1PB7A

Crystal structure of the nr1 ligand binding core in complex with glycine at 1.35 angstroms resolution
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
289
structure length
281
Chain Sequence
TRLKIVTIHQEPFVYVKPTMSDGTCKEEFTVNGDPVKKVICTGPNHTVPQCCYGFCIDLLIKLARTMNFTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKGTRITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSHENGFMEDLDKTWVRYQECDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-methyl-D-aspartate Receptor Subunit 1
publication title Mechanisms of activation, inhibition and specificity: crystal structures of the NMDA receptor NR1 ligand-binding core
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Ligand binding protein
total genus 78
structure length 281
sequence length 289
ec nomenclature
pdb deposition date 2003-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1pb7A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1pb7A02
3M3LA 3OO7A 4GIZA 1JEVA 1FTKA 5AE4A 4EF2A 3FV1A 1JVYA 2RKMA 2Y7PA 3CVGA 3TCGA 1SI0A 3MW0A 1QUIA 1MY1A 4R6KA 3BBRA 1IIWA 1LAXA 1MXZA 4N07A 2Q2AA 5CRYA 4XXUA 3SEUA 3TFLA 4LQ2A 3IR1A 5DT6A 3H6VA 2PT2A 4K3FA 4KCCA 4ZECA 4AB5A 1N0TA 2HAUA 4O3BA 2A5TB 4LZ7A 1USYE 5L9OA 4YICA 2UVHA 1NMUA 1N3WA 3DP4A 3OEKA 1PB8A 1JEUA 3N6UA 2Z8EA 4JDFA 2O1LA 2OLBA 4HW8A 3U72A 4XKQA 3BFUA 1VSOA 1NNTA 1EZ9A 1PDAA 3FZVA 2GH9A 2Z8DA 1N76A 4NWDA 3IB2A 2O7IA 3GBAA 4H5GA 5HPQA 1POTA 3PUVE 1P1WA 2XXWA 5ICQA 4Q0CA 4ZE9A 4ZEBA 3B7DA 3MC2A 2DSFA 4G4PA 5I2NA 1PEBA 3GZGA 3MAMA 3O66A 3MZ9A 1PBQA 3UIFA 1Y4CA 2I0CA 4HCYA 2AL4A 4OHNA 2DYXA 4DXUA 3MVXA 1O7TA 1MXUA 1A40A 3O97A 2P1SA 1IXGA 3PMXA 2Q9TA 3MVWA 3MP1A 4N6PA 2OK2A 3ECRA 4OETA 3T93B 4OTEA 3QIMA 1J1NA 3W9VA 1JQFA 2F7AA 1XVYA 2P0SA 4XIGQ 1DTZA 3RY3A 1OLAA 2DOJA 4YMAA 5B7DA 3E3KA 2E0SA 3LBSA 4IO2A 2UXAA 3B6QA 4THIA 3CSBA 1IXHA 1ZBMA 2YLNA 3TPAA 3G3KA 5DYHA 5I2NB 5DVJA 1FQCA 4QFNA 1VFEA 2HQ0A 4YB6A 3PUXE 4EUOA 3PPQA 1OVBA 4R2FA 3LSWA 1B7ZA 4BDLA 4RPOA 3IJXB 2NVUB 2P2AA 3HV1A 3OO6A 1RYXA 2XX8A 1B5JA 4GOTA 1R9QA 1EH3A 4F2QA 4F3BA 3KEIA 2QS1A 1LLSA 1A54A 3SESA 1QVSA 4DXBA 1XVXA 4YKIA 3CFZA 1IITA 4BDNA 2F7CA 4RJZA 3M3FA 3ILUB 1GVCA 4RXLA 1B1XA 4E0WA 4GD5A 3MPKA 3RGYA 3OOAA 4LZ8A 1N7WA 4PFYA 3L6HA 1N04A 1ELJA 3ODBA 2GHAA 1GR2A 1I69A 2RF1A 3GXAA 4GXSB 3TTLA 2QS2A 4FECA 3OXNA 4GXAA 1S9TA 4OXVA 2D5WA 1A8FA 4L17A 4E0XA 4IY5A 4GFRA 1MXXA 5I2KA 4I9DA 3TODA 3H6UA 3E4RA 4RYAA 3VV5A 1MY3A 4RPNA 3DLNA 4HS7A 1DMBA 4IO5A 4TOZA 2VD3A 4N13A 2DWJA 5TP9A 4ZZEA 3FD3A 1LAGE 3OSQA 2YPNA 4QSCA 4KD5A 3CG1A 4LATA 3WAFA 1S7YA 2A5SA 4IO7A 3U94A 1URDA 3T9HB 4I8CA 3OENA 3VLWA 4R9FA 3KN7A 4WKMA 4JB7A 1M5FA 1UIVA 2G29A 4IY6A 4P0GA 4KPTA 2QMXA 3RT6B 1NH8A 2QS3A 1H76A 1UTHA 2Y84A 2DVCA 2DWIA 4KQPA 5I2KB 3IOTA 4I62A 4LQ5A 4F1UA 1B7UA 2DXYA 4ONYA 4U1ZA 3O28A 3EHSA 2R9JA 1NNFA 1EZPA 3SETA 5CMCA 1LAFE 1UTBA 1JW5A 4UA8A 2I6EA 3TAJA 3HHFA 3HCQA 5TPAA 3FATA 4R75A 3FGSA 2ZXTA 5TP9B 1B46A 5KZTA 3OSRA 3FJMA 1Y3NA 2DWHA 1S50A 4EF1A 1II5A 2XXIA 4JWYA 1ZLQA 2KLFA 1P1NA 2PBWA 1B40A 1NNKA 4G68C 4M4GA 4YZZA 3KGCA 1QULA 4F1VA 1XS5A 4G8HA 2I3VA 4R6HA 3SEXA 4QF9A 2DP8A 4ESWA 3S9LC 3CSGA 4OENA 4GL0A 4Q30B 1UQWA 4MH5A 2DXRA 2YJPA 3MVZA 3FXQA 1B2HA 1UTHB 3PPRA 3HHGA 1MXVA 3DELB 2V3TA 1MQDA 2THIA 1R9LA 2LAOA 4KYDA 3K4UA 3FJ7A 5H8HA 4JXIA 3RQTA 4EQ9A 5I59A 1QUKA 4H67A 1SYIA 4ZEKA 5FHNA 4NMYA 3ONMA 3FUZA 1UTBB 3T9VA 5TPAB 3B6TA 1R6ZA 1MQGA 5HM4B 1HSJA 1YAEA 5EHSA 3K6VA 1B4HA 4NF5A 4PE5B 1MQJA 1D3KA 5B70A 1Y1MA 2I48A 4LONB 2ANJA 1RYOA 3KG2A 3N26A 2V93A 3IO6A 3IK6B 4H65A 4JWOA 1IXIA 4OZ9A 1TT1A 5BUUA 1Y3PA 4Z0IA 1P1UA 3FVNA 2XX9A 3CFXA 3A3UA 1NNPA 1O64A 2W7YA 3E13X 2ZNSA 5L8DA 3RNNA 1SW4A 5H8FA 5ELVA 1AH5A 5DVIA 3LSXA 1A7LA 3TQLA 5H8HB 5I59B 4U22A 2GFEA 3SEWA 4C1UA 3T9UA 2VOZA 2GRVA 3IOVA 1HSEA 4AQ4A 4QFPA 2F6PA 1OQGA 3FASA 2CZLA 5CBRA 2B65A 1P99A 3H7MA 3CR9A 4ND9A 4OFJA 3G3FA 4MLQA 4NF5B 3JZJA 2ZNTA 1B5IA 4WEDA 3VVFA 1SQYA 3SDFA 3KBRA 2AYSA 4R6YA 3RPWA 1SW5A 2ZNUA 4FEBA 2DS9A 2REGA 1NL5A 2XD2A 2Z8FA 4EQ7A 2VHAA 3MVYA 1LBBA 5H8SA 3V5AA 4R73A 4RA1A 3UK4A 4GF8A 5H8FB 4KR5A 3FXUA 1VFDA 4BDMA 4BLAA 3RLFE 3PMVA 1LFGA 3MBPA 3VE1B 4MFIA 1OVTA 4JSOA 1WDNA 1DSNA 3WAEA 1USYH 1XOCA 3LC8A 3FIRA 3C9HA 4O3CA 1MH3A 5L9MA 3K2DA 1MDP1 1B3EA 4PQJA 4BDOA 3QUFA 3THIA 3K1PA 4X9TA 1Q1KA 1VR5A 1MQIA 4JBZA 2H25A 5AA2D 3KJ7A 4ZEFA 1B32A 1EU8A 3CIJA 4H5FA 3KN8A 3T22A 2HAVA 1IEJA 4H6DA 1MPDA 1BLFA 4GL8A 3H4ZA 3CRBA 1B05A 2F97A 4MF3A 3PGFA 2F8DA 1FQFA 2Q88A 3S2VA 3N94A 4NTLA 1LFIA 3CG3A 4FORA 1AOVA 1NKXA 2HCAA 1POY1 1Z7NE 4MLVA 3O6GA 5IAIA 4R9GA 4EQBA 3EQ1A 4QRZA 1LAHE 3KSJA 1MXWA 3W9WA 5I56A 2DQVA 3JV9A 1SI1A 3H03A 3OMBA 3EF7A 1FTLA 2H4IA 2V84A 4OERA 2ZYOA 3LR1A 2Z22A 4LUBA 3Q29A 4DDDA 1SDXA 4TLMB 4H8JA 4FJPA 1GV8A 3JYRA 1WODA 2UVGA 4F1YA 4QHQA 1NH7A 5K2XA 2OCUA 4ISUA 1SW2A 1KWHA 2F35A 2OBGA 5FTHA 2Y7WA 3HPIA 1I6BA 3H3GA 3O2AA 3TEPA 3BFTA 2ONKE 2O7UA 3HSTA 4X48A 4GWOA 3MZ1A 1B3FA 4QSDA 1N84A 1A55A 3G3HA 3H6TA 1ATGA 1ZMGA 2D3IA 5I56B 4KHZE 2PX1A 3T96B 3RN8A 3PU5A 4F39A 2O68A 4P11A 2F36A 1ZJLA 3OO8A 2QS4A 4EXLA 2R71A 3MP6A 1N3XA 2FYIA 2RCAA 3VFJA 2XD3A 1P1QA 2UVIA 5LOMA 5JK4A 3TQWA 4F31B 1YPNA 4QFKA 1MM6A 3IX1A 1N7XA 4DXCA 1TFAA 2H9BA 3PUYE 4IGRA 3QXMA 3LUYA 3VVEA 2UYFA 4JWXA 4YU0A 4ZEIA 2DE3A 2I0BA 4XKNA 1FTJA 4R74A 3CI8A 4OEUA 2HZKA 3GBBA 5J1DA 5F7VA 5AA1A 3P7IA 5AA4A 2CMOA 5L9SA 5KDTA 4AB6A 1OQHA 1LBCA 1SD3A 3V89B 1MQHA 1B3GA 3I6VA 3TYHA 1ZU0A 4LVQA 2O51A 2VGQA 3K0VA 3Q26A 2QRYA 4YMBA 1JW1A 2O6AA 3Q27A 3C34A 3UA8A 1IZ1A 1B0LA 3MPLA 4F3GA 1I6AA 3OEMA 4OFLA 1NFTA 3SKPA 2QL3A 4F19A 1I6QA 2O1MA 4HCWA 1CE2A 1ANFA 3T9XB 4PETA 2OWSA 1HSLA 4EXKA 3U93A 2H98A 4DCYA 1DTGA 3QSLA 4R2BA 5AA3A 1IQ7A 3TTKA 3PUZE 4TQUQ 1MY2A 3K02A 5AA4B 5KDTB 4Q5TA 3B6WA 5DVFA 2RCBA 3QAXA 1BIYA 1US5A 2HXWA 3OELA 4HTGA 4IO6A 2O69A 5CMBA 2F6GA 3QYTA 4RK9A 3MP8A 3C33A 3EN3A 5JEIA 2E1SA 4IO4A 4DIGA 3SEVA 4MBPA 2HFBA 2DVZA 2R6GE 2ABHA 2ONRA 1B4ZA 1JW4A 3VDFA 1SYHA 4ELPA 4KI0E 4DLDA 5BWJA 1AIVA 1D4NA 2IEEA 3PMWA 3U8QA 1M5EA 1B3LA 1OIBA 3R6UA 5EYFA 5A5XA 3KOSA 3CFLA 3IORA 2VD2A 3FJGA 4FATA 4U1OA 4Z7EA 2F7BA 3L6GA 1UIUA 4YKJA 1OLCA 3ZSFA 5CBSA 1Y9UA 2XXYA 3D4GA 4M1VA 3K01A 2D21A 4YAHX 3K00A 3PPOA 3SEYA 1B52A 4O3AA 1H3DA 5F1QA 3TTMA 1Q35A 2ZYNA 2H99A 3C36A 1MS7A 2AIXA 2ONSA 2Q89A 3S9NC 1O63A 3PPPA 2RC7A 3TELA 2Q8JA 1PBPA 2Q2CA 5A5XB 4F18A 2FNCA 1YTVA 5JTYA 3C4MA 1DPPA 5H8NA 1LGBC 1L5TA 2X7PA 2PYYA 3O29A 2HEUA 1RKMA 3UP9A 4G77A 4QFLA 1A99A 2V25A 4ELQA 3Q28A 4JSDA 2I49A 4U4SA 3R7XA 1B3HA 2HZLA 2XXQA 5FHMA 2PVUA 3UORA 3I3VA 4XKPA 4DCXA 4BDQA 5CMKA 3K1NA 3S9MC 1IUDA 1ZIUA 3OO9A 4RY1A 5I57A 2XXVA 4QFOA 4F3SA 3QUJA 5FTIA 4NWCA 2Y7KA 3FXRA 1JETA 3KZGA 1B7HA 2XXXA 3RTFB 3TTRA 4PFUA 1M5CA 4G8NA 3USDA 1BKAA 3ILTB 1Z7ME 4XKRA 1JVXA 1WVJA 5JTYB 2NUVA 2O84X 1FW0A 2XXPA 3MZBA 3TCFA 4ZS9A 5H8NB 1D9YA 5ISUA 1BP5A 4FE8A 2ESNA 4U2RA 1LB8A 4OYVA 3KOTA 3KJTA 4BDRA 4OMBA 3UN6A 1B0HA 2VP1A 5H8QA 5ITPA 2BJJX 3DP8A 3I5OA 1B5HA 5EHMA 5FHOA 2Y7RA 4WEPA 3M8UA 5I58A 3T66A 1H45A 1EZOA 1TXFA 3S4UA 5I57B 4YB7A 4PFWA 3PD8A 1VE4A 1A8EA 4P0IA 3FVGA 3D4CA 4RNSA 1DPEA 5DEXA 4F2OA 1XHYA 2XX7A 1GTKA 1B1HA 1FQBA 3O6IA 1XT8A 3MJNA 1LCTA 2G93A 2DE4A 4IO3A 3QK6A 4OQOA 3MQ9A 4G68A 3PD9A 2M8CA 3LSLA 2XXRA 4H8IA 4OFOA 4YB5A 2B3FA 4F29A 5H8QB 1AL3A 3BKIB 3HN0A 1MM7A 4U21A 3C32A 1QW0A 2I4CA 2NXOA 1CB6A 2IA4A 5I58B 1DOTA 2RC9A 2REJA 3TZAA 4H1XA 2F78A 1R1NA 4GRKA 3A09A 3DM0A 3K6WA 3TUSA 3TMGA 2DWAA 3IOUA 1T0KA 5CC2A 2RC8A 4OVJA 5DEXB 4NF8A 4KCDA 4YKPA 3KSXA 2V3UA 3K1MA 1LB9A 4PFTA 2PT1A 2OJTA 3MUQA 2NOOA 4NF6A 2XHDA 4G68B 3PPNA 5HBCA 2NWJA 1FTOA 3TKDA 4LZ5A 1BTJA 1B6HA 1URGA 3V8XB 5CI5A 1PB7A 4OESA 2XXHA 1XC1A 4RK2A 2ALUA 3PV0E 1QUJA 1B51A 2ZYMA 3G3GA 3VLVA 3C31A 4LA9A 2OZZA 4KFQA 1H44A 4ECFA 2F5XA 3UGWA 4H0WA 5ICTA 2QMWA 4NF8B 3FV2A 1AMFA 3E9XA 4FAJA 2X26A 4POXA 3F11A 3MWBA 3C35A 4NEDA 3S9EA 4NF6B 5ITOA 2XXUA 4FEDA 3G7WA 5KCJA 3G3JA 3K6UA 3RTWB 2V3QA 2FA7A 3R26A 1US4A 5M2VA 3N5LA 2ZYKA 1MG1A 1LSTA 2GHBA 5CMMA 4ZEDA 1MRPA 5CM6A 3KN3A 1Y3QA 3A3CA 2QPQA 3H06B 4X1BA 3W15C 1FQAA 3IAZA 1FQDA 2WKYA 4TLLB 3M3KA 1F9BA 1TFDA 1B58A 1LFHA 2ZMBA 4G2ZA 4ZDMA 4R72A 2AL5A 4KYEA 4GQOA 2RINA 4XTCQ 1QKAA 3U92A 3IL1B 2UVJA 1Y1ZA 3AXFA 2DE2A 1MY4A 3K6XA 3TCHA 2B3BA 3V83A 3EPEA 5KCJB 4QSEA 1D9VA 4PP0A 1JNFA 3SERA 1LCFA 4Q8RA 2I4BA 2QJEA 3TTNA 2Y7IA 4LP2B 4ELOA 4YKKA 3FVKA 3IB1A 3KFMA 4F3PA 5AA2A 4UACA 2F34A 4NF4A 4POWA 4IB2A 1M5BA 3RUMA 2I58A 4OWDA 2PMSA 2OWTA 4GVOA 1MDQA 4G8MA 4KYSA 3ZKLA 4IGTA 2I3WA 4ESXA 1QJMA 5DTBA 1PB9A 1H43A 2H5YA 1FQEA 3OD7A 5IKBA 2UYEA 4F22A 1ZKBA 4ELRA 3LSFB 4WXJA 1OMPA 3VXCA 4ZE8A 3O6HA 1YCJA 1FTMA 3RT8A 4EDPA 1MPCA 3VLUA 4C0RA 3Q25A 3G3IA 4GLIA 1MPBA 3VXBA 4I1DA 3IJOB 1M5DA 3FVOA 1PC3A 3DP6A 3PUWE 3EHUA 5K2YA 4DZ1A 1FCKA 5I84A 4C1TA 4NE4A 2X7QA 1MY0A 3H6WA 4X1DA 2QSXA 1MH4A 1B9JA 4U23A 4ZZAA 3ZKKA 1URSA 3ZS6A 1SW1A 3GLBA 5AA2B 4NF4B 1Y20A 3IOWA 3HO7A 5TU0A 1ZTYA 3IB0A 2A5TA 1IXCA 3IO4A 4DE8A 4OEVA 1MXYA 2Z23A 3O9PA 4FIMA 4U4XA 1GGGA 1P1OA 1TWYA 3EHTA 3U1OA 1QKBA 1SVXB 3TDJA 1SBPA 2XXTA 3VVDA 3N6TA 1Y4TA
chains in the Genus database with same CATH superfamily
3M3LA 3OO7A 4GIZA 1JEVA 1FTKA 5AE4A 4EF2A 3FV1A 1JVYA 1IMEA 2RKMA 2Y7PA 3CVGA 3TCGA 1SI0A 3MW0A 1QUIA 1MY1A 4R6KA 4GX4A 3BBRA 1IIWA 1LAXA 1MXZA 4N07A 1NUZA 2Q2AA 5CRYA 4XXUA 3SEUA 3TFLA 4LQ2A 3IR1A 5DT6A 3H6VA 2PT2A 2R8TA 4K3FA 4KCCA 4ZECA 4AB5A 1N0TA 2HAUA 4O3BA 2A5TB 4LZ7A 1USYE 5L9OA 4YICA 2UVHA 1NMUA 1N3WA 3DP4A 3OEKA 1FPDA 1PB8A 1JEUA 3N6UA 2Z8EA 4MHFA 4JDFA 2O1LA 2OLBA 4HW8A 3U72A 4XKQA 3BFUA 1VSOA 1NNTA 1EZ9A 1PDAA 3FZVA 2GH9A 2Z8DA 1N76A 4NWDA 3IB2A 2O7IA 3GBAA 4H5GA 5HPQA 1POTA 3PUVE 1P1WA 4I3YA 2XXWA 5ICQA 3D1RA 4Q0CA 4I40A 4ZE9A 4ZEBA 4H45A 3B7DA 3MC2A 2DSFA 4G4PA 5I2NA 2OX3A 1PEBA 3GZGA 3MAMA 3O66A 3MZ9A 1PBQA 3UIFA 1Y4CA 2I0CA 4HCYA 2AL4A 2Q8MA 4OHNA 2DYXA 2P3VA 1DCUA 4DXUA 3MVXA 1O7TA 4AS4A 1MXUA 1A40A 3O97A 2P1SA 1IXGA 3LV0A 2QVRA 3PMXA 2Q9TA 3MVWA 3MP1A 4N6PA 2OK2A 3ECRA 1YYZA 4OETA 1KA1A 3T93B 4MAGA 4P1LA 4OTEA 3QIMA 1J1NA 3W9VA 1JQFA 2F7AA 1XVYA 2P0SA 4XIGQ 1DTZA 3RY3A 1OLAA 2DOJA 4YMAA 5B7DA 3E3KA 5EQAA 2E0SA 3LBSA 4IO2A 4IR8A 2UXAA 3B6QA 4THIA 3CSBA 4KXPA 1IXHA 1ZBMA 2YLNA 2FHYA 3TPAA 3G3KA 1FPGA 3EKIA 5DYHA 5I2NB 5DVJA 1FQCA 4QFNA 5LTCA 1VFEA 4P47A 2HQ0A 2FVZA 4YB6A 3PUXE 4EUOA 3PPQA 1OVBA 4PAFA 4R2FA 1KZ8A 3LSWA 1B7ZA 4BDLA 4RPOA 3IJXB 2NVUB 2P2AA 3HV1A 4PAIA 3OO6A 1RYXA 2XX8A 1B5JA 4GOTA 1R9QA 2HHMA 1EH3A 4F2QA 4F3BA 3KEIA 2QS1A 1LLSA 5LDZA 1A54A 3SESA 1QVSA 4DXBA 1XVXA 4YKIA 3CFZA 1IITA 4BDNA 2XWVA 3PTYA 2F7CA 2XXKA 4RJZA 2ZZVA 3M3FA 3ILUB 1GVCA 4RXLA 1B1XA 2Y5LA 4E0WA 1FBEA 4GD5A 3MPKA 3RGYA 3OOAA 4LZ8A 1N7WA 4PFYA 3L6HA 1N04A 3FBPA 1ELJA 3ODBA 2GHAA 2VT5A 1GR2A 1I69A 2RF1A 3GXAA 4GXSB 3TTLA 2QS2A 2B4MA 4FECA 3OXNA 4GXAA 2P3NA 1S9TA 4OXVA 2D5WA 1A8FA 4L17A 3CHGA 4E0XA 4IY5A 4GFRA 1MXXA 5I2KA 4I9DA 3TODA 1NUWA 3H6UA 4XFEA 3E4RA 4RYAA 3VV5A 1MY3A 2CZKA 3DLNA 4RPNA 4HS7A 1DMBA 4IO5A 4TOZA 2VD3A 4N13A 2DWJA 5TP9A 2GQ1A 2MKZA 4ZZEA 3FD3A 1LAGE 3OSQA 2YPNA 4QSCA 1FSAA 4KD5A 3CG1A 4LATA 3WAFA 1S7YA 1FPJA 2A5SA 4IO7A 3U94A 1URDA 3T9HB 4I8CA 3OENA 3VLWA 4JVDA 4R9FA 1IMCA 3KN7A 4WKMA 4JB7A 4GBVA 4QXDA 1M5FA 1FJ9A 1UIVA 2G29A 4IY6A 2HXRA 2ZZXA 4P0GA 4KPTA 2QMXA 3RT6B 1NH8A 2QS3A 1H76A 1UTHA 2Y84A 4AS5A 2DVCA 2DWIA 4KQPA 1NUXA 4JVIA 5I2KB 4H46A 3IOTA 4I62A 4LQ5A 4F1UA 1B7UA 2DXYA 4ONYA 4U1ZA 3O28A 3EHSA 2R9JA 1NNFA 1EZPA 3SETA 5CMCA 1LAFE 1UTBA 1JW5A 4UA8A 2I6EA 2L5VA 3TAJA 3HHFA 3NOHA 3HCQA 5TPAA 3FATA 4R75A 3FGSA 2ZXTA 5IM2A 5TP9B 2CEXA 1B46A 5KZTA 3OSRA 3FJMA 1Y3NA 2DWHA 1S50A 4EF1A 1II5A 2XXIA 4JWYA 1ZLQA 2KLFA 1P1NA 2PBWA 1B40A 1NNKA 3T0JA 4G68C 4M4GA 4YZZA 3KGCA 1QULA 4F1VA 1XS5A 4G8HA 2I3VA 4R6HA 3SEXA 4NG7A 4QF9A 2DP8A 4ESWA 3S9LC 1BK4A 3CSGA 4OENA 4GL0A 4Q30B 1UQWA 4MH5A 2DXRA 2YJPA 5EQ7A 4MEVA 3MVZA 4PDHA 3FXQA 1B2HA 1NV5A 1UTHB 5I3SA 3PPRA 3HHGA 1MXVA 1XI6A 3DELB 3E78A 2V3TA 1MQDA 2THIA 5F24A 2WYPA 1R9LA 5I5PA 2LAOA 4KYDA 3K4UA 3FJ7A 5H8HA 4JXIA 3RQTA 4EQ9A 5I59A 1QUKA 4H67A 1RDYA 1SYIA 5FHNA 4NMYA 4GWZA 3ONMA 4ZEKA 3FUZA 1UTBB 4NX1A 3IFAA 3T9VA 5TPAB 3B6TA 1R6ZA 1MQGA 5HM4B 4NHBA 4MCOA 1HSJA 1YAEA 1EYIA 5EHSA 3K6VA 1B4HA 4NF5A 4PE5B 1MQJA 1D3KA 5B70A 2Q74A 4MNCA 3KBZA 4I3EA 1Y1MA 2I48A 4LONB 2ANJA 1RYOA 3KG2A 1LBZA 4PBQA 3N26A 2V93A 1FPLA 3IO6A 3IK6B 4H65A 4JWOA 3U65A 1IXIA 4OZ9A 1TT1A 5BUUA 1Y3PA 4Z0IA 1P1UA 3FVNA 2XX9A 3CFXA 3A3UA 1NNPA 1O64A 2W7YA 3E13X 1IMAA 2ZNSA 5L8DA 3RNNA 1SW4A 5H8FA 5ELVA 1AH5A 5DVIA 3LSXA 1A7LA 3TQLA 1RDZA 2PFYA 4O7IA 5H8HB 5I59B 4U22A 1K9YA 2GFEA 3SEWA 4C1UA 3T9UA 2VOZA 4MJOA 2GRVA 3IOVA 1HSEA 4NGUA 4AQ4A 4QFPA 2F6PA 1OQGA 4OVQA 3FASA 2CZLA 5CBRA 2B65A 1P99A 3H7MA 3CR9A 4ND9A 4OFJA 3G3FA 4MLQA 4NF5B 3JZJA 2ZNTA 1B5IA 4WEDA 3VVFA 2VPOA 1SQYA 3SDFA 3KBRA 2AYSA 4R6YA 3RPWA 1SW5A 1FBHA 2ZNUA 4FEBA 4NN3A 2DS9A 2REGA 1NL5A 2XD2A 2Z8FA 4EQ7A 2VHAA 3MVYA 1LBBA 5H8SA 3V5AA 4R73A 4RA1A 3UK4A 4GF8A 5EQ9A 2V4CA 5H8FB 4KR5A 3FXUA 1VFDA 4BDMA 4BLAA 3RLFE 3PMVA 1NV4A 1LFGA 3MBPA 5J16A 3VE1B 4MFIA 1OVTA 4PE3A 4MNIA 4JSOA 1WDNA 1DSNA 3WAEA 1USYH 1XOCA 1IMFA 4PTKA 3LC8A 1FBFA 3FIRA 3C9HA 4O3CA 1MH3A 4N91A 5L9MA 3K2DA 4GWUA 1MDP1 1B3EA 4PQJA 3QUFA 4BDOA 1AWBA 3K1PA 3THIA 4X9TA 1Q1KA 4FBPA 4XF5A 1VR5A 1MQIA 4JBZA 2H25A 5AA2D 3KJ7A 4ZEFA 1B32A 1EU8A 2WBDA 3CIJA 4H5FA 3KN8A 4HXVA 3T22A 2HAVA 1IEJA 4H6DA 3A29A 1MPDA 1BLFA 4N17A 4GL8A 3H4ZA 3CRBA 1B05A 2F97A 4MF3A 4OVTA 3PGFA 2F8DA 1FQFA 2Q88A 3S2VA 3N94A 4NTLA 1LFIA 2F3BA 3CG3A 4FORA 1AOVA 1NKXA 2HCAA 4MX6A 1POY1 1Z7NE 4MLVA 3O6GA 5IAIA 4R9GA 1FPIA 4EQBA 3EQ1A 4QRZA 1LAHE 3KSJA 1MXWA 3W9WA 5I56A 2DQVA 3JV9A 1SI1A 3H03A 3OMBA 3EF7A 1FTLA 2H4IA 2V84A 3LUZA 4OERA 2ZYOA 3LR1A 2Z22A 1CNQA 4LUBA 3Q29A 4DDDA 1Q9DA 2WBBA 1SDXA 4TLMB 4H8JA 4FJPA 1GV8A 3JYRA 1EYKA 1WODA 2UVGA 4F1YA 4PGNA 2QFLA 4QHQA 1IMDA 1NH7A 5K2XA 2OCUA 4ISUA 1SW2A 1KWHA 5IGAA 5IZ1A 2F35A 2OBGA 5FTHA 2Y7WA 3HPIA 1I6BA 3H3GA 3O2AA 3TEPA 3BFTA 2ONKE 2O7UA 3HSTA 4X48A 4GWOA 3MZ1A 1B3FA 4QSDA 1N84A 1A55A 3G3HA 3H6TA 3T1BA 1ATGA 1ZMGA 4GX6A 1SPIA 2D3IA 4HE1A 5I56B 4KHZE 2PX1A 3T96B 3RN8A 3PU5A 4F39A 4P9KA 2O68A 4P11A 2F36A 1ZJLA 3OO8A 5ET8A 2QS4A 4EXLA 4N6DA 2R71A 3MP6A 1NI9A 1N3XA 2FYIA 2RCAA 3VFJA 2QVUA 4HE0A 2XD3A 4OVSA 1P1QA 4GX3A 2UVIA 5LOMA 5JK4A 3TQWA 4F31B 1YPNA 4QFKA 1MM6A 3IX1A 1N7XA 4DXCA 1TFAA 1EYJA 2H9BA 3PUYE 4IGRA 3QXMA 3LUYA 3VVEA 2UYFA 1FBCA 4GWXA 4N8GA 5A5LA 4JWXA 4O8MA 4YU0A 4ZEIA 2DE3A 3B8BA 2I0BA 4XKNA 1FTJA 4R74A 3CI8A 4OEUA 2HZKA 3GBBA 5J1DA 5F7VA 5AA1A 3P7IA 1FJ6A 5AA4A 2CMOA 2VPNA 4NAPA 5L9SA 5KDTA 4AB6A 1OQHA 2CEYA 1LBCA 1SD3A 3V89B 4N81A 1MQHA 1B3GA 3I6VA 3TYHA 1ZU0A 2QVVA 2KR0A 4LVQA 2O51A 2VGQA 3RYDA 3K0VA 3Q26A 2QRYA 3RPLA 4YMBA 1JW1A 2O6AA 3Q27A 3C34A 3UA8A 4HE2A 1IZ1A 1B0LA 3MPLA 4F3GA 1I6AA 3OEMA 4OFLA 1NFTA 3SKPA 2QL3A 4F19A 1I6QA 2O1MA 4LN5A 4HCWA 4DI4B 1CE2A 1ANFA 3T9XB 4PETA 2OWSA 1HSLA 4EXKA 3U93A 2H98A 4DCYA 4P1EA 1DTGA 3QSLA 2BJIA 4R2BA 5AA3A 1DBZA 1IQ7A 3TTKA 3PUZE 4TQUQ 1MY2A 3K02A 5AA4B 5KDTB 4X8RA 4Q5TA 3B6WA 5DVFA 2RCBA 3QAXA 1BIYA 1US5A 2HXWA 3OELA 4HTGA 4IO6A 2O69A 5CMBA 2F6GA 4GWSA 3QYTA 4RK9A 3MP8A 3C33A 3EN3A 5JEIA 2WYKA 3RPLB 2E1SA 4IO4A 4DIGA 4OVRA 3SEVA 4MBPA 2HFBA 2HPGA 2DVZA 2R6GE 2ABHA 2ONRA 1B4ZA 1JW4A 3VDFA 1SYHA 4ELPA 4KI0E 4DLDA 5BWJA 1AIVA 1D4NA 2IEEA 3PMWA 3U8QA 1M5EA 1B3LA 1OIBA 3R6UA 5EYFA 5A5XA 3KOSA 3CFLA 3IORA 2VD2A 3FJGA 4FATA 4U1OA 4Z7EA 2F7BA 3L6GA 1FPKA 3KC0A 1UIUA 4YKJA 1OLCA 3ZSFA 5CBSA 3B50A 1Y9UA 2XXYA 3D4GA 4M1VA 3K01A 2D21A 4YAHX 3K00A 3PPOA 3SEYA 1B52A 4O3AA 4PF6A 1H3DA 5F1QA 3TTMA 1Q35A 2ZYNA 4PFIA 2H99A 1LEVA 3C36A 1MS7A 2AIXA 2ONSA 2Q89A 3S9NC 3FXBA 4NQ8A 1O63A 3PPPA 2RC7A 3TELA 2Q8JA 1PBPA 1G0HA 2Q2CA 4PFRA 5A5XB 4F18A 2FNCA 1FPFA 2XWIA 1YTVA 5JTYA 3C4MA 1DPPA 5H8NA 3IFCA 1LGBC 1L5TA 2X7PA 2PYYA 3O29A 2HEUA 1RKMA 4N4UA 3UP9A 2FIEA 4G77A 4QFLA 4OA4A 1A99A 2V25A 1QGXA 4ELQA 4PCDA 3Q28A 4JSDA 2I49A 4U4SA 3R7XA 1B3HA 2HZLA 2XXQA 5FHMA 2PVUA 1FTAA 3UORA 3I3VA 4XKPA 4DCXA 4BDQA 5CMKA 4PF8A 3K1NA 3S9MC 1IUDA 1ZIUA 3OO9A 4RY1A 5I57A 2XXVA 4QFOA 4F3SA 4QBAA 1YZ0A 3QUJA 5FTIA 4NWCA 2Y7KA 3FXRA 1JETA 3KZGA 1B7HA 2XXXA 3RTFB 3TTRA 4PFUA 4MIJA 1NV3A 1M5CA 4G8NA 3USDA 1BKAA 3ILTB 1Z7ME 4XKRA 1JVXA 1WVJA 5JTYB 5ET5A 2NUVA 2O84X 1FW0A 4JVCA 2XXPA 3MZBA 3TCFA 4ZS9A 5H8NB 1D9YA 5ISUA 1BP5A 4FE8A 2ESNA 4U2RA 1K9ZA 1LB8A 4OYVA 3KOTA 3KJTA 4BDRA 4OMBA 3UN6A 1B0HA 4N6KA 2VP1A 5H8QA 5ITPA 2BJJX 3DP8A 3I5OA 1B5HA 5EHMA 5FHOA 5EYHA 4WEPA 2Y7RA 1FBGA 2Y5KA 3M8UA 5I58A 3T66A 1H45A 1EZOA 1TXFA 1G0IA 3S4UA 5I57B 4YB7A 4PFWA 1FBDA 3PD8A 1VE4A 1A8EA 4P0IA 3FVGA 3D4CA 4RNSA 1YXIA 1DPEA 5DEXA 4O94A 4F2OA 1XHYA 2XX7A 4P56A 1LBVA 1GTKA 5T3JA 5EYGA 1B1HA 1FQBA 3O6IA 1XT8A 3MJNA 5EQ8A 1LCTA 2G93A 2DE4A 4IO3A 3QK6A 4OQOA 3MQ9A 4G68A 3PD9A 2M8CA 3LSLA 2XXRA 4H8IA 4OFOA 4YB5A 2B3FA 4F29A 3ROJA 1LBXA 5H8QB 1AL3A 3BKIB 3HN0A 1MM7A 4U21A 3C32A 1QW0A 2I4CA 2NXOA 2ZZWA 1CB6A 2IA4A 5IZ3A 4MMPA 5I58B 1DOTA 2RC9A 2REJA 3TZAA 4NF0A 4H1XA 2CZHA 3MYUA 2F78A 1R1NA 4GRKA 2FBPA 3A09A 3DM0A 3K6WA 3TUSA 3TMGA 2DWAA 3IOUA 1T0KA 5CC2A 2RC8A 4OVJA 5DEXB 4NF8A 4KCDA 4YKPA 3KSXA 2WX9A 2V3UA 3K1MA 1LBYA 1LB9A 5IZZA 2PCRA 4PGPA 2DDKA 4PFTA 4P3LA 2PT1A 2OJTA 2WEFA 3MUQA 2NOOA 4NF6A 2XHDA 4G68B 1D9QA 3PPNA 4GBWA 5HBCA 2NWJA 1FTOA 3TKDA 4LZ5A 1FRPA 1NV1A 1BTJA 1B6HA 1URGA 3V8XB 5CI5A 1PB7A 4OESA 5IZ3B 2XXHA 1XC1A 2B4LA 4RK2A 2ALUA 3PV0E 1QUJA 1B51A 2ZYMA 3G3GA 3VLVA 3C31A 4LA9A 2OZZA 4KFQA 1H44A 4ECFA 2F5XA 3UGWA 4H0WA 5ET7A 5ICTA 2QMWA 4NF8B 3FV2A 1AMFA 3E9XA 4FAJA 2X26A 4POXA 3F11A 3MWBA 3C35A 4NEDA 3S9EA 2F3DA 4NF6B 5ITOA 2XXUA 4FEDA 3G7WA 4N8YA 4X04A 5KCJA 3G3JA 3K6UA 4PAKA 3RTWB 2V3QA 2FA7A 5ET6A 5I7IA 3R26A 1US4A 1IMBA 5M2VA 3N5LA 2ZYKA 4UABA 1MG1A 3BIGA 1LSTA 2GHBA 1KA0A 5CMMA 4ZEDA 1MRPA 5CM6A 1DK4A 3KN3A 1Y3QA 3A3CA 2QPQA 3H06B 4X1BA 1FPBA 3W15C 4N15A 1FQAA 2OWZA 3IAZA 1FQDA 2WKYA 1FPEA 4TLLB 3M3KA 1LBWA 3MSTA 1F9BA 1TFDA 1B58A 1LFHA 2ZMBA 4G2ZA 4G61A 4ZDMA 4R72A 2AL5A 4OVPA 3HFUA 4KYEA 4PFBA 4GQOA 1FBPA 2RINA 4XTCQ 1QKAA 4O7MA 3U92A 3GYYA 3IL1B 2UVJA 2FIXA 1Y1ZA 3AXFA 2DE2A 3ISPA 1MY4A 3K6XA 3TCHA 2B3BA 3V83A 3EPEA 5KCJB 4QSEA 1D9VA 4DI3D 1JP4A 4PP0A 1JNFA 3SERA 1INPA 1LCFA 4Q8RA 2I4BA 1NV0A 2QJEA 3TTNA 2Y7IA 4LP2B 4ELOA 4YKKA 4PBHA 3FVKA 3IB1A 3KFMA 4F3PA 5AA2A 4XEQA 1RDXA 4UACA 2F34A 4NF4A 4POWA 3E79A 4IB2A 1M5BA 3RUMA 2CZIA 2I58A 4OWDA 4GWWA 2PMSA 3BIHA 2OWTA 4GVOA 1MDQA 4PC9A 4G8MA 4KYSA 3ZKLA 2KQZA 4IGTA 2I3WA 4MNPA 4ESXA 1QJMA 5DTBA 1PB9A 1H43A 2H5YA 1FQEA 3OD7A 5IKBA 2UYEA 4F22A 1ZKBA 4ELRA 3LSFB 4WXJA 1OMPA 3VXCA 4ZE8A 3O6HA 5ESYA 1YCJA 1FTMA 3RT8A 4EDPA 1MPCA 1NV2A 3VLUA 3QMFA 4C0RA 3Q25A 3G3IA 4GLIA 1MPBA 3VXBA 4I1DA 3KC1A 3IJOB 5DW8A 1M5DA 1NUYA 3FVOA 1PC3A 3DP6A 4PDDA 3PUWE 3EHUA 5K2YA 4DZ1A 1FCKA 5I84A 4C1TA 4NE4A 2X7QA 3SZPA 1MY0A 3H6WA 4X1DA 2QSXA 1MH4A 1B9JA 4U23A 4ZZAA 3ZKKA 1URSA 3ZS6A 1SW1A 3GLBA 5AA2B 4NF4B 1Y20A 3IOWA 3HO7A 5TU0A 1ZTYA 3IB0A 1NV6A 2A5TA 1IXCA 2XWKA 3IO4A 4DE8A 2PFZA 4GWYA 2XWOA 4OEVA 1MXYA 2Z23A 3O9PA 4FIMA 4U4XA 1GGGA 5FBPA 2XA5A 1P1OA 1TWYA 3EHTA 3U1OA 1QKBA 1VDWA 1SVXB 1NV7A 3TDJA 1SBPA 4OANA 2XXTA 3VVDA 2JJKA 3N6TA 1Y4TA 4P8BA
chains in the Genus database with same CATH topology
3M3LA 3OO7A 4GIZA 1JEVA 1FTKA 5AE4A 4EF2A 3FV1A 1JVYA 2RKMA 2Y7PA 3CVGA 3TCGA 1SI0A 3MW0A 1QUIA 1MY1A 4R6KA 3BBRA 1IIWA 1LAXA 1MXZA 4N07A 2Q2AA 5CRYA 4XXUA 3SEUA 3TFLA 4LQ2A 3IR1A 5DT6A 3H6VA 2PT2A 4K3FA 4KCCA 4ZECA 4AB5A 1N0TA 2HAUA 4O3BA 2A5TB 4LZ7A 1USYE 5L9OA 4YICA 2UVHA 1NMUA 1N3WA 3DP4A 3OEKA 1PB8A 1JEUA 3N6UA 2Z8EA 4JDFA 2O1LA 2OLBA 4HW8A 3U72A 4XKQA 3BFUA 1VSOA 1NNTA 1EZ9A 1PDAA 3FZVA 2GH9A 2Z8DA 1N76A 4NWDA 3IB2A 2O7IA 3GBAA 4H5GA 5HPQA 1POTA 3PUVE 1P1WA 2XXWA 5ICQA 4Q0CA 4ZE9A 4ZEBA 3B7DA 3MC2A 2DSFA 4G4PA 5I2NA 1PEBA 3GZGA 3MAMA 3O66A 3MZ9A 1PBQA 3UIFA 1Y4CA 2I0CA 4HCYA 2AL4A 4OHNA 2DYXA 4DXUA 3MVXA 1O7TA 1MXUA 1A40A 3O97A 2P1SA 1IXGA 3PMXA 2Q9TA 3MVWA 3MP1A 4N6PA 2OK2A 3ECRA 4OETA 3T93B 4OTEA 3QIMA 1J1NA 3W9VA 1JQFA 2F7AA 1XVYA 2P0SA 4XIGQ 1DTZA 3RY3A 1OLAA 2DOJA 4YMAA 5B7DA 3E3KA 2E0SA 3LBSA 4IO2A 2UXAA 3B6QA 4THIA 3CSBA 1IXHA 1ZBMA 2YLNA 3TPAA 3G3KA 5DYHA 5I2NB 5DVJA 1FQCA 4QFNA 1VFEA 2HQ0A 4YB6A 3PUXE 4EUOA 3PPQA 1OVBA 4R2FA 3LSWA 1B7ZA 4BDLA 4RPOA 3IJXB 2NVUB 2P2AA 3HV1A 3OO6A 1RYXA 2XX8A 1B5JA 4GOTA 1R9QA 1EH3A 4F2QA 4F3BA 3KEIA 2QS1A 1LLSA 1A54A 3SESA 1QVSA 4DXBA 1XVXA 4YKIA 3CFZA 1IITA 4BDNA 2F7CA 4RJZA 3M3FA 3ILUB 1GVCA 4RXLA 1B1XA 4E0WA 4GD5A 3MPKA 3RGYA 3OOAA 4LZ8A 1N7WA 4PFYA 3L6HA 1N04A 1ELJA 3ODBA 2GHAA 1GR2A 1I69A 2RF1A 3GXAA 4GXSB 3TTLA 2QS2A 4FECA 3OXNA 4GXAA 1S9TA 4OXVA 2D5WA 1A8FA 4L17A 4E0XA 4IY5A 4GFRA 1MXXA 5I2KA 4I9DA 3TODA 3H6UA 3E4RA 4RYAA 3VV5A 1MY3A 4RPNA 3DLNA 4HS7A 1DMBA 4IO5A 4TOZA 2VD3A 4N13A 2DWJA 5TP9A 4ZZEA 3FD3A 1LAGE 3OSQA 2YPNA 4QSCA 4KD5A 3CG1A 4LATA 3WAFA 1S7YA 2A5SA 4IO7A 3U94A 1URDA 3T9HB 4I8CA 3OENA 3VLWA 4R9FA 3KN7A 4WKMA 4JB7A 1M5FA 1UIVA 2G29A 4IY6A 4P0GA 4KPTA 2QMXA 3RT6B 1NH8A 2QS3A 1H76A 1UTHA 2Y84A 2DVCA 2DWIA 4KQPA 5I2KB 3IOTA 4I62A 4LQ5A 4F1UA 1B7UA 2DXYA 4ONYA 4U1ZA 3O28A 3EHSA 2R9JA 1NNFA 1EZPA 3SETA 5CMCA 1LAFE 1UTBA 1JW5A 4UA8A 2I6EA 3TAJA 3HHFA 3HCQA 5TPAA 3FATA 4R75A 3FGSA 2ZXTA 5TP9B 1B46A 5KZTA 3OSRA 3FJMA 1Y3NA 2DWHA 1S50A 4EF1A 1II5A 2XXIA 4JWYA 1ZLQA 2KLFA 1P1NA 2PBWA 1B40A 1NNKA 4G68C 4M4GA 4YZZA 3KGCA 1QULA 4F1VA 1XS5A 4G8HA 2I3VA 4R6HA 3SEXA 4QF9A 2DP8A 4ESWA 3S9LC 3CSGA 4OENA 4GL0A 4Q30B 1UQWA 4MH5A 2DXRA 2YJPA 3MVZA 3FXQA 1B2HA 1UTHB 3PPRA 3HHGA 1MXVA 3DELB 2V3TA 1MQDA 2THIA 1R9LA 2LAOA 4KYDA 3K4UA 3FJ7A 5H8HA 4JXIA 3RQTA 4EQ9A 5I59A 1QUKA 4H67A 1SYIA 4ZEKA 5FHNA 4NMYA 3ONMA 3FUZA 1UTBB 3T9VA 5TPAB 3B6TA 1R6ZA 1MQGA 5HM4B 1HSJA 1YAEA 5EHSA 3K6VA 1B4HA 4NF5A 4PE5B 1MQJA 1D3KA 5B70A 1Y1MA 2I48A 4LONB 2ANJA 1RYOA 3KG2A 3N26A 2V93A 3IO6A 3IK6B 4H65A 4JWOA 1IXIA 4OZ9A 1TT1A 5BUUA 1Y3PA 4Z0IA 1P1UA 3FVNA 2XX9A 3CFXA 3A3UA 1NNPA 1O64A 2W7YA 3E13X 2ZNSA 5L8DA 3RNNA 1SW4A 5H8FA 5ELVA 1AH5A 5DVIA 3LSXA 1A7LA 3TQLA 5H8HB 5I59B 4U22A 2GFEA 3SEWA 4C1UA 3T9UA 2VOZA 2GRVA 3IOVA 1HSEA 4AQ4A 4QFPA 2F6PA 1OQGA 3FASA 2CZLA 5CBRA 2B65A 1P99A 3H7MA 3CR9A 4ND9A 4OFJA 3G3FA 4MLQA 4NF5B 3JZJA 2ZNTA 1B5IA 4WEDA 3VVFA 1SQYA 3SDFA 3KBRA 2AYSA 4R6YA 3RPWA 1SW5A 2ZNUA 4FEBA 2DS9A 2REGA 1NL5A 2XD2A 2Z8FA 4EQ7A 2VHAA 3MVYA 1LBBA 5H8SA 3V5AA 4R73A 4RA1A 3UK4A 4GF8A 5H8FB 4KR5A 3FXUA 1VFDA 4BDMA 4BLAA 3RLFE 3PMVA 1LFGA 3MBPA 3VE1B 4MFIA 1OVTA 4JSOA 1WDNA 1DSNA 3WAEA 1USYH 1XOCA 3LC8A 3FIRA 3C9HA 4O3CA 1MH3A 5L9MA 3K2DA 1MDP1 1B3EA 4PQJA 4BDOA 3QUFA 3THIA 3K1PA 4X9TA 1Q1KA 1VR5A 1MQIA 4JBZA 2H25A 5AA2D 3KJ7A 4ZEFA 1B32A 1EU8A 3CIJA 4H5FA 3KN8A 3T22A 2HAVA 1IEJA 4H6DA 1MPDA 1BLFA 4GL8A 3H4ZA 3CRBA 1B05A 2F97A 4MF3A 3PGFA 2F8DA 1FQFA 2Q88A 3S2VA 3N94A 4NTLA 1LFIA 3CG3A 4FORA 1AOVA 1NKXA 2HCAA 1POY1 1Z7NE 4MLVA 3O6GA 5IAIA 4R9GA 4EQBA 3EQ1A 4QRZA 1LAHE 3KSJA 1MXWA 3W9WA 5I56A 2DQVA 3JV9A 1SI1A 3H03A 3OMBA 3EF7A 1FTLA 2H4IA 2V84A 4OERA 2ZYOA 3LR1A 2Z22A 4LUBA 3Q29A 4DDDA 1SDXA 4TLMB 4H8JA 4FJPA 1GV8A 3JYRA 1WODA 2UVGA 4F1YA 4QHQA 1NH7A 5K2XA 2OCUA 4ISUA 1SW2A 1KWHA 2F35A 2OBGA 5FTHA 2Y7WA 3HPIA 1I6BA 3H3GA 3O2AA 3TEPA 3BFTA 2ONKE 2O7UA 3HSTA 4X48A 4GWOA 3MZ1A 1B3FA 4QSDA 1N84A 1A55A 3G3HA 3H6TA 1ATGA 1ZMGA 2D3IA 5I56B 4KHZE 2PX1A 3T96B 3RN8A 3PU5A 4F39A 2O68A 4P11A 2F36A 1ZJLA 3OO8A 2QS4A 4EXLA 2R71A 3MP6A 1N3XA 2FYIA 2RCAA 3VFJA 2XD3A 1P1QA 2UVIA 5LOMA 5JK4A 3TQWA 4F31B 1YPNA 4QFKA 1MM6A 3IX1A 1N7XA 4DXCA 1TFAA 2H9BA 3PUYE 4IGRA 3QXMA 3LUYA 3VVEA 2UYFA 4JWXA 4YU0A 4ZEIA 2DE3A 2I0BA 4XKNA 1FTJA 4R74A 3CI8A 4OEUA 2HZKA 3GBBA 5J1DA 5F7VA 5AA1A 3P7IA 5AA4A 2CMOA 5L9SA 5KDTA 4AB6A 1OQHA 1LBCA 1SD3A 3V89B 1MQHA 1B3GA 3I6VA 3TYHA 1ZU0A 4LVQA 2O51A 2VGQA 3K0VA 3Q26A 2QRYA 4YMBA 1JW1A 2O6AA 3Q27A 3C34A 3UA8A 1IZ1A 1B0LA 3MPLA 4F3GA 1I6AA 3OEMA 4OFLA 1NFTA 3SKPA 2QL3A 4F19A 1I6QA 2O1MA 4HCWA 1CE2A 1ANFA 3T9XB 4PETA 2OWSA 1HSLA 4EXKA 3U93A 2H98A 4DCYA 1DTGA 3QSLA 4R2BA 5AA3A 1IQ7A 3TTKA 3PUZE 4TQUQ 1MY2A 3K02A 5AA4B 5KDTB 4Q5TA 3B6WA 5DVFA 2RCBA 3QAXA 1BIYA 1US5A 2HXWA 3OELA 4HTGA 4IO6A 2O69A 5CMBA 2F6GA 3QYTA 4RK9A 3MP8A 3C33A 3EN3A 5JEIA 2E1SA 4IO4A 4DIGA 3SEVA 4MBPA 2HFBA 2DVZA 2R6GE 2ABHA 2ONRA 1B4ZA 1JW4A 3VDFA 1SYHA 4ELPA 4KI0E 4DLDA 5BWJA 1AIVA 1D4NA 2IEEA 3PMWA 3U8QA 1M5EA 1B3LA 1OIBA 3R6UA 5EYFA 5A5XA 3KOSA 3CFLA 3IORA 2VD2A 3FJGA 4FATA 4U1OA 4Z7EA 2F7BA 3L6GA 1UIUA 4YKJA 1OLCA 3ZSFA 5CBSA 1Y9UA 2XXYA 3D4GA 4M1VA 3K01A 2D21A 4YAHX 3K00A 3PPOA 3SEYA 1B52A 4O3AA 1H3DA 5F1QA 3TTMA 1Q35A 2ZYNA 2H99A 3C36A 1MS7A 2AIXA 2ONSA 2Q89A 3S9NC 1O63A 3PPPA 2RC7A 3TELA 2Q8JA 1PBPA 2Q2CA 5A5XB 4F18A 2FNCA 1YTVA 5JTYA 3C4MA 1DPPA 5H8NA 1LGBC 1L5TA 2X7PA 2PYYA 3O29A 2HEUA 1RKMA 3UP9A 4G77A 4QFLA 1A99A 2V25A 4ELQA 3Q28A 4JSDA 2I49A 4U4SA 3R7XA 1B3HA 2HZLA 2XXQA 5FHMA 2PVUA 3UORA 3I3VA 4XKPA 4DCXA 4BDQA 5CMKA 3K1NA 3S9MC 1IUDA 1ZIUA 3OO9A 4RY1A 5I57A 2XXVA 4QFOA 4F3SA 3QUJA 5FTIA 4NWCA 2Y7KA 3FXRA 1JETA 3KZGA 1B7HA 2XXXA 3RTFB 3TTRA 4PFUA 1M5CA 4G8NA 3USDA 1BKAA 3ILTB 1Z7ME 4XKRA 1JVXA 1WVJA 5JTYB 2NUVA 2O84X 1FW0A 2XXPA 3MZBA 3TCFA 4ZS9A 5H8NB 1D9YA 5ISUA 1BP5A 4FE8A 2ESNA 4U2RA 1LB8A 4OYVA 3KOTA 3KJTA 4BDRA 4OMBA 3UN6A 1B0HA 2VP1A 5H8QA 5ITPA 2BJJX 3DP8A 3I5OA 1B5HA 5EHMA 5FHOA 2Y7RA 4WEPA 3M8UA 5I58A 3T66A 1H45A 1EZOA 1TXFA 3S4UA 5I57B 4YB7A 4PFWA 3PD8A 1VE4A 1A8EA 4P0IA 3FVGA 3D4CA 4RNSA 1DPEA 5DEXA 4F2OA 1XHYA 2XX7A 1GTKA 1B1HA 1FQBA 3O6IA 1XT8A 3MJNA 1LCTA 2G93A 2DE4A 4IO3A 3QK6A 4OQOA 3MQ9A 4G68A 3PD9A 2M8CA 3LSLA 2XXRA 4H8IA 4OFOA 4YB5A 2B3FA 4F29A 5H8QB 1AL3A 3BKIB 3HN0A 1MM7A 4U21A 3C32A 1QW0A 2I4CA 2NXOA 1CB6A 2IA4A 5I58B 1DOTA 2RC9A 2REJA 3TZAA 4H1XA 2F78A 1R1NA 4GRKA 3A09A 3DM0A 3K6WA 3TUSA 3TMGA 2DWAA 3IOUA 1T0KA 5CC2A 2RC8A 4OVJA 5DEXB 4NF8A 4KCDA 4YKPA 3KSXA 2V3UA 3K1MA 1LB9A 4PFTA 2PT1A 2OJTA 3MUQA 2NOOA 4NF6A 2XHDA 4G68B 3PPNA 5HBCA 2NWJA 1FTOA 3TKDA 4LZ5A 1BTJA 1B6HA 1URGA 3V8XB 5CI5A 1PB7A 4OESA 2XXHA 1XC1A 4RK2A 2ALUA 3PV0E 1QUJA 1B51A 2ZYMA 3G3GA 3VLVA 3C31A 4LA9A 2OZZA 4KFQA 1H44A 4ECFA 2F5XA 3UGWA 4H0WA 5ICTA 2QMWA 4NF8B 3FV2A 1AMFA 3E9XA 4FAJA 2X26A 4POXA 3F11A 3MWBA 3C35A 4NEDA 3S9EA 4NF6B 5ITOA 2XXUA 4FEDA 3G7WA 5KCJA 3G3JA 3K6UA 3RTWB 2V3QA 2FA7A 3R26A 1US4A 5M2VA 3N5LA 2ZYKA 1MG1A 1LSTA 2GHBA 5CMMA 4ZEDA 1MRPA 5CM6A 3KN3A 1Y3QA 3A3CA 2QPQA 3H06B 4X1BA 3W15C 1FQAA 3IAZA 1FQDA 2WKYA 4TLLB 3M3KA 1F9BA 1TFDA 1B58A 1LFHA 2ZMBA 4G2ZA 4ZDMA 4R72A 2AL5A 4KYEA 4GQOA 2RINA 4XTCQ 1QKAA 3U92A 3IL1B 2UVJA 1Y1ZA 3AXFA 2DE2A 1MY4A 3K6XA 3TCHA 2B3BA 3V83A 3EPEA 5KCJB 4QSEA 1D9VA 4PP0A 1JNFA 3SERA 1LCFA 4Q8RA 2I4BA 2QJEA 3TTNA 2Y7IA 4LP2B 4ELOA 4YKKA 3FVKA 3IB1A 3KFMA 4F3PA 5AA2A 4UACA 2F34A 4NF4A 4POWA 4IB2A 1M5BA 3RUMA 2I58A 4OWDA 2PMSA 2OWTA 4GVOA 1MDQA 4G8MA 4KYSA 3ZKLA 4IGTA 2I3WA 4ESXA 1QJMA 5DTBA 1PB9A 1H43A 2H5YA 1FQEA 3OD7A 5IKBA 2UYEA 4F22A 1ZKBA 4ELRA 3LSFB 4WXJA 1OMPA 3VXCA 4ZE8A 3O6HA 1YCJA 1FTMA 3RT8A 4EDPA 1MPCA 3VLUA 4C0RA 3Q25A 3G3IA 4GLIA 1MPBA 3VXBA 4I1DA 3IJOB 1M5DA 3FVOA 1PC3A 3DP6A 3PUWE 3EHUA 5K2YA 4DZ1A 1FCKA 5I84A 4C1TA 4NE4A 2X7QA 1MY0A 3H6WA 4X1DA 2QSXA 1MH4A 1B9JA 4U23A 4ZZAA 3ZKKA 1URSA 3ZS6A 1SW1A 3GLBA 5AA2B 4NF4B 1Y20A 3IOWA 3HO7A 5TU0A 1ZTYA 3IB0A 2A5TA 1IXCA 3IO4A 4DE8A 4OEVA 1MXYA 2Z23A 3O9PA 4FIMA 4U4XA 1GGGA 1P1OA 1TWYA 3EHTA 3U1OA 1QKBA 1SVXB 3TDJA 1SBPA 2XXTA 3VVDA 3N6TA 1Y4TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M3L A;  3OO7 A;  4GIZ A;  1JEV A;  1FTK A;  5AE4 A;  4EF2 A;  3FV1 A;  1JVY A;  2RKM A;  2Y7P A;  3CVG A;  3TCG A;  1SI0 A;  3MW0 A;  1QUI A;  1MY1 A;  4R6K A;  3BBR A;  1IIW A;  1LAX A;  1MXZ A;  4N07 A;  2Q2A A;  5CRY A;  4XXU A;  3SEU A;  3TFL A;  4LQ2 A;  3IR1 A;  5DT6 A;  3H6V A;  2PT2 A;  4K3F A;  4KCC A;  4ZEC A;  4AB5 A;  1N0T A;  2HAU A;  4O3B A;  2A5T B;  4LZ7 A;  1USY E;  5L9O A;  4YIC A;  2UVH A;  1NMU A;  1N3W A;  3DP4 A;  3OEK A;  1PB8 A;  1JEU A;  3N6U A;  2Z8E A;  4JDF A;  2O1L A;  2OLB A;  4HW8 A;  3U72 A;  4XKQ A;  3BFU A;  1VSO A;  1NNT A;  1EZ9 A;  1PDA A;  3FZV A;  2GH9 A;  2Z8D A;  1N76 A;  4NWD A;  3IB2 A;  2O7I A;  3GBA A;  4H5G A;  5HPQ A;  1POT A;  3PUV E;  1P1W A;  2XXW A;  5ICQ A;  4Q0C A;  4ZE9 A;  4ZEB A;  3B7D A;  3MC2 A;  2DSF A;  4G4P A;  5I2N A;  1PEB A;  3GZG A;  3MAM A;  3O66 A;  3MZ9 A;  1PBQ A;  3UIF A;  1Y4C A;  2I0C A;  4HCY A;  2AL4 A;  4OHN A;  2DYX A;  4DXU A;  3MVX A;  1O7T A;  1MXU A;  1A40 A;  3O97 A;  2P1S A;  1IXG A;  3PMX A;  2Q9T A;  3MVW A;  3MP1 A;  4N6P A;  2OK2 A;  3ECR A;  4OET A;  3T93 B;  4OTE A;  3QIM A;  1J1N A;  3W9V A;  1JQF A;  2F7A A;  1XVY A;  2P0S A;  4XIG Q;  1DTZ A;  3RY3 A;  1OLA A;  2DOJ A;  4YMA A;  5B7D A;  3E3K A;  2E0S A;  3LBS A;  4IO2 A;  2UXA A;  3B6Q A;  4THI A;  3CSB A;  1IXH A;  1ZBM A;  2YLN A;  3TPA A;  3G3K A;  5DYH A;  5I2N B;  5DVJ A;  1FQC A;  4QFN A;  1VFE A;  2HQ0 A;  4YB6 A;  3PUX E;  4EUO A;  3PPQ A;  1OVB A;  4R2F A;  3LSW A;  1B7Z A;  4BDL A;  4RPO A;  3IJX B;  2NVU B;  2P2A A;  3HV1 A;  3OO6 A;  1RYX A;  2XX8 A;  1B5J A;  4GOT A;  1R9Q A;  1EH3 A;  4F2Q A;  4F3B A;  3KEI A;  2QS1 A;  1LLS A;  1A54 A;  3SES A;  1QVS A;  4DXB A;  1XVX A;  4YKI A;  3CFZ A;  1IIT A;  4BDN A;  2F7C A;  4RJZ A;  3M3F A;  3ILU B;  1GVC A;  4RXL A;  1B1X A;  4E0W A;  4GD5 A;  3MPK A;  3RGY A;  3OOA A;  4LZ8 A;  1N7W A;  4PFY A;  3L6H A;  1N04 A;  1ELJ A;  3ODB A;  2GHA A;  1GR2 A;  1I69 A;  2RF1 A;  3GXA A;  4GXS B;  3TTL A;  2QS2 A;  4FEC A;  3OXN A;  4GXA A;  1S9T A;  4OXV A;  2D5W A;  1A8F A;  4L17 A;  4E0X A;  4IY5 A;  4GFR A;  1MXX A;  5I2K A;  4I9D A;  3TOD A;  3H6U A;  3E4R A;  4RYA A;  3VV5 A;  1MY3 A;  4RPN A;  3DLN A;  4HS7 A;  1DMB A;  4IO5 A;  4TOZ A;  2VD3 A;  4N13 A;  2DWJ A;  5TP9 A;  4ZZE A;  3FD3 A;  1LAG E;  3OSQ A;  2YPN A;  4QSC A;  4KD5 A;  3CG1 A;  4LAT A;  3WAF A;  1S7Y A;  2A5S A;  4IO7 A;  3U94 A;  1URD A;  3T9H B;  4I8C A;  3OEN A;  3VLW A;  4R9F A;  3KN7 A;  4WKM A;  4JB7 A;  1M5F A;  1UIV A;  2G29 A;  4IY6 A;  4P0G A;  4KPT A;  2QMX A;  3RT6 B;  1NH8 A;  2QS3 A;  1H76 A;  1UTH A;  2Y84 A;  2DVC A;  2DWI A;  4KQP A;  5I2K B;  3IOT A;  4I62 A;  4LQ5 A;  4F1U A;  1B7U A;  2DXY A;  4ONY A;  4U1Z A;  3O28 A;  3EHS A;  2R9J A;  1NNF A;  1EZP A;  3SET A;  5CMC A;  1LAF E;  1UTB A;  1JW5 A;  4UA8 A;  2I6E A;  3TAJ A;  3HHF A;  3HCQ A;  5TPA A;  3FAT A;  4R75 A;  3FGS A;  2ZXT A;  5TP9 B;  1B46 A;  5KZT A;  3OSR A;  3FJM A;  1Y3N A;  2DWH A;  1S50 A;  4EF1 A;  1II5 A;  2XXI A;  4JWY A;  1ZLQ A;  2KLF A;  1P1N A;  2PBW A;  1B40 A;  1NNK A;  4G68 C;  4M4G A;  4YZZ A;  3KGC A;  1QUL A;  4F1V A;  1XS5 A;  4G8H A;  2I3V A;  4R6H A;  3SEX A;  4QF9 A;  2DP8 A;  4ESW A;  3S9L C;  3CSG A;  4OEN A;  4GL0 A;  4Q30 B;  1UQW A;  4MH5 A;  2DXR A;  2YJP A;  3MVZ A;  3FXQ A;  1B2H A;  1UTH B;  3PPR A;  3HHG A;  1MXV A;  3DEL B;  2V3T A;  1MQD A;  2THI A;  1R9L A;  2LAO A;  4KYD A;  3K4U A;  3FJ7 A;  5H8H A;  4JXI A;  3RQT A;  4EQ9 A;  5I59 A;  1QUK A;  4H67 A;  1SYI A;  4ZEK A;  5FHN A;  4NMY A;  3ONM A;  3FUZ A;  1UTB B;  3T9V A;  5TPA B;  3B6T A;  1R6Z A;  1MQG A;  5HM4 B;  1HSJ A;  1YAE A;  5EHS A;  3K6V A;  1B4H A;  4NF5 A;  4PE5 B;  1MQJ A;  1D3K A;  5B70 A;  1Y1M A;  2I48 A;  4LON B;  2ANJ A;  1RYO A;  3KG2 A;  3N26 A;  2V93 A;  3IO6 A;  3IK6 B;  4H65 A;  4JWO A;  1IXI A;  4OZ9 A;  1TT1 A;  5BUU A;  1Y3P A;  4Z0I A;  1P1U A;  3FVN A;  2XX9 A;  3CFX A;  3A3U A;  1NNP A;  1O64 A;  2W7Y A;  3E13 X;  2ZNS A;  5L8D A;  3RNN A;  1SW4 A;  5H8F A;  5ELV A;  1AH5 A;  5DVI A;  3LSX A;  1A7L A;  3TQL A;  5H8H B;  5I59 B;  4U22 A;  2GFE A;  3SEW A;  4C1U A;  3T9U A;  2VOZ A;  2GRV A;  3IOV A;  1HSE A;  4AQ4 A;  4QFP A;  2F6P A;  1OQG A;  3FAS A;  2CZL A;  5CBR A;  2B65 A;  1P99 A;  3H7M A;  3CR9 A;  4ND9 A;  4OFJ A;  3G3F A;  4MLQ A;  4NF5 B;  3JZJ A;  2ZNT A;  1B5I A;  4WED A;  3VVF A;  1SQY A;  3SDF A;  3KBR A;  2AYS A;  4R6Y A;  3RPW A;  1SW5 A;  2ZNU A;  4FEB A;  2DS9 A;  2REG A;  1NL5 A;  2XD2 A;  2Z8F A;  4EQ7 A;  2VHA A;  3MVY A;  1LBB A;  5H8S A;  3V5A A;  4R73 A;  4RA1 A;  3UK4 A;  4GF8 A;  5H8F B;  4KR5 A;  3FXU A;  1VFD A;  4BDM A;  4BLA A;  3RLF E;  3PMV A;  1LFG A;  3MBP A;  3VE1 B;  4MFI A;  1OVT A;  4JSO A;  1WDN A;  1DSN A;  3WAE A;  1USY H;  1XOC A;  3LC8 A;  3FIR A;  3C9H A;  4O3C A;  1MH3 A;  5L9M A;  3K2D A;  1MDP 1;  1B3E A;  4PQJ A;  4BDO A;  3QUF A;  3THI A;  3K1P A;  4X9T A;  1Q1K A;  1VR5 A;  1MQI A;  4JBZ A;  2H25 A;  5AA2 D;  3KJ7 A;  4ZEF A;  1B32 A;  1EU8 A;  3CIJ A;  4H5F A;  3KN8 A;  3T22 A;  2HAV A;  1IEJ A;  4H6D A;  1MPD A;  1BLF A;  4GL8 A;  3H4Z A;  3CRB A;  1B05 A;  2F97 A;  4MF3 A;  3PGF A;  2F8D A;  1FQF A;  2Q88 A;  3S2V A;  3N94 A;  4NTL A;  1LFI A;  3CG3 A;  4FOR A;  1AOV A;  1NKX A;  2HCA A;  1POY 1;  1Z7N E;  4MLV A;  3O6G A;  5IAI A;  4R9G A;  4EQB A;  3EQ1 A;  4QRZ A;  1LAH E;  3KSJ A;  1MXW A;  3W9W A;  5I56 A;  2DQV A;  3JV9 A;  1SI1 A;  3H03 A;  3OMB A;  3EF7 A;  1FTL A;  2H4I A;  2V84 A;  4OER A;  2ZYO A;  3LR1 A;  2Z22 A;  4LUB A;  3Q29 A;  4DDD A;  1SDX A;  4TLM B;  4H8J A;  4FJP A;  1GV8 A;  3JYR A;  1WOD A;  2UVG A;  4F1Y A;  4QHQ A;  1NH7 A;  5K2X A;  2OCU A;  4ISU A;  1SW2 A;  1KWH A;  2F35 A;  2OBG A;  5FTH A;  2Y7W A;  3HPI A;  1I6B A;  3H3G A;  3O2A A;  3TEP A;  3BFT A;  2ONK E;  2O7U A;  3HST A;  4X48 A;  4GWO A;  3MZ1 A;  1B3F A;  4QSD A;  1N84 A;  1A55 A;  3G3H A;  3H6T A;  1ATG A;  1ZMG A;  2D3I A;  5I56 B;  4KHZ E;  2PX1 A;  3T96 B;  3RN8 A;  3PU5 A;  4F39 A;  2O68 A;  4P11 A;  2F36 A;  1ZJL A;  3OO8 A;  2QS4 A;  4EXL A;  2R71 A;  3MP6 A;  1N3X A;  2FYI A;  2RCA A;  3VFJ A;  2XD3 A;  1P1Q A;  2UVI A;  5LOM A;  5JK4 A;  3TQW A;  4F31 B;  1YPN A;  4QFK A;  1MM6 A;  3IX1 A;  1N7X A;  4DXC A;  1TFA A;  2H9B A;  3PUY E;  4IGR A;  3QXM A;  3LUY A;  3VVE A;  2UYF A;  4JWX A;  4YU0 A;  4ZEI A;  2DE3 A;  2I0B A;  4XKN A;  1FTJ A;  4R74 A;  3CI8 A;  4OEU A;  2HZK A;  3GBB A;  5J1D A;  5F7V A;  5AA1 A;  3P7I A;  5AA4 A;  2CMO A;  5L9S A;  5KDT A;  4AB6 A;  1OQH A;  1LBC A;  1SD3 A;  3V89 B;  1MQH A;  1B3G A;  3I6V A;  3TYH A;  1ZU0 A;  4LVQ A;  2O51 A;  2VGQ A;  3K0V A;  3Q26 A;  2QRY A;  4YMB A;  1JW1 A;  2O6A A;  3Q27 A;  3C34 A;  3UA8 A;  1IZ1 A;  1B0L A;  3MPL A;  4F3G A;  1I6A A;  3OEM A;  4OFL A;  1NFT A;  3SKP A;  2QL3 A;  4F19 A;  1I6Q A;  2O1M A;  4HCW A;  1CE2 A;  1ANF A;  3T9X B;  4PET A;  2OWS A;  1HSL A;  4EXK A;  3U93 A;  2H98 A;  4DCY A;  1DTG A;  3QSL A;  4R2B A;  5AA3 A;  1IQ7 A;  3TTK A;  3PUZ E;  4TQU Q;  1MY2 A;  3K02 A;  5AA4 B;  5KDT B;  4Q5T A;  3B6W A;  5DVF A;  2RCB A;  3QAX A;  1BIY A;  1US5 A;  2HXW A;  3OEL A;  4HTG A;  4IO6 A;  2O69 A;  5CMB A;  2F6G A;  3QYT A;  4RK9 A;  3MP8 A;  3C33 A;  3EN3 A;  5JEI A;  2E1S A;  4IO4 A;  4DIG A;  3SEV A;  4MBP A;  2HFB A;  2DVZ A;  2R6G E;  2ABH A;  2ONR A;  1B4Z A;  1JW4 A;  3VDF A;  1SYH A;  4ELP A;  4KI0 E;  4DLD A;  5BWJ A;  1AIV A;  1D4N A;  2IEE A;  3PMW A;  3U8Q A;  1M5E A;  1B3L A;  1OIB A;  3R6U A;  5EYF A;  5A5X A;  3KOS A;  3CFL A;  3IOR A;  2VD2 A;  3FJG A;  4FAT A;  4U1O A;  4Z7E A;  2F7B A;  3L6G A;  1UIU A;  4YKJ A;  1OLC A;  3ZSF A;  5CBS A;  1Y9U A;  2XXY A;  3D4G A;  4M1V A;  3K01 A;  2D21 A;  4YAH X;  3K00 A;  3PPO A;  3SEY A;  1B52 A;  4O3A A;  1H3D A;  5F1Q A;  3TTM A;  1Q35 A;  2ZYN A;  2H99 A;  3C36 A;  1MS7 A;  2AIX A;  2ONS A;  2Q89 A;  3S9N C;  1O63 A;  3PPP A;  2RC7 A;  3TEL A;  2Q8J A;  1PBP A;  2Q2C A;  5A5X B;  4F18 A;  2FNC A;  1YTV A;  5JTY A;  3C4M A;  1DPP A;  5H8N A;  1LGB C;  1L5T A;  2X7P A;  2PYY A;  3O29 A;  2HEU A;  1RKM A;  3UP9 A;  4G77 A;  4QFL A;  1A99 A;  2V25 A;  4ELQ A;  3Q28 A;  4JSD A;  2I49 A;  4U4S A;  3R7X A;  1B3H A;  2HZL A;  2XXQ A;  5FHM A;  2PVU A;  3UOR A;  3I3V A;  4XKP A;  4DCX A;  4BDQ A;  5CMK A;  3K1N A;  3S9M C;  1IUD A;  1ZIU A;  3OO9 A;  4RY1 A;  5I57 A;  2XXV A;  4QFO A;  4F3S A;  3QUJ A;  5FTI A;  4NWC A;  2Y7K A;  3FXR A;  1JET A;  3KZG A;  1B7H A;  2XXX A;  3RTF B;  3TTR A;  4PFU A;  1M5C A;  4G8N A;  3USD A;  1BKA A;  3ILT B;  1Z7M E;  4XKR A;  1JVX A;  1WVJ A;  5JTY B;  2NUV A;  2O84 X;  1FW0 A;  2XXP A;  3MZB A;  3TCF A;  4ZS9 A;  5H8N B;  1D9Y A;  5ISU A;  1BP5 A;  4FE8 A;  2ESN A;  4U2R A;  1LB8 A;  4OYV A;  3KOT A;  3KJT A;  4BDR A;  4OMB A;  3UN6 A;  1B0H A;  2VP1 A;  5H8Q A;  5ITP A;  2BJJ X;  3DP8 A;  3I5O A;  1B5H A;  5EHM A;  5FHO A;  2Y7R A;  4WEP A;  3M8U A;  5I58 A;  3T66 A;  1H45 A;  1EZO A;  1TXF A;  3S4U A;  5I57 B;  4YB7 A;  4PFW A;  3PD8 A;  1VE4 A;  1A8E A;  4P0I A;  3FVG A;  3D4C A;  4RNS A;  1DPE A;  5DEX A;  4F2O A;  1XHY A;  2XX7 A;  1GTK A;  1B1H A;  1FQB A;  3O6I A;  1XT8 A;  3MJN A;  1LCT A;  2G93 A;  2DE4 A;  4IO3 A;  3QK6 A;  4OQO A;  3MQ9 A;  4G68 A;  3PD9 A;  2M8C A;  3LSL A;  2XXR A;  4H8I A;  4OFO A;  4YB5 A;  2B3F A;  4F29 A;  5H8Q B;  1AL3 A;  3BKI B;  3HN0 A;  1MM7 A;  4U21 A;  3C32 A;  1QW0 A;  2I4C A;  2NXO A;  1CB6 A;  2IA4 A;  5I58 B;  1DOT A;  2RC9 A;  2REJ A;  3TZA A;  4H1X A;  2F78 A;  1R1N A;  4GRK A;  3A09 A;  3DM0 A;  3K6W A;  3TUS A;  3TMG A;  2DWA A;  3IOU A;  1T0K A;  5CC2 A;  2RC8 A;  4OVJ A;  5DEX B;  4NF8 A;  4KCD A;  4YKP A;  3KSX A;  2V3U A;  3K1M A;  1LB9 A;  4PFT A;  2PT1 A;  2OJT A;  3MUQ A;  2NOO A;  4NF6 A;  2XHD A;  4G68 B;  3PPN A;  5HBC A;  2NWJ A;  1FTO A;  3TKD A;  4LZ5 A;  1BTJ A;  1B6H A;  1URG A;  3V8X B;  5CI5 A;  1PB7 A;  4OES A;  2XXH A;  1XC1 A;  4RK2 A;  2ALU A;  3PV0 E;  1QUJ A;  1B51 A;  2ZYM A;  3G3G A;  3VLV A;  3C31 A;  4LA9 A;  2OZZ A;  4KFQ A;  1H44 A;  4ECF A;  2F5X A;  3UGW A;  4H0W A;  5ICT A;  2QMW A;  4NF8 B;  3FV2 A;  1AMF A;  3E9X A;  4FAJ A;  2X26 A;  4POX A;  3F11 A;  3MWB A;  3C35 A;  4NED A;  3S9E A;  4NF6 B;  5ITO A;  2XXU A;  4FED A;  3G7W A;  5KCJ A;  3G3J A;  3K6U A;  3RTW B;  2V3Q A;  2FA7 A;  3R26 A;  1US4 A;  5M2V A;  3N5L A;  2ZYK A;  1MG1 A;  1LST A;  2GHB A;  5CMM A;  4ZED A;  1MRP A;  5CM6 A;  3KN3 A;  1Y3Q A;  3A3C A;  2QPQ A;  3H06 B;  4X1B A;  3W15 C;  1FQA A;  3IAZ A;  1FQD A;  2WKY A;  4TLL B;  3M3K A;  1F9B A;  1TFD A;  1B58 A;  1LFH A;  2ZMB A;  4G2Z A;  4ZDM A;  4R72 A;  2AL5 A;  4KYE A;  4GQO A;  2RIN A;  4XTC Q;  1QKA A;  3U92 A;  3IL1 B;  2UVJ A;  1Y1Z A;  3AXF A;  2DE2 A;  1MY4 A;  3K6X A;  3TCH A;  2B3B A;  3V83 A;  3EPE A;  5KCJ B;  4QSE A;  1D9V A;  4PP0 A;  1JNF A;  3SER A;  1LCF A;  4Q8R A;  2I4B A;  2QJE A;  3TTN A;  2Y7I A;  4LP2 B;  4ELO A;  4YKK A;  3FVK A;  3IB1 A;  3KFM A;  4F3P A;  5AA2 A;  4UAC A;  2F34 A;  4NF4 A;  4POW A;  4IB2 A;  1M5B A;  3RUM A;  2I58 A;  4OWD A;  2PMS A;  2OWT A;  4GVO A;  1MDQ A;  4G8M A;  4KYS A;  3ZKL A;  4IGT A;  2I3W A;  4ESX A;  1QJM A;  5DTB A;  1PB9 A;  1H43 A;  2H5Y A;  1FQE A;  3OD7 A;  5IKB A;  2UYE A;  4F22 A;  1ZKB A;  4ELR A;  3LSF B;  4WXJ A;  1OMP A;  3VXC A;  4ZE8 A;  3O6H A;  1YCJ A;  1FTM A;  3RT8 A;  4EDP A;  1MPC A;  3VLU A;  4C0R A;  3Q25 A;  3G3I A;  4GLI A;  1MPB A;  3VXB A;  4I1D A;  3IJO B;  1M5D A;  3FVO A;  1PC3 A;  3DP6 A;  3PUW E;  3EHU A;  5K2Y A;  4DZ1 A;  1FCK A;  5I84 A;  4C1T A;  4NE4 A;  2X7Q A;  1MY0 A;  3H6W A;  4X1D A;  2QSX A;  1MH4 A;  1B9J A;  4U23 A;  4ZZA A;  3ZKK A;  1URS A;  3ZS6 A;  1SW1 A;  3GLB A;  5AA2 B;  4NF4 B;  1Y20 A;  3IOW A;  3HO7 A;  5TU0 A;  1ZTY A;  3IB0 A;  2A5T A;  1IXC A;  3IO4 A;  4DE8 A;  4OEV A;  1MXY A;  2Z23 A;  3O9P A;  4FIM A;  4U4X A;  1GGG A;  1P1O A;  1TWY A;  3EHT A;  3U1O A;  1QKB A;  1SVX B;  3TDJ A;  1SBP A;  2XXT A;  3VVD A;  3N6T A;  1Y4T A; 
#chains in the Genus database with same CATH topology
 3M3L A;  3OO7 A;  4GIZ A;  1JEV A;  1FTK A;  5AE4 A;  4EF2 A;  3FV1 A;  1JVY A;  1IME A;  2RKM A;  2Y7P A;  3CVG A;  3TCG A;  1SI0 A;  3MW0 A;  1QUI A;  1MY1 A;  4R6K A;  4GX4 A;  3BBR A;  1IIW A;  1LAX A;  1MXZ A;  4N07 A;  1NUZ A;  2Q2A A;  5CRY A;  4XXU A;  3SEU A;  3TFL A;  4LQ2 A;  3IR1 A;  5DT6 A;  3H6V A;  2PT2 A;  2R8T A;  4K3F A;  4KCC A;  4ZEC A;  4AB5 A;  1N0T A;  2HAU A;  4O3B A;  2A5T B;  4LZ7 A;  1USY E;  5L9O A;  4YIC A;  2UVH A;  1NMU A;  1N3W A;  3DP4 A;  3OEK A;  1FPD A;  1PB8 A;  1JEU A;  3N6U A;  2Z8E A;  4MHF A;  4JDF A;  2O1L A;  2OLB A;  4HW8 A;  3U72 A;  4XKQ A;  3BFU A;  1VSO A;  1NNT A;  1EZ9 A;  1PDA A;  3FZV A;  2GH9 A;  2Z8D A;  1N76 A;  4NWD A;  3IB2 A;  2O7I A;  3GBA A;  4H5G A;  5HPQ A;  1POT A;  3PUV E;  1P1W A;  4I3Y A;  2XXW A;  5ICQ A;  3D1R A;  4Q0C A;  4I40 A;  4ZE9 A;  4ZEB A;  4H45 A;  3B7D A;  3MC2 A;  2DSF A;  4G4P A;  5I2N A;  2OX3 A;  1PEB A;  3GZG A;  3MAM A;  3O66 A;  3MZ9 A;  1PBQ A;  3UIF A;  1Y4C A;  2I0C A;  4HCY A;  2AL4 A;  2Q8M A;  4OHN A;  2DYX A;  2P3V A;  1DCU A;  4DXU A;  3MVX A;  1O7T A;  4AS4 A;  1MXU A;  1A40 A;  3O97 A;  2P1S A;  1IXG A;  3LV0 A;  2QVR A;  3PMX A;  2Q9T A;  3MVW A;  3MP1 A;  4N6P A;  2OK2 A;  3ECR A;  1YYZ A;  4OET A;  1KA1 A;  3T93 B;  4MAG A;  4P1L A;  4OTE A;  3QIM A;  1J1N A;  3W9V A;  1JQF A;  2F7A A;  1XVY A;  2P0S A;  4XIG Q;  1DTZ A;  3RY3 A;  1OLA A;  2DOJ A;  4YMA A;  5B7D A;  3E3K A;  5EQA A;  2E0S A;  3LBS A;  4IO2 A;  4IR8 A;  2UXA A;  3B6Q A;  4THI A;  3CSB A;  4KXP A;  1IXH A;  1ZBM A;  2YLN A;  2FHY A;  3TPA A;  3G3K A;  1FPG A;  3EKI A;  5DYH A;  5I2N B;  5DVJ A;  1FQC A;  4QFN A;  5LTC A;  1VFE A;  4P47 A;  2HQ0 A;  2FVZ A;  4YB6 A;  3PUX E;  4EUO A;  3PPQ A;  1OVB A;  4PAF A;  4R2F A;  1KZ8 A;  3LSW A;  1B7Z A;  4BDL A;  4RPO A;  3IJX B;  2NVU B;  2P2A A;  3HV1 A;  4PAI A;  3OO6 A;  1RYX A;  2XX8 A;  1B5J A;  4GOT A;  1R9Q A;  2HHM A;  1EH3 A;  4F2Q A;  4F3B A;  3KEI A;  2QS1 A;  1LLS A;  5LDZ A;  1A54 A;  3SES A;  1QVS A;  4DXB A;  1XVX A;  4YKI A;  3CFZ A;  1IIT A;  4BDN A;  2XWV A;  3PTY A;  2F7C A;  2XXK A;  4RJZ A;  2ZZV A;  3M3F A;  3ILU B;  1GVC A;  4RXL A;  1B1X A;  2Y5L A;  4E0W A;  1FBE A;  4GD5 A;  3MPK A;  3RGY A;  3OOA A;  4LZ8 A;  1N7W A;  4PFY A;  3L6H A;  1N04 A;  3FBP A;  1ELJ A;  3ODB A;  2GHA A;  2VT5 A;  1GR2 A;  1I69 A;  2RF1 A;  3GXA A;  4GXS B;  3TTL A;  2QS2 A;  2B4M A;  4FEC A;  3OXN A;  4GXA A;  2P3N A;  1S9T A;  4OXV A;  2D5W A;  1A8F A;  4L17 A;  3CHG A;  4E0X A;  4IY5 A;  4GFR A;  1MXX A;  5I2K A;  4I9D A;  3TOD A;  1NUW A;  3H6U A;  4XFE A;  3E4R A;  4RYA A;  3VV5 A;  1MY3 A;  2CZK A;  3DLN A;  4RPN A;  4HS7 A;  1DMB A;  4IO5 A;  4TOZ A;  2VD3 A;  4N13 A;  2DWJ A;  5TP9 A;  2GQ1 A;  2MKZ A;  4ZZE A;  3FD3 A;  1LAG E;  3OSQ A;  2YPN A;  4QSC A;  1FSA A;  4KD5 A;  3CG1 A;  4LAT A;  3WAF A;  1S7Y A;  1FPJ A;  2A5S A;  4IO7 A;  3U94 A;  1URD A;  3T9H B;  4I8C A;  3OEN A;  3VLW A;  4JVD A;  4R9F A;  1IMC A;  3KN7 A;  4WKM A;  4JB7 A;  4GBV A;  4QXD A;  1M5F A;  1FJ9 A;  1UIV A;  2G29 A;  4IY6 A;  2HXR A;  2ZZX A;  4P0G A;  4KPT A;  2QMX A;  3RT6 B;  1NH8 A;  2QS3 A;  1H76 A;  1UTH A;  2Y84 A;  4AS5 A;  2DVC A;  2DWI A;  4KQP A;  1NUX A;  4JVI A;  5I2K B;  4H46 A;  3IOT A;  4I62 A;  4LQ5 A;  4F1U A;  1B7U A;  2DXY A;  4ONY A;  4U1Z A;  3O28 A;  3EHS A;  2R9J A;  1NNF A;  1EZP A;  3SET A;  5CMC A;  1LAF E;  1UTB A;  1JW5 A;  4UA8 A;  2I6E A;  2L5V A;  3TAJ A;  3HHF A;  3NOH A;  3HCQ A;  5TPA A;  3FAT A;  4R75 A;  3FGS A;  2ZXT A;  5IM2 A;  5TP9 B;  2CEX A;  1B46 A;  5KZT A;  3OSR A;  3FJM A;  1Y3N A;  2DWH A;  1S50 A;  4EF1 A;  1II5 A;  2XXI A;  4JWY A;  1ZLQ A;  2KLF A;  1P1N A;  2PBW A;  1B40 A;  1NNK A;  3T0J A;  4G68 C;  4M4G A;  4YZZ A;  3KGC A;  1QUL A;  4F1V A;  1XS5 A;  4G8H A;  2I3V A;  4R6H A;  3SEX A;  4NG7 A;  4QF9 A;  2DP8 A;  4ESW A;  3S9L C;  1BK4 A;  3CSG A;  4OEN A;  4GL0 A;  4Q30 B;  1UQW A;  4MH5 A;  2DXR A;  2YJP A;  5EQ7 A;  4MEV A;  3MVZ A;  4PDH A;  3FXQ A;  1B2H A;  1NV5 A;  1UTH B;  5I3S A;  3PPR A;  3HHG A;  1MXV A;  1XI6 A;  3DEL B;  3E78 A;  2V3T A;  1MQD A;  2THI A;  5F24 A;  2WYP A;  1R9L A;  5I5P A;  2LAO A;  4KYD A;  3K4U A;  3FJ7 A;  5H8H A;  4JXI A;  3RQT A;  4EQ9 A;  5I59 A;  1QUK A;  4H67 A;  1RDY A;  1SYI A;  5FHN A;  4NMY A;  4GWZ A;  3ONM A;  4ZEK A;  3FUZ A;  1UTB B;  4NX1 A;  3IFA A;  3T9V A;  5TPA B;  3B6T A;  1R6Z A;  1MQG A;  5HM4 B;  4NHB A;  4MCO A;  1HSJ A;  1YAE A;  1EYI A;  5EHS A;  3K6V A;  1B4H A;  4NF5 A;  4PE5 B;  1MQJ A;  1D3K A;  5B70 A;  2Q74 A;  4MNC A;  3KBZ A;  4I3E A;  1Y1M A;  2I48 A;  4LON B;  2ANJ A;  1RYO A;  3KG2 A;  1LBZ A;  4PBQ A;  3N26 A;  2V93 A;  1FPL A;  3IO6 A;  3IK6 B;  4H65 A;  4JWO A;  3U65 A;  1IXI A;  4OZ9 A;  1TT1 A;  5BUU A;  1Y3P A;  4Z0I A;  1P1U A;  3FVN A;  2XX9 A;  3CFX A;  3A3U A;  1NNP A;  1O64 A;  2W7Y A;  3E13 X;  1IMA A;  2ZNS A;  5L8D A;  3RNN A;  1SW4 A;  5H8F A;  5ELV A;  1AH5 A;  5DVI A;  3LSX A;  1A7L A;  3TQL A;  1RDZ A;  2PFY A;  4O7I A;  5H8H B;  5I59 B;  4U22 A;  1K9Y A;  2GFE A;  3SEW A;  4C1U A;  3T9U A;  2VOZ A;  4MJO A;  2GRV A;  3IOV A;  1HSE A;  4NGU A;  4AQ4 A;  4QFP A;  2F6P A;  1OQG A;  4OVQ A;  3FAS A;  2CZL A;  5CBR A;  2B65 A;  1P99 A;  3H7M A;  3CR9 A;  4ND9 A;  4OFJ A;  3G3F A;  4MLQ A;  4NF5 B;  3JZJ A;  2ZNT A;  1B5I A;  4WED A;  3VVF A;  2VPO A;  1SQY A;  3SDF A;  3KBR A;  2AYS A;  4R6Y A;  3RPW A;  1SW5 A;  1FBH A;  2ZNU A;  4FEB A;  4NN3 A;  2DS9 A;  2REG A;  1NL5 A;  2XD2 A;  2Z8F A;  4EQ7 A;  2VHA A;  3MVY A;  1LBB A;  5H8S A;  3V5A A;  4R73 A;  4RA1 A;  3UK4 A;  4GF8 A;  5EQ9 A;  2V4C A;  5H8F B;  4KR5 A;  3FXU A;  1VFD A;  4BDM A;  4BLA A;  3RLF E;  3PMV A;  1NV4 A;  1LFG A;  3MBP A;  5J16 A;  3VE1 B;  4MFI A;  1OVT A;  4PE3 A;  4MNI A;  4JSO A;  1WDN A;  1DSN A;  3WAE A;  1USY H;  1XOC A;  1IMF A;  4PTK A;  3LC8 A;  1FBF A;  3FIR A;  3C9H A;  4O3C A;  1MH3 A;  4N91 A;  5L9M A;  3K2D A;  4GWU A;  1MDP 1;  1B3E A;  4PQJ A;  3QUF A;  4BDO A;  1AWB A;  3K1P A;  3THI A;  4X9T A;  1Q1K A;  4FBP A;  4XF5 A;  1VR5 A;  1MQI A;  4JBZ A;  2H25 A;  5AA2 D;  3KJ7 A;  4ZEF A;  1B32 A;  1EU8 A;  2WBD A;  3CIJ A;  4H5F A;  3KN8 A;  4HXV A;  3T22 A;  2HAV A;  1IEJ A;  4H6D A;  3A29 A;  1MPD A;  1BLF A;  4N17 A;  4GL8 A;  3H4Z A;  3CRB A;  1B05 A;  2F97 A;  4MF3 A;  4OVT A;  3PGF A;  2F8D A;  1FQF A;  2Q88 A;  3S2V A;  3N94 A;  4NTL A;  1LFI A;  2F3B A;  3CG3 A;  4FOR A;  1AOV A;  1NKX A;  2HCA A;  4MX6 A;  1POY 1;  1Z7N E;  4MLV A;  3O6G A;  5IAI A;  4R9G A;  1FPI A;  4EQB A;  3EQ1 A;  4QRZ A;  1LAH E;  3KSJ A;  1MXW A;  3W9W A;  5I56 A;  2DQV A;  3JV9 A;  1SI1 A;  3H03 A;  3OMB A;  3EF7 A;  1FTL A;  2H4I A;  2V84 A;  3LUZ A;  4OER A;  2ZYO A;  3LR1 A;  2Z22 A;  1CNQ A;  4LUB A;  3Q29 A;  4DDD A;  1Q9D A;  2WBB A;  1SDX A;  4TLM B;  4H8J A;  4FJP A;  1GV8 A;  3JYR A;  1EYK A;  1WOD A;  2UVG A;  4F1Y A;  4PGN A;  2QFL A;  4QHQ A;  1IMD A;  1NH7 A;  5K2X A;  2OCU A;  4ISU A;  1SW2 A;  1KWH A;  5IGA A;  5IZ1 A;  2F35 A;  2OBG A;  5FTH A;  2Y7W A;  3HPI A;  1I6B A;  3H3G A;  3O2A A;  3TEP A;  3BFT A;  2ONK E;  2O7U A;  3HST A;  4X48 A;  4GWO A;  3MZ1 A;  1B3F A;  4QSD A;  1N84 A;  1A55 A;  3G3H A;  3H6T A;  3T1B A;  1ATG A;  1ZMG A;  4GX6 A;  1SPI A;  2D3I A;  4HE1 A;  5I56 B;  4KHZ E;  2PX1 A;  3T96 B;  3RN8 A;  3PU5 A;  4F39 A;  4P9K A;  2O68 A;  4P11 A;  2F36 A;  1ZJL A;  3OO8 A;  5ET8 A;  2QS4 A;  4EXL A;  4N6D A;  2R71 A;  3MP6 A;  1NI9 A;  1N3X A;  2FYI A;  2RCA A;  3VFJ A;  2QVU A;  4HE0 A;  2XD3 A;  4OVS A;  1P1Q A;  4GX3 A;  2UVI A;  5LOM A;  5JK4 A;  3TQW A;  4F31 B;  1YPN A;  4QFK A;  1MM6 A;  3IX1 A;  1N7X A;  4DXC A;  1TFA A;  1EYJ A;  2H9B A;  3PUY E;  4IGR A;  3QXM A;  3LUY A;  3VVE A;  2UYF A;  1FBC A;  4GWX A;  4N8G A;  5A5L A;  4JWX A;  4O8M A;  4YU0 A;  4ZEI A;  2DE3 A;  3B8B A;  2I0B A;  4XKN A;  1FTJ A;  4R74 A;  3CI8 A;  4OEU A;  2HZK A;  3GBB A;  5J1D A;  5F7V A;  5AA1 A;  3P7I A;  1FJ6 A;  5AA4 A;  2CMO A;  2VPN A;  4NAP A;  5L9S A;  5KDT A;  4AB6 A;  1OQH A;  2CEY A;  1LBC A;  1SD3 A;  3V89 B;  4N81 A;  1MQH A;  1B3G A;  3I6V A;  3TYH A;  1ZU0 A;  2QVV A;  2KR0 A;  4LVQ A;  2O51 A;  2VGQ A;  3RYD A;  3K0V A;  3Q26 A;  2QRY A;  3RPL A;  4YMB A;  1JW1 A;  2O6A A;  3Q27 A;  3C34 A;  3UA8 A;  4HE2 A;  1IZ1 A;  1B0L A;  3MPL A;  4F3G A;  1I6A A;  3OEM A;  4OFL A;  1NFT A;  3SKP A;  2QL3 A;  4F19 A;  1I6Q A;  2O1M A;  4LN5 A;  4HCW A;  4DI4 B;  1CE2 A;  1ANF A;  3T9X B;  4PET A;  2OWS A;  1HSL A;  4EXK A;  3U93 A;  2H98 A;  4DCY A;  4P1E A;  1DTG A;  3QSL A;  2BJI A;  4R2B A;  5AA3 A;  1DBZ A;  1IQ7 A;  3TTK A;  3PUZ E;  4TQU Q;  1MY2 A;  3K02 A;  5AA4 B;  5KDT B;  4X8R A;  4Q5T A;  3B6W A;  5DVF A;  2RCB A;  3QAX A;  1BIY A;  1US5 A;  2HXW A;  3OEL A;  4HTG A;  4IO6 A;  2O69 A;  5CMB A;  2F6G A;  4GWS A;  3QYT A;  4RK9 A;  3MP8 A;  3C33 A;  3EN3 A;  5JEI A;  2WYK A;  3RPL B;  2E1S A;  4IO4 A;  4DIG A;  4OVR A;  3SEV A;  4MBP A;  2HFB A;  2HPG A;  2DVZ A;  2R6G E;  2ABH A;  2ONR A;  1B4Z A;  1JW4 A;  3VDF A;  1SYH A;  4ELP A;  4KI0 E;  4DLD A;  5BWJ A;  1AIV A;  1D4N A;  2IEE A;  3PMW A;  3U8Q A;  1M5E A;  1B3L A;  1OIB A;  3R6U A;  5EYF A;  5A5X A;  3KOS A;  3CFL A;  3IOR A;  2VD2 A;  3FJG A;  4FAT A;  4U1O A;  4Z7E A;  2F7B A;  3L6G A;  1FPK A;  3KC0 A;  1UIU A;  4YKJ A;  1OLC A;  3ZSF A;  5CBS A;  3B50 A;  1Y9U A;  2XXY A;  3D4G A;  4M1V A;  3K01 A;  2D21 A;  4YAH X;  3K00 A;  3PPO A;  3SEY A;  1B52 A;  4O3A A;  4PF6 A;  1H3D A;  5F1Q A;  3TTM A;  1Q35 A;  2ZYN A;  4PFI A;  2H99 A;  1LEV A;  3C36 A;  1MS7 A;  2AIX A;  2ONS A;  2Q89 A;  3S9N C;  3FXB A;  4NQ8 A;  1O63 A;  3PPP A;  2RC7 A;  3TEL A;  2Q8J A;  1PBP A;  1G0H A;  2Q2C A;  4PFR A;  5A5X B;  4F18 A;  2FNC A;  1FPF A;  2XWI A;  1YTV A;  5JTY A;  3C4M A;  1DPP A;  5H8N A;  3IFC A;  1LGB C;  1L5T A;  2X7P A;  2PYY A;  3O29 A;  2HEU A;  1RKM A;  4N4U A;  3UP9 A;  2FIE A;  4G77 A;  4QFL A;  4OA4 A;  1A99 A;  2V25 A;  1QGX A;  4ELQ A;  4PCD A;  3Q28 A;  4JSD A;  2I49 A;  4U4S A;  3R7X A;  1B3H A;  2HZL A;  2XXQ A;  5FHM A;  2PVU A;  1FTA A;  3UOR A;  3I3V A;  4XKP A;  4DCX A;  4BDQ A;  5CMK A;  4PF8 A;  3K1N A;  3S9M C;  1IUD A;  1ZIU A;  3OO9 A;  4RY1 A;  5I57 A;  2XXV A;  4QFO A;  4F3S A;  4QBA A;  1YZ0 A;  3QUJ A;  5FTI A;  4NWC A;  2Y7K A;  3FXR A;  1JET A;  3KZG A;  1B7H A;  2XXX A;  3RTF B;  3TTR A;  4PFU A;  4MIJ A;  1NV3 A;  1M5C A;  4G8N A;  3USD A;  1BKA A;  3ILT B;  1Z7M E;  4XKR A;  1JVX A;  1WVJ A;  5JTY B;  5ET5 A;  2NUV A;  2O84 X;  1FW0 A;  4JVC A;  2XXP A;  3MZB A;  3TCF A;  4ZS9 A;  5H8N B;  1D9Y A;  5ISU A;  1BP5 A;  4FE8 A;  2ESN A;  4U2R A;  1K9Z A;  1LB8 A;  4OYV A;  3KOT A;  3KJT A;  4BDR A;  4OMB A;  3UN6 A;  1B0H A;  4N6K A;  2VP1 A;  5H8Q A;  5ITP A;  2BJJ X;  3DP8 A;  3I5O A;  1B5H A;  5EHM A;  5FHO A;  5EYH A;  4WEP A;  2Y7R A;  1FBG A;  2Y5K A;  3M8U A;  5I58 A;  3T66 A;  1H45 A;  1EZO A;  1TXF A;  1G0I A;  3S4U A;  5I57 B;  4YB7 A;  4PFW A;  1FBD A;  3PD8 A;  1VE4 A;  1A8E A;  4P0I A;  3FVG A;  3D4C A;  4RNS A;  1YXI A;  1DPE A;  5DEX A;  4O94 A;  4F2O A;  1XHY A;  2XX7 A;  4P56 A;  1LBV A;  1GTK A;  5T3J A;  5EYG A;  1B1H A;  1FQB A;  3O6I A;  1XT8 A;  3MJN A;  5EQ8 A;  1LCT A;  2G93 A;  2DE4 A;  4IO3 A;  3QK6 A;  4OQO A;  3MQ9 A;  4G68 A;  3PD9 A;  2M8C A;  3LSL A;  2XXR A;  4H8I A;  4OFO A;  4YB5 A;  2B3F A;  4F29 A;  3ROJ A;  1LBX A;  5H8Q B;  1AL3 A;  3BKI B;  3HN0 A;  1MM7 A;  4U21 A;  3C32 A;  1QW0 A;  2I4C A;  2NXO A;  2ZZW A;  1CB6 A;  2IA4 A;  5IZ3 A;  4MMP A;  5I58 B;  1DOT A;  2RC9 A;  2REJ A;  3TZA A;  4NF0 A;  4H1X A;  2CZH A;  3MYU A;  2F78 A;  1R1N A;  4GRK A;  2FBP A;  3A09 A;  3DM0 A;  3K6W A;  3TUS A;  3TMG A;  2DWA A;  3IOU A;  1T0K A;  5CC2 A;  2RC8 A;  4OVJ A;  5DEX B;  4NF8 A;  4KCD A;  4YKP A;  3KSX A;  2WX9 A;  2V3U A;  3K1M A;  1LBY A;  1LB9 A;  5IZZ A;  2PCR A;  4PGP A;  2DDK A;  4PFT A;  4P3L A;  2PT1 A;  2OJT A;  2WEF A;  3MUQ A;  2NOO A;  4NF6 A;  2XHD A;  4G68 B;  1D9Q A;  3PPN A;  4GBW A;  5HBC A;  2NWJ A;  1FTO A;  3TKD A;  4LZ5 A;  1FRP A;  1NV1 A;  1BTJ A;  1B6H A;  1URG A;  3V8X B;  5CI5 A;  1PB7 A;  4OES A;  5IZ3 B;  2XXH A;  1XC1 A;  2B4L A;  4RK2 A;  2ALU A;  3PV0 E;  1QUJ A;  1B51 A;  2ZYM A;  3G3G A;  3VLV A;  3C31 A;  4LA9 A;  2OZZ A;  4KFQ A;  1H44 A;  4ECF A;  2F5X A;  3UGW A;  4H0W A;  5ET7 A;  5ICT A;  2QMW A;  4NF8 B;  3FV2 A;  1AMF A;  3E9X A;  4FAJ A;  2X26 A;  4POX A;  3F11 A;  3MWB A;  3C35 A;  4NED A;  3S9E A;  2F3D A;  4NF6 B;  5ITO A;  2XXU A;  4FED A;  3G7W A;  4N8Y A;  4X04 A;  5KCJ A;  3G3J A;  3K6U A;  4PAK A;  3RTW B;  2V3Q A;  2FA7 A;  5ET6 A;  5I7I A;  3R26 A;  1US4 A;  1IMB A;  5M2V A;  3N5L A;  2ZYK A;  4UAB A;  1MG1 A;  3BIG A;  1LST A;  2GHB A;  1KA0 A;  5CMM A;  4ZED A;  1MRP A;  5CM6 A;  1DK4 A;  3KN3 A;  1Y3Q A;  3A3C A;  2QPQ A;  3H06 B;  4X1B A;  1FPB A;  3W15 C;  4N15 A;  1FQA A;  2OWZ A;  3IAZ A;  1FQD A;  2WKY A;  1FPE A;  4TLL B;  3M3K A;  1LBW A;  3MST A;  1F9B A;  1TFD A;  1B58 A;  1LFH A;  2ZMB A;  4G2Z A;  4G61 A;  4ZDM A;  4R72 A;  2AL5 A;  4OVP A;  3HFU A;  4KYE A;  4PFB A;  4GQO A;  1FBP A;  2RIN A;  4XTC Q;  1QKA A;  4O7M A;  3U92 A;  3GYY A;  3IL1 B;  2UVJ A;  2FIX A;  1Y1Z A;  3AXF A;  2DE2 A;  3ISP A;  1MY4 A;  3K6X A;  3TCH A;  2B3B A;  3V83 A;  3EPE A;  5KCJ B;  4QSE A;  1D9V A;  4DI3 D;  1JP4 A;  4PP0 A;  1JNF A;  3SER A;  1INP A;  1LCF A;  4Q8R A;  2I4B A;  1NV0 A;  2QJE A;  3TTN A;  2Y7I A;  4LP2 B;  4ELO A;  4YKK A;  4PBH A;  3FVK A;  3IB1 A;  3KFM A;  4F3P A;  5AA2 A;  4XEQ A;  1RDX A;  4UAC A;  2F34 A;  4NF4 A;  4POW A;  3E79 A;  4IB2 A;  1M5B A;  3RUM A;  2CZI A;  2I58 A;  4OWD A;  4GWW A;  2PMS A;  3BIH A;  2OWT A;  4GVO A;  1MDQ A;  4PC9 A;  4G8M A;  4KYS A;  3ZKL A;  2KQZ A;  4IGT A;  2I3W A;  4MNP A;  4ESX A;  1QJM A;  5DTB A;  1PB9 A;  1H43 A;  2H5Y A;  1FQE A;  3OD7 A;  5IKB A;  2UYE A;  4F22 A;  1ZKB A;  4ELR A;  3LSF B;  4WXJ A;  1OMP A;  3VXC A;  4ZE8 A;  3O6H A;  5ESY A;  1YCJ A;  1FTM A;  3RT8 A;  4EDP A;  1MPC A;  1NV2 A;  3VLU A;  3QMF A;  4C0R A;  3Q25 A;  3G3I A;  4GLI A;  1MPB A;  3VXB A;  4I1D A;  3KC1 A;  3IJO B;  5DW8 A;  1M5D A;  1NUY A;  3FVO A;  1PC3 A;  3DP6 A;  4PDD A;  3PUW E;  3EHU A;  5K2Y A;  4DZ1 A;  1FCK A;  5I84 A;  4C1T A;  4NE4 A;  2X7Q A;  3SZP A;  1MY0 A;  3H6W A;  4X1D A;  2QSX A;  1MH4 A;  1B9J A;  4U23 A;  4ZZA A;  3ZKK A;  1URS A;  3ZS6 A;  1SW1 A;  3GLB A;  5AA2 B;  4NF4 B;  1Y20 A;  3IOW A;  3HO7 A;  5TU0 A;  1ZTY A;  3IB0 A;  1NV6 A;  2A5T A;  1IXC A;  2XWK A;  3IO4 A;  4DE8 A;  2PFZ A;  4GWY A;  2XWO A;  4OEV A;  1MXY A;  2Z23 A;  3O9P A;  4FIM A;  4U4X A;  1GGG A;  5FBP A;  2XA5 A;  1P1O A;  1TWY A;  3EHT A;  3U1O A;  1QKB A;  1VDW A;  1SVX B;  1NV7 A;  3TDJ A;  1SBP A;  4OAN A;  2XXT A;  3VVD A;  2JJK A;  3N6T A;  1Y4T A;  4P8B A; 
#chains in the Genus database with same CATH homology
 3M3L A;  3OO7 A;  4GIZ A;  1JEV A;  1FTK A;  5AE4 A;  4EF2 A;  3FV1 A;  1JVY A;  2RKM A;  2Y7P A;  3CVG A;  3TCG A;  1SI0 A;  3MW0 A;  1QUI A;  1MY1 A;  4R6K A;  3BBR A;  1IIW A;  1LAX A;  1MXZ A;  4N07 A;  2Q2A A;  5CRY A;  4XXU A;  3SEU A;  3TFL A;  4LQ2 A;  3IR1 A;  5DT6 A;  3H6V A;  2PT2 A;  4K3F A;  4KCC A;  4ZEC A;  4AB5 A;  1N0T A;  2HAU A;  4O3B A;  2A5T B;  4LZ7 A;  1USY E;  5L9O A;  4YIC A;  2UVH A;  1NMU A;  1N3W A;  3DP4 A;  3OEK A;  1PB8 A;  1JEU A;  3N6U A;  2Z8E A;  4JDF A;  2O1L A;  2OLB A;  4HW8 A;  3U72 A;  4XKQ A;  3BFU A;  1VSO A;  1NNT A;  1EZ9 A;  1PDA A;  3FZV A;  2GH9 A;  2Z8D A;  1N76 A;  4NWD A;  3IB2 A;  2O7I A;  3GBA A;  4H5G A;  5HPQ A;  1POT A;  3PUV E;  1P1W A;  2XXW A;  5ICQ A;  4Q0C A;  4ZE9 A;  4ZEB A;  3B7D A;  3MC2 A;  2DSF A;  4G4P A;  5I2N A;  1PEB A;  3GZG A;  3MAM A;  3O66 A;  3MZ9 A;  1PBQ A;  3UIF A;  1Y4C A;  2I0C A;  4HCY A;  2AL4 A;  4OHN A;  2DYX A;  4DXU A;  3MVX A;  1O7T A;  1MXU A;  1A40 A;  3O97 A;  2P1S A;  1IXG A;  3PMX A;  2Q9T A;  3MVW A;  3MP1 A;  4N6P A;  2OK2 A;  3ECR A;  4OET A;  3T93 B;  4OTE A;  3QIM A;  1J1N A;  3W9V A;  1JQF A;  2F7A A;  1XVY A;  2P0S A;  4XIG Q;  1DTZ A;  3RY3 A;  1OLA A;  2DOJ A;  4YMA A;  5B7D A;  3E3K A;  2E0S A;  3LBS A;  4IO2 A;  2UXA A;  3B6Q A;  4THI A;  3CSB A;  1IXH A;  1ZBM A;  2YLN A;  3TPA A;  3G3K A;  5DYH A;  5I2N B;  5DVJ A;  1FQC A;  4QFN A;  1VFE A;  2HQ0 A;  4YB6 A;  3PUX E;  4EUO A;  3PPQ A;  1OVB A;  4R2F A;  3LSW A;  1B7Z A;  4BDL A;  4RPO A;  3IJX B;  2NVU B;  2P2A A;  3HV1 A;  3OO6 A;  1RYX A;  2XX8 A;  1B5J A;  4GOT A;  1R9Q A;  1EH3 A;  4F2Q A;  4F3B A;  3KEI A;  2QS1 A;  1LLS A;  1A54 A;  3SES A;  1QVS A;  4DXB A;  1XVX A;  4YKI A;  3CFZ A;  1IIT A;  4BDN A;  2F7C A;  4RJZ A;  3M3F A;  3ILU B;  1GVC A;  4RXL A;  1B1X A;  4E0W A;  4GD5 A;  3MPK A;  3RGY A;  3OOA A;  4LZ8 A;  1N7W A;  4PFY A;  3L6H A;  1N04 A;  1ELJ A;  3ODB A;  2GHA A;  1GR2 A;  1I69 A;  2RF1 A;  3GXA A;  4GXS B;  3TTL A;  2QS2 A;  4FEC A;  3OXN A;  4GXA A;  1S9T A;  4OXV A;  2D5W A;  1A8F A;  4L17 A;  4E0X A;  4IY5 A;  4GFR A;  1MXX A;  5I2K A;  4I9D A;  3TOD A;  3H6U A;  3E4R A;  4RYA A;  3VV5 A;  1MY3 A;  4RPN A;  3DLN A;  4HS7 A;  1DMB A;  4IO5 A;  4TOZ A;  2VD3 A;  4N13 A;  2DWJ A;  5TP9 A;  4ZZE A;  3FD3 A;  1LAG E;  3OSQ A;  2YPN A;  4QSC A;  4KD5 A;  3CG1 A;  4LAT A;  3WAF A;  1S7Y A;  2A5S A;  4IO7 A;  3U94 A;  1URD A;  3T9H B;  4I8C A;  3OEN A;  3VLW A;  4R9F A;  3KN7 A;  4WKM A;  4JB7 A;  1M5F A;  1UIV A;  2G29 A;  4IY6 A;  4P0G A;  4KPT A;  2QMX A;  3RT6 B;  1NH8 A;  2QS3 A;  1H76 A;  1UTH A;  2Y84 A;  2DVC A;  2DWI A;  4KQP A;  5I2K B;  3IOT A;  4I62 A;  4LQ5 A;  4F1U A;  1B7U A;  2DXY A;  4ONY A;  4U1Z A;  3O28 A;  3EHS A;  2R9J A;  1NNF A;  1EZP A;  3SET A;  5CMC A;  1LAF E;  1UTB A;  1JW5 A;  4UA8 A;  2I6E A;  3TAJ A;  3HHF A;  3HCQ A;  5TPA A;  3FAT A;  4R75 A;  3FGS A;  2ZXT A;  5TP9 B;  1B46 A;  5KZT A;  3OSR A;  3FJM A;  1Y3N A;  2DWH A;  1S50 A;  4EF1 A;  1II5 A;  2XXI A;  4JWY A;  1ZLQ A;  2KLF A;  1P1N A;  2PBW A;  1B40 A;  1NNK A;  4G68 C;  4M4G A;  4YZZ A;  3KGC A;  1QUL A;  4F1V A;  1XS5 A;  4G8H A;  2I3V A;  4R6H A;  3SEX A;  4QF9 A;  2DP8 A;  4ESW A;  3S9L C;  3CSG A;  4OEN A;  4GL0 A;  4Q30 B;  1UQW A;  4MH5 A;  2DXR A;  2YJP A;  3MVZ A;  3FXQ A;  1B2H A;  1UTH B;  3PPR A;  3HHG A;  1MXV A;  3DEL B;  2V3T A;  1MQD A;  2THI A;  1R9L A;  2LAO A;  4KYD A;  3K4U A;  3FJ7 A;  5H8H A;  4JXI A;  3RQT A;  4EQ9 A;  5I59 A;  1QUK A;  4H67 A;  1SYI A;  4ZEK A;  5FHN A;  4NMY A;  3ONM A;  3FUZ A;  1UTB B;  3T9V A;  5TPA B;  3B6T A;  1R6Z A;  1MQG A;  5HM4 B;  1HSJ A;  1YAE A;  5EHS A;  3K6V A;  1B4H A;  4NF5 A;  4PE5 B;  1MQJ A;  1D3K A;  5B70 A;  1Y1M A;  2I48 A;  4LON B;  2ANJ A;  1RYO A;  3KG2 A;  3N26 A;  2V93 A;  3IO6 A;  3IK6 B;  4H65 A;  4JWO A;  1IXI A;  4OZ9 A;  1TT1 A;  5BUU A;  1Y3P A;  4Z0I A;  1P1U A;  3FVN A;  2XX9 A;  3CFX A;  3A3U A;  1NNP A;  1O64 A;  2W7Y A;  3E13 X;  2ZNS A;  5L8D A;  3RNN A;  1SW4 A;  5H8F A;  5ELV A;  1AH5 A;  5DVI A;  3LSX A;  1A7L A;  3TQL A;  5H8H B;  5I59 B;  4U22 A;  2GFE A;  3SEW A;  4C1U A;  3T9U A;  2VOZ A;  2GRV A;  3IOV A;  1HSE A;  4AQ4 A;  4QFP A;  2F6P A;  1OQG A;  3FAS A;  2CZL A;  5CBR A;  2B65 A;  1P99 A;  3H7M A;  3CR9 A;  4ND9 A;  4OFJ A;  3G3F A;  4MLQ A;  4NF5 B;  3JZJ A;  2ZNT A;  1B5I A;  4WED A;  3VVF A;  1SQY A;  3SDF A;  3KBR A;  2AYS A;  4R6Y A;  3RPW A;  1SW5 A;  2ZNU A;  4FEB A;  2DS9 A;  2REG A;  1NL5 A;  2XD2 A;  2Z8F A;  4EQ7 A;  2VHA A;  3MVY A;  1LBB A;  5H8S A;  3V5A A;  4R73 A;  4RA1 A;  3UK4 A;  4GF8 A;  5H8F B;  4KR5 A;  3FXU A;  1VFD A;  4BDM A;  4BLA A;  3RLF E;  3PMV A;  1LFG A;  3MBP A;  3VE1 B;  4MFI A;  1OVT A;  4JSO A;  1WDN A;  1DSN A;  3WAE A;  1USY H;  1XOC A;  3LC8 A;  3FIR A;  3C9H A;  4O3C A;  1MH3 A;  5L9M A;  3K2D A;  1MDP 1;  1B3E A;  4PQJ A;  4BDO A;  3QUF A;  3THI A;  3K1P A;  4X9T A;  1Q1K A;  1VR5 A;  1MQI A;  4JBZ A;  2H25 A;  5AA2 D;  3KJ7 A;  4ZEF A;  1B32 A;  1EU8 A;  3CIJ A;  4H5F A;  3KN8 A;  3T22 A;  2HAV A;  1IEJ A;  4H6D A;  1MPD A;  1BLF A;  4GL8 A;  3H4Z A;  3CRB A;  1B05 A;  2F97 A;  4MF3 A;  3PGF A;  2F8D A;  1FQF A;  2Q88 A;  3S2V A;  3N94 A;  4NTL A;  1LFI A;  3CG3 A;  4FOR A;  1AOV A;  1NKX A;  2HCA A;  1POY 1;  1Z7N E;  4MLV A;  3O6G A;  5IAI A;  4R9G A;  4EQB A;  3EQ1 A;  4QRZ A;  1LAH E;  3KSJ A;  1MXW A;  3W9W A;  5I56 A;  2DQV A;  3JV9 A;  1SI1 A;  3H03 A;  3OMB A;  3EF7 A;  1FTL A;  2H4I A;  2V84 A;  4OER A;  2ZYO A;  3LR1 A;  2Z22 A;  4LUB A;  3Q29 A;  4DDD A;  1SDX A;  4TLM B;  4H8J A;  4FJP A;  1GV8 A;  3JYR A;  1WOD A;  2UVG A;  4F1Y A;  4QHQ A;  1NH7 A;  5K2X A;  2OCU A;  4ISU A;  1SW2 A;  1KWH A;  2F35 A;  2OBG A;  5FTH A;  2Y7W A;  3HPI A;  1I6B A;  3H3G A;  3O2A A;  3TEP A;  3BFT A;  2ONK E;  2O7U A;  3HST A;  4X48 A;  4GWO A;  3MZ1 A;  1B3F A;  4QSD A;  1N84 A;  1A55 A;  3G3H A;  3H6T A;  1ATG A;  1ZMG A;  2D3I A;  5I56 B;  4KHZ E;  2PX1 A;  3T96 B;  3RN8 A;  3PU5 A;  4F39 A;  2O68 A;  4P11 A;  2F36 A;  1ZJL A;  3OO8 A;  2QS4 A;  4EXL A;  2R71 A;  3MP6 A;  1N3X A;  2FYI A;  2RCA A;  3VFJ A;  2XD3 A;  1P1Q A;  2UVI A;  5LOM A;  5JK4 A;  3TQW A;  4F31 B;  1YPN A;  4QFK A;  1MM6 A;  3IX1 A;  1N7X A;  4DXC A;  1TFA A;  2H9B A;  3PUY E;  4IGR A;  3QXM A;  3LUY A;  3VVE A;  2UYF A;  4JWX A;  4YU0 A;  4ZEI A;  2DE3 A;  2I0B A;  4XKN A;  1FTJ A;  4R74 A;  3CI8 A;  4OEU A;  2HZK A;  3GBB A;  5J1D A;  5F7V A;  5AA1 A;  3P7I A;  5AA4 A;  2CMO A;  5L9S A;  5KDT A;  4AB6 A;  1OQH A;  1LBC A;  1SD3 A;  3V89 B;  1MQH A;  1B3G A;  3I6V A;  3TYH A;  1ZU0 A;  4LVQ A;  2O51 A;  2VGQ A;  3K0V A;  3Q26 A;  2QRY A;  4YMB A;  1JW1 A;  2O6A A;  3Q27 A;  3C34 A;  3UA8 A;  1IZ1 A;  1B0L A;  3MPL A;  4F3G A;  1I6A A;  3OEM A;  4OFL A;  1NFT A;  3SKP A;  2QL3 A;  4F19 A;  1I6Q A;  2O1M A;  4HCW A;  1CE2 A;  1ANF A;  3T9X B;  4PET A;  2OWS A;  1HSL A;  4EXK A;  3U93 A;  2H98 A;  4DCY A;  1DTG A;  3QSL A;  4R2B A;  5AA3 A;  1IQ7 A;  3TTK A;  3PUZ E;  4TQU Q;  1MY2 A;  3K02 A;  5AA4 B;  5KDT B;  4Q5T A;  3B6W A;  5DVF A;  2RCB A;  3QAX A;  1BIY A;  1US5 A;  2HXW A;  3OEL A;  4HTG A;  4IO6 A;  2O69 A;  5CMB A;  2F6G A;  3QYT A;  4RK9 A;  3MP8 A;  3C33 A;  3EN3 A;  5JEI A;  2E1S A;  4IO4 A;  4DIG A;  3SEV A;  4MBP A;  2HFB A;  2DVZ A;  2R6G E;  2ABH A;  2ONR A;  1B4Z A;  1JW4 A;  3VDF A;  1SYH A;  4ELP A;  4KI0 E;  4DLD A;  5BWJ A;  1AIV A;  1D4N A;  2IEE A;  3PMW A;  3U8Q A;  1M5E A;  1B3L A;  1OIB A;  3R6U A;  5EYF A;  5A5X A;  3KOS A;  3CFL A;  3IOR A;  2VD2 A;  3FJG A;  4FAT A;  4U1O A;  4Z7E A;  2F7B A;  3L6G A;  1UIU A;  4YKJ A;  1OLC A;  3ZSF A;  5CBS A;  1Y9U A;  2XXY A;  3D4G A;  4M1V A;  3K01 A;  2D21 A;  4YAH X;  3K00 A;  3PPO A;  3SEY A;  1B52 A;  4O3A A;  1H3D A;  5F1Q A;  3TTM A;  1Q35 A;  2ZYN A;  2H99 A;  3C36 A;  1MS7 A;  2AIX A;  2ONS A;  2Q89 A;  3S9N C;  1O63 A;  3PPP A;  2RC7 A;  3TEL A;  2Q8J A;  1PBP A;  2Q2C A;  5A5X B;  4F18 A;  2FNC A;  1YTV A;  5JTY A;  3C4M A;  1DPP A;  5H8N A;  1LGB C;  1L5T A;  2X7P A;  2PYY A;  3O29 A;  2HEU A;  1RKM A;  3UP9 A;  4G77 A;  4QFL A;  1A99 A;  2V25 A;  4ELQ A;  3Q28 A;  4JSD A;  2I49 A;  4U4S A;  3R7X A;  1B3H A;  2HZL A;  2XXQ A;  5FHM A;  2PVU A;  3UOR A;  3I3V A;  4XKP A;  4DCX A;  4BDQ A;  5CMK A;  3K1N A;  3S9M C;  1IUD A;  1ZIU A;  3OO9 A;  4RY1 A;  5I57 A;  2XXV A;  4QFO A;  4F3S A;  3QUJ A;  5FTI A;  4NWC A;  2Y7K A;  3FXR A;  1JET A;  3KZG A;  1B7H A;  2XXX A;  3RTF B;  3TTR A;  4PFU A;  1M5C A;  4G8N A;  3USD A;  1BKA A;  3ILT B;  1Z7M E;  4XKR A;  1JVX A;  1WVJ A;  5JTY B;  2NUV A;  2O84 X;  1FW0 A;  2XXP A;  3MZB A;  3TCF A;  4ZS9 A;  5H8N B;  1D9Y A;  5ISU A;  1BP5 A;  4FE8 A;  2ESN A;  4U2R A;  1LB8 A;  4OYV A;  3KOT A;  3KJT A;  4BDR A;  4OMB A;  3UN6 A;  1B0H A;  2VP1 A;  5H8Q A;  5ITP A;  2BJJ X;  3DP8 A;  3I5O A;  1B5H A;  5EHM A;  5FHO A;  2Y7R A;  4WEP A;  3M8U A;  5I58 A;  3T66 A;  1H45 A;  1EZO A;  1TXF A;  3S4U A;  5I57 B;  4YB7 A;  4PFW A;  3PD8 A;  1VE4 A;  1A8E A;  4P0I A;  3FVG A;  3D4C A;  4RNS A;  1DPE A;  5DEX A;  4F2O A;  1XHY A;  2XX7 A;  1GTK A;  1B1H A;  1FQB A;  3O6I A;  1XT8 A;  3MJN A;  1LCT A;  2G93 A;  2DE4 A;  4IO3 A;  3QK6 A;  4OQO A;  3MQ9 A;  4G68 A;  3PD9 A;  2M8C A;  3LSL A;  2XXR A;  4H8I A;  4OFO A;  4YB5 A;  2B3F A;  4F29 A;  5H8Q B;  1AL3 A;  3BKI B;  3HN0 A;  1MM7 A;  4U21 A;  3C32 A;  1QW0 A;  2I4C A;  2NXO A;  1CB6 A;  2IA4 A;  5I58 B;  1DOT A;  2RC9 A;  2REJ A;  3TZA A;  4H1X A;  2F78 A;  1R1N A;  4GRK A;  3A09 A;  3DM0 A;  3K6W A;  3TUS A;  3TMG A;  2DWA A;  3IOU A;  1T0K A;  5CC2 A;  2RC8 A;  4OVJ A;  5DEX B;  4NF8 A;  4KCD A;  4YKP A;  3KSX A;  2V3U A;  3K1M A;  1LB9 A;  4PFT A;  2PT1 A;  2OJT A;  3MUQ A;  2NOO A;  4NF6 A;  2XHD A;  4G68 B;  3PPN A;  5HBC A;  2NWJ A;  1FTO A;  3TKD A;  4LZ5 A;  1BTJ A;  1B6H A;  1URG A;  3V8X B;  5CI5 A;  1PB7 A;  4OES A;  2XXH A;  1XC1 A;  4RK2 A;  2ALU A;  3PV0 E;  1QUJ A;  1B51 A;  2ZYM A;  3G3G A;  3VLV A;  3C31 A;  4LA9 A;  2OZZ A;  4KFQ A;  1H44 A;  4ECF A;  2F5X A;  3UGW A;  4H0W A;  5ICT A;  2QMW A;  4NF8 B;  3FV2 A;  1AMF A;  3E9X A;  4FAJ A;  2X26 A;  4POX A;  3F11 A;  3MWB A;  3C35 A;  4NED A;  3S9E A;  4NF6 B;  5ITO A;  2XXU A;  4FED A;  3G7W A;  5KCJ A;  3G3J A;  3K6U A;  3RTW B;  2V3Q A;  2FA7 A;  3R26 A;  1US4 A;  5M2V A;  3N5L A;  2ZYK A;  1MG1 A;  1LST A;  2GHB A;  5CMM A;  4ZED A;  1MRP A;  5CM6 A;  3KN3 A;  1Y3Q A;  3A3C A;  2QPQ A;  3H06 B;  4X1B A;  3W15 C;  1FQA A;  3IAZ A;  1FQD A;  2WKY A;  4TLL B;  3M3K A;  1F9B A;  1TFD A;  1B58 A;  1LFH A;  2ZMB A;  4G2Z A;  4ZDM A;  4R72 A;  2AL5 A;  4KYE A;  4GQO A;  2RIN A;  4XTC Q;  1QKA A;  3U92 A;  3IL1 B;  2UVJ A;  1Y1Z A;  3AXF A;  2DE2 A;  1MY4 A;  3K6X A;  3TCH A;  2B3B A;  3V83 A;  3EPE A;  5KCJ B;  4QSE A;  1D9V A;  4PP0 A;  1JNF A;  3SER A;  1LCF A;  4Q8R A;  2I4B A;  2QJE A;  3TTN A;  2Y7I A;  4LP2 B;  4ELO A;  4YKK A;  3FVK A;  3IB1 A;  3KFM A;  4F3P A;  5AA2 A;  4UAC A;  2F34 A;  4NF4 A;  4POW A;  4IB2 A;  1M5B A;  3RUM A;  2I58 A;  4OWD A;  2PMS A;  2OWT A;  4GVO A;  1MDQ A;  4G8M A;  4KYS A;  3ZKL A;  4IGT A;  2I3W A;  4ESX A;  1QJM A;  5DTB A;  1PB9 A;  1H43 A;  2H5Y A;  1FQE A;  3OD7 A;  5IKB A;  2UYE A;  4F22 A;  1ZKB A;  4ELR A;  3LSF B;  4WXJ A;  1OMP A;  3VXC A;  4ZE8 A;  3O6H A;  1YCJ A;  1FTM A;  3RT8 A;  4EDP A;  1MPC A;  3VLU A;  4C0R A;  3Q25 A;  3G3I A;  4GLI A;  1MPB A;  3VXB A;  4I1D A;  3IJO B;  1M5D A;  3FVO A;  1PC3 A;  3DP6 A;  3PUW E;  3EHU A;  5K2Y A;  4DZ1 A;  1FCK A;  5I84 A;  4C1T A;  4NE4 A;  2X7Q A;  1MY0 A;  3H6W A;  4X1D A;  2QSX A;  1MH4 A;  1B9J A;  4U23 A;  4ZZA A;  3ZKK A;  1URS A;  3ZS6 A;  1SW1 A;  3GLB A;  5AA2 B;  4NF4 B;  1Y20 A;  3IOW A;  3HO7 A;  5TU0 A;  1ZTY A;  3IB0 A;  2A5T A;  1IXC A;  3IO4 A;  4DE8 A;  4OEV A;  1MXY A;  2Z23 A;  3O9P A;  4FIM A;  4U4X A;  1GGG A;  1P1O A;  1TWY A;  3EHT A;  3U1O A;  1QKB A;  1SVX B;  3TDJ A;  1SBP A;  2XXT A;  3VVD A;  3N6T A;  1Y4T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...