1PB7A

Crystal structure of the nr1 ligand binding core in complex with glycine at 1.35 angstroms resolution
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
289
structure length
281
Chain Sequence
TRLKIVTIHQEPFVYVKPTMSDGTCKEEFTVNGDPVKKVICTGPNHTVPQCCYGFCIDLLIKLARTMNFTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKGTRITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSHENGFMEDLDKTWVRYQECDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligand binding protein
molecule keywords N-methyl-D-aspartate Receptor Subunit 1
publication title Mechanisms of activation, inhibition and specificity: crystal structures of the NMDA receptor NR1 ligand-binding core
pubmed doi rcsb
source organism Rattus norvegicus
total genus 78
structure length 281
sequence length 289
ec nomenclature
pdb deposition date 2003-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1pb7A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1pb7A02
2QS1A 1B7ZA 4G68A 4GQOA 3M3LA 4F22A 4BDOA 5KDTB 1IEJA 3UK4A 1MQJA 3K1MA 1D3KA 1QJMA 4IGTA 1IZ1A 2DE3A 2H4IA 2Z8FA 3E13X 2I58A 1LFIA 1DSNA 5B70A 4P11A 3VLVA 1P1UA 4MLQA 1DOTA 3PUYE 5CMCA 3U1OA 3RLFE 1QVSA 1I69A 2Y7WA 5I57A 3FATA 3T9UA 4PE5B 4BDLA 4ZEKA 3QAXA 4IO7A 4ND9A 1BKAA 3UA8A 4P0GA 4L17A 4EF2A 1B3LA 3FJ7A 2HZLA 2DP8A 5AA2A 4JSOA 2Q2AA 2O1MA 3CFZA 4KYDA 3QUJA 1MS7A 3T93B 4O3CA 1PBQA 3KN8A 2I49A 3M3KA 3C33A 1A8EA 1LCTA 4LVQA 1NFTA 4KYSA 4DIGA 2ZYOA 3S4UA 3TAJA 4Z7EA 3HCQA 4C1TA 1XC1A 3MJNA 5KCJB 1SDXA 4IB2A 3TELA 3FASA 4XIGQ 4AB6A 1VSOA 4YU0A 3Q27A 1F9BA 3DLNA 2DWAA 1ZKBA 4TQUQ 4IY5A 3N5LA 1PC3A 3MVYA 1MG1A 3MPLA 2QL3A 1UTHA 5H8SA 4BDNA 3SETA 1MQHA 3LR1A 1P1WA 4YZZA 1ANFA 1FQAA 3EHSA 3A3CA 1S7YA 1SI1A 3MBPA 1O63A 2F6GA 1O64A 4XKRA 3KGCA 2F34A 5EHSA 5AA3A 3MQ9A 1WVJA 3IL1B 1B51A 4U22A 4U1ZA 1URDA 2XXIA 1FTMA 3QXMA 2YJPA 3F11A 2HCAA 1UIUA 4OVJA 5CMKA 4OXVA 2NOOA 5FTIA 1IQ7A 2V3UA 1B32A 4RXLA 3H6WA 3RTWB 1PB7A 1JVYA 3FUZA 5ITOA 4H0WA 4ZEDA 4NEDA 1Z7ME 1TFAA 1MDQA 3KOSA 4R9FA 3KG2A 2PBWA 2AIXA 1QKAA 2Q89A 3HHGA 3HV1A 5H8FA 2Q2CA 3SEUA 1AH5A 3RT8A 2OK2A 3T9VA 3QK6A 1LB8A 2XXVA 1B5JA 2B3BA 3S9MC 1M5FA 1XHYA 1H45A 2I6EA 2XXHA 2XX9A 3WAEA 1MXZA 4G8NA 4YB7A 1LAGE 1NNTA 4QFLA 3U72A 4F19A 3TFLA 2XXQA 3BKIB 3DP8A 4NF4A 1O7TA 2R6GE 1T0KA 1GR2A 2O51A 3SKPA 4ZE9A 1OMPA 1BP5A 1XOCA 5ISUA 5F7VA 3QUFA 3B6WA 3IB0A 3TQWA 4DZ1A 2F35A 5JEIA 1XVXA 1PDAA 4X9TA 3R7XA 2AYSA 1B7HA 3O2AA 5KDTA 2BJJX 4JWYA 5I2KB 5EHMA 3MZ9A 4YAHX 3MW0A 2HXWA 3B6QA 4OENA 3TDJA 3K0VA 2XXWA 2DE2A 2QS3A 3TQLA 2Z8EA 3EHTA 2X7QA 3OO9A 2X26A 3G3IA 3G3JA 3PPPA 2XXYA 3TTNA 1P1QA 2Q88A 1ZJLA 5B7DA 1II5A 4RY1A 5HM4B 2ZNSA 4DCYA 5FHOA 1B5IA 3JZJA 3H7MA 4DDDA 3VFJA 2G93A 4FATA 4I1DA 2OCUA 3BFUA 1DPPA 1LBCA 3G3KA 4GF8A 2OWSA 4LA9A 2GH9A 5H8QB 3TKDA 3HO7A 4YB6A 3LSXA 3SEWA 1MDP1 4KD5A 3FJMA 5I2NB 4IO6A 1R9QA 2H25A 4R73A 2LAOA 4LZ8A 3PUXE 3GBBA 2DS9A 4U21A 1VR5A 2ZYNA 2ZYKA 3LUYA 1DTZA 4O3AA 4JSDA 1JEUA 4HCWA 4IY6A 5H8HB 1MXUA 3KN7A 3SEYA 3JV9A 3K6WA 3C32A 3O66A 3FJGA 4XTCQ 3LC8A 4ECFA 2F6PA 3LSWA 2UVGA 2DWHA 4ELOA 1ZMGA 3ILTB 1LCFA 3E9XA 2H99A 4GVOA 2O7IA 2D5WA 2VOZA 1SW1A 3N6TA 4YMAA 1HSEA 4OWDA 2HAUA 3OOAA 3KSJA 4JDFA 3HSTA 5TPAB 4ZE8A 3D4GA 5IKBA 3FVOA 1USYE 1LFHA 3P7IA 4F3BA 3VLUA 2O6AA 3THIA 2AL5A 1XT8A 3SDFA 1JEVA 4YKIA 3S2VA 4QSDA 4KCCA 4R6KA 4LZ7A 1EH3A 3SEXA 1UTBA 3FIRA 5EYFA 3DP6A 1BTJA 4GRKA 2O1LA 2ZNUA 3OELA 3BFTA 1LGBC 1JW4A 5BUUA 3MZBA 2A5TB 2XD3A 3VE1B 4WKMA 3IO4A 1A55A 3QSLA 3ECRA 3VV5A 3L6HA 1NNFA 5DEXB 4H8JA 5KZTA 4R2FA 4KQPA 3R26A 3GLBA 1A99A 1XS5A 2Y84A 4WXJA 5I59A 2THIA 4TOZA 3KJ7A 4U2RA 3MVWA 4RNSA 4DLDA 1MY1A 4OYVA 1MY4A 4JWXA 2O84X 5HPQA 5CM6A 1ELJA 3Q28A 4EQ7A 4EF1A 4MH5A 4RYAA 4OZ9A 4F2QA 1N7WA 3OO7A 3IX1A 3PPNA 3UP9A 1MQDA 4NWCA 3L6GA 4YMBA 3MC2A 4LONB 4PFTA 1B3GA 3FD3A 3PD8A 3M3FA 3KFMA 4EUOA 1UIVA 4OEUA 1MRPA 3S9LC 1NNKA 3TTKA 5I56B 4GIZA 4K3FA 2H9BA 1LFGA 3PMXA 1ZU0A 2B65A 2UVJA 2Z23A 2I4CA 4X48A 4DXCA 2Y7PA 4KI0E 2HZKA 3FXQA 2WKYA 5I58A 4FECA 1IIWA 2V93A 1SBPA 1SYIA 3FVNA 3IR1A 4QFNA 2VD3A 2XD2A 2CMOA 2RKMA 2UYFA 1S9TA 1M5DA 2PX1A 3C34A 4PFWA 4RA1A 2DOJA 1JVXA 4IGRA 4F1YA 2ESNA 3G3FA 4R6YA 5AA1A 4Q5TA 4R2BA 5A5XA 3C31A 2PVUA 1MM7A 3CG1A 3UN6A 3VVEA 4Q0CA 4FEDA 5AA4B 4JB7A 4RK9A 1D9YA 5AE4A 4F1VA 5L9OA 3U94A 4H5FA 3CR9A 4ZDMA 3S9NC 1H43A 3I6VA 2UVHA 4F2OA 3S9EA 3FV1A 2A5SA 4YKPA 4OFJA 3EHUA 3UGWA 1FCKA 1QUKA 4Q8RA 1FQDA 5I84A 1MQGA 3CRBA 1ZTYA 4OESA 3FXRA 3CSGA 1KWHA 4OHNA 1A40A 3QYTA 1SQYA 1AIVA 3C9HA 1SVXB 1B3HA 2XXUA 1Y3NA 5I2NA 2HFBA 4DXUA 3DELB 4UA8A 2FYIA 3N26A 2D21A 4QFPA 2H98A 5JK4A 2DXRA 1B3EA 2I48A 1Y1ZA 2UXAA 2QPQA 3B7DA 1URGA 3GZGA 3PPRA 3ODBA 1SW2A 1B6HA 2VD2A 1YPNA 4G68B 1MPBA 2RINA 1MXWA 3KZGA 4HS7A 3T66A 4QSCA 2HEUA 1EZ9A 1ZLQA 1B9JA 1Y4TA 4R74A 3N94A 3H03A 4GFRA 4LQ5A 2F7AA 2KLFA 3OSRA 3OEKA 1A54A 1AMFA 4TLLB 4ELRA 4HTGA 1FTJA 1B0HA 4IO5A 5K2YA 1P1OA 2DQVA 1N76A 3O6HA 1TFDA 1CB6A 1LSTA 3O6IA 1FTKA 4KPTA 5TPAA 3VVFA 3O6GA 2F5XA 2DSFA 4ONYA 2F36A 2QJEA 2P2AA 2REGA 3CIJA 4I9DA 1Y20A 1OVTA 5FTHA 5ITPA 4MF3A 3DP4A 1YCJA 1J1NA 4H1XA 2HQ0A 4JXIA 1B3FA 2Y7KA 4ZS9A 3KEIA 1Q35A 5DYHA 1CE2A 1BIYA 1SW5A 4ZEIA 5AA2B 1TT1A 1B46A 3K1PA 5CBSA 1US5A 2PMSA 3TTLA 4EQ9A 3W9WA 3MP1A 4ESWA 4U23A 4X1BA 2GHBA 3PGFA 4FIMA 3K2DA 3V83A 1GV8A 4U4XA 1AL3A 3TZAA 4GD5A 4E0WA 1ZIUA 3GBAA 3Q26A 3UIFA 3RGYA 5CC2A 1FQEA 2RC8A 1JNFA 2OJTA 3G7WA 1AOVA 2Y7IA 3MPKA 3GXAA 4P0IA 4HCYA 2HAVA 1MY3A 1SI0A 3M8UA 2I0CA 5CI5A 5J1DA 2Y7RA 4ZEFA 3K1NA 1DTGA 2DYXA 2F7CA 3FVKA 2OBGA 4XXUA 1P99A 1H76A 3PPOA 3IORA 4PQJA 4EXLA 5I56A 4H5GA 1R9LA 1URSA 1EZOA 4G77A 4POXA 2IA4A 3CVGA 3C36A 3H06B 4GL0A 4XKPA 1Y3QA 2Z8DA 4FEBA 1FTOA 3OO8A 1B1HA 3LSFB 1B4HA 5KCJA 1NNPA 3K01A 4KFQA 1MXXA 2Q9TA 1B05A 2XXXA 1RKMA 4YKJA 4M1VA 3O9PA 1NH7A 1TXFA 5K2XA 3EN3A 3O97A 1MM6A 1POTA 4M4GA 5M2VA 5AA4A 4XKNA 3MVZA 1YTVA 3MP6A 1H44A 1B40A 4ZEBA 3BBRA 5DVFA 2ZYMA 3RTFB 3ZS6A 3KBRA 1SD3A 1OVBA 1JETA 3ILUB 3RUMA 3PV0E 4QFKA 1IXCA 2F78A 3HPIA 1MPCA 2XX7A 5H8FB 1ATGA 3OSQA 4H67A 4YB5A 4WEDA 3T9HB 4ESXA 3PUVE 4NF8B 4TLMB 2G29A 4ZZAA 3CFXA 1A8FA 3R6UA 2V3TA 4GLIA 3RN8A 1PBPA 4N6PA 4GXSB 1XVYA 2PT2A 1Y9UA 2I3VA 4G8HA 4O3BA 3OXNA 1WODA 4NF4B 3H6VA 3RNNA 1PB9A 1FQCA 2DVZA 4NWDA 2QSXA 3MAMA 4NF6B 4GL8A 3LSLA 3A09A 3IJOB 3IOTA 3FXUA 2PYYA 3T9XB 1L5TA 4Z0IA 4IO2A 4F3PA 2M8CA 4NTLA 4U1OA 1QUJA 3K6VA 1JQFA 4F31B 2E0SA 2UVIA 5TP9B 3TCFA 1I6AA 2NXOA 3HHFA 3TTRA 3VLWA 3D4CA 4E0XA 3QIMA 3PUZE 1P1NA 5JTYB 3I5OA 2P0SA 4KR5A 2GHAA 5ELVA 3O28A 4THIA 3SEVA 1LLSA 2CZLA 4LUBA 4QSEA 4ZZEA 2D3IA 4RPOA 3IOWA 3IOVA 5ICTA 2R9JA 1MY2A 2ONRA 5F1QA 5AA2D 2DE4A 4R9GA 4R6HA 3H6UA 4QRZA 1EU8A 4NF5B 4GWOA 3K6XA 2RC9A 4IO3A 3EF7A 4R72A 3CSBA 1QULA 1H3DA 1R6ZA 1TWYA 1M5BA 1I6QA 2DWJA 2VP1A 3K4UA 1NKXA 2FNCA 1HSJA 1S50A 3TYHA 5I2KA 4H65A 2V25A 2O68A 3SESA 4MLVA 1D9VA 2XHDA 1OIBA 3VVDA 4F3GA 2ONSA 4FE8A 3ZKKA 3MUQA 5TU0A 4U4SA 4BDRA 5FHMA 1I6BA 1R1NA 3OMBA 1LAFE 5CRYA 2O69A 1M5EA 1Y3PA 5ICQA 4HW8A 1N04A 3TCGA 1US4A 3EPEA 4OERA 5HBCA 4GOTA 4DCXA 5CBRA 3IK6B 3AXFA 3PMVA 2W7YA 2IEEA 2XX8A 3RQTA 4F1UA 4X1DA 1NMUA 3SERA 2YPNA 2DXYA 4C0RA 2QRYA 1B4ZA 4POWA 3E4RA 3USDA 5H8QA 3KOTA 1MPDA 3CG3A 1B0LA 1LBBA 2O7UA 4RPNA 4KHZE 1B2HA 2Z22A 3TEPA 1FQBA 3E3KA 3FZVA 2NVUB 5BWJA 5CMMA 3IO6A 4F18A 5H8NB 2GRVA 4FJPA 1N7XA 4QF9A 4BDQA 2ONKE 1MXYA 1UTBB 1B5HA 5H8HA 1B7UA 3U93A 3PD9A 3VDFA 3C35A 1A7LA 3IB2A 4YKKA 4LP2B 1FW0A 1N3XA 5L9MA 3H6TA 2RCAA 1MY0A 3VXCA 3OEMA 1FTLA 3RPWA 2XXPA 2V84A 1LAXA 1WDNA 1POY1 3UORA 3TCHA 3TODA 3CI8A 5L8DA 2H5YA 5DVIA 3TUSA 1Y1MA 5I59B 2Q8JA 1D4NA 3IOUA 3EQ1A 4I62A 2B3FA 1MXVA 3T22A 1IXHA 2F8DA 4NF8A 1MQIA 5I57B 3OD7A 1ZBMA 1YAEA 3Q25A 1HSLA 3Q29A 1IITA 4YICA 1B58A 4G8MA 3FGSA 4WEPA 3TTMA 3PMWA 3PPQA 2ZMBA 2F97A 3U92A 1MH4A 4MFIA 1VFDA 2PT1A 4QFOA 2VGQA 2YLNA 2ABHA 4ELPA 3T96B 2A5TA 4GXAA 3V5AA 1SW4A 1IXGA 3PU5A 4F3SA 3MZ1A 4EQBA 3W15C 3ONMA 2I3WA 4NF6A 3ZSFA 1IXIA 3FV2A 3W9VA 3MWBA 5DEXA 1NH8A 3G3GA 2XXTA 5I58B 2QMXA 3MVXA 5LOMA 2AL4A 4KCDA 3VXBA 3G3HA 2FA7A 5TP9A 3LBSA 3B6TA 1N0TA 1OQGA 4BDMA 5JTYA 3IAZA 4JBZA 1OQHA 3IJXB 4G68C 4NE4A 4OMBA 2ZNTA 5A5XB 1UTHB 2OLBA 4OTEA 3KJTA 2QMWA 1OLAA 3MP8A 1OLCA 4BLAA 4OEVA 4NF5A 1M5CA 2REJA 2ALUA 4AQ4A 4KYEA 4XKQA 3JYRA 2X7PA 1JW1A 3I3VA 4NMYA 2RC7A 2F7BA 4PFUA 3RT6B 1USYH 2GFEA 4H6DA 4N07A 2ANJA 1DPEA 1QW0A 4EDPA 4Q30B 1Y4CA 3RY3A 5CMBA 3TPAA 4FORA 4QHQA 4MBPA 2RCBA 3V8XB 4PETA 2R71A 2XXRA 1QKBA 3IB1A 1IUDA 5IAIA 4F29A 1B52A 3A3UA 5DTBA 2NWJA 2VHAA 3O29A 4PP0A 3H4ZA 4IO4A 2DWIA 3TMGA 2RF1A 2DVCA 4OFLA 1GTKA 4UACA 4EXKA 1GGGA 1RYXA 4OETA 1MH3A 1VFEA 4RJZA 1QUIA 1LB9A 3V89B 2ZXTA 4G4PA 3DM0A 3PUWE 3FVGA 3OENA 1B1XA 4G2ZA 5L9SA 1EZPA 1LAHE 2OWTA 3H3GA 1DMBA 4I8CA 3ZKLA 2QS2A 4PFYA 3KN3A 4ELQA 4DXBA 3HN0A 1Q1KA 2I0BA 3WAFA 3N6UA 1VE4A 2V3QA 1Z7NE 1NL5A 1N3WA 4JWOA 1RYOA 5DT6A 2QS4A 4RK2A 1PEBA 4DE8A 2E1SA 4FAJA 4ISUA 2OZZA 1GVCA 5DVJA 2NUVA 1BLFA 1JW5A 3K00A 3OO6A 3K6UA 4R75A 1N84A 5FHNA 2UYEA 4LZ5A 4N13A 3U8QA 3C4MA 4F39A 3K02A 3KSXA 4OFOA 4H8IA 2P1SA 1FQFA 5H8NA 4LQ2A 1SYHA 1UQWA 4AB5A 3CFLA 4OQOA 4C1UA 4LATA 1PB8A 2I4BA 4ZECA
chains in the Genus database with same CATH superfamily
2QS1A 4PGNA 2Q74A 1B7ZA 4G68A 4GQOA 3M3LA 4F22A 5EYGA 4BDOA 5KDTB 1IEJA 3UK4A 1MQJA 3K1MA 4QXDA 1D3KA 1QJMA 2F3BA 4IGTA 1IZ1A 2DE3A 4QBAA 2H4IA 2Z8FA 3E13X 2FVZA 2I58A 1LFIA 1DSNA 5B70A 4P11A 3VLVA 1P1UA 4MLQA 1FBHA 1DOTA 3PUYE 5ET5A 5CMCA 3U1OA 3RLFE 1QVSA 1I69A 2Y7WA 5I57A 3FATA 3T9UA 4GWSA 4PE5B 4GWWA 4BDLA 4ZEKA 3QAXA 4IO7A 4ND9A 1BKAA 3UA8A 4P0GA 4L17A 4EF2A 1B3LA 3FJ7A 4N4UA 2HZLA 2DP8A 5AA2A 4N8GA 4JSOA 4PTKA 1QGXA 2Q2AA 2O1MA 3CFZA 4KYDA 3QUJA 1MS7A 3T93B 4O3CA 1PBQA 3KN8A 2I49A 3M3KA 2OX3A 3C33A 1A8EA 1LCTA 4LVQA 1NFTA 4KYSA 4DIGA 2ZYOA 3S4UA 3TAJA 1EYIA 4Z7EA 3BIGA 4PAFA 3HCQA 4C1TA 4PAIA 1XC1A 3MJNA 5KCJB 1SDXA 4GX4A 4IB2A 3TELA 3FASA 4XIGQ 4AB6A 4UABA 1VSOA 4YU0A 3Q27A 1F9BA 3DLNA 2DWAA 1ZKBA 4TQUQ 4IY5A 3N5LA 4N8YA 1PC3A 5EQ9A 3MVYA 1MG1A 3MPLA 2QL3A 1UTHA 1LBXA 5H8SA 4BDNA 1NV7A 3SETA 1MQHA 3LR1A 1P1WA 4YZZA 1ANFA 1LEVA 1FQAA 3EHSA 5IGAA 3A3CA 1S7YA 1SI1A 3MBPA 1O63A 2Q8MA 2F6GA 1O64A 4XKRA 3KGCA 2F34A 5EHSA 5AA3A 3MQ9A 1WVJA 3IL1B 1B51A 4U22A 4DI3D 4U1ZA 1URDA 2XXIA 1FTMA 3QXMA 2YJPA 3F11A 5IZ3A 2HCAA 1UIUA 2JJKA 3NOHA 4OVJA 4GX6A 5CMKA 5IZZA 4OXVA 2NOOA 1YXIA 1IQ7A 2V3UA 5FTIA 1B32A 4RXLA 3H6WA 3RTWB 1PB7A 1JVYA 3FUZA 5ITOA 4H0WA 4ZEDA 1DCUA 4NEDA 1Z7ME 3E79A 1IMAA 2HXRA 2WYKA 1TFAA 4PAKA 1MDQA 3KOSA 4R9FA 3KG2A 2PBWA 3IFCA 2AIXA 4PDDA 1QKAA 4N6DA 5FBPA 2Q89A 3HHGA 3LUZA 3T0JA 3HV1A 5H8FA 2Q2CA 3SEUA 4HE1A 1AH5A 5IM2A 3RT8A 2OK2A 3T9VA 3QK6A 1LB8A 2XXVA 1B5JA 2B3BA 3S9MC 1M5FA 1XHYA 1H45A 2I6EA 2XXHA 2XX9A 3WAEA 1MXZA 4G8NA 4N17A 4YB7A 1LAGE 1NNTA 4QFLA 3U72A 4F19A 3TFLA 4H46A 2XXQA 3BKIB 3DP8A 4NF4A 1O7TA 3D1RA 2FIXA 2R6GE 1T0KA 1GR2A 2O51A 3SKPA 4ZE9A 1OMPA 1BP5A 1XOCA 5ISUA 5F7VA 3QUFA 1G0HA 3B6WA 3MSTA 3IB0A 3TQWA 4DZ1A 2F35A 1Q9DA 5JEIA 1XVXA 1PDAA 3MYUA 4X9TA 3R7XA 2AYSA 1B7HA 3O2AA 5KDTA 2BJJX 4JWYA 5I2KB 2BJIA 5EHMA 3MZ9A 4XEQA 4YAHX 3MW0A 2HXWA 3B6QA 4XFEA 4OENA 3TDJA 4MCOA 3K0VA 2XXWA 2DE2A 1RDZA 2QS3A 3TQLA 2Z8EA 3EHTA 2X7QA 3OO9A 2X26A 3G3IA 3G3JA 3PPPA 2XXYA 3TTNA 1P1QA 2Q88A 1ZJLA 5DW8A 5B7DA 1II5A 4RY1A 5HM4B 4NG7A 2ZNSA 1NUZA 4GWYA 4DCYA 5FHOA 1B5IA 3JZJA 3H7MA 4DDDA 1NV6A 3VFJA 2G93A 4FATA 4NHBA 4I1DA 2OCUA 2QFLA 3BIHA 3BFUA 1DPPA 1LBCA 3G3KA 1SPIA 5ET8A 4GF8A 2OWSA 2CEYA 4LA9A 2GH9A 5H8QB 3TKDA 1CNQA 3HO7A 4YB6A 3LSXA 3SEWA 1MDP1 4KD5A 2CZKA 3FJMA 5I2NB 4IO6A 1R9QA 2H25A 4R73A 2LAOA 4LZ8A 3PUXE 3GBBA 2DS9A 2XWVA 2WBDA 4U21A 4O8MA 1VR5A 2ZYNA 3U65A 2ZYKA 2OWZA 3LUYA 1DTZA 4O3AA 3KC0A 4JSDA 1JEUA 4HCWA 4IY6A 5H8HB 1MXUA 3KN7A 3SEYA 3JV9A 1FBPA 3K6WA 3C32A 3O66A 3A29A 3FJGA 4XTCQ 3LC8A 4ECFA 2F6PA 3LSWA 2UVGA 2DWHA 2VPOA 4ELOA 3T1BA 1ZMGA 2FIEA 3ILTB 1LCFA 3E9XA 1K9ZA 2H99A 2MKZA 4GVOA 2O7IA 2D5WA 2VOZA 1SW1A 3N6TA 4YMAA 5ET7A 1HSEA 4OWDA 2HAUA 3OOAA 3KSJA 5ESYA 4JDFA 3HSTA 3KBZA 5TPAB 4ZE8A 3D4GA 2VPNA 5IKBA 3FVOA 1USYE 1LFHA 3P7IA 4F3BA 3VLUA 2O6AA 3THIA 2AL5A 1XT8A 3SDFA 4PE3A 1JEVA 4YKIA 3S2VA 1XI6A 4MNCA 4QSDA 4KCCA 4R6KA 4LZ7A 1EH3A 3SEXA 5LDZA 1UTBA 3FIRA 5EYFA 3DP6A 1BTJA 4GRKA 2O1LA 2ZNUA 1FTAA 3OELA 3BFTA 1LGBC 1JW4A 5BUUA 3MZBA 2A5TB 2XD3A 3VE1B 4WKMA 1EYKA 3IO4A 4GWUA 1RDYA 1A55A 3QSLA 4IR8A 3ECRA 5LTCA 1YYZA 3VV5A 3L6HA 5I5PA 1NNFA 5DEXB 4H8JA 5KZTA 4R2FA 4KQPA 2P3VA 3R26A 3GLBA 1A99A 1XS5A 2PCRA 2Y84A 4MAGA 4WXJA 4I40A 4MJOA 1BK4A 5I59A 4PBHA 2THIA 4TOZA 1DK4A 4MX6A 4NAPA 3KJ7A 4U2RA 3MVWA 4RNSA 4DLDA 1MY1A 4OYVA 1MY4A 4JWXA 2O84X 5HPQA 5CM6A 1ELJA 3Q28A 4EQ7A 4EF1A 4P56A 4MH5A 4RYAA 4OZ9A 4F2QA 1N7WA 1JP4A 3B50A 3OO7A 3IX1A 2WYPA 3PPNA 3UP9A 1MQDA 4NWCA 3L6GA 4YMBA 3MC2A 4LONB 4PFTA 1B3GA 1LBYA 3FD3A 3PD8A 3M3FA 3KFMA 4EUOA 1UIVA 4OEUA 1MRPA 3S9LC 3IFAA 1NNKA 3TTKA 5I56B 1FBEA 4GIZA 4OVPA 4K3FA 1D9QA 2H9BA 1LFGA 5EQ7A 3RPLA 3PMXA 1ZU0A 2B65A 2UVJA 2Z23A 2I4CA 4X48A 4DXCA 2Y7PA 4KI0E 2HZKA 3FXQA 2WKYA 5I58A 4FECA 4MMPA 1IIWA 2V93A 1SBPA 4G61A 1SYIA 3FVNA 3IR1A 4AS5A 4QFNA 2VD3A 2XD2A 2CMOA 2RKMA 2UYFA 1S9TA 1M5DA 2PX1A 3C34A 4PFWA 1NUYA 4RA1A 2DOJA 1JVXA 4IGRA 2R8TA 4F1YA 2ESNA 3G3FA 4R6YA 1RDXA 5AA1A 4Q5TA 4R2BA 5A5XA 3C31A 2PVUA 1MM7A 3CG1A 3UN6A 3VVEA 4Q0CA 4FEDA 5AA4B 4JB7A 4RK9A 1NV0A 1D9YA 5AE4A 2QVVA 4F1VA 5L9OA 3U94A 4H5FA 3CR9A 4ZDMA 3S9NC 1H43A 2Y5KA 3I6VA 2UVHA 4F2OA 3S9EA 3FV1A 3FBPA 2A5SA 4YKPA 4OFJA 3EHUA 3UGWA 1FCKA 2B4MA 4XF5A 1QUKA 4Q8RA 1FQDA 5I84A 1MQGA 4OESA 2P3NA 1ZTYA 3CRBA 3FXRA 4O94A 3CSGA 1KWHA 4OHNA 1A40A 3QYTA 1SQYA 1AIVA 3C9HA 1SVXB 1B3HA 2XXUA 4X8RA 1Y3NA 4NQ8A 5I2NA 2HFBA 4DXUA 3DELB 4UA8A 4MNIA 2FYIA 4OVRA 1NUXA 1LBVA 3N26A 1DBZA 2XXKA 2D21A 4QFPA 2H98A 5JK4A 1FPLA 2DXRA 1B3EA 2KQZA 2I48A 3SZPA 1Y1ZA 2UXAA 2QPQA 3B7DA 1URGA 2QVUA 3GZGA 3PPRA 3ODBA 1SW2A 1B6HA 2VD2A 1FBGA 1YPNA 4G68B 2CEXA 1MPBA 2RINA 1MXWA 3KZGA 4HS7A 3T66A 4QSCA 2HEUA 1EZ9A 2V4CA 1ZLQA 1B9JA 1Y4TA 4R74A 3N94A 3H03A 4GFRA 1FPDA 4LQ5A 2F7AA 2KLFA 3OSRA 3OEKA 4PFIA 1A54A 4DI4B 1AMFA 4TLLB 4ELRA 4HTGA 1FTJA 1B0HA 4IO5A 5K2YA 1P1OA 2DQVA 1N76A 3O6HA 1TFDA 1CB6A 1LSTA 3O6IA 4OVSA 1FTKA 4KPTA 5TPAA 3VVFA 3O6GA 2F5XA 2DSFA 3CHGA 4ONYA 2F36A 2QJEA 2P2AA 2REGA 3CIJA 4I9DA 1Y20A 1OVTA 5FTHA 1NV2A 4PGPA 5ITPA 4MF3A 3DP4A 1YCJA 1J1NA 4H1XA 2HQ0A 4JXIA 1B3FA 2Y7KA 4ZS9A 3KEIA 1Q35A 5DYHA 1CE2A 1BIYA 1SW5A 4ZEIA 5AA2B 1TT1A 1B46A 3K1PA 5CBSA 1US5A 2PMSA 3TTLA 4EQ9A 3W9WA 3MP1A 4ESWA 4U23A 1FBCA 4X1BA 2GHBA 3PGFA 4FIMA 3K2DA 3V83A 1GV8A 4U4XA 1AL3A 3TZAA 4GD5A 4E0WA 4KXPA 1ZIUA 3GBAA 3Q26A 3UIFA 3RGYA 5CC2A 1FQEA 4OVTA 2RC8A 1JNFA 2OJTA 3G7WA 1AOVA 2Y7IA 3MPKA 3GXAA 4P0IA 4HCYA 2HAVA 4O7IA 1MY3A 1FPJA 1FPGA 1SI0A 3M8UA 4GWXA 2I0CA 1FBDA 5CI5A 5J1DA 4N15A 4N91A 2Y7RA 1NV5A 4ZEFA 4JVIA 3K1NA 1DTGA 2DYXA 2F7CA 3FVKA 2OBGA 4XXUA 1EYJA 1FSAA 1H76A 1P99A 3IORA 3PPOA 4PQJA 4EXLA 5I56A 4GX3A 2XWOA 4H5GA 1R9LA 1URSA 1EZOA 4G77A 4POXA 2IA4A 3CVGA 4GWZA 3C36A 3H06B 4GL0A 4XKPA 1Y3QA 4HE0A 4I3EA 2Z8DA 4FEBA 1FTOA 3OO8A 1B1HA 3LSFB 1B4HA 5KCJA 5IZ3B 1NNPA 3K01A 4KFQA 1MXXA 4OANA 2Q9TA 1B05A 2XXXA 1RKMA 4YKJA 4M1VA 3O9PA 4MHFA 3EKIA 1NH7A 1TXFA 5K2XA 3EN3A 3O97A 2XWIA 5I3SA 1FJ9A 4N6KA 1MM6A 1POTA 4LN5A 4M4GA 5M2VA 5AA4A 4XKNA 3MVZA 1YTVA 3MP6A 1H44A 1B40A 4ZEBA 3BBRA 1IMEA 5DVFA 2ZYMA 3RTFB 4JVDA 3LV0A 3ZS6A 3KBRA 1SD3A 1KA1A 1OVBA 1JETA 3ILUB 3RUMA 3PV0E 4QFKA 1IXCA 2HHMA 2F78A 3HPIA 1MPCA 2XX7A 5H8FB 1VDWA 1ATGA 3OSQA 4H67A 4YB5A 4WEDA 3T9HB 4PF6A 4ESXA 3PUVE 4PC9A 1KZ8A 4HXVA 4NF8B 4TLMB 2G29A 2GQ1A 4ZZAA 3CFXA 1A8FA 3R6UA 2V3TA 1FPEA 4GLIA 3RN8A 1PBPA 4P1LA 5ET6A 4N6PA 4GXSB 1XVYA 1NI9A 2PT2A 1Y9UA 2I3VA 4G8HA 4O3BA 3OXNA 1WODA 4NF4B 1IMFA 1YZ0A 3H6VA 3RNNA 1PB9A 1FQCA 2DVZA 5I7IA 4NWDA 2QSXA 2F3DA 3MAMA 2CZIA 4HE2A 4NF6B 4GL8A 1G0IA 3LSLA 3A09A 3IJOB 3IOTA 3FXUA 2PYYA 3T9XB 1L5TA 4Z0IA 4IO2A 5J16A 4PBQA 4F3PA 2ZZWA 2M8CA 4NTLA 4U1OA 1QUJA 3K6VA 1JQFA 2L5VA 4F31B 2E0SA 2UVIA 5TP9B 3TCFA 1I6AA 2NXOA 4NF0A 2KR0A 3HHFA 3TTRA 1LBWA 3VLWA 1AWBA 3D4CA 3ROJA 3QIMA 4E0XA 3PUZE 1P1NA 2HPGA 1NV3A 5JTYB 3I5OA 2CZHA 2P0SA 4KR5A 2GHAA 5ELVA 3O28A 4JVCA 4THIA 3SEVA 1LLSA 2CZLA 4LUBA 4QSEA 4ZZEA 2D3IA 4RPOA 3IOWA 3IOVA 5ICTA 2R9JA 1FBFA 1MY2A 2ONRA 5F1QA 5AA2D 2DE4A 4R9GA 4R6HA 3H6UA 4QRZA 1EU8A 4NF5B 2XA5A 4GWOA 5EQAA 3K6XA 2RC9A 4IO3A 2WBBA 3EF7A 4R72A 3CSBA 1QULA 2WEFA 1H3DA 1R6ZA 1TWYA 1M5BA 1I6QA 2DWJA 2VP1A 3QMFA 5EYHA 3K4UA 4MNPA 1NKXA 2FNCA 2B4LA 1HSJA 1S50A 3TYHA 3PTYA 1INPA 4H65A 5I2KA 2V25A 3RYDA 2O68A 3SESA 4P1EA 2VT5A 4MLVA 1D9VA 2XHDA 1OIBA 3VVDA 4F3GA 2ONSA 4FE8A 3ZKKA 3MUQA 5TU0A 4U4SA 4BDRA 5FHMA 1I6BA 1R1NA 4PF8A 3OMBA 1LAFE 5CRYA 3E78A 2O69A 1M5EA 1NV4A 1Y3PA 5ICQA 4HW8A 1N04A 3TCGA 1US4A 3EPEA 4OERA 4P9KA 5HBCA 4GOTA 4DCXA 5CBRA 3IK6B 3AXFA 3PMVA 2W7YA 4O7MA 2IEEA 2XX8A 2PFYA 4PDHA 3RQTA 4F1UA 4X1DA 1NMUA 3SERA 2YPNA 4N81A 2DXYA 4C0RA 2QRYA 1B4ZA 4POWA 3E4RA 4P3LA 3USDA 5H8QA 3KOTA 1MPDA 4NX1A 3CG3A 1B0LA 1LBBA 2O7UA 4RPNA 4KHZE 1B2HA 2Z22A 3TEPA 2PFZA 1FQBA 1LBZA 3E3KA 4MIJA 3FZVA 2NVUB 5BWJA 2FHYA 5CMMA 3IO6A 4F18A 5H8NB 2GRVA 4FJPA 1N7XA 4QF9A 4BDQA 2ONKE 1MXYA 1UTBB 1B5HA 5H8HA 1B7UA 3U93A 3PD9A 3VDFA 3C35A 1K9YA 1A7LA 3IB2A 4YKKA 4LP2B 1FW0A 1N3XA 5L9MA 3H6TA 4GBWA 1IMDA 2RCAA 1MY0A 3VXCA 3OEMA 1FTLA 4NGUA 3RPWA 2XXPA 2V84A 1LAXA 1WDNA 1POY1 3UORA 3TCHA 3TODA 3CI8A 5L8DA 5T3JA 2H5YA 4MEVA 5DVIA 3TUSA 3HFUA 1Y1MA 5I59B 2Q8JA 1D4NA 3IOUA 3EQ1A 4I62A 1NV1A 2B3FA 1MXVA 3T22A 1IXHA 2F8DA 4NF8A 1MQIA 5I57B 3OD7A 1ZBMA 1YAEA 1IMBA 3B8BA 3Q25A 1HSLA 3Q29A 1IITA 3ISPA 4YICA 1B58A 4G8MA 3FGSA 4WEPA 3TTMA 1FPKA 3PMWA 3PPQA 2ZMBA 2F97A 3U92A 1MH4A 4MFIA 1VFDA 2XWKA 2PT1A 4QFOA 2VGQA 2YLNA 2ABHA 4ELPA 3T96B 2A5TA 4GXAA 3V5AA 1SW4A 1IXGA 3PU5A 4F3SA 3MZ1A 4EQBA 3W15C 3ONMA 5F24A 2I3WA 4NF6A 3ZSFA 1IXIA 3FV2A 3W9VA 3MWBA 3RPLB 2WX9A 5DEXA 1NH8A 3G3GA 2XXTA 5I58B 2QMXA 3MVXA 5LOMA 2AL4A 4KCDA 3VXBA 3G3HA 2FA7A 5TP9A 3LBSA 3B6TA 1N0TA 1OQGA 4BDMA 2QVRA 5JTYA 3IAZA 4JBZA 1OQHA 3IJXB 4G68C 2ZZVA 4NE4A 4OMBA 2ZNTA 5A5XB 4P8BA 4PFRA 1UTHB 2OLBA 4OTEA 3KJTA 2QMWA 1OLAA 3MP8A 1OLCA 1FJ6A 4X04A 4BLAA 4OEVA 4NF5A 1M5CA 2REJA 2ALUA 4AQ4A 4KYEA 4XKQA 3JYRA 3GYYA 2X7PA 1JW1A 3I3VA 4NMYA 1FRPA 2RC7A 2F7BA 4PFUA 4GBVA 5A5LA 3RT6B 1USYH 2GFEA 4H6DA 4H45A 4N07A 3FXBA 1IMCA 2ANJA 1DPEA 1QW0A 4EDPA 4Q30B 1Y4CA 3RY3A 5CMBA 3TPAA 4FORA 3KC1A 4QHQA 4MBPA 2RCBA 3V8XB 4PETA 2R71A 2XXRA 1QKBA 3IB1A 1IUDA 5IAIA 4F29A 1B52A 4PFBA 3A3UA 5DTBA 2NWJA 1KA0A 2VHAA 3O29A 4PP0A 3H4ZA 4IO4A 2DWIA 3TMGA 4NN3A 2RF1A 2DVCA 4OFLA 1GTKA 4UACA 4EXKA 1FPBA 1GGGA 1RYXA 4OVQA 4AS4A 4OETA 1MH3A 1VFEA 4RJZA 1QUIA 1LB9A 3V89B 2ZXTA 4G4PA 3DM0A 3PUWE 3FVGA 3OENA 1B1XA 4G2ZA 5L9SA 1EZPA 1LAHE 2OWTA 3H3GA 1DMBA 4I8CA 5IZ1A 3ZKLA 2QS2A 4PFYA 3KN3A 4ELQA 4DXBA 3HN0A 1Q1KA 1NUWA 1FPFA 2I0BA 3WAFA 3N6UA 2Y5LA 1VE4A 2V3QA 1Z7NE 1NL5A 1N3WA 4JWOA 1RYOA 5DT6A 2QS4A 4RK2A 4I3YA 1PEBA 4PCDA 4DE8A 2E1SA 4FAJA 4ISUA 5EQ8A 2OZZA 1GVCA 5DVJA 2NUVA 2DDKA 1BLFA 1JW5A 3K00A 4P47A 3OO6A 4OA4A 3K6UA 4R75A 1N84A 2ZZXA 5FHNA 2UYEA 4LZ5A 4N13A 3U8QA 3C4MA 2FBPA 4F39A 1FPIA 3K02A 3KSXA 4OFOA 4FBPA 4H8IA 2P1SA 1FQFA 5H8NA 4LQ2A 1SYHA 1UQWA 4AB5A 3CFLA 4OQOA 4C1UA 4LATA 1PB8A 2I4BA 4ZECA
chains in the Genus database with same CATH topology
2QS1A 1B7ZA 4G68A 4GQOA 3M3LA 4F22A 4BDOA 5KDTB 1IEJA 3UK4A 1MQJA 3K1MA 1D3KA 1QJMA 4IGTA 1IZ1A 2DE3A 2H4IA 2Z8FA 3E13X 2I58A 1LFIA 1DSNA 5B70A 4P11A 3VLVA 1P1UA 4MLQA 1DOTA 3PUYE 5CMCA 3U1OA 3RLFE 1QVSA 1I69A 2Y7WA 5I57A 3FATA 3T9UA 4PE5B 4BDLA 4ZEKA 3QAXA 4IO7A 4ND9A 1BKAA 3UA8A 4P0GA 4L17A 4EF2A 1B3LA 3FJ7A 2HZLA 2DP8A 5AA2A 4JSOA 2Q2AA 2O1MA 3CFZA 4KYDA 3QUJA 1MS7A 3T93B 4O3CA 1PBQA 3KN8A 2I49A 3M3KA 3C33A 1A8EA 1LCTA 4LVQA 1NFTA 4KYSA 4DIGA 2ZYOA 3S4UA 3TAJA 4Z7EA 3HCQA 4C1TA 1XC1A 3MJNA 5KCJB 1SDXA 4IB2A 3TELA 3FASA 4XIGQ 4AB6A 1VSOA 4YU0A 3Q27A 1F9BA 3DLNA 2DWAA 1ZKBA 4TQUQ 4IY5A 3N5LA 1PC3A 3MVYA 1MG1A 3MPLA 2QL3A 1UTHA 5H8SA 4BDNA 3SETA 1MQHA 3LR1A 1P1WA 4YZZA 1ANFA 1FQAA 3EHSA 3A3CA 1S7YA 1SI1A 3MBPA 1O63A 2F6GA 1O64A 4XKRA 3KGCA 2F34A 5EHSA 5AA3A 3MQ9A 1WVJA 3IL1B 1B51A 4U22A 4U1ZA 1URDA 2XXIA 1FTMA 3QXMA 2YJPA 3F11A 2HCAA 1UIUA 4OVJA 5CMKA 4OXVA 2NOOA 5FTIA 1IQ7A 2V3UA 1B32A 4RXLA 3H6WA 3RTWB 1PB7A 1JVYA 3FUZA 5ITOA 4H0WA 4ZEDA 4NEDA 1Z7ME 1TFAA 1MDQA 3KOSA 4R9FA 3KG2A 2PBWA 2AIXA 1QKAA 2Q89A 3HHGA 3HV1A 5H8FA 2Q2CA 3SEUA 1AH5A 3RT8A 2OK2A 3T9VA 3QK6A 1LB8A 2XXVA 1B5JA 2B3BA 3S9MC 1M5FA 1XHYA 1H45A 2I6EA 2XXHA 2XX9A 3WAEA 1MXZA 4G8NA 4YB7A 1LAGE 1NNTA 4QFLA 3U72A 4F19A 3TFLA 2XXQA 3BKIB 3DP8A 4NF4A 1O7TA 2R6GE 1T0KA 1GR2A 2O51A 3SKPA 4ZE9A 1OMPA 1BP5A 1XOCA 5ISUA 5F7VA 3QUFA 3B6WA 3IB0A 3TQWA 4DZ1A 2F35A 5JEIA 1XVXA 1PDAA 4X9TA 3R7XA 2AYSA 1B7HA 3O2AA 5KDTA 2BJJX 4JWYA 5I2KB 5EHMA 3MZ9A 4YAHX 3MW0A 2HXWA 3B6QA 4OENA 3TDJA 3K0VA 2XXWA 2DE2A 2QS3A 3TQLA 2Z8EA 3EHTA 2X7QA 3OO9A 2X26A 3G3IA 3G3JA 3PPPA 2XXYA 3TTNA 1P1QA 2Q88A 1ZJLA 5B7DA 1II5A 4RY1A 5HM4B 2ZNSA 4DCYA 5FHOA 1B5IA 3JZJA 3H7MA 4DDDA 3VFJA 2G93A 4FATA 4I1DA 2OCUA 3BFUA 1DPPA 1LBCA 3G3KA 4GF8A 2OWSA 4LA9A 2GH9A 5H8QB 3TKDA 3HO7A 4YB6A 3LSXA 3SEWA 1MDP1 4KD5A 3FJMA 5I2NB 4IO6A 1R9QA 2H25A 4R73A 2LAOA 4LZ8A 3PUXE 3GBBA 2DS9A 4U21A 1VR5A 2ZYNA 2ZYKA 3LUYA 1DTZA 4O3AA 4JSDA 1JEUA 4HCWA 4IY6A 5H8HB 1MXUA 3KN7A 3SEYA 3JV9A 3K6WA 3C32A 3O66A 3FJGA 4XTCQ 3LC8A 4ECFA 2F6PA 3LSWA 2UVGA 2DWHA 4ELOA 1ZMGA 3ILTB 1LCFA 3E9XA 2H99A 4GVOA 2O7IA 2D5WA 2VOZA 1SW1A 3N6TA 4YMAA 1HSEA 4OWDA 2HAUA 3OOAA 3KSJA 4JDFA 3HSTA 5TPAB 4ZE8A 3D4GA 5IKBA 3FVOA 1USYE 1LFHA 3P7IA 4F3BA 3VLUA 2O6AA 3THIA 2AL5A 1XT8A 3SDFA 1JEVA 4YKIA 3S2VA 4QSDA 4KCCA 4R6KA 4LZ7A 1EH3A 3SEXA 1UTBA 3FIRA 5EYFA 3DP6A 1BTJA 4GRKA 2O1LA 2ZNUA 3OELA 3BFTA 1LGBC 1JW4A 5BUUA 3MZBA 2A5TB 2XD3A 3VE1B 4WKMA 3IO4A 1A55A 3QSLA 3ECRA 3VV5A 3L6HA 1NNFA 5DEXB 4H8JA 5KZTA 4R2FA 4KQPA 3R26A 3GLBA 1A99A 1XS5A 2Y84A 4WXJA 5I59A 2THIA 4TOZA 3KJ7A 4U2RA 3MVWA 4RNSA 4DLDA 1MY1A 4OYVA 1MY4A 4JWXA 2O84X 5HPQA 5CM6A 1ELJA 3Q28A 4EQ7A 4EF1A 4MH5A 4RYAA 4OZ9A 4F2QA 1N7WA 3OO7A 3IX1A 3PPNA 3UP9A 1MQDA 4NWCA 3L6GA 4YMBA 3MC2A 4LONB 4PFTA 1B3GA 3FD3A 3PD8A 3M3FA 3KFMA 4EUOA 1UIVA 4OEUA 1MRPA 3S9LC 1NNKA 3TTKA 5I56B 4GIZA 4K3FA 2H9BA 1LFGA 3PMXA 1ZU0A 2B65A 2UVJA 2Z23A 2I4CA 4X48A 4DXCA 2Y7PA 4KI0E 2HZKA 3FXQA 2WKYA 5I58A 4FECA 1IIWA 2V93A 1SBPA 1SYIA 3FVNA 3IR1A 4QFNA 2VD3A 2XD2A 2CMOA 2RKMA 2UYFA 1S9TA 1M5DA 2PX1A 3C34A 4PFWA 4RA1A 2DOJA 1JVXA 4IGRA 4F1YA 2ESNA 3G3FA 4R6YA 5AA1A 4Q5TA 4R2BA 5A5XA 3C31A 2PVUA 1MM7A 3CG1A 3UN6A 3VVEA 4Q0CA 4FEDA 5AA4B 4JB7A 4RK9A 1D9YA 5AE4A 4F1VA 5L9OA 3U94A 4H5FA 3CR9A 4ZDMA 3S9NC 1H43A 3I6VA 2UVHA 4F2OA 3S9EA 3FV1A 2A5SA 4YKPA 4OFJA 3EHUA 3UGWA 1FCKA 1QUKA 4Q8RA 1FQDA 5I84A 1MQGA 3CRBA 1ZTYA 4OESA 3FXRA 3CSGA 1KWHA 4OHNA 1A40A 3QYTA 1SQYA 1AIVA 3C9HA 1SVXB 1B3HA 2XXUA 1Y3NA 5I2NA 2HFBA 4DXUA 3DELB 4UA8A 2FYIA 3N26A 2D21A 4QFPA 2H98A 5JK4A 2DXRA 1B3EA 2I48A 1Y1ZA 2UXAA 2QPQA 3B7DA 1URGA 3GZGA 3PPRA 3ODBA 1SW2A 1B6HA 2VD2A 1YPNA 4G68B 1MPBA 2RINA 1MXWA 3KZGA 4HS7A 3T66A 4QSCA 2HEUA 1EZ9A 1ZLQA 1B9JA 1Y4TA 4R74A 3N94A 3H03A 4GFRA 4LQ5A 2F7AA 2KLFA 3OSRA 3OEKA 1A54A 1AMFA 4TLLB 4ELRA 4HTGA 1FTJA 1B0HA 4IO5A 5K2YA 1P1OA 2DQVA 1N76A 3O6HA 1TFDA 1CB6A 1LSTA 3O6IA 1FTKA 4KPTA 5TPAA 3VVFA 3O6GA 2F5XA 2DSFA 4ONYA 2F36A 2QJEA 2P2AA 2REGA 3CIJA 4I9DA 1Y20A 1OVTA 5FTHA 5ITPA 4MF3A 3DP4A 1YCJA 1J1NA 4H1XA 2HQ0A 4JXIA 1B3FA 2Y7KA 4ZS9A 3KEIA 1Q35A 5DYHA 1CE2A 1BIYA 1SW5A 4ZEIA 5AA2B 1TT1A 1B46A 3K1PA 5CBSA 1US5A 2PMSA 3TTLA 4EQ9A 3W9WA 3MP1A 4ESWA 4U23A 4X1BA 2GHBA 3PGFA 4FIMA 3K2DA 3V83A 1GV8A 4U4XA 1AL3A 3TZAA 4GD5A 4E0WA 1ZIUA 3GBAA 3Q26A 3UIFA 3RGYA 5CC2A 1FQEA 2RC8A 1JNFA 2OJTA 3G7WA 1AOVA 2Y7IA 3MPKA 3GXAA 4P0IA 4HCYA 2HAVA 1MY3A 1SI0A 3M8UA 2I0CA 5CI5A 5J1DA 2Y7RA 4ZEFA 3K1NA 1DTGA 2DYXA 2F7CA 3FVKA 2OBGA 4XXUA 1P99A 1H76A 3PPOA 3IORA 4PQJA 4EXLA 5I56A 4H5GA 1R9LA 1URSA 1EZOA 4G77A 4POXA 2IA4A 3CVGA 3C36A 3H06B 4GL0A 4XKPA 1Y3QA 2Z8DA 4FEBA 1FTOA 3OO8A 1B1HA 3LSFB 1B4HA 5KCJA 1NNPA 3K01A 4KFQA 1MXXA 2Q9TA 1B05A 2XXXA 1RKMA 4YKJA 4M1VA 3O9PA 1NH7A 1TXFA 5K2XA 3EN3A 3O97A 1MM6A 1POTA 4M4GA 5M2VA 5AA4A 4XKNA 3MVZA 1YTVA 3MP6A 1H44A 1B40A 4ZEBA 3BBRA 5DVFA 2ZYMA 3RTFB 3ZS6A 3KBRA 1SD3A 1OVBA 1JETA 3ILUB 3RUMA 3PV0E 4QFKA 1IXCA 2F78A 3HPIA 1MPCA 2XX7A 5H8FB 1ATGA 3OSQA 4H67A 4YB5A 4WEDA 3T9HB 4ESXA 3PUVE 4NF8B 4TLMB 2G29A 4ZZAA 3CFXA 1A8FA 3R6UA 2V3TA 4GLIA 3RN8A 1PBPA 4N6PA 4GXSB 1XVYA 2PT2A 1Y9UA 2I3VA 4G8HA 4O3BA 3OXNA 1WODA 4NF4B 3H6VA 3RNNA 1PB9A 1FQCA 2DVZA 4NWDA 2QSXA 3MAMA 4NF6B 4GL8A 3LSLA 3A09A 3IJOB 3IOTA 3FXUA 2PYYA 3T9XB 1L5TA 4Z0IA 4IO2A 4F3PA 2M8CA 4NTLA 4U1OA 1QUJA 3K6VA 1JQFA 4F31B 2E0SA 2UVIA 5TP9B 3TCFA 1I6AA 2NXOA 3HHFA 3TTRA 3VLWA 3D4CA 4E0XA 3QIMA 3PUZE 1P1NA 5JTYB 3I5OA 2P0SA 4KR5A 2GHAA 5ELVA 3O28A 4THIA 3SEVA 1LLSA 2CZLA 4LUBA 4QSEA 4ZZEA 2D3IA 4RPOA 3IOWA 3IOVA 5ICTA 2R9JA 1MY2A 2ONRA 5F1QA 5AA2D 2DE4A 4R9GA 4R6HA 3H6UA 4QRZA 1EU8A 4NF5B 4GWOA 3K6XA 2RC9A 4IO3A 3EF7A 4R72A 3CSBA 1QULA 1H3DA 1R6ZA 1TWYA 1M5BA 1I6QA 2DWJA 2VP1A 3K4UA 1NKXA 2FNCA 1HSJA 1S50A 3TYHA 5I2KA 4H65A 2V25A 2O68A 3SESA 4MLVA 1D9VA 2XHDA 1OIBA 3VVDA 4F3GA 2ONSA 4FE8A 3ZKKA 3MUQA 5TU0A 4U4SA 4BDRA 5FHMA 1I6BA 1R1NA 3OMBA 1LAFE 5CRYA 2O69A 1M5EA 1Y3PA 5ICQA 4HW8A 1N04A 3TCGA 1US4A 3EPEA 4OERA 5HBCA 4GOTA 4DCXA 5CBRA 3IK6B 3AXFA 3PMVA 2W7YA 2IEEA 2XX8A 3RQTA 4F1UA 4X1DA 1NMUA 3SERA 2YPNA 2DXYA 4C0RA 2QRYA 1B4ZA 4POWA 3E4RA 3USDA 5H8QA 3KOTA 1MPDA 3CG3A 1B0LA 1LBBA 2O7UA 4RPNA 4KHZE 1B2HA 2Z22A 3TEPA 1FQBA 3E3KA 3FZVA 2NVUB 5BWJA 5CMMA 3IO6A 4F18A 5H8NB 2GRVA 4FJPA 1N7XA 4QF9A 4BDQA 2ONKE 1MXYA 1UTBB 1B5HA 5H8HA 1B7UA 3U93A 3PD9A 3VDFA 3C35A 1A7LA 3IB2A 4YKKA 4LP2B 1FW0A 1N3XA 5L9MA 3H6TA 2RCAA 1MY0A 3VXCA 3OEMA 1FTLA 3RPWA 2XXPA 2V84A 1LAXA 1WDNA 1POY1 3UORA 3TCHA 3TODA 3CI8A 5L8DA 2H5YA 5DVIA 3TUSA 1Y1MA 5I59B 2Q8JA 1D4NA 3IOUA 3EQ1A 4I62A 2B3FA 1MXVA 3T22A 1IXHA 2F8DA 4NF8A 1MQIA 5I57B 3OD7A 1ZBMA 1YAEA 3Q25A 1HSLA 3Q29A 1IITA 4YICA 1B58A 4G8MA 3FGSA 4WEPA 3TTMA 3PMWA 3PPQA 2ZMBA 2F97A 3U92A 1MH4A 4MFIA 1VFDA 2PT1A 4QFOA 2VGQA 2YLNA 2ABHA 4ELPA 3T96B 2A5TA 4GXAA 3V5AA 1SW4A 1IXGA 3PU5A 4F3SA 3MZ1A 4EQBA 3W15C 3ONMA 2I3WA 4NF6A 3ZSFA 1IXIA 3FV2A 3W9VA 3MWBA 5DEXA 1NH8A 3G3GA 2XXTA 5I58B 2QMXA 3MVXA 5LOMA 2AL4A 4KCDA 3VXBA 3G3HA 2FA7A 5TP9A 3LBSA 3B6TA 1N0TA 1OQGA 4BDMA 5JTYA 3IAZA 4JBZA 1OQHA 3IJXB 4G68C 4NE4A 4OMBA 2ZNTA 5A5XB 1UTHB 2OLBA 4OTEA 3KJTA 2QMWA 1OLAA 3MP8A 1OLCA 4BLAA 4OEVA 4NF5A 1M5CA 2REJA 2ALUA 4AQ4A 4KYEA 4XKQA 3JYRA 2X7PA 1JW1A 3I3VA 4NMYA 2RC7A 2F7BA 4PFUA 3RT6B 1USYH 2GFEA 4H6DA 4N07A 2ANJA 1DPEA 1QW0A 4EDPA 4Q30B 1Y4CA 3RY3A 5CMBA 3TPAA 4FORA 4QHQA 4MBPA 2RCBA 3V8XB 4PETA 2R71A 2XXRA 1QKBA 3IB1A 1IUDA 5IAIA 4F29A 1B52A 3A3UA 5DTBA 2NWJA 2VHAA 3O29A 4PP0A 3H4ZA 4IO4A 2DWIA 3TMGA 2RF1A 2DVCA 4OFLA 1GTKA 4UACA 4EXKA 1GGGA 1RYXA 4OETA 1MH3A 1VFEA 4RJZA 1QUIA 1LB9A 3V89B 2ZXTA 4G4PA 3DM0A 3PUWE 3FVGA 3OENA 1B1XA 4G2ZA 5L9SA 1EZPA 1LAHE 2OWTA 3H3GA 1DMBA 4I8CA 3ZKLA 2QS2A 4PFYA 3KN3A 4ELQA 4DXBA 3HN0A 1Q1KA 2I0BA 3WAFA 3N6UA 1VE4A 2V3QA 1Z7NE 1NL5A 1N3WA 4JWOA 1RYOA 5DT6A 2QS4A 4RK2A 1PEBA 4DE8A 2E1SA 4FAJA 4ISUA 2OZZA 1GVCA 5DVJA 2NUVA 1BLFA 1JW5A 3K00A 3OO6A 3K6UA 4R75A 1N84A 5FHNA 2UYEA 4LZ5A 4N13A 3U8QA 3C4MA 4F39A 3K02A 3KSXA 4OFOA 4H8IA 2P1SA 1FQFA 5H8NA 4LQ2A 1SYHA 1UQWA 4AB5A 3CFLA 4OQOA 4C1UA 4LATA 1PB8A 2I4BA 4ZECA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QS1 A;  1B7Z A;  4G68 A;  4GQO A;  3M3L A;  4F22 A;  4BDO A;  5KDT B;  1IEJ A;  3UK4 A;  1MQJ A;  3K1M A;  1D3K A;  1QJM A;  4IGT A;  1IZ1 A;  2DE3 A;  2H4I A;  2Z8F A;  3E13 X;  2I58 A;  1LFI A;  1DSN A;  5B70 A;  4P11 A;  3VLV A;  1P1U A;  4MLQ A;  1DOT A;  3PUY E;  5CMC A;  3U1O A;  3RLF E;  1QVS A;  1I69 A;  2Y7W A;  5I57 A;  3FAT A;  3T9U A;  4PE5 B;  4BDL A;  4ZEK A;  3QAX A;  4IO7 A;  4ND9 A;  1BKA A;  3UA8 A;  4P0G A;  4L17 A;  4EF2 A;  1B3L A;  3FJ7 A;  2HZL A;  2DP8 A;  5AA2 A;  4JSO A;  2Q2A A;  2O1M A;  3CFZ A;  4KYD A;  3QUJ A;  1MS7 A;  3T93 B;  4O3C A;  1PBQ A;  3KN8 A;  2I49 A;  3M3K A;  3C33 A;  1A8E A;  1LCT A;  4LVQ A;  1NFT A;  4KYS A;  4DIG A;  2ZYO A;  3S4U A;  3TAJ A;  4Z7E A;  3HCQ A;  4C1T A;  1XC1 A;  3MJN A;  5KCJ B;  1SDX A;  4IB2 A;  3TEL A;  3FAS A;  4XIG Q;  4AB6 A;  1VSO A;  4YU0 A;  3Q27 A;  1F9B A;  3DLN A;  2DWA A;  1ZKB A;  4TQU Q;  4IY5 A;  3N5L A;  1PC3 A;  3MVY A;  1MG1 A;  3MPL A;  2QL3 A;  1UTH A;  5H8S A;  4BDN A;  3SET A;  1MQH A;  3LR1 A;  1P1W A;  4YZZ A;  1ANF A;  1FQA A;  3EHS A;  3A3C A;  1S7Y A;  1SI1 A;  3MBP A;  1O63 A;  2F6G A;  1O64 A;  4XKR A;  3KGC A;  2F34 A;  5EHS A;  5AA3 A;  3MQ9 A;  1WVJ A;  3IL1 B;  1B51 A;  4U22 A;  4U1Z A;  1URD A;  2XXI A;  1FTM A;  3QXM A;  2YJP A;  3F11 A;  2HCA A;  1UIU A;  4OVJ A;  5CMK A;  4OXV A;  2NOO A;  5FTI A;  1IQ7 A;  2V3U A;  1B32 A;  4RXL A;  3H6W A;  3RTW B;  1PB7 A;  1JVY A;  3FUZ A;  5ITO A;  4H0W A;  4ZED A;  4NED A;  1Z7M E;  1TFA A;  1MDQ A;  3KOS A;  4R9F A;  3KG2 A;  2PBW A;  2AIX A;  1QKA A;  2Q89 A;  3HHG A;  3HV1 A;  5H8F A;  2Q2C A;  3SEU A;  1AH5 A;  3RT8 A;  2OK2 A;  3T9V A;  3QK6 A;  1LB8 A;  2XXV A;  1B5J A;  2B3B A;  3S9M C;  1M5F A;  1XHY A;  1H45 A;  2I6E A;  2XXH A;  2XX9 A;  3WAE A;  1MXZ A;  4G8N A;  4YB7 A;  1LAG E;  1NNT A;  4QFL A;  3U72 A;  4F19 A;  3TFL A;  2XXQ A;  3BKI B;  3DP8 A;  4NF4 A;  1O7T A;  2R6G E;  1T0K A;  1GR2 A;  2O51 A;  3SKP A;  4ZE9 A;  1OMP A;  1BP5 A;  1XOC A;  5ISU A;  5F7V A;  3QUF A;  3B6W A;  3IB0 A;  3TQW A;  4DZ1 A;  2F35 A;  5JEI A;  1XVX A;  1PDA A;  4X9T A;  3R7X A;  2AYS A;  1B7H A;  3O2A A;  5KDT A;  2BJJ X;  4JWY A;  5I2K B;  5EHM A;  3MZ9 A;  4YAH X;  3MW0 A;  2HXW A;  3B6Q A;  4OEN A;  3TDJ A;  3K0V A;  2XXW A;  2DE2 A;  2QS3 A;  3TQL A;  2Z8E A;  3EHT A;  2X7Q A;  3OO9 A;  2X26 A;  3G3I A;  3G3J A;  3PPP A;  2XXY A;  3TTN A;  1P1Q A;  2Q88 A;  1ZJL A;  5B7D A;  1II5 A;  4RY1 A;  5HM4 B;  2ZNS A;  4DCY A;  5FHO A;  1B5I A;  3JZJ A;  3H7M A;  4DDD A;  3VFJ A;  2G93 A;  4FAT A;  4I1D A;  2OCU A;  3BFU A;  1DPP A;  1LBC A;  3G3K A;  4GF8 A;  2OWS A;  4LA9 A;  2GH9 A;  5H8Q B;  3TKD A;  3HO7 A;  4YB6 A;  3LSX A;  3SEW A;  1MDP 1;  4KD5 A;  3FJM A;  5I2N B;  4IO6 A;  1R9Q A;  2H25 A;  4R73 A;  2LAO A;  4LZ8 A;  3PUX E;  3GBB A;  2DS9 A;  4U21 A;  1VR5 A;  2ZYN A;  2ZYK A;  3LUY A;  1DTZ A;  4O3A A;  4JSD A;  1JEU A;  4HCW A;  4IY6 A;  5H8H B;  1MXU A;  3KN7 A;  3SEY A;  3JV9 A;  3K6W A;  3C32 A;  3O66 A;  3FJG A;  4XTC Q;  3LC8 A;  4ECF A;  2F6P A;  3LSW A;  2UVG A;  2DWH A;  4ELO A;  1ZMG A;  3ILT B;  1LCF A;  3E9X A;  2H99 A;  4GVO A;  2O7I A;  2D5W A;  2VOZ A;  1SW1 A;  3N6T A;  4YMA A;  1HSE A;  4OWD A;  2HAU A;  3OOA A;  3KSJ A;  4JDF A;  3HST A;  5TPA B;  4ZE8 A;  3D4G A;  5IKB A;  3FVO A;  1USY E;  1LFH A;  3P7I A;  4F3B A;  3VLU A;  2O6A A;  3THI A;  2AL5 A;  1XT8 A;  3SDF A;  1JEV A;  4YKI A;  3S2V A;  4QSD A;  4KCC A;  4R6K A;  4LZ7 A;  1EH3 A;  3SEX A;  1UTB A;  3FIR A;  5EYF A;  3DP6 A;  1BTJ A;  4GRK A;  2O1L A;  2ZNU A;  3OEL A;  3BFT A;  1LGB C;  1JW4 A;  5BUU A;  3MZB A;  2A5T B;  2XD3 A;  3VE1 B;  4WKM A;  3IO4 A;  1A55 A;  3QSL A;  3ECR A;  3VV5 A;  3L6H A;  1NNF A;  5DEX B;  4H8J A;  5KZT A;  4R2F A;  4KQP A;  3R26 A;  3GLB A;  1A99 A;  1XS5 A;  2Y84 A;  4WXJ A;  5I59 A;  2THI A;  4TOZ A;  3KJ7 A;  4U2R A;  3MVW A;  4RNS A;  4DLD A;  1MY1 A;  4OYV A;  1MY4 A;  4JWX A;  2O84 X;  5HPQ A;  5CM6 A;  1ELJ A;  3Q28 A;  4EQ7 A;  4EF1 A;  4MH5 A;  4RYA A;  4OZ9 A;  4F2Q A;  1N7W A;  3OO7 A;  3IX1 A;  3PPN A;  3UP9 A;  1MQD A;  4NWC A;  3L6G A;  4YMB A;  3MC2 A;  4LON B;  4PFT A;  1B3G A;  3FD3 A;  3PD8 A;  3M3F A;  3KFM A;  4EUO A;  1UIV A;  4OEU A;  1MRP A;  3S9L C;  1NNK A;  3TTK A;  5I56 B;  4GIZ A;  4K3F A;  2H9B A;  1LFG A;  3PMX A;  1ZU0 A;  2B65 A;  2UVJ A;  2Z23 A;  2I4C A;  4X48 A;  4DXC A;  2Y7P A;  4KI0 E;  2HZK A;  3FXQ A;  2WKY A;  5I58 A;  4FEC A;  1IIW A;  2V93 A;  1SBP A;  1SYI A;  3FVN A;  3IR1 A;  4QFN A;  2VD3 A;  2XD2 A;  2CMO A;  2RKM A;  2UYF A;  1S9T A;  1M5D A;  2PX1 A;  3C34 A;  4PFW A;  4RA1 A;  2DOJ A;  1JVX A;  4IGR A;  4F1Y A;  2ESN A;  3G3F A;  4R6Y A;  5AA1 A;  4Q5T A;  4R2B A;  5A5X A;  3C31 A;  2PVU A;  1MM7 A;  3CG1 A;  3UN6 A;  3VVE A;  4Q0C A;  4FED A;  5AA4 B;  4JB7 A;  4RK9 A;  1D9Y A;  5AE4 A;  4F1V A;  5L9O A;  3U94 A;  4H5F A;  3CR9 A;  4ZDM A;  3S9N C;  1H43 A;  3I6V A;  2UVH A;  4F2O A;  3S9E A;  3FV1 A;  2A5S A;  4YKP A;  4OFJ A;  3EHU A;  3UGW A;  1FCK A;  1QUK A;  4Q8R A;  1FQD A;  5I84 A;  1MQG A;  3CRB A;  1ZTY A;  4OES A;  3FXR A;  3CSG A;  1KWH A;  4OHN A;  1A40 A;  3QYT A;  1SQY A;  1AIV A;  3C9H A;  1SVX B;  1B3H A;  2XXU A;  1Y3N A;  5I2N A;  2HFB A;  4DXU A;  3DEL B;  4UA8 A;  2FYI A;  3N26 A;  2D21 A;  4QFP A;  2H98 A;  5JK4 A;  2DXR A;  1B3E A;  2I48 A;  1Y1Z A;  2UXA A;  2QPQ A;  3B7D A;  1URG A;  3GZG A;  3PPR A;  3ODB A;  1SW2 A;  1B6H A;  2VD2 A;  1YPN A;  4G68 B;  1MPB A;  2RIN A;  1MXW A;  3KZG A;  4HS7 A;  3T66 A;  4QSC A;  2HEU A;  1EZ9 A;  1ZLQ A;  1B9J A;  1Y4T A;  4R74 A;  3N94 A;  3H03 A;  4GFR A;  4LQ5 A;  2F7A A;  2KLF A;  3OSR A;  3OEK A;  1A54 A;  1AMF A;  4TLL B;  4ELR A;  4HTG A;  1FTJ A;  1B0H A;  4IO5 A;  5K2Y A;  1P1O A;  2DQV A;  1N76 A;  3O6H A;  1TFD A;  1CB6 A;  1LST A;  3O6I A;  1FTK A;  4KPT A;  5TPA A;  3VVF A;  3O6G A;  2F5X A;  2DSF A;  4ONY A;  2F36 A;  2QJE A;  2P2A A;  2REG A;  3CIJ A;  4I9D A;  1Y20 A;  1OVT A;  5FTH A;  5ITP A;  4MF3 A;  3DP4 A;  1YCJ A;  1J1N A;  4H1X A;  2HQ0 A;  4JXI A;  1B3F A;  2Y7K A;  4ZS9 A;  3KEI A;  1Q35 A;  5DYH A;  1CE2 A;  1BIY A;  1SW5 A;  4ZEI A;  5AA2 B;  1TT1 A;  1B46 A;  3K1P A;  5CBS A;  1US5 A;  2PMS A;  3TTL A;  4EQ9 A;  3W9W A;  3MP1 A;  4ESW A;  4U23 A;  4X1B A;  2GHB A;  3PGF A;  4FIM A;  3K2D A;  3V83 A;  1GV8 A;  4U4X A;  1AL3 A;  3TZA A;  4GD5 A;  4E0W A;  1ZIU A;  3GBA A;  3Q26 A;  3UIF A;  3RGY A;  5CC2 A;  1FQE A;  2RC8 A;  1JNF A;  2OJT A;  3G7W A;  1AOV A;  2Y7I A;  3MPK A;  3GXA A;  4P0I A;  4HCY A;  2HAV A;  1MY3 A;  1SI0 A;  3M8U A;  2I0C A;  5CI5 A;  5J1D A;  2Y7R A;  4ZEF A;  3K1N A;  1DTG A;  2DYX A;  2F7C A;  3FVK A;  2OBG A;  4XXU A;  1P99 A;  1H76 A;  3PPO A;  3IOR A;  4PQJ A;  4EXL A;  5I56 A;  4H5G A;  1R9L A;  1URS A;  1EZO A;  4G77 A;  4POX A;  2IA4 A;  3CVG A;  3C36 A;  3H06 B;  4GL0 A;  4XKP A;  1Y3Q A;  2Z8D A;  4FEB A;  1FTO A;  3OO8 A;  1B1H A;  3LSF B;  1B4H A;  5KCJ A;  1NNP A;  3K01 A;  4KFQ A;  1MXX A;  2Q9T A;  1B05 A;  2XXX A;  1RKM A;  4YKJ A;  4M1V A;  3O9P A;  1NH7 A;  1TXF A;  5K2X A;  3EN3 A;  3O97 A;  1MM6 A;  1POT A;  4M4G A;  5M2V A;  5AA4 A;  4XKN A;  3MVZ A;  1YTV A;  3MP6 A;  1H44 A;  1B40 A;  4ZEB A;  3BBR A;  5DVF A;  2ZYM A;  3RTF B;  3ZS6 A;  3KBR A;  1SD3 A;  1OVB A;  1JET A;  3ILU B;  3RUM A;  3PV0 E;  4QFK A;  1IXC A;  2F78 A;  3HPI A;  1MPC A;  2XX7 A;  5H8F B;  1ATG A;  3OSQ A;  4H67 A;  4YB5 A;  4WED A;  3T9H B;  4ESX A;  3PUV E;  4NF8 B;  4TLM B;  2G29 A;  4ZZA A;  3CFX A;  1A8F A;  3R6U A;  2V3T A;  4GLI A;  3RN8 A;  1PBP A;  4N6P A;  4GXS B;  1XVY A;  2PT2 A;  1Y9U A;  2I3V A;  4G8H A;  4O3B A;  3OXN A;  1WOD A;  4NF4 B;  3H6V A;  3RNN A;  1PB9 A;  1FQC A;  2DVZ A;  4NWD A;  2QSX A;  3MAM A;  4NF6 B;  4GL8 A;  3LSL A;  3A09 A;  3IJO B;  3IOT A;  3FXU A;  2PYY A;  3T9X B;  1L5T A;  4Z0I A;  4IO2 A;  4F3P A;  2M8C A;  4NTL A;  4U1O A;  1QUJ A;  3K6V A;  1JQF A;  4F31 B;  2E0S A;  2UVI A;  5TP9 B;  3TCF A;  1I6A A;  2NXO A;  3HHF A;  3TTR A;  3VLW A;  3D4C A;  4E0X A;  3QIM A;  3PUZ E;  1P1N A;  5JTY B;  3I5O A;  2P0S A;  4KR5 A;  2GHA A;  5ELV A;  3O28 A;  4THI A;  3SEV A;  1LLS A;  2CZL A;  4LUB A;  4QSE A;  4ZZE A;  2D3I A;  4RPO A;  3IOW A;  3IOV A;  5ICT A;  2R9J A;  1MY2 A;  2ONR A;  5F1Q A;  5AA2 D;  2DE4 A;  4R9G A;  4R6H A;  3H6U A;  4QRZ A;  1EU8 A;  4NF5 B;  4GWO A;  3K6X A;  2RC9 A;  4IO3 A;  3EF7 A;  4R72 A;  3CSB A;  1QUL A;  1H3D A;  1R6Z A;  1TWY A;  1M5B A;  1I6Q A;  2DWJ A;  2VP1 A;  3K4U A;  1NKX A;  2FNC A;  1HSJ A;  1S50 A;  3TYH A;  5I2K A;  4H65 A;  2V25 A;  2O68 A;  3SES A;  4MLV A;  1D9V A;  2XHD A;  1OIB A;  3VVD A;  4F3G A;  2ONS A;  4FE8 A;  3ZKK A;  3MUQ A;  5TU0 A;  4U4S A;  4BDR A;  5FHM A;  1I6B A;  1R1N A;  3OMB A;  1LAF E;  5CRY A;  2O69 A;  1M5E A;  1Y3P A;  5ICQ A;  4HW8 A;  1N04 A;  3TCG A;  1US4 A;  3EPE A;  4OER A;  5HBC A;  4GOT A;  4DCX A;  5CBR A;  3IK6 B;  3AXF A;  3PMV A;  2W7Y A;  2IEE A;  2XX8 A;  3RQT A;  4F1U A;  4X1D A;  1NMU A;  3SER A;  2YPN A;  2DXY A;  4C0R A;  2QRY A;  1B4Z A;  4POW A;  3E4R A;  3USD A;  5H8Q A;  3KOT A;  1MPD A;  3CG3 A;  1B0L A;  1LBB A;  2O7U A;  4RPN A;  4KHZ E;  1B2H A;  2Z22 A;  3TEP A;  1FQB A;  3E3K A;  3FZV A;  2NVU B;  5BWJ A;  5CMM A;  3IO6 A;  4F18 A;  5H8N B;  2GRV A;  4FJP A;  1N7X A;  4QF9 A;  4BDQ A;  2ONK E;  1MXY A;  1UTB B;  1B5H A;  5H8H A;  1B7U A;  3U93 A;  3PD9 A;  3VDF A;  3C35 A;  1A7L A;  3IB2 A;  4YKK A;  4LP2 B;  1FW0 A;  1N3X A;  5L9M A;  3H6T A;  2RCA A;  1MY0 A;  3VXC A;  3OEM A;  1FTL A;  3RPW A;  2XXP A;  2V84 A;  1LAX A;  1WDN A;  1POY 1;  3UOR A;  3TCH A;  3TOD A;  3CI8 A;  5L8D A;  2H5Y A;  5DVI A;  3TUS A;  1Y1M A;  5I59 B;  2Q8J A;  1D4N A;  3IOU A;  3EQ1 A;  4I62 A;  2B3F A;  1MXV A;  3T22 A;  1IXH A;  2F8D A;  4NF8 A;  1MQI A;  5I57 B;  3OD7 A;  1ZBM A;  1YAE A;  3Q25 A;  1HSL A;  3Q29 A;  1IIT A;  4YIC A;  1B58 A;  4G8M A;  3FGS A;  4WEP A;  3TTM A;  3PMW A;  3PPQ A;  2ZMB A;  2F97 A;  3U92 A;  1MH4 A;  4MFI A;  1VFD A;  2PT1 A;  4QFO A;  2VGQ A;  2YLN A;  2ABH A;  4ELP A;  3T96 B;  2A5T A;  4GXA A;  3V5A A;  1SW4 A;  1IXG A;  3PU5 A;  4F3S A;  3MZ1 A;  4EQB A;  3W15 C;  3ONM A;  2I3W A;  4NF6 A;  3ZSF A;  1IXI A;  3FV2 A;  3W9V A;  3MWB A;  5DEX A;  1NH8 A;  3G3G A;  2XXT A;  5I58 B;  2QMX A;  3MVX A;  5LOM A;  2AL4 A;  4KCD A;  3VXB A;  3G3H A;  2FA7 A;  5TP9 A;  3LBS A;  3B6T A;  1N0T A;  1OQG A;  4BDM A;  5JTY A;  3IAZ A;  4JBZ A;  1OQH A;  3IJX B;  4G68 C;  4NE4 A;  4OMB A;  2ZNT A;  5A5X B;  1UTH B;  2OLB A;  4OTE A;  3KJT A;  2QMW A;  1OLA A;  3MP8 A;  1OLC A;  4BLA A;  4OEV A;  4NF5 A;  1M5C A;  2REJ A;  2ALU A;  4AQ4 A;  4KYE A;  4XKQ A;  3JYR A;  2X7P A;  1JW1 A;  3I3V A;  4NMY A;  2RC7 A;  2F7B A;  4PFU A;  3RT6 B;  1USY H;  2GFE A;  4H6D A;  4N07 A;  2ANJ A;  1DPE A;  1QW0 A;  4EDP A;  4Q30 B;  1Y4C A;  3RY3 A;  5CMB A;  3TPA A;  4FOR A;  4QHQ A;  4MBP A;  2RCB A;  3V8X B;  4PET A;  2R71 A;  2XXR A;  1QKB A;  3IB1 A;  1IUD A;  5IAI A;  4F29 A;  1B52 A;  3A3U A;  5DTB A;  2NWJ A;  2VHA A;  3O29 A;  4PP0 A;  3H4Z A;  4IO4 A;  2DWI A;  3TMG A;  2RF1 A;  2DVC A;  4OFL A;  1GTK A;  4UAC A;  4EXK A;  1GGG A;  1RYX A;  4OET A;  1MH3 A;  1VFE A;  4RJZ A;  1QUI A;  1LB9 A;  3V89 B;  2ZXT A;  4G4P A;  3DM0 A;  3PUW E;  3FVG A;  3OEN A;  1B1X A;  4G2Z A;  5L9S A;  1EZP A;  1LAH E;  2OWT A;  3H3G A;  1DMB A;  4I8C A;  3ZKL A;  2QS2 A;  4PFY A;  3KN3 A;  4ELQ A;  4DXB A;  3HN0 A;  1Q1K A;  2I0B A;  3WAF A;  3N6U A;  1VE4 A;  2V3Q A;  1Z7N E;  1NL5 A;  1N3W A;  4JWO A;  1RYO A;  5DT6 A;  2QS4 A;  4RK2 A;  1PEB A;  4DE8 A;  2E1S A;  4FAJ A;  4ISU A;  2OZZ A;  1GVC A;  5DVJ A;  2NUV A;  1BLF A;  1JW5 A;  3K00 A;  3OO6 A;  3K6U A;  4R75 A;  1N84 A;  5FHN A;  2UYE A;  4LZ5 A;  4N13 A;  3U8Q A;  3C4M A;  4F39 A;  3K02 A;  3KSX A;  4OFO A;  4H8I A;  2P1S A;  1FQF A;  5H8N A;  4LQ2 A;  1SYH A;  1UQW A;  4AB5 A;  3CFL A;  4OQO A;  4C1U A;  4LAT A;  1PB8 A;  2I4B A;  4ZEC A; 
#chains in the Genus database with same CATH topology
 2QS1 A;  4PGN A;  2Q74 A;  1B7Z A;  4G68 A;  4GQO A;  3M3L A;  4F22 A;  5EYG A;  4BDO A;  5KDT B;  1IEJ A;  3UK4 A;  1MQJ A;  3K1M A;  4QXD A;  1D3K A;  1QJM A;  2F3B A;  4IGT A;  1IZ1 A;  2DE3 A;  4QBA A;  2H4I A;  2Z8F A;  3E13 X;  2FVZ A;  2I58 A;  1LFI A;  1DSN A;  5B70 A;  4P11 A;  3VLV A;  1P1U A;  4MLQ A;  1FBH A;  1DOT A;  3PUY E;  5ET5 A;  5CMC A;  3U1O A;  3RLF E;  1QVS A;  1I69 A;  2Y7W A;  5I57 A;  3FAT A;  3T9U A;  4GWS A;  4PE5 B;  4GWW A;  4BDL A;  4ZEK A;  3QAX A;  4IO7 A;  4ND9 A;  1BKA A;  3UA8 A;  4P0G A;  4L17 A;  4EF2 A;  1B3L A;  3FJ7 A;  4N4U A;  2HZL A;  2DP8 A;  5AA2 A;  4N8G A;  4JSO A;  4PTK A;  1QGX A;  2Q2A A;  2O1M A;  3CFZ A;  4KYD A;  3QUJ A;  1MS7 A;  3T93 B;  4O3C A;  1PBQ A;  3KN8 A;  2I49 A;  3M3K A;  2OX3 A;  3C33 A;  1A8E A;  1LCT A;  4LVQ A;  1NFT A;  4KYS A;  4DIG A;  2ZYO A;  3S4U A;  3TAJ A;  1EYI A;  4Z7E A;  3BIG A;  4PAF A;  3HCQ A;  4C1T A;  4PAI A;  1XC1 A;  3MJN A;  5KCJ B;  1SDX A;  4GX4 A;  4IB2 A;  3TEL A;  3FAS A;  4XIG Q;  4AB6 A;  4UAB A;  1VSO A;  4YU0 A;  3Q27 A;  1F9B A;  3DLN A;  2DWA A;  1ZKB A;  4TQU Q;  4IY5 A;  3N5L A;  4N8Y A;  1PC3 A;  5EQ9 A;  3MVY A;  1MG1 A;  3MPL A;  2QL3 A;  1UTH A;  1LBX A;  5H8S A;  4BDN A;  1NV7 A;  3SET A;  1MQH A;  3LR1 A;  1P1W A;  4YZZ A;  1ANF A;  1LEV A;  1FQA A;  3EHS A;  5IGA A;  3A3C A;  1S7Y A;  1SI1 A;  3MBP A;  1O63 A;  2Q8M A;  2F6G A;  1O64 A;  4XKR A;  3KGC A;  2F34 A;  5EHS A;  5AA3 A;  3MQ9 A;  1WVJ A;  3IL1 B;  1B51 A;  4U22 A;  4DI3 D;  4U1Z A;  1URD A;  2XXI A;  1FTM A;  3QXM A;  2YJP A;  3F11 A;  5IZ3 A;  2HCA A;  1UIU A;  2JJK A;  3NOH A;  4OVJ A;  4GX6 A;  5CMK A;  5IZZ A;  4OXV A;  2NOO A;  1YXI A;  1IQ7 A;  2V3U A;  5FTI A;  1B32 A;  4RXL A;  3H6W A;  3RTW B;  1PB7 A;  1JVY A;  3FUZ A;  5ITO A;  4H0W A;  4ZED A;  1DCU A;  4NED A;  1Z7M E;  3E79 A;  1IMA A;  2HXR A;  2WYK A;  1TFA A;  4PAK A;  1MDQ A;  3KOS A;  4R9F A;  3KG2 A;  2PBW A;  3IFC A;  2AIX A;  4PDD A;  1QKA A;  4N6D A;  5FBP A;  2Q89 A;  3HHG A;  3LUZ A;  3T0J A;  3HV1 A;  5H8F A;  2Q2C A;  3SEU A;  4HE1 A;  1AH5 A;  5IM2 A;  3RT8 A;  2OK2 A;  3T9V A;  3QK6 A;  1LB8 A;  2XXV A;  1B5J A;  2B3B A;  3S9M C;  1M5F A;  1XHY A;  1H45 A;  2I6E A;  2XXH A;  2XX9 A;  3WAE A;  1MXZ A;  4G8N A;  4N17 A;  4YB7 A;  1LAG E;  1NNT A;  4QFL A;  3U72 A;  4F19 A;  3TFL A;  4H46 A;  2XXQ A;  3BKI B;  3DP8 A;  4NF4 A;  1O7T A;  3D1R A;  2FIX A;  2R6G E;  1T0K A;  1GR2 A;  2O51 A;  3SKP A;  4ZE9 A;  1OMP A;  1BP5 A;  1XOC A;  5ISU A;  5F7V A;  3QUF A;  1G0H A;  3B6W A;  3MST A;  3IB0 A;  3TQW A;  4DZ1 A;  2F35 A;  1Q9D A;  5JEI A;  1XVX A;  1PDA A;  3MYU A;  4X9T A;  3R7X A;  2AYS A;  1B7H A;  3O2A A;  5KDT A;  2BJJ X;  4JWY A;  5I2K B;  2BJI A;  5EHM A;  3MZ9 A;  4XEQ A;  4YAH X;  3MW0 A;  2HXW A;  3B6Q A;  4XFE A;  4OEN A;  3TDJ A;  4MCO A;  3K0V A;  2XXW A;  2DE2 A;  1RDZ A;  2QS3 A;  3TQL A;  2Z8E A;  3EHT A;  2X7Q A;  3OO9 A;  2X26 A;  3G3I A;  3G3J A;  3PPP A;  2XXY A;  3TTN A;  1P1Q A;  2Q88 A;  1ZJL A;  5DW8 A;  5B7D A;  1II5 A;  4RY1 A;  5HM4 B;  4NG7 A;  2ZNS A;  1NUZ A;  4GWY A;  4DCY A;  5FHO A;  1B5I A;  3JZJ A;  3H7M A;  4DDD A;  1NV6 A;  3VFJ A;  2G93 A;  4FAT A;  4NHB A;  4I1D A;  2OCU A;  2QFL A;  3BIH A;  3BFU A;  1DPP A;  1LBC A;  3G3K A;  1SPI A;  5ET8 A;  4GF8 A;  2OWS A;  2CEY A;  4LA9 A;  2GH9 A;  5H8Q B;  3TKD A;  1CNQ A;  3HO7 A;  4YB6 A;  3LSX A;  3SEW A;  1MDP 1;  4KD5 A;  2CZK A;  3FJM A;  5I2N B;  4IO6 A;  1R9Q A;  2H25 A;  4R73 A;  2LAO A;  4LZ8 A;  3PUX E;  3GBB A;  2DS9 A;  2XWV A;  2WBD A;  4U21 A;  4O8M A;  1VR5 A;  2ZYN A;  3U65 A;  2ZYK A;  2OWZ A;  3LUY A;  1DTZ A;  4O3A A;  3KC0 A;  4JSD A;  1JEU A;  4HCW A;  4IY6 A;  5H8H B;  1MXU A;  3KN7 A;  3SEY A;  3JV9 A;  1FBP A;  3K6W A;  3C32 A;  3O66 A;  3A29 A;  3FJG A;  4XTC Q;  3LC8 A;  4ECF A;  2F6P A;  3LSW A;  2UVG A;  2DWH A;  2VPO A;  4ELO A;  3T1B A;  1ZMG A;  2FIE A;  3ILT B;  1LCF A;  3E9X A;  1K9Z A;  2H99 A;  2MKZ A;  4GVO A;  2O7I A;  2D5W A;  2VOZ A;  1SW1 A;  3N6T A;  4YMA A;  5ET7 A;  1HSE A;  4OWD A;  2HAU A;  3OOA A;  3KSJ A;  5ESY A;  4JDF A;  3HST A;  3KBZ A;  5TPA B;  4ZE8 A;  3D4G A;  2VPN A;  5IKB A;  3FVO A;  1USY E;  1LFH A;  3P7I A;  4F3B A;  3VLU A;  2O6A A;  3THI A;  2AL5 A;  1XT8 A;  3SDF A;  4PE3 A;  1JEV A;  4YKI A;  3S2V A;  1XI6 A;  4MNC A;  4QSD A;  4KCC A;  4R6K A;  4LZ7 A;  1EH3 A;  3SEX A;  5LDZ A;  1UTB A;  3FIR A;  5EYF A;  3DP6 A;  1BTJ A;  4GRK A;  2O1L A;  2ZNU A;  1FTA A;  3OEL A;  3BFT A;  1LGB C;  1JW4 A;  5BUU A;  3MZB A;  2A5T B;  2XD3 A;  3VE1 B;  4WKM A;  1EYK A;  3IO4 A;  4GWU A;  1RDY A;  1A55 A;  3QSL A;  4IR8 A;  3ECR A;  5LTC A;  1YYZ A;  3VV5 A;  3L6H A;  5I5P A;  1NNF A;  5DEX B;  4H8J A;  5KZT A;  4R2F A;  4KQP A;  2P3V A;  3R26 A;  3GLB A;  1A99 A;  1XS5 A;  2PCR A;  2Y84 A;  4MAG A;  4WXJ A;  4I40 A;  4MJO A;  1BK4 A;  5I59 A;  4PBH A;  2THI A;  4TOZ A;  1DK4 A;  4MX6 A;  4NAP A;  3KJ7 A;  4U2R A;  3MVW A;  4RNS A;  4DLD A;  1MY1 A;  4OYV A;  1MY4 A;  4JWX A;  2O84 X;  5HPQ A;  5CM6 A;  1ELJ A;  3Q28 A;  4EQ7 A;  4EF1 A;  4P56 A;  4MH5 A;  4RYA A;  4OZ9 A;  4F2Q A;  1N7W A;  1JP4 A;  3B50 A;  3OO7 A;  3IX1 A;  2WYP A;  3PPN A;  3UP9 A;  1MQD A;  4NWC A;  3L6G A;  4YMB A;  3MC2 A;  4LON B;  4PFT A;  1B3G A;  1LBY A;  3FD3 A;  3PD8 A;  3M3F A;  3KFM A;  4EUO A;  1UIV A;  4OEU A;  1MRP A;  3S9L C;  3IFA A;  1NNK A;  3TTK A;  5I56 B;  1FBE A;  4GIZ A;  4OVP A;  4K3F A;  1D9Q A;  2H9B A;  1LFG A;  5EQ7 A;  3RPL A;  3PMX A;  1ZU0 A;  2B65 A;  2UVJ A;  2Z23 A;  2I4C A;  4X48 A;  4DXC A;  2Y7P A;  4KI0 E;  2HZK A;  3FXQ A;  2WKY A;  5I58 A;  4FEC A;  4MMP A;  1IIW A;  2V93 A;  1SBP A;  4G61 A;  1SYI A;  3FVN A;  3IR1 A;  4AS5 A;  4QFN A;  2VD3 A;  2XD2 A;  2CMO A;  2RKM A;  2UYF A;  1S9T A;  1M5D A;  2PX1 A;  3C34 A;  4PFW A;  1NUY A;  4RA1 A;  2DOJ A;  1JVX A;  4IGR A;  2R8T A;  4F1Y A;  2ESN A;  3G3F A;  4R6Y A;  1RDX A;  5AA1 A;  4Q5T A;  4R2B A;  5A5X A;  3C31 A;  2PVU A;  1MM7 A;  3CG1 A;  3UN6 A;  3VVE A;  4Q0C A;  4FED A;  5AA4 B;  4JB7 A;  4RK9 A;  1NV0 A;  1D9Y A;  5AE4 A;  2QVV A;  4F1V A;  5L9O A;  3U94 A;  4H5F A;  3CR9 A;  4ZDM A;  3S9N C;  1H43 A;  2Y5K A;  3I6V A;  2UVH A;  4F2O A;  3S9E A;  3FV1 A;  3FBP A;  2A5S A;  4YKP A;  4OFJ A;  3EHU A;  3UGW A;  1FCK A;  2B4M A;  4XF5 A;  1QUK A;  4Q8R A;  1FQD A;  5I84 A;  1MQG A;  4OES A;  2P3N A;  1ZTY A;  3CRB A;  3FXR A;  4O94 A;  3CSG A;  1KWH A;  4OHN A;  1A40 A;  3QYT A;  1SQY A;  1AIV A;  3C9H A;  1SVX B;  1B3H A;  2XXU A;  4X8R A;  1Y3N A;  4NQ8 A;  5I2N A;  2HFB A;  4DXU A;  3DEL B;  4UA8 A;  4MNI A;  2FYI A;  4OVR A;  1NUX A;  1LBV A;  3N26 A;  1DBZ A;  2XXK A;  2D21 A;  4QFP A;  2H98 A;  5JK4 A;  1FPL A;  2DXR A;  1B3E A;  2KQZ A;  2I48 A;  3SZP A;  1Y1Z A;  2UXA A;  2QPQ A;  3B7D A;  1URG A;  2QVU A;  3GZG A;  3PPR A;  3ODB A;  1SW2 A;  1B6H A;  2VD2 A;  1FBG A;  1YPN A;  4G68 B;  2CEX A;  1MPB A;  2RIN A;  1MXW A;  3KZG A;  4HS7 A;  3T66 A;  4QSC A;  2HEU A;  1EZ9 A;  2V4C A;  1ZLQ A;  1B9J A;  1Y4T A;  4R74 A;  3N94 A;  3H03 A;  4GFR A;  1FPD A;  4LQ5 A;  2F7A A;  2KLF A;  3OSR A;  3OEK A;  4PFI A;  1A54 A;  4DI4 B;  1AMF A;  4TLL B;  4ELR A;  4HTG A;  1FTJ A;  1B0H A;  4IO5 A;  5K2Y A;  1P1O A;  2DQV A;  1N76 A;  3O6H A;  1TFD A;  1CB6 A;  1LST A;  3O6I A;  4OVS A;  1FTK A;  4KPT A;  5TPA A;  3VVF A;  3O6G A;  2F5X A;  2DSF A;  3CHG A;  4ONY A;  2F36 A;  2QJE A;  2P2A A;  2REG A;  3CIJ A;  4I9D A;  1Y20 A;  1OVT A;  5FTH A;  1NV2 A;  4PGP A;  5ITP A;  4MF3 A;  3DP4 A;  1YCJ A;  1J1N A;  4H1X A;  2HQ0 A;  4JXI A;  1B3F A;  2Y7K A;  4ZS9 A;  3KEI A;  1Q35 A;  5DYH A;  1CE2 A;  1BIY A;  1SW5 A;  4ZEI A;  5AA2 B;  1TT1 A;  1B46 A;  3K1P A;  5CBS A;  1US5 A;  2PMS A;  3TTL A;  4EQ9 A;  3W9W A;  3MP1 A;  4ESW A;  4U23 A;  1FBC A;  4X1B A;  2GHB A;  3PGF A;  4FIM A;  3K2D A;  3V83 A;  1GV8 A;  4U4X A;  1AL3 A;  3TZA A;  4GD5 A;  4E0W A;  4KXP A;  1ZIU A;  3GBA A;  3Q26 A;  3UIF A;  3RGY A;  5CC2 A;  1FQE A;  4OVT A;  2RC8 A;  1JNF A;  2OJT A;  3G7W A;  1AOV A;  2Y7I A;  3MPK A;  3GXA A;  4P0I A;  4HCY A;  2HAV A;  4O7I A;  1MY3 A;  1FPJ A;  1FPG A;  1SI0 A;  3M8U A;  4GWX A;  2I0C A;  1FBD A;  5CI5 A;  5J1D A;  4N15 A;  4N91 A;  2Y7R A;  1NV5 A;  4ZEF A;  4JVI A;  3K1N A;  1DTG A;  2DYX A;  2F7C A;  3FVK A;  2OBG A;  4XXU A;  1EYJ A;  1FSA A;  1H76 A;  1P99 A;  3IOR A;  3PPO A;  4PQJ A;  4EXL A;  5I56 A;  4GX3 A;  2XWO A;  4H5G A;  1R9L A;  1URS A;  1EZO A;  4G77 A;  4POX A;  2IA4 A;  3CVG A;  4GWZ A;  3C36 A;  3H06 B;  4GL0 A;  4XKP A;  1Y3Q A;  4HE0 A;  4I3E A;  2Z8D A;  4FEB A;  1FTO A;  3OO8 A;  1B1H A;  3LSF B;  1B4H A;  5KCJ A;  5IZ3 B;  1NNP A;  3K01 A;  4KFQ A;  1MXX A;  4OAN A;  2Q9T A;  1B05 A;  2XXX A;  1RKM A;  4YKJ A;  4M1V A;  3O9P A;  4MHF A;  3EKI A;  1NH7 A;  1TXF A;  5K2X A;  3EN3 A;  3O97 A;  2XWI A;  5I3S A;  1FJ9 A;  4N6K A;  1MM6 A;  1POT A;  4LN5 A;  4M4G A;  5M2V A;  5AA4 A;  4XKN A;  3MVZ A;  1YTV A;  3MP6 A;  1H44 A;  1B40 A;  4ZEB A;  3BBR A;  1IME A;  5DVF A;  2ZYM A;  3RTF B;  4JVD A;  3LV0 A;  3ZS6 A;  3KBR A;  1SD3 A;  1KA1 A;  1OVB A;  1JET A;  3ILU B;  3RUM A;  3PV0 E;  4QFK A;  1IXC A;  2HHM A;  2F78 A;  3HPI A;  1MPC A;  2XX7 A;  5H8F B;  1VDW A;  1ATG A;  3OSQ A;  4H67 A;  4YB5 A;  4WED A;  3T9H B;  4PF6 A;  4ESX A;  3PUV E;  4PC9 A;  1KZ8 A;  4HXV A;  4NF8 B;  4TLM B;  2G29 A;  2GQ1 A;  4ZZA A;  3CFX A;  1A8F A;  3R6U A;  2V3T A;  1FPE A;  4GLI A;  3RN8 A;  1PBP A;  4P1L A;  5ET6 A;  4N6P A;  4GXS B;  1XVY A;  1NI9 A;  2PT2 A;  1Y9U A;  2I3V A;  4G8H A;  4O3B A;  3OXN A;  1WOD A;  4NF4 B;  1IMF A;  1YZ0 A;  3H6V A;  3RNN A;  1PB9 A;  1FQC A;  2DVZ A;  5I7I A;  4NWD A;  2QSX A;  2F3D A;  3MAM A;  2CZI A;  4HE2 A;  4NF6 B;  4GL8 A;  1G0I A;  3LSL A;  3A09 A;  3IJO B;  3IOT A;  3FXU A;  2PYY A;  3T9X B;  1L5T A;  4Z0I A;  4IO2 A;  5J16 A;  4PBQ A;  4F3P A;  2ZZW A;  2M8C A;  4NTL A;  4U1O A;  1QUJ A;  3K6V A;  1JQF A;  2L5V A;  4F31 B;  2E0S A;  2UVI A;  5TP9 B;  3TCF A;  1I6A A;  2NXO A;  4NF0 A;  2KR0 A;  3HHF A;  3TTR A;  1LBW A;  3VLW A;  1AWB A;  3D4C A;  3ROJ A;  3QIM A;  4E0X A;  3PUZ E;  1P1N A;  2HPG A;  1NV3 A;  5JTY B;  3I5O A;  2CZH A;  2P0S A;  4KR5 A;  2GHA A;  5ELV A;  3O28 A;  4JVC A;  4THI A;  3SEV A;  1LLS A;  2CZL A;  4LUB A;  4QSE A;  4ZZE A;  2D3I A;  4RPO A;  3IOW A;  3IOV A;  5ICT A;  2R9J A;  1FBF A;  1MY2 A;  2ONR A;  5F1Q A;  5AA2 D;  2DE4 A;  4R9G A;  4R6H A;  3H6U A;  4QRZ A;  1EU8 A;  4NF5 B;  2XA5 A;  4GWO A;  5EQA A;  3K6X A;  2RC9 A;  4IO3 A;  2WBB A;  3EF7 A;  4R72 A;  3CSB A;  1QUL A;  2WEF A;  1H3D A;  1R6Z A;  1TWY A;  1M5B A;  1I6Q A;  2DWJ A;  2VP1 A;  3QMF A;  5EYH A;  3K4U A;  4MNP A;  1NKX A;  2FNC A;  2B4L A;  1HSJ A;  1S50 A;  3TYH A;  3PTY A;  1INP A;  4H65 A;  5I2K A;  2V25 A;  3RYD A;  2O68 A;  3SES A;  4P1E A;  2VT5 A;  4MLV A;  1D9V A;  2XHD A;  1OIB A;  3VVD A;  4F3G A;  2ONS A;  4FE8 A;  3ZKK A;  3MUQ A;  5TU0 A;  4U4S A;  4BDR A;  5FHM A;  1I6B A;  1R1N A;  4PF8 A;  3OMB A;  1LAF E;  5CRY A;  3E78 A;  2O69 A;  1M5E A;  1NV4 A;  1Y3P A;  5ICQ A;  4HW8 A;  1N04 A;  3TCG A;  1US4 A;  3EPE A;  4OER A;  4P9K A;  5HBC A;  4GOT A;  4DCX A;  5CBR A;  3IK6 B;  3AXF A;  3PMV A;  2W7Y A;  4O7M A;  2IEE A;  2XX8 A;  2PFY A;  4PDH A;  3RQT A;  4F1U A;  4X1D A;  1NMU A;  3SER A;  2YPN A;  4N81 A;  2DXY A;  4C0R A;  2QRY A;  1B4Z A;  4POW A;  3E4R A;  4P3L A;  3USD A;  5H8Q A;  3KOT A;  1MPD A;  4NX1 A;  3CG3 A;  1B0L A;  1LBB A;  2O7U A;  4RPN A;  4KHZ E;  1B2H A;  2Z22 A;  3TEP A;  2PFZ A;  1FQB A;  1LBZ A;  3E3K A;  4MIJ A;  3FZV A;  2NVU B;  5BWJ A;  2FHY A;  5CMM A;  3IO6 A;  4F18 A;  5H8N B;  2GRV A;  4FJP A;  1N7X A;  4QF9 A;  4BDQ A;  2ONK E;  1MXY A;  1UTB B;  1B5H A;  5H8H A;  1B7U A;  3U93 A;  3PD9 A;  3VDF A;  3C35 A;  1K9Y A;  1A7L A;  3IB2 A;  4YKK A;  4LP2 B;  1FW0 A;  1N3X A;  5L9M A;  3H6T A;  4GBW A;  1IMD A;  2RCA A;  1MY0 A;  3VXC A;  3OEM A;  1FTL A;  4NGU A;  3RPW A;  2XXP A;  2V84 A;  1LAX A;  1WDN A;  1POY 1;  3UOR A;  3TCH A;  3TOD A;  3CI8 A;  5L8D A;  5T3J A;  2H5Y A;  4MEV A;  5DVI A;  3TUS A;  3HFU A;  1Y1M A;  5I59 B;  2Q8J A;  1D4N A;  3IOU A;  3EQ1 A;  4I62 A;  1NV1 A;  2B3F A;  1MXV A;  3T22 A;  1IXH A;  2F8D A;  4NF8 A;  1MQI A;  5I57 B;  3OD7 A;  1ZBM A;  1YAE A;  1IMB A;  3B8B A;  3Q25 A;  1HSL A;  3Q29 A;  1IIT A;  3ISP A;  4YIC A;  1B58 A;  4G8M A;  3FGS A;  4WEP A;  3TTM A;  1FPK A;  3PMW A;  3PPQ A;  2ZMB A;  2F97 A;  3U92 A;  1MH4 A;  4MFI A;  1VFD A;  2XWK A;  2PT1 A;  4QFO A;  2VGQ A;  2YLN A;  2ABH A;  4ELP A;  3T96 B;  2A5T A;  4GXA A;  3V5A A;  1SW4 A;  1IXG A;  3PU5 A;  4F3S A;  3MZ1 A;  4EQB A;  3W15 C;  3ONM A;  5F24 A;  2I3W A;  4NF6 A;  3ZSF A;  1IXI A;  3FV2 A;  3W9V A;  3MWB A;  3RPL B;  2WX9 A;  5DEX A;  1NH8 A;  3G3G A;  2XXT A;  5I58 B;  2QMX A;  3MVX A;  5LOM A;  2AL4 A;  4KCD A;  3VXB A;  3G3H A;  2FA7 A;  5TP9 A;  3LBS A;  3B6T A;  1N0T A;  1OQG A;  4BDM A;  2QVR A;  5JTY A;  3IAZ A;  4JBZ A;  1OQH A;  3IJX B;  4G68 C;  2ZZV A;  4NE4 A;  4OMB A;  2ZNT A;  5A5X B;  4P8B A;  4PFR A;  1UTH B;  2OLB A;  4OTE A;  3KJT A;  2QMW A;  1OLA A;  3MP8 A;  1OLC A;  1FJ6 A;  4X04 A;  4BLA A;  4OEV A;  4NF5 A;  1M5C A;  2REJ A;  2ALU A;  4AQ4 A;  4KYE A;  4XKQ A;  3JYR A;  3GYY A;  2X7P A;  1JW1 A;  3I3V A;  4NMY A;  1FRP A;  2RC7 A;  2F7B A;  4PFU A;  4GBV A;  5A5L A;  3RT6 B;  1USY H;  2GFE A;  4H6D A;  4H45 A;  4N07 A;  3FXB A;  1IMC A;  2ANJ A;  1DPE A;  1QW0 A;  4EDP A;  4Q30 B;  1Y4C A;  3RY3 A;  5CMB A;  3TPA A;  4FOR A;  3KC1 A;  4QHQ A;  4MBP A;  2RCB A;  3V8X B;  4PET A;  2R71 A;  2XXR A;  1QKB A;  3IB1 A;  1IUD A;  5IAI A;  4F29 A;  1B52 A;  4PFB A;  3A3U A;  5DTB A;  2NWJ A;  1KA0 A;  2VHA A;  3O29 A;  4PP0 A;  3H4Z A;  4IO4 A;  2DWI A;  3TMG A;  4NN3 A;  2RF1 A;  2DVC A;  4OFL A;  1GTK A;  4UAC A;  4EXK A;  1FPB A;  1GGG A;  1RYX A;  4OVQ A;  4AS4 A;  4OET A;  1MH3 A;  1VFE A;  4RJZ A;  1QUI A;  1LB9 A;  3V89 B;  2ZXT A;  4G4P A;  3DM0 A;  3PUW E;  3FVG A;  3OEN A;  1B1X A;  4G2Z A;  5L9S A;  1EZP A;  1LAH E;  2OWT A;  3H3G A;  1DMB A;  4I8C A;  5IZ1 A;  3ZKL A;  2QS2 A;  4PFY A;  3KN3 A;  4ELQ A;  4DXB A;  3HN0 A;  1Q1K A;  1NUW A;  1FPF A;  2I0B A;  3WAF A;  3N6U A;  2Y5L A;  1VE4 A;  2V3Q A;  1Z7N E;  1NL5 A;  1N3W A;  4JWO A;  1RYO A;  5DT6 A;  2QS4 A;  4RK2 A;  4I3Y A;  1PEB A;  4PCD A;  4DE8 A;  2E1S A;  4FAJ A;  4ISU A;  5EQ8 A;  2OZZ A;  1GVC A;  5DVJ A;  2NUV A;  2DDK A;  1BLF A;  1JW5 A;  3K00 A;  4P47 A;  3OO6 A;  4OA4 A;  3K6U A;  4R75 A;  1N84 A;  2ZZX A;  5FHN A;  2UYE A;  4LZ5 A;  4N13 A;  3U8Q A;  3C4M A;  2FBP A;  4F39 A;  1FPI A;  3K02 A;  3KSX A;  4OFO A;  4FBP A;  4H8I A;  2P1S A;  1FQF A;  5H8N A;  4LQ2 A;  1SYH A;  1UQW A;  4AB5 A;  3CFL A;  4OQO A;  4C1U A;  4LAT A;  1PB8 A;  2I4B A;  4ZEC A; 
#chains in the Genus database with same CATH homology
 2QS1 A;  1B7Z A;  4G68 A;  4GQO A;  3M3L A;  4F22 A;  4BDO A;  5KDT B;  1IEJ A;  3UK4 A;  1MQJ A;  3K1M A;  1D3K A;  1QJM A;  4IGT A;  1IZ1 A;  2DE3 A;  2H4I A;  2Z8F A;  3E13 X;  2I58 A;  1LFI A;  1DSN A;  5B70 A;  4P11 A;  3VLV A;  1P1U A;  4MLQ A;  1DOT A;  3PUY E;  5CMC A;  3U1O A;  3RLF E;  1QVS A;  1I69 A;  2Y7W A;  5I57 A;  3FAT A;  3T9U A;  4PE5 B;  4BDL A;  4ZEK A;  3QAX A;  4IO7 A;  4ND9 A;  1BKA A;  3UA8 A;  4P0G A;  4L17 A;  4EF2 A;  1B3L A;  3FJ7 A;  2HZL A;  2DP8 A;  5AA2 A;  4JSO A;  2Q2A A;  2O1M A;  3CFZ A;  4KYD A;  3QUJ A;  1MS7 A;  3T93 B;  4O3C A;  1PBQ A;  3KN8 A;  2I49 A;  3M3K A;  3C33 A;  1A8E A;  1LCT A;  4LVQ A;  1NFT A;  4KYS A;  4DIG A;  2ZYO A;  3S4U A;  3TAJ A;  4Z7E A;  3HCQ A;  4C1T A;  1XC1 A;  3MJN A;  5KCJ B;  1SDX A;  4IB2 A;  3TEL A;  3FAS A;  4XIG Q;  4AB6 A;  1VSO A;  4YU0 A;  3Q27 A;  1F9B A;  3DLN A;  2DWA A;  1ZKB A;  4TQU Q;  4IY5 A;  3N5L A;  1PC3 A;  3MVY A;  1MG1 A;  3MPL A;  2QL3 A;  1UTH A;  5H8S A;  4BDN A;  3SET A;  1MQH A;  3LR1 A;  1P1W A;  4YZZ A;  1ANF A;  1FQA A;  3EHS A;  3A3C A;  1S7Y A;  1SI1 A;  3MBP A;  1O63 A;  2F6G A;  1O64 A;  4XKR A;  3KGC A;  2F34 A;  5EHS A;  5AA3 A;  3MQ9 A;  1WVJ A;  3IL1 B;  1B51 A;  4U22 A;  4U1Z A;  1URD A;  2XXI A;  1FTM A;  3QXM A;  2YJP A;  3F11 A;  2HCA A;  1UIU A;  4OVJ A;  5CMK A;  4OXV A;  2NOO A;  5FTI A;  1IQ7 A;  2V3U A;  1B32 A;  4RXL A;  3H6W A;  3RTW B;  1PB7 A;  1JVY A;  3FUZ A;  5ITO A;  4H0W A;  4ZED A;  4NED A;  1Z7M E;  1TFA A;  1MDQ A;  3KOS A;  4R9F A;  3KG2 A;  2PBW A;  2AIX A;  1QKA A;  2Q89 A;  3HHG A;  3HV1 A;  5H8F A;  2Q2C A;  3SEU A;  1AH5 A;  3RT8 A;  2OK2 A;  3T9V A;  3QK6 A;  1LB8 A;  2XXV A;  1B5J A;  2B3B A;  3S9M C;  1M5F A;  1XHY A;  1H45 A;  2I6E A;  2XXH A;  2XX9 A;  3WAE A;  1MXZ A;  4G8N A;  4YB7 A;  1LAG E;  1NNT A;  4QFL A;  3U72 A;  4F19 A;  3TFL A;  2XXQ A;  3BKI B;  3DP8 A;  4NF4 A;  1O7T A;  2R6G E;  1T0K A;  1GR2 A;  2O51 A;  3SKP A;  4ZE9 A;  1OMP A;  1BP5 A;  1XOC A;  5ISU A;  5F7V A;  3QUF A;  3B6W A;  3IB0 A;  3TQW A;  4DZ1 A;  2F35 A;  5JEI A;  1XVX A;  1PDA A;  4X9T A;  3R7X A;  2AYS A;  1B7H A;  3O2A A;  5KDT A;  2BJJ X;  4JWY A;  5I2K B;  5EHM A;  3MZ9 A;  4YAH X;  3MW0 A;  2HXW A;  3B6Q A;  4OEN A;  3TDJ A;  3K0V A;  2XXW A;  2DE2 A;  2QS3 A;  3TQL A;  2Z8E A;  3EHT A;  2X7Q A;  3OO9 A;  2X26 A;  3G3I A;  3G3J A;  3PPP A;  2XXY A;  3TTN A;  1P1Q A;  2Q88 A;  1ZJL A;  5B7D A;  1II5 A;  4RY1 A;  5HM4 B;  2ZNS A;  4DCY A;  5FHO A;  1B5I A;  3JZJ A;  3H7M A;  4DDD A;  3VFJ A;  2G93 A;  4FAT A;  4I1D A;  2OCU A;  3BFU A;  1DPP A;  1LBC A;  3G3K A;  4GF8 A;  2OWS A;  4LA9 A;  2GH9 A;  5H8Q B;  3TKD A;  3HO7 A;  4YB6 A;  3LSX A;  3SEW A;  1MDP 1;  4KD5 A;  3FJM A;  5I2N B;  4IO6 A;  1R9Q A;  2H25 A;  4R73 A;  2LAO A;  4LZ8 A;  3PUX E;  3GBB A;  2DS9 A;  4U21 A;  1VR5 A;  2ZYN A;  2ZYK A;  3LUY A;  1DTZ A;  4O3A A;  4JSD A;  1JEU A;  4HCW A;  4IY6 A;  5H8H B;  1MXU A;  3KN7 A;  3SEY A;  3JV9 A;  3K6W A;  3C32 A;  3O66 A;  3FJG A;  4XTC Q;  3LC8 A;  4ECF A;  2F6P A;  3LSW A;  2UVG A;  2DWH A;  4ELO A;  1ZMG A;  3ILT B;  1LCF A;  3E9X A;  2H99 A;  4GVO A;  2O7I A;  2D5W A;  2VOZ A;  1SW1 A;  3N6T A;  4YMA A;  1HSE A;  4OWD A;  2HAU A;  3OOA A;  3KSJ A;  4JDF A;  3HST A;  5TPA B;  4ZE8 A;  3D4G A;  5IKB A;  3FVO A;  1USY E;  1LFH A;  3P7I A;  4F3B A;  3VLU A;  2O6A A;  3THI A;  2AL5 A;  1XT8 A;  3SDF A;  1JEV A;  4YKI A;  3S2V A;  4QSD A;  4KCC A;  4R6K A;  4LZ7 A;  1EH3 A;  3SEX A;  1UTB A;  3FIR A;  5EYF A;  3DP6 A;  1BTJ A;  4GRK A;  2O1L A;  2ZNU A;  3OEL A;  3BFT A;  1LGB C;  1JW4 A;  5BUU A;  3MZB A;  2A5T B;  2XD3 A;  3VE1 B;  4WKM A;  3IO4 A;  1A55 A;  3QSL A;  3ECR A;  3VV5 A;  3L6H A;  1NNF A;  5DEX B;  4H8J A;  5KZT A;  4R2F A;  4KQP A;  3R26 A;  3GLB A;  1A99 A;  1XS5 A;  2Y84 A;  4WXJ A;  5I59 A;  2THI A;  4TOZ A;  3KJ7 A;  4U2R A;  3MVW A;  4RNS A;  4DLD A;  1MY1 A;  4OYV A;  1MY4 A;  4JWX A;  2O84 X;  5HPQ A;  5CM6 A;  1ELJ A;  3Q28 A;  4EQ7 A;  4EF1 A;  4MH5 A;  4RYA A;  4OZ9 A;  4F2Q A;  1N7W A;  3OO7 A;  3IX1 A;  3PPN A;  3UP9 A;  1MQD A;  4NWC A;  3L6G A;  4YMB A;  3MC2 A;  4LON B;  4PFT A;  1B3G A;  3FD3 A;  3PD8 A;  3M3F A;  3KFM A;  4EUO A;  1UIV A;  4OEU A;  1MRP A;  3S9L C;  1NNK A;  3TTK A;  5I56 B;  4GIZ A;  4K3F A;  2H9B A;  1LFG A;  3PMX A;  1ZU0 A;  2B65 A;  2UVJ A;  2Z23 A;  2I4C A;  4X48 A;  4DXC A;  2Y7P A;  4KI0 E;  2HZK A;  3FXQ A;  2WKY A;  5I58 A;  4FEC A;  1IIW A;  2V93 A;  1SBP A;  1SYI A;  3FVN A;  3IR1 A;  4QFN A;  2VD3 A;  2XD2 A;  2CMO A;  2RKM A;  2UYF A;  1S9T A;  1M5D A;  2PX1 A;  3C34 A;  4PFW A;  4RA1 A;  2DOJ A;  1JVX A;  4IGR A;  4F1Y A;  2ESN A;  3G3F A;  4R6Y A;  5AA1 A;  4Q5T A;  4R2B A;  5A5X A;  3C31 A;  2PVU A;  1MM7 A;  3CG1 A;  3UN6 A;  3VVE A;  4Q0C A;  4FED A;  5AA4 B;  4JB7 A;  4RK9 A;  1D9Y A;  5AE4 A;  4F1V A;  5L9O A;  3U94 A;  4H5F A;  3CR9 A;  4ZDM A;  3S9N C;  1H43 A;  3I6V A;  2UVH A;  4F2O A;  3S9E A;  3FV1 A;  2A5S A;  4YKP A;  4OFJ A;  3EHU A;  3UGW A;  1FCK A;  1QUK A;  4Q8R A;  1FQD A;  5I84 A;  1MQG A;  3CRB A;  1ZTY A;  4OES A;  3FXR A;  3CSG A;  1KWH A;  4OHN A;  1A40 A;  3QYT A;  1SQY A;  1AIV A;  3C9H A;  1SVX B;  1B3H A;  2XXU A;  1Y3N A;  5I2N A;  2HFB A;  4DXU A;  3DEL B;  4UA8 A;  2FYI A;  3N26 A;  2D21 A;  4QFP A;  2H98 A;  5JK4 A;  2DXR A;  1B3E A;  2I48 A;  1Y1Z A;  2UXA A;  2QPQ A;  3B7D A;  1URG A;  3GZG A;  3PPR A;  3ODB A;  1SW2 A;  1B6H A;  2VD2 A;  1YPN A;  4G68 B;  1MPB A;  2RIN A;  1MXW A;  3KZG A;  4HS7 A;  3T66 A;  4QSC A;  2HEU A;  1EZ9 A;  1ZLQ A;  1B9J A;  1Y4T A;  4R74 A;  3N94 A;  3H03 A;  4GFR A;  4LQ5 A;  2F7A A;  2KLF A;  3OSR A;  3OEK A;  1A54 A;  1AMF A;  4TLL B;  4ELR A;  4HTG A;  1FTJ A;  1B0H A;  4IO5 A;  5K2Y A;  1P1O A;  2DQV A;  1N76 A;  3O6H A;  1TFD A;  1CB6 A;  1LST A;  3O6I A;  1FTK A;  4KPT A;  5TPA A;  3VVF A;  3O6G A;  2F5X A;  2DSF A;  4ONY A;  2F36 A;  2QJE A;  2P2A A;  2REG A;  3CIJ A;  4I9D A;  1Y20 A;  1OVT A;  5FTH A;  5ITP A;  4MF3 A;  3DP4 A;  1YCJ A;  1J1N A;  4H1X A;  2HQ0 A;  4JXI A;  1B3F A;  2Y7K A;  4ZS9 A;  3KEI A;  1Q35 A;  5DYH A;  1CE2 A;  1BIY A;  1SW5 A;  4ZEI A;  5AA2 B;  1TT1 A;  1B46 A;  3K1P A;  5CBS A;  1US5 A;  2PMS A;  3TTL A;  4EQ9 A;  3W9W A;  3MP1 A;  4ESW A;  4U23 A;  4X1B A;  2GHB A;  3PGF A;  4FIM A;  3K2D A;  3V83 A;  1GV8 A;  4U4X A;  1AL3 A;  3TZA A;  4GD5 A;  4E0W A;  1ZIU A;  3GBA A;  3Q26 A;  3UIF A;  3RGY A;  5CC2 A;  1FQE A;  2RC8 A;  1JNF A;  2OJT A;  3G7W A;  1AOV A;  2Y7I A;  3MPK A;  3GXA A;  4P0I A;  4HCY A;  2HAV A;  1MY3 A;  1SI0 A;  3M8U A;  2I0C A;  5CI5 A;  5J1D A;  2Y7R A;  4ZEF A;  3K1N A;  1DTG A;  2DYX A;  2F7C A;  3FVK A;  2OBG A;  4XXU A;  1P99 A;  1H76 A;  3PPO A;  3IOR A;  4PQJ A;  4EXL A;  5I56 A;  4H5G A;  1R9L A;  1URS A;  1EZO A;  4G77 A;  4POX A;  2IA4 A;  3CVG A;  3C36 A;  3H06 B;  4GL0 A;  4XKP A;  1Y3Q A;  2Z8D A;  4FEB A;  1FTO A;  3OO8 A;  1B1H A;  3LSF B;  1B4H A;  5KCJ A;  1NNP A;  3K01 A;  4KFQ A;  1MXX A;  2Q9T A;  1B05 A;  2XXX A;  1RKM A;  4YKJ A;  4M1V A;  3O9P A;  1NH7 A;  1TXF A;  5K2X A;  3EN3 A;  3O97 A;  1MM6 A;  1POT A;  4M4G A;  5M2V A;  5AA4 A;  4XKN A;  3MVZ A;  1YTV A;  3MP6 A;  1H44 A;  1B40 A;  4ZEB A;  3BBR A;  5DVF A;  2ZYM A;  3RTF B;  3ZS6 A;  3KBR A;  1SD3 A;  1OVB A;  1JET A;  3ILU B;  3RUM A;  3PV0 E;  4QFK A;  1IXC A;  2F78 A;  3HPI A;  1MPC A;  2XX7 A;  5H8F B;  1ATG A;  3OSQ A;  4H67 A;  4YB5 A;  4WED A;  3T9H B;  4ESX A;  3PUV E;  4NF8 B;  4TLM B;  2G29 A;  4ZZA A;  3CFX A;  1A8F A;  3R6U A;  2V3T A;  4GLI A;  3RN8 A;  1PBP A;  4N6P A;  4GXS B;  1XVY A;  2PT2 A;  1Y9U A;  2I3V A;  4G8H A;  4O3B A;  3OXN A;  1WOD A;  4NF4 B;  3H6V A;  3RNN A;  1PB9 A;  1FQC A;  2DVZ A;  4NWD A;  2QSX A;  3MAM A;  4NF6 B;  4GL8 A;  3LSL A;  3A09 A;  3IJO B;  3IOT A;  3FXU A;  2PYY A;  3T9X B;  1L5T A;  4Z0I A;  4IO2 A;  4F3P A;  2M8C A;  4NTL A;  4U1O A;  1QUJ A;  3K6V A;  1JQF A;  4F31 B;  2E0S A;  2UVI A;  5TP9 B;  3TCF A;  1I6A A;  2NXO A;  3HHF A;  3TTR A;  3VLW A;  3D4C A;  4E0X A;  3QIM A;  3PUZ E;  1P1N A;  5JTY B;  3I5O A;  2P0S A;  4KR5 A;  2GHA A;  5ELV A;  3O28 A;  4THI A;  3SEV A;  1LLS A;  2CZL A;  4LUB A;  4QSE A;  4ZZE A;  2D3I A;  4RPO A;  3IOW A;  3IOV A;  5ICT A;  2R9J A;  1MY2 A;  2ONR A;  5F1Q A;  5AA2 D;  2DE4 A;  4R9G A;  4R6H A;  3H6U A;  4QRZ A;  1EU8 A;  4NF5 B;  4GWO A;  3K6X A;  2RC9 A;  4IO3 A;  3EF7 A;  4R72 A;  3CSB A;  1QUL A;  1H3D A;  1R6Z A;  1TWY A;  1M5B A;  1I6Q A;  2DWJ A;  2VP1 A;  3K4U A;  1NKX A;  2FNC A;  1HSJ A;  1S50 A;  3TYH A;  5I2K A;  4H65 A;  2V25 A;  2O68 A;  3SES A;  4MLV A;  1D9V A;  2XHD A;  1OIB A;  3VVD A;  4F3G A;  2ONS A;  4FE8 A;  3ZKK A;  3MUQ A;  5TU0 A;  4U4S A;  4BDR A;  5FHM A;  1I6B A;  1R1N A;  3OMB A;  1LAF E;  5CRY A;  2O69 A;  1M5E A;  1Y3P A;  5ICQ A;  4HW8 A;  1N04 A;  3TCG A;  1US4 A;  3EPE A;  4OER A;  5HBC A;  4GOT A;  4DCX A;  5CBR A;  3IK6 B;  3AXF A;  3PMV A;  2W7Y A;  2IEE A;  2XX8 A;  3RQT A;  4F1U A;  4X1D A;  1NMU A;  3SER A;  2YPN A;  2DXY A;  4C0R A;  2QRY A;  1B4Z A;  4POW A;  3E4R A;  3USD A;  5H8Q A;  3KOT A;  1MPD A;  3CG3 A;  1B0L A;  1LBB A;  2O7U A;  4RPN A;  4KHZ E;  1B2H A;  2Z22 A;  3TEP A;  1FQB A;  3E3K A;  3FZV A;  2NVU B;  5BWJ A;  5CMM A;  3IO6 A;  4F18 A;  5H8N B;  2GRV A;  4FJP A;  1N7X A;  4QF9 A;  4BDQ A;  2ONK E;  1MXY A;  1UTB B;  1B5H A;  5H8H A;  1B7U A;  3U93 A;  3PD9 A;  3VDF A;  3C35 A;  1A7L A;  3IB2 A;  4YKK A;  4LP2 B;  1FW0 A;  1N3X A;  5L9M A;  3H6T A;  2RCA A;  1MY0 A;  3VXC A;  3OEM A;  1FTL A;  3RPW A;  2XXP A;  2V84 A;  1LAX A;  1WDN A;  1POY 1;  3UOR A;  3TCH A;  3TOD A;  3CI8 A;  5L8D A;  2H5Y A;  5DVI A;  3TUS A;  1Y1M A;  5I59 B;  2Q8J A;  1D4N A;  3IOU A;  3EQ1 A;  4I62 A;  2B3F A;  1MXV A;  3T22 A;  1IXH A;  2F8D A;  4NF8 A;  1MQI A;  5I57 B;  3OD7 A;  1ZBM A;  1YAE A;  3Q25 A;  1HSL A;  3Q29 A;  1IIT A;  4YIC A;  1B58 A;  4G8M A;  3FGS A;  4WEP A;  3TTM A;  3PMW A;  3PPQ A;  2ZMB A;  2F97 A;  3U92 A;  1MH4 A;  4MFI A;  1VFD A;  2PT1 A;  4QFO A;  2VGQ A;  2YLN A;  2ABH A;  4ELP A;  3T96 B;  2A5T A;  4GXA A;  3V5A A;  1SW4 A;  1IXG A;  3PU5 A;  4F3S A;  3MZ1 A;  4EQB A;  3W15 C;  3ONM A;  2I3W A;  4NF6 A;  3ZSF A;  1IXI A;  3FV2 A;  3W9V A;  3MWB A;  5DEX A;  1NH8 A;  3G3G A;  2XXT A;  5I58 B;  2QMX A;  3MVX A;  5LOM A;  2AL4 A;  4KCD A;  3VXB A;  3G3H A;  2FA7 A;  5TP9 A;  3LBS A;  3B6T A;  1N0T A;  1OQG A;  4BDM A;  5JTY A;  3IAZ A;  4JBZ A;  1OQH A;  3IJX B;  4G68 C;  4NE4 A;  4OMB A;  2ZNT A;  5A5X B;  1UTH B;  2OLB A;  4OTE A;  3KJT A;  2QMW A;  1OLA A;  3MP8 A;  1OLC A;  4BLA A;  4OEV A;  4NF5 A;  1M5C A;  2REJ A;  2ALU A;  4AQ4 A;  4KYE A;  4XKQ A;  3JYR A;  2X7P A;  1JW1 A;  3I3V A;  4NMY A;  2RC7 A;  2F7B A;  4PFU A;  3RT6 B;  1USY H;  2GFE A;  4H6D A;  4N07 A;  2ANJ A;  1DPE A;  1QW0 A;  4EDP A;  4Q30 B;  1Y4C A;  3RY3 A;  5CMB A;  3TPA A;  4FOR A;  4QHQ A;  4MBP A;  2RCB A;  3V8X B;  4PET A;  2R71 A;  2XXR A;  1QKB A;  3IB1 A;  1IUD A;  5IAI A;  4F29 A;  1B52 A;  3A3U A;  5DTB A;  2NWJ A;  2VHA A;  3O29 A;  4PP0 A;  3H4Z A;  4IO4 A;  2DWI A;  3TMG A;  2RF1 A;  2DVC A;  4OFL A;  1GTK A;  4UAC A;  4EXK A;  1GGG A;  1RYX A;  4OET A;  1MH3 A;  1VFE A;  4RJZ A;  1QUI A;  1LB9 A;  3V89 B;  2ZXT A;  4G4P A;  3DM0 A;  3PUW E;  3FVG A;  3OEN A;  1B1X A;  4G2Z A;  5L9S A;  1EZP A;  1LAH E;  2OWT A;  3H3G A;  1DMB A;  4I8C A;  3ZKL A;  2QS2 A;  4PFY A;  3KN3 A;  4ELQ A;  4DXB A;  3HN0 A;  1Q1K A;  2I0B A;  3WAF A;  3N6U A;  1VE4 A;  2V3Q A;  1Z7N E;  1NL5 A;  1N3W A;  4JWO A;  1RYO A;  5DT6 A;  2QS4 A;  4RK2 A;  1PEB A;  4DE8 A;  2E1S A;  4FAJ A;  4ISU A;  2OZZ A;  1GVC A;  5DVJ A;  2NUV A;  1BLF A;  1JW5 A;  3K00 A;  3OO6 A;  3K6U A;  4R75 A;  1N84 A;  5FHN A;  2UYE A;  4LZ5 A;  4N13 A;  3U8Q A;  3C4M A;  4F39 A;  3K02 A;  3KSX A;  4OFO A;  4H8I A;  2P1S A;  1FQF A;  5H8N A;  4LQ2 A;  1SYH A;  1UQW A;  4AB5 A;  3CFL A;  4OQO A;  4C1U A;  4LAT A;  1PB8 A;  2I4B A;  4ZEC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...