3HSTA

N-terminal rnase h domain of rv2228c from mycobacterium tuberculosis as a fusion protein with maltose binding protein
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
365
structure length
365
Chain Sequence
KLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTNSSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Maltose-binding periplasmic protein
publication title Structural and functional characterization of an RNase HI domain from the bifunctional protein Rv2228c from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Escherichia coli k-12
total genus 118
structure length 365
sequence length 365
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3hstA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3hstA01
4ESXA 4XXUA 5I56A 3O28A 1IZ1A 4AB6A 3HN0A 2O1MA 3L6HA 1N7XA 4JDFA 5LOMA 3RT8A 5DT6A 3PUXE 4NEDA 3A3UA 2F36A 4H65A 1MRPA 1B9JA 4YB6A 5HPQA 3H6TA 5I84A 4RA1A 3PUYE 2HFBA 4R6HA 1SQYA 2UVHA 3M8UA 4QFPA 3KFMA 2F5XA 4G68A 4RXLA 4C0RA 3ZKLA 1N3XA 2DWAA 3SKPA 5I59B 5ISUA 1D9YA 3OD7A 4QSDA 4N07A 4NTLA 4XKRA 3MPLA 3S2VA 1B40A 4LZ8A 3B6QA 4F31B 3E4RA 3FV2A 1P1WA 3IK6B 3KJ7A 4KD5A 3VFJA 4Q8RA 3O9PA 4JWXA 5L8DA 4X1DA 4RYAA 1AIVA 1N0TA 1WVJA 1FQDA 4I1DA 3THIA 3KBRA 3MVYA 3V83A 3U1OA 1BIYA 1S50A 1Y4CA 1JETA 1YCJA 3VVFA 4X9TA 4BDMA 3I3VA 4HTGA 1SI0A 5CMKA 1A8FA 2HEUA 1IXCA 4GXSB 3FXRA 3U94A 2OZZA 3TTNA 2F35A 5DVJA 3IJXB 2G93A 3PUZE 5KDTB 5AA2B 1B2HA 1LB9A 3VVDA 2CMOA 3P7IA 2I49A 4XKPA 3LSWA 1PEBA 5HBCA 5I58B 3OEMA 2F78A 3SEUA 2XXHA 1EZ9A 3PPNA 3TTLA 2AIXA 2PT1A 3RN8A 1B7ZA 1QULA 3B7DA 4PE5B 4QFNA 4NF8B 4HCWA 3JYRA 3OO8A 1LSTA 4XIGQ 2LAOA 3EHTA 4YMAA 2HZLA 3FJ7A 4L17A 3PMXA 1GV8A 1R9QA 3R26A 1A40A 3O97A 3PD8A 1US4A 3FIRA 1DPPA 2Z23A 3GBAA 3MJNA 4DXUA 2Y7WA 1GGGA 4FEBA 1A8EA 1US5A 4ESWA 3PUVE 1M5CA 1L5TA 1BLFA 3G7WA 4XKQA 3FJGA 1QUJA 2HCAA 3K6XA 1B5JA 1EZPA 3M3FA 1JW4A 1IIWA 2RCAA 2F6PA 1N04A 4OFLA 1DTZA 2Q89A 1PC3A 4OVJA 4F39A 1URGA 3FXUA 3UN6A 3DELB 4MLVA 3BFTA 3HHGA 3H6WA 1Y1MA 1B52A 3O6IA 1LB8A 3GLBA 1Y3NA 1B0LA 3G3JA 4HCYA 2UYEA 4LUBA 1B3EA 3PD9A 3RGYA 3WAFA 1FCKA 1ZIUA 4KPTA 5K2XA 5CMMA 1N7WA 3RQTA 5TPAA 2DE2A 3K01A 4YKJA 2OLBA 1Q1KA 1PDAA 4MFIA 4N6PA 1SW5A 2OCUA 4G8NA 1TT1A 2ZXTA 1SYIA 3VLVA 3L6GA 1EZOA 2V3QA 1FQFA 3USDA 1P99A 1B58A 1FTOA 5F1QA 3K1MA 2I0BA 4LVQA 3SESA 2A5TA 1B3HA 5I59A 3Q29A 4FE8A 2NWJA 1B51A 4ZEFA 4F1YA 2AL4A 1MG1A 3KJTA 3MZ1A 3G3KA 3F11A 1B5IA 2OJTA 2Q9TA 4UACA 1MM6A 1NNPA 4YKIA 3K4UA 1B1XA 1DPEA 1NNTA 1NKXA 2UXAA 3RTWB 4OZ9A 4YMBA 1RYOA 2YLNA 4ZZAA 1AH5A 1MH4A 5H8FB 4H8JA 1B4HA 4MBPA 4R6KA 4EXLA 4F1VA 1MH3A 2DSFA 1M5DA 5KCJB 1VE4A 3PPQA 4F18A 4U4XA 1MXUA 2V93A 2ZYNA 1A7LA 3N6UA 2XX8A 3FZVA 4R6YA 1MXYA 3EN3A 1MQHA 4BDLA 1QUKA 2NUVA 1FTMA 1SDXA 5CMBA 2QS2A 1HSJA 2WKYA 4IY5A 5AA4B 5L9MA 1IEJA 1M5FA 2ONRA 4C1UA 3HPIA 2O7UA 5KDTA 2W7YA 4R75A 2O84X 5AA2A 1USYH 5H8NA 4PFWA 1JW5A 2Y7IA 3U72A 1ATGA 1PB7A 1QJMA 1I6BA 5DVIA 3TFLA 3KSXA 3IO6A 4KQPA 2VD3A 5CRYA 4NWDA 1AOVA 4DCXA 1ZJLA 3G3HA 4IO7A 1BTJA 5I57B 3K02A 4OHNA 1VSOA 4P0IA 4GWOA 4H5GA 1D4NA 4DXCA 4F2QA 2QS1A 4DLDA 1JVYA 2XXVA 4EQBA 4NF8A 4QFOA 1BKAA 5DEXB 4QFKA 3PPPA 4ECFA 4YB5A 2ONSA 3OO7A 4THIA 1MQJA 2AYSA 3N26A 2XXQA 4H8IA 1SD3A 3VXBA 2F7BA 3W9WA 2Y7RA 3Q26A 4ZEDA 3O29A 3MP1A 3ODBA 5EYFA 2I4BA 2DOJA 3MZBA 4OFJA 4FJPA 1O63A 4EF1A 4EQ9A 4N13A 1DMBA 3OENA 5F7VA 2P1SA 4WKMA 3C33A 4NE4A 2QSXA 2GRVA 3T66A 4WEDA 2G29A 4OFOA 4G4PA 1PBQA 1Y1ZA 4IO2A 4JBZA 4LP2B 2RF1A 3I5OA 4GXAA 1POY1 4AB5A 3IOWA 5TP9B 3IB1A 1LCFA 5B7DA 5L9SA 3H06B 4Z0IA 1B1HA 2V3UA 3MP6A 2B3BA 2OWSA 5CBSA 5ICTA 4MF3A 1MQGA 3BFUA 3DP8A 2GHAA 2FA7A 3I6VA 3HO7A 5H8SA 4NMYA 1Y4TA 2RC8A 1RYXA 1I6QA 4OEVA 4OQOA 3IOTA 3LSFB 1HSEA 2V25A 3FGSA 1ZMGA 2F7CA 1UQWA 2PMSA 3D4GA 4O3CA 3MUQA 3DM0A 3CIJA 3T96B 1TXFA 2Y84A 3C35A 5L9OA 3O6GA 4GIZA 4F3PA 2I0CA 1JNFA 3KG2A 2HXWA 4RPOA 1Y20A 4O3BA 5CM6A 3TCFA 1M5BA 3FV1A 4ONYA 2ZYMA 2ZNSA 4EDPA 5A5XB 4BLAA 5M2VA 2XXUA 3LSLA 3O6HA 5H8FA 1XC1A 1P1UA 1M5EA 1SVXB 3HSTA 2A5SA 3PUWE 4GVOA 5ITPA 4KR5A 2H25A 3M3LA 3MWBA 3U8QA 5KCJA 1B3GA 4YU0A 4KYDA 3EQ1A 1FQBA 5FHNA 3CSGA 5ELVA 4Z7EA 3RPWA 5KZTA 2DE3A 3TQWA 1WDNA 2B3FA 3K1NA 1LGBC 4BDQA 2UVGA 3DP4A 4KI0E 2PBWA 3TTMA 3CRBA 3E3KA 4GFRA 1UIVA 3ILTB 2I58A 4NF4B 5AA4A 4F19A 1YTVA 4GL8A 2PX1A 3MBPA 1OLCA 1IXIA 3CI8A 3CFZA 2FYIA 2DE4A 4ELRA 1VFEA 5FTHA 3R7XA 2DWJA 1LCTA 4ZEIA 3TYHA 4ZE8A 4TOZA 3BBRA 1YAEA 2UYFA 3R6UA 5JEIA 1Y3QA 1R9LA 4MLQA 3CFXA 1R1NA 2UVJA 3MC2A 1IQ7A 3QIMA 4LQ5A 2V3TA 4HW8A 2PT2A 4IO4A 3FVGA 4H6DA 5FHOA 3LBSA 4POWA 5I57A 4LA9A 5AA1A 3OMBA 1TFAA 3LUYA 2QPQA 1NH7A 1H45A 1J1NA 3IB2A 4E0WA 4RK2A 3OXNA 3PPOA 2QL3A 1UTBB 3OEKA 1AMFA 1LAGE 3K6WA 1OLAA 1I69A 4R9GA 3UGWA 2DP8A 4PFTA 2O6AA 3TODA 3H7MA 2ABHA 4KYSA 4EQ7A 4ELQA 2HAVA 2XD3A 1F9BA 1FTLA 3W15C 1SW4A 4RY1A 4G8MA 1CB6A 4TQUQ 2XXWA 3IR1A 4OESA 2M8CA 1B46A 4JWOA 4H0WA 4PQJA 4X1BA 1B7HA 2H9BA 1P1NA 3CFLA 1Z7NE 4FECA 4F3BA 4NF5B 3T9UA 4TLLB 2XXRA 3OO9A 3BKIB 3DP6A 3D4CA 4YICA 3QXMA 1B3FA 3MQ9A 1QKAA 4IGRA 1URSA 2I3WA 5TP9A 3W9VA 1VR5A 1S7YA 4RNSA 3OELA 4IB2A 4YKKA 1SBPA 4G68C 1II5A 1B6HA 1USYE 2Y7KA 3PGFA 5IAIA 5H8QB 5IKBA 4DIGA 2NXOA 2B65A 3K1PA 3E13X 1GTKA 4P11A 4U2RA 4YB7A 1FTKA 2NOOA 1DOTA 5CBRA 2VHAA 4C1TA 2QS3A 2OWTA 3KN3A 2XXYA 1MY3A 1QVSA 1XVYA 1ZKBA 1OQHA 4ELOA 2I3VA 1LAFE 4LATA 5A5XA 2DXRA 3C34A 2DVCA 3RTFB 3OSQA 1B05A 1ZBMA 4OYVA 2O68A 3QAXA 1EH3A 5B70A 2Z8EA 1B0HA 4HS7A 3OSRA 1D3KA 4IY6A 3T22A 4F29A 1ELJA 1O64A 3VLUA 5I2NB 3SEVA 1YPNA 2Q2AA 5H8HB 4TLMB 3ONMA 5AA2D 1N84A 1MPBA 4JWYA 4JSOA 4M4GA 4K3FA 3KGCA 2DXYA 5I58A 4UA8A 3QUJA 4WEPA 3M3KA 3HCQA 2DWHA 5K2YA 3RUMA 5DVFA 1FW0A 4U4SA 4H1XA 2P0SA 1B32A 2D21A 3GZGA 3GXAA 1QUIA 4ZZEA 4DCYA 3SEWA 1MQDA 4ZS9A 3FUZA 2RC7A 3FVOA 4E0XA 3V89B 4OEUA 4BDNA 3MVWA 5I2KB 2QJEA 1FTJA 1UTBA 4P0GA 3K00A 4MH5A 2XXIA 3H3GA 1UTHB 3KN8A 3CR9A 3VVEA 1JQFA 2X7PA 4U1OA 1NFTA 1H43A 3KOTA 3MVZA 3UORA 4QFLA 5ITOA 1WODA 3Q25A 2V84A 3MAMA 1SW1A 4OERA 2QS4A 2HZKA 4R72A 4XKNA 3OOAA 3CG1A 1A54A 3QYTA 4PP0A 2O1LA 3RLFE 3T9XB 3KN7A 1B4ZA 4IO6A 3ZKKA 3Q28A 3PPRA 4NF5A 1N3WA 1H44A 4F3SA 4KCDA 5JTYB 4AQ4A 3U92A 4O3AA 4GQOA 4FORA 4QSEA 1JVXA 3RY3A 2REJA 2XXTA 2RINA 5TPAB 4H67A 3IO4A 2Y7PA 1OMPA 1LAHE 3TUSA 3ECRA 1NL5A 3G3IA 3PMWA 2X7QA 4G8HA 4OTEA 1MPCA 4QHQA 4U21A 3VLWA 2F7AA 4DZ1A 3EHSA 1RKMA 4GL0A 2A5TB 3TCGA 3S9EA 5H8QA 4Q30B 3H6UA 2AL5A 2F6GA 2PVUA 2XXPA 4ZDMA 3ZS6A 1GVCA 4U23A 4U1ZA 2O69A 3QUFA 3TAJA 2X26A 3C31A 3TQLA 2H98A 3IL1B 1Y9UA 1HSLA 3FXQA 3LC8A 4DDDA 3VE1B 4DXBA 5CMCA 4PFUA 1MY4A 4ZEKA 1XS5A 1PBPA 3IOUA 1DSNA 1S9TA 4POXA 3EF7A 3JZJA 3QSLA 3TZAA 3K2DA 2ESNA 1FQCA 1QKBA 4I8CA 4GOTA 3TELA 1MQIA 2VD2A 3N6TA 3TDJA 4I9DA 2DYXA 3IORA 1JEUA 3IAZA 3SEYA 1OVTA 1MM7A 3FASA 4KCCA 4ZECA 4ZEBA 1IXGA 5I2NA 2Z8FA 1OIBA 2NVUB 3H4ZA 3V8XB 2VGQA 4GF8A 5H8HA 3AXFA 1DTGA 1MXXA 5H8NB 1PB9A 4FAJA 4IGTA 3EHUA 4Q5TA 2E1SA 4YAHX 3TMGA 2R71A 3C36A 4IO3A 1FQAA 2D3IA 1JEVA 5TU0A 1LAXA 3HHFA 2Q8JA 1ZU0A 4EF2A 1MY1A 3DLNA 1SYHA 3UK4A 4OETA 4R74A 3V5AA 1H3DA 4EUOA 2HAUA 4OWDA 2GHBA 3B6TA 3VXCA 4BDRA 3MVXA 3MPKA 4ISUA 4Q0CA 3T9HB 2I4CA 3GBBA 5DEXA 1URDA 4FIMA 4JB7A 2F8DA 3C4MA 3S9NC 2YJPA 5I2KA 3FATA 2Z22A 3JV9A 5AE4A 4RK9A 4IO5A 3FJMA 4OXVA 1UTHA 1P1OA 1XT8A 3RT6B 3KEIA 3E9XA 5DTBA 2O7IA 3CSBA 4XTCQ 3MW0A 3EPEA 4OENA 2ZNTA 2XXXA 3SETA 1AL3A 1ANFA 1IITA 1XVXA 2DVZA 2F34A 3TTRA 2OK2A 3QK6A 3S9MC 1I6AA 1FQEA 2GFEA 3FVKA 4OMBA 4NF6B 4NWCA 1LLSA 1POTA 4F3GA 4QSCA 2P2AA 2XHDA 1UIUA 2REGA 3PU5A 4PETA 1B7UA 4G2ZA 4KHZE 3RNNA 1MXWA 5I56B 1A99A 1QW0A 4WXJA 2HQ0A 1NNKA 3K6UA 5BWJA 4RJZA 5JTYA 1MDQA 1SI1A 3UA8A 1SW2A 4R2FA 1LBCA 2QMXA 2ALUA 4RPNA 1Q35A 1MY2A 4G68B 3T9VA 3OO6A 3FVNA 1NMUA 3VV5A 1IXHA 4QF9A 3IX1A 1GR2A 4F1UA 2DQVA 4BDOA 2THIA 1OQGA 3KSJA 2Q88A 2E0SA 3FD3A 1NH8A 1MDP1 3G3GA 2ZYOA 2BJJX 2KLFA 3UIFA 2ZMBA 3S9LC 4FEDA 1P1QA 3SDFA 3TCHA 2GH9A 1CE2A 2RC9A 4KYEA 3N94A 2F97A 3Q27A 3U93A 1KWHA 1MPDA 1XOCA 3C32A 3KOSA 2DWIA 5EHMA 4F2OA 1LFGA 4LQ2A 3N5LA 1MS7A 3B6WA 3A3CA 2QMWA 2O51A 4FATA 4GLIA 4KFQA 1B3LA 2H4IA 1VFDA 3O2AA 3MP8A 3CVGA 1LFHA 4GRKA 4GD5A 4R73A 5CI5A 4DE8A 2RCBA 2FNCA 1NNFA 3K0VA 2ONKE 1PB8A 4NF4A 5EHSA 2ZNUA 1MY0A 3O66A 4ND9A 3VDFA 4H5FA 5HM4B 1ZTYA 2D5WA 3A09A 2QRYA 1OVBA 1ZLQA 5CC2A 1TWYA 5AA3A 1Y3PA 2OBGA 4ZE9A 4YZZA 3TKDA 4M1VA 2XX9A 4R9FA 1B5HA 1EU8A 1LBBA 1IUDA 1BP5A 1Z7ME 4R2BA 1JW1A 4G77A 1T0KA 4ELPA 3TPAA 3KZGA 4JSDA 3T93B 4LZ5A 2R6GE 3UP9A 4YKPA 3HV1A 4F22A 2YPNA 2VOZA 2Z8DA 2PYYA 5FTIA 1MXZA 4JXIA 5BUUA 2VP1A 3WAEA 2UVIA 3ZSFA 2DS9A 2H99A 2Q2CA 3G3FA 2I48A 3IJOB 5ICQA 2RKMA 1TFDA 4QRZA 2R9JA 3C9HA 1O7TA 3LR1A 4EXKA 4I62A 2H5YA 3S4UA 2IA4A 3CG3A 3IOVA 4PFYA 2CZLA 3SEXA 2IEEA 3ILUB 4U22A 3LSXA 1D9VA 1MXVA 3MZ9A 4LONB 3TEPA 2I6EA 1H76A 3K6VA 1XHYA 3SERA 1N76A 5J1DA 5JK4A 5FHMA 4NF6A 4LZ7A 4X48A 1LFIA 2XD2A 2ZYKA 1R6ZA 2ANJA 3PMVA 5DYHA 1A55A 3PV0E 3H03A 2XX7A 3H6VA 3IB0A 3TTKA
chains in the Genus database with same CATH superfamily
3T0JA 4ESXA 4XXUA 1JP4A 5I56A 3O28A 1IZ1A 4AB6A 3HN0A 2O1MA 4PF6A 3L6HA 1N7XA 4JDFA 5LOMA 3RT8A 5DT6A 3PUXE 4NEDA 3A3UA 2F36A 4H65A 1MRPA 1B9JA 4YB6A 5IZ3B 5HPQA 3H6TA 5I84A 1DK4A 4RA1A 3PUYE 2HFBA 4R6HA 1SQYA 2JJKA 2UVHA 3M8UA 4QFPA 3KFMA 4NQ8A 2F5XA 4G68A 4RXLA 4C0RA 5IGAA 3ZKLA 1N3XA 2DWAA 3SKPA 5I59B 5ISUA 1D9YA 3OD7A 4QSDA 4N07A 4NTLA 4XKRA 3MPLA 3S2VA 1B40A 4LZ8A 3B6QA 3LV0A 4F31B 3E4RA 3FV2A 4DI3D 1P1WA 4PCDA 3IK6B 3KJ7A 4KD5A 2FIXA 3VFJA 4Q8RA 3O9PA 4JWXA 4GWUA 5L8DA 4X1DA 4RYAA 1AIVA 1N0TA 1WVJA 1FQDA 4I1DA 4P47A 3THIA 3KBRA 3MVYA 3V83A 3U1OA 4GX3A 1BIYA 1S50A 2VT5A 1Y4CA 1DCUA 1JETA 1YCJA 3VVFA 4X9TA 4BDMA 3I3VA 4HTGA 1SI0A 5CMKA 1A8FA 2HEUA 3U65A 1IXCA 4GXSB 3FXRA 3U94A 1K9ZA 2V4CA 2OZZA 3TTNA 2F35A 5DVJA 3IJXB 4OVPA 2G93A 4HE1A 3PUZE 1NUYA 5KDTB 5AA2B 1B2HA 5J16A 1LB9A 3VVDA 2CMOA 3P7IA 2I49A 4XKPA 3LSWA 1PEBA 4PC9A 5HBCA 5I58B 3OEMA 2F78A 3SEUA 2XXHA 1EZ9A 4N6DA 3PPNA 3TTLA 2AIXA 1FPEA 2PT1A 3RN8A 1B7ZA 1QULA 3B7DA 4PE5B 4QFNA 4NF8B 4HCWA 3JYRA 3OO8A 1LSTA 4XIGQ 2LAOA 3EHTA 4YMAA 2HZLA 3FJ7A 1EYJA 5LDZA 4L17A 3PMXA 1GV8A 1R9QA 2WYPA 3FXBA 1BK4A 2HHMA 4O8MA 3R26A 1FRPA 1A40A 3O97A 3PD8A 1US4A 3FIRA 1DPPA 4P1EA 2Z23A 5EQ9A 3GBAA 3MJNA 4DXUA 2Y7WA 1GGGA 4FEBA 1A8EA 1US5A 4ESWA 2WX9A 3PUVE 1M5CA 1L5TA 1BLFA 3G7WA 4XKQA 3FJGA 1QUJA 2HCAA 3K6XA 1B5JA 1EZPA 3M3FA 1JW4A 4GWYA 1IIWA 2RCAA 2F6PA 1N04A 4OFLA 1DTZA 2Q89A 1PC3A 4OVJA 4F39A 1URGA 3FXUA 3UN6A 4I3YA 3DELB 5F24A 1LBYA 4PDDA 4MLVA 3BFTA 3HHGA 3H6WA 4MNPA 1Y1MA 1B52A 3O6IA 1LB8A 2L5VA 3GLBA 1Y3NA 1B0LA 2XWKA 3G3JA 4HCYA 2UYEA 4LUBA 1B3EA 3PD9A 3RGYA 3WAFA 1FCKA 1ZIUA 4KPTA 3LUZA 1IMBA 5K2XA 2WBBA 5CMMA 1N7WA 1IMFA 3RQTA 5TPAA 4PFRA 2DE2A 3K01A 4YKJA 2OLBA 1Q1KA 1PDAA 4MFIA 5IZ3A 4N6PA 1SW5A 2OCUA 4G8NA 1TT1A 2ZXTA 1SYIA 3VLVA 3L6GA 1EZOA 2V3QA 1FQFA 3USDA 1P99A 1B58A 1FTOA 5F1QA 3K1MA 2I0BA 4LVQA 3SESA 2A5TA 1B3HA 5I59A 3Q29A 4FE8A 2NWJA 1B51A 4ZEFA 4F1YA 2AL4A 1MG1A 3KJTA 1D9QA 3MZ1A 1FBGA 3G3KA 3F11A 1B5IA 2OJTA 2Q9TA 4UACA 1MM6A 5LTCA 1NNPA 4YKIA 3K4UA 1B1XA 1DPEA 1NNTA 1NKXA 2UXAA 3RTWB 4AS4A 4OZ9A 4YMBA 1RYOA 2YLNA 4ZZAA 3NOHA 2Y5LA 1AH5A 1MH4A 4GX4A 5H8FB 4H8JA 1B4HA 4MBPA 4R6KA 4EXLA 4F1VA 1MH3A 2DSFA 1M5DA 2PFYA 4PBHA 5KCJB 4G61A 1VE4A 3PPQA 4F18A 4U4XA 1MXUA 2V93A 2ZYNA 1A7LA 3N6UA 2XX8A 3FZVA 4R6YA 1MXYA 3EN3A 2VPNA 1MQHA 4BDLA 1QUKA 2NUVA 1FTMA 1SDXA 5CMBA 2QS2A 1HSJA 2WKYA 4IY5A 5AA4B 5L9MA 1IEJA 2MKZA 1M5FA 2ONRA 4C1UA 3HPIA 2O7UA 1YYZA 5KDTA 2W7YA 4R75A 2O84X 5AA2A 1USYH 5H8NA 4PFWA 1JW5A 2Y7IA 3U72A 1ATGA 1PB7A 1QJMA 1I6BA 5DVIA 3TFLA 3KSXA 3IO6A 4KQPA 2VD3A 2P3NA 5CRYA 4NWDA 1VDWA 1AOVA 2WEFA 3FBPA 4DCXA 1ZJLA 3G3HA 4IO7A 4NN3A 1BTJA 5I57B 3K02A 4OHNA 1VSOA 4P0IA 4GWOA 4H5GA 1D4NA 4DXCA 4F2QA 2QS1A 4DLDA 1JVYA 3KC0A 2XXVA 1LBZA 4P56A 4EQBA 3BIHA 4NF8A 1LEVA 4QFOA 1BKAA 5DEXB 4QFKA 3PPPA 4ECFA 4YB5A 2ONSA 3OO7A 4THIA 1MQJA 2AYSA 3N26A 2XXQA 4H8IA 1SD3A 3VXBA 2F7BA 3W9WA 2Y7RA 3Q26A 4N17A 4ZEDA 3O29A 3T1BA 3MP1A 4P1LA 5IZ1A 3ODBA 5EYFA 2I4BA 2DOJA 3MZBA 4OFJA 4FJPA 1O63A 4EF1A 1NV5A 4EQ9A 5ET7A 4N13A 1DMBA 3OENA 5F7VA 2P1SA 4WKMA 3C33A 4NE4A 2QSXA 2GRVA 3T66A 4WEDA 2G29A 4MMPA 4OFOA 4G4PA 1PBQA 1Y1ZA 4QBAA 5ET6A 4IO2A 4JBZA 4LP2B 4P9KA 2RF1A 3I5OA 4GXAA 1POY1 4AB5A 3IOWA 4I3EA 5TP9B 3IB1A 1LCFA 5B7DA 2QVRA 5L9SA 3H06B 4Z0IA 3IFCA 1B1HA 2V3UA 3MP6A 2B3BA 2OWSA 5CBSA 5ICTA 4MF3A 1FSAA 1MQGA 3BFUA 4KXPA 3DP8A 4PDHA 2GHAA 3ROJA 2FA7A 3I6VA 3HO7A 5H8SA 4NMYA 1Y4TA 2RC8A 1RYXA 1I6QA 5ESYA 4N15A 4OEVA 4OQOA 4O7IA 3IOTA 3LSFB 1HSEA 2V25A 1KA0A 3FGSA 1ZMGA 2F7CA 1UQWA 2PMSA 3D4GA 3RYDA 4O3CA 3MUQA 3DM0A 3CIJA 3T96B 1TXFA 2Y84A 3C35A 1DBZA 5L9OA 3O6GA 1LBXA 4O7MA 4GIZA 4F3PA 2I0CA 1JNFA 3KG2A 2HXWA 4RPOA 1Y20A 4O3BA 5CM6A 3TCFA 1M5BA 3FV1A 4ONYA 2ZYMA 2ZNSA 4EDPA 5A5XB 4I40A 4BLAA 4XEQA 2FHYA 5M2VA 2XXUA 3LSLA 3O6HA 5H8FA 1IMAA 1XC1A 1P1UA 1M5EA 4N8GA 1FBFA 1Q9DA 3D1RA 1SVXB 3HSTA 2A5SA 3PUWE 4GVOA 5ITPA 1FPDA 4GWZA 4KR5A 5IM2A 2H25A 3M3LA 3MWBA 3U8QA 5KCJA 1EYIA 1B3GA 4MNCA 4YU0A 4KYDA 3EQ1A 1FQBA 3CSGA 5FHNA 5ELVA 4Z7EA 4PFBA 3RPWA 5KZTA 2DE3A 3TQWA 1WDNA 2B3FA 3K1NA 1LGBC 4BDQA 2UVGA 3DP4A 4KI0E 2PBWA 3TTMA 3CRBA 3E3KA 4GFRA 1UIVA 4MIJA 4PE3A 3ILTB 2I58A 4NF4B 5AA4A 5I7IA 4F19A 1YTVA 1EYKA 4GL8A 2PX1A 3MBPA 1OLCA 1IXIA 3CI8A 3CFZA 2FYIA 2DE4A 4ELRA 1VFEA 5FTHA 3R7XA 2DWJA 1LCTA 4ZEIA 3TYHA 4ZE8A 4TOZA 3BBRA 1YAEA 2VPOA 1FBDA 2UYFA 3R6UA 5JEIA 3ISPA 1Y3QA 1NUWA 1R9LA 4MLQA 3CFXA 5ET8A 1FBCA 2ZZVA 1R1NA 2UVJA 3MC2A 1IQ7A 3QIMA 5EQ8A 4LQ5A 2V3TA 4HW8A 2PT2A 2DDKA 4IO4A 3FVGA 4H6DA 5FHOA 3LBSA 4POWA 1RDYA 5I57A 4LA9A 5AA1A 3OMBA 1TFAA 3LUYA 2QPQA 1NH7A 1H45A 2QFLA 1RDZA 1J1NA 3IB2A 4E0WA 4RK2A 3OXNA 3PPOA 2QVVA 2QL3A 1UTBB 3OEKA 1AMFA 1LAGE 3K6WA 5EYGA 1OLAA 1I69A 4R9GA 3UGWA 2DP8A 4PFTA 2O6AA 3TODA 4HE2A 3H7MA 2ABHA 4KYSA 4EQ7A 2OX3A 4H46A 1FPLA 3EKIA 4ELQA 2HAVA 2WYKA 4GX6A 1NV4A 2XD3A 1F9BA 1FTLA 3KC1A 3W15C 1SW4A 4RY1A 4G8MA 1CB6A 3CHGA 1NUZA 4X04A 4TQUQ 4NG7A 2XXWA 3IR1A 4OESA 2M8CA 2PFZA 1B46A 2ZZXA 4JWOA 4H0WA 4PQJA 4X1BA 1B7HA 2H9BA 1P1NA 3CFLA 4MCOA 1Z7NE 4FECA 4F3BA 4NF5B 3T9UA 1IMCA 4TLLB 2XXRA 3OO9A 2XXKA 3BKIB 3DP6A 3D4CA 4YICA 4PAIA 3QXMA 1B3FA 3MQ9A 1QKAA 4IGRA 1CNQA 1URSA 2I3WA 5TP9A 3W9VA 1VR5A 1AWBA 1S7YA 3GYYA 4RNSA 5ET5A 4LN5A 3OELA 4IB2A 4YKKA 4UABA 1SBPA 4G68C 1II5A 4N4UA 1B6HA 1USYE 2Y7KA 5T3JA 3PGFA 5IAIA 5H8QB 5IKBA 4DIGA 2NXOA 2B65A 3K1PA 3E13X 1NV2A 1GTKA 4P11A 4U2RA 5A5LA 4YB7A 1FTKA 2NOOA 1DOTA 4XFEA 5CBRA 2VHAA 4C1TA 2QS3A 2QVUA 2OWTA 3KN3A 2XXYA 1MY3A 1QVSA 1XVYA 1ZKBA 1OQHA 4ELOA 2I3VA 1LAFE 4LATA 5A5XA 2DXRA 3C34A 2DVCA 3RTFB 1G0IA 3OSQA 1NI9A 1B05A 1KA1A 4N91A 1ZBMA 4OYVA 2O68A 3QAXA 1EH3A 1FPBA 5B70A 2XWOA 2Z8EA 1B0HA 4HS7A 3OSRA 1D3KA 4IY6A 3T22A 4F29A 1ELJA 1O64A 3VLUA 5I2NB 4GBWA 3SEVA 1YPNA 2Q2AA 3E79A 5H8HB 4TLMB 3ONMA 1NV1A 5AA2D 1N84A 1MPBA 4JWYA 4JSOA 4M4GA 1QGXA 1NV7A 4K3FA 3KGCA 2DXYA 1FBEA 4DI4B 5I58A 4OVRA 4UA8A 3QUJA 4AS5A 4WEPA 4OVTA 3M3KA 3HCQA 2DWHA 5K2YA 4OANA 3RUMA 5DW8A 5DVFA 1FW0A 4U4SA 4H1XA 3KBZA 2P0SA 1B32A 2D21A 3GZGA 5I5PA 3GXAA 1QUIA 4ZZEA 4DCYA 3SEWA 1MQDA 4MJOA 4ZS9A 3FUZA 2RC7A 3FVOA 4IR8A 4E0XA 3V89B 4OEUA 4GWSA 4BDNA 3MVWA 4PAFA 5I2KB 2QJEA 1FTJA 1UTBA 4P0GA 3K00A 4MH5A 2XXIA 3H3GA 1UTHB 3KN8A 1FBHA 3CR9A 1FPKA 3HFUA 3VVEA 1IMDA 2HPGA 2GQ1A 1JQFA 2B4MA 4X8RA 2X7PA 4U1OA 1NFTA 1H43A 3KOTA 3MVZA 3UORA 4MAGA 4QFLA 5ITOA 1WODA 3QMFA 3Q25A 2V84A 3MAMA 2CZIA 1SW1A 3MSTA 4OERA 2QS4A 2HZKA 4R72A 1FPIA 3CG1A 3OOAA 1A54A 3QYTA 4PP0A 2O1LA 4XKNA 3RLFE 3T9XB 3KN7A 4N8YA 1B4ZA 4IO6A 3ZKKA 3Q28A 3PPRA 4NF5A 1N3WA 1H44A 4N81A 4F3SA 4KCDA 1YZ0A 5JTYB 4AQ4A 3U92A 4O3AA 4GQOA 4XF5A 4FORA 4QSEA 1JVXA 3RY3A 2REJA 2XXTA 2RINA 4PAKA 5TPAB 4H67A 3IO4A 2Y7PA 1XI6A 1OMPA 1LAHE 3TUSA 3ECRA 1NL5A 5EYHA 3G3IA 3PMWA 2X7QA 4G8HA 2HXRA 2WBDA 1MPCA 4OTEA 4QHQA 4U21A 4JVCA 3VLWA 2F7AA 4P3LA 4DZ1A 3EHSA 2F3DA 4MX6A 1RKMA 4GL0A 2A5TB 3TCGA 3S9EA 5H8QA 4Q30B 3H6UA 4P8BA 2AL5A 2F6GA 2PVUA 4NX1A 2XXPA 4ZDMA 3ZS6A 1GVCA 4U23A 4N6KA 4U1ZA 2O69A 3QUFA 5I3SA 3TAJA 2X26A 3C31A 3TQLA 2H98A 3IL1B 1Y9UA 1HSLA 3FXQA 3LC8A 4DDDA 3VE1B 4DXBA 5CMCA 4PFUA 1MY4A 4ZEKA 1XS5A 4NAPA 1PBPA 3IOUA 1DSNA 2XA5A 3RPLB 1S9TA 4POXA 3EF7A 3JZJA 3QSLA 3TZAA 4PGPA 3K2DA 1RDXA 2ESNA 1FQCA 1QKBA 4OA4A 4I8CA 4HE0A 3BIGA 4GOTA 3TELA 1MQIA 2VD2A 3N6TA 3TDJA 4I9DA 2DYXA 3IORA 1JEUA 3IAZA 3SEYA 2Q74A 4QXDA 1OVTA 1MM7A 3FASA 4OVQA 3TTKA 4KCCA 4ZECA 4ZEBA 1IXGA 5I2NA 2Z8FA 1OIBA 2NVUB 1NUXA 3H4ZA 3V8XB 2VGQA 4GF8A 5H8HA 3AXFA 1DTGA 1MXXA 4JVIA 5H8NB 1PB9A 5EQ7A 4FAJA 4IGTA 1YXIA 3EHUA 4Q5TA 2E1SA 4YAHX 3TMGA 2R71A 3C36A 4IO3A 1FQAA 2D3IA 1JEVA 5TU0A 1LAXA 3HHFA 2Q8JA 4NHBA 1ZU0A 4EF2A 1MY1A 4MHFA 3DLNA 1SYHA 4JVDA 3UK4A 4OETA 4R74A 3V5AA 1H3DA 4EUOA 2HAUA 4OWDA 2GHBA 3B6TA 3VXCA 4BDRA 3MVXA 3MPKA 2P3VA 4ISUA 4Q0CA 3T9HB 2I4CA 3GBBA 5DEXA 1URDA 4FIMA 4JB7A 2F8DA 5EQAA 3C4MA 3S9NC 2YJPA 5I2KA 2CZHA 3FATA 2Z22A 3JV9A 5AE4A 4RK9A 4IO5A 4PTKA 3FJMA 4OXVA 1UTHA 1P1OA 1XT8A 3SZPA 3RT6B 3KEIA 3E9XA 5DTBA 2O7IA 3CSBA 4XTCQ 3MW0A 3EPEA 2PCRA 4OENA 2ZNTA 2XXXA 3SETA 1AL3A 1ANFA 1IITA 1XVXA 2DVZA 2F34A 3TTRA 2OK2A 3QK6A 3S9MC 1I6AA 1FQEA 2GFEA 3FVKA 4OMBA 4NF6B 4NWCA 1LLSA 1POTA 2Y5KA 4F3GA 4QSCA 2P2AA 2XHDA 1UIUA 2REGA 3PU5A 4PETA 1B7UA 2B4LA 4G2ZA 4KHZE 3RNNA 1MXWA 5I56B 1A99A 1QW0A 4WXJA 1FPJA 2HQ0A 2R8TA 1LBWA 1NNKA 3K6UA 5BWJA 4RJZA 5JTYA 5IZZA 1MDQA 2F3BA 1SI1A 3UA8A 1SW2A 4R2FA 1FPGA 1LBCA 2QMXA 2ALUA 3IFAA 4RPNA 1Q35A 1MY2A 4FBPA 4G68B 3T9VA 3OO6A 3FVNA 1NMUA 3VV5A 1IXHA 4QF9A 3IX1A 1GR2A 1INPA 4F1UA 4O94A 1KZ8A 3B8BA 2DQVA 2FBPA 4BDOA 2THIA 1K9YA 2ZZWA 2Q8MA 1G0HA 1OQGA 4H45A 2KQZA 3KSJA 2Q88A 2E0SA 3FD3A 1NH8A 1MDP1 3G3GA 2ZYOA 2BJJX 2KLFA 3UIFA 2ZMBA 3S9LC 4FEDA 1P1QA 3SDFA 3TCHA 2GH9A 1CE2A 2RC9A 4KYEA 3N94A 2F97A 3MYUA 3Q27A 3U93A 1KWHA 1MPDA 1XOCA 4GWXA 3C32A 3KOSA 2DWIA 5EHMA 4F2OA 1LFGA 4LQ2A 3N5LA 1MS7A 3RPLA 4PF8A 1FJ9A 3B6WA 3A3CA 2QMWA 2O51A 4FATA 3E78A 4GLIA 4KFQA 4GBVA 1B3LA 2H4IA 1VFDA 3O2AA 3MP8A 3CVGA 1LFHA 4R73A 4GRKA 4GD5A 4NF0A 5CI5A 4DE8A 2RCBA 3A29A 2FNCA 1NNFA 3K0VA 2ONKE 1PB8A 4NF4A 5EHSA 2CEYA 2KR0A 2ZNUA 4PBQA 1MY0A 3O66A 4ND9A 3VDFA 4H5FA 5HM4B 1ZTYA 1NV3A 2D5WA 3A09A 2QRYA 4GWWA 1OVBA 1FJ6A 1ZLQA 5CC2A 1SPIA 1TWYA 2FIEA 5AA3A 1Y3PA 2OBGA 4ZE9A 1NV6A 4YZZA 3TKDA 1LBVA 4M1VA 2XX9A 3B50A 4R9FA 1B5HA 1EU8A 1LBBA 4PFIA 4HXVA 1IUDA 1BP5A 1Z7ME 4R2BA 1JW1A 4G77A 1T0KA 4ELPA 2OWZA 3TPAA 3KZGA 4JSDA 3T93B 4LZ5A 5FBPA 2R6GE 3UP9A 4YKPA 3HV1A 4NGUA 4F22A 3PTYA 2YPNA 2VOZA 2Z8DA 4OVSA 2PYYA 2BJIA 5FTIA 4PGNA 1MXZA 4JXIA 5BUUA 2VP1A 3WAEA 2UVIA 3ZSFA 2DS9A 2H99A 1IMEA 2Q2CA 2I48A 3G3FA 3IJOB 2XWVA 5ICQA 2RKMA 1TFDA 4QRZA 2R9JA 3C9HA 1O7TA 2FVZA 3LR1A 1NV0A 4EXKA 4I62A 2H5YA 3S4UA 2IA4A 2CEXA 3CG3A 3IOVA 2CZKA 4PFYA 2CZLA 3SEXA 4MEVA 2IEEA 3ILUB 4U22A 3LSXA 1D9VA 1MXVA 3MZ9A 4LONB 3TEPA 2I6EA 1H76A 3K6VA 1XHYA 3SERA 1FTAA 1N76A 5J1DA 5JK4A 5FHMA 4NF6A 4LZ7A 4X48A 1LFIA 2XD2A 2XWIA 2ZYKA 1R6ZA 2ANJA 3PMVA 5DYHA 1A55A 3PV0E 3H03A 4MNIA 2XX7A 3H6VA 1FBPA 3IB0A 1FPFA
chains in the Genus database with same CATH topology
4ESXA 4XXUA 5I56A 3O28A 1IZ1A 4AB6A 3HN0A 2O1MA 3L6HA 1N7XA 4JDFA 5LOMA 3RT8A 5DT6A 3PUXE 4NEDA 3A3UA 2F36A 4H65A 1MRPA 1B9JA 4YB6A 5HPQA 3H6TA 5I84A 4RA1A 3PUYE 2HFBA 4R6HA 1SQYA 2UVHA 3M8UA 4QFPA 3KFMA 2F5XA 4G68A 4RXLA 4C0RA 3ZKLA 1N3XA 2DWAA 3SKPA 5I59B 5ISUA 1D9YA 3OD7A 4QSDA 4N07A 4NTLA 4XKRA 3MPLA 3S2VA 1B40A 4LZ8A 3B6QA 4F31B 3E4RA 3FV2A 1P1WA 3IK6B 3KJ7A 4KD5A 3VFJA 4Q8RA 3O9PA 4JWXA 5L8DA 4X1DA 4RYAA 1AIVA 1N0TA 1WVJA 1FQDA 4I1DA 3THIA 3KBRA 3MVYA 3V83A 3U1OA 1BIYA 1S50A 1Y4CA 1JETA 1YCJA 3VVFA 4X9TA 4BDMA 3I3VA 4HTGA 1SI0A 5CMKA 1A8FA 2HEUA 1IXCA 4GXSB 3FXRA 3U94A 2OZZA 3TTNA 2F35A 5DVJA 3IJXB 2G93A 3PUZE 5KDTB 5AA2B 1B2HA 1LB9A 3VVDA 2CMOA 3P7IA 2I49A 4XKPA 3LSWA 1PEBA 5HBCA 5I58B 3OEMA 2F78A 3SEUA 2XXHA 1EZ9A 3PPNA 3TTLA 2AIXA 2PT1A 3RN8A 1B7ZA 1QULA 3B7DA 4PE5B 4QFNA 4NF8B 4HCWA 3JYRA 3OO8A 1LSTA 4XIGQ 2LAOA 3EHTA 4YMAA 2HZLA 3FJ7A 4L17A 3PMXA 1GV8A 1R9QA 3R26A 1A40A 3O97A 3PD8A 1US4A 3FIRA 1DPPA 2Z23A 3GBAA 3MJNA 4DXUA 2Y7WA 1GGGA 4FEBA 1A8EA 1US5A 4ESWA 3PUVE 1M5CA 1L5TA 1BLFA 3G7WA 4XKQA 3FJGA 1QUJA 2HCAA 3K6XA 1B5JA 1EZPA 3M3FA 1JW4A 1IIWA 2RCAA 2F6PA 1N04A 4OFLA 1DTZA 2Q89A 1PC3A 4OVJA 4F39A 1URGA 3FXUA 3UN6A 3DELB 4MLVA 3BFTA 3HHGA 3H6WA 1Y1MA 1B52A 3O6IA 1LB8A 3GLBA 1Y3NA 1B0LA 3G3JA 4HCYA 2UYEA 4LUBA 1B3EA 3PD9A 3RGYA 3WAFA 1FCKA 1ZIUA 4KPTA 5K2XA 5CMMA 1N7WA 3RQTA 5TPAA 2DE2A 3K01A 4YKJA 2OLBA 1Q1KA 1PDAA 4MFIA 4N6PA 1SW5A 2OCUA 4G8NA 1TT1A 2ZXTA 1SYIA 3VLVA 3L6GA 1EZOA 2V3QA 1FQFA 3USDA 1P99A 1B58A 1FTOA 5F1QA 3K1MA 2I0BA 4LVQA 3SESA 2A5TA 1B3HA 5I59A 3Q29A 4FE8A 2NWJA 1B51A 4ZEFA 4F1YA 2AL4A 1MG1A 3KJTA 3MZ1A 3G3KA 3F11A 1B5IA 2OJTA 2Q9TA 4UACA 1MM6A 1NNPA 4YKIA 3K4UA 1B1XA 1DPEA 1NNTA 1NKXA 2UXAA 3RTWB 4OZ9A 4YMBA 1RYOA 2YLNA 4ZZAA 1AH5A 1MH4A 5H8FB 4H8JA 1B4HA 4MBPA 4R6KA 4EXLA 4F1VA 1MH3A 2DSFA 1M5DA 5KCJB 1VE4A 3PPQA 4F18A 4U4XA 1MXUA 2V93A 2ZYNA 1A7LA 3N6UA 2XX8A 3FZVA 4R6YA 1MXYA 3EN3A 1MQHA 4BDLA 1QUKA 2NUVA 1FTMA 1SDXA 5CMBA 2QS2A 1HSJA 2WKYA 4IY5A 5AA4B 5L9MA 1IEJA 1M5FA 2ONRA 4C1UA 3HPIA 2O7UA 5KDTA 2W7YA 4R75A 2O84X 5AA2A 1USYH 5H8NA 4PFWA 1JW5A 2Y7IA 3U72A 1ATGA 1PB7A 1QJMA 1I6BA 5DVIA 3TFLA 3KSXA 3IO6A 4KQPA 2VD3A 5CRYA 4NWDA 1AOVA 4DCXA 1ZJLA 3G3HA 4IO7A 1BTJA 5I57B 3K02A 4OHNA 1VSOA 4P0IA 4GWOA 4H5GA 1D4NA 4DXCA 4F2QA 2QS1A 4DLDA 1JVYA 2XXVA 4EQBA 4NF8A 4QFOA 1BKAA 5DEXB 4QFKA 3PPPA 4ECFA 4YB5A 2ONSA 3OO7A 4THIA 1MQJA 2AYSA 3N26A 2XXQA 4H8IA 1SD3A 3VXBA 2F7BA 3W9WA 2Y7RA 3Q26A 4ZEDA 3O29A 3MP1A 3ODBA 5EYFA 2I4BA 2DOJA 3MZBA 4OFJA 4FJPA 1O63A 4EF1A 4EQ9A 4N13A 1DMBA 3OENA 5F7VA 2P1SA 4WKMA 3C33A 4NE4A 2QSXA 2GRVA 3T66A 4WEDA 2G29A 4OFOA 4G4PA 1PBQA 1Y1ZA 4IO2A 4JBZA 4LP2B 2RF1A 3I5OA 4GXAA 1POY1 4AB5A 3IOWA 5TP9B 3IB1A 1LCFA 5B7DA 5L9SA 3H06B 4Z0IA 1B1HA 2V3UA 3MP6A 2B3BA 2OWSA 5CBSA 5ICTA 4MF3A 1MQGA 3BFUA 3DP8A 2GHAA 2FA7A 3I6VA 3HO7A 5H8SA 4NMYA 1Y4TA 2RC8A 1RYXA 1I6QA 4OEVA 4OQOA 3IOTA 3LSFB 1HSEA 2V25A 3FGSA 1ZMGA 2F7CA 1UQWA 2PMSA 3D4GA 4O3CA 3MUQA 3DM0A 3CIJA 3T96B 1TXFA 2Y84A 3C35A 5L9OA 3O6GA 4GIZA 4F3PA 2I0CA 1JNFA 3KG2A 2HXWA 4RPOA 1Y20A 4O3BA 5CM6A 3TCFA 1M5BA 3FV1A 4ONYA 2ZYMA 2ZNSA 4EDPA 5A5XB 4BLAA 5M2VA 2XXUA 3LSLA 3O6HA 5H8FA 1XC1A 1P1UA 1M5EA 1SVXB 3HSTA 2A5SA 3PUWE 4GVOA 5ITPA 4KR5A 2H25A 3M3LA 3MWBA 3U8QA 5KCJA 1B3GA 4YU0A 4KYDA 3EQ1A 1FQBA 5FHNA 3CSGA 5ELVA 4Z7EA 3RPWA 5KZTA 2DE3A 3TQWA 1WDNA 2B3FA 3K1NA 1LGBC 4BDQA 2UVGA 3DP4A 4KI0E 2PBWA 3TTMA 3CRBA 3E3KA 4GFRA 1UIVA 3ILTB 2I58A 4NF4B 5AA4A 4F19A 1YTVA 4GL8A 2PX1A 3MBPA 1OLCA 1IXIA 3CI8A 3CFZA 2FYIA 2DE4A 4ELRA 1VFEA 5FTHA 3R7XA 2DWJA 1LCTA 4ZEIA 3TYHA 4ZE8A 4TOZA 3BBRA 1YAEA 2UYFA 3R6UA 5JEIA 1Y3QA 1R9LA 4MLQA 3CFXA 1R1NA 2UVJA 3MC2A 1IQ7A 3QIMA 4LQ5A 2V3TA 4HW8A 2PT2A 4IO4A 3FVGA 4H6DA 5FHOA 3LBSA 4POWA 5I57A 4LA9A 5AA1A 3OMBA 1TFAA 3LUYA 2QPQA 1NH7A 1H45A 1J1NA 3IB2A 4E0WA 4RK2A 3OXNA 3PPOA 2QL3A 1UTBB 3OEKA 1AMFA 1LAGE 3K6WA 1OLAA 1I69A 4R9GA 3UGWA 2DP8A 4PFTA 2O6AA 3TODA 3H7MA 2ABHA 4KYSA 4EQ7A 4ELQA 2HAVA 2XD3A 1F9BA 1FTLA 3W15C 1SW4A 4RY1A 4G8MA 1CB6A 4TQUQ 2XXWA 3IR1A 4OESA 2M8CA 1B46A 4JWOA 4H0WA 4PQJA 4X1BA 1B7HA 2H9BA 1P1NA 3CFLA 1Z7NE 4FECA 4F3BA 4NF5B 3T9UA 4TLLB 2XXRA 3OO9A 3BKIB 3DP6A 3D4CA 4YICA 3QXMA 1B3FA 3MQ9A 1QKAA 4IGRA 1URSA 2I3WA 5TP9A 3W9VA 1VR5A 1S7YA 4RNSA 3OELA 4IB2A 4YKKA 1SBPA 4G68C 1II5A 1B6HA 1USYE 2Y7KA 3PGFA 5IAIA 5H8QB 5IKBA 4DIGA 2NXOA 2B65A 3K1PA 3E13X 1GTKA 4P11A 4U2RA 4YB7A 1FTKA 2NOOA 1DOTA 5CBRA 2VHAA 4C1TA 2QS3A 2OWTA 3KN3A 2XXYA 1MY3A 1QVSA 1XVYA 1ZKBA 1OQHA 4ELOA 2I3VA 1LAFE 4LATA 5A5XA 2DXRA 3C34A 2DVCA 3RTFB 3OSQA 1B05A 1ZBMA 4OYVA 2O68A 3QAXA 1EH3A 5B70A 2Z8EA 1B0HA 4HS7A 3OSRA 1D3KA 4IY6A 3T22A 4F29A 1ELJA 1O64A 3VLUA 5I2NB 3SEVA 1YPNA 2Q2AA 5H8HB 4TLMB 3ONMA 5AA2D 1N84A 1MPBA 4JWYA 4JSOA 4M4GA 4K3FA 3KGCA 2DXYA 5I58A 4UA8A 3QUJA 4WEPA 3M3KA 3HCQA 2DWHA 5K2YA 3RUMA 5DVFA 1FW0A 4U4SA 4H1XA 2P0SA 1B32A 2D21A 3GZGA 3GXAA 1QUIA 4ZZEA 4DCYA 3SEWA 1MQDA 4ZS9A 3FUZA 2RC7A 3FVOA 4E0XA 3V89B 4OEUA 4BDNA 3MVWA 5I2KB 2QJEA 1FTJA 1UTBA 4P0GA 3K00A 4MH5A 2XXIA 3H3GA 1UTHB 3KN8A 3CR9A 3VVEA 1JQFA 2X7PA 4U1OA 1NFTA 1H43A 3KOTA 3MVZA 3UORA 4QFLA 5ITOA 1WODA 3Q25A 2V84A 3MAMA 1SW1A 4OERA 2QS4A 2HZKA 4R72A 4XKNA 3OOAA 3CG1A 1A54A 3QYTA 4PP0A 2O1LA 3RLFE 3T9XB 3KN7A 1B4ZA 4IO6A 3ZKKA 3Q28A 3PPRA 4NF5A 1N3WA 1H44A 4F3SA 4KCDA 5JTYB 4AQ4A 3U92A 4O3AA 4GQOA 4FORA 4QSEA 1JVXA 3RY3A 2REJA 2XXTA 2RINA 5TPAB 4H67A 3IO4A 2Y7PA 1OMPA 1LAHE 3TUSA 3ECRA 1NL5A 3G3IA 3PMWA 2X7QA 4G8HA 4OTEA 1MPCA 4QHQA 4U21A 3VLWA 2F7AA 4DZ1A 3EHSA 1RKMA 4GL0A 2A5TB 3TCGA 3S9EA 5H8QA 4Q30B 3H6UA 2AL5A 2F6GA 2PVUA 2XXPA 4ZDMA 3ZS6A 1GVCA 4U23A 4U1ZA 2O69A 3QUFA 3TAJA 2X26A 3C31A 3TQLA 2H98A 3IL1B 1Y9UA 1HSLA 3FXQA 3LC8A 4DDDA 3VE1B 4DXBA 5CMCA 4PFUA 1MY4A 4ZEKA 1XS5A 1PBPA 3IOUA 1DSNA 1S9TA 4POXA 3EF7A 3JZJA 3QSLA 3TZAA 3K2DA 2ESNA 1FQCA 1QKBA 4I8CA 4GOTA 3TELA 1MQIA 2VD2A 3N6TA 3TDJA 4I9DA 2DYXA 3IORA 1JEUA 3IAZA 3SEYA 1OVTA 1MM7A 3FASA 4KCCA 4ZECA 4ZEBA 1IXGA 5I2NA 2Z8FA 1OIBA 2NVUB 3H4ZA 3V8XB 2VGQA 4GF8A 5H8HA 3AXFA 1DTGA 1MXXA 5H8NB 1PB9A 4FAJA 4IGTA 3EHUA 4Q5TA 2E1SA 4YAHX 3TMGA 2R71A 3C36A 4IO3A 1FQAA 2D3IA 1JEVA 5TU0A 1LAXA 3HHFA 2Q8JA 1ZU0A 4EF2A 1MY1A 3DLNA 1SYHA 3UK4A 4OETA 4R74A 3V5AA 1H3DA 4EUOA 2HAUA 4OWDA 2GHBA 3B6TA 3VXCA 4BDRA 3MVXA 3MPKA 4ISUA 4Q0CA 3T9HB 2I4CA 3GBBA 5DEXA 1URDA 4FIMA 4JB7A 2F8DA 3C4MA 3S9NC 2YJPA 5I2KA 3FATA 2Z22A 3JV9A 5AE4A 4RK9A 4IO5A 3FJMA 4OXVA 1UTHA 1P1OA 1XT8A 3RT6B 3KEIA 3E9XA 5DTBA 2O7IA 3CSBA 4XTCQ 3MW0A 3EPEA 4OENA 2ZNTA 2XXXA 3SETA 1AL3A 1ANFA 1IITA 1XVXA 2DVZA 2F34A 3TTRA 2OK2A 3QK6A 3S9MC 1I6AA 1FQEA 2GFEA 3FVKA 4OMBA 4NF6B 4NWCA 1LLSA 1POTA 4F3GA 4QSCA 2P2AA 2XHDA 1UIUA 2REGA 3PU5A 4PETA 1B7UA 4G2ZA 4KHZE 3RNNA 1MXWA 5I56B 1A99A 1QW0A 4WXJA 2HQ0A 1NNKA 3K6UA 5BWJA 4RJZA 5JTYA 1MDQA 1SI1A 3UA8A 1SW2A 4R2FA 1LBCA 2QMXA 2ALUA 4RPNA 1Q35A 1MY2A 4G68B 3T9VA 3OO6A 3FVNA 1NMUA 3VV5A 1IXHA 4QF9A 3IX1A 1GR2A 4F1UA 2DQVA 4BDOA 2THIA 1OQGA 3KSJA 2Q88A 2E0SA 3FD3A 1NH8A 1MDP1 3G3GA 2ZYOA 2BJJX 2KLFA 3UIFA 2ZMBA 3S9LC 4FEDA 1P1QA 3SDFA 3TCHA 2GH9A 1CE2A 2RC9A 4KYEA 3N94A 2F97A 3Q27A 3U93A 1KWHA 1MPDA 1XOCA 3C32A 3KOSA 2DWIA 5EHMA 4F2OA 1LFGA 4LQ2A 3N5LA 1MS7A 3B6WA 3A3CA 2QMWA 2O51A 4FATA 4GLIA 4KFQA 1B3LA 2H4IA 1VFDA 3O2AA 3MP8A 3CVGA 1LFHA 4GRKA 4GD5A 4R73A 5CI5A 4DE8A 2RCBA 2FNCA 1NNFA 3K0VA 2ONKE 1PB8A 4NF4A 5EHSA 2ZNUA 1MY0A 3O66A 4ND9A 3VDFA 4H5FA 5HM4B 1ZTYA 2D5WA 3A09A 2QRYA 1OVBA 1ZLQA 5CC2A 1TWYA 5AA3A 1Y3PA 2OBGA 4ZE9A 4YZZA 3TKDA 4M1VA 2XX9A 4R9FA 1B5HA 1EU8A 1LBBA 1IUDA 1BP5A 1Z7ME 4R2BA 1JW1A 4G77A 1T0KA 4ELPA 3TPAA 3KZGA 4JSDA 3T93B 4LZ5A 2R6GE 3UP9A 4YKPA 3HV1A 4F22A 2YPNA 2VOZA 2Z8DA 2PYYA 5FTIA 1MXZA 4JXIA 5BUUA 2VP1A 3WAEA 2UVIA 3ZSFA 2DS9A 2H99A 2Q2CA 3G3FA 2I48A 3IJOB 5ICQA 2RKMA 1TFDA 4QRZA 2R9JA 3C9HA 1O7TA 3LR1A 4EXKA 4I62A 2H5YA 3S4UA 2IA4A 3CG3A 3IOVA 4PFYA 2CZLA 3SEXA 2IEEA 3ILUB 4U22A 3LSXA 1D9VA 1MXVA 3MZ9A 4LONB 3TEPA 2I6EA 1H76A 3K6VA 1XHYA 3SERA 1N76A 5J1DA 5JK4A 5FHMA 4NF6A 4LZ7A 4X48A 1LFIA 2XD2A 2ZYKA 1R6ZA 2ANJA 3PMVA 5DYHA 1A55A 3PV0E 3H03A 2XX7A 3H6VA 3IB0A 3TTKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ESX A;  4XXU A;  5I56 A;  3O28 A;  1IZ1 A;  4AB6 A;  3HN0 A;  2O1M A;  3L6H A;  1N7X A;  4JDF A;  5LOM A;  3RT8 A;  5DT6 A;  3PUX E;  4NED A;  3A3U A;  2F36 A;  4H65 A;  1MRP A;  1B9J A;  4YB6 A;  5HPQ A;  3H6T A;  5I84 A;  4RA1 A;  3PUY E;  2HFB A;  4R6H A;  1SQY A;  2UVH A;  3M8U A;  4QFP A;  3KFM A;  2F5X A;  4G68 A;  4RXL A;  4C0R A;  3ZKL A;  1N3X A;  2DWA A;  3SKP A;  5I59 B;  5ISU A;  1D9Y A;  3OD7 A;  4QSD A;  4N07 A;  4NTL A;  4XKR A;  3MPL A;  3S2V A;  1B40 A;  4LZ8 A;  3B6Q A;  4F31 B;  3E4R A;  3FV2 A;  1P1W A;  3IK6 B;  3KJ7 A;  4KD5 A;  3VFJ A;  4Q8R A;  3O9P A;  4JWX A;  5L8D A;  4X1D A;  4RYA A;  1AIV A;  1N0T A;  1WVJ A;  1FQD A;  4I1D A;  3THI A;  3KBR A;  3MVY A;  3V83 A;  3U1O A;  1BIY A;  1S50 A;  1Y4C A;  1JET A;  1YCJ A;  3VVF A;  4X9T A;  4BDM A;  3I3V A;  4HTG A;  1SI0 A;  5CMK A;  1A8F A;  2HEU A;  1IXC A;  4GXS B;  3FXR A;  3U94 A;  2OZZ A;  3TTN A;  2F35 A;  5DVJ A;  3IJX B;  2G93 A;  3PUZ E;  5KDT B;  5AA2 B;  1B2H A;  1LB9 A;  3VVD A;  2CMO A;  3P7I A;  2I49 A;  4XKP A;  3LSW A;  1PEB A;  5HBC A;  5I58 B;  3OEM A;  2F78 A;  3SEU A;  2XXH A;  1EZ9 A;  3PPN A;  3TTL A;  2AIX A;  2PT1 A;  3RN8 A;  1B7Z A;  1QUL A;  3B7D A;  4PE5 B;  4QFN A;  4NF8 B;  4HCW A;  3JYR A;  3OO8 A;  1LST A;  4XIG Q;  2LAO A;  3EHT A;  4YMA A;  2HZL A;  3FJ7 A;  4L17 A;  3PMX A;  1GV8 A;  1R9Q A;  3R26 A;  1A40 A;  3O97 A;  3PD8 A;  1US4 A;  3FIR A;  1DPP A;  2Z23 A;  3GBA A;  3MJN A;  4DXU A;  2Y7W A;  1GGG A;  4FEB A;  1A8E A;  1US5 A;  4ESW A;  3PUV E;  1M5C A;  1L5T A;  1BLF A;  3G7W A;  4XKQ A;  3FJG A;  1QUJ A;  2HCA A;  3K6X A;  1B5J A;  1EZP A;  3M3F A;  1JW4 A;  1IIW A;  2RCA A;  2F6P A;  1N04 A;  4OFL A;  1DTZ A;  2Q89 A;  1PC3 A;  4OVJ A;  4F39 A;  1URG A;  3FXU A;  3UN6 A;  3DEL B;  4MLV A;  3BFT A;  3HHG A;  3H6W A;  1Y1M A;  1B52 A;  3O6I A;  1LB8 A;  3GLB A;  1Y3N A;  1B0L A;  3G3J A;  4HCY A;  2UYE A;  4LUB A;  1B3E A;  3PD9 A;  3RGY A;  3WAF A;  1FCK A;  1ZIU A;  4KPT A;  5K2X A;  5CMM A;  1N7W A;  3RQT A;  5TPA A;  2DE2 A;  3K01 A;  4YKJ A;  2OLB A;  1Q1K A;  1PDA A;  4MFI A;  4N6P A;  1SW5 A;  2OCU A;  4G8N A;  1TT1 A;  2ZXT A;  1SYI A;  3VLV A;  3L6G A;  1EZO A;  2V3Q A;  1FQF A;  3USD A;  1P99 A;  1B58 A;  1FTO A;  5F1Q A;  3K1M A;  2I0B A;  4LVQ A;  3SES A;  2A5T A;  1B3H A;  5I59 A;  3Q29 A;  4FE8 A;  2NWJ A;  1B51 A;  4ZEF A;  4F1Y A;  2AL4 A;  1MG1 A;  3KJT A;  3MZ1 A;  3G3K A;  3F11 A;  1B5I A;  2OJT A;  2Q9T A;  4UAC A;  1MM6 A;  1NNP A;  4YKI A;  3K4U A;  1B1X A;  1DPE A;  1NNT A;  1NKX A;  2UXA A;  3RTW B;  4OZ9 A;  4YMB A;  1RYO A;  2YLN A;  4ZZA A;  1AH5 A;  1MH4 A;  5H8F B;  4H8J A;  1B4H A;  4MBP A;  4R6K A;  4EXL A;  4F1V A;  1MH3 A;  2DSF A;  1M5D A;  5KCJ B;  1VE4 A;  3PPQ A;  4F18 A;  4U4X A;  1MXU A;  2V93 A;  2ZYN A;  1A7L A;  3N6U A;  2XX8 A;  3FZV A;  4R6Y A;  1MXY A;  3EN3 A;  1MQH A;  4BDL A;  1QUK A;  2NUV A;  1FTM A;  1SDX A;  5CMB A;  2QS2 A;  1HSJ A;  2WKY A;  4IY5 A;  5AA4 B;  5L9M A;  1IEJ A;  1M5F A;  2ONR A;  4C1U A;  3HPI A;  2O7U A;  5KDT A;  2W7Y A;  4R75 A;  2O84 X;  5AA2 A;  1USY H;  5H8N A;  4PFW A;  1JW5 A;  2Y7I A;  3U72 A;  1ATG A;  1PB7 A;  1QJM A;  1I6B A;  5DVI A;  3TFL A;  3KSX A;  3IO6 A;  4KQP A;  2VD3 A;  5CRY A;  4NWD A;  1AOV A;  4DCX A;  1ZJL A;  3G3H A;  4IO7 A;  1BTJ A;  5I57 B;  3K02 A;  4OHN A;  1VSO A;  4P0I A;  4GWO A;  4H5G A;  1D4N A;  4DXC A;  4F2Q A;  2QS1 A;  4DLD A;  1JVY A;  2XXV A;  4EQB A;  4NF8 A;  4QFO A;  1BKA A;  5DEX B;  4QFK A;  3PPP A;  4ECF A;  4YB5 A;  2ONS A;  3OO7 A;  4THI A;  1MQJ A;  2AYS A;  3N26 A;  2XXQ A;  4H8I A;  1SD3 A;  3VXB A;  2F7B A;  3W9W A;  2Y7R A;  3Q26 A;  4ZED A;  3O29 A;  3MP1 A;  3ODB A;  5EYF A;  2I4B A;  2DOJ A;  3MZB A;  4OFJ A;  4FJP A;  1O63 A;  4EF1 A;  4EQ9 A;  4N13 A;  1DMB A;  3OEN A;  5F7V A;  2P1S A;  4WKM A;  3C33 A;  4NE4 A;  2QSX A;  2GRV A;  3T66 A;  4WED A;  2G29 A;  4OFO A;  4G4P A;  1PBQ A;  1Y1Z A;  4IO2 A;  4JBZ A;  4LP2 B;  2RF1 A;  3I5O A;  4GXA A;  1POY 1;  4AB5 A;  3IOW A;  5TP9 B;  3IB1 A;  1LCF A;  5B7D A;  5L9S A;  3H06 B;  4Z0I A;  1B1H A;  2V3U A;  3MP6 A;  2B3B A;  2OWS A;  5CBS A;  5ICT A;  4MF3 A;  1MQG A;  3BFU A;  3DP8 A;  2GHA A;  2FA7 A;  3I6V A;  3HO7 A;  5H8S A;  4NMY A;  1Y4T A;  2RC8 A;  1RYX A;  1I6Q A;  4OEV A;  4OQO A;  3IOT A;  3LSF B;  1HSE A;  2V25 A;  3FGS A;  1ZMG A;  2F7C A;  1UQW A;  2PMS A;  3D4G A;  4O3C A;  3MUQ A;  3DM0 A;  3CIJ A;  3T96 B;  1TXF A;  2Y84 A;  3C35 A;  5L9O A;  3O6G A;  4GIZ A;  4F3P A;  2I0C A;  1JNF A;  3KG2 A;  2HXW A;  4RPO A;  1Y20 A;  4O3B A;  5CM6 A;  3TCF A;  1M5B A;  3FV1 A;  4ONY A;  2ZYM A;  2ZNS A;  4EDP A;  5A5X B;  4BLA A;  5M2V A;  2XXU A;  3LSL A;  3O6H A;  5H8F A;  1XC1 A;  1P1U A;  1M5E A;  1SVX B;  3HST A;  2A5S A;  3PUW E;  4GVO A;  5ITP A;  4KR5 A;  2H25 A;  3M3L A;  3MWB A;  3U8Q A;  5KCJ A;  1B3G A;  4YU0 A;  4KYD A;  3EQ1 A;  1FQB A;  5FHN A;  3CSG A;  5ELV A;  4Z7E A;  3RPW A;  5KZT A;  2DE3 A;  3TQW A;  1WDN A;  2B3F A;  3K1N A;  1LGB C;  4BDQ A;  2UVG A;  3DP4 A;  4KI0 E;  2PBW A;  3TTM A;  3CRB A;  3E3K A;  4GFR A;  1UIV A;  3ILT B;  2I58 A;  4NF4 B;  5AA4 A;  4F19 A;  1YTV A;  4GL8 A;  2PX1 A;  3MBP A;  1OLC A;  1IXI A;  3CI8 A;  3CFZ A;  2FYI A;  2DE4 A;  4ELR A;  1VFE A;  5FTH A;  3R7X A;  2DWJ A;  1LCT A;  4ZEI A;  3TYH A;  4ZE8 A;  4TOZ A;  3BBR A;  1YAE A;  2UYF A;  3R6U A;  5JEI A;  1Y3Q A;  1R9L A;  4MLQ A;  3CFX A;  1R1N A;  2UVJ A;  3MC2 A;  1IQ7 A;  3QIM A;  4LQ5 A;  2V3T A;  4HW8 A;  2PT2 A;  4IO4 A;  3FVG A;  4H6D A;  5FHO A;  3LBS A;  4POW A;  5I57 A;  4LA9 A;  5AA1 A;  3OMB A;  1TFA A;  3LUY A;  2QPQ A;  1NH7 A;  1H45 A;  1J1N A;  3IB2 A;  4E0W A;  4RK2 A;  3OXN A;  3PPO A;  2QL3 A;  1UTB B;  3OEK A;  1AMF A;  1LAG E;  3K6W A;  1OLA A;  1I69 A;  4R9G A;  3UGW A;  2DP8 A;  4PFT A;  2O6A A;  3TOD A;  3H7M A;  2ABH A;  4KYS A;  4EQ7 A;  4ELQ A;  2HAV A;  2XD3 A;  1F9B A;  1FTL A;  3W15 C;  1SW4 A;  4RY1 A;  4G8M A;  1CB6 A;  4TQU Q;  2XXW A;  3IR1 A;  4OES A;  2M8C A;  1B46 A;  4JWO A;  4H0W A;  4PQJ A;  4X1B A;  1B7H A;  2H9B A;  1P1N A;  3CFL A;  1Z7N E;  4FEC A;  4F3B A;  4NF5 B;  3T9U A;  4TLL B;  2XXR A;  3OO9 A;  3BKI B;  3DP6 A;  3D4C A;  4YIC A;  3QXM A;  1B3F A;  3MQ9 A;  1QKA A;  4IGR A;  1URS A;  2I3W A;  5TP9 A;  3W9V A;  1VR5 A;  1S7Y A;  4RNS A;  3OEL A;  4IB2 A;  4YKK A;  1SBP A;  4G68 C;  1II5 A;  1B6H A;  1USY E;  2Y7K A;  3PGF A;  5IAI A;  5H8Q B;  5IKB A;  4DIG A;  2NXO A;  2B65 A;  3K1P A;  3E13 X;  1GTK A;  4P11 A;  4U2R A;  4YB7 A;  1FTK A;  2NOO A;  1DOT A;  5CBR A;  2VHA A;  4C1T A;  2QS3 A;  2OWT A;  3KN3 A;  2XXY A;  1MY3 A;  1QVS A;  1XVY A;  1ZKB A;  1OQH A;  4ELO A;  2I3V A;  1LAF E;  4LAT A;  5A5X A;  2DXR A;  3C34 A;  2DVC A;  3RTF B;  3OSQ A;  1B05 A;  1ZBM A;  4OYV A;  2O68 A;  3QAX A;  1EH3 A;  5B70 A;  2Z8E A;  1B0H A;  4HS7 A;  3OSR A;  1D3K A;  4IY6 A;  3T22 A;  4F29 A;  1ELJ A;  1O64 A;  3VLU A;  5I2N B;  3SEV A;  1YPN A;  2Q2A A;  5H8H B;  4TLM B;  3ONM A;  5AA2 D;  1N84 A;  1MPB A;  4JWY A;  4JSO A;  4M4G A;  4K3F A;  3KGC A;  2DXY A;  5I58 A;  4UA8 A;  3QUJ A;  4WEP A;  3M3K A;  3HCQ A;  2DWH A;  5K2Y A;  3RUM A;  5DVF A;  1FW0 A;  4U4S A;  4H1X A;  2P0S A;  1B32 A;  2D21 A;  3GZG A;  3GXA A;  1QUI A;  4ZZE A;  4DCY A;  3SEW A;  1MQD A;  4ZS9 A;  3FUZ A;  2RC7 A;  3FVO A;  4E0X A;  3V89 B;  4OEU A;  4BDN A;  3MVW A;  5I2K B;  2QJE A;  1FTJ A;  1UTB A;  4P0G A;  3K00 A;  4MH5 A;  2XXI A;  3H3G A;  1UTH B;  3KN8 A;  3CR9 A;  3VVE A;  1JQF A;  2X7P A;  4U1O A;  1NFT A;  1H43 A;  3KOT A;  3MVZ A;  3UOR A;  4QFL A;  5ITO A;  1WOD A;  3Q25 A;  2V84 A;  3MAM A;  1SW1 A;  4OER A;  2QS4 A;  2HZK A;  4R72 A;  4XKN A;  3OOA A;  3CG1 A;  1A54 A;  3QYT A;  4PP0 A;  2O1L A;  3RLF E;  3T9X B;  3KN7 A;  1B4Z A;  4IO6 A;  3ZKK A;  3Q28 A;  3PPR A;  4NF5 A;  1N3W A;  1H44 A;  4F3S A;  4KCD A;  5JTY B;  4AQ4 A;  3U92 A;  4O3A A;  4GQO A;  4FOR A;  4QSE A;  1JVX A;  3RY3 A;  2REJ A;  2XXT A;  2RIN A;  5TPA B;  4H67 A;  3IO4 A;  2Y7P A;  1OMP A;  1LAH E;  3TUS A;  3ECR A;  1NL5 A;  3G3I A;  3PMW A;  2X7Q A;  4G8H A;  4OTE A;  1MPC A;  4QHQ A;  4U21 A;  3VLW A;  2F7A A;  4DZ1 A;  3EHS A;  1RKM A;  4GL0 A;  2A5T B;  3TCG A;  3S9E A;  5H8Q A;  4Q30 B;  3H6U A;  2AL5 A;  2F6G A;  2PVU A;  2XXP A;  4ZDM A;  3ZS6 A;  1GVC A;  4U23 A;  4U1Z A;  2O69 A;  3QUF A;  3TAJ A;  2X26 A;  3C31 A;  3TQL A;  2H98 A;  3IL1 B;  1Y9U A;  1HSL A;  3FXQ A;  3LC8 A;  4DDD A;  3VE1 B;  4DXB A;  5CMC A;  4PFU A;  1MY4 A;  4ZEK A;  1XS5 A;  1PBP A;  3IOU A;  1DSN A;  1S9T A;  4POX A;  3EF7 A;  3JZJ A;  3QSL A;  3TZA A;  3K2D A;  2ESN A;  1FQC A;  1QKB A;  4I8C A;  4GOT A;  3TEL A;  1MQI A;  2VD2 A;  3N6T A;  3TDJ A;  4I9D A;  2DYX A;  3IOR A;  1JEU A;  3IAZ A;  3SEY A;  1OVT A;  1MM7 A;  3FAS A;  4KCC A;  4ZEC A;  4ZEB A;  1IXG A;  5I2N A;  2Z8F A;  1OIB A;  2NVU B;  3H4Z A;  3V8X B;  2VGQ A;  4GF8 A;  5H8H A;  3AXF A;  1DTG A;  1MXX A;  5H8N B;  1PB9 A;  4FAJ A;  4IGT A;  3EHU A;  4Q5T A;  2E1S A;  4YAH X;  3TMG A;  2R71 A;  3C36 A;  4IO3 A;  1FQA A;  2D3I A;  1JEV A;  5TU0 A;  1LAX A;  3HHF A;  2Q8J A;  1ZU0 A;  4EF2 A;  1MY1 A;  3DLN A;  1SYH A;  3UK4 A;  4OET A;  4R74 A;  3V5A A;  1H3D A;  4EUO A;  2HAU A;  4OWD A;  2GHB A;  3B6T A;  3VXC A;  4BDR A;  3MVX A;  3MPK A;  4ISU A;  4Q0C A;  3T9H B;  2I4C A;  3GBB A;  5DEX A;  1URD A;  4FIM A;  4JB7 A;  2F8D A;  3C4M A;  3S9N C;  2YJP A;  5I2K A;  3FAT A;  2Z22 A;  3JV9 A;  5AE4 A;  4RK9 A;  4IO5 A;  3FJM A;  4OXV A;  1UTH A;  1P1O A;  1XT8 A;  3RT6 B;  3KEI A;  3E9X A;  5DTB A;  2O7I A;  3CSB A;  4XTC Q;  3MW0 A;  3EPE A;  4OEN A;  2ZNT A;  2XXX A;  3SET A;  1AL3 A;  1ANF A;  1IIT A;  1XVX A;  2DVZ A;  2F34 A;  3TTR A;  2OK2 A;  3QK6 A;  3S9M C;  1I6A A;  1FQE A;  2GFE A;  3FVK A;  4OMB A;  4NF6 B;  4NWC A;  1LLS A;  1POT A;  4F3G A;  4QSC A;  2P2A A;  2XHD A;  1UIU A;  2REG A;  3PU5 A;  4PET A;  1B7U A;  4G2Z A;  4KHZ E;  3RNN A;  1MXW A;  5I56 B;  1A99 A;  1QW0 A;  4WXJ A;  2HQ0 A;  1NNK A;  3K6U A;  5BWJ A;  4RJZ A;  5JTY A;  1MDQ A;  1SI1 A;  3UA8 A;  1SW2 A;  4R2F A;  1LBC A;  2QMX A;  2ALU A;  4RPN A;  1Q35 A;  1MY2 A;  4G68 B;  3T9V A;  3OO6 A;  3FVN A;  1NMU A;  3VV5 A;  1IXH A;  4QF9 A;  3IX1 A;  1GR2 A;  4F1U A;  2DQV A;  4BDO A;  2THI A;  1OQG A;  3KSJ A;  2Q88 A;  2E0S A;  3FD3 A;  1NH8 A;  1MDP 1;  3G3G A;  2ZYO A;  2BJJ X;  2KLF A;  3UIF A;  2ZMB A;  3S9L C;  4FED A;  1P1Q A;  3SDF A;  3TCH A;  2GH9 A;  1CE2 A;  2RC9 A;  4KYE A;  3N94 A;  2F97 A;  3Q27 A;  3U93 A;  1KWH A;  1MPD A;  1XOC A;  3C32 A;  3KOS A;  2DWI A;  5EHM A;  4F2O A;  1LFG A;  4LQ2 A;  3N5L A;  1MS7 A;  3B6W A;  3A3C A;  2QMW A;  2O51 A;  4FAT A;  4GLI A;  4KFQ A;  1B3L A;  2H4I A;  1VFD A;  3O2A A;  3MP8 A;  3CVG A;  1LFH A;  4GRK A;  4GD5 A;  4R73 A;  5CI5 A;  4DE8 A;  2RCB A;  2FNC A;  1NNF A;  3K0V A;  2ONK E;  1PB8 A;  4NF4 A;  5EHS A;  2ZNU A;  1MY0 A;  3O66 A;  4ND9 A;  3VDF A;  4H5F A;  5HM4 B;  1ZTY A;  2D5W A;  3A09 A;  2QRY A;  1OVB A;  1ZLQ A;  5CC2 A;  1TWY A;  5AA3 A;  1Y3P A;  2OBG A;  4ZE9 A;  4YZZ A;  3TKD A;  4M1V A;  2XX9 A;  4R9F A;  1B5H A;  1EU8 A;  1LBB A;  1IUD A;  1BP5 A;  1Z7M E;  4R2B A;  1JW1 A;  4G77 A;  1T0K A;  4ELP A;  3TPA A;  3KZG A;  4JSD A;  3T93 B;  4LZ5 A;  2R6G E;  3UP9 A;  4YKP A;  3HV1 A;  4F22 A;  2YPN A;  2VOZ A;  2Z8D A;  2PYY A;  5FTI A;  1MXZ A;  4JXI A;  5BUU A;  2VP1 A;  3WAE A;  2UVI A;  3ZSF A;  2DS9 A;  2H99 A;  2Q2C A;  3G3F A;  2I48 A;  3IJO B;  5ICQ A;  2RKM A;  1TFD A;  4QRZ A;  2R9J A;  3C9H A;  1O7T A;  3LR1 A;  4EXK A;  4I62 A;  2H5Y A;  3S4U A;  2IA4 A;  3CG3 A;  3IOV A;  4PFY A;  2CZL A;  3SEX A;  2IEE A;  3ILU B;  4U22 A;  3LSX A;  1D9V A;  1MXV A;  3MZ9 A;  4LON B;  3TEP A;  2I6E A;  1H76 A;  3K6V A;  1XHY A;  3SER A;  1N76 A;  5J1D A;  5JK4 A;  5FHM A;  4NF6 A;  4LZ7 A;  4X48 A;  1LFI A;  2XD2 A;  2ZYK A;  1R6Z A;  2ANJ A;  3PMV A;  5DYH A;  1A55 A;  3PV0 E;  3H03 A;  2XX7 A;  3H6V A;  3IB0 A;  3TTK A; 
#chains in the Genus database with same CATH topology
 3T0J A;  4ESX A;  4XXU A;  1JP4 A;  5I56 A;  3O28 A;  1IZ1 A;  4AB6 A;  3HN0 A;  2O1M A;  4PF6 A;  3L6H A;  1N7X A;  4JDF A;  5LOM A;  3RT8 A;  5DT6 A;  3PUX E;  4NED A;  3A3U A;  2F36 A;  4H65 A;  1MRP A;  1B9J A;  4YB6 A;  5IZ3 B;  5HPQ A;  3H6T A;  5I84 A;  1DK4 A;  4RA1 A;  3PUY E;  2HFB A;  4R6H A;  1SQY A;  2JJK A;  2UVH A;  3M8U A;  4QFP A;  3KFM A;  4NQ8 A;  2F5X A;  4G68 A;  4RXL A;  4C0R A;  5IGA A;  3ZKL A;  1N3X A;  2DWA A;  3SKP A;  5I59 B;  5ISU A;  1D9Y A;  3OD7 A;  4QSD A;  4N07 A;  4NTL A;  4XKR A;  3MPL A;  3S2V A;  1B40 A;  4LZ8 A;  3B6Q A;  3LV0 A;  4F31 B;  3E4R A;  3FV2 A;  4DI3 D;  1P1W A;  4PCD A;  3IK6 B;  3KJ7 A;  4KD5 A;  2FIX A;  3VFJ A;  4Q8R A;  3O9P A;  4JWX A;  4GWU A;  5L8D A;  4X1D A;  4RYA A;  1AIV A;  1N0T A;  1WVJ A;  1FQD A;  4I1D A;  4P47 A;  3THI A;  3KBR A;  3MVY A;  3V83 A;  3U1O A;  4GX3 A;  1BIY A;  1S50 A;  2VT5 A;  1Y4C A;  1DCU A;  1JET A;  1YCJ A;  3VVF A;  4X9T A;  4BDM A;  3I3V A;  4HTG A;  1SI0 A;  5CMK A;  1A8F A;  2HEU A;  3U65 A;  1IXC A;  4GXS B;  3FXR A;  3U94 A;  1K9Z A;  2V4C A;  2OZZ A;  3TTN A;  2F35 A;  5DVJ A;  3IJX B;  4OVP A;  2G93 A;  4HE1 A;  3PUZ E;  1NUY A;  5KDT B;  5AA2 B;  1B2H A;  5J16 A;  1LB9 A;  3VVD A;  2CMO A;  3P7I A;  2I49 A;  4XKP A;  3LSW A;  1PEB A;  4PC9 A;  5HBC A;  5I58 B;  3OEM A;  2F78 A;  3SEU A;  2XXH A;  1EZ9 A;  4N6D A;  3PPN A;  3TTL A;  2AIX A;  1FPE A;  2PT1 A;  3RN8 A;  1B7Z A;  1QUL A;  3B7D A;  4PE5 B;  4QFN A;  4NF8 B;  4HCW A;  3JYR A;  3OO8 A;  1LST A;  4XIG Q;  2LAO A;  3EHT A;  4YMA A;  2HZL A;  3FJ7 A;  1EYJ A;  5LDZ A;  4L17 A;  3PMX A;  1GV8 A;  1R9Q A;  2WYP A;  3FXB A;  1BK4 A;  2HHM A;  4O8M A;  3R26 A;  1FRP A;  1A40 A;  3O97 A;  3PD8 A;  1US4 A;  3FIR A;  1DPP A;  4P1E A;  2Z23 A;  5EQ9 A;  3GBA A;  3MJN A;  4DXU A;  2Y7W A;  1GGG A;  4FEB A;  1A8E A;  1US5 A;  4ESW A;  2WX9 A;  3PUV E;  1M5C A;  1L5T A;  1BLF A;  3G7W A;  4XKQ A;  3FJG A;  1QUJ A;  2HCA A;  3K6X A;  1B5J A;  1EZP A;  3M3F A;  1JW4 A;  4GWY A;  1IIW A;  2RCA A;  2F6P A;  1N04 A;  4OFL A;  1DTZ A;  2Q89 A;  1PC3 A;  4OVJ A;  4F39 A;  1URG A;  3FXU A;  3UN6 A;  4I3Y A;  3DEL B;  5F24 A;  1LBY A;  4PDD A;  4MLV A;  3BFT A;  3HHG A;  3H6W A;  4MNP A;  1Y1M A;  1B52 A;  3O6I A;  1LB8 A;  2L5V A;  3GLB A;  1Y3N A;  1B0L A;  2XWK A;  3G3J A;  4HCY A;  2UYE A;  4LUB A;  1B3E A;  3PD9 A;  3RGY A;  3WAF A;  1FCK A;  1ZIU A;  4KPT A;  3LUZ A;  1IMB A;  5K2X A;  2WBB A;  5CMM A;  1N7W A;  1IMF A;  3RQT A;  5TPA A;  4PFR A;  2DE2 A;  3K01 A;  4YKJ A;  2OLB A;  1Q1K A;  1PDA A;  4MFI A;  5IZ3 A;  4N6P A;  1SW5 A;  2OCU A;  4G8N A;  1TT1 A;  2ZXT A;  1SYI A;  3VLV A;  3L6G A;  1EZO A;  2V3Q A;  1FQF A;  3USD A;  1P99 A;  1B58 A;  1FTO A;  5F1Q A;  3K1M A;  2I0B A;  4LVQ A;  3SES A;  2A5T A;  1B3H A;  5I59 A;  3Q29 A;  4FE8 A;  2NWJ A;  1B51 A;  4ZEF A;  4F1Y A;  2AL4 A;  1MG1 A;  3KJT A;  1D9Q A;  3MZ1 A;  1FBG A;  3G3K A;  3F11 A;  1B5I A;  2OJT A;  2Q9T A;  4UAC A;  1MM6 A;  5LTC A;  1NNP A;  4YKI A;  3K4U A;  1B1X A;  1DPE A;  1NNT A;  1NKX A;  2UXA A;  3RTW B;  4AS4 A;  4OZ9 A;  4YMB A;  1RYO A;  2YLN A;  4ZZA A;  3NOH A;  2Y5L A;  1AH5 A;  1MH4 A;  4GX4 A;  5H8F B;  4H8J A;  1B4H A;  4MBP A;  4R6K A;  4EXL A;  4F1V A;  1MH3 A;  2DSF A;  1M5D A;  2PFY A;  4PBH A;  5KCJ B;  4G61 A;  1VE4 A;  3PPQ A;  4F18 A;  4U4X A;  1MXU A;  2V93 A;  2ZYN A;  1A7L A;  3N6U A;  2XX8 A;  3FZV A;  4R6Y A;  1MXY A;  3EN3 A;  2VPN A;  1MQH A;  4BDL A;  1QUK A;  2NUV A;  1FTM A;  1SDX A;  5CMB A;  2QS2 A;  1HSJ A;  2WKY A;  4IY5 A;  5AA4 B;  5L9M A;  1IEJ A;  2MKZ A;  1M5F A;  2ONR A;  4C1U A;  3HPI A;  2O7U A;  1YYZ A;  5KDT A;  2W7Y A;  4R75 A;  2O84 X;  5AA2 A;  1USY H;  5H8N A;  4PFW A;  1JW5 A;  2Y7I A;  3U72 A;  1ATG A;  1PB7 A;  1QJM A;  1I6B A;  5DVI A;  3TFL A;  3KSX A;  3IO6 A;  4KQP A;  2VD3 A;  2P3N A;  5CRY A;  4NWD A;  1VDW A;  1AOV A;  2WEF A;  3FBP A;  4DCX A;  1ZJL A;  3G3H A;  4IO7 A;  4NN3 A;  1BTJ A;  5I57 B;  3K02 A;  4OHN A;  1VSO A;  4P0I A;  4GWO A;  4H5G A;  1D4N A;  4DXC A;  4F2Q A;  2QS1 A;  4DLD A;  1JVY A;  3KC0 A;  2XXV A;  1LBZ A;  4P56 A;  4EQB A;  3BIH A;  4NF8 A;  1LEV A;  4QFO A;  1BKA A;  5DEX B;  4QFK A;  3PPP A;  4ECF A;  4YB5 A;  2ONS A;  3OO7 A;  4THI A;  1MQJ A;  2AYS A;  3N26 A;  2XXQ A;  4H8I A;  1SD3 A;  3VXB A;  2F7B A;  3W9W A;  2Y7R A;  3Q26 A;  4N17 A;  4ZED A;  3O29 A;  3T1B A;  3MP1 A;  4P1L A;  5IZ1 A;  3ODB A;  5EYF A;  2I4B A;  2DOJ A;  3MZB A;  4OFJ A;  4FJP A;  1O63 A;  4EF1 A;  1NV5 A;  4EQ9 A;  5ET7 A;  4N13 A;  1DMB A;  3OEN A;  5F7V A;  2P1S A;  4WKM A;  3C33 A;  4NE4 A;  2QSX A;  2GRV A;  3T66 A;  4WED A;  2G29 A;  4MMP A;  4OFO A;  4G4P A;  1PBQ A;  1Y1Z A;  4QBA A;  5ET6 A;  4IO2 A;  4JBZ A;  4LP2 B;  4P9K A;  2RF1 A;  3I5O A;  4GXA A;  1POY 1;  4AB5 A;  3IOW A;  4I3E A;  5TP9 B;  3IB1 A;  1LCF A;  5B7D A;  2QVR A;  5L9S A;  3H06 B;  4Z0I A;  3IFC A;  1B1H A;  2V3U A;  3MP6 A;  2B3B A;  2OWS A;  5CBS A;  5ICT A;  4MF3 A;  1FSA A;  1MQG A;  3BFU A;  4KXP A;  3DP8 A;  4PDH A;  2GHA A;  3ROJ A;  2FA7 A;  3I6V A;  3HO7 A;  5H8S A;  4NMY A;  1Y4T A;  2RC8 A;  1RYX A;  1I6Q A;  5ESY A;  4N15 A;  4OEV A;  4OQO A;  4O7I A;  3IOT A;  3LSF B;  1HSE A;  2V25 A;  1KA0 A;  3FGS A;  1ZMG A;  2F7C A;  1UQW A;  2PMS A;  3D4G A;  3RYD A;  4O3C A;  3MUQ A;  3DM0 A;  3CIJ A;  3T96 B;  1TXF A;  2Y84 A;  3C35 A;  1DBZ A;  5L9O A;  3O6G A;  1LBX A;  4O7M A;  4GIZ A;  4F3P A;  2I0C A;  1JNF A;  3KG2 A;  2HXW A;  4RPO A;  1Y20 A;  4O3B A;  5CM6 A;  3TCF A;  1M5B A;  3FV1 A;  4ONY A;  2ZYM A;  2ZNS A;  4EDP A;  5A5X B;  4I40 A;  4BLA A;  4XEQ A;  2FHY A;  5M2V A;  2XXU A;  3LSL A;  3O6H A;  5H8F A;  1IMA A;  1XC1 A;  1P1U A;  1M5E A;  4N8G A;  1FBF A;  1Q9D A;  3D1R A;  1SVX B;  3HST A;  2A5S A;  3PUW E;  4GVO A;  5ITP A;  1FPD A;  4GWZ A;  4KR5 A;  5IM2 A;  2H25 A;  3M3L A;  3MWB A;  3U8Q A;  5KCJ A;  1EYI A;  1B3G A;  4MNC A;  4YU0 A;  4KYD A;  3EQ1 A;  1FQB A;  3CSG A;  5FHN A;  5ELV A;  4Z7E A;  4PFB A;  3RPW A;  5KZT A;  2DE3 A;  3TQW A;  1WDN A;  2B3F A;  3K1N A;  1LGB C;  4BDQ A;  2UVG A;  3DP4 A;  4KI0 E;  2PBW A;  3TTM A;  3CRB A;  3E3K A;  4GFR A;  1UIV A;  4MIJ A;  4PE3 A;  3ILT B;  2I58 A;  4NF4 B;  5AA4 A;  5I7I A;  4F19 A;  1YTV A;  1EYK A;  4GL8 A;  2PX1 A;  3MBP A;  1OLC A;  1IXI A;  3CI8 A;  3CFZ A;  2FYI A;  2DE4 A;  4ELR A;  1VFE A;  5FTH A;  3R7X A;  2DWJ A;  1LCT A;  4ZEI A;  3TYH A;  4ZE8 A;  4TOZ A;  3BBR A;  1YAE A;  2VPO A;  1FBD A;  2UYF A;  3R6U A;  5JEI A;  3ISP A;  1Y3Q A;  1NUW A;  1R9L A;  4MLQ A;  3CFX A;  5ET8 A;  1FBC A;  2ZZV A;  1R1N A;  2UVJ A;  3MC2 A;  1IQ7 A;  3QIM A;  5EQ8 A;  4LQ5 A;  2V3T A;  4HW8 A;  2PT2 A;  2DDK A;  4IO4 A;  3FVG A;  4H6D A;  5FHO A;  3LBS A;  4POW A;  1RDY A;  5I57 A;  4LA9 A;  5AA1 A;  3OMB A;  1TFA A;  3LUY A;  2QPQ A;  1NH7 A;  1H45 A;  2QFL A;  1RDZ A;  1J1N A;  3IB2 A;  4E0W A;  4RK2 A;  3OXN A;  3PPO A;  2QVV A;  2QL3 A;  1UTB B;  3OEK A;  1AMF A;  1LAG E;  3K6W A;  5EYG A;  1OLA A;  1I69 A;  4R9G A;  3UGW A;  2DP8 A;  4PFT A;  2O6A A;  3TOD A;  4HE2 A;  3H7M A;  2ABH A;  4KYS A;  4EQ7 A;  2OX3 A;  4H46 A;  1FPL A;  3EKI A;  4ELQ A;  2HAV A;  2WYK A;  4GX6 A;  1NV4 A;  2XD3 A;  1F9B A;  1FTL A;  3KC1 A;  3W15 C;  1SW4 A;  4RY1 A;  4G8M A;  1CB6 A;  3CHG A;  1NUZ A;  4X04 A;  4TQU Q;  4NG7 A;  2XXW A;  3IR1 A;  4OES A;  2M8C A;  2PFZ A;  1B46 A;  2ZZX A;  4JWO A;  4H0W A;  4PQJ A;  4X1B A;  1B7H A;  2H9B A;  1P1N A;  3CFL A;  4MCO A;  1Z7N E;  4FEC A;  4F3B A;  4NF5 B;  3T9U A;  1IMC A;  4TLL B;  2XXR A;  3OO9 A;  2XXK A;  3BKI B;  3DP6 A;  3D4C A;  4YIC A;  4PAI A;  3QXM A;  1B3F A;  3MQ9 A;  1QKA A;  4IGR A;  1CNQ A;  1URS A;  2I3W A;  5TP9 A;  3W9V A;  1VR5 A;  1AWB A;  1S7Y A;  3GYY A;  4RNS A;  5ET5 A;  4LN5 A;  3OEL A;  4IB2 A;  4YKK A;  4UAB A;  1SBP A;  4G68 C;  1II5 A;  4N4U A;  1B6H A;  1USY E;  2Y7K A;  5T3J A;  3PGF A;  5IAI A;  5H8Q B;  5IKB A;  4DIG A;  2NXO A;  2B65 A;  3K1P A;  3E13 X;  1NV2 A;  1GTK A;  4P11 A;  4U2R A;  5A5L A;  4YB7 A;  1FTK A;  2NOO A;  1DOT A;  4XFE A;  5CBR A;  2VHA A;  4C1T A;  2QS3 A;  2QVU A;  2OWT A;  3KN3 A;  2XXY A;  1MY3 A;  1QVS A;  1XVY A;  1ZKB A;  1OQH A;  4ELO A;  2I3V A;  1LAF E;  4LAT A;  5A5X A;  2DXR A;  3C34 A;  2DVC A;  3RTF B;  1G0I A;  3OSQ A;  1NI9 A;  1B05 A;  1KA1 A;  4N91 A;  1ZBM A;  4OYV A;  2O68 A;  3QAX A;  1EH3 A;  1FPB A;  5B70 A;  2XWO A;  2Z8E A;  1B0H A;  4HS7 A;  3OSR A;  1D3K A;  4IY6 A;  3T22 A;  4F29 A;  1ELJ A;  1O64 A;  3VLU A;  5I2N B;  4GBW A;  3SEV A;  1YPN A;  2Q2A A;  3E79 A;  5H8H B;  4TLM B;  3ONM A;  1NV1 A;  5AA2 D;  1N84 A;  1MPB A;  4JWY A;  4JSO A;  4M4G A;  1QGX A;  1NV7 A;  4K3F A;  3KGC A;  2DXY A;  1FBE A;  4DI4 B;  5I58 A;  4OVR A;  4UA8 A;  3QUJ A;  4AS5 A;  4WEP A;  4OVT A;  3M3K A;  3HCQ A;  2DWH A;  5K2Y A;  4OAN A;  3RUM A;  5DW8 A;  5DVF A;  1FW0 A;  4U4S A;  4H1X A;  3KBZ A;  2P0S A;  1B32 A;  2D21 A;  3GZG A;  5I5P A;  3GXA A;  1QUI A;  4ZZE A;  4DCY A;  3SEW A;  1MQD A;  4MJO A;  4ZS9 A;  3FUZ A;  2RC7 A;  3FVO A;  4IR8 A;  4E0X A;  3V89 B;  4OEU A;  4GWS A;  4BDN A;  3MVW A;  4PAF A;  5I2K B;  2QJE A;  1FTJ A;  1UTB A;  4P0G A;  3K00 A;  4MH5 A;  2XXI A;  3H3G A;  1UTH B;  3KN8 A;  1FBH A;  3CR9 A;  1FPK A;  3HFU A;  3VVE A;  1IMD A;  2HPG A;  2GQ1 A;  1JQF A;  2B4M A;  4X8R A;  2X7P A;  4U1O A;  1NFT A;  1H43 A;  3KOT A;  3MVZ A;  3UOR A;  4MAG A;  4QFL A;  5ITO A;  1WOD A;  3QMF A;  3Q25 A;  2V84 A;  3MAM A;  2CZI A;  1SW1 A;  3MST A;  4OER A;  2QS4 A;  2HZK A;  4R72 A;  1FPI A;  3CG1 A;  3OOA A;  1A54 A;  3QYT A;  4PP0 A;  2O1L A;  4XKN A;  3RLF E;  3T9X B;  3KN7 A;  4N8Y A;  1B4Z A;  4IO6 A;  3ZKK A;  3Q28 A;  3PPR A;  4NF5 A;  1N3W A;  1H44 A;  4N81 A;  4F3S A;  4KCD A;  1YZ0 A;  5JTY B;  4AQ4 A;  3U92 A;  4O3A A;  4GQO A;  4XF5 A;  4FOR A;  4QSE A;  1JVX A;  3RY3 A;  2REJ A;  2XXT A;  2RIN A;  4PAK A;  5TPA B;  4H67 A;  3IO4 A;  2Y7P A;  1XI6 A;  1OMP A;  1LAH E;  3TUS A;  3ECR A;  1NL5 A;  5EYH A;  3G3I A;  3PMW A;  2X7Q A;  4G8H A;  2HXR A;  2WBD A;  1MPC A;  4OTE A;  4QHQ A;  4U21 A;  4JVC A;  3VLW A;  2F7A A;  4P3L A;  4DZ1 A;  3EHS A;  2F3D A;  4MX6 A;  1RKM A;  4GL0 A;  2A5T B;  3TCG A;  3S9E A;  5H8Q A;  4Q30 B;  3H6U A;  4P8B A;  2AL5 A;  2F6G A;  2PVU A;  4NX1 A;  2XXP A;  4ZDM A;  3ZS6 A;  1GVC A;  4U23 A;  4N6K A;  4U1Z A;  2O69 A;  3QUF A;  5I3S A;  3TAJ A;  2X26 A;  3C31 A;  3TQL A;  2H98 A;  3IL1 B;  1Y9U A;  1HSL A;  3FXQ A;  3LC8 A;  4DDD A;  3VE1 B;  4DXB A;  5CMC A;  4PFU A;  1MY4 A;  4ZEK A;  1XS5 A;  4NAP A;  1PBP A;  3IOU A;  1DSN A;  2XA5 A;  3RPL B;  1S9T A;  4POX A;  3EF7 A;  3JZJ A;  3QSL A;  3TZA A;  4PGP A;  3K2D A;  1RDX A;  2ESN A;  1FQC A;  1QKB A;  4OA4 A;  4I8C A;  4HE0 A;  3BIG A;  4GOT A;  3TEL A;  1MQI A;  2VD2 A;  3N6T A;  3TDJ A;  4I9D A;  2DYX A;  3IOR A;  1JEU A;  3IAZ A;  3SEY A;  2Q74 A;  4QXD A;  1OVT A;  1MM7 A;  3FAS A;  4OVQ A;  3TTK A;  4KCC A;  4ZEC A;  4ZEB A;  1IXG A;  5I2N A;  2Z8F A;  1OIB A;  2NVU B;  1NUX A;  3H4Z A;  3V8X B;  2VGQ A;  4GF8 A;  5H8H A;  3AXF A;  1DTG A;  1MXX A;  4JVI A;  5H8N B;  1PB9 A;  5EQ7 A;  4FAJ A;  4IGT A;  1YXI A;  3EHU A;  4Q5T A;  2E1S A;  4YAH X;  3TMG A;  2R71 A;  3C36 A;  4IO3 A;  1FQA A;  2D3I A;  1JEV A;  5TU0 A;  1LAX A;  3HHF A;  2Q8J A;  4NHB A;  1ZU0 A;  4EF2 A;  1MY1 A;  4MHF A;  3DLN A;  1SYH A;  4JVD A;  3UK4 A;  4OET A;  4R74 A;  3V5A A;  1H3D A;  4EUO A;  2HAU A;  4OWD A;  2GHB A;  3B6T A;  3VXC A;  4BDR A;  3MVX A;  3MPK A;  2P3V A;  4ISU A;  4Q0C A;  3T9H B;  2I4C A;  3GBB A;  5DEX A;  1URD A;  4FIM A;  4JB7 A;  2F8D A;  5EQA A;  3C4M A;  3S9N C;  2YJP A;  5I2K A;  2CZH A;  3FAT A;  2Z22 A;  3JV9 A;  5AE4 A;  4RK9 A;  4IO5 A;  4PTK A;  3FJM A;  4OXV A;  1UTH A;  1P1O A;  1XT8 A;  3SZP A;  3RT6 B;  3KEI A;  3E9X A;  5DTB A;  2O7I A;  3CSB A;  4XTC Q;  3MW0 A;  3EPE A;  2PCR A;  4OEN A;  2ZNT A;  2XXX A;  3SET A;  1AL3 A;  1ANF A;  1IIT A;  1XVX A;  2DVZ A;  2F34 A;  3TTR A;  2OK2 A;  3QK6 A;  3S9M C;  1I6A A;  1FQE A;  2GFE A;  3FVK A;  4OMB A;  4NF6 B;  4NWC A;  1LLS A;  1POT A;  2Y5K A;  4F3G A;  4QSC A;  2P2A A;  2XHD A;  1UIU A;  2REG A;  3PU5 A;  4PET A;  1B7U A;  2B4L A;  4G2Z A;  4KHZ E;  3RNN A;  1MXW A;  5I56 B;  1A99 A;  1QW0 A;  4WXJ A;  1FPJ A;  2HQ0 A;  2R8T A;  1LBW A;  1NNK A;  3K6U A;  5BWJ A;  4RJZ A;  5JTY A;  5IZZ A;  1MDQ A;  2F3B A;  1SI1 A;  3UA8 A;  1SW2 A;  4R2F A;  1FPG A;  1LBC A;  2QMX A;  2ALU A;  3IFA A;  4RPN A;  1Q35 A;  1MY2 A;  4FBP A;  4G68 B;  3T9V A;  3OO6 A;  3FVN A;  1NMU A;  3VV5 A;  1IXH A;  4QF9 A;  3IX1 A;  1GR2 A;  1INP A;  4F1U A;  4O94 A;  1KZ8 A;  3B8B A;  2DQV A;  2FBP A;  4BDO A;  2THI A;  1K9Y A;  2ZZW A;  2Q8M A;  1G0H A;  1OQG A;  4H45 A;  2KQZ A;  3KSJ A;  2Q88 A;  2E0S A;  3FD3 A;  1NH8 A;  1MDP 1;  3G3G A;  2ZYO A;  2BJJ X;  2KLF A;  3UIF A;  2ZMB A;  3S9L C;  4FED A;  1P1Q A;  3SDF A;  3TCH A;  2GH9 A;  1CE2 A;  2RC9 A;  4KYE A;  3N94 A;  2F97 A;  3MYU A;  3Q27 A;  3U93 A;  1KWH A;  1MPD A;  1XOC A;  4GWX A;  3C32 A;  3KOS A;  2DWI A;  5EHM A;  4F2O A;  1LFG A;  4LQ2 A;  3N5L A;  1MS7 A;  3RPL A;  4PF8 A;  1FJ9 A;  3B6W A;  3A3C A;  2QMW A;  2O51 A;  4FAT A;  3E78 A;  4GLI A;  4KFQ A;  4GBV A;  1B3L A;  2H4I A;  1VFD A;  3O2A A;  3MP8 A;  3CVG A;  1LFH A;  4R73 A;  4GRK A;  4GD5 A;  4NF0 A;  5CI5 A;  4DE8 A;  2RCB A;  3A29 A;  2FNC A;  1NNF A;  3K0V A;  2ONK E;  1PB8 A;  4NF4 A;  5EHS A;  2CEY A;  2KR0 A;  2ZNU A;  4PBQ A;  1MY0 A;  3O66 A;  4ND9 A;  3VDF A;  4H5F A;  5HM4 B;  1ZTY A;  1NV3 A;  2D5W A;  3A09 A;  2QRY A;  4GWW A;  1OVB A;  1FJ6 A;  1ZLQ A;  5CC2 A;  1SPI A;  1TWY A;  2FIE A;  5AA3 A;  1Y3P A;  2OBG A;  4ZE9 A;  1NV6 A;  4YZZ A;  3TKD A;  1LBV A;  4M1V A;  2XX9 A;  3B50 A;  4R9F A;  1B5H A;  1EU8 A;  1LBB A;  4PFI A;  4HXV A;  1IUD A;  1BP5 A;  1Z7M E;  4R2B A;  1JW1 A;  4G77 A;  1T0K A;  4ELP A;  2OWZ A;  3TPA A;  3KZG A;  4JSD A;  3T93 B;  4LZ5 A;  5FBP A;  2R6G E;  3UP9 A;  4YKP A;  3HV1 A;  4NGU A;  4F22 A;  3PTY A;  2YPN A;  2VOZ A;  2Z8D A;  4OVS A;  2PYY A;  2BJI A;  5FTI A;  4PGN A;  1MXZ A;  4JXI A;  5BUU A;  2VP1 A;  3WAE A;  2UVI A;  3ZSF A;  2DS9 A;  2H99 A;  1IME A;  2Q2C A;  2I48 A;  3G3F A;  3IJO B;  2XWV A;  5ICQ A;  2RKM A;  1TFD A;  4QRZ A;  2R9J A;  3C9H A;  1O7T A;  2FVZ A;  3LR1 A;  1NV0 A;  4EXK A;  4I62 A;  2H5Y A;  3S4U A;  2IA4 A;  2CEX A;  3CG3 A;  3IOV A;  2CZK A;  4PFY A;  2CZL A;  3SEX A;  4MEV A;  2IEE A;  3ILU B;  4U22 A;  3LSX A;  1D9V A;  1MXV A;  3MZ9 A;  4LON B;  3TEP A;  2I6E A;  1H76 A;  3K6V A;  1XHY A;  3SER A;  1FTA A;  1N76 A;  5J1D A;  5JK4 A;  5FHM A;  4NF6 A;  4LZ7 A;  4X48 A;  1LFI A;  2XD2 A;  2XWI A;  2ZYK A;  1R6Z A;  2ANJ A;  3PMV A;  5DYH A;  1A55 A;  3PV0 E;  3H03 A;  4MNI A;  2XX7 A;  3H6V A;  1FBP A;  3IB0 A;  1FPF A; 
#chains in the Genus database with same CATH homology
 4ESX A;  4XXU A;  5I56 A;  3O28 A;  1IZ1 A;  4AB6 A;  3HN0 A;  2O1M A;  3L6H A;  1N7X A;  4JDF A;  5LOM A;  3RT8 A;  5DT6 A;  3PUX E;  4NED A;  3A3U A;  2F36 A;  4H65 A;  1MRP A;  1B9J A;  4YB6 A;  5HPQ A;  3H6T A;  5I84 A;  4RA1 A;  3PUY E;  2HFB A;  4R6H A;  1SQY A;  2UVH A;  3M8U A;  4QFP A;  3KFM A;  2F5X A;  4G68 A;  4RXL A;  4C0R A;  3ZKL A;  1N3X A;  2DWA A;  3SKP A;  5I59 B;  5ISU A;  1D9Y A;  3OD7 A;  4QSD A;  4N07 A;  4NTL A;  4XKR A;  3MPL A;  3S2V A;  1B40 A;  4LZ8 A;  3B6Q A;  4F31 B;  3E4R A;  3FV2 A;  1P1W A;  3IK6 B;  3KJ7 A;  4KD5 A;  3VFJ A;  4Q8R A;  3O9P A;  4JWX A;  5L8D A;  4X1D A;  4RYA A;  1AIV A;  1N0T A;  1WVJ A;  1FQD A;  4I1D A;  3THI A;  3KBR A;  3MVY A;  3V83 A;  3U1O A;  1BIY A;  1S50 A;  1Y4C A;  1JET A;  1YCJ A;  3VVF A;  4X9T A;  4BDM A;  3I3V A;  4HTG A;  1SI0 A;  5CMK A;  1A8F A;  2HEU A;  1IXC A;  4GXS B;  3FXR A;  3U94 A;  2OZZ A;  3TTN A;  2F35 A;  5DVJ A;  3IJX B;  2G93 A;  3PUZ E;  5KDT B;  5AA2 B;  1B2H A;  1LB9 A;  3VVD A;  2CMO A;  3P7I A;  2I49 A;  4XKP A;  3LSW A;  1PEB A;  5HBC A;  5I58 B;  3OEM A;  2F78 A;  3SEU A;  2XXH A;  1EZ9 A;  3PPN A;  3TTL A;  2AIX A;  2PT1 A;  3RN8 A;  1B7Z A;  1QUL A;  3B7D A;  4PE5 B;  4QFN A;  4NF8 B;  4HCW A;  3JYR A;  3OO8 A;  1LST A;  4XIG Q;  2LAO A;  3EHT A;  4YMA A;  2HZL A;  3FJ7 A;  4L17 A;  3PMX A;  1GV8 A;  1R9Q A;  3R26 A;  1A40 A;  3O97 A;  3PD8 A;  1US4 A;  3FIR A;  1DPP A;  2Z23 A;  3GBA A;  3MJN A;  4DXU A;  2Y7W A;  1GGG A;  4FEB A;  1A8E A;  1US5 A;  4ESW A;  3PUV E;  1M5C A;  1L5T A;  1BLF A;  3G7W A;  4XKQ A;  3FJG A;  1QUJ A;  2HCA A;  3K6X A;  1B5J A;  1EZP A;  3M3F A;  1JW4 A;  1IIW A;  2RCA A;  2F6P A;  1N04 A;  4OFL A;  1DTZ A;  2Q89 A;  1PC3 A;  4OVJ A;  4F39 A;  1URG A;  3FXU A;  3UN6 A;  3DEL B;  4MLV A;  3BFT A;  3HHG A;  3H6W A;  1Y1M A;  1B52 A;  3O6I A;  1LB8 A;  3GLB A;  1Y3N A;  1B0L A;  3G3J A;  4HCY A;  2UYE A;  4LUB A;  1B3E A;  3PD9 A;  3RGY A;  3WAF A;  1FCK A;  1ZIU A;  4KPT A;  5K2X A;  5CMM A;  1N7W A;  3RQT A;  5TPA A;  2DE2 A;  3K01 A;  4YKJ A;  2OLB A;  1Q1K A;  1PDA A;  4MFI A;  4N6P A;  1SW5 A;  2OCU A;  4G8N A;  1TT1 A;  2ZXT A;  1SYI A;  3VLV A;  3L6G A;  1EZO A;  2V3Q A;  1FQF A;  3USD A;  1P99 A;  1B58 A;  1FTO A;  5F1Q A;  3K1M A;  2I0B A;  4LVQ A;  3SES A;  2A5T A;  1B3H A;  5I59 A;  3Q29 A;  4FE8 A;  2NWJ A;  1B51 A;  4ZEF A;  4F1Y A;  2AL4 A;  1MG1 A;  3KJT A;  3MZ1 A;  3G3K A;  3F11 A;  1B5I A;  2OJT A;  2Q9T A;  4UAC A;  1MM6 A;  1NNP A;  4YKI A;  3K4U A;  1B1X A;  1DPE A;  1NNT A;  1NKX A;  2UXA A;  3RTW B;  4OZ9 A;  4YMB A;  1RYO A;  2YLN A;  4ZZA A;  1AH5 A;  1MH4 A;  5H8F B;  4H8J A;  1B4H A;  4MBP A;  4R6K A;  4EXL A;  4F1V A;  1MH3 A;  2DSF A;  1M5D A;  5KCJ B;  1VE4 A;  3PPQ A;  4F18 A;  4U4X A;  1MXU A;  2V93 A;  2ZYN A;  1A7L A;  3N6U A;  2XX8 A;  3FZV A;  4R6Y A;  1MXY A;  3EN3 A;  1MQH A;  4BDL A;  1QUK A;  2NUV A;  1FTM A;  1SDX A;  5CMB A;  2QS2 A;  1HSJ A;  2WKY A;  4IY5 A;  5AA4 B;  5L9M A;  1IEJ A;  1M5F A;  2ONR A;  4C1U A;  3HPI A;  2O7U A;  5KDT A;  2W7Y A;  4R75 A;  2O84 X;  5AA2 A;  1USY H;  5H8N A;  4PFW A;  1JW5 A;  2Y7I A;  3U72 A;  1ATG A;  1PB7 A;  1QJM A;  1I6B A;  5DVI A;  3TFL A;  3KSX A;  3IO6 A;  4KQP A;  2VD3 A;  5CRY A;  4NWD A;  1AOV A;  4DCX A;  1ZJL A;  3G3H A;  4IO7 A;  1BTJ A;  5I57 B;  3K02 A;  4OHN A;  1VSO A;  4P0I A;  4GWO A;  4H5G A;  1D4N A;  4DXC A;  4F2Q A;  2QS1 A;  4DLD A;  1JVY A;  2XXV A;  4EQB A;  4NF8 A;  4QFO A;  1BKA A;  5DEX B;  4QFK A;  3PPP A;  4ECF A;  4YB5 A;  2ONS A;  3OO7 A;  4THI A;  1MQJ A;  2AYS A;  3N26 A;  2XXQ A;  4H8I A;  1SD3 A;  3VXB A;  2F7B A;  3W9W A;  2Y7R A;  3Q26 A;  4ZED A;  3O29 A;  3MP1 A;  3ODB A;  5EYF A;  2I4B A;  2DOJ A;  3MZB A;  4OFJ A;  4FJP A;  1O63 A;  4EF1 A;  4EQ9 A;  4N13 A;  1DMB A;  3OEN A;  5F7V A;  2P1S A;  4WKM A;  3C33 A;  4NE4 A;  2QSX A;  2GRV A;  3T66 A;  4WED A;  2G29 A;  4OFO A;  4G4P A;  1PBQ A;  1Y1Z A;  4IO2 A;  4JBZ A;  4LP2 B;  2RF1 A;  3I5O A;  4GXA A;  1POY 1;  4AB5 A;  3IOW A;  5TP9 B;  3IB1 A;  1LCF A;  5B7D A;  5L9S A;  3H06 B;  4Z0I A;  1B1H A;  2V3U A;  3MP6 A;  2B3B A;  2OWS A;  5CBS A;  5ICT A;  4MF3 A;  1MQG A;  3BFU A;  3DP8 A;  2GHA A;  2FA7 A;  3I6V A;  3HO7 A;  5H8S A;  4NMY A;  1Y4T A;  2RC8 A;  1RYX A;  1I6Q A;  4OEV A;  4OQO A;  3IOT A;  3LSF B;  1HSE A;  2V25 A;  3FGS A;  1ZMG A;  2F7C A;  1UQW A;  2PMS A;  3D4G A;  4O3C A;  3MUQ A;  3DM0 A;  3CIJ A;  3T96 B;  1TXF A;  2Y84 A;  3C35 A;  5L9O A;  3O6G A;  4GIZ A;  4F3P A;  2I0C A;  1JNF A;  3KG2 A;  2HXW A;  4RPO A;  1Y20 A;  4O3B A;  5CM6 A;  3TCF A;  1M5B A;  3FV1 A;  4ONY A;  2ZYM A;  2ZNS A;  4EDP A;  5A5X B;  4BLA A;  5M2V A;  2XXU A;  3LSL A;  3O6H A;  5H8F A;  1XC1 A;  1P1U A;  1M5E A;  1SVX B;  3HST A;  2A5S A;  3PUW E;  4GVO A;  5ITP A;  4KR5 A;  2H25 A;  3M3L A;  3MWB A;  3U8Q A;  5KCJ A;  1B3G A;  4YU0 A;  4KYD A;  3EQ1 A;  1FQB A;  5FHN A;  3CSG A;  5ELV A;  4Z7E A;  3RPW A;  5KZT A;  2DE3 A;  3TQW A;  1WDN A;  2B3F A;  3K1N A;  1LGB C;  4BDQ A;  2UVG A;  3DP4 A;  4KI0 E;  2PBW A;  3TTM A;  3CRB A;  3E3K A;  4GFR A;  1UIV A;  3ILT B;  2I58 A;  4NF4 B;  5AA4 A;  4F19 A;  1YTV A;  4GL8 A;  2PX1 A;  3MBP A;  1OLC A;  1IXI A;  3CI8 A;  3CFZ A;  2FYI A;  2DE4 A;  4ELR A;  1VFE A;  5FTH A;  3R7X A;  2DWJ A;  1LCT A;  4ZEI A;  3TYH A;  4ZE8 A;  4TOZ A;  3BBR A;  1YAE A;  2UYF A;  3R6U A;  5JEI A;  1Y3Q A;  1R9L A;  4MLQ A;  3CFX A;  1R1N A;  2UVJ A;  3MC2 A;  1IQ7 A;  3QIM A;  4LQ5 A;  2V3T A;  4HW8 A;  2PT2 A;  4IO4 A;  3FVG A;  4H6D A;  5FHO A;  3LBS A;  4POW A;  5I57 A;  4LA9 A;  5AA1 A;  3OMB A;  1TFA A;  3LUY A;  2QPQ A;  1NH7 A;  1H45 A;  1J1N A;  3IB2 A;  4E0W A;  4RK2 A;  3OXN A;  3PPO A;  2QL3 A;  1UTB B;  3OEK A;  1AMF A;  1LAG E;  3K6W A;  1OLA A;  1I69 A;  4R9G A;  3UGW A;  2DP8 A;  4PFT A;  2O6A A;  3TOD A;  3H7M A;  2ABH A;  4KYS A;  4EQ7 A;  4ELQ A;  2HAV A;  2XD3 A;  1F9B A;  1FTL A;  3W15 C;  1SW4 A;  4RY1 A;  4G8M A;  1CB6 A;  4TQU Q;  2XXW A;  3IR1 A;  4OES A;  2M8C A;  1B46 A;  4JWO A;  4H0W A;  4PQJ A;  4X1B A;  1B7H A;  2H9B A;  1P1N A;  3CFL A;  1Z7N E;  4FEC A;  4F3B A;  4NF5 B;  3T9U A;  4TLL B;  2XXR A;  3OO9 A;  3BKI B;  3DP6 A;  3D4C A;  4YIC A;  3QXM A;  1B3F A;  3MQ9 A;  1QKA A;  4IGR A;  1URS A;  2I3W A;  5TP9 A;  3W9V A;  1VR5 A;  1S7Y A;  4RNS A;  3OEL A;  4IB2 A;  4YKK A;  1SBP A;  4G68 C;  1II5 A;  1B6H A;  1USY E;  2Y7K A;  3PGF A;  5IAI A;  5H8Q B;  5IKB A;  4DIG A;  2NXO A;  2B65 A;  3K1P A;  3E13 X;  1GTK A;  4P11 A;  4U2R A;  4YB7 A;  1FTK A;  2NOO A;  1DOT A;  5CBR A;  2VHA A;  4C1T A;  2QS3 A;  2OWT A;  3KN3 A;  2XXY A;  1MY3 A;  1QVS A;  1XVY A;  1ZKB A;  1OQH A;  4ELO A;  2I3V A;  1LAF E;  4LAT A;  5A5X A;  2DXR A;  3C34 A;  2DVC A;  3RTF B;  3OSQ A;  1B05 A;  1ZBM A;  4OYV A;  2O68 A;  3QAX A;  1EH3 A;  5B70 A;  2Z8E A;  1B0H A;  4HS7 A;  3OSR A;  1D3K A;  4IY6 A;  3T22 A;  4F29 A;  1ELJ A;  1O64 A;  3VLU A;  5I2N B;  3SEV A;  1YPN A;  2Q2A A;  5H8H B;  4TLM B;  3ONM A;  5AA2 D;  1N84 A;  1MPB A;  4JWY A;  4JSO A;  4M4G A;  4K3F A;  3KGC A;  2DXY A;  5I58 A;  4UA8 A;  3QUJ A;  4WEP A;  3M3K A;  3HCQ A;  2DWH A;  5K2Y A;  3RUM A;  5DVF A;  1FW0 A;  4U4S A;  4H1X A;  2P0S A;  1B32 A;  2D21 A;  3GZG A;  3GXA A;  1QUI A;  4ZZE A;  4DCY A;  3SEW A;  1MQD A;  4ZS9 A;  3FUZ A;  2RC7 A;  3FVO A;  4E0X A;  3V89 B;  4OEU A;  4BDN A;  3MVW A;  5I2K B;  2QJE A;  1FTJ A;  1UTB A;  4P0G A;  3K00 A;  4MH5 A;  2XXI A;  3H3G A;  1UTH B;  3KN8 A;  3CR9 A;  3VVE A;  1JQF A;  2X7P A;  4U1O A;  1NFT A;  1H43 A;  3KOT A;  3MVZ A;  3UOR A;  4QFL A;  5ITO A;  1WOD A;  3Q25 A;  2V84 A;  3MAM A;  1SW1 A;  4OER A;  2QS4 A;  2HZK A;  4R72 A;  4XKN A;  3OOA A;  3CG1 A;  1A54 A;  3QYT A;  4PP0 A;  2O1L A;  3RLF E;  3T9X B;  3KN7 A;  1B4Z A;  4IO6 A;  3ZKK A;  3Q28 A;  3PPR A;  4NF5 A;  1N3W A;  1H44 A;  4F3S A;  4KCD A;  5JTY B;  4AQ4 A;  3U92 A;  4O3A A;  4GQO A;  4FOR A;  4QSE A;  1JVX A;  3RY3 A;  2REJ A;  2XXT A;  2RIN A;  5TPA B;  4H67 A;  3IO4 A;  2Y7P A;  1OMP A;  1LAH E;  3TUS A;  3ECR A;  1NL5 A;  3G3I A;  3PMW A;  2X7Q A;  4G8H A;  4OTE A;  1MPC A;  4QHQ A;  4U21 A;  3VLW A;  2F7A A;  4DZ1 A;  3EHS A;  1RKM A;  4GL0 A;  2A5T B;  3TCG A;  3S9E A;  5H8Q A;  4Q30 B;  3H6U A;  2AL5 A;  2F6G A;  2PVU A;  2XXP A;  4ZDM A;  3ZS6 A;  1GVC A;  4U23 A;  4U1Z A;  2O69 A;  3QUF A;  3TAJ A;  2X26 A;  3C31 A;  3TQL A;  2H98 A;  3IL1 B;  1Y9U A;  1HSL A;  3FXQ A;  3LC8 A;  4DDD A;  3VE1 B;  4DXB A;  5CMC A;  4PFU A;  1MY4 A;  4ZEK A;  1XS5 A;  1PBP A;  3IOU A;  1DSN A;  1S9T A;  4POX A;  3EF7 A;  3JZJ A;  3QSL A;  3TZA A;  3K2D A;  2ESN A;  1FQC A;  1QKB A;  4I8C A;  4GOT A;  3TEL A;  1MQI A;  2VD2 A;  3N6T A;  3TDJ A;  4I9D A;  2DYX A;  3IOR A;  1JEU A;  3IAZ A;  3SEY A;  1OVT A;  1MM7 A;  3FAS A;  4KCC A;  4ZEC A;  4ZEB A;  1IXG A;  5I2N A;  2Z8F A;  1OIB A;  2NVU B;  3H4Z A;  3V8X B;  2VGQ A;  4GF8 A;  5H8H A;  3AXF A;  1DTG A;  1MXX A;  5H8N B;  1PB9 A;  4FAJ A;  4IGT A;  3EHU A;  4Q5T A;  2E1S A;  4YAH X;  3TMG A;  2R71 A;  3C36 A;  4IO3 A;  1FQA A;  2D3I A;  1JEV A;  5TU0 A;  1LAX A;  3HHF A;  2Q8J A;  1ZU0 A;  4EF2 A;  1MY1 A;  3DLN A;  1SYH A;  3UK4 A;  4OET A;  4R74 A;  3V5A A;  1H3D A;  4EUO A;  2HAU A;  4OWD A;  2GHB A;  3B6T A;  3VXC A;  4BDR A;  3MVX A;  3MPK A;  4ISU A;  4Q0C A;  3T9H B;  2I4C A;  3GBB A;  5DEX A;  1URD A;  4FIM A;  4JB7 A;  2F8D A;  3C4M A;  3S9N C;  2YJP A;  5I2K A;  3FAT A;  2Z22 A;  3JV9 A;  5AE4 A;  4RK9 A;  4IO5 A;  3FJM A;  4OXV A;  1UTH A;  1P1O A;  1XT8 A;  3RT6 B;  3KEI A;  3E9X A;  5DTB A;  2O7I A;  3CSB A;  4XTC Q;  3MW0 A;  3EPE A;  4OEN A;  2ZNT A;  2XXX A;  3SET A;  1AL3 A;  1ANF A;  1IIT A;  1XVX A;  2DVZ A;  2F34 A;  3TTR A;  2OK2 A;  3QK6 A;  3S9M C;  1I6A A;  1FQE A;  2GFE A;  3FVK A;  4OMB A;  4NF6 B;  4NWC A;  1LLS A;  1POT A;  4F3G A;  4QSC A;  2P2A A;  2XHD A;  1UIU A;  2REG A;  3PU5 A;  4PET A;  1B7U A;  4G2Z A;  4KHZ E;  3RNN A;  1MXW A;  5I56 B;  1A99 A;  1QW0 A;  4WXJ A;  2HQ0 A;  1NNK A;  3K6U A;  5BWJ A;  4RJZ A;  5JTY A;  1MDQ A;  1SI1 A;  3UA8 A;  1SW2 A;  4R2F A;  1LBC A;  2QMX A;  2ALU A;  4RPN A;  1Q35 A;  1MY2 A;  4G68 B;  3T9V A;  3OO6 A;  3FVN A;  1NMU A;  3VV5 A;  1IXH A;  4QF9 A;  3IX1 A;  1GR2 A;  4F1U A;  2DQV A;  4BDO A;  2THI A;  1OQG A;  3KSJ A;  2Q88 A;  2E0S A;  3FD3 A;  1NH8 A;  1MDP 1;  3G3G A;  2ZYO A;  2BJJ X;  2KLF A;  3UIF A;  2ZMB A;  3S9L C;  4FED A;  1P1Q A;  3SDF A;  3TCH A;  2GH9 A;  1CE2 A;  2RC9 A;  4KYE A;  3N94 A;  2F97 A;  3Q27 A;  3U93 A;  1KWH A;  1MPD A;  1XOC A;  3C32 A;  3KOS A;  2DWI A;  5EHM A;  4F2O A;  1LFG A;  4LQ2 A;  3N5L A;  1MS7 A;  3B6W A;  3A3C A;  2QMW A;  2O51 A;  4FAT A;  4GLI A;  4KFQ A;  1B3L A;  2H4I A;  1VFD A;  3O2A A;  3MP8 A;  3CVG A;  1LFH A;  4GRK A;  4GD5 A;  4R73 A;  5CI5 A;  4DE8 A;  2RCB A;  2FNC A;  1NNF A;  3K0V A;  2ONK E;  1PB8 A;  4NF4 A;  5EHS A;  2ZNU A;  1MY0 A;  3O66 A;  4ND9 A;  3VDF A;  4H5F A;  5HM4 B;  1ZTY A;  2D5W A;  3A09 A;  2QRY A;  1OVB A;  1ZLQ A;  5CC2 A;  1TWY A;  5AA3 A;  1Y3P A;  2OBG A;  4ZE9 A;  4YZZ A;  3TKD A;  4M1V A;  2XX9 A;  4R9F A;  1B5H A;  1EU8 A;  1LBB A;  1IUD A;  1BP5 A;  1Z7M E;  4R2B A;  1JW1 A;  4G77 A;  1T0K A;  4ELP A;  3TPA A;  3KZG A;  4JSD A;  3T93 B;  4LZ5 A;  2R6G E;  3UP9 A;  4YKP A;  3HV1 A;  4F22 A;  2YPN A;  2VOZ A;  2Z8D A;  2PYY A;  5FTI A;  1MXZ A;  4JXI A;  5BUU A;  2VP1 A;  3WAE A;  2UVI A;  3ZSF A;  2DS9 A;  2H99 A;  2Q2C A;  3G3F A;  2I48 A;  3IJO B;  5ICQ A;  2RKM A;  1TFD A;  4QRZ A;  2R9J A;  3C9H A;  1O7T A;  3LR1 A;  4EXK A;  4I62 A;  2H5Y A;  3S4U A;  2IA4 A;  3CG3 A;  3IOV A;  4PFY A;  2CZL A;  3SEX A;  2IEE A;  3ILU B;  4U22 A;  3LSX A;  1D9V A;  1MXV A;  3MZ9 A;  4LON B;  3TEP A;  2I6E A;  1H76 A;  3K6V A;  1XHY A;  3SER A;  1N76 A;  5J1D A;  5JK4 A;  5FHM A;  4NF6 A;  4LZ7 A;  4X48 A;  1LFI A;  2XD2 A;  2ZYK A;  1R6Z A;  2ANJ A;  3PMV A;  5DYH A;  1A55 A;  3PV0 E;  3H03 A;  2XX7 A;  3H6V A;  3IB0 A;  3TTK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...