ISUA 3GZGA 4OEVA 3N6TA 3FVOA 2AL5A 1FQCA 3TMGA 1UTBA 3HN0A 1Y3QA 4G68B 3SEUA 1PEBA 2OZZA 1MQIA 4KCDA 2AL4A 4R9FA 3AXFA 4HW8A 1P99A 1UIUA 3B6WA 3CFZA 1B52A 4LZ7A 3FGSA 5CI5A 3LSFB 2NVUB 4Q8RA 5I2NB 2XX9A 2DVCA 2NWJA 1NMUA 1JETA 2F7AA 3OO9A 3C34A 1N3XA 4MLQA 4PFTA 4LUBA 1GVCA 4I1DA 1USYH 3OSQA 3IB2A 3K00A 4IO5A 3U92A 4DCYA 5BUUA 3V8XB 5BWJA 4GFRA 2RCBA 1BP5A 1MY1A 3S9NC 3C36A 4YKKA 3OELA 2RCAA 3Q26A 3C35A 1YPNA 2Q9TA 4H65A 2NXOA 4BDNA 1Y1MA 3K4UA 3O28A 5I2NA 3UGWA 1PB9A 4ZZAA 1NKXA 2Y84A 1Q35A 1JEUA 2V3UA 5KDTA 1MDQA 1MXXA 3RTWB 3MVYA 1DTGA 4JWYA 1B3HA 2KLFA 4NF8A 2HQ0A 3FV2A 1D9VA 2ONKE 1AH5A 1FQAA 1S9TA 4C1UA 4EXKA 3B7DA 1FQBA 3DELB 1JVXA 2HZKA 1IXGA 2ONRA 4HCWA 4OQOA 1ATGA 3ECRA 4H5GA 3ZKLA 5DTBA 3S9EA 3SERA 5AE4A 1DTZA 4GRKA 3IAZA 1L5TA 5HPQA 1FTOA 1POY1 3Q25A 1N0TA 4G4PA 3FV1A 1BIYA 4DLDA 3QAXA 2GHAA 3O97A 5I2KB 4ELPA 4EQ9A 1POTA 4U21A 3LSWA 3U72A 2HZLA 2D3IA 5AA4B 3IOWA 3O66A 2O1MA 4X48A 1S7YA 4XKNA 5LOMA 4F2QA 4LVQA 3OSRA 3HCQA 1RKMA 5EHSA 3EQ1A 1Q1KA 4MH5A 4X1DA 4GWOA 2BJJX 1S50A 3VVFA 2HFBA 1JW4A 3E9XA 4GL0A 4P0GA 5H8HA 1CE2A 5IKBA 3JV9A 2Y7RA 3E3KA 2X7QA 3KSJA 4G2ZA 4DXBA 4ZDMA 5H8FB 1XVYA 4QFLA 2OBGA 1SYHA 1DPPA 1M5BA 1RYXA 1EH3A 2UVJA 4IGRA 1GGGA 1MH3A 2Y7KA 5DEXA 5F1QA 3TELA 2F8DA 4RPOA 5DT6A 1MPBA 1D9YA 1FTKA 3K01A 2QMWA 2QPQA 4QSDA 4EQBA 2D5WA 1OVTA 4R72A 4R6YA 1XT8A 2XD3A 3ILUB 4LONB 2W7YA 4FAJA 4GVOA 3CRBA 4IO4A 3MBPA 5A5XA 4U1OA 2GRVA 4F29A 1ZLQA 2A5SA 2XXXA 3FVNA 4R2BA 2XX7A 2IA4A 3OO6A 3Q27A 1LBCA 1FW0A 3I6VA 4KYSA 2XXQA 2ZMBA 4FECA 4JDFA 4H0WA 3RTFB 2H4IA 3TCFA 4Z7EA 5L9MA 3GXAA 1GTKA 1MQDA 4G8MA 3KSXA 2ANJA 3SESA 4MFIA 3UORA 4ISUA 3MPLA 2PYYA 1MXWA 3BBRA 3HSTA 3TTRA 3TTKA 2GFEA 5AA2B 2I4BA 5AA2D 1QULA 3GBBA 4L17A 1ZKBA 2I49A 3H6UA 1MY3A 4NTLA 1B0HA 1Y4CA 3LSXA 2DE3A 3MC2A 4RXLA 4EUOA 4H6DA 4BDMA 2A5TB 4AQ4A 5B7DA 1UTHB 3MP8A 4N07A 3RT6B 3DP4A 4F3PA 1MM6A 1HSEA 3H03A 5I59A 3KJTA 2X26A 5TPAB 4OYVA 1FTMA 2Q2CA 3R6UA 2ZNTA 1MXUA 3C4MA 3ODBA 3IB1A 3VLUA 3D4GA 4LP2B 4KYEA 4ONYA 1N84A 3HPIA 1IUDA 1OMPA 1B3EA 1JQFA 2YLNA 3E4RA 1ZU0A 3H06B 4P11A 1H3DA 2OJTA 1LB8A 5A5XB 3HHGA 5ICQA 3IK6B 3QIMA 2XHDA 1RYOA 1H43A 2XD2A 3BKIB 4NF8B 1NL5A 3B6TA 4E0XA 4GD5A 1PDAA 1B7UA 3VVEA 3G3KA 3PMXA 4KI0E 2HAVA 3PD9A 4JXIA 4YICA 4F3GA 3QUFA 1B3GA 2O7UA 1P1OA 2ESNA 4TQUQ 3D4CA 1IITA 1N3WA 4QSEA 4LA9A 1P1WA 5F7VA 4BDOA 4BLAA 5ITPA 4F3SA 2NOOA 2QJEA 3IO6A 4ELRA 1MH4A 3EPEA 1O63A 2DOJA 1NFTA 4LZ5A 4F1VA 1B7ZA 2V84A 2DWJA 3GLBA 3IOTA 3WAEA 4ESWA 3S9MC 2GH9A 1FQEA 4FORA 3LR1A 3MVWA 3I3VA 4RK9A 3U8QA 1EZOA 1B6HA 3SEXA 1I6BA 3LSLA 1URDA 2FA7A 4C1TA 1UQWA 4TLLB 5H8NB 3TODA 1LCTA 3FASA 1IXIA 4LQ5A 1NH7A 4FE8A 3KN8A 3IOVA 5DEXB 3SEWA 5CMKA 4OMBA 1CB6A 2RC7A 4KFQA 3L6HA 2REGA 4NWDA 3MJNA 3PUZE 2Z8FA 4FATA 1WVJA 1SW5A 3H6TA 3PUWE 4DE8A 3QXMA 1LLSA 4F18A 1MY4A 5I58A 1LFGA 1LAFE 3MAMA 4R75A 1MDP1 2H25A 2XXRA 2DWIA 3UA8A 2UVIA 1NNPA 1SYIA 2P0SA 1LAHE 3EN3A 1LBBA 4IO7A 1B7HA 3IX1A 4OWDA 3U1OA 1EU8A 1AOVA 3EHUA 4U23A 1H45A 4F22A 4OVJA 1LFIA 4IGTA 2O68A 1LAGE 1I6AA 3G3GA 3N5LA 4EXLA 3THIA 2DWHA 3RGYA 1DPEA 1B40A 2ZNUA 1AMFA 4K3FA 3S2VA 1N04A 4YZZA 1J1NA 1QUJA 2B3FA 3IO4A 4M4GA 3ILTB 3K6WA 2WKYA 5TP9B 4GXSB 2F78A 3OD7A 3IORA 3PD8A 5CMBA 1B3FA 2V3TA 5I56B 1M5EA 1DMBA 5CC2A 3FVKA 5L8DA 4DZ1A 1FTLA 1LFHA 3IOUA 3RY3A 3N6UA 5HM4B 4ZEIA 3U93A 4RJZA 3K2DA 1PBPA 3QK6A 3G3JA 4FJPA 1VSOA 4RA1A 1B1XA 5TPAA 2DXYA 3O6HA 4F39A 5IAIA 1MS7A 2G29A 4AB6A 2Z22A 4U4SA 5I59B 3T22A 3DLNA 3H7MA 4EQ7A 2Q8JA 2I4CA 3OEMA 3KJ7A 3TCGA 4QFOA 3OEKA 3G3FA 4JSDA 4PQJA 3KGCA 4EF1A 1B1HA 2ZYNA 5FHOA 1XVXA 3TFLA 2UVGA 3N94A 4PFWA 3TUSA 3RPWA 1MY2A 3KN7A 3KOTA 3TAJA 4GF8A 2QS4A 4X1BA 1Z7ME 4QSCA 3U94A 1B3LA 1N7WA 1SQYA 3T96B 1US5A 2FNCA 3K0VA 4R74A 2UYFA 1SW1A 2HAUA 4ZEFA 2F97A 4GXAA 4WEPA 2DWAA 5JTYA 3TQWA 1B46A 3MP1A 4P0IA 2I6EA 1P1UA 2VGQA 3KBRA 4ND9A 3S9LC 2F6PA 2F36A 2PBWA 4I9DA 2QRYA 1F9BA 1P1NA 2ALUA 2V3QA 4POWA 5B70A 5I57A 1IXHA 1R6ZA 3FJGA 2REJA 4JBZA 3OO7A 1Z7NE 4Q30B 4YU0A 1H44A 3F11A 3FVGA 2I0CA 4NF4B 1SI0A 4FEBA 3VVDA 1P1QA 4AB5A 2XXYA 2THIA 4OEUA 1PB7A 3CG1A 2XXUA 2DSFA 3OMBA 2Y7PA 1MM7A 4OZ9A 1M5FA 3O6IA 1EZ9A 3V83A 1B05A 1ZTYA 4YB5A 1QUIA 4IY5A 2ONSA 5H8QA 1NNFA 1USYE 3O2AA 1MRPA 2XX8A 1B58A 4GOTA 3MZBA 3PPOA 5CMMA 3FXUA 2PMSA 3HO7A 3C31A 4ZE9A 2OWSA 1M5DA 1OQGA 1A8EA 1TFDA 2XXPA 2LAOA 4QFPA 4XKQA 3KZGA 3OXNA 2DQVA 1I69A 2H9BA 1JW5A 5H8HB 4RK2A 5DYHA 3DP8A 4F31B 1DSNA 3TCHA 1Y1ZA 4PFYA 3FATA 4FEDA 2D21A 1WODA 2V93A 2H99A 2F6GA 4ZE8A 3V89B 1KWHA 3VLWA 2R6GE 5I57B 5M2VA 1ZIUA 2O51A 3FJ7A 3DM0A 3VDFA 3G7WA 4OETA 4ECFA 1YAEA 3RQTA 2XXVA 1N76A 1JVYA 3RUMA 4XXUA 5AA4A 3MZ1A 1FTJA 1MPCA 1O7TA 2CZLA 3JYRA 4JB7A 1BTJA 4ZS9A 4JWOA 5AA1A 4C0RA 3CSBA 1PC3A 4Z0IA 2Q88A 2IEEA 1BKAA 2QL3A 1QJMA 3K1MA 3TTNA 5K2YA 3Q28A 3IB0A 4QRZA 4BDQA 4ESXA 1XS5A 3MP6A 3VV5A 3EHSA 2DP8A 3T9XB 4YKPA 3GBAA 1MPDA 3QSLA 4JSOA 3W9WA 3RN8A 3A3UA 1B51A 1DOTA 1SW4A 1Y4TA 5I58B 3SDFA 1YTVA 3TKDA 3RT8A 1YCJA 4F3BA 3SKPA 1Y3PA 2R9JA 4KPTA 3USDA 5ICTA 1II5A 5CM6A 4I8CA 4XKPA 1B2HA 1ZJLA 2CMOA 2I0BA 2O7IA 2DE4A 2OK2A 2P2AA 2V25A 3FUZA 3VXCA 3ZKKA 1MXVA 3TYHA 5ELVA 5H8NA 3MWBA 1IQ7A 1PBQA 3H3GA 5DVIA 1Y20A 2UYEA 1B4ZA 3RNNA 4IO2A 3E13X 1QVSA 4YKIA 4NF4A 2QS3A 4G8HA 3UK4A 5TP9A 5CBSA 3PPQA 1QKAA 5FTIA 3KOSA 3FXQA 3WAFA 4U4XA 4OENA 3UN6A 4G8NA 1Y9UA 1IIWA 4F1UA 1VR5A 5EHMA 5CMCA 3MQ9A 5JTYB 1EZPA 4WXJA 1B5IA 4O3CA 4ZZEA 2F7BA 3V5AA 2GHBA 2E0SA 4KHZE 1JNFA 3O6GA 2VD2A 3TTMA 4GIZA 3SEYA 4KYDA 4N13A 3L6GA 3VXBA 1URSA 3MZ9A 1LGBC 1LSTA 2B65A 3MVZA 3O9PA 3W9VA 3OO8A 2DS9A 2Y7WA 1MG1A 2YPNA 3KN3A 4NWCA 4NF6A 4R2FA 3T66A 2NUVA 3PUVE 2HEUA 4NE4A 4POXA 3KFMA 5EYFA 4JWXA 3K02A 3T93B 4DXCA 1IZ1A 1B5HA 5DVFA 3UIFA 3M8UA 3K6XA 5KZTA 4WEDA 1A99A 1XOCA 4RYAA 1HSJA 2DE2A 3DP6A 4H67A 4ZEBA 3TDJA 4YMAA 2PT1A 2RKMA 2UVHA 2QS1A 3CI8A 2R71A 3PUYE 5FTHA 1UTHA 3PMVA 1SD3A 1WDNA 3HV1A 3JZJA 2AIXA 3MW0A 2OCUA 1ZMGA 2E1SA 2Q2AA 2RC8A 3PUXE 4HS7A 5ITOA 3T9HB 5H8FA 5JK4A 1TFAA 1ELJA 4XTCQ 4ZEKA 2H98A 1B4HA 4UA8A 2DXRA 2O6AA 1R1NA 3VE1B 3N26A 5J1DA 2Y7IA 1A54A 3MVXA 2B3BA 3R26A 1FQFA 4GL8A 3TPAA 2OLBA 4KD5A 4DIGA 1JW1A 1B0LA 2ZXTA 4OFJA 3A09A 4PETA 5I56A 3OENA 3R7XA 2VP1A 2HCAA 3IJOB 5TU0A 1H76A 4M1VA 4NEDA 4NF5B 4E0WA 4OERA 5I2KA 4G68A 2PVUA 3H6VA 3LUYA 2H5YA 5KCJB 1AL3A 1SVXB 2RF1A 2XXWA 3C32A 3HHFA 4NF5A 4YKJA 5K2XA 3VFJA 2Z8EA 1M5CA 1QUKA 5HBCA 3S4UA 4ZEDA 1D3KA 4LATA 4YAHX 5FHNA 3RLFE 2UXAA 1OQHA 3MPKA 4QF9A 4THIA 5FHMA 2O84X 1MQJA 2ZYKA 3H4ZA 4EF2A 1IEJA 1HSLA 2I3WA 2P1SA 1SW2A 4LQ2A 2I58A 5JEIA 1A7LA 2ABHA 3IR1A 3K6VA 2AYSA 3FD3A 3IL1B 4O3BA 4YB7A 4F1YA 1NNTA 3ONMA 3BFTA 5DVJA 2Z23A 1I6QA 3H6WA 2F7CA 2A5TA 2ZNSA 4RY1A 1IXCA 2QMXA 3FJMA 2G93A 3CFLA 1B9JA 2VOZA 3PGFA 3T9UA 1FQDA 3LBSA 3PPRA 4QFNA 4TLMB 3W15C 4NF6B 1B32A 2VD3A 4MLVA 4NMYA 4O3AA 4RNSA 3M3LA 5L9SA 1URGA 4IB2A 2DYXA 3PPNA 4ELOA 4GLIA 3SETA 2F35A 2XXIA 3A3CA 3CR9A 3PV0E 4Q0CA 4UACA 3TTLA 2O1LA 1LAXA 3CIJA 1US4A 4I62A 3B6QA 3FIRA 3SEVA 1AIVA 1ZBMA 3Q29A 2PT2A 4IO3A 2YJPA 1A8FA 2DVZA 1A40A 2Q89A 3CG3A 4QFKA 4X9TA 4U1ZA 2OWTA 4KR5A 2QS2A 3TZAA 2I3VA 4BDLA 3CFXA 4PP0A 2PX1A 4HTGA 1BLFA 3CVGA 1A55A 2I48A 3EF7A 1TWYA 1QKBA 4MF3A 4OESA 2QSXA 4BDRA 5I84A 4H8IA 2XXHA 1NH8A 1OLCA 3BFUA 4KCCA 4OTEA 4DDDA 3ZS6A 5CBRA 4IY6A 3OOAA 1UIVA 3QUJA 2Z8DA 1MXYA 3QYTA 1N7XA 1SI1A 3K1NA 3M3FA 2M8CA 4HCYA 4MBPA 4OHNA 4U2RA 1PB8A 3UP9A 5H8SA 1O64A 3ZSFA 1T0KA 4DCXA 5KCJA 1D4NA 1GV8A 3O29A 1LCFA 1R9QA 3PPPA 3G3HA 5H8QB 4YB6A 4F19A 1NNKA 2F34A 5AA3A 4U22A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MUQ A;  4H8J A;  1SBP A;  2ZYM A;  3M3K A;  1MXZ A;  3K6U A;  2RIN A;  2HXW A;  1QW0 A;  1VFE A;  4OFL A;  1SDX A;  4R6K A;  1B5J A;  3IJX B;  3FXR A;  1JEV A;  4OFO A;  4TOZ A;  3EHT A;  1OIB A;  1Y3N A;  2VHA A;  1MQH A;  4ELQ A;  1R9L A;  4OXV A;  4XKR A;  1XHY A;  1VE4 A;  4G68 C;  2ZYO A;  4N6P A;  3C9H A;  1OVB A;  1OLA A;  2X7P A;  4LZ8 A;  2F5X A;  2RC9 A;  3PU5 A;  4IO6 A;  4H5F A;  4WKM A;  5AA2 A;  3TQL A;  3PMW A;  4FIM A;  4Q5T A;  3K1P A;  4R73 A;  1XC1 A;  3I5O A;  4GQO A;  4EDP A;  3KG2 A;  4R6H A;  1MY0 A;  1UTB B;  3T9V A;  4H1X A;  4R9G A;  3CSG A;  1MQG A;  2FYI A;  4DXU A;  4KQP A;  4PFU A;  3KEI A;  3P7I A;  3LC8 A;  4PE5 B;  4RPN A;  1TXF A;  3FZV A;  4XIG Q;  1LB9 A;  2XXT A;  3TEP A;  4QHQ A;  3C33 A;  4G77 A;  1GR2 A;  5L9O A;  3G3I A;  1TT1 A;  1ANF A;  3VLV A;  4F2O A;  1VFD A;  5CRY A;  2O69 A;  4ZEC A;  5KDT B;  4YMB A;  1FCK A;  5ISU A;  3GZG A;  4OEV A;  3N6T A;  3FVO A;  2AL5 A;  1FQC A;  3TMG A;  1UTB A;  3HN0 A;  1Y3Q A;  4G68 B;  3SEU A;  1PEB A;  2OZZ A;  1MQI A;  4KCD A;  2AL4 A;  4R9F A;  3AXF A;  4HW8 A;  1P99 A;  1UIU A;  3B6W A;  3CFZ A;  1B52 A;  4LZ7 A;  3FGS A;  5CI5 A;  3LSF B;  2NVU B;  4Q8R A;  5I2N B;  2XX9 A;  2DVC A;  2NWJ A;  1NMU A;  1JET A;  2F7A A;  3OO9 A;  3C34 A;  1N3X A;  4MLQ A;  4PFT A;  4LUB A;  1GVC A;  4I1D A;  1USY H;  3OSQ A;  3IB2 A;  3K00 A;  4IO5 A;  3U92 A;  4DCY A;  5BUU A;  3V8X B;  5BWJ A;  4GFR A;  2RCB A;  1BP5 A;  1MY1 A;  3S9N C;  3C36 A;  4YKK A;  3OEL A;  2RCA A;  3Q26 A;  3C35 A;  1YPN A;  2Q9T A;  4H65 A;  2NXO A;  4BDN A;  1Y1M A;  3K4U A;  3O28 A;  5I2N A;  3UGW A;  1PB9 A;  4ZZA A;  1NKX A;  2Y84 A;  1Q35 A;  1JEU A;  2V3U A;  5KDT A;  1MDQ A;  1MXX A;  3RTW B;  3MVY A;  1DTG A;  4JWY A;  1B3H A;  2KLF A;  4NF8 A;  2HQ0 A;  3FV2 A;  1D9V A;  2ONK E;  1AH5 A;  1FQA A;  1S9T A;  4C1U A;  4EXK A;  3B7D A;  1FQB A;  3DEL B;  1JVX A;  2HZK A;  1IXG A;  2ONR A;  4HCW A;  4OQO A;  1ATG A;  3ECR A;  4H5G A;  3ZKL A;  5DTB A;  3S9E A;  3SER A;  5AE4 A;  1DTZ A;  4GRK A;  3IAZ A;  1L5T A;  5HPQ A;  1FTO A;  1POY 1;  3Q25 A;  1N0T A;  4G4P A;  3FV1 A;  1BIY A;  4DLD A;  3QAX A;  2GHA A;  3O97 A;  5I2K B;  4ELP A;  4EQ9 A;  1POT A;  4U21 A;  3LSW A;  3U72 A;  2HZL A;  2D3I A;  5AA4 B;  3IOW A;  3O66 A;  2O1M A;  4X48 A;  1S7Y A;  4XKN A;  5LOM A;  4F2Q A;  4LVQ A;  3OSR A;  3HCQ A;  1RKM A;  5EHS A;  3EQ1 A;  1Q1K A;  4MH5 A;  4X1D A;  4GWO A;  2BJJ X;  1S50 A;  3VVF A;  2HFB A;  1JW4 A;  3E9X A;  4GL0 A;  4P0G A;  5H8H A;  1CE2 A;  5IKB A;  3JV9 A;  2Y7R A;  3E3K A;  2X7Q A;  3KSJ A;  4G2Z A;  4DXB A;  4ZDM A;  5H8F B;  1XVY A;  4QFL A;  2OBG A;  1SYH A;  1DPP A;  1M5B A;  1RYX A;  1EH3 A;  2UVJ A;  4IGR A;  1GGG A;  1MH3 A;  2Y7K A;  5DEX A;  5F1Q A;  3TEL A;  2F8D A;  4RPO A;  5DT6 A;  1MPB A;  1D9Y A;  1FTK A;  3K01 A;  2QMW A;  2QPQ A;  4QSD A;  4EQB A;  2D5W A;  1OVT A;  4R72 A;  4R6Y A;  1XT8 A;  2XD3 A;  3ILU B;  4LON B;  2W7Y A;  4FAJ A;  4GVO A;  3CRB A;  4IO4 A;  3MBP A;  5A5X A;  4U1O A;  2GRV A;  4F29 A;  1ZLQ A;  2A5S A;  2XXX A;  3FVN A;  4R2B A;  2XX7 A;  2IA4 A;  3OO6 A;  3Q27 A;  1LBC A;  1FW0 A;  3I6V A;  4KYS A;  2XXQ A;  2ZMB A;  4FEC A;  4JDF A;  4H0W A;  3RTF B;  2H4I A;  3TCF A;  4Z7E A;  5L9M A;  3GXA A;  1GTK A;  1MQD A;  4G8M A;  3KSX A;  2ANJ A;  3SES A;  4MFI A;  3UOR A;  4ISU A;  3MPL A;  2PYY A;  1MXW A;  3BBR A;  3HST A;  3TTR A;  3TTK A;  2GFE A;  5AA2 B;  2I4B A;  5AA2 D;  1QUL A;  3GBB A;  4L17 A;  1ZKB A;  2I49 A;  3H6U A;  1MY3 A;  4NTL A;  1B0H A;  1Y4C A;  3LSX A;  2DE3 A;  3MC2 A;  4RXL A;  4EUO A;  4H6D A;  4BDM A;  2A5T B;  4AQ4 A;  5B7D A;  1UTH B;  3MP8 A;  4N07 A;  3RT6 B;  3DP4 A;  4F3P A;  1MM6 A;  1HSE A;  3H03 A;  5I59 A;  3KJT A;  2X26 A;  5TPA B;  4OYV A;  1FTM A;  2Q2C A;  3R6U A;  2ZNT A;  1MXU A;  3C4M A;  3ODB A;  3IB1 A;  3VLU A;  3D4G A;  4LP2 B;  4KYE A;  4ONY A;  1N84 A;  3HPI A;  1IUD A;  1OMP A;  1B3E A;  1JQF A;  2YLN A;  3E4R A;  1ZU0 A;  3H06 B;  4P11 A;  1H3D A;  2OJT A;  1LB8 A;  5A5X B;  3HHG A;  5ICQ A;  3IK6 B;  3QIM A;  2XHD A;  1RYO A;  1H43 A;  2XD2 A;  3BKI B;  4NF8 B;  1NL5 A;  3B6T A;  4E0X A;  4GD5 A;  1PDA A;  1B7U A;  3VVE A;  3G3K A;  3PMX A;  4KI0 E;  2HAV A;  3PD9 A;  4JXI A;  4YIC A;  4F3G A;  3QUF A;  1B3G A;  2O7U A;  1P1O A;  2ESN A;  4TQU Q;  3D4C A;  1IIT A;  1N3W A;  4QSE A;  4LA9 A;  1P1W A;  5F7V A;  4BDO A;  4BLA A;  5ITP A;  4F3S A;  2NOO A;  2QJE A;  3IO6 A;  4ELR A;  1MH4 A;  3EPE A;  1O63 A;  2DOJ A;  1NFT A;  4LZ5 A;  4F1V A;  1B7Z A;  2V84 A;  2DWJ A;  3GLB A;  3IOT A;  3WAE A;  4ESW A;  3S9M C;  2GH9 A;  1FQE A;  4FOR A;  3LR1 A;  3MVW A;  3I3V A;  4RK9 A;  3U8Q A;  1EZO A;  1B6H A;  3SEX A;  1I6B A;  3LSL A;  1URD A;  2FA7 A;  4C1T A;  1UQW A;  4TLL B;  5H8N B;  3TOD A;  1LCT A;  3FAS A;  1IXI A;  4LQ5 A;  1NH7 A;  4FE8 A;  3KN8 A;  3IOV A;  5DEX B;  3SEW A;  5CMK A;  4OMB A;  1CB6 A;  2RC7 A;  4KFQ A;  3L6H A;  2REG A;  4NWD A;  3MJN A;  3PUZ E;  2Z8F A;  4FAT A;  1WVJ A;  1SW5 A;  3H6T A;  3PUW E;  4DE8 A;  3QXM A;  1LLS A;  4F18 A;  1MY4 A;  5I58 A;  1LFG A;  1LAF E;  3MAM A;  4R75 A;  1MDP 1;  2H25 A;  2XXR A;  2DWI A;  3UA8 A;  2UVI A;  1NNP A;  1SYI A;  2P0S A;  1LAH E;  3EN3 A;  1LBB A;  4IO7 A;  1B7H A;  3IX1 A;  4OWD A;  3U1O A;  1EU8 A;  1AOV A;  3EHU A;  4U23 A;  1H45 A;  4F22 A;  4OVJ A;  1LFI A;  4IGT A;  2O68 A;  1LAG E;  1I6A A;  3G3G A;  3N5L A;  4EXL A;  3THI A;  2DWH A;  3RGY A;  1DPE A;  1B40 A;  2ZNU A;  1AMF A;  4K3F A;  3S2V A;  1N04 A;  4YZZ A;  1J1N A;  1QUJ A;  2B3F A;  3IO4 A;  4M4G A;  3ILT B;  3K6W A;  2WKY A;  5TP9 B;  4GXS B;  2F78 A;  3OD7 A;  3IOR A;  3PD8 A;  5CMB A;  1B3F A;  2V3T A;  5I56 B;  1M5E A;  1DMB A;  5CC2 A;  3FVK A;  5L8D A;  4DZ1 A;  1FTL A;  1LFH A;  3IOU A;  3RY3 A;  3N6U A;  5HM4 B;  4ZEI A;  3U93 A;  4RJZ A;  3K2D A;  1PBP A;  3QK6 A;  3G3J A;  4FJP A;  1VSO A;  4RA1 A;  1B1X A;  5TPA A;  2DXY A;  3O6H A;  4F39 A;  5IAI A;  1MS7 A;  2G29 A;  4AB6 A;  2Z22 A;  4U4S A;  5I59 B;  3T22 A;  3DLN A;  3H7M A;  4EQ7 A;  2Q8J A;  2I4C A;  3OEM A;  3KJ7 A;  3TCG A;  4QFO A;  3OEK A;  3G3F A;  4JSD A;  4PQJ A;  3KGC A;  4EF1 A;  1B1H A;  2ZYN A;  5FHO A;  1XVX A;  3TFL A;  2UVG A;  3N94 A;  4PFW A;  3TUS A;  3RPW A;  1MY2 A;  3KN7 A;  3KOT A;  3TAJ A;  4GF8 A;  2QS4 A;  4X1B A;  1Z7M E;  4QSC A;  3U94 A;  1B3L A;  1N7W A;  1SQY A;  3T96 B;  1US5 A;  2FNC A;  3K0V A;  4R74 A;  2UYF A;  1SW1 A;  2HAU A;  4ZEF A;  2F97 A;  4GXA A;  4WEP A;  2DWA A;  5JTY A;  3TQW A;  1B46 A;  3MP1 A;  4P0I A;  2I6E A;  1P1U A;  2VGQ A;  3KBR A;  4ND9 A;  3S9L C;  2F6P A;  2F36 A;  2PBW A;  4I9D A;  2QRY A;  1F9B A;  1P1N A;  2ALU A;  2V3Q A;  4POW A;  5B70 A;  5I57 A;  1IXH A;  1R6Z A;  3FJG A;  2REJ A;  4JBZ A;  3OO7 A;  1Z7N E;  4Q30 B;  4YU0 A;  1H44 A;  3F11 A;  3FVG A;  2I0C A;  4NF4 B;  1SI0 A;  4FEB A;  3VVD A;  1P1Q A;  4AB5 A;  2XXY A;  2THI A;  4OEU A;  1PB7 A;  3CG1 A;  2XXU A;  2DSF A;  3OMB A;  2Y7P A;  1MM7 A;  4OZ9 A;  1M5F A;  3O6I A;  1EZ9 A;  3V83 A;  1B05 A;  1ZTY A;  4YB5 A;  1QUI A;  4IY5 A;  2ONS A;  5H8Q A;  1NNF A;  1USY E;  3O2A A;  1MRP A;  2XX8 A;  1B58 A;  4GOT A;  3MZB A;  3PPO A;  5CMM A;  3FXU A;  2PMS A;  3HO7 A;  3C31 A;  4ZE9 A;  2OWS A;  1M5D A;  1OQG A;  1A8E A;  1TFD A;  2XXP A;  2LAO A;  4QFP A;  4XKQ A;  3KZG A;  3OXN A;  2DQV A;  1I69 A;  2H9B A;  1JW5 A;  5H8H B;  4RK2 A;  5DYH A;  3DP8 A;  4F31 B;  1DSN A;  3TCH A;  1Y1Z A;  4PFY A;  3FAT A;  4FED A;  2D21 A;  1WOD A;  2V93 A;  2H99 A;  2F6G A;  4ZE8 A;  3V89 B;  1KWH A;  3VLW A;  2R6G E;  5I57 B;  5M2V A;  1ZIU A;  2O51 A;  3FJ7 A;  3DM0 A;  3VDF A;  3G7W A;  4OET A;  4ECF A;  1YAE A;  3RQT A;  2XXV A;  1N76 A;  1JVY A;  3RUM A;  4XXU A;  5AA4 A;  3MZ1 A;  1FTJ A;  1MPC A;  1O7T A;  2CZL A;  3JYR A;  4JB7 A;  1BTJ A;  4ZS9 A;  4JWO A;  5AA1 A;  4C0R A;  3CSB A;  1PC3 A;  4Z0I A;  2Q88 A;  2IEE A;  1BKA A;  2QL3 A;  1QJM A;  3K1M A;  3TTN A;  5K2Y A;  3Q28 A;  3IB0 A;  4QRZ A;  4BDQ A;  4ESX A;  1XS5 A;  3MP6 A;  3VV5 A;  3EHS A;  2DP8 A;  3T9X B;  4YKP A;  3GBA A;  1MPD A;  3QSL A;  4JSO A;  3W9W A;  3RN8 A;  3A3U A;  1B51 A;  1DOT A;  1SW4 A;  1Y4T A;  5I58 B;  3SDF A;  1YTV A;  3TKD A;  3RT8 A;  1YCJ A;  4F3B A;  3SKP A;  1Y3P A;  2R9J A;  4KPT A;  3USD A;  5ICT A;  1II5 A;  5CM6 A;  4I8C A;  4XKP A;  1B2H A;  1ZJL A;  2CMO A;  2I0B A;  2O7I A;  2DE4 A;  2OK2 A;  2P2A A;  2V25 A;  3FUZ A;  3VXC A;  3ZKK A;  1MXV A;  3TYH A;  5ELV A;  5H8N A;  3MWB A;  1IQ7 A;  1PBQ A;  3H3G A;  5DVI A;  1Y20 A;  2UYE A;  1B4Z A;  3RNN A;  4IO2 A;  3E13 X;  1QVS A;  4YKI A;  4NF4 A;  2QS3 A;  4G8H A;  3UK4 A;  5TP9 A;  5CBS A;  3PPQ A;  1QKA A;  5FTI A;  3KOS A;  3FXQ A;  3WAF A;  4U4X A;  4OEN A;  3UN6 A;  4G8N A;  1Y9U A;  1IIW A;  4F1U A;  1VR5 A;  5EHM A;  5CMC A;  3MQ9 A;  5JTY B;  1EZP A;  4WXJ A;  1B5I A;  4O3C A;  4ZZE A;  2F7B A;  3V5A A;  2GHB A;  2E0S A;  4KHZ E;  1JNF A;  3O6G A;  2VD2 A;  3TTM A;  4GIZ A;  3SEY A;  4KYD A;  4N13 A;  3L6G A;  3VXB A;  1URS A;  3MZ9 A;  1LGB C;  1LST A;  2B65 A;  3MVZ A;  3O9P A;  3W9V A;  3OO8 A;  2DS9 A;  2Y7W A;  1MG1 A;  2YPN A;  3KN3 A;  4NWC A;  4NF6 A;  4R2F A;  3T66 A;  2NUV A;  3PUV E;  2HEU A;  4NE4 A;  4POX A;  3KFM A;  5EYF A;  4JWX A;  3K02 A;  3T93 B;  4DXC A;  1IZ1 A;  1B5H A;  5DVF A;  3UIF A;  3M8U A;  3K6X A;  5KZT A;  4WED A;  1A99 A;  1XOC A;  4RYA A;  1HSJ A;  2DE2 A;  3DP6 A;  4H67 A;  4ZEB A;  3TDJ A;  4YMA A;  2PT1 A;  2RKM A;  2UVH A;  2QS1 A;  3CI8 A;  2R71 A;  3PUY E;  5FTH A;  1UTH A;  3PMV A;  1SD3 A;  1WDN A;  3HV1 A;  3JZJ A;  2AIX A;  3MW0 A;  2OCU A;  1ZMG A;  2E1S A;  2Q2A A;  2RC8 A;  3PUX E;  4HS7 A;  5ITO A;  3T9H B;  5H8F A;  5JK4 A;  1TFA A;  1ELJ A;  4XTC Q;  4ZEK A;  2H98 A;  1B4H A;  4UA8 A;  2DXR A;  2O6A A;  1R1N A;  3VE1 B;  3N26 A;  5J1D A;  2Y7I A;  1A54 A;  3MVX A;  2B3B A;  3R26 A;  1FQF A;  4GL8 A;  3TPA A;  2OLB A;  4KD5 A;  4DIG A;  1JW1 A;  1B0L A;  2ZXT A;  4OFJ A;  3A09 A;  4PET A;  5I56 A;  3OEN A;  3R7X A;  2VP1 A;  2HCA A;  3IJO B;  5TU0 A;  1H76 A;  4M1V A;  4NED A;  4NF5 B;  4E0W A;  4OER A;  5I2K A;  4G68 A;  2PVU A;  3H6V A;  3LUY A;  2H5Y A;  5KCJ B;  1AL3 A;  1SVX B;  2RF1 A;  2XXW A;  3C32 A;  3HHF A;  4NF5 A;  4YKJ A;  5K2X A;  3VFJ A;  2Z8E A;  1M5C A;  1QUK A;  5HBC A;  3S4U A;  4ZED A;  1D3K A;  4LAT A;  4YAH X;  5FHN A;  3RLF E;  2UXA A;  1OQH A;  3MPK A;  4QF9 A;  4THI A;  5FHM A;  2O84 X;  1MQJ A;  2ZYK A;  3H4Z A;  4EF2 A;  1IEJ A;  1HSL A;  2I3W A;  2P1S A;  1SW2 A;  4LQ2 A;  2I58 A;  5JEI A;  1A7L A;  2ABH A;  3IR1 A;  3K6V A;  2AYS A;  3FD3 A;  3IL1 B;  4O3B A;  4YB7 A;  4F1Y A;  1NNT A;  3ONM A;  3BFT A;  5DVJ A;  2Z23 A;  1I6Q A;  3H6W A;  2F7C A;  2A5T A;  2ZNS A;  4RY1 A;  1IXC A;  2QMX A;  3FJM A;  2G93 A;  3CFL A;  1B9J A;  2VOZ A;  3PGF A;  3T9U A;  1FQD A;  3LBS A;  3PPR A;  4QFN A;  4TLM B;  3W15 C;  4NF6 B;  1B32 A;  2VD3 A;  4MLV A;  4NMY A;  4O3A A;  4RNS A;  3M3L A;  5L9S A;  1URG A;  4IB2 A;  2DYX A;  3PPN A;  4ELO A;  4GLI A;  3SET A;  2F35 A;  2XXI A;  3A3C A;  3CR9 A;  3PV0 E;  4Q0C A;  4UAC A;  3TTL A;  2O1L A;  1LAX A;  3CIJ A;  1US4 A;  4I62 A;  3B6Q A;  3FIR A;  3SEV A;  1AIV A;  1ZBM A;  3Q29 A;  2PT2 A;  4IO3 A;  2YJP A;  1A8F A;  2DVZ A;  1A40 A;  2Q89 A;  3CG3 A;  4QFK A;  4X9T A;  4U1Z A;  2OWT A;  4KR5 A;  2QS2 A;  3TZA A;  2I3V A;  4BDL A;  3CFX A;  4PP0 A;  2PX1 A;  4HTG A;  1BLF A;  3CVG A;  1A55 A;  2I48 A;  3EF7 A;  1TWY A;  1QKB A;  4MF3 A;  4OES A;  2QSX A;  4BDR A;  5I84 A;  4H8I A;  2XXH A;  1NH8 A;  1OLC A;  3BFU A;  4KCC A;  4OTE A;  4DDD A;  3ZS6 A;  5CBR A;  4IY6 A;  3OOA A;  1UIV A;  3QUJ A;  2Z8D A;  1MXY A;  3QYT A;  1N7X A;  1SI1 A;  3K1N A;  3M3F A;  2M8C A;  4HCY A;  4MBP A;  4OHN A;  4U2R A;  1PB8 A;  3UP9 A;  5H8S A;  1O64 A;  3ZSF A;  1T0K A;  4DCX A;  5KCJ A;  1D4N A;  1GV8 A;  3O29 A;  1LCF A;  1R9Q A;  3PPP A;  3G3H A;  5H8Q B;  4YB6 A;  4F19 A;  1NNK A;  2F34 A;  5AA3 A;  4U22 A; 
#chains in the Genus database with same CATH topology
 3M3K A;  3K6U A;  4OFL A;  1SDX A;  4R6K A;  4TOZ A;  4PDH A;  4G68 C;  5AA2 A;  3PU5 A;  4IO6 A;  1XC1 A;  1UTB B;  4DXU A;  3LC8 A;  5IM2 A;  4PE5 B;  3TEP A;  2XXT A;  4N6D A;  4QHQ A;  1TT1 A;  1ANF A;  5KDT B;  1NUX A;  3N6T A;  3FVO A;  3TMG A;  2HHM A;  4KCD A;  3AXF A;  3CFZ A;  5I2N B;  1FSA A;  2NVU B;  2DVC A;  1NMU A;  3OO9 A;  4PFT A;  4MLQ A;  4I1D A;  3OSQ A;  3K00 A;  4GFR A;  1BP5 A;  4N91 A;  2NXO A;  3CHG A;  4BDN A;  1Y1M A;  3UGW A;  1FPJ A;  1FPG A;  4ZZA A;  2GQ1 A;  1NKX A;  4OVP A;  1Q35 A;  1MXX A;  2KLF A;  2ONK E;  1FQA A;  1FQB A;  2HZK A;  4UAB A;  4OQO A;  1NV5 A;  3ECR A;  3ZKL A;  5DTB A;  3SER A;  4H45 A;  5HPQ A;  1L5T A;  1FTO A;  1RDZ A;  1BIY A;  4PTK A;  5I2K B;  4ELP A;  4U21 A;  4XKN A;  4GWO A;  1JW4 A;  4GL0 A;  5H8H A;  3E3K A;  3KSJ A;  4ZDM A;  1SYH A;  1DPP A;  1RYX A;  2CZI A;  1EH3 A;  2UVJ A;  5DEX A;  2Y7K A;  4PAI A;  2F8D A;  1OVT A;  4FAJ A;  3CRB A;  3FVN A;  4R2B A;  1FW0 A;  3I6V A;  2JJK A;  4Z7E A;  4JDF A;  4MMP A;  1RDX A;  1VDW A;  4ISU A;  3TTR A;  3HST A;  2GFE A;  1MY3 A;  4RXL A;  5IZ3 B;  4H6D A;  5DW8 A;  4BDM A;  4AQ4 A;  1UTH B;  3MP8 A;  2X26 A;  4I3E A;  1INP A;  1FTM A;  3IB1 A;  4KYE A;  4MNP A;  1ZU0 A;  3IK6 B;  4I3Y A;  2HXR A;  1H43 A;  3MYU A;  4GD5 A;  2XWI A;  3PD9 A;  4BDO A;  1IIT A;  4O94 A;  4MHF A;  3WAE A;  3IOT A;  4ESW A;  2GH9 A;  1EZO A;  4FOR A;  4RK9 A;  1I6B A;  2FA7 A;  4N8Y A;  2KR0 A;  1FPB A;  3IOV A;  3MJN A;  2Z8F A;  3H6T A;  3KC1 A;  3PUW E;  4P1L A;  5I58 A;  4R75 A;  3E79 A;  1MDP 1;  2H25 A;  2XXR A;  2P0S A;  3EN3 A;  1LAH E;  3IX1 A;  3EHU A;  4F22 A;  2O68 A;  3THI A;  2DWH A;  2ZNU A;  4YZZ A;  1J1N A;  1QUJ A;  2B3F A;  2OX3 A;  3ILT B;  5TP9 B;  2WKY A;  3PD8 A;  3IOR A;  1B3F A;  1M5E A;  5CC2 A;  3FVK A;  1JP4 A;  1LFH A;  3IOU A;  4ZEI A;  3G3J A;  4FJP A;  1B1X A;  3OEM A;  4GWX A;  3OEK A;  4PQJ A;  1YYZ A;  4HE0 A;  2UVG A;  3N94 A;  4PF8 A;  4QSC A;  1SQY A;  2HAU A;  4I9D A;  1P1N A;  2V3Q A;  5I57 A;  5EQ9 A;  1R6Z A;  3FJG A;  4JBZ A;  3T9U A;  3TTK A;  1H44 A;  4NF4 B;  1SI0 A;  3KC0 A;  4OEU A;  2DSF A;  1MM7 A;  1M5F A;  3V83 A;  4KXP A;  2ONS A;  3W9W A;  3PPO A;  5CMM A;  3FXU A;  1FRP A;  1OQG A;  3RGY A;  2XXP A;  3KZG A;  1IMA A;  3DP8 A;  4F31 B;  3TCH A;  1Y1Z A;  1WOD A;  2D21 A;  3V89 B;  1KWH A;  1ZIU A;  4ECF A;  4MIJ A;  2XXV A;  4XXU A;  3BIG A;  4JVD A;  1MPC A;  1O7T A;  4JB7 A;  4C0R A;  4JWO A;  1PC3 A;  2ZZX A;  2IEE A;  1BKA A;  4GBV A;  3IB0 A;  4QRZ A;  4YKP A;  4JSO A;  3TKD A;  3RT8 A;  4PGP A;  5ICT A;  5CM6 A;  4XKP A;  2CMO A;  2V25 A;  2I0B A;  3IFC A;  4NF0 A;  4YKI A;  2QS3 A;  4G8H A;  4U4X A;  5CMC A;  3MQ9 A;  4WXJ A;  2GHB A;  4KHZ E;  1JNF A;  3VXB A;  1URS A;  2B65 A;  3MVZ A;  4MAG A;  4R2F A;  5EYF A;  4WED A;  1XOC A;  2DE2 A;  2UVH A;  2R71 A;  3PUY E;  5FTH A;  1UTH A;  3HV1 A;  4HS7 A;  3PUX E;  1TFA A;  4ZEK A;  3VE1 B;  2QVV A;  1FQF A;  2OLB A;  4PET A;  2XA5 A;  5ET8 A;  4NN3 A;  3R7X A;  5TU0 A;  2HCA A;  3GYY A;  3C32 A;  3HHF A;  3S4U A;  4ZED A;  4YAH X;  3MPK A;  4QF9 A;  1LBY A;  4LQ2 A;  3K6V A;  4O3B A;  2AYS A;  2WEF A;  4F1Y A;  1NNT A;  5DVJ A;  3H6W A;  2ZNS A;  1K9Z A;  1IMC A;  1B9J A;  2VOZ A;  3PGF A;  1FQD A;  4QFN A;  3PPR A;  4MLV A;  5L9S A;  2DYX A;  4ELO A;  4UAC A;  4Q0C A;  3B6Q A;  1ZBM A;  2PT2 A;  4IO3 A;  2YJP A;  1A8F A;  3CG3 A;  4X9T A;  4U1Z A;  3CVG A;  5I84 A;  4BDR A;  4H8I A;  4KCC A;  5AA1 A;  3QUJ A;  2Z8D A;  4LN5 A;  3UP9 A;  1O64 A;  1D4N A;  1GV8 A;  5H8Q B;  4YB6 A;  1Y3N A;  2F34 A;  1NNK A;  5AA3 A;  3MUQ A;  1SBP A;  1QW0 A;  1VFE A;  1B5J A;  3IJX B;  4OFO A;  1DBZ A;  2VHA A;  5J16 A;  2ZYO A;  3C9H A;  2F5X A;  4WKM A;  1FBH A;  3PMW A;  4FIM A;  4R9G A;  3CSG A;  4PFU A;  3P7I A;  4RPN A;  4JVI A;  1GR2 A;  4AS5 A;  1FPK A;  4FBP A;  3GZG A;  2AL5 A;  5ET6 A;  1UTB A;  3HN0 A;  1Y3Q A;  3SEU A;  2OZZ A;  4HW8 A;  4R9F A;  1UIU A;  3B6W A;  1FBG A;  4Q8R A;  1NUW A;  3C34 A;  1N3X A;  4LUB A;  4QBA A;  3U92 A;  4HE2 A;  4YKK A;  4NGU A;  2RCA A;  3C35 A;  1NV3 A;  3K4U A;  2VPO A;  1PB9 A;  1RDY A;  3RPL A;  5KDT A;  1MDQ A;  3MVY A;  4GWU A;  1DTG A;  4JWY A;  4NF8 A;  4C1U A;  1JVX A;  1IXG A;  4HCW A;  1NV1 A;  5AE4 A;  4GRK A;  1POY 1;  2CZH A;  4HE1 A;  3QAX A;  3O97 A;  3IOW A;  2O1M A;  4X48 A;  5LOM A;  4LVQ A;  3OSR A;  5EHS A;  5ET7 A;  3EQ1 A;  1YZ0 A;  2HFB A;  2XXK A;  3JV9 A;  4G2Z A;  2OBG A;  1M5B A;  4PFW A;  5F1Q A;  1G0I A;  4RPO A;  1MPB A;  1FTK A;  2WYP A;  2QMW A;  2QPQ A;  2D5W A;  4R72 A;  1XT8 A;  2W7Y A;  4IO4 A;  4GWZ A;  4MJO A;  5A5X A;  1ZLQ A;  1NUY A;  3Q27 A;  4PBQ A;  2ZMB A;  2H4I A;  5L9M A;  3GXA A;  1GTK A;  1MQD A;  4G8M A;  3KSX A;  2ANJ A;  4MFI A;  3MPL A;  2PYY A;  2I4B A;  1QUL A;  1ZKB A;  2DDK A;  3H6U A;  1B0H A;  4DI3 D;  3LSX A;  4EUO A;  2ZZV A;  2A5T B;  5B7D A;  4F3P A;  3RT6 B;  5I59 A;  1MM6 A;  1HSE A;  3FXB A;  3KJT A;  3T0J A;  3QMF A;  4OYV A;  3C4M A;  4LP2 B;  4F19 A;  1B3E A;  3E4R A;  3H06 B;  1H3D A;  1NV4 A;  1LB8 A;  5ICQ A;  1FBC A;  2XHD A;  2XD2 A;  3BKI B;  1NL5 A;  4E0X A;  3NOH A;  3VVE A;  3PMX A;  4LA9 A;  4PDD A;  1O63 A;  2DOJ A;  1NFT A;  4LZ5 A;  1NV2 A;  1Q9D A;  2V84 A;  1FQE A;  3LR1 A;  3I3V A;  3SEX A;  3LSL A;  3T1B A;  1LBW A;  1LCT A;  4LQ5 A;  4FE8 A;  4PFI A;  5CMK A;  2RC7 A;  4NWD A;  3PUZ E;  4PAF A;  4DE8 A;  3QXM A;  1MY4 A;  2DWI A;  1B7H A;  1EU8 A;  4U23 A;  1LFI A;  4IGT A;  1LAG E;  3N5L A;  1B40 A;  1AMF A;  2QVR A;  4M4G A;  4GXS B;  5CMB A;  2V3T A;  5L8D A;  4RJZ A;  4F39 A;  1MS7 A;  4U4S A;  2Q8J A;  2I4C A;  3KJ7 A;  4NG7 A;  4JSD A;  4I40 A;  1B1H A;  4X1B A;  3U94 A;  1US5 A;  4NX1 A;  4PE3 A;  4WEP A;  1B46 A;  3MP1 A;  4P0I A;  2I6E A;  1P1U A;  3KBR A;  4ND9 A;  4O7M A;  3S9L C;  2F6P A;  1F9B A;  2ALU A;  5B70 A;  4Q30 B;  4YU0 A;  1LBX A;  3VVD A;  1P1Q A;  1PB7 A;  2Y7P A;  1ZTY A;  4IY5 A;  1USY E;  1MRP A;  1B58 A;  3HO7 A;  1M5D A;  4QFP A;  2LAO A;  2H9B A;  1JW5 A;  4RK2 A;  1DSN A;  4ZE8 A;  2H99 A;  2XWO A;  5EYH A;  3FJ7 A;  3G7W A;  1JVY A;  3JYR A;  4ZS9 A;  4GWW A;  4BDQ A;  3MP6 A;  3T9X B;  1MPD A;  3QSL A;  3A3U A;  1B51 A;  4P3L A;  4F3B A;  4KPT A;  2R9J A;  1II5 A;  2DE4 A;  1G0H A;  4N15 A;  3FUZ A;  1MXV A;  3TYH A;  5H8N A;  3MWB A;  3RNN A;  4NAP A;  4NQ8 A;  4MCO A;  1QVS A;  5CBS A;  3PPQ A;  3FXQ A;  3B50 A;  2P3V A;  3UN6 A;  4G8N A;  1Y9U A;  5EHM A;  4O3C A;  2F7B A;  3O6G A;  3L6G A;  2FBP A;  3OO8 A;  1MG1 A;  2NUV A;  3PUV E;  4PCD A;  4POX A;  3KFM A;  3K02 A;  4XF5 A;  1NI9 A;  1B5H A;  3UIF A;  4N4U A;  5KZT A;  3DP6 A;  4YMA A;  2MKZ A;  1LBZ A;  2RKM A;  3PMV A;  4NED A;  2AIX A;  2RC8 A;  4UA8 A;  1B4H A;  2O6A A;  1R1N A;  2Y7I A;  3R26 A;  4GL8 A;  3TPA A;  4DIG A;  2ZXT A;  1B0L A;  4OFJ A;  3OEN A;  4E0W A;  4OER A;  1SVX B;  2XXW A;  4OVS A;  4YKJ A;  1QUK A;  2QFL A;  1AWB A;  1OQH A;  3H4Z A;  4EF2 A;  2P1S A;  1SW2 A;  3FD3 A;  3IL1 B;  4YB7 A;  3ONM A;  2L5V A;  1I6Q A;  2QMX A;  3FJM A;  4O7I A;  2G93 A;  4RNS A;  3M3L A;  4IB2 A;  2F35 A;  2FIE A;  3CR9 A;  4X8R A;  3TTL A;  5IZ1 A;  2WBB A;  4PFB A;  3CIJ A;  3FIR A;  3SEV A;  2Q89 A;  4XKR A;  5AA4 A;  4BDL A;  4HTG A;  4MF3 A;  4OES A;  2QSX A;  5F24 A;  2XXH A;  3OOA A;  3QYT A;  1MXY A;  4U2R A;  1N7X A;  3ZSF A;  5KCJ A;  2ZZW A;  4AS4 A;  2Y5K A;  1MXZ A;  2HXW A;  5IZ3 A;  3EHT A;  1OIB A;  1MQH A;  4OXV A;  1XHY A;  1OVB A;  2X7P A;  2RC9 A;  1DCU A;  4H5F A;  4DI4 B;  3TQL A;  4MNC A;  3I5O A;  4EDP A;  3KG2 A;  1MY0 A;  1EYJ A;  1MQG A;  4KQP A;  3KEI A;  1FPE A;  4GX3 A;  3KBZ A;  1LB9 A;  3C33 A;  5L9O A;  3G3I A;  3VLV A;  4F2O A;  5CRY A;  4N17 A;  4YMB A;  4OEV A;  2Q74 A;  4LZ7 A;  3FGS A;  2XX9 A;  5T3J A;  1JET A;  2F7A A;  1GVC A;  4JVC A;  2WYK A;  5BWJ A;  2RCB A;  1MY1 A;  3S9N C;  3OEL A;  3Q26 A;  1YPN A;  1JEU A;  4N6K A;  2HQ0 A;  3FV2 A;  1D9V A;  4GWS A;  3B7D A;  3DEL B;  2XWV A;  1ATG A;  4H5G A;  3FV1 A;  4DLD A;  4EQ9 A;  3U72 A;  2HZL A;  2D3I A;  1S7Y A;  4F2Q A;  5ET5 A;  1RKM A;  1Q1K A;  5IKB A;  2X7Q A;  5H8F B;  1GGG A;  1MH3 A;  5DT6 A;  5FBP A;  1D9Y A;  3K01 A;  2WX9 A;  4QSD A;  4R6Y A;  4LON B;  4P1E A;  2B4L A;  2GRV A;  4U1O A;  2A5S A;  2XX7 A;  4KYS A;  3OO6 A;  1LBC A;  2XXQ A;  3RTF B;  1LBV A;  3LUZ A;  3SES A;  3UOR A;  3BBR A;  5AA2 B;  3GBB A;  4L17 A;  2I49 A;  2DE3 A;  3MC2 A;  1LEV A;  3B8B A;  3HFU A;  3DP4 A;  5TPA B;  4P9K A;  3R6U A;  3ODB A;  3D4G A;  4ONY A;  3HPI A;  4RY1 A;  3T22 A;  1IMF A;  1FBE A;  3QIM A;  1RYO A;  3B6T A;  3G3K A;  2HAV A;  4JXI A;  4F3G A;  3QUF A;  1B3G A;  2O7U A;  1P1O A;  2KQZ A;  4TQU Q;  3D4C A;  4QSE A;  1P1W A;  5F7V A;  2NOO A;  4F1V A;  2DWJ A;  3GLB A;  3S9M C;  1DK4 A;  3U8Q A;  5IGA A;  4PAK A;  5I5P A;  1URD A;  4C1T A;  4TLL B;  3TOD A;  1IXI A;  3KN8 A;  5DEX B;  4OMB A;  2REG A;  4FAT A;  1WVJ A;  1SW5 A;  1LAF E;  4OVQ A;  2UVI A;  1NNP A;  3U65 A;  1FPF A;  2FVZ A;  1I6A A;  5IZZ A;  1DPE A;  4K3F A;  1N04 A;  3IO4 A;  1FTL A;  3RY3 A;  3N6U A;  5HM4 B;  3U93 A;  3K2D A;  4PC9 A;  1PBP A;  4OA4 A;  1VSO A;  5TPA A;  3O6H A;  2G29 A;  2Z22 A;  4EQ7 A;  3H7M A;  3TCG A;  3G3F A;  3KGC A;  3TFL A;  3RPW A;  3KOT A;  4GF8 A;  2QS4 A;  1Z7M E;  1N7W A;  2FNC A;  4R74 A;  2DWA A;  2BJI A;  2F36 A;  2QRY A;  1IXH A;  1Z7N E;  4FEB A;  2XXY A;  3OMB A;  1B05 A;  1YXI A;  1QUI A;  5BUU A;  3O2A A;  4GOT A;  2Q8M A;  3MZB A;  2PMS A;  4ZE9 A;  2OWS A;  4XKQ A;  3OXN A;  5DYH A;  4PFY A;  3FAT A;  4FED A;  2F6G A;  2R6G E;  5M2V A;  3DM0 A;  1YAE A;  3RQT A;  1N76 A;  1FTJ A;  2CZL A;  1BTJ A;  3CSB A;  2Q88 A;  3K1M A;  4QXD A;  5K2Y A;  4ESX A;  3EHS A;  3GBA A;  3RN8 A;  2VPN A;  1DOT A;  1SW4 A;  3SDF A;  1Y3P A;  3USD A;  4I8C A;  1B2H A;  3ZKK A;  3VXC A;  2P2A A;  1IQ7 A;  2UYE A;  1B4Z A;  2VT5 A;  3IFA A;  1QKA A;  3KOS A;  1IIW A;  4F1U A;  4GWY A;  3V5A A;  3TTM A;  4GIZ A;  4N8G A;  1LGB C;  3O9P A;  2Y7W A;  3KN3 A;  4NWC A;  1KZ8 A;  2YPN A;  4NE4 A;  1IZ1 A;  5DVF A;  1IME A;  3K6X A;  4RYA A;  1HSJ A;  4H67 A;  4ZEB A;  1SD3 A;  1ZMG A;  2E1S A;  2Q2A A;  5H8F A;  1ELJ A;  4XTC Q;  2H98 A;  1XI6 A;  2CZK A;  3N26 A;  5LTC A;  3MVX A;  2B4M A;  4KD5 A;  5I56 A;  3A09 A;  2VP1 A;  3IJO B;  1H76 A;  4M1V A;  5I2K A;  1IMB A;  3H6V A;  3LUY A;  2H5Y A;  5KCJ B;  5K2X A;  1M5C A;  4P8B A;  5FHN A;  5FHM A;  2O84 X;  1IEJ A;  2I3W A;  2I58 A;  5JEI A;  1A7L A;  3IR1 A;  3FBP A;  1IXC A;  1KA1 A;  3LBS A;  4TLM B;  4NF6 B;  1B32 A;  2VD3 A;  4NMY A;  3PPN A;  4GLI A;  3SET A;  3PV0 E;  4MX6 A;  4I62 A;  1US4 A;  3Q29 A;  2OWT A;  2QS2 A;  3CFX A;  4PP0 A;  1FBD A;  2PX1 A;  1A55 A;  2HPG A;  2PFZ A;  1NH8 A;  4OTE A;  4DDD A;  1UIV A;  2F3B A;  1SI1 A;  3M3F A;  4MBP A;  1PB8 A;  5H8S A;  4DCX A;  3O29 A;  1LCF A;  3PPP A;  3G3H A;  1LBB A;  1FQC A;  4H8J A;  2ZYM A;  3D1R A;  2RIN A;  1FJ9 A;  3FXR A;  1JEV A;  3A29 A;  4X04 A;  4ELQ A;  1R9L A;  1VE4 A;  4N6P A;  1OLA A;  4LZ8 A;  4Q5T A;  3SZP A;  3K1P A;  4R73 A;  4GQO A;  4R6H A;  2F3D A;  3T9V A;  4H1X A;  2FYI A;  1TXF A;  3FZV A;  4XIG Q;  4G77 A;  1VFD A;  2O69 A;  4GX4 A;  4ZEC A;  1FCK A;  5ISU A;  4G68 B;  1PEB A;  1MQI A;  2AL4 A;  1P99 A;  1B52 A;  3BIH A;  3LSF B;  5CI5 A;  4PFR A;  2NWJ A;  1USY H;  2P3N A;  4IO5 A;  3IB2 A;  4DCY A;  3V8X B;  3C36 A;  2Q9T A;  4H65 A;  3O28 A;  5I2N A;  2Y84 A;  2V3U A;  3ISP A;  3RTW B;  1B3H A;  1S9T A;  1AH5 A;  4OVR A;  4EXK A;  2ONR A;  3S9E A;  1DTZ A;  3IAZ A;  3Q25 A;  1N0T A;  4G4P A;  2GHA A;  1POT A;  5AA4 B;  3LSW A;  3O66 A;  4NHB A;  3HCQ A;  4X1D A;  4MH5 A;  3VVF A;  2BJJ X;  1S50 A;  3E9X A;  4P0G A;  1CE2 A;  2Y7R A;  4DXB A;  1XVY A;  4QFL A;  4IGR A;  3TEL A;  4EQB A;  4PBH A;  2XD3 A;  3ILU B;  5EQ8 A;  4GVO A;  5LDZ A;  3MBP A;  4F29 A;  2XXX A;  2IA4 A;  1FBF A;  5I7I A;  4FEC A;  3TCF A;  4H0W A;  1MXW A;  5AA2 D;  4NTL A;  1Y4C A;  1FPL A;  4N07 A;  3H03 A;  2Q2C A;  2ZNT A;  1MXU A;  3VLU A;  1N84 A;  4P11 A;  1IUD A;  1OMP A;  2YLN A;  1JQF A;  5A5X B;  2OJT A;  3HHG A;  4NF8 B;  1PDA A;  1B7U A;  4KI0 E;  4YIC A;  2ESN A;  1N3W A;  5ITP A;  4BLA A;  4F3S A;  2QJE A;  3IO6 A;  4ELR A;  1MH4 A;  3EPE A;  1B7Z A;  3MVW A;  1B6H A;  2FHY A;  1UQW A;  5H8N B;  3FAS A;  3RYD A;  1FPD A;  1NH7 A;  5EQ7 A;  3SEW A;  1IMD A;  1CB6 A;  4KFQ A;  3L6H A;  1LLS A;  4F18 A;  1LFG A;  3MAM A;  3UA8 A;  1SYI A;  4IO7 A;  4OWD A;  3U1O A;  1AOV A;  1H45 A;  4OVJ A;  2OWZ A;  3G3G A;  4EXL A;  2WBD A;  2V4C A;  3VDF A;  3K6W A;  2F78 A;  3OD7 A;  5I56 B;  3EKI A;  1DMB A;  4DZ1 A;  3QK6 A;  4RA1 A;  2DXY A;  1NV7 A;  5IAI A;  4AB6 A;  1EYK A;  5I59 B;  4XFE A;  3DLN A;  4PGN A;  4QFO A;  2Y5L A;  4EF1 A;  2ZYN A;  5FHO A;  1XVX A;  3TUS A;  1MY2 A;  3KN7 A;  1NV0 A;  3TAJ A;  1B3L A;  4HXV A;  3T96 B;  3K0V A;  2UYF A;  1SW1 A;  4ZEF A;  5JTY A;  2F97 A;  4GXA A;  3MST A;  3TQW A;  2VGQ A;  2XWK A;  2PBW A;  4POW A;  1CNQ A;  1NV6 A;  2FIX A;  2REJ A;  3OO7 A;  3F11 A;  3FVG A;  2I0C A;  4AB5 A;  2THI A;  3CG1 A;  2XXU A;  4P56 A;  4OZ9 A;  3O6I A;  1EZ9 A;  4YB5 A;  5I3S A;  1FBP A;  1D9Q A;  5H8Q A;  1NNF A;  2XX8 A;  1FJ6 A;  3C31 A;  1TFD A;  1A8E A;  1SPI A;  4N81 A;  2DQV A;  1I69 A;  5H8H B;  1K9Y A;  2V93 A;  3VLW A;  5I57 B;  2O51 A;  4OET A;  3RUM A;  3MZ1 A;  2CEX A;  4Z0I A;  1FPI A;  3TTN A;  2QL3 A;  1QJM A;  3Q28 A;  1XS5 A;  3VV5 A;  2DP8 A;  1Y4T A;  5I58 B;  5EYG A;  1YTV A;  1YCJ A;  3SKP A;  5CBR A;  1ZJL A;  2O7I A;  2OK2 A;  3RPL B;  5ELV A;  3PTY A;  1PBQ A;  3H3G A;  5DVI A;  1Y20 A;  4IO2 A;  3E13 X;  4H46 A;  4NF4 A;  3UK4 A;  5TP9 A;  4MNI A;  5FTI A;  3WAF A;  4OEN A;  1VR5 A;  1EZP A;  5JTY B;  4P47 A;  1B5I A;  4ZZE A;  2E0S A;  3LV0 A;  2VD2 A;  1EYI A;  3SEY A;  4KYD A;  4N13 A;  3MZ9 A;  3W9V A;  1LST A;  2DS9 A;  4NF6 A;  3T66 A;  2HEU A;  4JWX A;  3T93 B;  4DXC A;  3M8U A;  1A99 A;  3TDJ A;  2PT1 A;  4IR8 A;  3CI8 A;  2QS1 A;  1WDN A;  3JZJ A;  3MW0 A;  4GX6 A;  2OCU A;  3T9H B;  5JK4 A;  5ITO A;  2R8T A;  2DXR A;  5J1D A;  1A54 A;  2B3B A;  1JW1 A;  4G61 A;  4NF5 B;  4XEQ A;  4G68 A;  2PVU A;  3E78 A;  1AL3 A;  2RF1 A;  4NF5 A;  3ROJ A;  3VFJ A;  2Z8E A;  5HBC A;  1D3K A;  4LAT A;  3RLF E;  1FTA A;  5ESY A;  2UXA A;  4THI A;  1MQJ A;  2ZYK A;  4O8M A;  5A5L A;  1HSL A;  2QVU A;  2ABH A;  1BK4 A;  3BFT A;  2Z23 A;  2F7C A;  2A5T A;  5EQA A;  3CFL A;  3W15 C;  4O3A A;  1QGX A;  1URG A;  1KA0 A;  2XXI A;  3A3C A;  2O1L A;  4GBW A;  1LAX A;  1NUZ A;  1AIV A;  2CEY A;  4QFK A;  2DVZ A;  1A40 A;  3TZA A;  2PCR A;  4KR5 A;  4OAN A;  2I3V A;  1BLF A;  2I48 A;  3EF7 A;  1TWY A;  1QKB A;  1OLC A;  3BFU A;  4PF6 A;  3ZS6 A;  4IY6 A;  4MEV A;  3K1N A;  4OHN A;  2M8C A;  4HCY A;  4OVT A;  1T0K A;  1R9Q A;  3S2V A;  2PFY A;  4U22 A; 
#chains in the Genus database with same CATH homology
 3MUQ A;  4H8J A;  1SBP A;  2ZYM A;  3M3K A;  1MXZ A;  3K6U A;  2RIN A;  2HXW A;  1QW0 A;  1VFE A;  4OFL A;  1SDX A;  4R6K A;  1B5J A;  3IJX B;  3FXR A;  1JEV A;  4OFO A;  4TOZ A;  3EHT A;  1OIB A;  1Y3N A;  2VHA A;  1MQH A;  4ELQ A;  1R9L A;  4OXV A;  4XKR A;  1XHY A;  1VE4 A;  4G68 C;  2ZYO A;  4N6P A;  3C9H A;  1OVB A;  1OLA A;  2X7P A;  4LZ8 A;  2F5X A;  2RC9 A;  3PU5 A;  4IO6 A;  4H5F A;  4WKM A;  5AA2 A;  3TQL A;  3PMW A;  4FIM A;  4Q5T A;  3K1P A;  4R73 A;  1XC1 A;  3I5O A;  4GQO A;  4EDP A;  3KG2 A;  4R6H A;  1MY0 A;  1UTB B;  3T9V A;  4H1X A;  4R9G A;  3CSG A;  1MQG A;  2FYI A;  4DXU A;  4KQP A;  4PFU A;  3KEI A;  3P7I A;  3LC8 A;  4PE5 B;  4RPN A;  1TXF A;  3FZV A;  4XIG Q;  1LB9 A;  2XXT A;  3TEP A;  4QHQ A;  3C33 A;  4G77 A;  1GR2 A;  5L9O A;  3G3I A;  1TT1 A;  1ANF A;  3VLV A;  4F2O A;  1VFD A;  5CRY A;  2O69 A;  4ZEC A;  5KDT B;  4YMB A;  1FCK A;  5ISU A;  3GZG A;  4OEV A;  3N6T A;  3FVO A;  2AL5 A;  1FQC A;  3TMG A;  1UTB A;  3HN0 A;  1Y3Q A;  4G68 B;  3SEU A;  1PEB A;  2OZZ A;  1MQI A;  4KCD A;  2AL4 A;  4R9F A;  3AXF A;  4HW8 A;  1P99 A;  1UIU A;  3B6W A;  3CFZ A;  1B52 A;  4LZ7 A;  3FGS A;  5CI5 A;  3LSF B;  2NVU B;  4Q8R A;  5I2N B;  2XX9 A;  2DVC A;  2NWJ A;  1NMU A;  1JET A;  2F7A A;  3OO9 A;  3C34 A;  1N3X A;  4MLQ A;  4PFT A;  4LUB A;  1GVC A;  4I1D A;  1USY H;  3OSQ A;  3IB2 A;  3K00 A;  4IO5 A;  3U92 A;  4DCY A;  5BUU A;  3V8X B;  5BWJ A;  4GFR A;  2RCB A;  1BP5 A;  1MY1 A;  3S9N C;  3C36 A;  4YKK A;  3OEL A;  2RCA A;  3Q26 A;  3C35 A;  1YPN A;  2Q9T A;  4H65 A;  2NXO A;  4BDN A;  1Y1M A;  3K4U A;  3O28 A;  5I2N A;  3UGW A;  1PB9 A;  4ZZA A;  1NKX A;  2Y84 A;  1Q35 A;  1JEU A;  2V3U A;  5KDT A;  1MDQ A;  1MXX A;  3RTW B;  3MVY A;  1DTG A;  4JWY A;  1B3H A;  2KLF A;  4NF8 A;  2HQ0 A;  3FV2 A;  1D9V A;  2ONK E;  1AH5 A;  1FQA A;  1S9T A;  4C1U A;  4EXK A;  3B7D A;  1FQB A;  3DEL B;  1JVX A;  2HZK A;  1IXG A;  2ONR A;  4HCW A;  4OQO A;  1ATG A;  3ECR A;  4H5G A;  3ZKL A;  5DTB A;  3S9E A;  3SER A;  5AE4 A;  1DTZ A;  4GRK A;  3IAZ A;  1L5T A;  5HPQ A;  1FTO A;  1POY 1;  3Q25 A;  1N0T A;  4G4P A;  3FV1 A;  1BIY A;  4DLD A;  3QAX A;  2GHA A;  3O97 A;  5I2K B;  4ELP A;  4EQ9 A;  1POT A;  4U21 A;  3LSW A;  3U72 A;  2HZL A;  2D3I A;  5AA4 B;  3IOW A;  3O66 A;  2O1M A;  4X48 A;  1S7Y A;  4XKN A;  5LOM A;  4F2Q A;  4LVQ A;  3OSR A;  3HCQ A;  1RKM A;  5EHS A;  3EQ1 A;  1Q1K A;  4MH5 A;  4X1D A;  4GWO A;  2BJJ X;  1S50 A;  3VVF A;  2HFB A;  1JW4 A;  3E9X A;  4GL0 A;  4P0G A;  5H8H A;  1CE2 A;  5IKB A;  3JV9 A;  2Y7R A;  3E3K A;  2X7Q A;  3KSJ A;  4G2Z A;  4DXB A;  4ZDM A;  5H8F B;  1XVY A;  4QFL A;  2OBG A;  1SYH A;  1DPP A;  1M5B A;  1RYX A;  1EH3 A;  2UVJ A;  4IGR A;  1GGG A;  1MH3 A;  2Y7K A;  5DEX A;  5F1Q A;  3TEL A;  2F8D A;  4RPO A;  5DT6 A;  1MPB A;  1D9Y A;  1FTK A;  3K01 A;  2QMW A;  2QPQ A;  4QSD A;  4EQB A;  2D5W A;  1OVT A;  4R72 A;  4R6Y A;  1XT8 A;  2XD3 A;  3ILU B;  4LON B;  2W7Y A;  4FAJ A;  4GVO A;  3CRB A;  4IO4 A;  3MBP A;  5A5X A;  4U1O A;  2GRV A;  4F29 A;  1ZLQ A;  2A5S A;  2XXX A;  3FVN A;  4R2B A;  2XX7 A;  2IA4 A;  3OO6 A;  3Q27 A;  1LBC A;  1FW0 A;  3I6V A;  4KYS A;  2XXQ A;  2ZMB A;  4FEC A;  4JDF A;  4H0W A;  3RTF B;  2H4I A;  3TCF A;  4Z7E A;  5L9M A;  3GXA A;  1GTK A;  1MQD A;  4G8M A;  3KSX A;  2ANJ A;  3SES A;  4MFI A;  3UOR A;  4ISU A;  3MPL A;  2PYY A;  1MXW A;  3BBR A;  3HST A;  3TTR A;  3TTK A;  2GFE A;  5AA2 B;  2I4B A;  5AA2 D;  1QUL A;  3GBB A;  4L17 A;  1ZKB A;  2I49 A;  3H6U A;  1MY3 A;  4NTL A;  1B0H A;  1Y4C A;  3LSX A;  2DE3 A;  3MC2 A;  4RXL A;  4EUO A;  4H6D A;  4BDM A;  2A5T B;  4AQ4 A;  5B7D A;  1UTH B;  3MP8 A;  4N07 A;  3RT6 B;  3DP4 A;  4F3P A;  1MM6 A;  1HSE A;  3H03 A;  5I59 A;  3KJT A;  2X26 A;  5TPA B;  4OYV A;  1FTM A;  2Q2C A;  3R6U A;  2ZNT A;  1MXU A;  3C4M A;  3ODB A;  3IB1 A;  3VLU A;  3D4G A;  4LP2 B;  4KYE A;  4ONY A;  1N84 A;  3HPI A;  1IUD A;  1OMP A;  1B3E A;  1JQF A;  2YLN A;  3E4R A;  1ZU0 A;  3H06 B;  4P11 A;  1H3D A;  2OJT A;  1LB8 A;  5A5X B;  3HHG A;  5ICQ A;  3IK6 B;  3QIM A;  2XHD A;  1RYO A;  1H43 A;  2XD2 A;  3BKI B;  4NF8 B;  1NL5 A;  3B6T A;  4E0X A;  4GD5 A;  1PDA A;  1B7U A;  3VVE A;  3G3K A;  3PMX A;  4KI0 E;  2HAV A;  3PD9 A;  4JXI A;  4YIC A;  4F3G A;  3QUF A;  1B3G A;  2O7U A;  1P1O A;  2ESN A;  4TQU Q;  3D4C A;  1IIT A;  1N3W A;  4QSE A;  4LA9 A;  1P1W A;  5F7V A;  4BDO A;  4BLA A;  5ITP A;  4F3S A;  2NOO A;  2QJE A;  3IO6 A;  4ELR A;  1MH4 A;  3EPE A;  1O63 A;  2DOJ A;  1NFT A;  4LZ5 A;  4F1V A;  1B7Z A;  2V84 A;  2DWJ A;  3GLB A;  3IOT A;  3WAE A;  4ESW A;  3S9M C;  2GH9 A;  1FQE A;  4FOR A;  3LR1 A;  3MVW A;  3I3V A;  4RK9 A;  3U8Q A;  1EZO A;  1B6H A;  3SEX A;  1I6B A;  3LSL A;  1URD A;  2FA7 A;  4C1T A;  1UQW A;  4TLL B;  5H8N B;  3TOD A;  1LCT A;  3FAS A;  1IXI A;  4LQ5 A;  1NH7 A;  4FE8 A;  3KN8 A;  3IOV A;  5DEX B;  3SEW A;  5CMK A;  4OMB A;  1CB6 A;  2RC7 A;  4KFQ A;  3L6H A;  2REG A;  4NWD A;  3MJN A;  3PUZ E;  2Z8F A;  4FAT A;  1WVJ A;  1SW5 A;  3H6T A;  3PUW E;  4DE8 A;  3QXM A;  1LLS A;  4F18 A;  1MY4 A;  5I58 A;  1LFG A;  1LAF E;  3MAM A;  4R75 A;  1MDP 1;  2H25 A;  2XXR A;  2DWI A;  3UA8 A;  2UVI A;  1NNP A;  1SYI A;  2P0S A;  1LAH E;  3EN3 A;  1LBB A;  4IO7 A;  1B7H A;  3IX1 A;  4OWD A;  3U1O A;  1EU8 A;  1AOV A;  3EHU A;  4U23 A;  1H45 A;  4F22 A;  4OVJ A;  1LFI A;  4IGT A;  2O68 A;  1LAG E;  1I6A A;  3G3G A;  3N5L A;  4EXL A;  3THI A;  2DWH A;  3RGY A;  1DPE A;  1B40 A;  2ZNU A;  1AMF A;  4K3F A;  3S2V A;  1N04 A;  4YZZ A;  1J1N A;  1QUJ A;  2B3F A;  3IO4 A;  4M4G A;  3ILT B;  3K6W A;  2WKY A;  5TP9 B;  4GXS B;  2F78 A;  3OD7 A;  3IOR A;  3PD8 A;  5CMB A;  1B3F A;  2V3T A;  5I56 B;  1M5E A;  1DMB A;  5CC2 A;  3FVK A;  5L8D A;  4DZ1 A;  1FTL A;  1LFH A;  3IOU A;  3RY3 A;  3N6U A;  5HM4 B;  4ZEI A;  3U93 A;  4RJZ A;  3K2D A;  1PBP A;  3QK6 A;  3G3J A;  4FJP A;  1VSO A;  4RA1 A;  1B1X A;  5TPA A;  2DXY A;  3O6H A;  4F39 A;  5IAI A;  1MS7 A;  2G29 A;  4AB6 A;  2Z22 A;  4U4S A;  5I59 B;  3T22 A;  3DLN A;  3H7M A;  4EQ7 A;  2Q8J A;  2I4C A;  3OEM A;  3KJ7 A;  3TCG A;  4QFO A;  3OEK A;  3G3F A;  4JSD A;  4PQJ A;  3KGC A;  4EF1 A;  1B1H A;  2ZYN A;  5FHO A;  1XVX A;  3TFL A;  2UVG A;  3N94 A;  4PFW A;  3TUS A;  3RPW A;  1MY2 A;  3KN7 A;  3KOT A;  3TAJ A;  4GF8 A;  2QS4 A;  4X1B A;  1Z7M E;  4QSC A;  3U94 A;  1B3L A;  1N7W A;  1SQY A;  3T96 B;  1US5 A;  2FNC A;  3K0V A;  4R74 A;  2UYF A;  1SW1 A;  2HAU A;  4ZEF A;  2F97 A;  4GXA A;  4WEP A;  2DWA A;  5JTY A;  3TQW A;  1B46 A;  3MP1 A;  4P0I A;  2I6E A;  1P1U A;  2VGQ A;  3KBR A;  4ND9 A;  3S9L C;  2F6P A;  2F36 A;  2PBW A;  4I9D A;  2QRY A;  1F9B A;  1P1N A;  2ALU A;  2V3Q A;  4POW A;  5B70 A;  5I57 A;  1IXH A;  1R6Z A;  3FJG A;  2REJ A;  4JBZ A;  3OO7 A;  1Z7N E;  4Q30 B;  4YU0 A;  1H44 A;  3F11 A;  3FVG A;  2I0C A;  4NF4 B;  1SI0 A;  4FEB A;  3VVD A;  1P1Q A;  4AB5 A;  2XXY A;  2THI A;  4OEU A;  1PB7 A;  3CG1 A;  2XXU A;  2DSF A;  3OMB A;  2Y7P A;  1MM7 A;  4OZ9 A;  1M5F A;  3O6I A;  1EZ9 A;  3V83 A;  1B05 A;  1ZTY A;  4YB5 A;  1QUI A;  4IY5 A;  2ONS A;  5H8Q A;  1NNF A;  1USY E;  3O2A A;  1MRP A;  2XX8 A;  1B58 A;  4GOT A;  3MZB A;  3PPO A;  5CMM A;  3FXU A;  2PMS A;  3HO7 A;  3C31 A;  4ZE9 A;  2OWS A;  1M5D A;  1OQG A;  1A8E A;  1TFD A;  2XXP A;  2LAO A;  4QFP A;  4XKQ A;  3KZG A;  3OXN A;  2DQV A;  1I69 A;  2H9B A;  1JW5 A;  5H8H B;  4RK2 A;  5DYH A;  3DP8 A;  4F31 B;  1DSN A;  3TCH A;  1Y1Z A;  4PFY A;  3FAT A;  4FED A;  2D21 A;  1WOD A;  2V93 A;  2H99 A;  2F6G A;  4ZE8 A;  3V89 B;  1KWH A;  3VLW A;  2R6G E;  5I57 B;  5M2V A;  1ZIU A;  2O51 A;  3FJ7 A;  3DM0 A;  3VDF A;  3G7W A;  4OET A;  4ECF A;  1YAE A;  3RQT A;  2XXV A;  1N76 A;  1JVY A;  3RUM A;  4XXU A;  5AA4 A;  3MZ1 A;  1FTJ A;  1MPC A;  1O7T A;  2CZL A;  3JYR A;  4JB7 A;  1BTJ A;  4ZS9 A;  4JWO A;  5AA1 A;  4C0R A;  3CSB A;  1PC3 A;  4Z0I A;  2Q88 A;  2IEE A;  1BKA A;  2QL3 A;  1QJM A;  3K1M A;  3TTN A;  5K2Y A;  3Q28 A;  3IB0 A;  4QRZ A;  4BDQ A;  4ESX A;  1XS5 A;  3MP6 A;  3VV5 A;  3EHS A;  2DP8 A;  3T9X B;  4YKP A;  3GBA A;  1MPD A;  3QSL A;  4JSO A;  3W9W A;  3RN8 A;  3A3U A;  1B51 A;  1DOT A;  1SW4 A;  1Y4T A;  5I58 B;  3SDF A;  1YTV A;  3TKD A;  3RT8 A;  1YCJ A;  4F3B A;  3SKP A;  1Y3P A;  2R9J A;  4KPT A;  3USD A;  5ICT A;  1II5 A;  5CM6 A;  4I8C A;  4XKP A;  1B2H A;  1ZJL A;  2CMO A;  2I0B A;  2O7I A;  2DE4 A;  2OK2 A;  2P2A A;  2V25 A;  3FUZ A;  3VXC A;  3ZKK A;  1MXV A;  3TYH A;  5ELV A;  5H8N A;  3MWB A;  1IQ7 A;  1PBQ A;  3H3G A;  5DVI A;  1Y20 A;  2UYE A;  1B4Z A;  3RNN A;  4IO2 A;  3E13 X;  1QVS A;  4YKI A;  4NF4 A;  2QS3 A;  4G8H A;  3UK4 A;  5TP9 A;  5CBS A;  3PPQ A;  1QKA A;  5FTI A;  3KOS A;  3FXQ A;  3WAF A;  4U4X A;  4OEN A;  3UN6 A;  4G8N A;  1Y9U A;  1IIW A;  4F1U A;  1VR5 A;  5EHM A;  5CMC A;  3MQ9 A;  5JTY B;  1EZP A;  4WXJ A;  1B5I A;  4O3C A;  4ZZE A;  2F7B A;  3V5A A;  2GHB A;  2E0S A;  4KHZ E;  1JNF A;  3O6G A;  2VD2 A;  3TTM A;  4GIZ A;  3SEY A;  4KYD A;  4N13 A;  3L6G A;  3VXB A;  1URS A;  3MZ9 A;  1LGB C;  1LST A;  2B65 A;  3MVZ A;  3O9P A;  3W9V A;  3OO8 A;  2DS9 A;  2Y7W A;  1MG1 A;  2YPN A;  3KN3 A;  4NWC A;  4NF6 A;  4R2F A;  3T66 A;  2NUV A;  3PUV E;  2HEU A;  4NE4 A;  4POX A;  3KFM A;  5EYF A;  4JWX A;  3K02 A;  3T93 B;  4DXC A;  1IZ1 A;  1B5H A;  5DVF A;  3UIF A;  3M8U A;  3K6X A;  5KZT A;  4WED A;  1A99 A;  1XOC A;  4RYA A;  1HSJ A;  2DE2 A;  3DP6 A;  4H67 A;  4ZEB A;  3TDJ A;  4YMA A;  2PT1 A;  2RKM A;  2UVH A;  2QS1 A;  3CI8 A;  2R71 A;  3PUY E;  5FTH A;  1UTH A;  3PMV A;  1SD3 A;  1WDN A;  3HV1 A;  3JZJ A;  2AIX A;  3MW0 A;  2OCU A;  1ZMG A;  2E1S A;  2Q2A A;  2RC8 A;  3PUX E;  4HS7 A;  5ITO A;  3T9H B;  5H8F A;  5JK4 A;  1TFA A;  1ELJ A;  4XTC Q;  4ZEK A;  2H98 A;  1B4H A;  4UA8 A;  2DXR A;  2O6A A;  1R1N A;  3VE1 B;  3N26 A;  5J1D A;  2Y7I A;  1A54 A;  3MVX A;  2B3B A;  3R26 A;  1FQF A;  4GL8 A;  3TPA A;  2OLB A;  4KD5 A;  4DIG A;  1JW1 A;  1B0L A;  2ZXT A;  4OFJ A;  3A09 A;  4PET A;  5I56 A;  3OEN A;  3R7X A;  2VP1 A;  2HCA A;  3IJO B;  5TU0 A;  1H76 A;  4M1V A;  4NED A;  4NF5 B;  4E0W A;  4OER A;  5I2K A;  4G68 A;  2PVU A;  3H6V A;  3LUY A;  2H5Y A;  5KCJ B;  1AL3 A;  1SVX B;  2RF1 A;  2XXW A;  3C32 A;  3HHF A;  4NF5 A;  4YKJ A;  5K2X A;  3VFJ A;  2Z8E A;  1M5C A;  1QUK A;  5HBC A;  3S4U A;  4ZED A;  1D3K A;  4LAT A;  4YAH X;  5FHN A;  3RLF E;  2UXA A;  1OQH A;  3MPK A;  4QF9 A;  4THI A;  5FHM A;  2O84 X;  1MQJ A;  2ZYK A;  3H4Z A;  4EF2 A;  1IEJ A;  1HSL A;  2I3W A;  2P1S A;  1SW2 A;  4LQ2 A;  2I58 A;  5JEI A;  1A7L A;  2ABH A;  3IR1 A;  3K6V A;  2AYS A;  3FD3 A;  3IL1 B;  4O3B A;  4YB7 A;  4F1Y A;  1NNT A;  3ONM A;  3BFT A;  5DVJ A;  2Z23 A;  1I6Q A;  3H6W A;  2F7C A;  2A5T A;  2ZNS A;  4RY1 A;  1IXC A;  2QMX A;  3FJM A;  2G93 A;  3CFL A;  1B9J A;  2VOZ A;  3PGF A;  3T9U A;  1FQD A;  3LBS A;  3PPR A;  4QFN A;  4TLM B;  3W15 C;  4NF6 B;  1B32 A;  2VD3 A;  4MLV A;  4NMY A;  4O3A A;  4RNS A;  3M3L A;  5L9S A;  1URG A;  4IB2 A;  2DYX A;  3PPN A;  4ELO A;  4GLI A;  3SET A;  2F35 A;  2XXI A;  3A3C A;  3CR9 A;  3PV0 E;  4Q0C A;  4UAC A;  3TTL A;  2O1L A;  1LAX A;  3CIJ A;  1US4 A;  4I62 A;  3B6Q A;  3FIR A;  3SEV A;  1AIV A;  1ZBM A;  3Q29 A;  2PT2 A;  4IO3 A;  2YJP A;  1A8F A;  2DVZ A;  1A40 A;  2Q89 A;  3CG3 A;  4QFK A;  4X9T A;  4U1Z A;  2OWT A;  4KR5 A;  2QS2 A;  3TZA A;  2I3V A;  4BDL A;  3CFX A;  4PP0 A;  2PX1 A;  4HTG A;  1BLF A;  3CVG A;  1A55 A;  2I48 A;  3EF7 A;  1TWY A;  1QKB A;  4MF3 A;  4OES A;  2QSX A;  4BDR A;  5I84 A;  4H8I A;  2XXH A;  1NH8 A;  1OLC A;  3BFU A;  4KCC A;  4OTE A;  4DDD A;  3ZS6 A;  5CBR A;  4IY6 A;  3OOA A;  1UIV A;  3QUJ A;  2Z8D A;  1MXY A;  3QYT A;  1N7X A;  1SI1 A;  3K1N A;  3M3F A;  2M8C A;  4HCY A;  4MBP A;  4OHN A;  4U2R A;  1PB8 A;  3UP9 A;  5H8S A;  1O64 A;  3ZSF A;  1T0K A;  4DCX A;  5KCJ A;  1D4N A;  1GV8 A;  3O29 A;  1LCF A;  1R9Q A;  3PPP A;  3G3H A;  5H8Q B;  4YB6 A;  4F19 A;  1NNK A;  2F34 A;  5AA3 A;  4U22 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...