1S9TA

Crystal structure of the glur6 ligand binding core in complex with quisqualate at 1.8a resolution
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
251
structure length
251
Chain Sequence
NRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKGTPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the GluR5 and GluR6 ligand binding cores: molecular mechanisms underlying kainate receptor selectivity.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Membrane protein
molecule keywords Glutamate receptor, ionotropic kainate 2
total genus 88
structure length 251
sequence length 251
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1s9tA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1s9tA02
1LSTA 3TQWA 3CVGA 3FV2A 3QK6A 4GVOA 3HHFA 5DVJA 4BDQA 3WAEA 3N6TA 4KR5A 3MP8A 4H0WA 4N13A 3V8XB 3HCQA 5TPAB 3MVYA 3OSRA 2Y7IA 4GF8A 2HXWA 1LAHE 2Y7RA 4HCYA 2A5SA 4ZZAA 3TCFA 2O7IA 3TMGA 4ELQA 2RKMA 3B6WA 2ZMBA 4X9TA 3UK4A 4EDPA 4YAHX 2Q89A 3K6WA 4POWA 4Q0CA 4ECFA 1SBPA 3SESA 2ZYNA 3FJMA 5F1QA 1AOVA 2I6EA 3ZS6A 4E0WA 4F19A 4NF5B 3MC2A 1XVYA 1UIVA 3PD8A 1B4ZA 2O51A 3TPAA 1QUKA 1LBCA 1IXGA 4NF6B 2BJJX 3K02A 4GXAA 3KN3A 4K3FA 3W9WA 4ZEDA 4G77A 1MRPA 1N84A 1XT8A 4OFOA 3UA8A 1I6AA 1LCFA 1BTJA 5TP9A 3VXBA 5I59B 1PBQA 3KSJA 4R74A 1R9LA 2GHAA 3CG3A 3A3CA 3O97A 3OO7A 1PB9A 3P7IA 3JYRA 1CE2A 3LC8A 3OO8A 4X48A 2XXYA 4G4PA 4LZ8A 1GTKA 2RC9A 3T9XB 3DP8A 1F9BA 4HW8A 3VLWA 2D21A 5B70A 2Q9TA 3OOAA 1B5JA 4JBZA 4GXSB 1N3WA 2YJPA 2OK2A 1NFTA 4RNSA 4LQ2A 2GFEA 2DQVA 2XXQA 3C33A 4TLLB 3T96B 3TCHA 1MPBA 3O28A 1FQEA 1M5CA 1URDA 2DE4A 3M3FA 4UACA 2PVUA 2XXRA 3OO6A 3LSWA 1Z7ME 3MPKA 3QUFA 4NF4A 4P11A 4Q30B 3PPRA 1DMBA 1FTMA 2I0CA 2ONKE 2PYYA 5CM6A 3FD3A 4F2QA 3FXRA 3K6UA 3PD9A 2O84X 3H6UA 1OQHA 4R6HA 3S4UA 4THIA 5FHMA 3N26A 4MLQA 1ZIUA 3CFXA 1FQDA 2I49A 3SEYA 4JWXA 3Q27A 1Y20A 2NUVA 3N5LA 3O6IA 4GRKA 1JNFA 5I2KA 1M5FA 1XC1A 1MH4A 3ILTB 2UXAA 1DSNA 3FVKA 5DVFA 3EN3A 1SW5A 4RXLA 1B3EA 4WXJA 2O1LA 1T0KA 1MY1A 2QS2A 3T22A 1BKAA 1N7WA 2LAOA 3T93B 4AB5A 3DELB 4JSOA 1B3HA 3TODA 4ZEIA 3W9VA 5IAIA 2UVHA 3E9XA 2HAUA 1EH3A 1SI1A 3PMVA 1RYOA 3LSFB 3H4ZA 1MXVA 5F7VA 1ZLQA 2ANJA 1DPPA 1Y9UA 2HZLA 5A5XB 4JB7A 1H43A 3HN0A 4IO2A 5H8QB 5KZTA 1MXZA 1B7HA 2AIXA 4X1DA 3FATA 5TPAA 5H8NB 3IJXB 4KYDA 4DLDA 5JTYA 1Y3PA 2W7YA 3ZSFA 3KOSA 4I1DA 5H8HB 4OESA 4OEUA 2B3FA 3MVWA 1B46A 1FQFA 2PMSA 1H45A 4OVJA 4F1VA 3HSTA 1IUDA 3HHGA 1LBBA 4LZ7A 1N7XA 3C9HA 1YAEA 2ZNTA 2V3UA 4MLVA 4F3GA 3Q26A 1TFDA 2H99A 4Z0IA 2V84A 1MY2A 3EQ1A 4PETA 3WAFA 4C1UA 5FHOA 3RGYA 4PFWA 5L9MA 1DOTA 4GIZA 2QRYA 3KSXA 4F1YA 2F35A 1M5EA 3V89B 1HSEA 4O3CA 1P1UA 2RC7A 3SEXA 4I62A 2F34A 4RA1A 2Y7PA 3C35A 3CR9A 3K4UA 3MW0A 4GWOA 4RY1A 3U8QA 5AA4B 4LONB 1I69A 2O6AA 1R6ZA 3C36A 3H3GA 1B0LA 4QFLA 3VDFA 3VLVA 4F1UA 3EPEA 4NF8A 3S9EA 4Q8RA 4EF1A 2GRVA 4H8IA 4NE4A 2XX9A 4QRZA 2E1SA 1QKBA 3RT8A 2VHAA 3IB2A 1IXIA 3Q29A 4NMYA 1KWHA 3T9HB 2X26A 5HPQA 3K01A 1FTOA 1JETA 4FORA 4EUOA 4F31B 4BLAA 3CI8A 3I5OA 4DE8A 1B3LA 3E4RA 3G3FA 2H4IA 4U23A 4F18A 1Y4TA 1IXHA 1ELJA 4ELOA 2E0SA 1GVCA 1O64A 1MXWA 3IORA 3EF7A 3V83A 4KFQA 1B51A 3HO7A 2XXIA 1MXYA 4MFIA 4DIGA 4H67A 1LAFE 3G7WA 3G3IA 5I56A 4ZZEA 5H8FA 4GL8A 3U93A 1QJMA 3C4MA 1I6BA 5A5XA 5L8DA 4G68A 4U4XA 1B4HA 1XHYA 3U72A 5LOMA 1P99A 3OD7A 1MQIA 1MG1A 2CMOA 2KLFA 1FQAA 3L6HA 1LFHA 3C32A 2B65A 2ZYKA 3O2AA 2Z23A 4EQ7A 1MPCA 3KJTA 2XD3A 4C1TA 5I58B 5DEXA 3M3KA 1MS7A 1HSLA 4KCDA 4NWCA 2B3BA 2UVJA 1UTBA 3DLNA 2NXOA 5DVIA 1LAXA 4G68B 2X7QA 4DXCA 4RK2A 2WKYA 2XXPA 1ATGA 3DM0A 1FTKA 1M5DA 1FTJA 3MZ1A 3H6TA 4MBPA 2VOZA 1OLAA 2QS1A 3M8UA 4P0GA 5ISUA 1B40A 3K00A 4F22A 1PBPA 4TOZA 4R2FA 1QW0A 1OQGA 3LSXA 1XS5A 3SDFA 1B9JA 2ESNA 4M4GA 3MAMA 4GFRA 5H8NA 3SETA 4XTCQ 1ZMGA 2Z8EA 4OMBA 2DSFA 2VD2A 2I4BA 1ZTYA 2P2AA 1LFGA 1S7YA 3VXCA 5CRYA 5ICQA 3KG2A 2FYIA 3MZ9A 4EF2A 3LSLA 3R6UA 3GXAA 2ONRA 4R2BA 1USYH 4RYAA 3IK6B 2XX8A 4H6DA 3MVZA 3KN8A 4HCWA 4LATA 1SW4A 2D3IA 4H65A 5I84A 4FJPA 2H25A 2XXWA 1QUJA 1A7LA 5EHMA 2P0SA 4ZE8A 3IL1B 1Y3QA 3L6GA 5DTBA 2DWHA 2F7BA 2HQ0A 3CFLA 1PDAA 1EZOA 3MQ9A 4F39A 3K1MA 4OFJA 3UGWA 4ESWA 3TTMA 1B1HA 2Q2AA 5K2XA 3GZGA 4QSCA 3R26A 2I0BA 3GBBA 3K6XA 3IR1A 3RY3A 3IJOB 4YB5A 4YMBA 4OXVA 1NL5A 4BDLA 4BDMA 1RKMA 4F3PA 1N3XA 3PV0E 1US4A 4XIGQ 3FASA 4NF4B 1POTA 1B52A 3RN8A 5I57B 3MWBA 4GOTA 1OVBA 1NNFA 1MH3A 2F97A 2PT2A 3VVEA 4FATA 3IO6A 1VR5A 4LVQA 3G3HA 5CMBA 3RTWB 3TFLA 3KN7A 3E3KA 3FVNA 2Q2CA 2F5XA 5HBCA 1TFAA 2XX7A 4ZECA 3EHUA 1ANFA 1NNTA 3H06B 1OIBA 1SI0A 3KGCA 4XKRA 1B3GA 3T66A 3JV9A 4KYEA 4OHNA 3B6TA 1IQ7A 2I3WA 2F78A 4ND9A 5BWJA 5AA2A 2RCBA 1QKAA 2O69A 3EHSA 4PQJA 3THIA 3BBRA 4FECA 4WEDA 3USDA 3D4CA 4OQOA 3LUYA 2DYXA 4PFYA 3PUVE 3LBSA 3U94A 2F8DA 1USYE 2ABHA 3CSBA 3OO9A 4FE8A 1B6HA 4LQ5A 5FHNA 5I59A 1P1OA 2O68A 1Z7NE 4IO6A 2F6PA 2QJEA 2DVCA 1CB6A 4YICA 3R7XA 2AYSA 3CRBA 2GHBA 3DP6A 1N76A 1VFEA 2IEEA 3PPOA 1QUIA 2UVIA 3FJGA 3QIMA 3T9UA 4BDNA 3PPPA 3V5AA 3PUYE 1JW4A 5K2YA 1B7UA 2DOJA 2I3VA 2FNCA 4YMAA 2QMXA 5J1DA 4GQOA 2UVGA 4KI0E 1EZPA 3RLFE 1TWYA 4NF8B 4E0XA 4JWOA 1ZU0A 2P1SA 4MH5A 3VV5A 3TEPA 2OCUA 4OEVA 1MQGA 4P0IA 4OTEA 1MQHA 4YB7A 2R9JA 1MDQA 4YU0A 4RPNA 1O63A 5BUUA 4QSEA 4ZEBA 1Q1KA 4ESXA 1ZBMA 2H9BA 3O9PA 4Q5TA 1AMFA 3GLBA 5H8HA 2ALUA 3W15C 5I2NB 1L5TA 4U22A 1SQYA 2XXUA 3SERA 3ODBA 4HS7A 4QFOA 1DTZA 4R72A 1P1QA 1NMUA 1PB8A 1Y1ZA 5H8QA 4DCXA 5AA3A 2VP1A 5CMCA 4F2OA 1Y4CA 5H8SA 3K6VA 3B6QA 3GBAA 1A99A 1LFIA 4WEPA 3FGSA 3OEKA 2HFBA 2ZXTA 4JSDA 2V93A 3FZVA 3TTKA 3TZAA 1YCJA 4N6PA 2I4CA 3RT6B 5JEIA 1WDNA 3KJ7A 4R6KA 1AH5A 1B3FA 1UTHA 4H5GA 1YTVA 3T9VA 1TXFA 3TTRA 5ICTA 4NTLA 3IO4A 4QFPA 4RJZA 3EHTA 2V25A 1JQFA 4RPOA 2PT1A 5ELVA 3UP9A 4O3AA 2DWAA 1IXCA 3O66A 2ZYMA 4G8HA 3IB0A 4H1XA 2DWIA 4G68C 2OWTA 3MBPA 4OFLA 3MP6A 2ZNSA 2R6GE 4YB6A 1H3DA 3O6HA 5IKBA 3U1OA 3H6WA 4Z7EA 1LB8A 3BKIB 1MM7A 4RK9A 4U1OA 1B5IA 3QSLA 2R71A 1M5BA 1RYXA 3B7DA 3ILUB 4QHQA 2HZKA 1A55A 5L9OA 4FIMA 1P1NA 2HCAA 1B58A 5TP9B 3FVOA 4JWYA 1ZKBA 2O7UA 1MQJA 3ECRA 3UORA 3OSQA 2PX1A 1NKXA 1A40A 3QXMA 4G8MA 1IZ1A 2I48A 4HTGA 1QULA 1DTGA 5CI5A 1WVJA 2F7CA 5EHSA 1PC3A 2GH9A 4DCYA 4X1BA 4YKPA 3SEWA 3VLUA 4XKNA 3TCGA 3OMBA 1SW2A 3DP4A 1HSJA 4IB2A 4OYVA 4R9GA 3RTFB 3SEVA 4UA8A 2QS3A 2ZNUA 1AIVA 1IIWA 4YKIA 4DXUA 5ITPA 1NH7A 2YPNA 1URGA 1FQBA 1EU8A 4PP0A 1FTLA 1MY4A 3LR1A 1B7ZA 1NH8A 4TLMB 4ZDMA 2V3TA 1OMPA 1LAGE 4KQPA 2QMWA 4ONYA 1MXXA 4OETA 1R1NA 4KD5A 1A8EA 1LB9A 1EZ9A 2RINA 3K2DA 5ITOA 3VFJA 3OELA 3VVDA 2Q8JA 2OWSA 2Y7KA 4EQBA 1SYHA 1LLSA 2XXTA 2Z22A 3UN6A 4ZE9A 5AA1A 3RUMA 4R75A 1AL3A 1P1WA 2G29A 1S9TA 3KEIA 2DS9A 1UTHB 1JVYA 1ZJLA 4F29A 2OJTA 1LCTA 4PFTA 3O6GA 4R73A 4G2ZA 1VFDA 3G3JA 4BDRA 1SW1A 1MQDA 5CBSA 3MJNA 3PUZE 2DE3A 1OVTA 1FCKA 2XXHA 5KCJA 4ELRA 3KZGA 1FQCA 4NF6A 1S50A 3TQLA 4L17A 4MF3A 3PU5A 4KYSA 3K1PA 3KOTA 4ZS9A 1MPDA 5EYFA 1N04A 4XKQA 1D9VA 2VD3A 4U21A 2QS4A 1JW5A 1PB7A 1OLCA 1YPNA 2QPQA 5CC2A 4I8CA 2Z8FA 3S9MC 3FXQA 1WODA 2AL4A 3CFZA 5L9SA 1BLFA 2OBGA 5AE4A 1XOCA 1B32A 4QFKA 4PFUA 1XVXA 3TELA 1JVXA 1UQWA 1D9YA 4M1VA 4OZ9A 2NWJA 3TAJA 4F3BA 3QAXA 3FV1A 2ZYOA 3ONMA 3VE1B 1B2HA 1B5HA 3IX1A 4YKKA 4OENA 4BDOA 3TKDA 4EXLA 1A8FA 2D5WA 2V3QA 3A3UA 2HEUA 2DVZA 2F6GA 3D4GA 3H03A 1SVXB 2DWJA 3HV1A 4TQUQ 4YKJA 3TYHA 3QYTA 4ELPA 1Y3NA 1JW1A 1MDP1 3FUZA 5H8FB 5DEXB 5I56B 2OLBA 4GLIA 3UIFA 5AA2B 2Z8DA 4LZ5A 1Q35A 1IITA 4NF5A 1BP5A 2M8CA 5TU0A 3BFTA 2RCAA 2G93A 3FXUA 3PUWE 4FAJA 2ONSA 1B1XA 2H5YA 2QL3A 4IY6A 2CZLA 4JDFA 3N94A 1Y1MA 2XHDA 3I6VA 4JXIA 4XXUA 4ZEKA 3TTLA 3OEMA 1MM6A 4NWDA 2F7AA 2THIA 2UYEA 4G8NA 1MY3A 5DYHA 3S9NC 1PEBA 3IOWA 1SD3A 2Y84A 4U2RA 4WKMA 3AXFA 3FVGA 5JTYB 3KFMA 1R9QA 2NVUB 3FIRA 3TUSA 3MZBA 4EXKA 2DP8A 4O3BA 3ZKLA 4DZ1A 3MVXA 2DXYA 1A54A 3H7MA 4IO4A 1VE4A 4IO3A 3RNNA 5AA4A 3Q28A 3CG1A 2A5TB 3S2VA 3TTNA 3FJ7A 1B05A 1URSA 3HPIA 5CBRA 2F36A 2YLNA 3IAZA 3PGFA 2XD2A 3E13X 3RQTA 4R6YA 4C0RA 4U4SA 5AA2D 4KPTA 1POY1 1H44A 1UTBB 4IGRA 1GV8A 1JEVA 4H5FA 1LGBC 2VGQA 2XXXA 4DDDA 4U1ZA 2AL5A 5I2KB 1VSOA 5KDTA 2I58A 1TT1A 3MP1A 3O29A 5FTHA 1O7TA 3TDJA 1JEUA 4F3SA 5CMKA 1SDXA 1I6QA 2HAVA 3KBRA 3PPNA 5CMMA 3PMXA 3JZJA 3OXNA 3PMWA 3G3KA 4PE5B 2H98A 1IEJA 2RC8A 4LUBA 4POXA 4QSDA 3SKPA 3S9LC 3OENA 1N0TA 2PBWA 3IOVA 2UYFA 5M2VA 3CSGA 4I9DA 1FW0A 2O1MA 4N07A 4EQ9A 4FEBA 4FEDA 4YZZA 1NNKA 1US5A 3C34A 3F11A 4AB6A 3PUXE 3N6UA 1GGGA 5B7DA 5HM4B 5I57A 3I3VA 4ISUA 4OERA 3MPLA 1II5A 3M3LA 4GL0A 1MXUA 1D3KA 5FTIA 3VVFA 2X7PA 3PPQA 3U92A 3K1NA 4AQ4A 4DXBA 2DXRA 5I2NA 5KDTB 1QVSA 3Q25A 5KCJB 2XXVA 3C31A 3G3GA 2Q88A 4IY5A 4LA9A 5I58A 2REJA 4IGTA 3CIJA 4QFNA 2OZZA 4GD5A 4LP2B 1MY0A 3ZKKA 3BFUA 2FA7A 3QUJA 5JK4A 2QSXA 4IO5A 3K0VA 2A5TA 5DT6A 2DE2A 1DPEA 3RPWA 3IOTA 3IOUA 1D4NA 1J1NA 1GR2A 2IA4A 2REGA 1B0HA 1NNPA 4IO7A 4KHZE 4NEDA 3SEUA 4H8JA 3IB1A 1UIUA 2Y7WA 3MUQA 2NOOA 3H6VA 4XKPA 4OWDA 1BIYA 3A09A 4KCCA 4ZEFA 1H76A 4QF9A 2RF1A 4R9FA 1SYIA
chains in the Genus database with same CATH superfamily
5DVJA 1Q9DA 3WAEA 3N6TA 4N13A 1LAHE 4ELQA 1INPA 2O7IA 2ZMBA 4X9TA 4EDPA 4YAHX 3K6WA 4Q0CA 1IMBA 1UIVA 2O51A 3K02A 1NUYA 4G77A 1N84A 5TP9A 1PBQA 4R74A 5ET6A 3CG3A 3A3CA 3JYRA 3BIGA 4LZ8A 1GTKA 4HW8A 3VLWA 2D21A 5B70A 4PC9A 2XXQA 3O28A 4NQ8A 1FQEA 1URDA 2XXRA 2QVRA 3OO6A 3A29A 1Z7ME 3MPKA 3PPRA 1FTMA 2PYYA 4F2QA 4THIA 4JVCA 5FHMA 3N26A 4MLQA 1Y20A 3O6IA 1JNFA 3FVKA 3EN3A 4WXJA 1B3EA 2O1LA 1MY1A 5ET7A 4ZEIA 3E9XA 2HAUA 1RDYA 1ZLQA 4JB7A 4X1DA 5H8NB 3IJXB 3ZSFA 5H8HB 4OEUA 2B3FA 1H45A 4OVJA 3HSTA 1N7XA 3C9HA 2ZNTA 2V3UA 4MLVA 3Q26A 2XWIA 3EQ1A 4C1UA 3WAFA 2QRYA 2XWKA 3SEXA 4I62A 3MW0A 3C35A 3K4UA 3U8QA 5LTCA 3H3GA 3VDFA 3EPEA 4EF1A 4NMYA 2Q8MA 1KWHA 3T1BA 5HPQA 4XEQA 4BLAA 4JVIA 2H4IA 3PTYA 4F18A 1Y4TA 1IXHA 3EF7A 4KFQA 2XXIA 4N8GA 4ZZEA 1QJMA 3C4MA 5L8DA 4G68A 3KC1A 1XHYA 1P99A 2KLFA 1LFHA 3C32A 2ZYKA 1MPCA 2XD3A 4C1TA 1HSLA 1UTBA 4G61A 3DM0A 1FTKA 2QS1A 1B40A 4F22A 4TOZA 4R2FA 1QW0A 4M4GA 2ESNA 4GFRA 3SETA 1ZMGA 4OMBA 4GX3A 2P2AA 1LFGA 3KG2A 3R6UA 1USYH 4H6DA 4HCWA 4LATA 1SW4A 5I84A 2P0SA 2DWHA 4F39A 3UGWA 4ESWA 1B1HA 3IR1A 4PAIA 5ET8A 4N17A 1US4A 3FASA 3KC0A 1NNFA 3VVEA 3RTWB 5CMBA 2Q2CA 5ESYA 5LDZA 1TFAA 2XX7A 4QXDA 2B4LA 1NNTA 2Y5KA 1OIBA 3H06B 3T66A 3TMGA 1B3GA 2F78A 2PFYA 4GWSA 3D4CA 2DYXA 3HFUA 4PFYA 3LBSA 4NX1A 2F8DA 4OQOA 2ABHA 3OO9A 4FE8A 4LQ5A 1P1OA 3R7XA 2DVCA 2AYSA 2IEEA 3FJGA 2HPGA 1JW4A 4MIJA 2DOJA 1TWYA 4JWOA 4OEVA 3IFCA 3ISPA 4OTEA 2R9JA 5BUUA 1O63A 2Y5LA 1L5TA 4P56A 4QFOA 4X8RA 5CMCA 4F2OA 1Y4CA 3K6VA 1A99A 2V93A 4R6KA 1AH5A 1YTVA 5ICTA 3IO4A 4O3AA 1LBYA 2DWAA 3RYDA 2ZNSA 1NUXA 4RK9A 5L9OA 4PAFA 3ECRA 4PFRA 5FBPA 2PX1A 1NKXA 4HTGA 5CI5A 4DI3D 1WVJA 4DCYA 4XKNA 3TCGA 1CNQA 3DP4A 4TLMB 1OMPA 4KQPA 3VFJA 3K2DA 3VVDA 1NUWA 4EQBA 2OWSA 2CZHA 2Z22A 3UN6A 4R75A 1UTHB 4F29A 4NAPA 4O7MA 3G3JA 1FPIA 5CBSA 5KCJA 1FQCA 4MF3A 3PU5A 4KYSA 3K1PA 3KOTA 5EYFA 2VD3A 1PB7A 1OLCA 2L5VA 3CFZA 2OBGA 1XOCA 1SPIA 2JJKA 3TELA 1UQWA 2NWJA 3ONMA 3VE1B 2QFLA 4BDOA 1A8FA 2D5WA 2F6GA 2QVUA 4HE2A 4ELPA 1JW1A 1MDP1 5H8FB 4NF5A 4GX6A 2M8CA 4N4UA 2QL3A 3N94A 2XHDA 1MM6A 1PEBA 1SD3A 1FJ9A 4U2RA 3KFMA 1R9QA 3B50A 4O3BA 4DZ1A 3H7MA 3FJ7A 2F36A 1BK4A 3E13X 4MCOA 5AA2D 1H44A 2AL5A 2WBDA 1TT1A 3MP1A 1O7TA 1JEUA 4PF8A 2HAVA 3PMXA 4PE5B 3JZJA 3G3KA 4QSDA 3SKPA 4LUBA 4NF0A 3OENA 3IOVA 3CSGA 4I9DA 4FEDA 3C34A 5B7DA 4MNCA 5FTIA 3K1NA 3Q25A 5KCJB 2XXVA 3G3GA 5I58A 2REJA 4IGTA 2FA7A 3QUJA 2QSXA 4IO5A 3RPWA 3IOUA 4IO7A 1J1NA 2IA4A 2WX9A 1FPDA 3H6VA 4OWDA 1BIYA 4R9FA 1SYIA 3TQWA 3QK6A 4JVDA 3E78A 5TPAB 4GF8A 3LV0A 4POWA 4ECFA 2I6EA 1XI6A 1XVYA 3TPAA 1LBCA 1IXGA 4NF6B 4K3FA 4GXAA 4P3LA 3KN3A 3W9WA 2P3VA 1MRPA 4OFOA 1LCFA 1KZ8A 5I59B 3KSJA 3OO7A 3O97A 1CE2A 3LC8A 3T9XB 3FBPA 1N3WA 2OK2A 1NFTA 1MPBA 1M5CA 4I40A 3LSWA 5CM6A 3FD3A 3FXRA 3K6UA 2O84X 3H6UA 4R6HA 3S4UA 1ZIUA 1FQDA 5I5PA 1FPEA 3Q27A 2NUVA 3N5LA 5I2KA 4RXLA 2QVVA 1JP4A 1N7WA 2LAOA 3T93B 2UVHA 3PMVA 5I7IA 1Y9UA 1H43A 5H8QB 3FATA 4DLDA 5JTYA 1Y3PA 4HE0A 1IUDA 1LBBA 1FBEA 4F3GA 4PETA 3IFAA 3RGYA 4F1YA 3V89B 1M5EA 1KA1A 2RC7A 1FSAA 2Y7PA 3CR9A 4RY1A 3C36A 3VLVA 4QFLA 4GBWA 4MAGA 1FBGA 2GQ1A 5ET5A 1QKBA 2X26A 2PCRA 2XA5A 3G3FA 1ELJA 2E0SA 2P3NA 2V4CA 4GWYA 1GVCA 1O64A 1B51A 4DIGA 1LAFE 5H8FA 4GL8A 5EYHA 5A5XA 5F24A 1MG1A 3L6HA 3O2AA 1LEVA 1LBVA 5DEXA 1MS7A 4KCDA 4NWCA 2B3BA 2UVJA 3DLNA 2NXOA 1LAXA 4DXCA 2X7QA 2WKYA 2XXPA 3SZPA 4MBPA 2VOZA 1OLAA 3K00A 2FIXA 1OQGA 2DDKA 1LBXA 3MAMA 4XTCQ 2OX3A 2I4BA 4NG7A 1S7YA 5CRYA 4EF2A 3LSLA 4R2BA 1DBZA 2H25A 4I3EA 4ZE8A 4P1LA 3L6GA 4PF6A 4PGNA 2CZKA 4OFJA 3TTMA 3R26A 3GBBA 3K6XA 3IJOB 4YMBA 4BDLA 4BDMA 4PGPA 1N3XA 3RN8A 1OVBA 3IO6A 1VR5A 1IMEA 3D1RA 3TFLA 3E3KA 4ZECA 2FIEA 1ANFA 3EHUA 4OHNA 3B6TA 2I3WA 5BWJA 3USDA 3LUYA 3PUVE 1AOVA 1T0KA 1USYE 4IO6A 4N6KA 4GWXA 3DP6A 1N76A 3PPOA 2PFZA 1QUIA 3PPPA 2I3VA 2FNCA 4MH5A 3TEPA 1MQGA 4P0IA 1MQHA 1MDQA 4RPNA 3QMFA 4QSEA 1AMFA 3GLBA 5I2NB 2ALUA 3ODBA 5EQ9A 4R72A 1NMUA 1PB8A 1Y1ZA 5H8SA 2CZIA 4WEPA 3FGSA 2HFBA 3KJ7A 3RPLA 1B3FA 1NV7A 1UTHA 4H5GA 3TTRA 4RJZA 1JQFA 4RPOA 5ELVA 1IXCA 4PFBA 4G8HA 5I58B 2DWIA 2WBBA 3MBPA 4G68C 2R6GE 5IKBA 3O6HA 1FJ6A 3H6WA 1B5IA 3QSLA 2R71A 1M5BA 3B7DA 2HZKA 3FVOA 3UORA 3QXMA 1QULA 1DTGA 3MSTA 5EHSA 3OMBA 1SW2A 4OYVA 3SEVA 2QS3A 2ZNUA 1NH7A 1URGA 1FQBA 1EU8A 4ZDMA 1MY4A 2V3TA 4ONYA 1MXXA 4AS5A 1G0IA 1A8EA 1LB9A 2RINA 4LN5A 4OVTA 3OELA 1SYHA 4N15A 2XXTA 4ZE9A 1P1WA 1S9TA 1JVYA 4FBPA 2OJTA 3O6GA 4BDRA 1SW1A 1MQDA 1OVTA 3KZGA 4NF6A 1S50A 1IMCA 1JW5A 3FXQA 3FXBA 5EYGA 2ZYOA 1B2HA 3IX1A 4YKKA 3D4GA 3A3UA 4TQUQ 3FUZA 5A5LA 2R8TA 2OLBA 3UIFA 5AA2B 4LZ5A 4MJOA 2G93A 3PUWE 2ONSA 1B1XA 4IY6A 4ZEKA 4JXIA 2THIA 5DYHA 2UYEA 3S9NC 3IOWA 2Y84A 4WKMA 5JTYB 2NVUB 3MZBA 4EXKA 1D9QA 3ZKLA 4DI4B 5AA4A 1NV6A 3CG1A 2A5TB 1B05A 1FBHA 3HPIA 2XD2A 4U4SA 5CC2A 4KPTA 1POY1 1EZPA 5I2KB 1NI9A 4F3SA 1RDZA 1I6QA 3KBRA 4QBAA 5CMMA 5ISUA 3PMWA 4POXA 3S9LC 1N0TA 5M2VA 2O1MA 4N07A 1NNKA 5JK4A 1GGGA 4GWUA 3I3VA 3M3LA 1MXUA 1D3KA 4NHBA 5I2NA 4IY5A 3C31A 2A5TA 5DT6A 2DE2A 1VDWA 1D4NA 4KHZE 1UIUA 4KCCA 4ZEFA 4QF9A 2RF1A 4YZZA 1LSTA 4BDQA 3CVGA 3KBZA 3HHFA 3MP8A 3V8XB 3MVYA 2Y7IA 2HXWA 4ZZAA 4HCYA 3B6WA 2WYKA 5I3SA 3UK4A 2Q89A 4OVRA 1SBPA 3SESA 3FJMA 3E79A 4E0WA 4F19A 1B4ZA 1QUKA 2BJJX 4N6DA 4ZEDA 1NV0A 1RDXA 3UA8A 1PB9A 5IZ1A 4X48A 4G4PA 1F9BA 2KR0A 1B5JA 4RNSA 2GFEA 2DQVA 4TLLB 4OA4A 3T96B 4UACA 3M3FA 3QUFA 4P11A 4PBQA 1DMBA 2I0CA 2XWOA 1FTAA 3PD9A 5EQ8A 2I49A 4GRKA 2UXAA 1DSNA 1SW5A 2HXRA 4P9KA 3DELB 4JSOA 1B3HA 3TODA 3W9VA 5IAIA 3NOHA 1RYOA 3H4ZA 1MXVA 5F7VA 1DPPA 5A5XB 3HN0A 4IO2A 5KZTA 1B7HA 2FHYA 5TPAA 1EYKA 1FPKA 2W7YA 3KOSA 4I1DA 4OESA 2PMSA 1FQFA 1TFDA 1MY2A 5L9MA 4O3CA 1P1UA 2F34A 5J1DA 5AA4B 4LONB 1R6ZA 1B0LA 3S9EA 4F1UA 2GRVA 2E1SA 3IB2A 4FORA 4F31B 3CI8A 1B3LA 1FBFA 2CEYA 4U23A 4ELOA 2ZZVA 3IORA 3HO7A 1MXYA 4MFIA 1LBWA 4H67A 3G3IA 5I56A 4U4XA 1B4HA 5LOMA 3OD7A 1MQIA 2CMOA 2B65A 2Z23A 3KJTA 3M3KA 4O7IA 5DVIA 1ATGA 2Q74A 1M5DA 3H6TA 1FBCA 3SDFA 2FBPA 5H8NA 2Z8EA 2VD2A 1ZTYA 4GWZA 4PE3A 4OVQA 4MHFA 2ONRA 2XX8A 3MVZA 4UABA 2D3IA 2XXWA 3GYYA 3IL1B 1Y3QA 1NV2A 2OWZA 2F7BA 3CFLA 1EZOA 3MQ9A 2Q2AA 3GZGA 2I0BA 3RY3A 1NL5A 4F3PA 1B52A 3MWBA 4GOTA 2F97A 4LVQA 5HBCA 4NGUA 1FRPA 3JV9A 5IM2A 2ZZWA 2XWVA 4HE1A 5AA2A 2RCBA 2O69A 1YZ0A 3EHSA 4NN3A 4FECA 4WEDA 3U94A 2WYPA 1Z7NE 3CRBA 1VFEA 3QIMA 2UVIA 4MNPA 5K2YA 1B7UA 2F3BA 4YMAA 2QMXA 4GQOA 4KI0E 3VV5A 2P1SA 4YB7A 4ZEBA 1ZBMA 5H8HA 2XXUA 3RPLB 3SERA 4GBVA 1P1QA 3TZAA 3FZVA 1YCJA 2I4CA 3T9VA 5T3JA 1TXFA 2HHMA 3EHTA 2PT1A 2ZYMA 3IB0A 4YB6A 1IMAA 3U1OA 4Z7EA 1LB8A 3BKIB 1MM7A 2O7UA 3OSQA 1A40A 4G8MA 1IZ1A 2GH9A 4IB2A 4R9GA 4AS4A 4UA8A 5J16A 1IIWA 5ITPA 4PP0A 4O8MA 1R1NA 4KD5A 1EZ9A 4MMPA 2VPNA 2Q8JA 1AL3A 2G29A 3KEIA 1ZJLA 4H46A 1LCTA 4R73A 3MJNA 3PUZE 4L17A 4ZS9A 1MPDA 1N04A 4XKQA 1D9VA 4U21A 4I8CA 3S9MC 2AL4A 5L9SA 1BLFA 4QFKA 1JVXA 4OZ9A 4M1VA 1B5HA 4EXLA 4OENA 2V3QA 2DVZA 3H03A 1SVXB 3TYHA 1Y3NA 5DEXB 2Z8DA 1Q35A 5TU0A 4FAJA 1EYJA 2CZLA 4XXUA 3TTLA 4NWDA 2F7AA 3FIRA 3TUSA 2DP8A 2DXYA 1A54A 4IO4A 3S2VA 1FPGA 5CBRA 3RQTA 1EYIA 1GV8A 1UTBB 4IGRA 4H5FA 1LGBC 2VGQA 3CHGA 4U1ZA 2I58A 3O29A 5FTHA 3TDJA 5CMKA 3PPNA 3OXNA 2H98A 1IEJA 4EQ9A 4FEBA 4AB6A 3PUXE 3N6UA 4MX6A 4ISUA 4X04A 1II5A 4GL0A 3U92A 2DXRA 5EQAA 2Q88A 4LA9A 4PDDA 4QFNA 2OZZA 4LP2B 1MY0A 3BFUA 3K0VA 1DPEA 1B0HA 3SEUA 4H8JA 3MUQA 2NOOA 4XKPA 3A09A 4EQ7A 1MH3A 4PAKA 3FV2A 4GVOA 1K9ZA 4KR5A 4H0WA 3HCQA 3OSRA 2Y7RA 3TCFA 2A5SA 2RKMA 2VT5A 2ZYNA 5F1QA 3ZS6A 4NF5B 3MC2A 3PD8A 1FPFA 1XT8A 1I6AA 1BTJA 3VXBA 3EKIA 3ROJA 5IZZA 1R9LA 2GHAA 4XF5A 3P7IA 3OO8A 2XXYA 2RC9A 3DP8A 2Q9TA 3OOAA 4JBZA 4GXSB 2YJPA 4LQ2A 3TCHA 3C33A 2DE4A 2PVUA 4NF4A 4Q30B 2ONKE 3U65A 1OQHA 3CFXA 3SEYA 4JWXA 1M5FA 1XC1A 1MH4A 3ILTB 4N8YA 5DVFA 2QS2A 3T22A 1BKAA 4PFIA 4P8BA 4AB5A 4PTKA 1EH3A 1SI1A 2CEXA 3LSFB 2ANJA 2HZLA 1MXZA 2AIXA 4KYDA 1K9YA 3MVWA 1B46A 4N91A 4F1VA 3HHGA 4LZ7A 1YAEA 2H99A 4Z0IA 2V84A 5FHOA 4PFWA 1DOTA 4GIZA 3B8BA 3KSXA 2F35A 1HSEA 1NV3A 4RA1A 1FPBA 4GWOA 1I69A 2O6AA 4MEVA 4NF8A 4Q8RA 2BJIA 4H8IA 4NE4A 2XX9A 4QRZA 3RT8A 2VHAA 1IXIA 3Q29A 3T9HB 3K01A 1FTOA 1JETA 4EUOA 3I5OA 4DE8A 3E4RA 1DK4A 1MXWA 3V83A 3BIHA 3G7WA 3U93A 1I6BA 1AWBA 3U72A 1FQAA 4G68B 4RK2A 1FTJA 3MZ1A 3M8UA 4P0GA 1PBPA 3LSXA 1XS5A 1B9JA 2DSFA 2B4MA 1FPLA 3VXCA 5ICQA 2FYIA 3MZ9A 3GXAA 4RYAA 3IK6B 3KN8A 4H65A 4FJPA 1QUJA 1A7LA 5EHMA 1DCUA 5DTBA 2HQ0A 1PDAA 5IZ3B 3K1MA 1NUZA 5K2XA 4QSCA 4YB5A 2F3DA 2WEFA 4OXVA 1RKMA 3PV0E 4XIGQ 4NF4B 1POTA 5I57B 1YYZA 2PT2A 4FATA 3G3HA 3KN7A 3FVNA 2F5XA 3MYUA 1SI0A 3KGCA 4XKRA 4KYEA 3T0JA 1IQ7A 4ND9A 1QGXA 4O94A 1QKAA 4PQJA 3THIA 3BBRA 1KA0A 3CSBA 5FHNA 1B6HA 5I59A 4YICA 2O68A 2F6PA 2QJEA 1CB6A 2GHBA 4P1EA 3T9UA 1G0HA 5HM4B 4BDNA 3V5AA 3PUYE 1IMDA 2UVGA 3RLFE 4NF8B 4E0XA 1ZU0A 2OCUA 2VPOA 4MNIA 4OVPA 4YU0A 4I3YA 1Q1KA 4ESXA 2H9BA 3O9PA 4Q5TA 3W15C 4U22A 1SQYA 4HS7A 2KQZA 1DTZA 5H8QA 4DCXA 5AA3A 2VP1A 3B6QA 3GBAA 1LFIA 3OEKA 2ZXTA 4JSDA 3TTKA 4N6PA 5JEIA 3RT6B 1WDNA 4PCDA 4NTLA 4QFPA 2V25A 3UP9A 3O66A 4H1XA 2OWTA 4OFLA 3MP6A 4XFEA 1H3DA 4U1OA 4GX4A 1RYXA 3ILUB 4QHQA 1A55A 4FIMA 1P1NA 2HCAA 1B58A 5TP9B 4JWYA 1ZKBA 1MQJA 2I48A 2F7CA 1PC3A 4X1BA 4YKPA 3SEWA 3VLUA 4PDHA 1HSJA 3RTFB 1YXIA 1IMFA 1AIVA 4YKIA 4DXUA 2YPNA 1FTLA 3LR1A 1B7ZA 1NH8A 1LAGE 2QMWA 1FBDA 4OETA 4GWWA 5ITOA 2Y7KA 4PBHA 1LLSA 3RUMA 2DS9A 4PFTA 4KXPA 4HXVA 4G2ZA 1VFDA 2DE3A 1FCKA 2XXHA 4ELRA 3TQLA 5EQ7A 2QS4A 2XXKA 1YPNA 2QPQA 5DW8A 2Z8FA 1WODA 4IR8A 4P47A 5AE4A 1B32A 4PFUA 1XVXA 5IZ3A 1D9YA 4F3BA 3TAJA 3QAXA 3FV1A 1FPJA 3TKDA 5AA1A 2HEUA 3HV1A 5IGAA 2DWJA 4YKJA 3QYTA 5I56B 4GLIA 1IITA 1BP5A 3BFTA 2RCAA 3FXUA 2H5YA 4JDFA 1Y1MA 3I6VA 3OEMA 4G8NA 1MY3A 3AXFA 3FVGA 1NV5A 2ZZXA 1LBZA 3MVXA 4IO3A 1VE4A 3RNNA 3Q28A 4N81A 3TTNA 1URSA 2YLNA 3IAZA 3PGFA 4R6YA 4C0RA 1JEVA 4DDDA 5KDTA 2XXXA 1VSOA 1SDXA 4H45A 2RC8A 2PBWA 1NV4A 2UYFA 1FW0A 3LUZA 1US5A 3F11A 4OANA 5I57A 1FBPA 4OERA 3MPLA 2MKZA 2FVZA 3VVFA 2X7PA 3PPQA 4AQ4A 4DXBA 5KDTB 1QVSA 3CIJA 4GD5A 3ZKKA 3IOTA 1GR2A 2REGA 1NNPA 4NEDA 4OVSA 3IB1A 2Y7WA 1NV1A 1H76A
chains in the Genus database with same CATH topology
1LSTA 3TQWA 3CVGA 3FV2A 3QK6A 4GVOA 3HHFA 5DVJA 4BDQA 3WAEA 3N6TA 4KR5A 3MP8A 4H0WA 4N13A 3V8XB 3HCQA 5TPAB 3MVYA 3OSRA 2Y7IA 4GF8A 2HXWA 1LAHE 2Y7RA 4HCYA 2A5SA 4ZZAA 3TCFA 2O7IA 3TMGA 4ELQA 2RKMA 3B6WA 2ZMBA 4X9TA 3UK4A 4EDPA 4YAHX 2Q89A 3K6WA 4POWA 4Q0CA 4ECFA 1SBPA 3SESA 2ZYNA 3FJMA 5F1QA 1AOVA 2I6EA 3ZS6A 4E0WA 4F19A 4NF5B 3MC2A 1XVYA 1UIVA 3PD8A 1B4ZA 2O51A 3TPAA 1QUKA 1LBCA 1IXGA 4NF6B 2BJJX 3K02A 4GXAA 3KN3A 4K3FA 3W9WA 4ZEDA 4G77A 1MRPA 1N84A 1XT8A 4OFOA 3UA8A 1I6AA 1LCFA 1BTJA 5TP9A 3VXBA 5I59B 1PBQA 3KSJA 4R74A 1R9LA 2GHAA 3CG3A 3A3CA 3O97A 3OO7A 1PB9A 3P7IA 3JYRA 1CE2A 3LC8A 3OO8A 4X48A 2XXYA 4G4PA 4LZ8A 1GTKA 2RC9A 3T9XB 3DP8A 1F9BA 4HW8A 3VLWA 2D21A 5B70A 2Q9TA 3OOAA 1B5JA 4JBZA 4GXSB 1N3WA 2YJPA 2OK2A 1NFTA 4RNSA 4LQ2A 2GFEA 2DQVA 2XXQA 3C33A 4TLLB 3T96B 3TCHA 1MPBA 3O28A 1FQEA 1M5CA 1URDA 2DE4A 3M3FA 4UACA 2PVUA 2XXRA 3OO6A 3LSWA 1Z7ME 3MPKA 3QUFA 4NF4A 4P11A 4Q30B 3PPRA 1DMBA 1FTMA 2I0CA 2ONKE 2PYYA 5CM6A 3FD3A 4F2QA 3FXRA 3K6UA 3PD9A 2O84X 3H6UA 1OQHA 4R6HA 3S4UA 4THIA 5FHMA 3N26A 4MLQA 1ZIUA 3CFXA 1FQDA 2I49A 3SEYA 4JWXA 3Q27A 1Y20A 2NUVA 3N5LA 3O6IA 4GRKA 1JNFA 5I2KA 1M5FA 1XC1A 1MH4A 3ILTB 2UXAA 1DSNA 3FVKA 5DVFA 3EN3A 1SW5A 4RXLA 1B3EA 4WXJA 2O1LA 1T0KA 1MY1A 2QS2A 3T22A 1BKAA 1N7WA 2LAOA 3T93B 4AB5A 3DELB 4JSOA 1B3HA 3TODA 4ZEIA 3W9VA 5IAIA 2UVHA 3E9XA 2HAUA 1EH3A 1SI1A 3PMVA 1RYOA 3LSFB 3H4ZA 1MXVA 5F7VA 1ZLQA 2ANJA 1DPPA 1Y9UA 2HZLA 5A5XB 4JB7A 1H43A 3HN0A 4IO2A 5H8QB 5KZTA 1MXZA 1B7HA 2AIXA 4X1DA 3FATA 5TPAA 5H8NB 3IJXB 4KYDA 4DLDA 5JTYA 1Y3PA 2W7YA 3ZSFA 3KOSA 4I1DA 5H8HB 4OESA 4OEUA 2B3FA 3MVWA 1B46A 1FQFA 2PMSA 1H45A 4OVJA 4F1VA 3HSTA 1IUDA 3HHGA 1LBBA 4LZ7A 1N7XA 3C9HA 1YAEA 2ZNTA 2V3UA 4MLVA 4F3GA 3Q26A 1TFDA 2H99A 4Z0IA 2V84A 1MY2A 3EQ1A 4PETA 3WAFA 4C1UA 5FHOA 3RGYA 4PFWA 5L9MA 1DOTA 4GIZA 2QRYA 3KSXA 4F1YA 2F35A 1M5EA 3V89B 1HSEA 4O3CA 1P1UA 2RC7A 3SEXA 4I62A 2F34A 4RA1A 2Y7PA 3C35A 3CR9A 3K4UA 3MW0A 4GWOA 4RY1A 3U8QA 5AA4B 4LONB 1I69A 2O6AA 1R6ZA 3C36A 3H3GA 1B0LA 4QFLA 3VDFA 3VLVA 4F1UA 3EPEA 4NF8A 3S9EA 4Q8RA 4EF1A 2GRVA 4H8IA 4NE4A 2XX9A 4QRZA 2E1SA 1QKBA 3RT8A 2VHAA 3IB2A 1IXIA 3Q29A 4NMYA 1KWHA 3T9HB 2X26A 5HPQA 3K01A 1FTOA 1JETA 4FORA 4EUOA 4F31B 4BLAA 3CI8A 3I5OA 4DE8A 1B3LA 3E4RA 3G3FA 2H4IA 4U23A 4F18A 1Y4TA 1IXHA 1ELJA 4ELOA 2E0SA 1GVCA 1O64A 1MXWA 3IORA 3EF7A 3V83A 4KFQA 1B51A 3HO7A 2XXIA 1MXYA 4MFIA 4DIGA 4H67A 1LAFE 3G7WA 3G3IA 5I56A 4ZZEA 5H8FA 4GL8A 3U93A 1QJMA 3C4MA 1I6BA 5A5XA 5L8DA 4G68A 4U4XA 1B4HA 1XHYA 3U72A 5LOMA 1P99A 3OD7A 1MQIA 1MG1A 2CMOA 2KLFA 1FQAA 3L6HA 1LFHA 3C32A 2B65A 2ZYKA 3O2AA 2Z23A 4EQ7A 1MPCA 3KJTA 2XD3A 4C1TA 5I58B 5DEXA 3M3KA 1MS7A 1HSLA 4KCDA 4NWCA 2B3BA 2UVJA 1UTBA 3DLNA 2NXOA 5DVIA 1LAXA 4G68B 2X7QA 4DXCA 4RK2A 2WKYA 2XXPA 1ATGA 3DM0A 1FTKA 1M5DA 1FTJA 3MZ1A 3H6TA 4MBPA 2VOZA 1OLAA 2QS1A 3M8UA 4P0GA 5ISUA 1B40A 3K00A 4F22A 1PBPA 4TOZA 4R2FA 1QW0A 1OQGA 3LSXA 1XS5A 3SDFA 1B9JA 2ESNA 4M4GA 3MAMA 4GFRA 5H8NA 3SETA 4XTCQ 1ZMGA 2Z8EA 4OMBA 2DSFA 2VD2A 2I4BA 1ZTYA 2P2AA 1LFGA 1S7YA 3VXCA 5CRYA 5ICQA 3KG2A 2FYIA 3MZ9A 4EF2A 3LSLA 3R6UA 3GXAA 2ONRA 4R2BA 1USYH 4RYAA 3IK6B 2XX8A 4H6DA 3MVZA 3KN8A 4HCWA 4LATA 1SW4A 2D3IA 4H65A 5I84A 4FJPA 2H25A 2XXWA 1QUJA 1A7LA 5EHMA 2P0SA 4ZE8A 3IL1B 1Y3QA 3L6GA 5DTBA 2DWHA 2F7BA 2HQ0A 3CFLA 1PDAA 1EZOA 3MQ9A 4F39A 3K1MA 4OFJA 3UGWA 4ESWA 3TTMA 1B1HA 2Q2AA 5K2XA 3GZGA 4QSCA 3R26A 2I0BA 3GBBA 3K6XA 3IR1A 3RY3A 3IJOB 4YB5A 4YMBA 4OXVA 1NL5A 4BDLA 4BDMA 1RKMA 4F3PA 1N3XA 3PV0E 1US4A 4XIGQ 3FASA 4NF4B 1POTA 1B52A 3RN8A 5I57B 3MWBA 4GOTA 1OVBA 1NNFA 1MH3A 2F97A 2PT2A 3VVEA 4FATA 3IO6A 1VR5A 4LVQA 3G3HA 5CMBA 3RTWB 3TFLA 3KN7A 3E3KA 3FVNA 2Q2CA 2F5XA 5HBCA 1TFAA 2XX7A 4ZECA 3EHUA 1ANFA 1NNTA 3H06B 1OIBA 1SI0A 3KGCA 4XKRA 1B3GA 3T66A 3JV9A 4KYEA 4OHNA 3B6TA 1IQ7A 2I3WA 2F78A 4ND9A 5BWJA 5AA2A 2RCBA 1QKAA 2O69A 3EHSA 4PQJA 3THIA 3BBRA 4FECA 4WEDA 3USDA 3D4CA 4OQOA 3LUYA 2DYXA 4PFYA 3PUVE 3LBSA 3U94A 2F8DA 1USYE 2ABHA 3CSBA 3OO9A 4FE8A 1B6HA 4LQ5A 5FHNA 5I59A 1P1OA 2O68A 1Z7NE 4IO6A 2F6PA 2QJEA 2DVCA 1CB6A 4YICA 3R7XA 2AYSA 3CRBA 2GHBA 3DP6A 1N76A 1VFEA 2IEEA 3PPOA 1QUIA 2UVIA 3FJGA 3QIMA 3T9UA 4BDNA 3PPPA 3V5AA 3PUYE 1JW4A 5K2YA 1B7UA 2DOJA 2I3VA 2FNCA 4YMAA 2QMXA 5J1DA 4GQOA 2UVGA 4KI0E 1EZPA 3RLFE 1TWYA 4NF8B 4E0XA 4JWOA 1ZU0A 2P1SA 4MH5A 3VV5A 3TEPA 2OCUA 4OEVA 1MQGA 4P0IA 4OTEA 1MQHA 4YB7A 2R9JA 1MDQA 4YU0A 4RPNA 1O63A 5BUUA 4QSEA 4ZEBA 1Q1KA 4ESXA 1ZBMA 2H9BA 3O9PA 4Q5TA 1AMFA 3GLBA 5H8HA 2ALUA 3W15C 5I2NB 1L5TA 4U22A 1SQYA 2XXUA 3SERA 3ODBA 4HS7A 4QFOA 1DTZA 4R72A 1P1QA 1NMUA 1PB8A 1Y1ZA 5H8QA 4DCXA 5AA3A 2VP1A 5CMCA 4F2OA 1Y4CA 5H8SA 3K6VA 3B6QA 3GBAA 1A99A 1LFIA 4WEPA 3FGSA 3OEKA 2HFBA 2ZXTA 4JSDA 2V93A 3FZVA 3TTKA 3TZAA 1YCJA 4N6PA 2I4CA 3RT6B 5JEIA 1WDNA 3KJ7A 4R6KA 1AH5A 1B3FA 1UTHA 4H5GA 1YTVA 3T9VA 1TXFA 3TTRA 5ICTA 4NTLA 3IO4A 4QFPA 4RJZA 3EHTA 2V25A 1JQFA 4RPOA 2PT1A 5ELVA 3UP9A 4O3AA 2DWAA 1IXCA 3O66A 2ZYMA 4G8HA 3IB0A 4H1XA 2DWIA 4G68C 2OWTA 3MBPA 4OFLA 3MP6A 2ZNSA 2R6GE 4YB6A 1H3DA 3O6HA 5IKBA 3U1OA 3H6WA 4Z7EA 1LB8A 3BKIB 1MM7A 4RK9A 4U1OA 1B5IA 3QSLA 2R71A 1M5BA 1RYXA 3B7DA 3ILUB 4QHQA 2HZKA 1A55A 5L9OA 4FIMA 1P1NA 2HCAA 1B58A 5TP9B 3FVOA 4JWYA 1ZKBA 2O7UA 1MQJA 3ECRA 3UORA 3OSQA 2PX1A 1NKXA 1A40A 3QXMA 4G8MA 1IZ1A 2I48A 4HTGA 1QULA 1DTGA 5CI5A 1WVJA 2F7CA 5EHSA 1PC3A 2GH9A 4DCYA 4X1BA 4YKPA 3SEWA 3VLUA 4XKNA 3TCGA 3OMBA 1SW2A 3DP4A 1HSJA 4IB2A 4OYVA 4R9GA 3RTFB 3SEVA 4UA8A 2QS3A 2ZNUA 1AIVA 1IIWA 4YKIA 4DXUA 5ITPA 1NH7A 2YPNA 1URGA 1FQBA 1EU8A 4PP0A 1FTLA 1MY4A 3LR1A 1B7ZA 1NH8A 4TLMB 4ZDMA 2V3TA 1OMPA 1LAGE 4KQPA 2QMWA 4ONYA 1MXXA 4OETA 1R1NA 4KD5A 1A8EA 1LB9A 1EZ9A 2RINA 3K2DA 5ITOA 3VFJA 3OELA 3VVDA 2Q8JA 2OWSA 2Y7KA 4EQBA 1SYHA 1LLSA 2XXTA 2Z22A 3UN6A 4ZE9A 5AA1A 3RUMA 4R75A 1AL3A 1P1WA 2G29A 1S9TA 3KEIA 2DS9A 1UTHB 1JVYA 1ZJLA 4F29A 2OJTA 1LCTA 4PFTA 3O6GA 4R73A 4G2ZA 1VFDA 3G3JA 4BDRA 1SW1A 1MQDA 5CBSA 3MJNA 3PUZE 2DE3A 1OVTA 1FCKA 2XXHA 5KCJA 4ELRA 3KZGA 1FQCA 4NF6A 1S50A 3TQLA 4L17A 4MF3A 3PU5A 4KYSA 3K1PA 3KOTA 4ZS9A 1MPDA 5EYFA 1N04A 4XKQA 1D9VA 2VD3A 4U21A 2QS4A 1JW5A 1PB7A 1OLCA 1YPNA 2QPQA 5CC2A 4I8CA 2Z8FA 3S9MC 3FXQA 1WODA 2AL4A 3CFZA 5L9SA 1BLFA 2OBGA 5AE4A 1XOCA 1B32A 4QFKA 4PFUA 1XVXA 3TELA 1JVXA 1UQWA 1D9YA 4M1VA 4OZ9A 2NWJA 3TAJA 4F3BA 3QAXA 3FV1A 2ZYOA 3ONMA 3VE1B 1B2HA 1B5HA 3IX1A 4YKKA 4OENA 4BDOA 3TKDA 4EXLA 1A8FA 2D5WA 2V3QA 3A3UA 2HEUA 2DVZA 2F6GA 3D4GA 3H03A 1SVXB 2DWJA 3HV1A 4TQUQ 4YKJA 3TYHA 3QYTA 4ELPA 1Y3NA 1JW1A 1MDP1 3FUZA 5H8FB 5DEXB 5I56B 2OLBA 4GLIA 3UIFA 5AA2B 2Z8DA 4LZ5A 1Q35A 1IITA 4NF5A 1BP5A 2M8CA 5TU0A 3BFTA 2RCAA 2G93A 3FXUA 3PUWE 4FAJA 2ONSA 1B1XA 2H5YA 2QL3A 4IY6A 2CZLA 4JDFA 3N94A 1Y1MA 2XHDA 3I6VA 4JXIA 4XXUA 4ZEKA 3TTLA 3OEMA 1MM6A 4NWDA 2F7AA 2THIA 2UYEA 4G8NA 1MY3A 5DYHA 3S9NC 1PEBA 3IOWA 1SD3A 2Y84A 4U2RA 4WKMA 3AXFA 3FVGA 5JTYB 3KFMA 1R9QA 2NVUB 3FIRA 3TUSA 3MZBA 4EXKA 2DP8A 4O3BA 3ZKLA 4DZ1A 3MVXA 2DXYA 1A54A 3H7MA 4IO4A 1VE4A 4IO3A 3RNNA 5AA4A 3Q28A 3CG1A 2A5TB 3S2VA 3TTNA 3FJ7A 1B05A 1URSA 3HPIA 5CBRA 2F36A 2YLNA 3IAZA 3PGFA 2XD2A 3E13X 3RQTA 4R6YA 4C0RA 4U4SA 5AA2D 4KPTA 1POY1 1H44A 1UTBB 4IGRA 1GV8A 1JEVA 4H5FA 1LGBC 2VGQA 2XXXA 4DDDA 4U1ZA 2AL5A 5I2KB 1VSOA 5KDTA 2I58A 1TT1A 3MP1A 3O29A 5FTHA 1O7TA 3TDJA 1JEUA 4F3SA 5CMKA 1SDXA 1I6QA 2HAVA 3KBRA 3PPNA 5CMMA 3PMXA 3JZJA 3OXNA 3PMWA 3G3KA 4PE5B 2H98A 1IEJA 2RC8A 4LUBA 4POXA 4QSDA 3SKPA 3S9LC 3OENA 1N0TA 2PBWA 3IOVA 2UYFA 5M2VA 3CSGA 4I9DA 1FW0A 2O1MA 4N07A 4EQ9A 4FEBA 4FEDA 4YZZA 1NNKA 1US5A 3C34A 3F11A 4AB6A 3PUXE 3N6UA 1GGGA 5B7DA 5HM4B 5I57A 3I3VA 4ISUA 4OERA 3MPLA 1II5A 3M3LA 4GL0A 1MXUA 1D3KA 5FTIA 3VVFA 2X7PA 3PPQA 3U92A 3K1NA 4AQ4A 4DXBA 2DXRA 5I2NA 5KDTB 1QVSA 3Q25A 5KCJB 2XXVA 3C31A 3G3GA 2Q88A 4IY5A 4LA9A 5I58A 2REJA 4IGTA 3CIJA 4QFNA 2OZZA 4GD5A 4LP2B 1MY0A 3ZKKA 3BFUA 2FA7A 3QUJA 5JK4A 2QSXA 4IO5A 3K0VA 2A5TA 5DT6A 2DE2A 1DPEA 3RPWA 3IOTA 3IOUA 1D4NA 1J1NA 1GR2A 2IA4A 2REGA 1B0HA 1NNPA 4IO7A 4KHZE 4NEDA 3SEUA 4H8JA 3IB1A 1UIUA 2Y7WA 3MUQA 2NOOA 3H6VA 4XKPA 4OWDA 1BIYA 3A09A 4KCCA 4ZEFA 1H76A 4QF9A 2RF1A 4R9FA 1SYIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LST A;  3TQW A;  3CVG A;  3FV2 A;  3QK6 A;  4GVO A;  3HHF A;  5DVJ A;  4BDQ A;  3WAE A;  3N6T A;  4KR5 A;  3MP8 A;  4H0W A;  4N13 A;  3V8X B;  3HCQ A;  5TPA B;  3MVY A;  3OSR A;  2Y7I A;  4GF8 A;  2HXW A;  1LAH E;  2Y7R A;  4HCY A;  2A5S A;  4ZZA A;  3TCF A;  2O7I A;  3TMG A;  4ELQ A;  2RKM A;  3B6W A;  2ZMB A;  4X9T A;  3UK4 A;  4EDP A;  4YAH X;  2Q89 A;  3K6W A;  4POW A;  4Q0C A;  4ECF A;  1SBP A;  3SES A;  2ZYN A;  3FJM A;  5F1Q A;  1AOV A;  2I6E A;  3ZS6 A;  4E0W A;  4F19 A;  4NF5 B;  3MC2 A;  1XVY A;  1UIV A;  3PD8 A;  1B4Z A;  2O51 A;  3TPA A;  1QUK A;  1LBC A;  1IXG A;  4NF6 B;  2BJJ X;  3K02 A;  4GXA A;  3KN3 A;  4K3F A;  3W9W A;  4ZED A;  4G77 A;  1MRP A;  1N84 A;  1XT8 A;  4OFO A;  3UA8 A;  1I6A A;  1LCF A;  1BTJ A;  5TP9 A;  3VXB A;  5I59 B;  1PBQ A;  3KSJ A;  4R74 A;  1R9L A;  2GHA A;  3CG3 A;  3A3C A;  3O97 A;  3OO7 A;  1PB9 A;  3P7I A;  3JYR A;  1CE2 A;  3LC8 A;  3OO8 A;  4X48 A;  2XXY A;  4G4P A;  4LZ8 A;  1GTK A;  2RC9 A;  3T9X B;  3DP8 A;  1F9B A;  4HW8 A;  3VLW A;  2D21 A;  5B70 A;  2Q9T A;  3OOA A;  1B5J A;  4JBZ A;  4GXS B;  1N3W A;  2YJP A;  2OK2 A;  1NFT A;  4RNS A;  4LQ2 A;  2GFE A;  2DQV A;  2XXQ A;  3C33 A;  4TLL B;  3T96 B;  3TCH A;  1MPB A;  3O28 A;  1FQE A;  1M5C A;  1URD A;  2DE4 A;  3M3F A;  4UAC A;  2PVU A;  2XXR A;  3OO6 A;  3LSW A;  1Z7M E;  3MPK A;  3QUF A;  4NF4 A;  4P11 A;  4Q30 B;  3PPR A;  1DMB A;  1FTM A;  2I0C A;  2ONK E;  2PYY A;  5CM6 A;  3FD3 A;  4F2Q A;  3FXR A;  3K6U A;  3PD9 A;  2O84 X;  3H6U A;  1OQH A;  4R6H A;  3S4U A;  4THI A;  5FHM A;  3N26 A;  4MLQ A;  1ZIU A;  3CFX A;  1FQD A;  2I49 A;  3SEY A;  4JWX A;  3Q27 A;  1Y20 A;  2NUV A;  3N5L A;  3O6I A;  4GRK A;  1JNF A;  5I2K A;  1M5F A;  1XC1 A;  1MH4 A;  3ILT B;  2UXA A;  1DSN A;  3FVK A;  5DVF A;  3EN3 A;  1SW5 A;  4RXL A;  1B3E A;  4WXJ A;  2O1L A;  1T0K A;  1MY1 A;  2QS2 A;  3T22 A;  1BKA A;  1N7W A;  2LAO A;  3T93 B;  4AB5 A;  3DEL B;  4JSO A;  1B3H A;  3TOD A;  4ZEI A;  3W9V A;  5IAI A;  2UVH A;  3E9X A;  2HAU A;  1EH3 A;  1SI1 A;  3PMV A;  1RYO A;  3LSF B;  3H4Z A;  1MXV A;  5F7V A;  1ZLQ A;  2ANJ A;  1DPP A;  1Y9U A;  2HZL A;  5A5X B;  4JB7 A;  1H43 A;  3HN0 A;  4IO2 A;  5H8Q B;  5KZT A;  1MXZ A;  1B7H A;  2AIX A;  4X1D A;  3FAT A;  5TPA A;  5H8N B;  3IJX B;  4KYD A;  4DLD A;  5JTY A;  1Y3P A;  2W7Y A;  3ZSF A;  3KOS A;  4I1D A;  5H8H B;  4OES A;  4OEU A;  2B3F A;  3MVW A;  1B46 A;  1FQF A;  2PMS A;  1H45 A;  4OVJ A;  4F1V A;  3HST A;  1IUD A;  3HHG A;  1LBB A;  4LZ7 A;  1N7X A;  3C9H A;  1YAE A;  2ZNT A;  2V3U A;  4MLV A;  4F3G A;  3Q26 A;  1TFD A;  2H99 A;  4Z0I A;  2V84 A;  1MY2 A;  3EQ1 A;  4PET A;  3WAF A;  4C1U A;  5FHO A;  3RGY A;  4PFW A;  5L9M A;  1DOT A;  4GIZ A;  2QRY A;  3KSX A;  4F1Y A;  2F35 A;  1M5E A;  3V89 B;  1HSE A;  4O3C A;  1P1U A;  2RC7 A;  3SEX A;  4I62 A;  2F34 A;  4RA1 A;  2Y7P A;  3C35 A;  3CR9 A;  3K4U A;  3MW0 A;  4GWO A;  4RY1 A;  3U8Q A;  5AA4 B;  4LON B;  1I69 A;  2O6A A;  1R6Z A;  3C36 A;  3H3G A;  1B0L A;  4QFL A;  3VDF A;  3VLV A;  4F1U A;  3EPE A;  4NF8 A;  3S9E A;  4Q8R A;  4EF1 A;  2GRV A;  4H8I A;  4NE4 A;  2XX9 A;  4QRZ A;  2E1S A;  1QKB A;  3RT8 A;  2VHA A;  3IB2 A;  1IXI A;  3Q29 A;  4NMY A;  1KWH A;  3T9H B;  2X26 A;  5HPQ A;  3K01 A;  1FTO A;  1JET A;  4FOR A;  4EUO A;  4F31 B;  4BLA A;  3CI8 A;  3I5O A;  4DE8 A;  1B3L A;  3E4R A;  3G3F A;  2H4I A;  4U23 A;  4F18 A;  1Y4T A;  1IXH A;  1ELJ A;  4ELO A;  2E0S A;  1GVC A;  1O64 A;  1MXW A;  3IOR A;  3EF7 A;  3V83 A;  4KFQ A;  1B51 A;  3HO7 A;  2XXI A;  1MXY A;  4MFI A;  4DIG A;  4H67 A;  1LAF E;  3G7W A;  3G3I A;  5I56 A;  4ZZE A;  5H8F A;  4GL8 A;  3U93 A;  1QJM A;  3C4M A;  1I6B A;  5A5X A;  5L8D A;  4G68 A;  4U4X A;  1B4H A;  1XHY A;  3U72 A;  5LOM A;  1P99 A;  3OD7 A;  1MQI A;  1MG1 A;  2CMO A;  2KLF A;  1FQA A;  3L6H A;  1LFH A;  3C32 A;  2B65 A;  2ZYK A;  3O2A A;  2Z23 A;  4EQ7 A;  1MPC A;  3KJT A;  2XD3 A;  4C1T A;  5I58 B;  5DEX A;  3M3K A;  1MS7 A;  1HSL A;  4KCD A;  4NWC A;  2B3B A;  2UVJ A;  1UTB A;  3DLN A;  2NXO A;  5DVI A;  1LAX A;  4G68 B;  2X7Q A;  4DXC A;  4RK2 A;  2WKY A;  2XXP A;  1ATG A;  3DM0 A;  1FTK A;  1M5D A;  1FTJ A;  3MZ1 A;  3H6T A;  4MBP A;  2VOZ A;  1OLA A;  2QS1 A;  3M8U A;  4P0G A;  5ISU A;  1B40 A;  3K00 A;  4F22 A;  1PBP A;  4TOZ A;  4R2F A;  1QW0 A;  1OQG A;  3LSX A;  1XS5 A;  3SDF A;  1B9J A;  2ESN A;  4M4G A;  3MAM A;  4GFR A;  5H8N A;  3SET A;  4XTC Q;  1ZMG A;  2Z8E A;  4OMB A;  2DSF A;  2VD2 A;  2I4B A;  1ZTY A;  2P2A A;  1LFG A;  1S7Y A;  3VXC A;  5CRY A;  5ICQ A;  3KG2 A;  2FYI A;  3MZ9 A;  4EF2 A;  3LSL A;  3R6U A;  3GXA A;  2ONR A;  4R2B A;  1USY H;  4RYA A;  3IK6 B;  2XX8 A;  4H6D A;  3MVZ A;  3KN8 A;  4HCW A;  4LAT A;  1SW4 A;  2D3I A;  4H65 A;  5I84 A;  4FJP A;  2H25 A;  2XXW A;  1QUJ A;  1A7L A;  5EHM A;  2P0S A;  4ZE8 A;  3IL1 B;  1Y3Q A;  3L6G A;  5DTB A;  2DWH A;  2F7B A;  2HQ0 A;  3CFL A;  1PDA A;  1EZO A;  3MQ9 A;  4F39 A;  3K1M A;  4OFJ A;  3UGW A;  4ESW A;  3TTM A;  1B1H A;  2Q2A A;  5K2X A;  3GZG A;  4QSC A;  3R26 A;  2I0B A;  3GBB A;  3K6X A;  3IR1 A;  3RY3 A;  3IJO B;  4YB5 A;  4YMB A;  4OXV A;  1NL5 A;  4BDL A;  4BDM A;  1RKM A;  4F3P A;  1N3X A;  3PV0 E;  1US4 A;  4XIG Q;  3FAS A;  4NF4 B;  1POT A;  1B52 A;  3RN8 A;  5I57 B;  3MWB A;  4GOT A;  1OVB A;  1NNF A;  1MH3 A;  2F97 A;  2PT2 A;  3VVE A;  4FAT A;  3IO6 A;  1VR5 A;  4LVQ A;  3G3H A;  5CMB A;  3RTW B;  3TFL A;  3KN7 A;  3E3K A;  3FVN A;  2Q2C A;  2F5X A;  5HBC A;  1TFA A;  2XX7 A;  4ZEC A;  3EHU A;  1ANF A;  1NNT A;  3H06 B;  1OIB A;  1SI0 A;  3KGC A;  4XKR A;  1B3G A;  3T66 A;  3JV9 A;  4KYE A;  4OHN A;  3B6T A;  1IQ7 A;  2I3W A;  2F78 A;  4ND9 A;  5BWJ A;  5AA2 A;  2RCB A;  1QKA A;  2O69 A;  3EHS A;  4PQJ A;  3THI A;  3BBR A;  4FEC A;  4WED A;  3USD A;  3D4C A;  4OQO A;  3LUY A;  2DYX A;  4PFY A;  3PUV E;  3LBS A;  3U94 A;  2F8D A;  1USY E;  2ABH A;  3CSB A;  3OO9 A;  4FE8 A;  1B6H A;  4LQ5 A;  5FHN A;  5I59 A;  1P1O A;  2O68 A;  1Z7N E;  4IO6 A;  2F6P A;  2QJE A;  2DVC A;  1CB6 A;  4YIC A;  3R7X A;  2AYS A;  3CRB A;  2GHB A;  3DP6 A;  1N76 A;  1VFE A;  2IEE A;  3PPO A;  1QUI A;  2UVI A;  3FJG A;  3QIM A;  3T9U A;  4BDN A;  3PPP A;  3V5A A;  3PUY E;  1JW4 A;  5K2Y A;  1B7U A;  2DOJ A;  2I3V A;  2FNC A;  4YMA A;  2QMX A;  5J1D A;  4GQO A;  2UVG A;  4KI0 E;  1EZP A;  3RLF E;  1TWY A;  4NF8 B;  4E0X A;  4JWO A;  1ZU0 A;  2P1S A;  4MH5 A;  3VV5 A;  3TEP A;  2OCU A;  4OEV A;  1MQG A;  4P0I A;  4OTE A;  1MQH A;  4YB7 A;  2R9J A;  1MDQ A;  4YU0 A;  4RPN A;  1O63 A;  5BUU A;  4QSE A;  4ZEB A;  1Q1K A;  4ESX A;  1ZBM A;  2H9B A;  3O9P A;  4Q5T A;  1AMF A;  3GLB A;  5H8H A;  2ALU A;  3W15 C;  5I2N B;  1L5T A;  4U22 A;  1SQY A;  2XXU A;  3SER A;  3ODB A;  4HS7 A;  4QFO A;  1DTZ A;  4R72 A;  1P1Q A;  1NMU A;  1PB8 A;  1Y1Z A;  5H8Q A;  4DCX A;  5AA3 A;  2VP1 A;  5CMC A;  4F2O A;  1Y4C A;  5H8S A;  3K6V A;  3B6Q A;  3GBA A;  1A99 A;  1LFI A;  4WEP A;  3FGS A;  3OEK A;  2HFB A;  2ZXT A;  4JSD A;  2V93 A;  3FZV A;  3TTK A;  3TZA A;  1YCJ A;  4N6P A;  2I4C A;  3RT6 B;  5JEI A;  1WDN A;  3KJ7 A;  4R6K A;  1AH5 A;  1B3F A;  1UTH A;  4H5G A;  1YTV A;  3T9V A;  1TXF A;  3TTR A;  5ICT A;  4NTL A;  3IO4 A;  4QFP A;  4RJZ A;  3EHT A;  2V25 A;  1JQF A;  4RPO A;  2PT1 A;  5ELV A;  3UP9 A;  4O3A A;  2DWA A;  1IXC A;  3O66 A;  2ZYM A;  4G8H A;  3IB0 A;  4H1X A;  2DWI A;  4G68 C;  2OWT A;  3MBP A;  4OFL A;  3MP6 A;  2ZNS A;  2R6G E;  4YB6 A;  1H3D A;  3O6H A;  5IKB A;  3U1O A;  3H6W A;  4Z7E A;  1LB8 A;  3BKI B;  1MM7 A;  4RK9 A;  4U1O A;  1B5I A;  3QSL A;  2R71 A;  1M5B A;  1RYX A;  3B7D A;  3ILU B;  4QHQ A;  2HZK A;  1A55 A;  5L9O A;  4FIM A;  1P1N A;  2HCA A;  1B58 A;  5TP9 B;  3FVO A;  4JWY A;  1ZKB A;  2O7U A;  1MQJ A;  3ECR A;  3UOR A;  3OSQ A;  2PX1 A;  1NKX A;  1A40 A;  3QXM A;  4G8M A;  1IZ1 A;  2I48 A;  4HTG A;  1QUL A;  1DTG A;  5CI5 A;  1WVJ A;  2F7C A;  5EHS A;  1PC3 A;  2GH9 A;  4DCY A;  4X1B A;  4YKP A;  3SEW A;  3VLU A;  4XKN A;  3TCG A;  3OMB A;  1SW2 A;  3DP4 A;  1HSJ A;  4IB2 A;  4OYV A;  4R9G A;  3RTF B;  3SEV A;  4UA8 A;  2QS3 A;  2ZNU A;  1AIV A;  1IIW A;  4YKI A;  4DXU A;  5ITP A;  1NH7 A;  2YPN A;  1URG A;  1FQB A;  1EU8 A;  4PP0 A;  1FTL A;  1MY4 A;  3LR1 A;  1B7Z A;  1NH8 A;  4TLM B;  4ZDM A;  2V3T A;  1OMP A;  1LAG E;  4KQP A;  2QMW A;  4ONY A;  1MXX A;  4OET A;  1R1N A;  4KD5 A;  1A8E A;  1LB9 A;  1EZ9 A;  2RIN A;  3K2D A;  5ITO A;  3VFJ A;  3OEL A;  3VVD A;  2Q8J A;  2OWS A;  2Y7K A;  4EQB A;  1SYH A;  1LLS A;  2XXT A;  2Z22 A;  3UN6 A;  4ZE9 A;  5AA1 A;  3RUM A;  4R75 A;  1AL3 A;  1P1W A;  2G29 A;  1S9T A;  3KEI A;  2DS9 A;  1UTH B;  1JVY A;  1ZJL A;  4F29 A;  2OJT A;  1LCT A;  4PFT A;  3O6G A;  4R73 A;  4G2Z A;  1VFD A;  3G3J A;  4BDR A;  1SW1 A;  1MQD A;  5CBS A;  3MJN A;  3PUZ E;  2DE3 A;  1OVT A;  1FCK A;  2XXH A;  5KCJ A;  4ELR A;  3KZG A;  1FQC A;  4NF6 A;  1S50 A;  3TQL A;  4L17 A;  4MF3 A;  3PU5 A;  4KYS A;  3K1P A;  3KOT A;  4ZS9 A;  1MPD A;  5EYF A;  1N04 A;  4XKQ A;  1D9V A;  2VD3 A;  4U21 A;  2QS4 A;  1JW5 A;  1PB7 A;  1OLC A;  1YPN A;  2QPQ A;  5CC2 A;  4I8C A;  2Z8F A;  3S9M C;  3FXQ A;  1WOD A;  2AL4 A;  3CFZ A;  5L9S A;  1BLF A;  2OBG A;  5AE4 A;  1XOC A;  1B32 A;  4QFK A;  4PFU A;  1XVX A;  3TEL A;  1JVX A;  1UQW A;  1D9Y A;  4M1V A;  4OZ9 A;  2NWJ A;  3TAJ A;  4F3B A;  3QAX A;  3FV1 A;  2ZYO A;  3ONM A;  3VE1 B;  1B2H A;  1B5H A;  3IX1 A;  4YKK A;  4OEN A;  4BDO A;  3TKD A;  4EXL A;  1A8F A;  2D5W A;  2V3Q A;  3A3U A;  2HEU A;  2DVZ A;  2F6G A;  3D4G A;  3H03 A;  1SVX B;  2DWJ A;  3HV1 A;  4TQU Q;  4YKJ A;  3TYH A;  3QYT A;  4ELP A;  1Y3N A;  1JW1 A;  1MDP 1;  3FUZ A;  5H8F B;  5DEX B;  5I56 B;  2OLB A;  4GLI A;  3UIF A;  5AA2 B;  2Z8D A;  4LZ5 A;  1Q35 A;  1IIT A;  4NF5 A;  1BP5 A;  2M8C A;  5TU0 A;  3BFT A;  2RCA A;  2G93 A;  3FXU A;  3PUW E;  4FAJ A;  2ONS A;  1B1X A;  2H5Y A;  2QL3 A;  4IY6 A;  2CZL A;  4JDF A;  3N94 A;  1Y1M A;  2XHD A;  3I6V A;  4JXI A;  4XXU A;  4ZEK A;  3TTL A;  3OEM A;  1MM6 A;  4NWD A;  2F7A A;  2THI A;  2UYE A;  4G8N A;  1MY3 A;  5DYH A;  3S9N C;  1PEB A;  3IOW A;  1SD3 A;  2Y84 A;  4U2R A;  4WKM A;  3AXF A;  3FVG A;  5JTY B;  3KFM A;  1R9Q A;  2NVU B;  3FIR A;  3TUS A;  3MZB A;  4EXK A;  2DP8 A;  4O3B A;  3ZKL A;  4DZ1 A;  3MVX A;  2DXY A;  1A54 A;  3H7M A;  4IO4 A;  1VE4 A;  4IO3 A;  3RNN A;  5AA4 A;  3Q28 A;  3CG1 A;  2A5T B;  3S2V A;  3TTN A;  3FJ7 A;  1B05 A;  1URS A;  3HPI A;  5CBR A;  2F36 A;  2YLN A;  3IAZ A;  3PGF A;  2XD2 A;  3E13 X;  3RQT A;  4R6Y A;  4C0R A;  4U4S A;  5AA2 D;  4KPT A;  1POY 1;  1H44 A;  1UTB B;  4IGR A;  1GV8 A;  1JEV A;  4H5F A;  1LGB C;  2VGQ A;  2XXX A;  4DDD A;  4U1Z A;  2AL5 A;  5I2K B;  1VSO A;  5KDT A;  2I58 A;  1TT1 A;  3MP1 A;  3O29 A;  5FTH A;  1O7T A;  3TDJ A;  1JEU A;  4F3S A;  5CMK A;  1SDX A;  1I6Q A;  2HAV A;  3KBR A;  3PPN A;  5CMM A;  3PMX A;  3JZJ A;  3OXN A;  3PMW A;  3G3K A;  4PE5 B;  2H98 A;  1IEJ A;  2RC8 A;  4LUB A;  4POX A;  4QSD A;  3SKP A;  3S9L C;  3OEN A;  1N0T A;  2PBW A;  3IOV A;  2UYF A;  5M2V A;  3CSG A;  4I9D A;  1FW0 A;  2O1M A;  4N07 A;  4EQ9 A;  4FEB A;  4FED A;  4YZZ A;  1NNK A;  1US5 A;  3C34 A;  3F11 A;  4AB6 A;  3PUX E;  3N6U A;  1GGG A;  5B7D A;  5HM4 B;  5I57 A;  3I3V A;  4ISU A;  4OER A;  3MPL A;  1II5 A;  3M3L A;  4GL0 A;  1MXU A;  1D3K A;  5FTI A;  3VVF A;  2X7P A;  3PPQ A;  3U92 A;  3K1N A;  4AQ4 A;  4DXB A;  2DXR A;  5I2N A;  5KDT B;  1QVS A;  3Q25 A;  5KCJ B;  2XXV A;  3C31 A;  3G3G A;  2Q88 A;  4IY5 A;  4LA9 A;  5I58 A;  2REJ A;  4IGT A;  3CIJ A;  4QFN A;  2OZZ A;  4GD5 A;  4LP2 B;  1MY0 A;  3ZKK A;  3BFU A;  2FA7 A;  3QUJ A;  5JK4 A;  2QSX A;  4IO5 A;  3K0V A;  2A5T A;  5DT6 A;  2DE2 A;  1DPE A;  3RPW A;  3IOT A;  3IOU A;  1D4N A;  1J1N A;  1GR2 A;  2IA4 A;  2REG A;  1B0H A;  1NNP A;  4IO7 A;  4KHZ E;  4NED A;  3SEU A;  4H8J A;  3IB1 A;  1UIU A;  2Y7W A;  3MUQ A;  2NOO A;  3H6V A;  4XKP A;  4OWD A;  1BIY A;  3A09 A;  4KCC A;  4ZEF A;  1H76 A;  4QF9 A;  2RF1 A;  4R9F A;  1SYI A; 
#chains in the Genus database with same CATH topology
 5DVJ A;  1Q9D A;  3WAE A;  3N6T A;  4N13 A;  1LAH E;  4ELQ A;  1INP A;  2O7I A;  2ZMB A;  4X9T A;  4EDP A;  4YAH X;  3K6W A;  4Q0C A;  1IMB A;  1UIV A;  2O51 A;  3K02 A;  1NUY A;  4G77 A;  1N84 A;  5TP9 A;  1PBQ A;  4R74 A;  5ET6 A;  3CG3 A;  3A3C A;  3JYR A;  3BIG A;  4LZ8 A;  1GTK A;  4HW8 A;  3VLW A;  2D21 A;  5B70 A;  4PC9 A;  2XXQ A;  3O28 A;  4NQ8 A;  1FQE A;  1URD A;  2XXR A;  2QVR A;  3OO6 A;  3A29 A;  1Z7M E;  3MPK A;  3PPR A;  1FTM A;  2PYY A;  4F2Q A;  4THI A;  4JVC A;  5FHM A;  3N26 A;  4MLQ A;  1Y20 A;  3O6I A;  1JNF A;  3FVK A;  3EN3 A;  4WXJ A;  1B3E A;  2O1L A;  1MY1 A;  5ET7 A;  4ZEI A;  3E9X A;  2HAU A;  1RDY A;  1ZLQ A;  4JB7 A;  4X1D A;  5H8N B;  3IJX B;  3ZSF A;  5H8H B;  4OEU A;  2B3F A;  1H45 A;  4OVJ A;  3HST A;  1N7X A;  3C9H A;  2ZNT A;  2V3U A;  4MLV A;  3Q26 A;  2XWI A;  3EQ1 A;  4C1U A;  3WAF A;  2QRY A;  2XWK A;  3SEX A;  4I62 A;  3MW0 A;  3C35 A;  3K4U A;  3U8Q A;  5LTC A;  3H3G A;  3VDF A;  3EPE A;  4EF1 A;  4NMY A;  2Q8M A;  1KWH A;  3T1B A;  5HPQ A;  4XEQ A;  4BLA A;  4JVI A;  2H4I A;  3PTY A;  4F18 A;  1Y4T A;  1IXH A;  3EF7 A;  4KFQ A;  2XXI A;  4N8G A;  4ZZE A;  1QJM A;  3C4M A;  5L8D A;  4G68 A;  3KC1 A;  1XHY A;  1P99 A;  2KLF A;  1LFH A;  3C32 A;  2ZYK A;  1MPC A;  2XD3 A;  4C1T A;  1HSL A;  1UTB A;  4G61 A;  3DM0 A;  1FTK A;  2QS1 A;  1B40 A;  4F22 A;  4TOZ A;  4R2F A;  1QW0 A;  4M4G A;  2ESN A;  4GFR A;  3SET A;  1ZMG A;  4OMB A;  4GX3 A;  2P2A A;  1LFG A;  3KG2 A;  3R6U A;  1USY H;  4H6D A;  4HCW A;  4LAT A;  1SW4 A;  5I84 A;  2P0S A;  2DWH A;  4F39 A;  3UGW A;  4ESW A;  1B1H A;  3IR1 A;  4PAI A;  5ET8 A;  4N17 A;  1US4 A;  3FAS A;  3KC0 A;  1NNF A;  3VVE A;  3RTW B;  5CMB A;  2Q2C A;  5ESY A;  5LDZ A;  1TFA A;  2XX7 A;  4QXD A;  2B4L A;  1NNT A;  2Y5K A;  1OIB A;  3H06 B;  3T66 A;  3TMG A;  1B3G A;  2F78 A;  2PFY A;  4GWS A;  3D4C A;  2DYX A;  3HFU A;  4PFY A;  3LBS A;  4NX1 A;  2F8D A;  4OQO A;  2ABH A;  3OO9 A;  4FE8 A;  4LQ5 A;  1P1O A;  3R7X A;  2DVC A;  2AYS A;  2IEE A;  3FJG A;  2HPG A;  1JW4 A;  4MIJ A;  2DOJ A;  1TWY A;  4JWO A;  4OEV A;  3IFC A;  3ISP A;  4OTE A;  2R9J A;  5BUU A;  1O63 A;  2Y5L A;  1L5T A;  4P56 A;  4QFO A;  4X8R A;  5CMC A;  4F2O A;  1Y4C A;  3K6V A;  1A99 A;  2V93 A;  4R6K A;  1AH5 A;  1YTV A;  5ICT A;  3IO4 A;  4O3A A;  1LBY A;  2DWA A;  3RYD A;  2ZNS A;  1NUX A;  4RK9 A;  5L9O A;  4PAF A;  3ECR A;  4PFR A;  5FBP A;  2PX1 A;  1NKX A;  4HTG A;  5CI5 A;  4DI3 D;  1WVJ A;  4DCY A;  4XKN A;  3TCG A;  1CNQ A;  3DP4 A;  4TLM B;  1OMP A;  4KQP A;  3VFJ A;  3K2D A;  3VVD A;  1NUW A;  4EQB A;  2OWS A;  2CZH A;  2Z22 A;  3UN6 A;  4R75 A;  1UTH B;  4F29 A;  4NAP A;  4O7M A;  3G3J A;  1FPI A;  5CBS A;  5KCJ A;  1FQC A;  4MF3 A;  3PU5 A;  4KYS A;  3K1P A;  3KOT A;  5EYF A;  2VD3 A;  1PB7 A;  1OLC A;  2L5V A;  3CFZ A;  2OBG A;  1XOC A;  1SPI A;  2JJK A;  3TEL A;  1UQW A;  2NWJ A;  3ONM A;  3VE1 B;  2QFL A;  4BDO A;  1A8F A;  2D5W A;  2F6G A;  2QVU A;  4HE2 A;  4ELP A;  1JW1 A;  1MDP 1;  5H8F B;  4NF5 A;  4GX6 A;  2M8C A;  4N4U A;  2QL3 A;  3N94 A;  2XHD A;  1MM6 A;  1PEB A;  1SD3 A;  1FJ9 A;  4U2R A;  3KFM A;  1R9Q A;  3B50 A;  4O3B A;  4DZ1 A;  3H7M A;  3FJ7 A;  2F36 A;  1BK4 A;  3E13 X;  4MCO A;  5AA2 D;  1H44 A;  2AL5 A;  2WBD A;  1TT1 A;  3MP1 A;  1O7T A;  1JEU A;  4PF8 A;  2HAV A;  3PMX A;  4PE5 B;  3JZJ A;  3G3K A;  4QSD A;  3SKP A;  4LUB A;  4NF0 A;  3OEN A;  3IOV A;  3CSG A;  4I9D A;  4FED A;  3C34 A;  5B7D A;  4MNC A;  5FTI A;  3K1N A;  3Q25 A;  5KCJ B;  2XXV A;  3G3G A;  5I58 A;  2REJ A;  4IGT A;  2FA7 A;  3QUJ A;  2QSX A;  4IO5 A;  3RPW A;  3IOU A;  4IO7 A;  1J1N A;  2IA4 A;  2WX9 A;  1FPD A;  3H6V A;  4OWD A;  1BIY A;  4R9F A;  1SYI A;  3TQW A;  3QK6 A;  4JVD A;  3E78 A;  5TPA B;  4GF8 A;  3LV0 A;  4POW A;  4ECF A;  2I6E A;  1XI6 A;  1XVY A;  3TPA A;  1LBC A;  1IXG A;  4NF6 B;  4K3F A;  4GXA A;  4P3L A;  3KN3 A;  3W9W A;  2P3V A;  1MRP A;  4OFO A;  1LCF A;  1KZ8 A;  5I59 B;  3KSJ A;  3OO7 A;  3O97 A;  1CE2 A;  3LC8 A;  3T9X B;  3FBP A;  1N3W A;  2OK2 A;  1NFT A;  1MPB A;  1M5C A;  4I40 A;  3LSW A;  5CM6 A;  3FD3 A;  3FXR A;  3K6U A;  2O84 X;  3H6U A;  4R6H A;  3S4U A;  1ZIU A;  1FQD A;  5I5P A;  1FPE A;  3Q27 A;  2NUV A;  3N5L A;  5I2K A;  4RXL A;  2QVV A;  1JP4 A;  1N7W A;  2LAO A;  3T93 B;  2UVH A;  3PMV A;  5I7I A;  1Y9U A;  1H43 A;  5H8Q B;  3FAT A;  4DLD A;  5JTY A;  1Y3P A;  4HE0 A;  1IUD A;  1LBB A;  1FBE A;  4F3G A;  4PET A;  3IFA A;  3RGY A;  4F1Y A;  3V89 B;  1M5E A;  1KA1 A;  2RC7 A;  1FSA A;  2Y7P A;  3CR9 A;  4RY1 A;  3C36 A;  3VLV A;  4QFL A;  4GBW A;  4MAG A;  1FBG A;  2GQ1 A;  5ET5 A;  1QKB A;  2X26 A;  2PCR A;  2XA5 A;  3G3F A;  1ELJ A;  2E0S A;  2P3N A;  2V4C A;  4GWY A;  1GVC A;  1O64 A;  1B51 A;  4DIG A;  1LAF E;  5H8F A;  4GL8 A;  5EYH A;  5A5X A;  5F24 A;  1MG1 A;  3L6H A;  3O2A A;  1LEV A;  1LBV A;  5DEX A;  1MS7 A;  4KCD A;  4NWC A;  2B3B A;  2UVJ A;  3DLN A;  2NXO A;  1LAX A;  4DXC A;  2X7Q A;  2WKY A;  2XXP A;  3SZP A;  4MBP A;  2VOZ A;  1OLA A;  3K00 A;  2FIX A;  1OQG A;  2DDK A;  1LBX A;  3MAM A;  4XTC Q;  2OX3 A;  2I4B A;  4NG7 A;  1S7Y A;  5CRY A;  4EF2 A;  3LSL A;  4R2B A;  1DBZ A;  2H25 A;  4I3E A;  4ZE8 A;  4P1L A;  3L6G A;  4PF6 A;  4PGN A;  2CZK A;  4OFJ A;  3TTM A;  3R26 A;  3GBB A;  3K6X A;  3IJO B;  4YMB A;  4BDL A;  4BDM A;  4PGP A;  1N3X A;  3RN8 A;  1OVB A;  3IO6 A;  1VR5 A;  1IME A;  3D1R A;  3TFL A;  3E3K A;  4ZEC A;  2FIE A;  1ANF A;  3EHU A;  4OHN A;  3B6T A;  2I3W A;  5BWJ A;  3USD A;  3LUY A;  3PUV E;  1AOV A;  1T0K A;  1USY E;  4IO6 A;  4N6K A;  4GWX A;  3DP6 A;  1N76 A;  3PPO A;  2PFZ A;  1QUI A;  3PPP A;  2I3V A;  2FNC A;  4MH5 A;  3TEP A;  1MQG A;  4P0I A;  1MQH A;  1MDQ A;  4RPN A;  3QMF A;  4QSE A;  1AMF A;  3GLB A;  5I2N B;  2ALU A;  3ODB A;  5EQ9 A;  4R72 A;  1NMU A;  1PB8 A;  1Y1Z A;  5H8S A;  2CZI A;  4WEP A;  3FGS A;  2HFB A;  3KJ7 A;  3RPL A;  1B3F A;  1NV7 A;  1UTH A;  4H5G A;  3TTR A;  4RJZ A;  1JQF A;  4RPO A;  5ELV A;  1IXC A;  4PFB A;  4G8H A;  5I58 B;  2DWI A;  2WBB A;  3MBP A;  4G68 C;  2R6G E;  5IKB A;  3O6H A;  1FJ6 A;  3H6W A;  1B5I A;  3QSL A;  2R71 A;  1M5B A;  3B7D A;  2HZK A;  3FVO A;  3UOR A;  3QXM A;  1QUL A;  1DTG A;  3MST A;  5EHS A;  3OMB A;  1SW2 A;  4OYV A;  3SEV A;  2QS3 A;  2ZNU A;  1NH7 A;  1URG A;  1FQB A;  1EU8 A;  4ZDM A;  1MY4 A;  2V3T A;  4ONY A;  1MXX A;  4AS5 A;  1G0I A;  1A8E A;  1LB9 A;  2RIN A;  4LN5 A;  4OVT A;  3OEL A;  1SYH A;  4N15 A;  2XXT A;  4ZE9 A;  1P1W A;  1S9T A;  1JVY A;  4FBP A;  2OJT A;  3O6G A;  4BDR A;  1SW1 A;  1MQD A;  1OVT A;  3KZG A;  4NF6 A;  1S50 A;  1IMC A;  1JW5 A;  3FXQ A;  3FXB A;  5EYG A;  2ZYO A;  1B2H A;  3IX1 A;  4YKK A;  3D4G A;  3A3U A;  4TQU Q;  3FUZ A;  5A5L A;  2R8T A;  2OLB A;  3UIF A;  5AA2 B;  4LZ5 A;  4MJO A;  2G93 A;  3PUW E;  2ONS A;  1B1X A;  4IY6 A;  4ZEK A;  4JXI A;  2THI A;  5DYH A;  2UYE A;  3S9N C;  3IOW A;  2Y84 A;  4WKM A;  5JTY B;  2NVU B;  3MZB A;  4EXK A;  1D9Q A;  3ZKL A;  4DI4 B;  5AA4 A;  1NV6 A;  3CG1 A;  2A5T B;  1B05 A;  1FBH A;  3HPI A;  2XD2 A;  4U4S A;  5CC2 A;  4KPT A;  1POY 1;  1EZP A;  5I2K B;  1NI9 A;  4F3S A;  1RDZ A;  1I6Q A;  3KBR A;  4QBA A;  5CMM A;  5ISU A;  3PMW A;  4POX A;  3S9L C;  1N0T A;  5M2V A;  2O1M A;  4N07 A;  1NNK A;  5JK4 A;  1GGG A;  4GWU A;  3I3V A;  3M3L A;  1MXU A;  1D3K A;  4NHB A;  5I2N A;  4IY5 A;  3C31 A;  2A5T A;  5DT6 A;  2DE2 A;  1VDW A;  1D4N A;  4KHZ E;  1UIU A;  4KCC A;  4ZEF A;  4QF9 A;  2RF1 A;  4YZZ A;  1LST A;  4BDQ A;  3CVG A;  3KBZ A;  3HHF A;  3MP8 A;  3V8X B;  3MVY A;  2Y7I A;  2HXW A;  4ZZA A;  4HCY A;  3B6W A;  2WYK A;  5I3S A;  3UK4 A;  2Q89 A;  4OVR A;  1SBP A;  3SES A;  3FJM A;  3E79 A;  4E0W A;  4F19 A;  1B4Z A;  1QUK A;  2BJJ X;  4N6D A;  4ZED A;  1NV0 A;  1RDX A;  3UA8 A;  1PB9 A;  5IZ1 A;  4X48 A;  4G4P A;  1F9B A;  2KR0 A;  1B5J A;  4RNS A;  2GFE A;  2DQV A;  4TLL B;  4OA4 A;  3T96 B;  4UAC A;  3M3F A;  3QUF A;  4P11 A;  4PBQ A;  1DMB A;  2I0C A;  2XWO A;  1FTA A;  3PD9 A;  5EQ8 A;  2I49 A;  4GRK A;  2UXA A;  1DSN A;  1SW5 A;  2HXR A;  4P9K A;  3DEL B;  4JSO A;  1B3H A;  3TOD A;  3W9V A;  5IAI A;  3NOH A;  1RYO A;  3H4Z A;  1MXV A;  5F7V A;  1DPP A;  5A5X B;  3HN0 A;  4IO2 A;  5KZT A;  1B7H A;  2FHY A;  5TPA A;  1EYK A;  1FPK A;  2W7Y A;  3KOS A;  4I1D A;  4OES A;  2PMS A;  1FQF A;  1TFD A;  1MY2 A;  5L9M A;  4O3C A;  1P1U A;  2F34 A;  5J1D A;  5AA4 B;  4LON B;  1R6Z A;  1B0L A;  3S9E A;  4F1U A;  2GRV A;  2E1S A;  3IB2 A;  4FOR A;  4F31 B;  3CI8 A;  1B3L A;  1FBF A;  2CEY A;  4U23 A;  4ELO A;  2ZZV A;  3IOR A;  3HO7 A;  1MXY A;  4MFI A;  1LBW A;  4H67 A;  3G3I A;  5I56 A;  4U4X A;  1B4H A;  5LOM A;  3OD7 A;  1MQI A;  2CMO A;  2B65 A;  2Z23 A;  3KJT A;  3M3K A;  4O7I A;  5DVI A;  1ATG A;  2Q74 A;  1M5D A;  3H6T A;  1FBC A;  3SDF A;  2FBP A;  5H8N A;  2Z8E A;  2VD2 A;  1ZTY A;  4GWZ A;  4PE3 A;  4OVQ A;  4MHF A;  2ONR A;  2XX8 A;  3MVZ A;  4UAB A;  2D3I A;  2XXW A;  3GYY A;  3IL1 B;  1Y3Q A;  1NV2 A;  2OWZ A;  2F7B A;  3CFL A;  1EZO A;  3MQ9 A;  2Q2A A;  3GZG A;  2I0B A;  3RY3 A;  1NL5 A;  4F3P A;  1B52 A;  3MWB A;  4GOT A;  2F97 A;  4LVQ A;  5HBC A;  4NGU A;  1FRP A;  3JV9 A;  5IM2 A;  2ZZW A;  2XWV A;  4HE1 A;  5AA2 A;  2RCB A;  2O69 A;  1YZ0 A;  3EHS A;  4NN3 A;  4FEC A;  4WED A;  3U94 A;  2WYP A;  1Z7N E;  3CRB A;  1VFE A;  3QIM A;  2UVI A;  4MNP A;  5K2Y A;  1B7U A;  2F3B A;  4YMA A;  2QMX A;  4GQO A;  4KI0 E;  3VV5 A;  2P1S A;  4YB7 A;  4ZEB A;  1ZBM A;  5H8H A;  2XXU A;  3RPL B;  3SER A;  4GBV A;  1P1Q A;  3TZA A;  3FZV A;  1YCJ A;  2I4C A;  3T9V A;  5T3J A;  1TXF A;  2HHM A;  3EHT A;  2PT1 A;  2ZYM A;  3IB0 A;  4YB6 A;  1IMA A;  3U1O A;  4Z7E A;  1LB8 A;  3BKI B;  1MM7 A;  2O7U A;  3OSQ A;  1A40 A;  4G8M A;  1IZ1 A;  2GH9 A;  4IB2 A;  4R9G A;  4AS4 A;  4UA8 A;  5J16 A;  1IIW A;  5ITP A;  4PP0 A;  4O8M A;  1R1N A;  4KD5 A;  1EZ9 A;  4MMP A;  2VPN A;  2Q8J A;  1AL3 A;  2G29 A;  3KEI A;  1ZJL A;  4H46 A;  1LCT A;  4R73 A;  3MJN A;  3PUZ E;  4L17 A;  4ZS9 A;  1MPD A;  1N04 A;  4XKQ A;  1D9V A;  4U21 A;  4I8C A;  3S9M C;  2AL4 A;  5L9S A;  1BLF A;  4QFK A;  1JVX A;  4OZ9 A;  4M1V A;  1B5H A;  4EXL A;  4OEN A;  2V3Q A;  2DVZ A;  3H03 A;  1SVX B;  3TYH A;  1Y3N A;  5DEX B;  2Z8D A;  1Q35 A;  5TU0 A;  4FAJ A;  1EYJ A;  2CZL A;  4XXU A;  3TTL A;  4NWD A;  2F7A A;  3FIR A;  3TUS A;  2DP8 A;  2DXY A;  1A54 A;  4IO4 A;  3S2V A;  1FPG A;  5CBR A;  3RQT A;  1EYI A;  1GV8 A;  1UTB B;  4IGR A;  4H5F A;  1LGB C;  2VGQ A;  3CHG A;  4U1Z A;  2I58 A;  3O29 A;  5FTH A;  3TDJ A;  5CMK A;  3PPN A;  3OXN A;  2H98 A;  1IEJ A;  4EQ9 A;  4FEB A;  4AB6 A;  3PUX E;  3N6U A;  4MX6 A;  4ISU A;  4X04 A;  1II5 A;  4GL0 A;  3U92 A;  2DXR A;  5EQA A;  2Q88 A;  4LA9 A;  4PDD A;  4QFN A;  2OZZ A;  4LP2 B;  1MY0 A;  3BFU A;  3K0V A;  1DPE A;  1B0H A;  3SEU A;  4H8J A;  3MUQ A;  2NOO A;  4XKP A;  3A09 A;  4EQ7 A;  1MH3 A;  4PAK A;  3FV2 A;  4GVO A;  1K9Z A;  4KR5 A;  4H0W A;  3HCQ A;  3OSR A;  2Y7R A;  3TCF A;  2A5S A;  2RKM A;  2VT5 A;  2ZYN A;  5F1Q A;  3ZS6 A;  4NF5 B;  3MC2 A;  3PD8 A;  1FPF A;  1XT8 A;  1I6A A;  1BTJ A;  3VXB A;  3EKI A;  3ROJ A;  5IZZ A;  1R9L A;  2GHA A;  4XF5 A;  3P7I A;  3OO8 A;  2XXY A;  2RC9 A;  3DP8 A;  2Q9T A;  3OOA A;  4JBZ A;  4GXS B;  2YJP A;  4LQ2 A;  3TCH A;  3C33 A;  2DE4 A;  2PVU A;  4NF4 A;  4Q30 B;  2ONK E;  3U65 A;  1OQH A;  3CFX A;  3SEY A;  4JWX A;  1M5F A;  1XC1 A;  1MH4 A;  3ILT B;  4N8Y A;  5DVF A;  2QS2 A;  3T22 A;  1BKA A;  4PFI A;  4P8B A;  4AB5 A;  4PTK A;  1EH3 A;  1SI1 A;  2CEX A;  3LSF B;  2ANJ A;  2HZL A;  1MXZ A;  2AIX A;  4KYD A;  1K9Y A;  3MVW A;  1B46 A;  4N91 A;  4F1V A;  3HHG A;  4LZ7 A;  1YAE A;  2H99 A;  4Z0I A;  2V84 A;  5FHO A;  4PFW A;  1DOT A;  4GIZ A;  3B8B A;  3KSX A;  2F35 A;  1HSE A;  1NV3 A;  4RA1 A;  1FPB A;  4GWO A;  1I69 A;  2O6A A;  4MEV A;  4NF8 A;  4Q8R A;  2BJI A;  4H8I A;  4NE4 A;  2XX9 A;  4QRZ A;  3RT8 A;  2VHA A;  1IXI A;  3Q29 A;  3T9H B;  3K01 A;  1FTO A;  1JET A;  4EUO A;  3I5O A;  4DE8 A;  3E4R A;  1DK4 A;  1MXW A;  3V83 A;  3BIH A;  3G7W A;  3U93 A;  1I6B A;  1AWB A;  3U72 A;  1FQA A;  4G68 B;  4RK2 A;  1FTJ A;  3MZ1 A;  3M8U A;  4P0G A;  1PBP A;  3LSX A;  1XS5 A;  1B9J A;  2DSF A;  2B4M A;  1FPL A;  3VXC A;  5ICQ A;  2FYI A;  3MZ9 A;  3GXA A;  4RYA A;  3IK6 B;  3KN8 A;  4H65 A;  4FJP A;  1QUJ A;  1A7L A;  5EHM A;  1DCU A;  5DTB A;  2HQ0 A;  1PDA A;  5IZ3 B;  3K1M A;  1NUZ A;  5K2X A;  4QSC A;  4YB5 A;  2F3D A;  2WEF A;  4OXV A;  1RKM A;  3PV0 E;  4XIG Q;  4NF4 B;  1POT A;  5I57 B;  1YYZ A;  2PT2 A;  4FAT A;  3G3H A;  3KN7 A;  3FVN A;  2F5X A;  3MYU A;  1SI0 A;  3KGC A;  4XKR A;  4KYE A;  3T0J A;  1IQ7 A;  4ND9 A;  1QGX A;  4O94 A;  1QKA A;  4PQJ A;  3THI A;  3BBR A;  1KA0 A;  3CSB A;  5FHN A;  1B6H A;  5I59 A;  4YIC A;  2O68 A;  2F6P A;  2QJE A;  1CB6 A;  2GHB A;  4P1E A;  3T9U A;  1G0H A;  5HM4 B;  4BDN A;  3V5A A;  3PUY E;  1IMD A;  2UVG A;  3RLF E;  4NF8 B;  4E0X A;  1ZU0 A;  2OCU A;  2VPO A;  4MNI A;  4OVP A;  4YU0 A;  4I3Y A;  1Q1K A;  4ESX A;  2H9B A;  3O9P A;  4Q5T A;  3W15 C;  4U22 A;  1SQY A;  4HS7 A;  2KQZ A;  1DTZ A;  5H8Q A;  4DCX A;  5AA3 A;  2VP1 A;  3B6Q A;  3GBA A;  1LFI A;  3OEK A;  2ZXT A;  4JSD A;  3TTK A;  4N6P A;  5JEI A;  3RT6 B;  1WDN A;  4PCD A;  4NTL A;  4QFP A;  2V25 A;  3UP9 A;  3O66 A;  4H1X A;  2OWT A;  4OFL A;  3MP6 A;  4XFE A;  1H3D A;  4U1O A;  4GX4 A;  1RYX A;  3ILU B;  4QHQ A;  1A55 A;  4FIM A;  1P1N A;  2HCA A;  1B58 A;  5TP9 B;  4JWY A;  1ZKB A;  1MQJ A;  2I48 A;  2F7C A;  1PC3 A;  4X1B A;  4YKP A;  3SEW A;  3VLU A;  4PDH A;  1HSJ A;  3RTF B;  1YXI A;  1IMF A;  1AIV A;  4YKI A;  4DXU A;  2YPN A;  1FTL A;  3LR1 A;  1B7Z A;  1NH8 A;  1LAG E;  2QMW A;  1FBD A;  4OET A;  4GWW A;  5ITO A;  2Y7K A;  4PBH A;  1LLS A;  3RUM A;  2DS9 A;  4PFT A;  4KXP A;  4HXV A;  4G2Z A;  1VFD A;  2DE3 A;  1FCK A;  2XXH A;  4ELR A;  3TQL A;  5EQ7 A;  2QS4 A;  2XXK A;  1YPN A;  2QPQ A;  5DW8 A;  2Z8F A;  1WOD A;  4IR8 A;  4P47 A;  5AE4 A;  1B32 A;  4PFU A;  1XVX A;  5IZ3 A;  1D9Y A;  4F3B A;  3TAJ A;  3QAX A;  3FV1 A;  1FPJ A;  3TKD A;  5AA1 A;  2HEU A;  3HV1 A;  5IGA A;  2DWJ A;  4YKJ A;  3QYT A;  5I56 B;  4GLI A;  1IIT A;  1BP5 A;  3BFT A;  2RCA A;  3FXU A;  2H5Y A;  4JDF A;  1Y1M A;  3I6V A;  3OEM A;  4G8N A;  1MY3 A;  3AXF A;  3FVG A;  1NV5 A;  2ZZX A;  1LBZ A;  3MVX A;  4IO3 A;  1VE4 A;  3RNN A;  3Q28 A;  4N81 A;  3TTN A;  1URS A;  2YLN A;  3IAZ A;  3PGF A;  4R6Y A;  4C0R A;  1JEV A;  4DDD A;  5KDT A;  2XXX A;  1VSO A;  1SDX A;  4H45 A;  2RC8 A;  2PBW A;  1NV4 A;  2UYF A;  1FW0 A;  3LUZ A;  1US5 A;  3F11 A;  4OAN A;  5I57 A;  1FBP A;  4OER A;  3MPL A;  2MKZ A;  2FVZ A;  3VVF A;  2X7P A;  3PPQ A;  4AQ4 A;  4DXB A;  5KDT B;  1QVS A;  3CIJ A;  4GD5 A;  3ZKK A;  3IOT A;  1GR2 A;  2REG A;  1NNP A;  4NED A;  4OVS A;  3IB1 A;  2Y7W A;  1NV1 A;  1H76 A; 
#chains in the Genus database with same CATH homology
 1LST A;  3TQW A;  3CVG A;  3FV2 A;  3QK6 A;  4GVO A;  3HHF A;  5DVJ A;  4BDQ A;  3WAE A;  3N6T A;  4KR5 A;  3MP8 A;  4H0W A;  4N13 A;  3V8X B;  3HCQ A;  5TPA B;  3MVY A;  3OSR A;  2Y7I A;  4GF8 A;  2HXW A;  1LAH E;  2Y7R A;  4HCY A;  2A5S A;  4ZZA A;  3TCF A;  2O7I A;  3TMG A;  4ELQ A;  2RKM A;  3B6W A;  2ZMB A;  4X9T A;  3UK4 A;  4EDP A;  4YAH X;  2Q89 A;  3K6W A;  4POW A;  4Q0C A;  4ECF A;  1SBP A;  3SES A;  2ZYN A;  3FJM A;  5F1Q A;  1AOV A;  2I6E A;  3ZS6 A;  4E0W A;  4F19 A;  4NF5 B;  3MC2 A;  1XVY A;  1UIV A;  3PD8 A;  1B4Z A;  2O51 A;  3TPA A;  1QUK A;  1LBC A;  1IXG A;  4NF6 B;  2BJJ X;  3K02 A;  4GXA A;  3KN3 A;  4K3F A;  3W9W A;  4ZED A;  4G77 A;  1MRP A;  1N84 A;  1XT8 A;  4OFO A;  3UA8 A;  1I6A A;  1LCF A;  1BTJ A;  5TP9 A;  3VXB A;  5I59 B;  1PBQ A;  3KSJ A;  4R74 A;  1R9L A;  2GHA A;  3CG3 A;  3A3C A;  3O97 A;  3OO7 A;  1PB9 A;  3P7I A;  3JYR A;  1CE2 A;  3LC8 A;  3OO8 A;  4X48 A;  2XXY A;  4G4P A;  4LZ8 A;  1GTK A;  2RC9 A;  3T9X B;  3DP8 A;  1F9B A;  4HW8 A;  3VLW A;  2D21 A;  5B70 A;  2Q9T A;  3OOA A;  1B5J A;  4JBZ A;  4GXS B;  1N3W A;  2YJP A;  2OK2 A;  1NFT A;  4RNS A;  4LQ2 A;  2GFE A;  2DQV A;  2XXQ A;  3C33 A;  4TLL B;  3T96 B;  3TCH A;  1MPB A;  3O28 A;  1FQE A;  1M5C A;  1URD A;  2DE4 A;  3M3F A;  4UAC A;  2PVU A;  2XXR A;  3OO6 A;  3LSW A;  1Z7M E;  3MPK A;  3QUF A;  4NF4 A;  4P11 A;  4Q30 B;  3PPR A;  1DMB A;  1FTM A;  2I0C A;  2ONK E;  2PYY A;  5CM6 A;  3FD3 A;  4F2Q A;  3FXR A;  3K6U A;  3PD9 A;  2O84 X;  3H6U A;  1OQH A;  4R6H A;  3S4U A;  4THI A;  5FHM A;  3N26 A;  4MLQ A;  1ZIU A;  3CFX A;  1FQD A;  2I49 A;  3SEY A;  4JWX A;  3Q27 A;  1Y20 A;  2NUV A;  3N5L A;  3O6I A;  4GRK A;  1JNF A;  5I2K A;  1M5F A;  1XC1 A;  1MH4 A;  3ILT B;  2UXA A;  1DSN A;  3FVK A;  5DVF A;  3EN3 A;  1SW5 A;  4RXL A;  1B3E A;  4WXJ A;  2O1L A;  1T0K A;  1MY1 A;  2QS2 A;  3T22 A;  1BKA A;  1N7W A;  2LAO A;  3T93 B;  4AB5 A;  3DEL B;  4JSO A;  1B3H A;  3TOD A;  4ZEI A;  3W9V A;  5IAI A;  2UVH A;  3E9X A;  2HAU A;  1EH3 A;  1SI1 A;  3PMV A;  1RYO A;  3LSF B;  3H4Z A;  1MXV A;  5F7V A;  1ZLQ A;  2ANJ A;  1DPP A;  1Y9U A;  2HZL A;  5A5X B;  4JB7 A;  1H43 A;  3HN0 A;  4IO2 A;  5H8Q B;  5KZT A;  1MXZ A;  1B7H A;  2AIX A;  4X1D A;  3FAT A;  5TPA A;  5H8N B;  3IJX B;  4KYD A;  4DLD A;  5JTY A;  1Y3P A;  2W7Y A;  3ZSF A;  3KOS A;  4I1D A;  5H8H B;  4OES A;  4OEU A;  2B3F A;  3MVW A;  1B46 A;  1FQF A;  2PMS A;  1H45 A;  4OVJ A;  4F1V A;  3HST A;  1IUD A;  3HHG A;  1LBB A;  4LZ7 A;  1N7X A;  3C9H A;  1YAE A;  2ZNT A;  2V3U A;  4MLV A;  4F3G A;  3Q26 A;  1TFD A;  2H99 A;  4Z0I A;  2V84 A;  1MY2 A;  3EQ1 A;  4PET A;  3WAF A;  4C1U A;  5FHO A;  3RGY A;  4PFW A;  5L9M A;  1DOT A;  4GIZ A;  2QRY A;  3KSX A;  4F1Y A;  2F35 A;  1M5E A;  3V89 B;  1HSE A;  4O3C A;  1P1U A;  2RC7 A;  3SEX A;  4I62 A;  2F34 A;  4RA1 A;  2Y7P A;  3C35 A;  3CR9 A;  3K4U A;  3MW0 A;  4GWO A;  4RY1 A;  3U8Q A;  5AA4 B;  4LON B;  1I69 A;  2O6A A;  1R6Z A;  3C36 A;  3H3G A;  1B0L A;  4QFL A;  3VDF A;  3VLV A;  4F1U A;  3EPE A;  4NF8 A;  3S9E A;  4Q8R A;  4EF1 A;  2GRV A;  4H8I A;  4NE4 A;  2XX9 A;  4QRZ A;  2E1S A;  1QKB A;  3RT8 A;  2VHA A;  3IB2 A;  1IXI A;  3Q29 A;  4NMY A;  1KWH A;  3T9H B;  2X26 A;  5HPQ A;  3K01 A;  1FTO A;  1JET A;  4FOR A;  4EUO A;  4F31 B;  4BLA A;  3CI8 A;  3I5O A;  4DE8 A;  1B3L A;  3E4R A;  3G3F A;  2H4I A;  4U23 A;  4F18 A;  1Y4T A;  1IXH A;  1ELJ A;  4ELO A;  2E0S A;  1GVC A;  1O64 A;  1MXW A;  3IOR A;  3EF7 A;  3V83 A;  4KFQ A;  1B51 A;  3HO7 A;  2XXI A;  1MXY A;  4MFI A;  4DIG A;  4H67 A;  1LAF E;  3G7W A;  3G3I A;  5I56 A;  4ZZE A;  5H8F A;  4GL8 A;  3U93 A;  1QJM A;  3C4M A;  1I6B A;  5A5X A;  5L8D A;  4G68 A;  4U4X A;  1B4H A;  1XHY A;  3U72 A;  5LOM A;  1P99 A;  3OD7 A;  1MQI A;  1MG1 A;  2CMO A;  2KLF A;  1FQA A;  3L6H A;  1LFH A;  3C32 A;  2B65 A;  2ZYK A;  3O2A A;  2Z23 A;  4EQ7 A;  1MPC A;  3KJT A;  2XD3 A;  4C1T A;  5I58 B;  5DEX A;  3M3K A;  1MS7 A;  1HSL A;  4KCD A;  4NWC A;  2B3B A;  2UVJ A;  1UTB A;  3DLN A;  2NXO A;  5DVI A;  1LAX A;  4G68 B;  2X7Q A;  4DXC A;  4RK2 A;  2WKY A;  2XXP A;  1ATG A;  3DM0 A;  1FTK A;  1M5D A;  1FTJ A;  3MZ1 A;  3H6T A;  4MBP A;  2VOZ A;  1OLA A;  2QS1 A;  3M8U A;  4P0G A;  5ISU A;  1B40 A;  3K00 A;  4F22 A;  1PBP A;  4TOZ A;  4R2F A;  1QW0 A;  1OQG A;  3LSX A;  1XS5 A;  3SDF A;  1B9J A;  2ESN A;  4M4G A;  3MAM A;  4GFR A;  5H8N A;  3SET A;  4XTC Q;  1ZMG A;  2Z8E A;  4OMB A;  2DSF A;  2VD2 A;  2I4B A;  1ZTY A;  2P2A A;  1LFG A;  1S7Y A;  3VXC A;  5CRY A;  5ICQ A;  3KG2 A;  2FYI A;  3MZ9 A;  4EF2 A;  3LSL A;  3R6U A;  3GXA A;  2ONR A;  4R2B A;  1USY H;  4RYA A;  3IK6 B;  2XX8 A;  4H6D A;  3MVZ A;  3KN8 A;  4HCW A;  4LAT A;  1SW4 A;  2D3I A;  4H65 A;  5I84 A;  4FJP A;  2H25 A;  2XXW A;  1QUJ A;  1A7L A;  5EHM A;  2P0S A;  4ZE8 A;  3IL1 B;  1Y3Q A;  3L6G A;  5DTB A;  2DWH A;  2F7B A;  2HQ0 A;  3CFL A;  1PDA A;  1EZO A;  3MQ9 A;  4F39 A;  3K1M A;  4OFJ A;  3UGW A;  4ESW A;  3TTM A;  1B1H A;  2Q2A A;  5K2X A;  3GZG A;  4QSC A;  3R26 A;  2I0B A;  3GBB A;  3K6X A;  3IR1 A;  3RY3 A;  3IJO B;  4YB5 A;  4YMB A;  4OXV A;  1NL5 A;  4BDL A;  4BDM A;  1RKM A;  4F3P A;  1N3X A;  3PV0 E;  1US4 A;  4XIG Q;  3FAS A;  4NF4 B;  1POT A;  1B52 A;  3RN8 A;  5I57 B;  3MWB A;  4GOT A;  1OVB A;  1NNF A;  1MH3 A;  2F97 A;  2PT2 A;  3VVE A;  4FAT A;  3IO6 A;  1VR5 A;  4LVQ A;  3G3H A;  5CMB A;  3RTW B;  3TFL A;  3KN7 A;  3E3K A;  3FVN A;  2Q2C A;  2F5X A;  5HBC A;  1TFA A;  2XX7 A;  4ZEC A;  3EHU A;  1ANF A;  1NNT A;  3H06 B;  1OIB A;  1SI0 A;  3KGC A;  4XKR A;  1B3G A;  3T66 A;  3JV9 A;  4KYE A;  4OHN A;  3B6T A;  1IQ7 A;  2I3W A;  2F78 A;  4ND9 A;  5BWJ A;  5AA2 A;  2RCB A;  1QKA A;  2O69 A;  3EHS A;  4PQJ A;  3THI A;  3BBR A;  4FEC A;  4WED A;  3USD A;  3D4C A;  4OQO A;  3LUY A;  2DYX A;  4PFY A;  3PUV E;  3LBS A;  3U94 A;  2F8D A;  1USY E;  2ABH A;  3CSB A;  3OO9 A;  4FE8 A;  1B6H A;  4LQ5 A;  5FHN A;  5I59 A;  1P1O A;  2O68 A;  1Z7N E;  4IO6 A;  2F6P A;  2QJE A;  2DVC A;  1CB6 A;  4YIC A;  3R7X A;  2AYS A;  3CRB A;  2GHB A;  3DP6 A;  1N76 A;  1VFE A;  2IEE A;  3PPO A;  1QUI A;  2UVI A;  3FJG A;  3QIM A;  3T9U A;  4BDN A;  3PPP A;  3V5A A;  3PUY E;  1JW4 A;  5K2Y A;  1B7U A;  2DOJ A;  2I3V A;  2FNC A;  4YMA A;  2QMX A;  5J1D A;  4GQO A;  2UVG A;  4KI0 E;  1EZP A;  3RLF E;  1TWY A;  4NF8 B;  4E0X A;  4JWO A;  1ZU0 A;  2P1S A;  4MH5 A;  3VV5 A;  3TEP A;  2OCU A;  4OEV A;  1MQG A;  4P0I A;  4OTE A;  1MQH A;  4YB7 A;  2R9J A;  1MDQ A;  4YU0 A;  4RPN A;  1O63 A;  5BUU A;  4QSE A;  4ZEB A;  1Q1K A;  4ESX A;  1ZBM A;  2H9B A;  3O9P A;  4Q5T A;  1AMF A;  3GLB A;  5H8H A;  2ALU A;  3W15 C;  5I2N B;  1L5T A;  4U22 A;  1SQY A;  2XXU A;  3SER A;  3ODB A;  4HS7 A;  4QFO A;  1DTZ A;  4R72 A;  1P1Q A;  1NMU A;  1PB8 A;  1Y1Z A;  5H8Q A;  4DCX A;  5AA3 A;  2VP1 A;  5CMC A;  4F2O A;  1Y4C A;  5H8S A;  3K6V A;  3B6Q A;  3GBA A;  1A99 A;  1LFI A;  4WEP A;  3FGS A;  3OEK A;  2HFB A;  2ZXT A;  4JSD A;  2V93 A;  3FZV A;  3TTK A;  3TZA A;  1YCJ A;  4N6P A;  2I4C A;  3RT6 B;  5JEI A;  1WDN A;  3KJ7 A;  4R6K A;  1AH5 A;  1B3F A;  1UTH A;  4H5G A;  1YTV A;  3T9V A;  1TXF A;  3TTR A;  5ICT A;  4NTL A;  3IO4 A;  4QFP A;  4RJZ A;  3EHT A;  2V25 A;  1JQF A;  4RPO A;  2PT1 A;  5ELV A;  3UP9 A;  4O3A A;  2DWA A;  1IXC A;  3O66 A;  2ZYM A;  4G8H A;  3IB0 A;  4H1X A;  2DWI A;  4G68 C;  2OWT A;  3MBP A;  4OFL A;  3MP6 A;  2ZNS A;  2R6G E;  4YB6 A;  1H3D A;  3O6H A;  5IKB A;  3U1O A;  3H6W A;  4Z7E A;  1LB8 A;  3BKI B;  1MM7 A;  4RK9 A;  4U1O A;  1B5I A;  3QSL A;  2R71 A;  1M5B A;  1RYX A;  3B7D A;  3ILU B;  4QHQ A;  2HZK A;  1A55 A;  5L9O A;  4FIM A;  1P1N A;  2HCA A;  1B58 A;  5TP9 B;  3FVO A;  4JWY A;  1ZKB A;  2O7U A;  1MQJ A;  3ECR A;  3UOR A;  3OSQ A;  2PX1 A;  1NKX A;  1A40 A;  3QXM A;  4G8M A;  1IZ1 A;  2I48 A;  4HTG A;  1QUL A;  1DTG A;  5CI5 A;  1WVJ A;  2F7C A;  5EHS A;  1PC3 A;  2GH9 A;  4DCY A;  4X1B A;  4YKP A;  3SEW A;  3VLU A;  4XKN A;  3TCG A;  3OMB A;  1SW2 A;  3DP4 A;  1HSJ A;  4IB2 A;  4OYV A;  4R9G A;  3RTF B;  3SEV A;  4UA8 A;  2QS3 A;  2ZNU A;  1AIV A;  1IIW A;  4YKI A;  4DXU A;  5ITP A;  1NH7 A;  2YPN A;  1URG A;  1FQB A;  1EU8 A;  4PP0 A;  1FTL A;  1MY4 A;  3LR1 A;  1B7Z A;  1NH8 A;  4TLM B;  4ZDM A;  2V3T A;  1OMP A;  1LAG E;  4KQP A;  2QMW A;  4ONY A;  1MXX A;  4OET A;  1R1N A;  4KD5 A;  1A8E A;  1LB9 A;  1EZ9 A;  2RIN A;  3K2D A;  5ITO A;  3VFJ A;  3OEL A;  3VVD A;  2Q8J A;  2OWS A;  2Y7K A;  4EQB A;  1SYH A;  1LLS A;  2XXT A;  2Z22 A;  3UN6 A;  4ZE9 A;  5AA1 A;  3RUM A;  4R75 A;  1AL3 A;  1P1W A;  2G29 A;  1S9T A;  3KEI A;  2DS9 A;  1UTH B;  1JVY A;  1ZJL A;  4F29 A;  2OJT A;  1LCT A;  4PFT A;  3O6G A;  4R73 A;  4G2Z A;  1VFD A;  3G3J A;  4BDR A;  1SW1 A;  1MQD A;  5CBS A;  3MJN A;  3PUZ E;  2DE3 A;  1OVT A;  1FCK A;  2XXH A;  5KCJ A;  4ELR A;  3KZG A;  1FQC A;  4NF6 A;  1S50 A;  3TQL A;  4L17 A;  4MF3 A;  3PU5 A;  4KYS A;  3K1P A;  3KOT A;  4ZS9 A;  1MPD A;  5EYF A;  1N04 A;  4XKQ A;  1D9V A;  2VD3 A;  4U21 A;  2QS4 A;  1JW5 A;  1PB7 A;  1OLC A;  1YPN A;  2QPQ A;  5CC2 A;  4I8C A;  2Z8F A;  3S9M C;  3FXQ A;  1WOD A;  2AL4 A;  3CFZ A;  5L9S A;  1BLF A;  2OBG A;  5AE4 A;  1XOC A;  1B32 A;  4QFK A;  4PFU A;  1XVX A;  3TEL A;  1JVX A;  1UQW A;  1D9Y A;  4M1V A;  4OZ9 A;  2NWJ A;  3TAJ A;  4F3B A;  3QAX A;  3FV1 A;  2ZYO A;  3ONM A;  3VE1 B;  1B2H A;  1B5H A;  3IX1 A;  4YKK A;  4OEN A;  4BDO A;  3TKD A;  4EXL A;  1A8F A;  2D5W A;  2V3Q A;  3A3U A;  2HEU A;  2DVZ A;  2F6G A;  3D4G A;  3H03 A;  1SVX B;  2DWJ A;  3HV1 A;  4TQU Q;  4YKJ A;  3TYH A;  3QYT A;  4ELP A;  1Y3N A;  1JW1 A;  1MDP 1;  3FUZ A;  5H8F B;  5DEX B;  5I56 B;  2OLB A;  4GLI A;  3UIF A;  5AA2 B;  2Z8D A;  4LZ5 A;  1Q35 A;  1IIT A;  4NF5 A;  1BP5 A;  2M8C A;  5TU0 A;  3BFT A;  2RCA A;  2G93 A;  3FXU A;  3PUW E;  4FAJ A;  2ONS A;  1B1X A;  2H5Y A;  2QL3 A;  4IY6 A;  2CZL A;  4JDF A;  3N94 A;  1Y1M A;  2XHD A;  3I6V A;  4JXI A;  4XXU A;  4ZEK A;  3TTL A;  3OEM A;  1MM6 A;  4NWD A;  2F7A A;  2THI A;  2UYE A;  4G8N A;  1MY3 A;  5DYH A;  3S9N C;  1PEB A;  3IOW A;  1SD3 A;  2Y84 A;  4U2R A;  4WKM A;  3AXF A;  3FVG A;  5JTY B;  3KFM A;  1R9Q A;  2NVU B;  3FIR A;  3TUS A;  3MZB A;  4EXK A;  2DP8 A;  4O3B A;  3ZKL A;  4DZ1 A;  3MVX A;  2DXY A;  1A54 A;  3H7M A;  4IO4 A;  1VE4 A;  4IO3 A;  3RNN A;  5AA4 A;  3Q28 A;  3CG1 A;  2A5T B;  3S2V A;  3TTN A;  3FJ7 A;  1B05 A;  1URS A;  3HPI A;  5CBR A;  2F36 A;  2YLN A;  3IAZ A;  3PGF A;  2XD2 A;  3E13 X;  3RQT A;  4R6Y A;  4C0R A;  4U4S A;  5AA2 D;  4KPT A;  1POY 1;  1H44 A;  1UTB B;  4IGR A;  1GV8 A;  1JEV A;  4H5F A;  1LGB C;  2VGQ A;  2XXX A;  4DDD A;  4U1Z A;  2AL5 A;  5I2K B;  1VSO A;  5KDT A;  2I58 A;  1TT1 A;  3MP1 A;  3O29 A;  5FTH A;  1O7T A;  3TDJ A;  1JEU A;  4F3S A;  5CMK A;  1SDX A;  1I6Q A;  2HAV A;  3KBR A;  3PPN A;  5CMM A;  3PMX A;  3JZJ A;  3OXN A;  3PMW A;  3G3K A;  4PE5 B;  2H98 A;  1IEJ A;  2RC8 A;  4LUB A;  4POX A;  4QSD A;  3SKP A;  3S9L C;  3OEN A;  1N0T A;  2PBW A;  3IOV A;  2UYF A;  5M2V A;  3CSG A;  4I9D A;  1FW0 A;  2O1M A;  4N07 A;  4EQ9 A;  4FEB A;  4FED A;  4YZZ A;  1NNK A;  1US5 A;  3C34 A;  3F11 A;  4AB6 A;  3PUX E;  3N6U A;  1GGG A;  5B7D A;  5HM4 B;  5I57 A;  3I3V A;  4ISU A;  4OER A;  3MPL A;  1II5 A;  3M3L A;  4GL0 A;  1MXU A;  1D3K A;  5FTI A;  3VVF A;  2X7P A;  3PPQ A;  3U92 A;  3K1N A;  4AQ4 A;  4DXB A;  2DXR A;  5I2N A;  5KDT B;  1QVS A;  3Q25 A;  5KCJ B;  2XXV A;  3C31 A;  3G3G A;  2Q88 A;  4IY5 A;  4LA9 A;  5I58 A;  2REJ A;  4IGT A;  3CIJ A;  4QFN A;  2OZZ A;  4GD5 A;  4LP2 B;  1MY0 A;  3ZKK A;  3BFU A;  2FA7 A;  3QUJ A;  5JK4 A;  2QSX A;  4IO5 A;  3K0V A;  2A5T A;  5DT6 A;  2DE2 A;  1DPE A;  3RPW A;  3IOT A;  3IOU A;  1D4N A;  1J1N A;  1GR2 A;  2IA4 A;  2REG A;  1B0H A;  1NNP A;  4IO7 A;  4KHZ E;  4NED A;  3SEU A;  4H8J A;  3IB1 A;  1UIU A;  2Y7W A;  3MUQ A;  2NOO A;  3H6V A;  4XKP A;  4OWD A;  1BIY A;  3A09 A;  4KCC A;  4ZEF A;  1H76 A;  4QF9 A;  2RF1 A;  4R9F A;  1SYI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...