1S9TA

Crystal structure of the glur6 ligand binding core in complex with quisqualate at 1.8a resolution
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
251
structure length
251
Chain Sequence
NRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKGTPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Glutamate receptor, ionotropic kainate 2
publication title Crystal structures of the GluR5 and GluR6 ligand binding cores: molecular mechanisms underlying kainate receptor selectivity.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 88
structure length 251
sequence length 251
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1s9tA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1s9tA02
3RT6B 3N26A 2RC9A 3G3HA 4G68C 1QVSA 3K6WA 3KFMA 4OERA 1RKMA 1SDXA 2B3FA 5TPAB 4BDQA 2F5XA 4YB6A 4DE8A 3DP8A 3K01A 3EN3A 3KG2A 3BKIB 4ESWA 4KYSA 5I2KB 4DXCA 2XXQA 3C34A 2OK2A 4G68B 3H7MA 5K2YA 2QMWA 2RINA 3TTNA 5BWJA 4ZECA 3CFZA 1IUDA 1GR2A 3ZKKA 3BBRA 2A5TA 4JB7A 4GQOA 1NNTA 5BUUA 3KN8A 2DP8A 3PPQA 4UA8A 4QFNA 2FYIA 4I62A 2DSFA 2DE3A 3M3FA 2ZMBA 3QUFA 2Q89A 2XX8A 1SI1A 1A8FA 3PMVA 1PC3A 1ZU0A 3GBBA 1P1NA 1XS5A 4H0WA 1AIVA 1IXHA 4KYDA 4BLAA 2QS4A 1XHYA 5DVIA 3FATA 3F11A 3PUWE 4RPNA 3FV1A 1SW5A 1B3EA 1D9VA 1MY2A 4LZ5A 3MW0A 1RYXA 3ZS6A 3H3GA 4QSEA 2ONRA 4JSOA 2H25A 3G3JA 3VLUA 1BKAA 2P2AA 3PGFA 1Q35A 1O63A 1H76A 3HCQA 2QS2A 1XT8A 1IXGA 3PUZE 1D9YA 4RA1A 3VFJA 4WXJA 1VR5A 4NF6A 3H6TA 1T0KA 3C33A 4C1UA 1B5JA 3E4RA 1MY4A 2W7YA 1R9QA 5H8FB 3TEPA 2O84X 3RQTA 4Q8RA 1RYOA 1N84A 2NVUB 3FXRA 1EZPA 4R75A 2Y84A 4FE8A 1MXZA 4IO4A 4DZ1A 1TT1A 1GV8A 1QUIA 2XXVA 3UP9A 1N3XA 1M5DA 2VHAA 1NNFA 4EQ9A 5B70A 4IO7A 3IB2A 3OO7A 3K4UA 2V3UA 4KD5A 1XVYA 2OWTA 1UIUA 4HCYA 4R2BA 3MP8A 5A5XA 2FA7A 4GL8A 4POWA 3G3KA 4QRZA 4QSCA 5JTYA 3MBPA 4IGRA 1MXXA 4NF4A 2Z8FA 3GXAA 4H67A 4NTLA 1LGBC 4X1DA 4YAHX 1P99A 2RKMA 3H4ZA 3PPOA 4FECA 3T9VA 5L9OA 1MPCA 4N6PA 3G3IA 4TOZA 1URDA 1B1HA 4MLVA 3FVOA 1NNPA 1VFEA 3CIJA 3U93A 1LBBA 4F2QA 4OVJA 3MWBA 4GOTA 4HCWA 4QFPA 2F34A 2F7CA 2QMXA 3LSXA 3MPKA 4F29A 1USYH 3QSLA 2XXUA 4P11A 4IO3A 3N6TA 4H6DA 4P0IA 3OO9A 2F97A 2DYXA 4DLDA 1FQEA 3EHUA 3G7WA 4GL0A 3Q27A 5H8NA 2ZXTA 1PBQA 2XX9A 5DVFA 4NF5A 3FJ7A 3LUYA 3O6GA 3A3CA 1Y1MA 3IAZA 2AYSA 1DPPA 4TLMB 3PD9A 2HQ0A 2Q2CA 1LB8A 1B0HA 4NWCA 3KOSA 2DWHA 4G2ZA 3GZGA 2XHDA 2PYYA 1EZ9A 2PX1A 1FTLA 5EYFA 3T93B 1SYHA 3BFUA 3VVFA 4LQ5A 1MQDA 3O29A 1NFTA 3RGYA 5I84A 2A5TB 1SQYA 3MVWA 4BDOA 2OZZA 2REJA 4EXLA 2HAVA 1MM7A 3KN3A 3KGCA 4ZEKA 1ZTYA 3EF7A 5H8QA 1AOVA 1HSLA 1A55A 3IB1A 1Z7ME 1FTMA 2PVUA 1MXUA 3LR1A 2OBGA 3SEXA 1N7XA 3PUXE 3S9NC 5ISUA 1B4HA 4PQJA 3VE1B 4TLLB 4R2FA 1MXVA 3C36A 4RXLA 4YB7A 2QJEA 4F1VA 2UVIA 3GBAA 3VVDA 3S9LC 3KN7A 5L8DA 3C35A 3MZ1A 4KR5A 3PD8A 1JQFA 3OMBA 2Z8DA 1LLSA 2UXAA 3T9XB 2G29A 3KZGA 3RTFB 2V3TA 1CB6A 3T9UA 3UIFA 3I6VA 3FASA 1N7WA 2OLBA 4NF8B 1YTVA 4DCXA 2Y7WA 1LCTA 2Y7RA 1QUKA 2H4IA 3H6VA 1D3KA 5AA2A 3RLFE 3T9HB 2LAOA 2V93A 1PBPA 3EHSA 1WODA 2F36A 4O3CA 3FZVA 3PPNA 1DSNA 2O69A 3L6GA 1H43A 5I2NA 1ANFA 2ESNA 4F3BA 4Q0CA 3KBRA 3FGSA 3K1PA 3B6QA 3MZ9A 3QIMA 4F18A 1H45A 5B7DA 3OD7A 3W9VA 4QFLA 2PT2A 3MC2A 3FVGA 3HHFA 4H1XA 4PETA 3JYRA 1ZKBA 3LSFB 3RN8A 4HW8A 2UYEA 4I8CA 1Y4CA 4E0WA 5I59A 3MAMA 2DWJA 1IXCA 1B7UA 4U22A 4KCCA 5A5XB 4GFRA 3IOVA 1FQBA 4ESXA 2AL5A 1MQJA 1NH8A 2UYFA 3VXBA 1MQHA 2PBWA 4LA9A 4LONB 4IO6A 1B7ZA 4BDRA 1MPDA 3SDFA 2Z22A 2X26A 4OFLA 3KJ7A 3VLVA 4FAJA 4EXKA 4NF4B 4RNSA 3R6UA 2DXRA 1DOTA 3OSQA 2GHBA 2O7UA 2DVZA 4X9TA 2XD2A 3QUJA 1M5EA 1FQAA 1ATGA 3B6WA 1A8EA 4MFIA 5CI5A 1B2HA 2XXYA 2GRVA 4ELOA 1II5A 2VOZA 4OQOA 3PUYE 4YKKA 5I58A 3KSJA 3TELA 1S7YA 3QYTA 5H8NB 5F1QA 1MY0A 5I57A 1XVXA 1N04A 5M2VA 5ICQA 3A09A 2Y7KA 3O97A 2OWSA 3K02A 4NF5B 3T96B 2XXWA 3CFLA 2YLNA 1SW2A 2ZYNA 1O7TA 1SBPA 4YMAA 3LC8A 4OWDA 3O6IA 4R72A 3RPWA 1B40A 1Y20A 3K1MA 1ZLQA 3TCHA 1LAXA 1SYIA 2V3QA 2NOOA 4FATA 1B51A 1VSOA 1UIVA 2Q88A 2D5WA 5CMKA 2XX7A 3OOAA 1LSTA 3U1OA 4JWOA 4ZEIA 2AL4A 3MPLA 2E1SA 2I6EA 4DIGA 3FVNA 3K1NA 3IO6A 1MG1A 1DMBA 2CZLA 3MQ9A 1OLAA 5H8QB 1P1OA 4QFOA 1MQIA 2I58A 3M3KA 3VXCA 4PFWA 2BJJX 4E0XA 3ODBA 4OESA 3IL1B 1QULA 2I49A 4FEBA 3TCFA 3DP4A 4RK2A 3MVZA 4O3AA 4ZDMA 4YKPA 2RCAA 1Y1ZA 5FHOA 3Q26A 4L17A 3O66A 3TPAA 4U2RA 4WEPA 4XXUA 2RF1A 3RNNA 2Z8EA 4YKIA 2ZYKA 4LZ8A 3U92A 4DCYA 3HV1A 4JBZA 4THIA 4Z0IA 1NKXA 4M4GA 3Q28A 4PFTA 2NWJA 1MH3A 3KOTA 4OENA 4XKQA 3DM0A 5AA2B 2ALUA 2ZYMA 1IQ7A 4R9FA 5AA3A 3VLWA 4F3GA 3LSWA 3QXMA 3K00A 1MDP1 4G8MA 5AE4A 3IORA 4ZE8A 5I2NB 3CRBA 5KCJB 2ZNUA 3V5AA 4PFUA 4I9DA 3O2AA 1SVXB 1OQGA 4IO2A 5AA1A 3G3GA 3OELA 1FTJA 2WKYA 5DYHA 4OEVA 4K3FA 3ILUB 3B7DA 1R9LA 1GTKA 1I6QA 5AA4A 4PP0A 4H5FA 5I59B 4GXSB 1A7LA 2F6GA 3FV2A 5L9MA 2I4BA 2QS3A 5HM4B 2QS1A 1TWYA 2DE2A 1I6AA 2VP1A 3KEIA 2OJTA 5CBRA 1XC1A 5CMCA 3MP1A 3CG3A 2YJPA 3PUVE 3S9EA 4WEDA 3JV9A 1JVXA 5I2KA 2B65A 1ZBMA 4IY6A 4C1TA 2NXOA 1B32A 1FQCA 1AMFA 3CI8A 3CSGA 3PMXA 5FTIA 1TFAA 2D21A 1AL3A 1H44A 4KHZE 4ND9A 4F1UA 3I5OA 1VFDA 4GIZA 3PPRA 1EU8A 4Q5TA 4RYAA 5I58B 4R6YA 3E3KA 3T66A 4POXA 4MF3A 1LAHE 4LZ7A 3B6TA 3CR9A 5ITPA 4OFJA 5I57B 1PB8A 4AB6A 4EF1A 3QAXA 1QKAA 4N13A 4ELPA 2CMOA 4F19A 1VE4A 3RY3A 3EQ1A 4F2OA 1JEVA 3IOTA 5CMBA 3ILTB 3TTRA 2M8CA 4G8HA 4ZZEA 3OO6A 3IJOB 2I48A 5L9SA 3HHGA 2XXXA 2ONKE 1B4ZA 1MXYA 3TKDA 4OFOA 2XXTA 4ZS9A 3UGWA 1MM6A 1Y9UA 4F22A 4JWXA 2RCBA 1POY1 4BDLA 4H8JA 3R26A 3SESA 4ELQA 3L6HA 4HS7A 3O6HA 1PB7A 2XD3A 3WAFA 4F39A 1PB9A 1ZIUA 2UVGA 1Y3PA 3UN6A 3FVKA 5LOMA 4EUOA 5EHSA 4WKMA 3TZAA 1O64A 2QL3A 4NF6B 3TAJA 4XIGQ 2X7PA 1FQFA 1R1NA 1B05A 3EHTA 1IIWA 4GWOA 1LFHA 4R9GA 2P0SA 4G8NA 1BTJA 4GXAA 3H6UA 5TP9A 1SD3A 5ITOA 2GHAA 4OEUA 1BP5A 1Z7NE 2XXHA 2DWIA 4ONYA 3V8XB 1IZ1A 5CM6A 5K2XA 4JWYA 1M5FA 1A54A 4M1VA 4DDDA 1US4A 4GD5A 2R6GE 1MQGA 3O9PA 1B1XA 5KZTA 4X1BA 3MJNA 2DQVA 1MDQA 2I3VA 3K0VA 4QHQA 4ZZAA 4LVQA 2XXIA 1Y3QA 5KDTA 4NEDA 3SEYA 3U8QA 3CSBA 2HCAA 1GVCA 4KYEA 3MP6A 2DVCA 2HXWA 3PU5A 5JTYB 2V25A 1TXFA 2QSXA 4RJZA 1P1WA 4UACA 5JEIA 3OO8A 5DVJA 1R6ZA 1HSJA 4EF2A 4JSDA 1LB9A 4FORA 3SETA 4KQPA 4I1DA 4O3BA 4EDPA 1L5TA 1OIBA 1KWHA 3IO4A 4TQUQ 1IXIA 3DP6A 4P0GA 5CBSA 4ISUA 4ZEFA 5AA4B 2QPQA 2X7QA 2F7BA 3BFTA 4DXBA 4PFYA 4IB2A 3WAEA 1S50A 3M3LA 4LQ2A 2V84A 1LFGA 2YPNA 2VD3A 4GLIA 4DXUA 1DTZA 3EPEA 4ECFA 4YICA 1P1QA 2A5SA 2PMSA 4FEDA 4NMYA 4KPTA 2F6PA 1FTOA 3CVGA 4YMBA 4OZ9A 3W15C 1H3DA 1NL5A 1ZJLA 2HEUA 4OYVA 3RT8A 1IITA 1N3WA 4ZEBA 5FTHA 3K2DA 5H8HA 3V83A 3C32A 2HZLA 3TCGA 4U4SA 4ELRA 3TQLA 1PEBA 3DLNA 3PMWA 4RPOA 4IGTA 1URGA 4RK9A 4ZEDA 3VV5A 4NE4A 3HN0A 3VVEA 5JK4A 1B5HA 3P7IA 1UTBA 5H8SA 2ZYOA 2UVHA 3PV0E 4R6HA 3N5LA 2G93A 3KSXA 1B9JA 2Y7IA 5I56A 4H65A 3TMGA 1QJMA 3N94A 3IR1A 3SEVA 3TTLA 3JZJA 3OSRA 2REGA 4LUBA 4MH5A 1DPEA 2XXRA 1QKBA 2ANJA 4QSDA 1LFIA 4AQ4A 3MVXA 5EHMA 3A3UA 1B7HA 2DXYA 1CE2A 4GF8A 3T22A 3AXFA 4IY5A 5DTBA 1OQHA 3CFXA 4C0RA 4X48A 1YAEA 4U1OA 3FXUA 4R74A 4OETA 5IAIA 4N07A 2HZKA 1J1NA 4NF8A 2I3WA 5ELVA 1B3GA 1HSEA 2O51A 1F9BA 1FCKA 3I3VA 2RC8A 4OXVA 1M5BA 2QRYA 3C31A 2Q8JA 3UORA 3W9WA 1PDAA 1TFDA 2H9BA 1FTKA 3MUQA 1UTHA 3TODA 2KLFA 4G4PA 3Q25A 1I6BA 1JW1A 5TU0A 1MY3A 3IOUA 4FIMA 4JXIA 2F35A 1B3LA 4R73A 3MZBA 5DEXA 2E0SA 1B0LA 4GRKA 1B3HA 3D4GA 4YB5A 5TP9B 4KFQA 1EH3A 3K6XA 3K6UA 2ABHA 1B52A 4MBPA 3ZKLA 1LAGE 1JW4A 1OLCA 3TUSA 2GH9A 3V89B 5HPQA 3VDFA 3SEUA 1I69A 3N6UA 3TTKA 2ZNTA 3HPIA 4F3SA 4XKPA 3PPPA 3TDJA 1LCFA 1B58A 2VD2A 2RC7A 3FXQA 3RTWB 3IB0A 4MLQA 4RY1A 3KJTA 3DELB 3IK6B 1B46A 5KDTB 1N76A 3THIA 3R7XA 3E9XA 2DOJA 4U4XA 4F31B 3ONMA 1MH4A 5DT6A 1UQWA 4KI0E 2NUVA 4YU0A 3D4CA 3U72A 1MS7A 5TPAA 2ZNSA 3C9HA 1DTGA 5IKBA 3CG1A 1Y4TA 2AIXA 1M5CA 4QFKA 4G68A 4ZE9A 5FHNA 1XOCA 3O28A 4F1YA 1EZOA 1D4NA 3H6WA 1WVJA 2B3BA 5AA2D 2D3IA 2FNCA 5F7VA 3E13X 1ZMGA 1MRPA 4NWDA 2Y7PA 1SW4A 3C4MA 4LATA 5CC2A 2Q9TA 4BDMA 3FUZA 3HO7A 2DE4A 2THIA 1POTA 4EQBA 3S9MC 4IO5A 4XTCQ 3G3FA 1NMUA 1QUJA 1GGGA 4Q30B 3TFLA 1B3FA 2DWAA 3SERA 1SW1A 1JETA 3K6VA 3MVYA 1BIYA 5H8HB 2I4CA 3OENA 4YZZA 5ICTA 3USDA 2HAUA 1QW0A 1FQDA 4JDFA 1URSA 2DS9A 3U94A 1BLFA 1P1UA 3H03A 1UTBB 3OXNA 3S2VA 4OMBA 2HFBA 3S4UA 1A40A 2F78A 1N0TA 3Q29A 3GLBA 2PT1A 1FW0A 4BDNA 4LP2B 3ZSFA 1B5IA 5I56B 1IEJA 3TTMA 2I0BA 3FJGA 1S9TA 2H98A 5J1DA 1JW5A 3FIRA 4XKRA 2O1LA 4R6KA 5H8FA 4AB5A 2O6AA 1B6HA 3UK4A 2GFEA 3QK6A 2F7AA 2F8DA 2R71A 1LBCA 5CMMA 5HBCA 1YCJA 2H99A 3SKPA 1MY1A 4OHNA 2IEEA 3TYHA 4PE5B 3M8UA 1US5A 3UA8A 4XKNA 1OMPA 1USYE 2ONSA 2Z23A 4Z7EA 2OCUA 1WDNA 4YKJA 2O7IA 3IX1A 5KCJA 1UTHB 3RUMA 1MXWA 1MPBA 1NH7A 3LBSA 3FJMA 2P1SA 4F3PA 1A99A 3TQWA 5DEXB 5CRYA 4QF9A 1SI0A 3FD3A 1JEUA 2Q2AA 4FJPA 4H8IA 1OVBA 1OVTA 3ECRA 3LSLA 4HTGA 2IA4A 1JNFA 3HSTA 1ELJA 2H5YA 2VGQA 5FHMA 3OEKA 2O1MA 1YPNA 1Y3NA 1Q1KA 4GVOA 3OEMA 3IJXB 1AH5A 4G77A 3H06B 4EQ7A 3SEWA 4OTEA 4H5GA 2R9JA 4U21A 4U23A 1JVYA 2I0CA 3IOWA 2UVJA 2O68A 4U1ZA 1LAFE 4KCDA 2XXPA 1NNKA
chains in the Genus database with same CATH superfamily
3RT6B 3N26A 4OVTA 2RC9A 3G3HA 4G68C 1QVSA 3K6WA 3EKIA 3KFMA 4OERA 1RKMA 1SDXA 1YYZA 2B3FA 5TPAB 4BDQA 2F5XA 4NQ8A 4YB6A 4DE8A 3DP8A 3K01A 1DK4A 3EN3A 5IZZA 3KG2A 1IMCA 3BKIB 1NV0A 4ESWA 4KYSA 5I2KB 4DXCA 2XXQA 3C34A 2OK2A 4G68B 3H7MA 5K2YA 2QMWA 2RINA 3TTNA 5BWJA 4ZECA 3CFZA 1IUDA 1GR2A 1FPGA 3ZKKA 3BBRA 2A5TA 4JB7A 4GQOA 1NNTA 5BUUA 3KN8A 2DP8A 3PPQA 4UA8A 4QFNA 4MIJA 2FYIA 4I62A 2DSFA 2DE3A 3M3FA 2ZMBA 3QUFA 2Q89A 1FPFA 1LBYA 2XX8A 1SI1A 1A8FA 3BIHA 2ZZWA 3PMVA 1PC3A 1ZU0A 5DW8A 3GBBA 2HXRA 1P1NA 2ZZVA 3KBZA 3RYDA 4DI4B 1XS5A 4H0WA 1AIVA 1IXHA 4KYDA 4BLAA 2QS4A 1XHYA 5DVIA 3FATA 3F11A 3PUWE 4RPNA 3FV1A 1SW5A 1B3EA 1D9VA 1MY2A 4LZ5A 2FIXA 1RYXA 1DCUA 3MW0A 3ZS6A 3H3GA 4QSEA 2ONRA 4JSOA 4PAIA 2H25A 3G3JA 3VLUA 1BKAA 2P2AA 3PGFA 1Q35A 1O63A 1H76A 3HCQA 2QS2A 1XT8A 1IXGA 3PUZE 1D9YA 4GWWA 4RA1A 3VFJA 4WXJA 1VR5A 4O94A 4NF6A 3H6TA 2B4LA 3E79A 1T0KA 3C33A 4C1UA 1B5JA 1XI6A 3E4RA 1MY4A 2W7YA 1R9QA 2CZIA 5H8FB 3TEPA 2XA5A 2O84X 3RQTA 4Q8RA 1RYOA 1N84A 2NVUB 3FXRA 1EZPA 4R75A 2Y84A 4FE8A 1FPDA 1MXZA 4IO4A 4DZ1A 1TT1A 1GV8A 1QUIA 2XXVA 3UP9A 1N3XA 1M5DA 2V4CA 2VHAA 1NNFA 4EQ9A 5B70A 4IO7A 3IB2A 3OO7A 5EQ8A 3K4UA 2V3UA 4KD5A 1XVYA 2OWTA 4GWXA 1UIUA 4HCYA 4R2BA 3KC1A 3MP8A 5A5XA 2F3DA 5IM2A 4P47A 2FA7A 4P56A 2FBPA 4GL8A 4POWA 1FSAA 4PC9A 3G3KA 4QRZA 4QSCA 5EQ9A 5JTYA 3MBPA 4HE2A 4IGRA 1MXXA 4NF4A 2Z8FA 3GXAA 4H67A 4NTLA 1LGBC 4X1DA 3LUZA 4YAHX 1P99A 4N4UA 2RKMA 3H4ZA 3PPOA 4FECA 3T9VA 4HE1A 5L9OA 1MPCA 4N6PA 3G3IA 4TOZA 1URDA 1B1HA 5J16A 4MLVA 3FVOA 1NNPA 1K9YA 1VFEA 3CIJA 3U93A 1LBBA 4F2QA 4OVJA 3MWBA 4GOTA 4HCWA 4QFPA 2F34A 2F7CA 4KXPA 2QMXA 3LSXA 3MPKA 4F29A 1USYH 3QSLA 2XXUA 4P11A 4IO3A 3N6TA 4H6DA 3SZPA 4P0IA 1G0HA 3OO9A 2F97A 2DYXA 4DLDA 1FQEA 3EHUA 2FIEA 3G7WA 4GL0A 3IFCA 5LDZA 3Q27A 5H8NA 2ZXTA 1G0IA 1PBQA 4N17A 2XX9A 4X8RA 5DVFA 4NF5A 3FJ7A 3LUYA 3O6GA 3A3CA 1Y1MA 3IAZA 2AYSA 4N8YA 1DPPA 4TLMB 1FJ9A 1NUXA 3PD9A 2HQ0A 2WYPA 2Q2CA 1LB8A 4AS5A 1B0HA 4NWCA 3KOSA 2DWHA 4G2ZA 3GZGA 2XHDA 2PYYA 1EZ9A 2B4MA 2PX1A 1FTLA 5EYFA 3T93B 2PFYA 1SYHA 3BFUA 3VVFA 4LQ5A 5EQ7A 1MQDA 3O29A 2QVRA 1NFTA 3RGYA 4OVRA 2PCRA 3LV0A 5I84A 2A5TB 1SQYA 3MVWA 4BDOA 2OZZA 2REJA 4UABA 4EXLA 2HAVA 4PAFA 1MM7A 3KN3A 3KGCA 4ZEKA 1LBVA 1ZTYA 3EF7A 5H8QA 1AOVA 1HSLA 1A55A 3IB1A 1Z7ME 3MYUA 1FTMA 2PVUA 1MXUA 3LR1A 2OBGA 3SEXA 4O8MA 1N7XA 3PUXE 3S9NC 5ISUA 1B4HA 4PQJA 3VE1B 4TLLB 4R2FA 1MXVA 3C36A 4RXLA 4YB7A 2QJEA 4F1VA 2UVIA 3GBAA 3VVDA 3S9LC 3KN7A 5L8DA 3C35A 3MZ1A 4KR5A 3PD8A 2ZZXA 1JQFA 3OMBA 2Z8DA 1LLSA 2UXAA 3T9XB 1RDYA 2G29A 4O7IA 3KZGA 3RTFB 4OVSA 2V3TA 1CB6A 3T9UA 3UIFA 5ET6A 3I6VA 3FASA 1N7WA 2OLBA 4NF8B 1YTVA 4DCXA 2Y7WA 1LCTA 2Y7RA 4AS4A 1QUKA 2H4IA 3H6VA 1D3KA 5AA2A 3RLFE 2LAOA 2V93A 3EHSA 1PBPA 3T9HB 1WODA 2F36A 4O3CA 5I3SA 3FZVA 3PPNA 4NAPA 1DSNA 2O69A 3L6GA 1H43A 5I2NA 1ANFA 2ESNA 4F3BA 4Q0CA 3KBRA 3FGSA 1KZ8A 3K1PA 3B6QA 3MZ9A 3GYYA 3QIMA 4F18A 1H45A 5B7DA 3OD7A 3W9VA 4QFLA 2PT2A 3MC2A 3FVGA 3HHFA 4H1XA 4PETA 3JYRA 1ZKBA 3LSFB 4XF5A 3RN8A 2XXKA 4HW8A 2UYEA 4I8CA 1Y4CA 4E0WA 5I59A 3MAMA 1FRPA 2XWKA 2DWJA 1IXCA 1B7UA 4U22A 1NUWA 4KCCA 5A5XB 4GFRA 3IOVA 1FQBA 1MQJA 2AL5A 2UYFA 1NH8A 4ESXA 2FVZA 3VXBA 1MQHA 2PBWA 4LA9A 4LONB 4IO6A 1B7ZA 3T0JA 4BDRA 1MPDA 3SDFA 2Z22A 2X26A 4OFLA 3KJ7A 1QGXA 3VLVA 4NN3A 2CEYA 4FAJA 4EXKA 4NF4B 4RNSA 3R6UA 2DXRA 4XFEA 1DOTA 4MHFA 3OSQA 2GHBA 2O7UA 2DVZA 2P3VA 4P9KA 4X9TA 1LBXA 2XD2A 3QUJA 1M5EA 1FQAA 1ATGA 3B6WA 1A8EA 4MFIA 5CI5A 1B2HA 2XXYA 2GRVA 4ELOA 1II5A 2VOZA 4OQOA 3PUYE 4YKKA 4GX4A 5I58A 3KSJA 4GX3A 3TELA 1S7YA 3QYTA 4GWZA 5H8NB 5F1QA 1MY0A 5I57A 1XVXA 4MNIA 1N04A 5M2VA 4XEQA 3A09A 5ICQA 2Y7KA 3O97A 2OWSA 3K02A 4NF5B 3T96B 2XXWA 3CFLA 2YLNA 1SW2A 2ZYNA 1O7TA 1SBPA 4YMAA 3LC8A 4GBVA 4G61A 4OWDA 3O6IA 4R72A 3RPWA 1B40A 1Y20A 3K1MA 1ZLQA 3TCHA 1D9QA 1LAXA 1KA0A 1SYIA 2V3QA 2NOOA 4FATA 1B51A 1VSOA 1UIVA 2Q88A 2D5WA 2GQ1A 5CMKA 2XX7A 3OOAA 1LSTA 3U1OA 4JWOA 2Y5LA 4ZEIA 2AL4A 3MPLA 1EYKA 2E1SA 4I40A 2I6EA 4DIGA 3FVNA 3FBPA 3K1NA 3IO6A 1NV4A 1MG1A 1DMBA 2CZLA 3MQ9A 1OLAA 5H8QB 1P1OA 4QFOA 1MQIA 2I58A 3M3KA 3VXCA 4PFWA 2BJJX 4E0XA 3ODBA 3PTYA 3RPLA 4OESA 3IL1B 1QULA 2I49A 4FEBA 3TCFA 1FPIA 4P1LA 3DP4A 4RK2A 4JVCA 3MVZA 4MNPA 4O3AA 4ZDMA 1SPIA 2VT5A 4YKPA 2RCAA 1NV1A 1Y1ZA 5FHOA 3Q26A 5T3JA 4L17A 3O66A 3TPAA 4U2RA 4WEPA 4XXUA 2RF1A 3RNNA 2Z8EA 2VPOA 4PBQA 4YKIA 2ZYKA 4LZ8A 4PGPA 3U92A 4DCYA 3HV1A 4JBZA 4THIA 4Z0IA 1NKXA 4M4GA 3Q28A 4PFTA 2NWJA 1MH3A 3KOTA 4OENA 4XKQA 3DM0A 5AA2B 1FBCA 2ALUA 2ZYMA 1IQ7A 4R9FA 5AA3A 3VLWA 4F3GA 3LSWA 3QXMA 3K00A 1MDP1 4G8MA 4N81A 5AE4A 2XWIA 3IORA 4ZE8A 5I2NB 3CRBA 5KCJB 2ZNUA 4MNCA 3V5AA 4PFUA 4I9DA 3O2AA 1SVXB 1LBZA 1OQGA 4IO2A 5AA1A 4N6KA 3G3GA 3OELA 1FTJA 2WKYA 5DYHA 4OEVA 4K3FA 3ILUB 3B7DA 1R9LA 2XWVA 1GTKA 1I6QA 5AA4A 4PP0A 4H5FA 1FBEA 5IZ3B 5I59B 4GXSB 4H45A 2CEXA 1A7LA 1NI9A 2F6GA 3FV2A 5L9MA 2I4BA 2QS3A 3IFAA 5HM4B 2QS1A 2F3BA 1TWYA 2DE2A 3B50A 1I6AA 2VP1A 3KEIA 2OJTA 5CBRA 2CZKA 1INPA 1XC1A 5CMCA 3MP1A 3CG3A 2YJPA 3PUVE 3S9EA 4WEDA 3JV9A 1JVXA 5I2KA 2B65A 1ZBMA 4IY6A 4C1TA 2NXOA 1B32A 1FQCA 4QBAA 4JVIA 1AMFA 4PDHA 3CI8A 3CSGA 3PMXA 5FTIA 1TFAA 5IGAA 2D21A 1AL3A 1H44A 4KHZE 4ND9A 4F1UA 3I5OA 1VFDA 4GIZA 3PPRA 1EU8A 4Q5TA 4RYAA 3ROJA 5I58B 4R6YA 3E3KA 3T66A 4POXA 4MF3A 1LAHE 4LZ7A 3B6TA 3CR9A 5ITPA 4OFJA 5I57B 1PB8A 4AB6A 2WX9A 4EF1A 4HXVA 3QAXA 4N8GA 1QKAA 4FBPA 4N13A 4ELPA 2CMOA 4F19A 1VE4A 3RY3A 3EQ1A 4F2OA 4NX1A 1JEVA 3IOTA 5CMBA 3ILTB 3A29A 4NF0A 2P3NA 3TTRA 2M8CA 4G8HA 1FPJA 4ZZEA 3OO6A 3IJOB 2I48A 5L9SA 3HHGA 2XXXA 2ONKE 1B4ZA 1MXYA 3TKDA 4OFOA 2XXTA 4ZS9A 3UGWA 1MM6A 1Y9UA 4F22A 4JWXA 2RCBA 4PF8A 1POY1 4BDLA 4H8JA 5A5LA 3R26A 3SESA 4ELQA 3L6HA 4HS7A 3T1BA 3O6HA 1PB7A 1DBZA 2XD3A 3WAFA 4F39A 4P1EA 1PB9A 1ZIUA 4PAKA 1NV5A 2UVGA 1Y3PA 3UN6A 5I5PA 3FVKA 5LOMA 4EUOA 5EHSA 4WKMA 3RPLB 3TZAA 1O64A 2QL3A 4NF6B 3TAJA 4XIGQ 2X7PA 1FQFA 1R1NA 1B05A 3EHTA 1IIWA 1AWBA 4GWOA 4MMPA 1LFHA 1NV7A 4R9GA 2P0SA 4G8NA 4PBHA 1BTJA 4GXAA 2QVUA 3H6UA 5TP9A 1SD3A 5ITOA 2GHAA 4OEUA 1BP5A 1RDZA 1Z7NE 2XXHA 4NHBA 2DWIA 4ONYA 3V8XB 1IMFA 4IR8A 1IZ1A 5CM6A 5ET7A 5K2XA 4JWYA 4P8BA 1M5FA 1A54A 4M1VA 4DDDA 1US4A 4GD5A 2R6GE 1MQGA 1EYJA 3O9PA 1B1XA 5KZTA 4X1BA 3MJNA 1K9ZA 2DQVA 1MDQA 2I3VA 4MAGA 3K0VA 4QHQA 4ZZAA 4LVQA 2XXIA 1Y3QA 5KDTA 4NEDA 3SEYA 3U8QA 3CSBA 2HCAA 1GVCA 4KYEA 3MP6A 2DVCA 2HXWA 3PU5A 5JTYB 2V25A 1TXFA 2QSXA 4RJZA 1P1WA 4UACA 5JEIA 3OO8A 5DVJA 1R6ZA 4PE3A 1HSJA 4EF2A 4JSDA 1LB9A 4GBWA 4FORA 3SETA 4KQPA 4I1DA 4O3BA 4EDPA 1L5TA 1OIBA 1KWHA 3IO4A 4TQUQ 1IXIA 3BIGA 3DP6A 4P0GA 5CBSA 4ISUA 4H46A 4ZEFA 5AA4B 2QPQA 2Q74A 2X7QA 2XWOA 2F7BA 3BFTA 4DXBA 4PFYA 4IB2A 3WAEA 1S50A 3M3LA 4LQ2A 2V84A 5IZ1A 1LFGA 2YPNA 2VD3A 1FBFA 4GLIA 4DXUA 1DTZA 3EPEA 4OVQA 4ECFA 4YICA 4PFRA 1P1QA 4PTKA 2A5SA 2PMSA 4FEDA 4NMYA 4KPTA 2F6PA 1FTOA 3CVGA 4YMBA 4OZ9A 3W15C 1H3DA 1NL5A 1ZJLA 2HEUA 5EYGA 4OYVA 3RT8A 1IITA 1N3WA 4ZEBA 5FTHA 3K2DA 5H8HA 3V83A 3C32A 2HZLA 3TCGA 4U4SA 4ELRA 3TQLA 1PEBA 3DLNA 1FTAA 3PMWA 4RPOA 4GWYA 4IGTA 1URGA 4RK9A 4ZEDA 3VV5A 4NE4A 3HN0A 3VVEA 5JK4A 1CNQA 2HHMA 4N6DA 1B5HA 3P7IA 1UTBA 5H8SA 2ZYOA 2UVHA 3PV0E 4R6HA 3HFUA 3N5LA 2G93A 3KSXA 1B9JA 2Y7IA 5I56A 4H65A 3TMGA 1QJMA 3N94A 5I7IA 4PDDA 3IR1A 2Y5KA 3SEVA 2JJKA 3TTLA 1FPLA 3JZJA 3OSRA 2REGA 4OANA 4LUBA 4MH5A 1DPEA 1EYIA 2XXRA 1QKBA 2ANJA 4QSDA 1LFIA 1YXIA 4AQ4A 3MVXA 5EHMA 3A3UA 2OX3A 1B7HA 2DXYA 1CE2A 4GF8A 3T22A 3AXFA 4IY5A 4PF6A 5DTBA 1OQHA 3CFXA 2KQZA 4C0RA 4X48A 1YAEA 4U1OA 3FXUA 4R74A 4OETA 5IAIA 4MCOA 4N07A 2HZKA 1J1NA 4NF8A 2I3WA 4GX6A 1NUYA 1JP4A 5ELVA 1B3GA 1HSEA 1IMDA 2O51A 1F9BA 1FCKA 3I3VA 3KC0A 2RC8A 4OXVA 1M5BA 2QRYA 3C31A 2Q8JA 3UORA 3W9WA 1PDAA 1TFDA 2H9BA 1FTKA 3MUQA 1UTHA 3TODA 4LN5A 2KLFA 4G4PA 3Q25A 1I6BA 1JW1A 5TU0A 1MY3A 1FBHA 3D1RA 2BJIA 1FJ6A 3IOUA 4FIMA 4JXIA 2F35A 1B3LA 4R73A 3MZBA 5DEXA 2E0SA 1B0LA 4GRKA 1B3HA 3D4GA 4YB5A 5TP9B 4KFQA 4I3EA 1EH3A 3K6XA 3K6UA 2ABHA 1B52A 4MBPA 3ZKLA 1LAGE 1JW4A 1OLCA 3TUSA 2GH9A 3FXBA 3V89B 5HPQA 3VDFA 3SEUA 1YZ0A 1RDXA 1I69A 1IMBA 3N6UA 4DI3D 4NGUA 3TTKA 2CZHA 2ZNTA 3HPIA 4F3SA 2OWZA 4XKPA 3PPPA 3TDJA 1LCFA 4P3LA 1B58A 2VD2A 2RC7A 3FXQA 3RTWB 3IB0A 4MLQA 4RY1A 3KJTA 3DELB 3IK6B 1B46A 5KDTB 5ET5A 1N76A 3THIA 3R7XA 3MSTA 3E9XA 2DOJA 2WBDA 4U4XA 4F31B 3ONMA 1MH4A 5DT6A 1UQWA 4KI0E 4N15A 2NUVA 4MEVA 4YU0A 3D4CA 3U72A 1Q9DA 1MS7A 5TPAA 2ZNSA 3C9HA 1DTGA 5IKBA 2WBBA 3CG1A 4MJOA 1Y4TA 2AIXA 3ISPA 1M5CA 4QFKA 4G68A 4ZE9A 5FHNA 1XOCA 3O28A 2Q8MA 4F1YA 4HE0A 1EZOA 1D4NA 3H6WA 1WVJA 2B3BA 5AA2D 2D3IA 2WYKA 2FNCA 1FPBA 5F7VA 3E13X 1ZMGA 1MRPA 4NWDA 2Y7PA 1SW4A 3C4MA 4LATA 5CC2A 5FBPA 1NV2A 2Q9TA 2WEFA 4BDMA 4GWSA 3FUZA 3HO7A 2DE4A 2THIA 1POTA 4EQBA 3S9MC 4IO5A 4XTCQ 1VDWA 3G3FA 1NMUA 1QUJA 1GGGA 4Q30B 3TFLA 1B3FA 2DWAA 4NG7A 3SERA 2VPNA 1SW1A 1JETA 3K6VA 3MVYA 1BIYA 5H8HB 2I4CA 3OENA 4YZZA 2KR0A 5EQAA 5ICTA 1FBDA 3USDA 2QVVA 2HAUA 3CHGA 1QW0A 1FQDA 4JDFA 2R8TA 1URSA 2DS9A 3U94A 1BLFA 1P1UA 3H03A 4OVPA 1UTBB 3OXNA 4JVDA 3S2VA 4OMBA 2HFBA 3S4UA 1A40A 2F78A 1N0TA 3Q29A 3GLBA 2PT1A 1FW0A 5F24A 4LP2B 3ZSFA 1B5IA 4BDNA 5I56B 1IEJA 3TTMA 2I0BA 5ET8A 3FJGA 1S9TA 5EYHA 2H98A 5J1DA 1LEVA 1JW5A 4OA4A 3FIRA 4XKRA 2QFLA 2O1LA 4R6KA 1FPEA 5H8FA 4AB5A 2O6AA 1B6HA 3UK4A 2GFEA 3QK6A 4QXDA 2F7AA 2F8DA 1NV6A 2R71A 1LBCA 5CMMA 5HBCA 5LTCA 1YCJA 2H99A 3SKPA 1MY1A 4X04A 4OHNA 2IEEA 3TYHA 4PE5B 3M8UA 4N91A 1LBWA 1US5A 3UA8A 4XKNA 1OMPA 1USYE 2ONSA 4MX6A 2Z23A 1FPKA 1FBGA 4Z7EA 2OCUA 1WDNA 4YKJA 3U65A 2O7IA 1NV3A 3NOHA 2MKZA 3IX1A 5KCJA 1UTHB 3RUMA 2HPGA 1MXWA 1MPBA 1BK4A 1NH7A 3LBSA 1NUZA 3FJMA 2P1SA 4O7MA 3E78A 4F3PA 4PGNA 1A99A 3QMFA 3TQWA 5DEXB 5CRYA 4QF9A 1SI0A 3FD3A 1JEUA 2Q2AA 4FJPA 4H8IA 1OVBA 1OVTA 5IZ3A 5ESYA 3ECRA 1FBPA 3LSLA 4HTGA 2IA4A 1JNFA 3HSTA 1ELJA 4PCDA 2H5YA 2VGQA 5FHMA 2PFZA 3OEKA 1IMAA 2O1MA 1YPNA 1Y3NA 1KA1A 3B8BA 1Q1KA 4GVOA 4GWUA 3OEMA 3IJXB 1AH5A 2L5VA 4G77A 3H06B 4EQ7A 2FHYA 3SEWA 1IMEA 4OTEA 4H5GA 2R9JA 4U21A 4PFIA 4I3YA 4U23A 1JVYA 2DDKA 4PFBA 2I0CA 3IOWA 2UVJA 4U1ZA 2O68A 1LAFE 4KCDA 2XXPA 1NNKA
chains in the Genus database with same CATH topology
3RT6B 3N26A 2RC9A 3G3HA 4G68C 1QVSA 3K6WA 3KFMA 4OERA 1RKMA 1SDXA 2B3FA 5TPAB 4BDQA 2F5XA 4YB6A 4DE8A 3DP8A 3K01A 3EN3A 3KG2A 3BKIB 4ESWA 4KYSA 5I2KB 4DXCA 2XXQA 3C34A 2OK2A 4G68B 3H7MA 5K2YA 2QMWA 2RINA 3TTNA 5BWJA 4ZECA 3CFZA 1IUDA 1GR2A 3ZKKA 3BBRA 2A5TA 4JB7A 4GQOA 1NNTA 5BUUA 3KN8A 2DP8A 3PPQA 4UA8A 4QFNA 2FYIA 4I62A 2DSFA 2DE3A 3M3FA 2ZMBA 3QUFA 2Q89A 2XX8A 1SI1A 1A8FA 3PMVA 1PC3A 1ZU0A 3GBBA 1P1NA 1XS5A 4H0WA 1AIVA 1IXHA 4KYDA 4BLAA 2QS4A 1XHYA 5DVIA 3FATA 3F11A 3PUWE 4RPNA 3FV1A 1SW5A 1B3EA 1D9VA 1MY2A 4LZ5A 3MW0A 1RYXA 3ZS6A 3H3GA 4QSEA 2ONRA 4JSOA 2H25A 3G3JA 3VLUA 1BKAA 2P2AA 3PGFA 1Q35A 1O63A 1H76A 3HCQA 2QS2A 1XT8A 1IXGA 3PUZE 1D9YA 4RA1A 3VFJA 4WXJA 1VR5A 4NF6A 3H6TA 1T0KA 3C33A 4C1UA 1B5JA 3E4RA 1MY4A 2W7YA 1R9QA 5H8FB 3TEPA 2O84X 3RQTA 4Q8RA 1RYOA 1N84A 2NVUB 3FXRA 1EZPA 4R75A 2Y84A 4FE8A 1MXZA 4IO4A 4DZ1A 1TT1A 1GV8A 1QUIA 2XXVA 3UP9A 1N3XA 1M5DA 2VHAA 1NNFA 4EQ9A 5B70A 4IO7A 3IB2A 3OO7A 3K4UA 2V3UA 4KD5A 1XVYA 2OWTA 1UIUA 4HCYA 4R2BA 3MP8A 5A5XA 2FA7A 4GL8A 4POWA 3G3KA 4QRZA 4QSCA 5JTYA 3MBPA 4IGRA 1MXXA 4NF4A 2Z8FA 3GXAA 4H67A 4NTLA 1LGBC 4X1DA 4YAHX 1P99A 2RKMA 3H4ZA 3PPOA 4FECA 3T9VA 5L9OA 1MPCA 4N6PA 3G3IA 4TOZA 1URDA 1B1HA 4MLVA 3FVOA 1NNPA 1VFEA 3CIJA 3U93A 1LBBA 4F2QA 4OVJA 3MWBA 4GOTA 4HCWA 4QFPA 2F34A 2F7CA 2QMXA 3LSXA 3MPKA 4F29A 1USYH 3QSLA 2XXUA 4P11A 4IO3A 3N6TA 4H6DA 4P0IA 3OO9A 2F97A 2DYXA 4DLDA 1FQEA 3EHUA 3G7WA 4GL0A 3Q27A 5H8NA 2ZXTA 1PBQA 2XX9A 5DVFA 4NF5A 3FJ7A 3LUYA 3O6GA 3A3CA 1Y1MA 3IAZA 2AYSA 1DPPA 4TLMB 3PD9A 2HQ0A 2Q2CA 1LB8A 1B0HA 4NWCA 3KOSA 2DWHA 4G2ZA 3GZGA 2XHDA 2PYYA 1EZ9A 2PX1A 1FTLA 5EYFA 3T93B 1SYHA 3BFUA 3VVFA 4LQ5A 1MQDA 3O29A 1NFTA 3RGYA 5I84A 2A5TB 1SQYA 3MVWA 4BDOA 2OZZA 2REJA 4EXLA 2HAVA 1MM7A 3KN3A 3KGCA 4ZEKA 1ZTYA 3EF7A 5H8QA 1AOVA 1HSLA 1A55A 3IB1A 1Z7ME 1FTMA 2PVUA 1MXUA 3LR1A 2OBGA 3SEXA 1N7XA 3PUXE 3S9NC 5ISUA 1B4HA 4PQJA 3VE1B 4TLLB 4R2FA 1MXVA 3C36A 4RXLA 4YB7A 2QJEA 4F1VA 2UVIA 3GBAA 3VVDA 3S9LC 3KN7A 5L8DA 3C35A 3MZ1A 4KR5A 3PD8A 1JQFA 3OMBA 2Z8DA 1LLSA 2UXAA 3T9XB 2G29A 3KZGA 3RTFB 2V3TA 1CB6A 3T9UA 3UIFA 3I6VA 3FASA 1N7WA 2OLBA 4NF8B 1YTVA 4DCXA 2Y7WA 1LCTA 2Y7RA 1QUKA 2H4IA 3H6VA 1D3KA 5AA2A 3RLFE 3T9HB 2LAOA 2V93A 1PBPA 3EHSA 1WODA 2F36A 4O3CA 3FZVA 3PPNA 1DSNA 2O69A 3L6GA 1H43A 5I2NA 1ANFA 2ESNA 4F3BA 4Q0CA 3KBRA 3FGSA 3K1PA 3B6QA 3MZ9A 3QIMA 4F18A 1H45A 5B7DA 3OD7A 3W9VA 4QFLA 2PT2A 3MC2A 3FVGA 3HHFA 4H1XA 4PETA 3JYRA 1ZKBA 3LSFB 3RN8A 4HW8A 2UYEA 4I8CA 1Y4CA 4E0WA 5I59A 3MAMA 2DWJA 1IXCA 1B7UA 4U22A 4KCCA 5A5XB 4GFRA 3IOVA 1FQBA 4ESXA 2AL5A 1MQJA 1NH8A 2UYFA 3VXBA 1MQHA 2PBWA 4LA9A 4LONB 4IO6A 1B7ZA 4BDRA 1MPDA 3SDFA 2Z22A 2X26A 4OFLA 3KJ7A 3VLVA 4FAJA 4EXKA 4NF4B 4RNSA 3R6UA 2DXRA 1DOTA 3OSQA 2GHBA 2O7UA 2DVZA 4X9TA 2XD2A 3QUJA 1M5EA 1FQAA 1ATGA 3B6WA 1A8EA 4MFIA 5CI5A 1B2HA 2XXYA 2GRVA 4ELOA 1II5A 2VOZA 4OQOA 3PUYE 4YKKA 5I58A 3KSJA 3TELA 1S7YA 3QYTA 5H8NB 5F1QA 1MY0A 5I57A 1XVXA 1N04A 5M2VA 5ICQA 3A09A 2Y7KA 3O97A 2OWSA 3K02A 4NF5B 3T96B 2XXWA 3CFLA 2YLNA 1SW2A 2ZYNA 1O7TA 1SBPA 4YMAA 3LC8A 4OWDA 3O6IA 4R72A 3RPWA 1B40A 1Y20A 3K1MA 1ZLQA 3TCHA 1LAXA 1SYIA 2V3QA 2NOOA 4FATA 1B51A 1VSOA 1UIVA 2Q88A 2D5WA 5CMKA 2XX7A 3OOAA 1LSTA 3U1OA 4JWOA 4ZEIA 2AL4A 3MPLA 2E1SA 2I6EA 4DIGA 3FVNA 3K1NA 3IO6A 1MG1A 1DMBA 2CZLA 3MQ9A 1OLAA 5H8QB 1P1OA 4QFOA 1MQIA 2I58A 3M3KA 3VXCA 4PFWA 2BJJX 4E0XA 3ODBA 4OESA 3IL1B 1QULA 2I49A 4FEBA 3TCFA 3DP4A 4RK2A 3MVZA 4O3AA 4ZDMA 4YKPA 2RCAA 1Y1ZA 5FHOA 3Q26A 4L17A 3O66A 3TPAA 4U2RA 4WEPA 4XXUA 2RF1A 3RNNA 2Z8EA 4YKIA 2ZYKA 4LZ8A 3U92A 4DCYA 3HV1A 4JBZA 4THIA 4Z0IA 1NKXA 4M4GA 3Q28A 4PFTA 2NWJA 1MH3A 3KOTA 4OENA 4XKQA 3DM0A 5AA2B 2ALUA 2ZYMA 1IQ7A 4R9FA 5AA3A 3VLWA 4F3GA 3LSWA 3QXMA 3K00A 1MDP1 4G8MA 5AE4A 3IORA 4ZE8A 5I2NB 3CRBA 5KCJB 2ZNUA 3V5AA 4PFUA 4I9DA 3O2AA 1SVXB 1OQGA 4IO2A 5AA1A 3G3GA 3OELA 1FTJA 2WKYA 5DYHA 4OEVA 4K3FA 3ILUB 3B7DA 1R9LA 1GTKA 1I6QA 5AA4A 4PP0A 4H5FA 5I59B 4GXSB 1A7LA 2F6GA 3FV2A 5L9MA 2I4BA 2QS3A 5HM4B 2QS1A 1TWYA 2DE2A 1I6AA 2VP1A 3KEIA 2OJTA 5CBRA 1XC1A 5CMCA 3MP1A 3CG3A 2YJPA 3PUVE 3S9EA 4WEDA 3JV9A 1JVXA 5I2KA 2B65A 1ZBMA 4IY6A 4C1TA 2NXOA 1B32A 1FQCA 1AMFA 3CI8A 3CSGA 3PMXA 5FTIA 1TFAA 2D21A 1AL3A 1H44A 4KHZE 4ND9A 4F1UA 3I5OA 1VFDA 4GIZA 3PPRA 1EU8A 4Q5TA 4RYAA 5I58B 4R6YA 3E3KA 3T66A 4POXA 4MF3A 1LAHE 4LZ7A 3B6TA 3CR9A 5ITPA 4OFJA 5I57B 1PB8A 4AB6A 4EF1A 3QAXA 1QKAA 4N13A 4ELPA 2CMOA 4F19A 1VE4A 3RY3A 3EQ1A 4F2OA 1JEVA 3IOTA 5CMBA 3ILTB 3TTRA 2M8CA 4G8HA 4ZZEA 3OO6A 3IJOB 2I48A 5L9SA 3HHGA 2XXXA 2ONKE 1B4ZA 1MXYA 3TKDA 4OFOA 2XXTA 4ZS9A 3UGWA 1MM6A 1Y9UA 4F22A 4JWXA 2RCBA 1POY1 4BDLA 4H8JA 3R26A 3SESA 4ELQA 3L6HA 4HS7A 3O6HA 1PB7A 2XD3A 3WAFA 4F39A 1PB9A 1ZIUA 2UVGA 1Y3PA 3UN6A 3FVKA 5LOMA 4EUOA 5EHSA 4WKMA 3TZAA 1O64A 2QL3A 4NF6B 3TAJA 4XIGQ 2X7PA 1FQFA 1R1NA 1B05A 3EHTA 1IIWA 4GWOA 1LFHA 4R9GA 2P0SA 4G8NA 1BTJA 4GXAA 3H6UA 5TP9A 1SD3A 5ITOA 2GHAA 4OEUA 1BP5A 1Z7NE 2XXHA 2DWIA 4ONYA 3V8XB 1IZ1A 5CM6A 5K2XA 4JWYA 1M5FA 1A54A 4M1VA 4DDDA 1US4A 4GD5A 2R6GE 1MQGA 3O9PA 1B1XA 5KZTA 4X1BA 3MJNA 2DQVA 1MDQA 2I3VA 3K0VA 4QHQA 4ZZAA 4LVQA 2XXIA 1Y3QA 5KDTA 4NEDA 3SEYA 3U8QA 3CSBA 2HCAA 1GVCA 4KYEA 3MP6A 2DVCA 2HXWA 3PU5A 5JTYB 2V25A 1TXFA 2QSXA 4RJZA 1P1WA 4UACA 5JEIA 3OO8A 5DVJA 1R6ZA 1HSJA 4EF2A 4JSDA 1LB9A 4FORA 3SETA 4KQPA 4I1DA 4O3BA 4EDPA 1L5TA 1OIBA 1KWHA 3IO4A 4TQUQ 1IXIA 3DP6A 4P0GA 5CBSA 4ISUA 4ZEFA 5AA4B 2QPQA 2X7QA 2F7BA 3BFTA 4DXBA 4PFYA 4IB2A 3WAEA 1S50A 3M3LA 4LQ2A 2V84A 1LFGA 2YPNA 2VD3A 4GLIA 4DXUA 1DTZA 3EPEA 4ECFA 4YICA 1P1QA 2A5SA 2PMSA 4FEDA 4NMYA 4KPTA 2F6PA 1FTOA 3CVGA 4YMBA 4OZ9A 3W15C 1H3DA 1NL5A 1ZJLA 2HEUA 4OYVA 3RT8A 1IITA 1N3WA 4ZEBA 5FTHA 3K2DA 5H8HA 3V83A 3C32A 2HZLA 3TCGA 4U4SA 4ELRA 3TQLA 1PEBA 3DLNA 3PMWA 4RPOA 4IGTA 1URGA 4RK9A 4ZEDA 3VV5A 4NE4A 3HN0A 3VVEA 5JK4A 1B5HA 3P7IA 1UTBA 5H8SA 2ZYOA 2UVHA 3PV0E 4R6HA 3N5LA 2G93A 3KSXA 1B9JA 2Y7IA 5I56A 4H65A 3TMGA 1QJMA 3N94A 3IR1A 3SEVA 3TTLA 3JZJA 3OSRA 2REGA 4LUBA 4MH5A 1DPEA 2XXRA 1QKBA 2ANJA 4QSDA 1LFIA 4AQ4A 3MVXA 5EHMA 3A3UA 1B7HA 2DXYA 1CE2A 4GF8A 3T22A 3AXFA 4IY5A 5DTBA 1OQHA 3CFXA 4C0RA 4X48A 1YAEA 4U1OA 3FXUA 4R74A 4OETA 5IAIA 4N07A 2HZKA 1J1NA 4NF8A 2I3WA 5ELVA 1B3GA 1HSEA 2O51A 1F9BA 1FCKA 3I3VA 2RC8A 4OXVA 1M5BA 2QRYA 3C31A 2Q8JA 3UORA 3W9WA 1PDAA 1TFDA 2H9BA 1FTKA 3MUQA 1UTHA 3TODA 2KLFA 4G4PA 3Q25A 1I6BA 1JW1A 5TU0A 1MY3A 3IOUA 4FIMA 4JXIA 2F35A 1B3LA 4R73A 3MZBA 5DEXA 2E0SA 1B0LA 4GRKA 1B3HA 3D4GA 4YB5A 5TP9B 4KFQA 1EH3A 3K6XA 3K6UA 2ABHA 1B52A 4MBPA 3ZKLA 1LAGE 1JW4A 1OLCA 3TUSA 2GH9A 3V89B 5HPQA 3VDFA 3SEUA 1I69A 3N6UA 3TTKA 2ZNTA 3HPIA 4F3SA 4XKPA 3PPPA 3TDJA 1LCFA 1B58A 2VD2A 2RC7A 3FXQA 3RTWB 3IB0A 4MLQA 4RY1A 3KJTA 3DELB 3IK6B 1B46A 5KDTB 1N76A 3THIA 3R7XA 3E9XA 2DOJA 4U4XA 4F31B 3ONMA 1MH4A 5DT6A 1UQWA 4KI0E 2NUVA 4YU0A 3D4CA 3U72A 1MS7A 5TPAA 2ZNSA 3C9HA 1DTGA 5IKBA 3CG1A 1Y4TA 2AIXA 1M5CA 4QFKA 4G68A 4ZE9A 5FHNA 1XOCA 3O28A 4F1YA 1EZOA 1D4NA 3H6WA 1WVJA 2B3BA 5AA2D 2D3IA 2FNCA 5F7VA 3E13X 1ZMGA 1MRPA 4NWDA 2Y7PA 1SW4A 3C4MA 4LATA 5CC2A 2Q9TA 4BDMA 3FUZA 3HO7A 2DE4A 2THIA 1POTA 4EQBA 3S9MC 4IO5A 4XTCQ 3G3FA 1NMUA 1QUJA 1GGGA 4Q30B 3TFLA 1B3FA 2DWAA 3SERA 1SW1A 1JETA 3K6VA 3MVYA 1BIYA 5H8HB 2I4CA 3OENA 4YZZA 5ICTA 3USDA 2HAUA 1QW0A 1FQDA 4JDFA 1URSA 2DS9A 3U94A 1BLFA 1P1UA 3H03A 1UTBB 3OXNA 3S2VA 4OMBA 2HFBA 3S4UA 1A40A 2F78A 1N0TA 3Q29A 3GLBA 2PT1A 1FW0A 4BDNA 4LP2B 3ZSFA 1B5IA 5I56B 1IEJA 3TTMA 2I0BA 3FJGA 1S9TA 2H98A 5J1DA 1JW5A 3FIRA 4XKRA 2O1LA 4R6KA 5H8FA 4AB5A 2O6AA 1B6HA 3UK4A 2GFEA 3QK6A 2F7AA 2F8DA 2R71A 1LBCA 5CMMA 5HBCA 1YCJA 2H99A 3SKPA 1MY1A 4OHNA 2IEEA 3TYHA 4PE5B 3M8UA 1US5A 3UA8A 4XKNA 1OMPA 1USYE 2ONSA 2Z23A 4Z7EA 2OCUA 1WDNA 4YKJA 2O7IA 3IX1A 5KCJA 1UTHB 3RUMA 1MXWA 1MPBA 1NH7A 3LBSA 3FJMA 2P1SA 4F3PA 1A99A 3TQWA 5DEXB 5CRYA 4QF9A 1SI0A 3FD3A 1JEUA 2Q2AA 4FJPA 4H8IA 1OVBA 1OVTA 3ECRA 3LSLA 4HTGA 2IA4A 1JNFA 3HSTA 1ELJA 2H5YA 2VGQA 5FHMA 3OEKA 2O1MA 1YPNA 1Y3NA 1Q1KA 4GVOA 3OEMA 3IJXB 1AH5A 4G77A 3H06B 4EQ7A 3SEWA 4OTEA 4H5GA 2R9JA 4U21A 4U23A 1JVYA 2I0CA 3IOWA 2UVJA 2O68A 4U1ZA 1LAFE 4KCDA 2XXPA 1NNKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RT6 B;  3N26 A;  2RC9 A;  3G3H A;  4G68 C;  1QVS A;  3K6W A;  3KFM A;  4OER A;  1RKM A;  1SDX A;  2B3F A;  5TPA B;  4BDQ A;  2F5X A;  4YB6 A;  4DE8 A;  3DP8 A;  3K01 A;  3EN3 A;  3KG2 A;  3BKI B;  4ESW A;  4KYS A;  5I2K B;  4DXC A;  2XXQ A;  3C34 A;  2OK2 A;  4G68 B;  3H7M A;  5K2Y A;  2QMW A;  2RIN A;  3TTN A;  5BWJ A;  4ZEC A;  3CFZ A;  1IUD A;  1GR2 A;  3ZKK A;  3BBR A;  2A5T A;  4JB7 A;  4GQO A;  1NNT A;  5BUU A;  3KN8 A;  2DP8 A;  3PPQ A;  4UA8 A;  4QFN A;  2FYI A;  4I62 A;  2DSF A;  2DE3 A;  3M3F A;  2ZMB A;  3QUF A;  2Q89 A;  2XX8 A;  1SI1 A;  1A8F A;  3PMV A;  1PC3 A;  1ZU0 A;  3GBB A;  1P1N A;  1XS5 A;  4H0W A;  1AIV A;  1IXH A;  4KYD A;  4BLA A;  2QS4 A;  1XHY A;  5DVI A;  3FAT A;  3F11 A;  3PUW E;  4RPN A;  3FV1 A;  1SW5 A;  1B3E A;  1D9V A;  1MY2 A;  4LZ5 A;  3MW0 A;  1RYX A;  3ZS6 A;  3H3G A;  4QSE A;  2ONR A;  4JSO A;  2H25 A;  3G3J A;  3VLU A;  1BKA A;  2P2A A;  3PGF A;  1Q35 A;  1O63 A;  1H76 A;  3HCQ A;  2QS2 A;  1XT8 A;  1IXG A;  3PUZ E;  1D9Y A;  4RA1 A;  3VFJ A;  4WXJ A;  1VR5 A;  4NF6 A;  3H6T A;  1T0K A;  3C33 A;  4C1U A;  1B5J A;  3E4R A;  1MY4 A;  2W7Y A;  1R9Q A;  5H8F B;  3TEP A;  2O84 X;  3RQT A;  4Q8R A;  1RYO A;  1N84 A;  2NVU B;  3FXR A;  1EZP A;  4R75 A;  2Y84 A;  4FE8 A;  1MXZ A;  4IO4 A;  4DZ1 A;  1TT1 A;  1GV8 A;  1QUI A;  2XXV A;  3UP9 A;  1N3X A;  1M5D A;  2VHA A;  1NNF A;  4EQ9 A;  5B70 A;  4IO7 A;  3IB2 A;  3OO7 A;  3K4U A;  2V3U A;  4KD5 A;  1XVY A;  2OWT A;  1UIU A;  4HCY A;  4R2B A;  3MP8 A;  5A5X A;  2FA7 A;  4GL8 A;  4POW A;  3G3K A;  4QRZ A;  4QSC A;  5JTY A;  3MBP A;  4IGR A;  1MXX A;  4NF4 A;  2Z8F A;  3GXA A;  4H67 A;  4NTL A;  1LGB C;  4X1D A;  4YAH X;  1P99 A;  2RKM A;  3H4Z A;  3PPO A;  4FEC A;  3T9V A;  5L9O A;  1MPC A;  4N6P A;  3G3I A;  4TOZ A;  1URD A;  1B1H A;  4MLV A;  3FVO A;  1NNP A;  1VFE A;  3CIJ A;  3U93 A;  1LBB A;  4F2Q A;  4OVJ A;  3MWB A;  4GOT A;  4HCW A;  4QFP A;  2F34 A;  2F7C A;  2QMX A;  3LSX A;  3MPK A;  4F29 A;  1USY H;  3QSL A;  2XXU A;  4P11 A;  4IO3 A;  3N6T A;  4H6D A;  4P0I A;  3OO9 A;  2F97 A;  2DYX A;  4DLD A;  1FQE A;  3EHU A;  3G7W A;  4GL0 A;  3Q27 A;  5H8N A;  2ZXT A;  1PBQ A;  2XX9 A;  5DVF A;  4NF5 A;  3FJ7 A;  3LUY A;  3O6G A;  3A3C A;  1Y1M A;  3IAZ A;  2AYS A;  1DPP A;  4TLM B;  3PD9 A;  2HQ0 A;  2Q2C A;  1LB8 A;  1B0H A;  4NWC A;  3KOS A;  2DWH A;  4G2Z A;  3GZG A;  2XHD A;  2PYY A;  1EZ9 A;  2PX1 A;  1FTL A;  5EYF A;  3T93 B;  1SYH A;  3BFU A;  3VVF A;  4LQ5 A;  1MQD A;  3O29 A;  1NFT A;  3RGY A;  5I84 A;  2A5T B;  1SQY A;  3MVW A;  4BDO A;  2OZZ A;  2REJ A;  4EXL A;  2HAV A;  1MM7 A;  3KN3 A;  3KGC A;  4ZEK A;  1ZTY A;  3EF7 A;  5H8Q A;  1AOV A;  1HSL A;  1A55 A;  3IB1 A;  1Z7M E;  1FTM A;  2PVU A;  1MXU A;  3LR1 A;  2OBG A;  3SEX A;  1N7X A;  3PUX E;  3S9N C;  5ISU A;  1B4H A;  4PQJ A;  3VE1 B;  4TLL B;  4R2F A;  1MXV A;  3C36 A;  4RXL A;  4YB7 A;  2QJE A;  4F1V A;  2UVI A;  3GBA A;  3VVD A;  3S9L C;  3KN7 A;  5L8D A;  3C35 A;  3MZ1 A;  4KR5 A;  3PD8 A;  1JQF A;  3OMB A;  2Z8D A;  1LLS A;  2UXA A;  3T9X B;  2G29 A;  3KZG A;  3RTF B;  2V3T A;  1CB6 A;  3T9U A;  3UIF A;  3I6V A;  3FAS A;  1N7W A;  2OLB A;  4NF8 B;  1YTV A;  4DCX A;  2Y7W A;  1LCT A;  2Y7R A;  1QUK A;  2H4I A;  3H6V A;  1D3K A;  5AA2 A;  3RLF E;  3T9H B;  2LAO A;  2V93 A;  1PBP A;  3EHS A;  1WOD A;  2F36 A;  4O3C A;  3FZV A;  3PPN A;  1DSN A;  2O69 A;  3L6G A;  1H43 A;  5I2N A;  1ANF A;  2ESN A;  4F3B A;  4Q0C A;  3KBR A;  3FGS A;  3K1P A;  3B6Q A;  3MZ9 A;  3QIM A;  4F18 A;  1H45 A;  5B7D A;  3OD7 A;  3W9V A;  4QFL A;  2PT2 A;  3MC2 A;  3FVG A;  3HHF A;  4H1X A;  4PET A;  3JYR A;  1ZKB A;  3LSF B;  3RN8 A;  4HW8 A;  2UYE A;  4I8C A;  1Y4C A;  4E0W A;  5I59 A;  3MAM A;  2DWJ A;  1IXC A;  1B7U A;  4U22 A;  4KCC A;  5A5X B;  4GFR A;  3IOV A;  1FQB A;  4ESX A;  2AL5 A;  1MQJ A;  1NH8 A;  2UYF A;  3VXB A;  1MQH A;  2PBW A;  4LA9 A;  4LON B;  4IO6 A;  1B7Z A;  4BDR A;  1MPD A;  3SDF A;  2Z22 A;  2X26 A;  4OFL A;  3KJ7 A;  3VLV A;  4FAJ A;  4EXK A;  4NF4 B;  4RNS A;  3R6U A;  2DXR A;  1DOT A;  3OSQ A;  2GHB A;  2O7U A;  2DVZ A;  4X9T A;  2XD2 A;  3QUJ A;  1M5E A;  1FQA A;  1ATG A;  3B6W A;  1A8E A;  4MFI A;  5CI5 A;  1B2H A;  2XXY A;  2GRV A;  4ELO A;  1II5 A;  2VOZ A;  4OQO A;  3PUY E;  4YKK A;  5I58 A;  3KSJ A;  3TEL A;  1S7Y A;  3QYT A;  5H8N B;  5F1Q A;  1MY0 A;  5I57 A;  1XVX A;  1N04 A;  5M2V A;  5ICQ A;  3A09 A;  2Y7K A;  3O97 A;  2OWS A;  3K02 A;  4NF5 B;  3T96 B;  2XXW A;  3CFL A;  2YLN A;  1SW2 A;  2ZYN A;  1O7T A;  1SBP A;  4YMA A;  3LC8 A;  4OWD A;  3O6I A;  4R72 A;  3RPW A;  1B40 A;  1Y20 A;  3K1M A;  1ZLQ A;  3TCH A;  1LAX A;  1SYI A;  2V3Q A;  2NOO A;  4FAT A;  1B51 A;  1VSO A;  1UIV A;  2Q88 A;  2D5W A;  5CMK A;  2XX7 A;  3OOA A;  1LST A;  3U1O A;  4JWO A;  4ZEI A;  2AL4 A;  3MPL A;  2E1S A;  2I6E A;  4DIG A;  3FVN A;  3K1N A;  3IO6 A;  1MG1 A;  1DMB A;  2CZL A;  3MQ9 A;  1OLA A;  5H8Q B;  1P1O A;  4QFO A;  1MQI A;  2I58 A;  3M3K A;  3VXC A;  4PFW A;  2BJJ X;  4E0X A;  3ODB A;  4OES A;  3IL1 B;  1QUL A;  2I49 A;  4FEB A;  3TCF A;  3DP4 A;  4RK2 A;  3MVZ A;  4O3A A;  4ZDM A;  4YKP A;  2RCA A;  1Y1Z A;  5FHO A;  3Q26 A;  4L17 A;  3O66 A;  3TPA A;  4U2R A;  4WEP A;  4XXU A;  2RF1 A;  3RNN A;  2Z8E A;  4YKI A;  2ZYK A;  4LZ8 A;  3U92 A;  4DCY A;  3HV1 A;  4JBZ A;  4THI A;  4Z0I A;  1NKX A;  4M4G A;  3Q28 A;  4PFT A;  2NWJ A;  1MH3 A;  3KOT A;  4OEN A;  4XKQ A;  3DM0 A;  5AA2 B;  2ALU A;  2ZYM A;  1IQ7 A;  4R9F A;  5AA3 A;  3VLW A;  4F3G A;  3LSW A;  3QXM A;  3K00 A;  1MDP 1;  4G8M A;  5AE4 A;  3IOR A;  4ZE8 A;  5I2N B;  3CRB A;  5KCJ B;  2ZNU A;  3V5A A;  4PFU A;  4I9D A;  3O2A A;  1SVX B;  1OQG A;  4IO2 A;  5AA1 A;  3G3G A;  3OEL A;  1FTJ A;  2WKY A;  5DYH A;  4OEV A;  4K3F A;  3ILU B;  3B7D A;  1R9L A;  1GTK A;  1I6Q A;  5AA4 A;  4PP0 A;  4H5F A;  5I59 B;  4GXS B;  1A7L A;  2F6G A;  3FV2 A;  5L9M A;  2I4B A;  2QS3 A;  5HM4 B;  2QS1 A;  1TWY A;  2DE2 A;  1I6A A;  2VP1 A;  3KEI A;  2OJT A;  5CBR A;  1XC1 A;  5CMC A;  3MP1 A;  3CG3 A;  2YJP A;  3PUV E;  3S9E A;  4WED A;  3JV9 A;  1JVX A;  5I2K A;  2B65 A;  1ZBM A;  4IY6 A;  4C1T A;  2NXO A;  1B32 A;  1FQC A;  1AMF A;  3CI8 A;  3CSG A;  3PMX A;  5FTI A;  1TFA A;  2D21 A;  1AL3 A;  1H44 A;  4KHZ E;  4ND9 A;  4F1U A;  3I5O A;  1VFD A;  4GIZ A;  3PPR A;  1EU8 A;  4Q5T A;  4RYA A;  5I58 B;  4R6Y A;  3E3K A;  3T66 A;  4POX A;  4MF3 A;  1LAH E;  4LZ7 A;  3B6T A;  3CR9 A;  5ITP A;  4OFJ A;  5I57 B;  1PB8 A;  4AB6 A;  4EF1 A;  3QAX A;  1QKA A;  4N13 A;  4ELP A;  2CMO A;  4F19 A;  1VE4 A;  3RY3 A;  3EQ1 A;  4F2O A;  1JEV A;  3IOT A;  5CMB A;  3ILT B;  3TTR A;  2M8C A;  4G8H A;  4ZZE A;  3OO6 A;  3IJO B;  2I48 A;  5L9S A;  3HHG A;  2XXX A;  2ONK E;  1B4Z A;  1MXY A;  3TKD A;  4OFO A;  2XXT A;  4ZS9 A;  3UGW A;  1MM6 A;  1Y9U A;  4F22 A;  4JWX A;  2RCB A;  1POY 1;  4BDL A;  4H8J A;  3R26 A;  3SES A;  4ELQ A;  3L6H A;  4HS7 A;  3O6H A;  1PB7 A;  2XD3 A;  3WAF A;  4F39 A;  1PB9 A;  1ZIU A;  2UVG A;  1Y3P A;  3UN6 A;  3FVK A;  5LOM A;  4EUO A;  5EHS A;  4WKM A;  3TZA A;  1O64 A;  2QL3 A;  4NF6 B;  3TAJ A;  4XIG Q;  2X7P A;  1FQF A;  1R1N A;  1B05 A;  3EHT A;  1IIW A;  4GWO A;  1LFH A;  4R9G A;  2P0S A;  4G8N A;  1BTJ A;  4GXA A;  3H6U A;  5TP9 A;  1SD3 A;  5ITO A;  2GHA A;  4OEU A;  1BP5 A;  1Z7N E;  2XXH A;  2DWI A;  4ONY A;  3V8X B;  1IZ1 A;  5CM6 A;  5K2X A;  4JWY A;  1M5F A;  1A54 A;  4M1V A;  4DDD A;  1US4 A;  4GD5 A;  2R6G E;  1MQG A;  3O9P A;  1B1X A;  5KZT A;  4X1B A;  3MJN A;  2DQV A;  1MDQ A;  2I3V A;  3K0V A;  4QHQ A;  4ZZA A;  4LVQ A;  2XXI A;  1Y3Q A;  5KDT A;  4NED A;  3SEY A;  3U8Q A;  3CSB A;  2HCA A;  1GVC A;  4KYE A;  3MP6 A;  2DVC A;  2HXW A;  3PU5 A;  5JTY B;  2V25 A;  1TXF A;  2QSX A;  4RJZ A;  1P1W A;  4UAC A;  5JEI A;  3OO8 A;  5DVJ A;  1R6Z A;  1HSJ A;  4EF2 A;  4JSD A;  1LB9 A;  4FOR A;  3SET A;  4KQP A;  4I1D A;  4O3B A;  4EDP A;  1L5T A;  1OIB A;  1KWH A;  3IO4 A;  4TQU Q;  1IXI A;  3DP6 A;  4P0G A;  5CBS A;  4ISU A;  4ZEF A;  5AA4 B;  2QPQ A;  2X7Q A;  2F7B A;  3BFT A;  4DXB A;  4PFY A;  4IB2 A;  3WAE A;  1S50 A;  3M3L A;  4LQ2 A;  2V84 A;  1LFG A;  2YPN A;  2VD3 A;  4GLI A;  4DXU A;  1DTZ A;  3EPE A;  4ECF A;  4YIC A;  1P1Q A;  2A5S A;  2PMS A;  4FED A;  4NMY A;  4KPT A;  2F6P A;  1FTO A;  3CVG A;  4YMB A;  4OZ9 A;  3W15 C;  1H3D A;  1NL5 A;  1ZJL A;  2HEU A;  4OYV A;  3RT8 A;  1IIT A;  1N3W A;  4ZEB A;  5FTH A;  3K2D A;  5H8H A;  3V83 A;  3C32 A;  2HZL A;  3TCG A;  4U4S A;  4ELR A;  3TQL A;  1PEB A;  3DLN A;  3PMW A;  4RPO A;  4IGT A;  1URG A;  4RK9 A;  4ZED A;  3VV5 A;  4NE4 A;  3HN0 A;  3VVE A;  5JK4 A;  1B5H A;  3P7I A;  1UTB A;  5H8S A;  2ZYO A;  2UVH A;  3PV0 E;  4R6H A;  3N5L A;  2G93 A;  3KSX A;  1B9J A;  2Y7I A;  5I56 A;  4H65 A;  3TMG A;  1QJM A;  3N94 A;  3IR1 A;  3SEV A;  3TTL A;  3JZJ A;  3OSR A;  2REG A;  4LUB A;  4MH5 A;  1DPE A;  2XXR A;  1QKB A;  2ANJ A;  4QSD A;  1LFI A;  4AQ4 A;  3MVX A;  5EHM A;  3A3U A;  1B7H A;  2DXY A;  1CE2 A;  4GF8 A;  3T22 A;  3AXF A;  4IY5 A;  5DTB A;  1OQH A;  3CFX A;  4C0R A;  4X48 A;  1YAE A;  4U1O A;  3FXU A;  4R74 A;  4OET A;  5IAI A;  4N07 A;  2HZK A;  1J1N A;  4NF8 A;  2I3W A;  5ELV A;  1B3G A;  1HSE A;  2O51 A;  1F9B A;  1FCK A;  3I3V A;  2RC8 A;  4OXV A;  1M5B A;  2QRY A;  3C31 A;  2Q8J A;  3UOR A;  3W9W A;  1PDA A;  1TFD A;  2H9B A;  1FTK A;  3MUQ A;  1UTH A;  3TOD A;  2KLF A;  4G4P A;  3Q25 A;  1I6B A;  1JW1 A;  5TU0 A;  1MY3 A;  3IOU A;  4FIM A;  4JXI A;  2F35 A;  1B3L A;  4R73 A;  3MZB A;  5DEX A;  2E0S A;  1B0L A;  4GRK A;  1B3H A;  3D4G A;  4YB5 A;  5TP9 B;  4KFQ A;  1EH3 A;  3K6X A;  3K6U A;  2ABH A;  1B52 A;  4MBP A;  3ZKL A;  1LAG E;  1JW4 A;  1OLC A;  3TUS A;  2GH9 A;  3V89 B;  5HPQ A;  3VDF A;  3SEU A;  1I69 A;  3N6U A;  3TTK A;  2ZNT A;  3HPI A;  4F3S A;  4XKP A;  3PPP A;  3TDJ A;  1LCF A;  1B58 A;  2VD2 A;  2RC7 A;  3FXQ A;  3RTW B;  3IB0 A;  4MLQ A;  4RY1 A;  3KJT A;  3DEL B;  3IK6 B;  1B46 A;  5KDT B;  1N76 A;  3THI A;  3R7X A;  3E9X A;  2DOJ A;  4U4X A;  4F31 B;  3ONM A;  1MH4 A;  5DT6 A;  1UQW A;  4KI0 E;  2NUV A;  4YU0 A;  3D4C A;  3U72 A;  1MS7 A;  5TPA A;  2ZNS A;  3C9H A;  1DTG A;  5IKB A;  3CG1 A;  1Y4T A;  2AIX A;  1M5C A;  4QFK A;  4G68 A;  4ZE9 A;  5FHN A;  1XOC A;  3O28 A;  4F1Y A;  1EZO A;  1D4N A;  3H6W A;  1WVJ A;  2B3B A;  5AA2 D;  2D3I A;  2FNC A;  5F7V A;  3E13 X;  1ZMG A;  1MRP A;  4NWD A;  2Y7P A;  1SW4 A;  3C4M A;  4LAT A;  5CC2 A;  2Q9T A;  4BDM A;  3FUZ A;  3HO7 A;  2DE4 A;  2THI A;  1POT A;  4EQB A;  3S9M C;  4IO5 A;  4XTC Q;  3G3F A;  1NMU A;  1QUJ A;  1GGG A;  4Q30 B;  3TFL A;  1B3F A;  2DWA A;  3SER A;  1SW1 A;  1JET A;  3K6V A;  3MVY A;  1BIY A;  5H8H B;  2I4C A;  3OEN A;  4YZZ A;  5ICT A;  3USD A;  2HAU A;  1QW0 A;  1FQD A;  4JDF A;  1URS A;  2DS9 A;  3U94 A;  1BLF A;  1P1U A;  3H03 A;  1UTB B;  3OXN A;  3S2V A;  4OMB A;  2HFB A;  3S4U A;  1A40 A;  2F78 A;  1N0T A;  3Q29 A;  3GLB A;  2PT1 A;  1FW0 A;  4BDN A;  4LP2 B;  3ZSF A;  1B5I A;  5I56 B;  1IEJ A;  3TTM A;  2I0B A;  3FJG A;  1S9T A;  2H98 A;  5J1D A;  1JW5 A;  3FIR A;  4XKR A;  2O1L A;  4R6K A;  5H8F A;  4AB5 A;  2O6A A;  1B6H A;  3UK4 A;  2GFE A;  3QK6 A;  2F7A A;  2F8D A;  2R71 A;  1LBC A;  5CMM A;  5HBC A;  1YCJ A;  2H99 A;  3SKP A;  1MY1 A;  4OHN A;  2IEE A;  3TYH A;  4PE5 B;  3M8U A;  1US5 A;  3UA8 A;  4XKN A;  1OMP A;  1USY E;  2ONS A;  2Z23 A;  4Z7E A;  2OCU A;  1WDN A;  4YKJ A;  2O7I A;  3IX1 A;  5KCJ A;  1UTH B;  3RUM A;  1MXW A;  1MPB A;  1NH7 A;  3LBS A;  3FJM A;  2P1S A;  4F3P A;  1A99 A;  3TQW A;  5DEX B;  5CRY A;  4QF9 A;  1SI0 A;  3FD3 A;  1JEU A;  2Q2A A;  4FJP A;  4H8I A;  1OVB A;  1OVT A;  3ECR A;  3LSL A;  4HTG A;  2IA4 A;  1JNF A;  3HST A;  1ELJ A;  2H5Y A;  2VGQ A;  5FHM A;  3OEK A;  2O1M A;  1YPN A;  1Y3N A;  1Q1K A;  4GVO A;  3OEM A;  3IJX B;  1AH5 A;  4G77 A;  3H06 B;  4EQ7 A;  3SEW A;  4OTE A;  4H5G A;  2R9J A;  4U21 A;  4U23 A;  1JVY A;  2I0C A;  3IOW A;  2UVJ A;  2O68 A;  4U1Z A;  1LAF E;  4KCD A;  2XXP A;  1NNK A; 
#chains in the Genus database with same CATH topology
 3RT6 B;  3N26 A;  4OVT A;  2RC9 A;  3G3H A;  4G68 C;  1QVS A;  3K6W A;  3EKI A;  3KFM A;  4OER A;  1RKM A;  1SDX A;  1YYZ A;  2B3F A;  5TPA B;  4BDQ A;  2F5X A;  4NQ8 A;  4YB6 A;  4DE8 A;  3DP8 A;  3K01 A;  1DK4 A;  3EN3 A;  5IZZ A;  3KG2 A;  1IMC A;  3BKI B;  1NV0 A;  4ESW A;  4KYS A;  5I2K B;  4DXC A;  2XXQ A;  3C34 A;  2OK2 A;  4G68 B;  3H7M A;  5K2Y A;  2QMW A;  2RIN A;  3TTN A;  5BWJ A;  4ZEC A;  3CFZ A;  1IUD A;  1GR2 A;  1FPG A;  3ZKK A;  3BBR A;  2A5T A;  4JB7 A;  4GQO A;  1NNT A;  5BUU A;  3KN8 A;  2DP8 A;  3PPQ A;  4UA8 A;  4QFN A;  4MIJ A;  2FYI A;  4I62 A;  2DSF A;  2DE3 A;  3M3F A;  2ZMB A;  3QUF A;  2Q89 A;  1FPF A;  1LBY A;  2XX8 A;  1SI1 A;  1A8F A;  3BIH A;  2ZZW A;  3PMV A;  1PC3 A;  1ZU0 A;  5DW8 A;  3GBB A;  2HXR A;  1P1N A;  2ZZV A;  3KBZ A;  3RYD A;  4DI4 B;  1XS5 A;  4H0W A;  1AIV A;  1IXH A;  4KYD A;  4BLA A;  2QS4 A;  1XHY A;  5DVI A;  3FAT A;  3F11 A;  3PUW E;  4RPN A;  3FV1 A;  1SW5 A;  1B3E A;  1D9V A;  1MY2 A;  4LZ5 A;  2FIX A;  1RYX A;  1DCU A;  3MW0 A;  3ZS6 A;  3H3G A;  4QSE A;  2ONR A;  4JSO A;  4PAI A;  2H25 A;  3G3J A;  3VLU A;  1BKA A;  2P2A A;  3PGF A;  1Q35 A;  1O63 A;  1H76 A;  3HCQ A;  2QS2 A;  1XT8 A;  1IXG A;  3PUZ E;  1D9Y A;  4GWW A;  4RA1 A;  3VFJ A;  4WXJ A;  1VR5 A;  4O94 A;  4NF6 A;  3H6T A;  2B4L A;  3E79 A;  1T0K A;  3C33 A;  4C1U A;  1B5J A;  1XI6 A;  3E4R A;  1MY4 A;  2W7Y A;  1R9Q A;  2CZI A;  5H8F B;  3TEP A;  2XA5 A;  2O84 X;  3RQT A;  4Q8R A;  1RYO A;  1N84 A;  2NVU B;  3FXR A;  1EZP A;  4R75 A;  2Y84 A;  4FE8 A;  1FPD A;  1MXZ A;  4IO4 A;  4DZ1 A;  1TT1 A;  1GV8 A;  1QUI A;  2XXV A;  3UP9 A;  1N3X A;  1M5D A;  2V4C A;  2VHA A;  1NNF A;  4EQ9 A;  5B70 A;  4IO7 A;  3IB2 A;  3OO7 A;  5EQ8 A;  3K4U A;  2V3U A;  4KD5 A;  1XVY A;  2OWT A;  4GWX A;  1UIU A;  4HCY A;  4R2B A;  3KC1 A;  3MP8 A;  5A5X A;  2F3D A;  5IM2 A;  4P47 A;  2FA7 A;  4P56 A;  2FBP A;  4GL8 A;  4POW A;  1FSA A;  4PC9 A;  3G3K A;  4QRZ A;  4QSC A;  5EQ9 A;  5JTY A;  3MBP A;  4HE2 A;  4IGR A;  1MXX A;  4NF4 A;  2Z8F A;  3GXA A;  4H67 A;  4NTL A;  1LGB C;  4X1D A;  3LUZ A;  4YAH X;  1P99 A;  4N4U A;  2RKM A;  3H4Z A;  3PPO A;  4FEC A;  3T9V A;  4HE1 A;  5L9O A;  1MPC A;  4N6P A;  3G3I A;  4TOZ A;  1URD A;  1B1H A;  5J16 A;  4MLV A;  3FVO A;  1NNP A;  1K9Y A;  1VFE A;  3CIJ A;  3U93 A;  1LBB A;  4F2Q A;  4OVJ A;  3MWB A;  4GOT A;  4HCW A;  4QFP A;  2F34 A;  2F7C A;  4KXP A;  2QMX A;  3LSX A;  3MPK A;  4F29 A;  1USY H;  3QSL A;  2XXU A;  4P11 A;  4IO3 A;  3N6T A;  4H6D A;  3SZP A;  4P0I A;  1G0H A;  3OO9 A;  2F97 A;  2DYX A;  4DLD A;  1FQE A;  3EHU A;  2FIE A;  3G7W A;  4GL0 A;  3IFC A;  5LDZ A;  3Q27 A;  5H8N A;  2ZXT A;  1G0I A;  1PBQ A;  4N17 A;  2XX9 A;  4X8R A;  5DVF A;  4NF5 A;  3FJ7 A;  3LUY A;  3O6G A;  3A3C A;  1Y1M A;  3IAZ A;  2AYS A;  4N8Y A;  1DPP A;  4TLM B;  1FJ9 A;  1NUX A;  3PD9 A;  2HQ0 A;  2WYP A;  2Q2C A;  1LB8 A;  4AS5 A;  1B0H A;  4NWC A;  3KOS A;  2DWH A;  4G2Z A;  3GZG A;  2XHD A;  2PYY A;  1EZ9 A;  2B4M A;  2PX1 A;  1FTL A;  5EYF A;  3T93 B;  2PFY A;  1SYH A;  3BFU A;  3VVF A;  4LQ5 A;  5EQ7 A;  1MQD A;  3O29 A;  2QVR A;  1NFT A;  3RGY A;  4OVR A;  2PCR A;  3LV0 A;  5I84 A;  2A5T B;  1SQY A;  3MVW A;  4BDO A;  2OZZ A;  2REJ A;  4UAB A;  4EXL A;  2HAV A;  4PAF A;  1MM7 A;  3KN3 A;  3KGC A;  4ZEK A;  1LBV A;  1ZTY A;  3EF7 A;  5H8Q A;  1AOV A;  1HSL A;  1A55 A;  3IB1 A;  1Z7M E;  3MYU A;  1FTM A;  2PVU A;  1MXU A;  3LR1 A;  2OBG A;  3SEX A;  4O8M A;  1N7X A;  3PUX E;  3S9N C;  5ISU A;  1B4H A;  4PQJ A;  3VE1 B;  4TLL B;  4R2F A;  1MXV A;  3C36 A;  4RXL A;  4YB7 A;  2QJE A;  4F1V A;  2UVI A;  3GBA A;  3VVD A;  3S9L C;  3KN7 A;  5L8D A;  3C35 A;  3MZ1 A;  4KR5 A;  3PD8 A;  2ZZX A;  1JQF A;  3OMB A;  2Z8D A;  1LLS A;  2UXA A;  3T9X B;  1RDY A;  2G29 A;  4O7I A;  3KZG A;  3RTF B;  4OVS A;  2V3T A;  1CB6 A;  3T9U A;  3UIF A;  5ET6 A;  3I6V A;  3FAS A;  1N7W A;  2OLB A;  4NF8 B;  1YTV A;  4DCX A;  2Y7W A;  1LCT A;  2Y7R A;  4AS4 A;  1QUK A;  2H4I A;  3H6V A;  1D3K A;  5AA2 A;  3RLF E;  2LAO A;  2V93 A;  3EHS A;  1PBP A;  3T9H B;  1WOD A;  2F36 A;  4O3C A;  5I3S A;  3FZV A;  3PPN A;  4NAP A;  1DSN A;  2O69 A;  3L6G A;  1H43 A;  5I2N A;  1ANF A;  2ESN A;  4F3B A;  4Q0C A;  3KBR A;  3FGS A;  1KZ8 A;  3K1P A;  3B6Q A;  3MZ9 A;  3GYY A;  3QIM A;  4F18 A;  1H45 A;  5B7D A;  3OD7 A;  3W9V A;  4QFL A;  2PT2 A;  3MC2 A;  3FVG A;  3HHF A;  4H1X A;  4PET A;  3JYR A;  1ZKB A;  3LSF B;  4XF5 A;  3RN8 A;  2XXK A;  4HW8 A;  2UYE A;  4I8C A;  1Y4C A;  4E0W A;  5I59 A;  3MAM A;  1FRP A;  2XWK A;  2DWJ A;  1IXC A;  1B7U A;  4U22 A;  1NUW A;  4KCC A;  5A5X B;  4GFR A;  3IOV A;  1FQB A;  1MQJ A;  2AL5 A;  2UYF A;  1NH8 A;  4ESX A;  2FVZ A;  3VXB A;  1MQH A;  2PBW A;  4LA9 A;  4LON B;  4IO6 A;  1B7Z A;  3T0J A;  4BDR A;  1MPD A;  3SDF A;  2Z22 A;  2X26 A;  4OFL A;  3KJ7 A;  1QGX A;  3VLV A;  4NN3 A;  2CEY A;  4FAJ A;  4EXK A;  4NF4 B;  4RNS A;  3R6U A;  2DXR A;  4XFE A;  1DOT A;  4MHF A;  3OSQ A;  2GHB A;  2O7U A;  2DVZ A;  2P3V A;  4P9K A;  4X9T A;  1LBX A;  2XD2 A;  3QUJ A;  1M5E A;  1FQA A;  1ATG A;  3B6W A;  1A8E A;  4MFI A;  5CI5 A;  1B2H A;  2XXY A;  2GRV A;  4ELO A;  1II5 A;  2VOZ A;  4OQO A;  3PUY E;  4YKK A;  4GX4 A;  5I58 A;  3KSJ A;  4GX3 A;  3TEL A;  1S7Y A;  3QYT A;  4GWZ A;  5H8N B;  5F1Q A;  1MY0 A;  5I57 A;  1XVX A;  4MNI A;  1N04 A;  5M2V A;  4XEQ A;  3A09 A;  5ICQ A;  2Y7K A;  3O97 A;  2OWS A;  3K02 A;  4NF5 B;  3T96 B;  2XXW A;  3CFL A;  2YLN A;  1SW2 A;  2ZYN A;  1O7T A;  1SBP A;  4YMA A;  3LC8 A;  4GBV A;  4G61 A;  4OWD A;  3O6I A;  4R72 A;  3RPW A;  1B40 A;  1Y20 A;  3K1M A;  1ZLQ A;  3TCH A;  1D9Q A;  1LAX A;  1KA0 A;  1SYI A;  2V3Q A;  2NOO A;  4FAT A;  1B51 A;  1VSO A;  1UIV A;  2Q88 A;  2D5W A;  2GQ1 A;  5CMK A;  2XX7 A;  3OOA A;  1LST A;  3U1O A;  4JWO A;  2Y5L A;  4ZEI A;  2AL4 A;  3MPL A;  1EYK A;  2E1S A;  4I40 A;  2I6E A;  4DIG A;  3FVN A;  3FBP A;  3K1N A;  3IO6 A;  1NV4 A;  1MG1 A;  1DMB A;  2CZL A;  3MQ9 A;  1OLA A;  5H8Q B;  1P1O A;  4QFO A;  1MQI A;  2I58 A;  3M3K A;  3VXC A;  4PFW A;  2BJJ X;  4E0X A;  3ODB A;  3PTY A;  3RPL A;  4OES A;  3IL1 B;  1QUL A;  2I49 A;  4FEB A;  3TCF A;  1FPI A;  4P1L A;  3DP4 A;  4RK2 A;  4JVC A;  3MVZ A;  4MNP A;  4O3A A;  4ZDM A;  1SPI A;  2VT5 A;  4YKP A;  2RCA A;  1NV1 A;  1Y1Z A;  5FHO A;  3Q26 A;  5T3J A;  4L17 A;  3O66 A;  3TPA A;  4U2R A;  4WEP A;  4XXU A;  2RF1 A;  3RNN A;  2Z8E A;  2VPO A;  4PBQ A;  4YKI A;  2ZYK A;  4LZ8 A;  4PGP A;  3U92 A;  4DCY A;  3HV1 A;  4JBZ A;  4THI A;  4Z0I A;  1NKX A;  4M4G A;  3Q28 A;  4PFT A;  2NWJ A;  1MH3 A;  3KOT A;  4OEN A;  4XKQ A;  3DM0 A;  5AA2 B;  1FBC A;  2ALU A;  2ZYM A;  1IQ7 A;  4R9F A;  5AA3 A;  3VLW A;  4F3G A;  3LSW A;  3QXM A;  3K00 A;  1MDP 1;  4G8M A;  4N81 A;  5AE4 A;  2XWI A;  3IOR A;  4ZE8 A;  5I2N B;  3CRB A;  5KCJ B;  2ZNU A;  4MNC A;  3V5A A;  4PFU A;  4I9D A;  3O2A A;  1SVX B;  1LBZ A;  1OQG A;  4IO2 A;  5AA1 A;  4N6K A;  3G3G A;  3OEL A;  1FTJ A;  2WKY A;  5DYH A;  4OEV A;  4K3F A;  3ILU B;  3B7D A;  1R9L A;  2XWV A;  1GTK A;  1I6Q A;  5AA4 A;  4PP0 A;  4H5F A;  1FBE A;  5IZ3 B;  5I59 B;  4GXS B;  4H45 A;  2CEX A;  1A7L A;  1NI9 A;  2F6G A;  3FV2 A;  5L9M A;  2I4B A;  2QS3 A;  3IFA A;  5HM4 B;  2QS1 A;  2F3B A;  1TWY A;  2DE2 A;  3B50 A;  1I6A A;  2VP1 A;  3KEI A;  2OJT A;  5CBR A;  2CZK A;  1INP A;  1XC1 A;  5CMC A;  3MP1 A;  3CG3 A;  2YJP A;  3PUV E;  3S9E A;  4WED A;  3JV9 A;  1JVX A;  5I2K A;  2B65 A;  1ZBM A;  4IY6 A;  4C1T A;  2NXO A;  1B32 A;  1FQC A;  4QBA A;  4JVI A;  1AMF A;  4PDH A;  3CI8 A;  3CSG A;  3PMX A;  5FTI A;  1TFA A;  5IGA A;  2D21 A;  1AL3 A;  1H44 A;  4KHZ E;  4ND9 A;  4F1U A;  3I5O A;  1VFD A;  4GIZ A;  3PPR A;  1EU8 A;  4Q5T A;  4RYA A;  3ROJ A;  5I58 B;  4R6Y A;  3E3K A;  3T66 A;  4POX A;  4MF3 A;  1LAH E;  4LZ7 A;  3B6T A;  3CR9 A;  5ITP A;  4OFJ A;  5I57 B;  1PB8 A;  4AB6 A;  2WX9 A;  4EF1 A;  4HXV A;  3QAX A;  4N8G A;  1QKA A;  4FBP A;  4N13 A;  4ELP A;  2CMO A;  4F19 A;  1VE4 A;  3RY3 A;  3EQ1 A;  4F2O A;  4NX1 A;  1JEV A;  3IOT A;  5CMB A;  3ILT B;  3A29 A;  4NF0 A;  2P3N A;  3TTR A;  2M8C A;  4G8H A;  1FPJ A;  4ZZE A;  3OO6 A;  3IJO B;  2I48 A;  5L9S A;  3HHG A;  2XXX A;  2ONK E;  1B4Z A;  1MXY A;  3TKD A;  4OFO A;  2XXT A;  4ZS9 A;  3UGW A;  1MM6 A;  1Y9U A;  4F22 A;  4JWX A;  2RCB A;  4PF8 A;  1POY 1;  4BDL A;  4H8J A;  5A5L A;  3R26 A;  3SES A;  4ELQ A;  3L6H A;  4HS7 A;  3T1B A;  3O6H A;  1PB7 A;  1DBZ A;  2XD3 A;  3WAF A;  4F39 A;  4P1E A;  1PB9 A;  1ZIU A;  4PAK A;  1NV5 A;  2UVG A;  1Y3P A;  3UN6 A;  5I5P A;  3FVK A;  5LOM A;  4EUO A;  5EHS A;  4WKM A;  3RPL B;  3TZA A;  1O64 A;  2QL3 A;  4NF6 B;  3TAJ A;  4XIG Q;  2X7P A;  1FQF A;  1R1N A;  1B05 A;  3EHT A;  1IIW A;  1AWB A;  4GWO A;  4MMP A;  1LFH A;  1NV7 A;  4R9G A;  2P0S A;  4G8N A;  4PBH A;  1BTJ A;  4GXA A;  2QVU A;  3H6U A;  5TP9 A;  1SD3 A;  5ITO A;  2GHA A;  4OEU A;  1BP5 A;  1RDZ A;  1Z7N E;  2XXH A;  4NHB A;  2DWI A;  4ONY A;  3V8X B;  1IMF A;  4IR8 A;  1IZ1 A;  5CM6 A;  5ET7 A;  5K2X A;  4JWY A;  4P8B A;  1M5F A;  1A54 A;  4M1V A;  4DDD A;  1US4 A;  4GD5 A;  2R6G E;  1MQG A;  1EYJ A;  3O9P A;  1B1X A;  5KZT A;  4X1B A;  3MJN A;  1K9Z A;  2DQV A;  1MDQ A;  2I3V A;  4MAG A;  3K0V A;  4QHQ A;  4ZZA A;  4LVQ A;  2XXI A;  1Y3Q A;  5KDT A;  4NED A;  3SEY A;  3U8Q A;  3CSB A;  2HCA A;  1GVC A;  4KYE A;  3MP6 A;  2DVC A;  2HXW A;  3PU5 A;  5JTY B;  2V25 A;  1TXF A;  2QSX A;  4RJZ A;  1P1W A;  4UAC A;  5JEI A;  3OO8 A;  5DVJ A;  1R6Z A;  4PE3 A;  1HSJ A;  4EF2 A;  4JSD A;  1LB9 A;  4GBW A;  4FOR A;  3SET A;  4KQP A;  4I1D A;  4O3B A;  4EDP A;  1L5T A;  1OIB A;  1KWH A;  3IO4 A;  4TQU Q;  1IXI A;  3BIG A;  3DP6 A;  4P0G A;  5CBS A;  4ISU A;  4H46 A;  4ZEF A;  5AA4 B;  2QPQ A;  2Q74 A;  2X7Q A;  2XWO A;  2F7B A;  3BFT A;  4DXB A;  4PFY A;  4IB2 A;  3WAE A;  1S50 A;  3M3L A;  4LQ2 A;  2V84 A;  5IZ1 A;  1LFG A;  2YPN A;  2VD3 A;  1FBF A;  4GLI A;  4DXU A;  1DTZ A;  3EPE A;  4OVQ A;  4ECF A;  4YIC A;  4PFR A;  1P1Q A;  4PTK A;  2A5S A;  2PMS A;  4FED A;  4NMY A;  4KPT A;  2F6P A;  1FTO A;  3CVG A;  4YMB A;  4OZ9 A;  3W15 C;  1H3D A;  1NL5 A;  1ZJL A;  2HEU A;  5EYG A;  4OYV A;  3RT8 A;  1IIT A;  1N3W A;  4ZEB A;  5FTH A;  3K2D A;  5H8H A;  3V83 A;  3C32 A;  2HZL A;  3TCG A;  4U4S A;  4ELR A;  3TQL A;  1PEB A;  3DLN A;  1FTA A;  3PMW A;  4RPO A;  4GWY A;  4IGT A;  1URG A;  4RK9 A;  4ZED A;  3VV5 A;  4NE4 A;  3HN0 A;  3VVE A;  5JK4 A;  1CNQ A;  2HHM A;  4N6D A;  1B5H A;  3P7I A;  1UTB A;  5H8S A;  2ZYO A;  2UVH A;  3PV0 E;  4R6H A;  3HFU A;  3N5L A;  2G93 A;  3KSX A;  1B9J A;  2Y7I A;  5I56 A;  4H65 A;  3TMG A;  1QJM A;  3N94 A;  5I7I A;  4PDD A;  3IR1 A;  2Y5K A;  3SEV A;  2JJK A;  3TTL A;  1FPL A;  3JZJ A;  3OSR A;  2REG A;  4OAN A;  4LUB A;  4MH5 A;  1DPE A;  1EYI A;  2XXR A;  1QKB A;  2ANJ A;  4QSD A;  1LFI A;  1YXI A;  4AQ4 A;  3MVX A;  5EHM A;  3A3U A;  2OX3 A;  1B7H A;  2DXY A;  1CE2 A;  4GF8 A;  3T22 A;  3AXF A;  4IY5 A;  4PF6 A;  5DTB A;  1OQH A;  3CFX A;  2KQZ A;  4C0R A;  4X48 A;  1YAE A;  4U1O A;  3FXU A;  4R74 A;  4OET A;  5IAI A;  4MCO A;  4N07 A;  2HZK A;  1J1N A;  4NF8 A;  2I3W A;  4GX6 A;  1NUY A;  1JP4 A;  5ELV A;  1B3G A;  1HSE A;  1IMD A;  2O51 A;  1F9B A;  1FCK A;  3I3V A;  3KC0 A;  2RC8 A;  4OXV A;  1M5B A;  2QRY A;  3C31 A;  2Q8J A;  3UOR A;  3W9W A;  1PDA A;  1TFD A;  2H9B A;  1FTK A;  3MUQ A;  1UTH A;  3TOD A;  4LN5 A;  2KLF A;  4G4P A;  3Q25 A;  1I6B A;  1JW1 A;  5TU0 A;  1MY3 A;  1FBH A;  3D1R A;  2BJI A;  1FJ6 A;  3IOU A;  4FIM A;  4JXI A;  2F35 A;  1B3L A;  4R73 A;  3MZB A;  5DEX A;  2E0S A;  1B0L A;  4GRK A;  1B3H A;  3D4G A;  4YB5 A;  5TP9 B;  4KFQ A;  4I3E A;  1EH3 A;  3K6X A;  3K6U A;  2ABH A;  1B52 A;  4MBP A;  3ZKL A;  1LAG E;  1JW4 A;  1OLC A;  3TUS A;  2GH9 A;  3FXB A;  3V89 B;  5HPQ A;  3VDF A;  3SEU A;  1YZ0 A;  1RDX A;  1I69 A;  1IMB A;  3N6U A;  4DI3 D;  4NGU A;  3TTK A;  2CZH A;  2ZNT A;  3HPI A;  4F3S A;  2OWZ A;  4XKP A;  3PPP A;  3TDJ A;  1LCF A;  4P3L A;  1B58 A;  2VD2 A;  2RC7 A;  3FXQ A;  3RTW B;  3IB0 A;  4MLQ A;  4RY1 A;  3KJT A;  3DEL B;  3IK6 B;  1B46 A;  5KDT B;  5ET5 A;  1N76 A;  3THI A;  3R7X A;  3MST A;  3E9X A;  2DOJ A;  2WBD A;  4U4X A;  4F31 B;  3ONM A;  1MH4 A;  5DT6 A;  1UQW A;  4KI0 E;  4N15 A;  2NUV A;  4MEV A;  4YU0 A;  3D4C A;  3U72 A;  1Q9D A;  1MS7 A;  5TPA A;  2ZNS A;  3C9H A;  1DTG A;  5IKB A;  2WBB A;  3CG1 A;  4MJO A;  1Y4T A;  2AIX A;  3ISP A;  1M5C A;  4QFK A;  4G68 A;  4ZE9 A;  5FHN A;  1XOC A;  3O28 A;  2Q8M A;  4F1Y A;  4HE0 A;  1EZO A;  1D4N A;  3H6W A;  1WVJ A;  2B3B A;  5AA2 D;  2D3I A;  2WYK A;  2FNC A;  1FPB A;  5F7V A;  3E13 X;  1ZMG A;  1MRP A;  4NWD A;  2Y7P A;  1SW4 A;  3C4M A;  4LAT A;  5CC2 A;  5FBP A;  1NV2 A;  2Q9T A;  2WEF A;  4BDM A;  4GWS A;  3FUZ A;  3HO7 A;  2DE4 A;  2THI A;  1POT A;  4EQB A;  3S9M C;  4IO5 A;  4XTC Q;  1VDW A;  3G3F A;  1NMU A;  1QUJ A;  1GGG A;  4Q30 B;  3TFL A;  1B3F A;  2DWA A;  4NG7 A;  3SER A;  2VPN A;  1SW1 A;  1JET A;  3K6V A;  3MVY A;  1BIY A;  5H8H B;  2I4C A;  3OEN A;  4YZZ A;  2KR0 A;  5EQA A;  5ICT A;  1FBD A;  3USD A;  2QVV A;  2HAU A;  3CHG A;  1QW0 A;  1FQD A;  4JDF A;  2R8T A;  1URS A;  2DS9 A;  3U94 A;  1BLF A;  1P1U A;  3H03 A;  4OVP A;  1UTB B;  3OXN A;  4JVD A;  3S2V A;  4OMB A;  2HFB A;  3S4U A;  1A40 A;  2F78 A;  1N0T A;  3Q29 A;  3GLB A;  2PT1 A;  1FW0 A;  5F24 A;  4LP2 B;  3ZSF A;  1B5I A;  4BDN A;  5I56 B;  1IEJ A;  3TTM A;  2I0B A;  5ET8 A;  3FJG A;  1S9T A;  5EYH A;  2H98 A;  5J1D A;  1LEV A;  1JW5 A;  4OA4 A;  3FIR A;  4XKR A;  2QFL A;  2O1L A;  4R6K A;  1FPE A;  5H8F A;  4AB5 A;  2O6A A;  1B6H A;  3UK4 A;  2GFE A;  3QK6 A;  4QXD A;  2F7A A;  2F8D A;  1NV6 A;  2R71 A;  1LBC A;  5CMM A;  5HBC A;  5LTC A;  1YCJ A;  2H99 A;  3SKP A;  1MY1 A;  4X04 A;  4OHN A;  2IEE A;  3TYH A;  4PE5 B;  3M8U A;  4N91 A;  1LBW A;  1US5 A;  3UA8 A;  4XKN A;  1OMP A;  1USY E;  2ONS A;  4MX6 A;  2Z23 A;  1FPK A;  1FBG A;  4Z7E A;  2OCU A;  1WDN A;  4YKJ A;  3U65 A;  2O7I A;  1NV3 A;  3NOH A;  2MKZ A;  3IX1 A;  5KCJ A;  1UTH B;  3RUM A;  2HPG A;  1MXW A;  1MPB A;  1BK4 A;  1NH7 A;  3LBS A;  1NUZ A;  3FJM A;  2P1S A;  4O7M A;  3E78 A;  4F3P A;  4PGN A;  1A99 A;  3QMF A;  3TQW A;  5DEX B;  5CRY A;  4QF9 A;  1SI0 A;  3FD3 A;  1JEU A;  2Q2A A;  4FJP A;  4H8I A;  1OVB A;  1OVT A;  5IZ3 A;  5ESY A;  3ECR A;  1FBP A;  3LSL A;  4HTG A;  2IA4 A;  1JNF A;  3HST A;  1ELJ A;  4PCD A;  2H5Y A;  2VGQ A;  5FHM A;  2PFZ A;  3OEK A;  1IMA A;  2O1M A;  1YPN A;  1Y3N A;  1KA1 A;  3B8B A;  1Q1K A;  4GVO A;  4GWU A;  3OEM A;  3IJX B;  1AH5 A;  2L5V A;  4G77 A;  3H06 B;  4EQ7 A;  2FHY A;  3SEW A;  1IME A;  4OTE A;  4H5G A;  2R9J A;  4U21 A;  4PFI A;  4I3Y A;  4U23 A;  1JVY A;  2DDK A;  4PFB A;  2I0C A;  3IOW A;  2UVJ A;  4U1Z A;  2O68 A;  1LAF E;  4KCD A;  2XXP A;  1NNK A; 
#chains in the Genus database with same CATH homology
 3RT6 B;  3N26 A;  2RC9 A;  3G3H A;  4G68 C;  1QVS A;  3K6W A;  3KFM A;  4OER A;  1RKM A;  1SDX A;  2B3F A;  5TPA B;  4BDQ A;  2F5X A;  4YB6 A;  4DE8 A;  3DP8 A;  3K01 A;  3EN3 A;  3KG2 A;  3BKI B;  4ESW A;  4KYS A;  5I2K B;  4DXC A;  2XXQ A;  3C34 A;  2OK2 A;  4G68 B;  3H7M A;  5K2Y A;  2QMW A;  2RIN A;  3TTN A;  5BWJ A;  4ZEC A;  3CFZ A;  1IUD A;  1GR2 A;  3ZKK A;  3BBR A;  2A5T A;  4JB7 A;  4GQO A;  1NNT A;  5BUU A;  3KN8 A;  2DP8 A;  3PPQ A;  4UA8 A;  4QFN A;  2FYI A;  4I62 A;  2DSF A;  2DE3 A;  3M3F A;  2ZMB A;  3QUF A;  2Q89 A;  2XX8 A;  1SI1 A;  1A8F A;  3PMV A;  1PC3 A;  1ZU0 A;  3GBB A;  1P1N A;  1XS5 A;  4H0W A;  1AIV A;  1IXH A;  4KYD A;  4BLA A;  2QS4 A;  1XHY A;  5DVI A;  3FAT A;  3F11 A;  3PUW E;  4RPN A;  3FV1 A;  1SW5 A;  1B3E A;  1D9V A;  1MY2 A;  4LZ5 A;  3MW0 A;  1RYX A;  3ZS6 A;  3H3G A;  4QSE A;  2ONR A;  4JSO A;  2H25 A;  3G3J A;  3VLU A;  1BKA A;  2P2A A;  3PGF A;  1Q35 A;  1O63 A;  1H76 A;  3HCQ A;  2QS2 A;  1XT8 A;  1IXG A;  3PUZ E;  1D9Y A;  4RA1 A;  3VFJ A;  4WXJ A;  1VR5 A;  4NF6 A;  3H6T A;  1T0K A;  3C33 A;  4C1U A;  1B5J A;  3E4R A;  1MY4 A;  2W7Y A;  1R9Q A;  5H8F B;  3TEP A;  2O84 X;  3RQT A;  4Q8R A;  1RYO A;  1N84 A;  2NVU B;  3FXR A;  1EZP A;  4R75 A;  2Y84 A;  4FE8 A;  1MXZ A;  4IO4 A;  4DZ1 A;  1TT1 A;  1GV8 A;  1QUI A;  2XXV A;  3UP9 A;  1N3X A;  1M5D A;  2VHA A;  1NNF A;  4EQ9 A;  5B70 A;  4IO7 A;  3IB2 A;  3OO7 A;  3K4U A;  2V3U A;  4KD5 A;  1XVY A;  2OWT A;  1UIU A;  4HCY A;  4R2B A;  3MP8 A;  5A5X A;  2FA7 A;  4GL8 A;  4POW A;  3G3K A;  4QRZ A;  4QSC A;  5JTY A;  3MBP A;  4IGR A;  1MXX A;  4NF4 A;  2Z8F A;  3GXA A;  4H67 A;  4NTL A;  1LGB C;  4X1D A;  4YAH X;  1P99 A;  2RKM A;  3H4Z A;  3PPO A;  4FEC A;  3T9V A;  5L9O A;  1MPC A;  4N6P A;  3G3I A;  4TOZ A;  1URD A;  1B1H A;  4MLV A;  3FVO A;  1NNP A;  1VFE A;  3CIJ A;  3U93 A;  1LBB A;  4F2Q A;  4OVJ A;  3MWB A;  4GOT A;  4HCW A;  4QFP A;  2F34 A;  2F7C A;  2QMX A;  3LSX A;  3MPK A;  4F29 A;  1USY H;  3QSL A;  2XXU A;  4P11 A;  4IO3 A;  3N6T A;  4H6D A;  4P0I A;  3OO9 A;  2F97 A;  2DYX A;  4DLD A;  1FQE A;  3EHU A;  3G7W A;  4GL0 A;  3Q27 A;  5H8N A;  2ZXT A;  1PBQ A;  2XX9 A;  5DVF A;  4NF5 A;  3FJ7 A;  3LUY A;  3O6G A;  3A3C A;  1Y1M A;  3IAZ A;  2AYS A;  1DPP A;  4TLM B;  3PD9 A;  2HQ0 A;  2Q2C A;  1LB8 A;  1B0H A;  4NWC A;  3KOS A;  2DWH A;  4G2Z A;  3GZG A;  2XHD A;  2PYY A;  1EZ9 A;  2PX1 A;  1FTL A;  5EYF A;  3T93 B;  1SYH A;  3BFU A;  3VVF A;  4LQ5 A;  1MQD A;  3O29 A;  1NFT A;  3RGY A;  5I84 A;  2A5T B;  1SQY A;  3MVW A;  4BDO A;  2OZZ A;  2REJ A;  4EXL A;  2HAV A;  1MM7 A;  3KN3 A;  3KGC A;  4ZEK A;  1ZTY A;  3EF7 A;  5H8Q A;  1AOV A;  1HSL A;  1A55 A;  3IB1 A;  1Z7M E;  1FTM A;  2PVU A;  1MXU A;  3LR1 A;  2OBG A;  3SEX A;  1N7X A;  3PUX E;  3S9N C;  5ISU A;  1B4H A;  4PQJ A;  3VE1 B;  4TLL B;  4R2F A;  1MXV A;  3C36 A;  4RXL A;  4YB7 A;  2QJE A;  4F1V A;  2UVI A;  3GBA A;  3VVD A;  3S9L C;  3KN7 A;  5L8D A;  3C35 A;  3MZ1 A;  4KR5 A;  3PD8 A;  1JQF A;  3OMB A;  2Z8D A;  1LLS A;  2UXA A;  3T9X B;  2G29 A;  3KZG A;  3RTF B;  2V3T A;  1CB6 A;  3T9U A;  3UIF A;  3I6V A;  3FAS A;  1N7W A;  2OLB A;  4NF8 B;  1YTV A;  4DCX A;  2Y7W A;  1LCT A;  2Y7R A;  1QUK A;  2H4I A;  3H6V A;  1D3K A;  5AA2 A;  3RLF E;  3T9H B;  2LAO A;  2V93 A;  1PBP A;  3EHS A;  1WOD A;  2F36 A;  4O3C A;  3FZV A;  3PPN A;  1DSN A;  2O69 A;  3L6G A;  1H43 A;  5I2N A;  1ANF A;  2ESN A;  4F3B A;  4Q0C A;  3KBR A;  3FGS A;  3K1P A;  3B6Q A;  3MZ9 A;  3QIM A;  4F18 A;  1H45 A;  5B7D A;  3OD7 A;  3W9V A;  4QFL A;  2PT2 A;  3MC2 A;  3FVG A;  3HHF A;  4H1X A;  4PET A;  3JYR A;  1ZKB A;  3LSF B;  3RN8 A;  4HW8 A;  2UYE A;  4I8C A;  1Y4C A;  4E0W A;  5I59 A;  3MAM A;  2DWJ A;  1IXC A;  1B7U A;  4U22 A;  4KCC A;  5A5X B;  4GFR A;  3IOV A;  1FQB A;  4ESX A;  2AL5 A;  1MQJ A;  1NH8 A;  2UYF A;  3VXB A;  1MQH A;  2PBW A;  4LA9 A;  4LON B;  4IO6 A;  1B7Z A;  4BDR A;  1MPD A;  3SDF A;  2Z22 A;  2X26 A;  4OFL A;  3KJ7 A;  3VLV A;  4FAJ A;  4EXK A;  4NF4 B;  4RNS A;  3R6U A;  2DXR A;  1DOT A;  3OSQ A;  2GHB A;  2O7U A;  2DVZ A;  4X9T A;  2XD2 A;  3QUJ A;  1M5E A;  1FQA A;  1ATG A;  3B6W A;  1A8E A;  4MFI A;  5CI5 A;  1B2H A;  2XXY A;  2GRV A;  4ELO A;  1II5 A;  2VOZ A;  4OQO A;  3PUY E;  4YKK A;  5I58 A;  3KSJ A;  3TEL A;  1S7Y A;  3QYT A;  5H8N B;  5F1Q A;  1MY0 A;  5I57 A;  1XVX A;  1N04 A;  5M2V A;  5ICQ A;  3A09 A;  2Y7K A;  3O97 A;  2OWS A;  3K02 A;  4NF5 B;  3T96 B;  2XXW A;  3CFL A;  2YLN A;  1SW2 A;  2ZYN A;  1O7T A;  1SBP A;  4YMA A;  3LC8 A;  4OWD A;  3O6I A;  4R72 A;  3RPW A;  1B40 A;  1Y20 A;  3K1M A;  1ZLQ A;  3TCH A;  1LAX A;  1SYI A;  2V3Q A;  2NOO A;  4FAT A;  1B51 A;  1VSO A;  1UIV A;  2Q88 A;  2D5W A;  5CMK A;  2XX7 A;  3OOA A;  1LST A;  3U1O A;  4JWO A;  4ZEI A;  2AL4 A;  3MPL A;  2E1S A;  2I6E A;  4DIG A;  3FVN A;  3K1N A;  3IO6 A;  1MG1 A;  1DMB A;  2CZL A;  3MQ9 A;  1OLA A;  5H8Q B;  1P1O A;  4QFO A;  1MQI A;  2I58 A;  3M3K A;  3VXC A;  4PFW A;  2BJJ X;  4E0X A;  3ODB A;  4OES A;  3IL1 B;  1QUL A;  2I49 A;  4FEB A;  3TCF A;  3DP4 A;  4RK2 A;  3MVZ A;  4O3A A;  4ZDM A;  4YKP A;  2RCA A;  1Y1Z A;  5FHO A;  3Q26 A;  4L17 A;  3O66 A;  3TPA A;  4U2R A;  4WEP A;  4XXU A;  2RF1 A;  3RNN A;  2Z8E A;  4YKI A;  2ZYK A;  4LZ8 A;  3U92 A;  4DCY A;  3HV1 A;  4JBZ A;  4THI A;  4Z0I A;  1NKX A;  4M4G A;  3Q28 A;  4PFT A;  2NWJ A;  1MH3 A;  3KOT A;  4OEN A;  4XKQ A;  3DM0 A;  5AA2 B;  2ALU A;  2ZYM A;  1IQ7 A;  4R9F A;  5AA3 A;  3VLW A;  4F3G A;  3LSW A;  3QXM A;  3K00 A;  1MDP 1;  4G8M A;  5AE4 A;  3IOR A;  4ZE8 A;  5I2N B;  3CRB A;  5KCJ B;  2ZNU A;  3V5A A;  4PFU A;  4I9D A;  3O2A A;  1SVX B;  1OQG A;  4IO2 A;  5AA1 A;  3G3G A;  3OEL A;  1FTJ A;  2WKY A;  5DYH A;  4OEV A;  4K3F A;  3ILU B;  3B7D A;  1R9L A;  1GTK A;  1I6Q A;  5AA4 A;  4PP0 A;  4H5F A;  5I59 B;  4GXS B;  1A7L A;  2F6G A;  3FV2 A;  5L9M A;  2I4B A;  2QS3 A;  5HM4 B;  2QS1 A;  1TWY A;  2DE2 A;  1I6A A;  2VP1 A;  3KEI A;  2OJT A;  5CBR A;  1XC1 A;  5CMC A;  3MP1 A;  3CG3 A;  2YJP A;  3PUV E;  3S9E A;  4WED A;  3JV9 A;  1JVX A;  5I2K A;  2B65 A;  1ZBM A;  4IY6 A;  4C1T A;  2NXO A;  1B32 A;  1FQC A;  1AMF A;  3CI8 A;  3CSG A;  3PMX A;  5FTI A;  1TFA A;  2D21 A;  1AL3 A;  1H44 A;  4KHZ E;  4ND9 A;  4F1U A;  3I5O A;  1VFD A;  4GIZ A;  3PPR A;  1EU8 A;  4Q5T A;  4RYA A;  5I58 B;  4R6Y A;  3E3K A;  3T66 A;  4POX A;  4MF3 A;  1LAH E;  4LZ7 A;  3B6T A;  3CR9 A;  5ITP A;  4OFJ A;  5I57 B;  1PB8 A;  4AB6 A;  4EF1 A;  3QAX A;  1QKA A;  4N13 A;  4ELP A;  2CMO A;  4F19 A;  1VE4 A;  3RY3 A;  3EQ1 A;  4F2O A;  1JEV A;  3IOT A;  5CMB A;  3ILT B;  3TTR A;  2M8C A;  4G8H A;  4ZZE A;  3OO6 A;  3IJO B;  2I48 A;  5L9S A;  3HHG A;  2XXX A;  2ONK E;  1B4Z A;  1MXY A;  3TKD A;  4OFO A;  2XXT A;  4ZS9 A;  3UGW A;  1MM6 A;  1Y9U A;  4F22 A;  4JWX A;  2RCB A;  1POY 1;  4BDL A;  4H8J A;  3R26 A;  3SES A;  4ELQ A;  3L6H A;  4HS7 A;  3O6H A;  1PB7 A;  2XD3 A;  3WAF A;  4F39 A;  1PB9 A;  1ZIU A;  2UVG A;  1Y3P A;  3UN6 A;  3FVK A;  5LOM A;  4EUO A;  5EHS A;  4WKM A;  3TZA A;  1O64 A;  2QL3 A;  4NF6 B;  3TAJ A;  4XIG Q;  2X7P A;  1FQF A;  1R1N A;  1B05 A;  3EHT A;  1IIW A;  4GWO A;  1LFH A;  4R9G A;  2P0S A;  4G8N A;  1BTJ A;  4GXA A;  3H6U A;  5TP9 A;  1SD3 A;  5ITO A;  2GHA A;  4OEU A;  1BP5 A;  1Z7N E;  2XXH A;  2DWI A;  4ONY A;  3V8X B;  1IZ1 A;  5CM6 A;  5K2X A;  4JWY A;  1M5F A;  1A54 A;  4M1V A;  4DDD A;  1US4 A;  4GD5 A;  2R6G E;  1MQG A;  3O9P A;  1B1X A;  5KZT A;  4X1B A;  3MJN A;  2DQV A;  1MDQ A;  2I3V A;  3K0V A;  4QHQ A;  4ZZA A;  4LVQ A;  2XXI A;  1Y3Q A;  5KDT A;  4NED A;  3SEY A;  3U8Q A;  3CSB A;  2HCA A;  1GVC A;  4KYE A;  3MP6 A;  2DVC A;  2HXW A;  3PU5 A;  5JTY B;  2V25 A;  1TXF A;  2QSX A;  4RJZ A;  1P1W A;  4UAC A;  5JEI A;  3OO8 A;  5DVJ A;  1R6Z A;  1HSJ A;  4EF2 A;  4JSD A;  1LB9 A;  4FOR A;  3SET A;  4KQP A;  4I1D A;  4O3B A;  4EDP A;  1L5T A;  1OIB A;  1KWH A;  3IO4 A;  4TQU Q;  1IXI A;  3DP6 A;  4P0G A;  5CBS A;  4ISU A;  4ZEF A;  5AA4 B;  2QPQ A;  2X7Q A;  2F7B A;  3BFT A;  4DXB A;  4PFY A;  4IB2 A;  3WAE A;  1S50 A;  3M3L A;  4LQ2 A;  2V84 A;  1LFG A;  2YPN A;  2VD3 A;  4GLI A;  4DXU A;  1DTZ A;  3EPE A;  4ECF A;  4YIC A;  1P1Q A;  2A5S A;  2PMS A;  4FED A;  4NMY A;  4KPT A;  2F6P A;  1FTO A;  3CVG A;  4YMB A;  4OZ9 A;  3W15 C;  1H3D A;  1NL5 A;  1ZJL A;  2HEU A;  4OYV A;  3RT8 A;  1IIT A;  1N3W A;  4ZEB A;  5FTH A;  3K2D A;  5H8H A;  3V83 A;  3C32 A;  2HZL A;  3TCG A;  4U4S A;  4ELR A;  3TQL A;  1PEB A;  3DLN A;  3PMW A;  4RPO A;  4IGT A;  1URG A;  4RK9 A;  4ZED A;  3VV5 A;  4NE4 A;  3HN0 A;  3VVE A;  5JK4 A;  1B5H A;  3P7I A;  1UTB A;  5H8S A;  2ZYO A;  2UVH A;  3PV0 E;  4R6H A;  3N5L A;  2G93 A;  3KSX A;  1B9J A;  2Y7I A;  5I56 A;  4H65 A;  3TMG A;  1QJM A;  3N94 A;  3IR1 A;  3SEV A;  3TTL A;  3JZJ A;  3OSR A;  2REG A;  4LUB A;  4MH5 A;  1DPE A;  2XXR A;  1QKB A;  2ANJ A;  4QSD A;  1LFI A;  4AQ4 A;  3MVX A;  5EHM A;  3A3U A;  1B7H A;  2DXY A;  1CE2 A;  4GF8 A;  3T22 A;  3AXF A;  4IY5 A;  5DTB A;  1OQH A;  3CFX A;  4C0R A;  4X48 A;  1YAE A;  4U1O A;  3FXU A;  4R74 A;  4OET A;  5IAI A;  4N07 A;  2HZK A;  1J1N A;  4NF8 A;  2I3W A;  5ELV A;  1B3G A;  1HSE A;  2O51 A;  1F9B A;  1FCK A;  3I3V A;  2RC8 A;  4OXV A;  1M5B A;  2QRY A;  3C31 A;  2Q8J A;  3UOR A;  3W9W A;  1PDA A;  1TFD A;  2H9B A;  1FTK A;  3MUQ A;  1UTH A;  3TOD A;  2KLF A;  4G4P A;  3Q25 A;  1I6B A;  1JW1 A;  5TU0 A;  1MY3 A;  3IOU A;  4FIM A;  4JXI A;  2F35 A;  1B3L A;  4R73 A;  3MZB A;  5DEX A;  2E0S A;  1B0L A;  4GRK A;  1B3H A;  3D4G A;  4YB5 A;  5TP9 B;  4KFQ A;  1EH3 A;  3K6X A;  3K6U A;  2ABH A;  1B52 A;  4MBP A;  3ZKL A;  1LAG E;  1JW4 A;  1OLC A;  3TUS A;  2GH9 A;  3V89 B;  5HPQ A;  3VDF A;  3SEU A;  1I69 A;  3N6U A;  3TTK A;  2ZNT A;  3HPI A;  4F3S A;  4XKP A;  3PPP A;  3TDJ A;  1LCF A;  1B58 A;  2VD2 A;  2RC7 A;  3FXQ A;  3RTW B;  3IB0 A;  4MLQ A;  4RY1 A;  3KJT A;  3DEL B;  3IK6 B;  1B46 A;  5KDT B;  1N76 A;  3THI A;  3R7X A;  3E9X A;  2DOJ A;  4U4X A;  4F31 B;  3ONM A;  1MH4 A;  5DT6 A;  1UQW A;  4KI0 E;  2NUV A;  4YU0 A;  3D4C A;  3U72 A;  1MS7 A;  5TPA A;  2ZNS A;  3C9H A;  1DTG A;  5IKB A;  3CG1 A;  1Y4T A;  2AIX A;  1M5C A;  4QFK A;  4G68 A;  4ZE9 A;  5FHN A;  1XOC A;  3O28 A;  4F1Y A;  1EZO A;  1D4N A;  3H6W A;  1WVJ A;  2B3B A;  5AA2 D;  2D3I A;  2FNC A;  5F7V A;  3E13 X;  1ZMG A;  1MRP A;  4NWD A;  2Y7P A;  1SW4 A;  3C4M A;  4LAT A;  5CC2 A;  2Q9T A;  4BDM A;  3FUZ A;  3HO7 A;  2DE4 A;  2THI A;  1POT A;  4EQB A;  3S9M C;  4IO5 A;  4XTC Q;  3G3F A;  1NMU A;  1QUJ A;  1GGG A;  4Q30 B;  3TFL A;  1B3F A;  2DWA A;  3SER A;  1SW1 A;  1JET A;  3K6V A;  3MVY A;  1BIY A;  5H8H B;  2I4C A;  3OEN A;  4YZZ A;  5ICT A;  3USD A;  2HAU A;  1QW0 A;  1FQD A;  4JDF A;  1URS A;  2DS9 A;  3U94 A;  1BLF A;  1P1U A;  3H03 A;  1UTB B;  3OXN A;  3S2V A;  4OMB A;  2HFB A;  3S4U A;  1A40 A;  2F78 A;  1N0T A;  3Q29 A;  3GLB A;  2PT1 A;  1FW0 A;  4BDN A;  4LP2 B;  3ZSF A;  1B5I A;  5I56 B;  1IEJ A;  3TTM A;  2I0B A;  3FJG A;  1S9T A;  2H98 A;  5J1D A;  1JW5 A;  3FIR A;  4XKR A;  2O1L A;  4R6K A;  5H8F A;  4AB5 A;  2O6A A;  1B6H A;  3UK4 A;  2GFE A;  3QK6 A;  2F7A A;  2F8D A;  2R71 A;  1LBC A;  5CMM A;  5HBC A;  1YCJ A;  2H99 A;  3SKP A;  1MY1 A;  4OHN A;  2IEE A;  3TYH A;  4PE5 B;  3M8U A;  1US5 A;  3UA8 A;  4XKN A;  1OMP A;  1USY E;  2ONS A;  2Z23 A;  4Z7E A;  2OCU A;  1WDN A;  4YKJ A;  2O7I A;  3IX1 A;  5KCJ A;  1UTH B;  3RUM A;  1MXW A;  1MPB A;  1NH7 A;  3LBS A;  3FJM A;  2P1S A;  4F3P A;  1A99 A;  3TQW A;  5DEX B;  5CRY A;  4QF9 A;  1SI0 A;  3FD3 A;  1JEU A;  2Q2A A;  4FJP A;  4H8I A;  1OVB A;  1OVT A;  3ECR A;  3LSL A;  4HTG A;  2IA4 A;  1JNF A;  3HST A;  1ELJ A;  2H5Y A;  2VGQ A;  5FHM A;  3OEK A;  2O1M A;  1YPN A;  1Y3N A;  1Q1K A;  4GVO A;  3OEM A;  3IJX B;  1AH5 A;  4G77 A;  3H06 B;  4EQ7 A;  3SEW A;  4OTE A;  4H5G A;  2R9J A;  4U21 A;  4U23 A;  1JVY A;  2I0C A;  3IOW A;  2UVJ A;  2O68 A;  4U1Z A;  1LAF E;  4KCD A;  2XXP A;  1NNK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...