4UABA

Crystal structure of a trap periplasmic solute binding protein from chromohalobacter salexigens dsm 3043 (csal_0678), target efi-501078, with bound ethanolamine
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
315
structure length
315
Chain Sequence
TIKWRMQTYAGAALAEHVAKPAIDLFNRIAGDRMQIELYSADQLVPTGELFRAMQRGTIDAVQSDDDSMASPTEVTVFGGYFPFGCRYSLDVPVLFNQYGLKEIWEEEYAKVGVKHVSAGAWDPCHFATKEPIRSLKDLEGKRVFTFPTAGRFLSRFGVVPVTLPWEDIEVALQTGELDGIAWSGITEDYTVGWANVTNYFLTNNISGAWIGHFFVNMERWEELPEDLRLLFEVCCEQSHYHRQYWYWGGEARLRVHGDKLELTSIPDAEWDQVETAAQEFWDEIAAQSETKAKVVEIFKQYNADMRKAGRPYRY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Twin-arginine translocation pathway signal
publication title Experimental strategies for functional annotation and metabolism discovery: targeted screening of solute binding proteins and unbiased panning of metabolomes.
pubmed doi rcsb
source organism Chromohalobacter salexigens
total genus 116
structure length 315
sequence length 315
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4uabA00
4PF6A 5I7IA 2PFZA 2WYPA 4N6KA 4MNIA 4UABA 4MMPA 4NG7A 2HZKA 4NF0A 3U65A 5IGAA 4PBHA 4OVQA 4NHBA 2ZZWA 4PFIA 4NX1A 4O7MA 4OVRA 2XWKA 4N17A 2V4CA 4MCOA 2XWIA 4PDDA 2VPOA 2WX9A 4X04A 2VPNA 4MIJA 4N4UA 2HZLA 2CEXA 4XFEA 2WYKA 3FXBA 4P9KA 5CM6A 4MNCA 4LN5A 4MEVA 2XA5A 4PBQA 4PE3A 4N6DA 4P56A 4PAFA 4PFRA 4P47A 3B50A 4N15A 4DI4B 4PETA 4P8BA 5IZZA 4NQ8A 2ZZVA 2XWVA 4PF8A 4PAIA 4O8MA 4OVTA 4PAKA 5LTCA 4MAGA 4NAPA 4N8YA 4PC9A 5IM2A 2HPGA 4DI3D 4O94A 4P1LA 4XEQA 4MHFA 4PGPA 4OVSA 4OANA 2PFYA 4NGUA 4OVPA 5I5PA 4P3LA 2CEYA 4NN3A 4YICA 4X8RA 4OA4A 4N91A 4P1EA 2XXKA 4XF5A 2ZZXA 4PCDA 4PFBA 4MNPA 4PGNA 4PDHA 3GYYA 4YZZA 2XWOA 4MX6A 4N8GA
chains in the Genus database with same CATH superfamily
4EDPA 3MYUA 2PFZA 4N6KA 3HN0A 2RCBA 4BLAA 1JP4A 1H76A 2XXVA 2O7UA 4OZ9A 1TT1A 3TTMA 2VD3A 1FQDA 3RLFE 1FBHA 4EQBA 4BDRA 1ZLQA 1DMBA 1FTLA 5L9MA 2QJEA 3G7WA 1DTGA 3OMBA 1WODA 3OEMA 4RPNA 3RPLA 1NUXA 3K1MA 4U1OA 1B52A 1ZIUA 3N94A 1BTJA 5FTIA 3MP1A 1MQIA 1PBQA 4THIA 1FTMA 3USDA 3MPKA 1D9QA 1QUIA 1XVYA 2I4BA 2QPQA 4FATA 2REGA 2RKMA 3OELA 1DBZA 1B46A 1BIYA 3TDJA 4LVQA 4OHNA 2O51A 1B4HA 1LBZA 4G61A 4U4SA 2A5TB 2F7BA 1T0KA 1Y3PA 1KWHA 5IM2A 3BFTA 1IIWA 5B70A 2HPGA 3F11A 2KLFA 3RQTA 2WEFA 2E1SA 2HHMA 2Y7RA 3RTFB 3A3UA 1KA1A 3RGYA 4PDHA 2PYYA 1VDWA 2ZXTA 4H0WA 3E3KA 5I58A 3EKIA 2F5XA 1QGXA 1QW0A 1FQEA 2DOJA 1SW5A 1B7UA 4JVCA 3MW0A 3GXAA 3U65A 4GWSA 4MLVA 4ZEIA 1IMAA 1Z7NE 2ZZWA 2XWKA 3PPNA 4MCOA 3DP8A 5H8NA 1NV6A 3LUYA 1MDP1 2I3VA 1NUYA 4R72A 4RK2A 3K1PA 4MEVA 3DELB 2VD2A 3SEWA 3FGSA 4BDQA 4X48A 3CI8A 3HFUA 3MP6A 1NV1A 2I58A 1B0LA 4P47A 4NWCA 3H4ZA 3G3GA 4JVIA 4I3EA 1FPDA 4NMYA 1LFGA 1GGGA 2XXIA 4IO7A 1EYKA 1OQGA 4H67A 3ISPA 3MZBA 1B51A 2RF1A 1R1NA 3K6WA 2XXHA 1N76A 4HTGA 5AA2D 4F1VA 4PE5B 4GQOA 1FJ9A 4GVOA 2OJTA 3N6TA 3KBZA 2NUVA 5AA3A 4XEQA 2B65A 4MF3A 4P3LA 1TFDA 3T9HB 2Y5LA 1H43A 4GWXA 5DT6A 1LGBC 1B5HA 2ANJA 3KN3A 3W15C 4ZE9A 4HE2A 4OEUA 2X7PA 1DK4A 4PFBA 5FHNA 1NV0A 1MPBA 1FPGA 2V84A 4FAJA 1HSLA 3T96B 4TLLB 2NVUB 1B3FA 1NNPA 4G2ZA 4F2QA 1TWYA 3MZ1A 2Z8FA 2Z8EA 2E0SA 4IB2A 2PBWA 3RT8A 2Q74A 4H65A 4KD5A 1XHYA 1M5FA 1FTJA 3IOWA 3M3FA 2IEEA 4ZEFA 5AA2B 3T9UA 2YLNA 4KR5A 4PBQA 4M1VA 2Z22A 3H7MA 5AA4A 5TU0A 5K2XA 3DLNA 3K0VA 1LSTA 2WBDA 1LAGE 5TP9A 2FHYA 2HFBA 4PTKA 1D9VA 4EQ9A 2P1SA 5I57B 3FV2A 2PT2A 4AS5A 4U4XA 1B9JA 4PAKA 1VR5A 3Q28A 3OSRA 1I69A 4U22A 1NV2A 2HCAA 4OANA 3QAXA 4OVPA 4E0WA 4I40A 1PEBA 3PD9A 5CBSA 4OMBA 5I59A 3PUWE 4RY1A 3IK6B 2ONRA 2Q9TA 2DSFA 3FV1A 4QF9A 3IFCA 4O3BA 4UACA 2I4CA 3G3IA 3VXCA 1B05A 5IGAA 3TAJA 2Q2AA 4YKJA 5K2YA 5ET8A 2R6GE 3TEPA 1A7LA 3RPLB 4NHBA 2WBBA 1EZPA 2CZLA 1D3KA 1Y4TA 4JWYA 3C33A 3QUFA 4HXVA 1UIVA 4QSDA 1BLFA 2CZHA 2ZYNA 3IOTA 3THIA 1OMPA 4QBAA 3MVZA 5I56A 3B50A 3I3VA 4N15A 3UP9A 3C32A 1DOTA 1G0HA 1VSOA 4R9FA 5IZZA 4NQ8A 1MQHA 4TQUQ 2ZZVA 2DWIA 4IO4A 2GFEA 1KA0A 1DCUA 3TTLA 1YTVA 2OK2A 3U93A 4ZEBA 4X1DA 1EH3A 3GBAA 3SERA 4IO3A 3P7IA 3TCHA 5I58B 3EN3A 2XXYA 4GX6A 4DI3D 2DS9A 2O1MA 3TUSA 1M5BA 2AYSA 4IO5A 4YICA 4OA4A 1YPNA 1J1NA 3MC2A 3EHSA 3KSJA 4ELPA 3T9VA 3PPRA 4Q5TA 3KSXA 2XWOA 4EF1A 5H8NB 3KBRA 3HPIA 2F6GA 4H45A 4EQ7A 2D21A 3DP4A 2UVIA 4MNIA 1SBPA 3PTYA 4G68B 2ONKE 1MY3A 4PBHA 4OVQA 4QRZA 5FBPA 4O7MA 4LZ5A 2GRVA 2WKYA 2XWIA 4ELRA 1QUJA 1NMUA 2HAUA 3MVYA 2DVZA 4GLIA 5TPAA 2R8TA 4IO2A 4JSDA 3MVXA 4GWYA 3KJ7A 1LCTA 5EQ8A 3FBPA 3TMGA 1Y1MA 3RPWA 4HW8A 1MXVA 1A99A 2B3BA 1NV7A 3I6VA 4O3AA 4POWA 2Q89A 2Y7IA 3H6TA 4O7IA 2R9JA 3MQ9A 3PUYE 2F7AA 2O7IA 4P8BA 2F78A 2W7YA 3PMWA 3UGWA 3CVGA 3GBBA 3OSQA 1LLSA 1QKAA 4PAIA 3VV5A 1R9QA 1IMDA 2DWJA 3O2AA 4LQ2A 1ATGA 4GOTA 2XX8A 1IMFA 4IGRA 3PPPA 4R9GA 3IJXB 1IZ1A 3UN6A 1Y3NA 3CSGA 1D9YA 4NN3A 1JW1A 3FASA 3IL1B 4PQJA 1US5A 2GH9A 2XXKA 4GIZA 1FTKA 4POXA 1BP5A 5FHOA 4YZZA 1ZTYA 2B4MA 3IJOB 4JVDA 2PX1A 3UORA 4H8IA 4PF6A 4XKNA 5JTYB 2M8CA 4QHQA 5ICTA 4U2RA 2F3BA 4QFPA 1MY4A 3QYTA 2UVGA 4GWOA 1O64A 1MPDA 5J1DA 2RC8A 4ZE8A 1PBPA 3VE1B 3KZGA 4TOZA 4DXBA 3B6QA 1YYZA 2V3TA 1Q9DA 1RDXA 2RCAA 4MIJA 3GLBA 5TP9B 1OLCA 4XFEA 5H8QA 3T1BA 2GHAA 5CM6A 3S9EA 5A5XA 1EYIA 4YB7A 1PB8A 4ESXA 5JK4A 3TTKA 4AB5A 3BIHA 1XS5A 3K02A 4JWOA 2BJJX 3TFLA 2I49A 4R2FA 1FPBA 3FUZA 1FBDA 3K6VA 1O63A 3PPQA 3MBPA 4Q30B 3V83A 1S50A 5I59B 3UA8A 1EZ9A 2L5VA 3UK4A 4JDFA 3MP8A 4RK9A 2F7CA 4QFKA 3TPAA 1UTBA 2F8DA 2CEYA 1SI0A 1Y1ZA 2Z23A 3AXFA 2OWTA 3GZGA 2ZYKA 1B5JA 1XC1A 5KDTA 3BIGA 4ZZAA 2ZNUA 1EU8A 4DXUA 1EZOA 5IZ1A 5LDZA 4RPOA 2DE2A 2QS4A 1MY1A 4XTCQ 1MS7A 3MPLA 4OFLA 1N3WA 1ZU0A 2O69A 2ONSA 2RINA 4KI0E 1B7ZA 2MKZA 4EF2A 3MWBA 4MLQA 3U72A 1Y3QA 3EQ1A 4YAHX 3LV0A 1JETA 4R74A 5DVIA 3QIMA 4BDLA 2A5SA 3C36A 3HV1A 1NH7A 1AL3A 1I6QA 2H99A 4PAFA 1ZMGA 4NF6B 2XD2A 2AL5A 2OWSA 4H6DA 3U92A 3HCQA 4PFUA 3U1OA 4R2BA 2F3DA 3MAMA 3UIFA 4WXJA 3ZS6A 2H9BA 1LFIA 2R71A 4OWDA 5EQ7A 4GWWA 3D1RA 5KCJA 3L6HA 3TTRA 3MJNA 2NOOA 5A5LA 2Z8DA 3PUVE 3TELA 4P11A 2F6PA 1MQGA 3SZPA 4NF8A 3OENA 2QS1A 4JB7A 4OVSA 1H44A 2XX9A 4X8RA 3Q27A 1A55A 1QVSA 2DP8A 4DXCA 4XF5A 3LC8A 1SYHA 4F29A 2Y7PA 4E0XA 3R26A 2QFLA 4ELOA 3OEKA 2XXTA 4X9TA 3LUZA 2XXPA 4OERA 5TPAB 2FIXA 3OXNA 3BKIB 1IEJA 4GX3A 4IR8A 1NUZA 2QMWA 2FA7A 2ABHA 1FPIA 1FPLA 4H46A 5HPQA 2OCUA 4NX1A 5ESYA 3RT6B 3PD8A 3MZ9A 1FBGA 4X04A 3K4UA 3ILTB 1RDYA 3D4GA 4G8NA 3KN8A 2WYKA 4JXIA 4GL0A 4QXDA 4MNCA 5DVFA 3S9NC 2GHBA 4IY6A 1A8EA 1HSJA 1NV4A 4HS7A 1AMFA 4JSOA 4MH5A 3IFAA 4KYSA 2VGQA 3HHFA 4IGTA 3V8XB 1XI6A 3VLUA 1NNKA 2X7QA 2P3NA 1L5TA 4YU0A 2Q8MA 1JVXA 4QSCA 5EYHA 5KZTA 4U21A 4KXPA 5I2NA 3OO9A 1IQ7A 5CI5A 3TTNA 1SW1A 4FORA 4YKKA 5F7VA 4LZ7A 1N0TA 1NKXA 1FBFA 4F2OA 3IX1A 5H8FB 4AB6A 4F31B 4KQPA 5H8HB 4FBPA 5ISUA 2REJA 3FVNA 3VVDA 5ICQA 3JZJA 5HBCA 1FPEA 4QSEA 3B8BA 1B58A 2F97A 4GF8A 4DCXA 1KZ8A 4NEDA 4ELQA 4F3GA 2XHDA 3FVGA 4OESA 2V25A 3H6VA 3HO7A 1FW0A 4HCYA 5H8QB 3O29A 1Q1KA 4WEDA 4FEDA 5I84A 3TODA 2HQ0A 4OFOA 2UXAA 1SD3A 2VPOA 3TQWA 2ZNTA 1USYH 1IMBA 4Z7EA 4GWUA 5FHMA 1P1QA 3NOHA 2QVUA 4OENA 1B1XA 3V5AA 5CBRA 1MG1A 5CMCA 2FVZA 3KEIA 3C35A 4PFRA 1MH4A 1JVYA 2P0SA 1TFAA 3CFZA 3E4RA 4ISUA 4FEBA 4QFOA 3BFUA 1MPCA 3V89B 5EQ9A 5EHMA 2G29A 1F9BA 2V93A 5L9OA 4I8CA 3PMXA 3QSLA 1P99A 1AH5A 3JV9A 4F22A 4R6KA 1PC3A 4XIGQ 5DVJA 4N13A 3A3CA 1Z7ME 3VXBA 4YB5A 1LAXA 1USYE 4NF4A 4F1UA 1YXIA 3VFJA 3H3GA 2QS3A 2G93A 1II5A 1OVTA 4NGUA 1CB6A 1M5EA 3OD7A 5M2VA 4P1EA 2O6AA 3B6WA 2F36A 4MNPA 3Q25A 4IY5A 4PGNA 3FATA 3CFXA 4YMAA 1VFEA 1ANFA 1VFDA 2DVCA 3SEXA 4OEVA 5IAIA 1FSAA 2ZMBA 4LP2B 4KCCA 3H6UA 1FBCA 1LB9A 3WAEA 1FPFA 1WDNA 4N17A 1MM6A 2OWZA 2WX9A 1JNFA 4LQ5A 1XT8A 4N4UA 2HZLA 1K9ZA 3K2DA 2CEXA 2PT1A 3S2VA 3Q29A 3QMFA 3CRBA 5ET6A 5AA1A 2P3VA 5ET7A 2I3WA 4F3BA 5KCJB 4FJPA 4P56A 1MY2A 3E79A 4GBWA 4H5GA 2ZYMA 3C4MA 1EYJA 1FBEA 3N26A 1M5CA 4YMBA 5ELVA 4H1XA 1ZJLA 5I3SA 1AOVA 4H8JA 1SPIA 2I0CA 1GR2A 4F3SA 3IOUA 2XWVA 3TQLA 3S9MC 4OYVA 2DXYA 2AIXA 5EYFA 4N6PA 4NF5A 1B3EA 3OO6A 3PV0E 4I1DA 4RNSA 3ONMA 4LUBA 3M8UA 3LR1A 4O3CA 1NNTA 4G8MA 3O9PA 3D4CA 3H06B 2VHAA 3ZSFA 1IMEA 2QVRA 5ET5A 1IUDA 1ZBMA 2VT5A 3EF7A 4N91A 2KR0A 2DE4A 1AIVA 1GTKA 3OO7A 2OLBA 3RY3A 2Y7WA 4I9DA 3HHGA 2PCRA 3R7XA 1GVCA 3IB0A 1BKAA 1DSNA 5J16A 5F24A 4N8GA 4P0GA 4ZEDA 2LAOA 2CZIA 3LBSA 4OQOA 1NV5A 2HZKA 4H5FA 4KCDA 1SQYA 4WEPA 3N6UA 3KJTA 3K6XA 4NTLA 4G4PA 1G0IA 1OIBA 1FQAA 3FD3A 4C1TA 1SVXB 3K01A 5AA2A 2O68A 4LA9A 1LBBA 2X26A 1FPJA 3C31A 1RDZA 4N6DA 1P1OA 5AE4A 1I6BA 5L9SA 3TYHA 4DI4B 1B3LA 1LB8A 5AA4B 1LBXA 3CSBA 4ECFA 5EYGA 5I2KA 3RUMA 2B3FA 5B7DA 2FIEA 3FVKA 4GRKA 4PF8A 3C34A 4JWXA 5DEXA 5HM4B 5I57A 3ODBA 1POTA 5DW8A 4RXLA 3CG1A 1SW4A 5FTHA 4FIMA 4Q8RA 4AS4A 3K1NA 3RYDA 4KPTA 3VLVA 2D5WA 1A8FA 3IAZA 3FXQA 1JW4A 3FJMA 1P1NA 4N07A 1IXHA 2DWAA 2ZZXA 1POY1 2CMOA 5IZ3A 1LBWA 3MSTA 2HAVA 2FNCA 4XKRA 4ESWA 4KYEA 4MBPA 1JEUA 2UYEA 3K00A 2QL3A 4R6HA 2RC7A 1B3HA 2FBPA 4YB6A 3U8QA 2JJKA 3CFLA 4R6YA 1FPKA 4FE8A 2XXRA 2QS2A 3T22A 4OVRA 4LATA 2V4CA 1S7YA 4JBZA 2VOZA 1N3XA 4GWZA 1US4A 2F35A 2DDKA 5F1QA 3DP6A 4PE3A 5I56B 1GV8A 4DZ1A 5BUUA 4BDNA 1LBYA 4NF4B 1K9YA 4GXSB 3MUQA 5H8SA 1XOCA 4Z0IA 3KG2A 4I62A 1CE2A 4MAGA 4KFQA 3IB2A 3PUXE 1Y9UA 4P0IA 1UTHA 2QSXA 1ELJA 3IO6A 2VP1A 1S9TA 3EHTA 2IA4A 4PFWA 4P1LA 1RKMA 3O66A 3R6UA 3RTWB 2PVUA 3ILUB 1A54A 3SETA 1NL5A 4ZZEA 1TXFA 4EXLA 2CZKA 2Y7KA 1CNQA 1YZ0A 1O7TA 1MRPA 2XD3A 3ROJA 2QVVA 3QUJA 3JYRA 4YKPA 3G3HA 2WYPA 3IOVA 1MXYA 1R9LA 1VE4A 5T3JA 4G68A 4NF0A 3CHGA 3A09A 1FQBA 3IO4A 4ONYA 4GBVA 3SESA 2UVJA 1AWBA 1UQWA 5CMMA 1FJ6A 4PDDA 3G3KA 5LOMA 2ESNA 2HXWA 3A29A 3HSTA 2VPNA 3FVOA 4ZDMA 3TKDA 4OTEA 4ZEKA 4C1UA 4RA1A 1SDXA 1NNFA 2O1LA 4LN5A 1SYIA 1B2HA 2Q8JA 4NE4A 4NF5B 5EQAA 4LONB 2THIA 1IXCA 4OXVA 2Y5KA 1LFHA 4X1BA 3T66A 4PETA 1B0HA 4I3YA 4BDOA 1YCJA 4F1YA 4O8MA 1D4NA 4G8HA 3TCGA 5LTCA 1FTOA 3PMVA 1INPA 3PGFA 2NWJA 2UYFA 3VVEA 1OLAA 2OZZA 4O94A 1LBVA 2DWHA 1LCFA 1N84A 3CG3A 4R73A 1LAHE 3O28A 4ZS9A 3VDFA 4IO6A 4GD5A 1N7XA 5DYHA 3GYYA 1LBCA 1N7WA 4DE8A 1IXIA 5JTYA 4XKQA 2ZNSA 2P2AA 1FBPA 1DPEA 1PB9A 2I6EA 1B40A 1B1HA 3IR1A 4UA8A 1B7HA 3SKPA 2O84X 3IB1A 3VVFA 4MJOA 5I2KB 1OQHA 4GXAA 4QFLA 3LSLA 5DEXB 3FXBA 4P9KA 4K3FA 5A5XB 2XA5A 2Q88A 2KQZA 3SEUA 1URDA 5IKBA 1URGA 1NI9A 3M3LA 1RYXA 3B6TA 2DXRA 3KOSA 2GQ1A 3OO8A 2UVHA 1QJMA 4YKIA 4R75A 3KC1A 4KYDA 1LEVA 3FXRA 4HCWA 4ZECA 1B6HA 2HEUA 1FTAA 1JQFA 5IZ3B 4M4GA 4N8YA 4N81A 4PC9A 3LSFB 3SEYA 4HE1A 3Q26A 1HSEA 3EHUA 1UTBB 5BWJA 2YJPA 3FZVA 1SW2A 2XX7A 4AQ4A 3ZKLA 5CMKA 4GFRA 1WVJA 3BBRA 4DLDA 3O6IA 5KDTB 1MM7A 2A5TA 3T0JA 4RYAA 1JEVA 3SEVA 2F34A 1IMCA 2DYXA 1NUWA 3I5OA 3T93B 1MDQA 5L8DA 1M5DA 3IORA 4OFJA 1B4ZA 4UABA 4MMPA 4NG7A 3FXUA 4L17A 2V3QA 2XXUA 3LSXA 1SI1A 2ALUA 4OVJA 1H3DA 2RC9A 3LSWA 1NV3A 3E13X 1OVBA 3QK6A 1B3GA 3S9LC 5ITPA 3L6GA 4WKMA 3TZAA 4F3PA 1FQFA 1BK4A 2XXXA 3W9WA 1Y20A 2D3IA 3T9XB 5CRYA 2Q2CA 4NF6A 4GX4A 5DTBA 1UTHB 4DIGA 4NWDA 4LZ8A 1MXWA 2ZYOA 1QULA 3WAFA 4XKPA 5JEIA 1MXUA 3MVWA 3KGCA 1P1UA 3CIJA 1MXXA 2V3UA 2XXWA 2H25A 3QXMA 1YAEA 4HE0A 5CMBA 4F18A 2I48A 1DPPA 1IITA 3KC0A 4GL8A 3PUZE 4NF8B 4C0RA 1N04A 4QFNA 2PFYA 5I5PA 3E9XA 1QUKA 3U94A 4Q0CA 1B32A 4G68C 3O6HA 1I6AA 2OBGA 3VLWA 4PFYA 4RJZA 3KN7A 4DDDA 3B7DA 3N5LA 4BDMA 2OX3A 2QRYA 3EPEA 3DM0A 3E78A 2H5YA 5I7IA 3W9VA 2DQVA 2NXOA 1DTZA 3G3FA 3PPOA 2BJIA 1MXZA 1QKBA 1NFTA 3H6WA 2DE3A 3O97A 2Y84A 3RN8A 1Y4CA 1A40A 4PFIA 4F39A 3FJGA 1ZKBA 3H03A 1IXGA 1URSA 2YPNA 1RYOA 1PDAA 1MQJA 3OOAA 4U23A 1H45A 2I0BA 2HXRA 1FRPA 1Q35A 4KHZE 3ECRA 3CR9A 4F19A 1R6ZA 1MY0A 5EHSA 1LAFE 4MFIA 1PB7A 3ZKKA 1JW5A 3PU5A 4XXUA 3RNNA 1P1WA 4PP0A 2H98A 4G77A 2AL4A 4OVTA 3FJ7A 4EXKA 1B5IA 1UIUA 4NAPA 1FCKA 3C9HA 3O6GA 2QMXA 1NH8A 4EUOA 3TCFA 5CC2A 2H4IA 4DCYA 3FIRA 5I2NB 1MH3A 4OETA 2B4LA 3S4UA 4TLMB 1MQDA 4MHFA 4PGPA 5H8FA 2FYIA 3K6UA 3KFMA 5H8HA 4ND9A 2XXQA 1FQCA 4PCDA 4FECA 2PMSA 5ITOA 3G3JA 4MX6A 3KOTA 3SDFA 1XVXA 3M3KA 4PFTA 4U1ZA
chains in the Genus database with same CATH topology
3MYUA 2PFZA 2WYPA 4N6KA 4HCYA 4MNIA 1JP4A 3PTYA 5T3JA 4NF0A 3CHGA 4PBHA 4OVQA 4GBVA 1AWBA 5FBPA 4O7MA 1FJ6A 2XWIA 4PDDA 2VPOA 3A29A 1FBHA 2DVZA 2VPNA 2R8TA 1IMBA 4GWUA 4GWYA 3NOHA 5EQ8A 2QVUA 3FBPA 4LN5A 1NV7A 2FVZA 5EQAA 3RPLA 4PFRA 1NUXA 2Y5KA 4O7IA 4PETA 4I3YA 4P8BA 5EQ9A 1D9QA 2QPQA 1DBZA 4PAIA 4O8MA 1IMDA 5LTCA 1INPA 1LBZA 4G61A 1IMFA 5IM2A 4F1UA 2HPGA 1YXIA 4O94A 1LBVA 2WEFA 4NGUA 4NN3A 2HHMA 4P1EA 2XXKA 1KA1A 4MNPA 4PGNA 4PDHA 1VDWA 3GYYA 4YZZA 2B4MA 4JVDA 4PF6A 3EKIA 2F5XA 1QGXA 2F3BA 1FSAA 1FBCA 4JVCA 3U65A 4GWSA 1FBPA 5J1DA 1IMAA 2ZZWA 1FPFA 2XWKA 4N17A 4MCOA 2OWZA 1YYZA 1NV6A 2WX9A 1Q9DA 4MJOA 1NUYA 1RDXA 4MIJA 4N4UA 2HZLA 1K9ZA 2CEXA 4XFEA 3QMFA 3T1BA 3FXBA 4P9KA 5ET6A 2P3VA 5ET7A 5CM6A 4MEVA 2XA5A 1EYIA 4P56A 3HFUA 5JK4A 3E79A 1NV1A 3BIHA 4GBWA 4P47A 1EYJA 2KQZA 1FBEA 5I3SA 4JVIA 1NI9A 1FPDA 4I3EA 1SPIA 1FPBA 2GQ1A 2XWVA 1EYKA 1FBDA 3ISPA 3KC1A 1LEVA 4HCWA 4F1VA 1FTAA 5IZ3B 4N8YA 4N81A 1FJ9A 2L5VA 4PC9A 4HE1A 3KBZA 4XEQA 1IMEA 2CEYA 2QVRA 4P3LA 5ET5A 2Y5LA 2VT5A 4N91A 2KR0A 4GWXA 2DE4A 4HE2A 1DK4A 4PFBA 1NV0A 2PCRA 3BIGA 5J16A 5F24A 3T0JA 1FPGA 4N8GA 5IZ1A 5LDZA 1IMCA 1NUWA 2DE2A 2CZIA 4UABA 4MMPA 4NG7A 1NV5A 2HZKA 2V3QA 2Q74A 2MKZA 1NV3A 3LV0A 1G0IA 1BK4A 1FPJA 3W9WA 1RDZA 4PBQA 4M1VA 4N6DA 4PAFA 4DI4B 4GX4A 1LBXA 5EYGA 2WBDA 2F3DA 2FHYA 4PTKA 2FIEA 4PF8A 5EQ7A 4GWWA 5DW8A 4AS5A 3D1RA 4PAKA 4AS4A 3RYDA 4HE0A 4F18A 5A5LA 3KC0A 1NV2A 3SZPA 4OVSA 4OANA 2PFYA 4OVPA 5I5PA 4X8RA 4I40A 4XF5A 2ZZXA 2QFLA 5IZ3A 3MSTA 4X9TA 3LUZA 2OX3A 3E78A 2FIXA 5I7IA 3W9VA 4GX3A 4IR8A 2Q9TA 1NUZA 3IFCA 2BJIA 2FBPA 2JJKA 2DE3A 1FPIA 5IGAA 5ET8A 3RPLB 1FPLA 4H46A 4NHBA 2WBBA 1FPKA 4PFIA 4NX1A 4OVRA 5ESYA 2V4CA 1FBGA 4X04A 4GWZA 1RDYA 2WYKA 4QXDA 2DDKA 4MNCA 4HXVA 2HXRA 1FRPA 2CZHA 4PE3A 4QBAA 4F19A 3B50A 4N15A 1NV4A 1LBYA 1G0HA 1K9YA 5IZZA 4NQ8A 2ZZVA 3IFAA 1KA0A 1DCUA 1XI6A 4OVTA 4MAGA 2P3NA 4NAPA 2Q8MA 5EYHA 4KXPA 2B4LA 4GX6A 4DI3D 1FBFA 4P1LA 4MHFA 4PGPA 4YICA 4OA4A 4FBPA 2CZKA 1CNQA 4PCDA 1YZ0A 1FPEA 3ROJA 3B8BA 2QVVA 2XWOA 4MX6A 1LBWA 1KZ8A 4H45A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PF6 A;  5I7I A;  2PFZ A;  2WYP A;  4N6K A;  4MNI A;  4UAB A;  4MMP A;  4NG7 A;  2HZK A;  4NF0 A;  3U65 A;  5IGA A;  4PBH A;  4OVQ A;  4NHB A;  2ZZW A;  4PFI A;  4NX1 A;  4O7M A;  4OVR A;  2XWK A;  4N17 A;  2V4C A;  4MCO A;  2XWI A;  4PDD A;  2VPO A;  2WX9 A;  4X04 A;  2VPN A;  4MIJ A;  4N4U A;  2HZL A;  2CEX A;  4XFE A;  2WYK A;  3FXB A;  4P9K A;  5CM6 A;  4MNC A;  4LN5 A;  4MEV A;  2XA5 A;  4PBQ A;  4PE3 A;  4N6D A;  4P56 A;  4PAF A;  4PFR A;  4P47 A;  3B50 A;  4N15 A;  4DI4 B;  4PET A;  4P8B A;  5IZZ A;  4NQ8 A;  2ZZV A;  2XWV A;  4PF8 A;  4PAI A;  4O8M A;  4OVT A;  4PAK A;  5LTC A;  4MAG A;  4NAP A;  4N8Y A;  4PC9 A;  5IM2 A;  2HPG A;  4DI3 D;  4O94 A;  4P1L A;  4XEQ A;  4MHF A;  4PGP A;  4OVS A;  4OAN A;  2PFY A;  4NGU A;  4OVP A;  5I5P A;  4P3L A;  2CEY A;  4NN3 A;  4YIC A;  4X8R A;  4OA4 A;  4N91 A;  4P1E A;  2XXK A;  4XF5 A;  2ZZX A;  4PCD A;  4PFB A;  4MNP A;  4PGN A;  4PDH A;  3GYY A;  4YZZ A;  2XWO A;  4MX6 A;  4N8G A; 
#chains in the Genus database with same CATH topology
 4EDP A;  3MYU A;  2PFZ A;  4N6K A;  3HN0 A;  2RCB A;  4BLA A;  1JP4 A;  1H76 A;  2XXV A;  2O7U A;  4OZ9 A;  1TT1 A;  3TTM A;  2VD3 A;  1FQD A;  3RLF E;  1FBH A;  4EQB A;  4BDR A;  1ZLQ A;  1DMB A;  1FTL A;  5L9M A;  2QJE A;  3G7W A;  1DTG A;  3OMB A;  1WOD A;  3OEM A;  4RPN A;  3RPL A;  1NUX A;  3K1M A;  4U1O A;  1B52 A;  1ZIU A;  3N94 A;  1BTJ A;  5FTI A;  3MP1 A;  1MQI A;  1PBQ A;  4THI A;  1FTM A;  3USD A;  3MPK A;  1D9Q A;  1QUI A;  1XVY A;  2I4B A;  2QPQ A;  4FAT A;  2REG A;  2RKM A;  3OEL A;  1DBZ A;  1B46 A;  1BIY A;  3TDJ A;  4LVQ A;  4OHN A;  2O51 A;  1B4H A;  1LBZ A;  4G61 A;  4U4S A;  2A5T B;  2F7B A;  1T0K A;  1Y3P A;  1KWH A;  5IM2 A;  3BFT A;  1IIW A;  5B70 A;  2HPG A;  3F11 A;  2KLF A;  3RQT A;  2WEF A;  2E1S A;  2HHM A;  2Y7R A;  3RTF B;  3A3U A;  1KA1 A;  3RGY A;  4PDH A;  2PYY A;  1VDW A;  2ZXT A;  4H0W A;  3E3K A;  5I58 A;  3EKI A;  2F5X A;  1QGX A;  1QW0 A;  1FQE A;  2DOJ A;  1SW5 A;  1B7U A;  4JVC A;  3MW0 A;  3GXA A;  3U65 A;  4GWS A;  4MLV A;  4ZEI A;  1IMA A;  1Z7N E;  2ZZW A;  2XWK A;  3PPN A;  4MCO A;  3DP8 A;  5H8N A;  1NV6 A;  3LUY A;  1MDP 1;  2I3V A;  1NUY A;  4R72 A;  4RK2 A;  3K1P A;  4MEV A;  3DEL B;  2VD2 A;  3SEW A;  3FGS A;  4BDQ A;  4X48 A;  3CI8 A;  3HFU A;  3MP6 A;  1NV1 A;  2I58 A;  1B0L A;  4P47 A;  4NWC A;  3H4Z A;  3G3G A;  4JVI A;  4I3E A;  1FPD A;  4NMY A;  1LFG A;  1GGG A;  2XXI A;  4IO7 A;  1EYK A;  1OQG A;  4H67 A;  3ISP A;  3MZB A;  1B51 A;  2RF1 A;  1R1N A;  3K6W A;  2XXH A;  1N76 A;  4HTG A;  5AA2 D;  4F1V A;  4PE5 B;  4GQO A;  1FJ9 A;  4GVO A;  2OJT A;  3N6T A;  3KBZ A;  2NUV A;  5AA3 A;  4XEQ A;  2B65 A;  4MF3 A;  4P3L A;  1TFD A;  3T9H B;  2Y5L A;  1H43 A;  4GWX A;  5DT6 A;  1LGB C;  1B5H A;  2ANJ A;  3KN3 A;  3W15 C;  4ZE9 A;  4HE2 A;  4OEU A;  2X7P A;  1DK4 A;  4PFB A;  5FHN A;  1NV0 A;  1MPB A;  1FPG A;  2V84 A;  4FAJ A;  1HSL A;  3T96 B;  4TLL B;  2NVU B;  1B3F A;  1NNP A;  4G2Z A;  4F2Q A;  1TWY A;  3MZ1 A;  2Z8F A;  2Z8E A;  2E0S A;  4IB2 A;  2PBW A;  3RT8 A;  2Q74 A;  4H65 A;  4KD5 A;  1XHY A;  1M5F A;  1FTJ A;  3IOW A;  3M3F A;  2IEE A;  4ZEF A;  5AA2 B;  3T9U A;  2YLN A;  4KR5 A;  4PBQ A;  4M1V A;  2Z22 A;  3H7M A;  5AA4 A;  5TU0 A;  5K2X A;  3DLN A;  3K0V A;  1LST A;  2WBD A;  1LAG E;  5TP9 A;  2FHY A;  2HFB A;  4PTK A;  1D9V A;  4EQ9 A;  2P1S A;  5I57 B;  3FV2 A;  2PT2 A;  4AS5 A;  4U4X A;  1B9J A;  4PAK A;  1VR5 A;  3Q28 A;  3OSR A;  1I69 A;  4U22 A;  1NV2 A;  2HCA A;  4OAN A;  3QAX A;  4OVP A;  4E0W A;  4I40 A;  1PEB A;  3PD9 A;  5CBS A;  4OMB A;  5I59 A;  3PUW E;  4RY1 A;  3IK6 B;  2ONR A;  2Q9T A;  2DSF A;  3FV1 A;  4QF9 A;  3IFC A;  4O3B A;  4UAC A;  2I4C A;  3G3I A;  3VXC A;  1B05 A;  5IGA A;  3TAJ A;  2Q2A A;  4YKJ A;  5K2Y A;  5ET8 A;  2R6G E;  3TEP A;  1A7L A;  3RPL B;  4NHB A;  2WBB A;  1EZP A;  2CZL A;  1D3K A;  1Y4T A;  4JWY A;  3C33 A;  3QUF A;  4HXV A;  1UIV A;  4QSD A;  1BLF A;  2CZH A;  2ZYN A;  3IOT A;  3THI A;  1OMP A;  4QBA A;  3MVZ A;  5I56 A;  3B50 A;  3I3V A;  4N15 A;  3UP9 A;  3C32 A;  1DOT A;  1G0H A;  1VSO A;  4R9F A;  5IZZ A;  4NQ8 A;  1MQH A;  4TQU Q;  2ZZV A;  2DWI A;  4IO4 A;  2GFE A;  1KA0 A;  1DCU A;  3TTL A;  1YTV A;  2OK2 A;  3U93 A;  4ZEB A;  4X1D A;  1EH3 A;  3GBA A;  3SER A;  4IO3 A;  3P7I A;  3TCH A;  5I58 B;  3EN3 A;  2XXY A;  4GX6 A;  4DI3 D;  2DS9 A;  2O1M A;  3TUS A;  1M5B A;  2AYS A;  4IO5 A;  4YIC A;  4OA4 A;  1YPN A;  1J1N A;  3MC2 A;  3EHS A;  3KSJ A;  4ELP A;  3T9V A;  3PPR A;  4Q5T A;  3KSX A;  2XWO A;  4EF1 A;  5H8N B;  3KBR A;  3HPI A;  2F6G A;  4H45 A;  4EQ7 A;  2D21 A;  3DP4 A;  2UVI A;  4MNI A;  1SBP A;  3PTY A;  4G68 B;  2ONK E;  1MY3 A;  4PBH A;  4OVQ A;  4QRZ A;  5FBP A;  4O7M A;  4LZ5 A;  2GRV A;  2WKY A;  2XWI A;  4ELR A;  1QUJ A;  1NMU A;  2HAU A;  3MVY A;  2DVZ A;  4GLI A;  5TPA A;  2R8T A;  4IO2 A;  4JSD A;  3MVX A;  4GWY A;  3KJ7 A;  1LCT A;  5EQ8 A;  3FBP A;  3TMG A;  1Y1M A;  3RPW A;  4HW8 A;  1MXV A;  1A99 A;  2B3B A;  1NV7 A;  3I6V A;  4O3A A;  4POW A;  2Q89 A;  2Y7I A;  3H6T A;  4O7I A;  2R9J A;  3MQ9 A;  3PUY E;  2F7A A;  2O7I A;  4P8B A;  2F78 A;  2W7Y A;  3PMW A;  3UGW A;  3CVG A;  3GBB A;  3OSQ A;  1LLS A;  1QKA A;  4PAI A;  3VV5 A;  1R9Q A;  1IMD A;  2DWJ A;  3O2A A;  4LQ2 A;  1ATG A;  4GOT A;  2XX8 A;  1IMF A;  4IGR A;  3PPP A;  4R9G A;  3IJX B;  1IZ1 A;  3UN6 A;  1Y3N A;  3CSG A;  1D9Y A;  4NN3 A;  1JW1 A;  3FAS A;  3IL1 B;  4PQJ A;  1US5 A;  2GH9 A;  2XXK A;  4GIZ A;  1FTK A;  4POX A;  1BP5 A;  5FHO A;  4YZZ A;  1ZTY A;  2B4M A;  3IJO B;  4JVD A;  2PX1 A;  3UOR A;  4H8I A;  4PF6 A;  4XKN A;  5JTY B;  2M8C A;  4QHQ A;  5ICT A;  4U2R A;  2F3B A;  4QFP A;  1MY4 A;  3QYT A;  2UVG A;  4GWO A;  1O64 A;  1MPD A;  5J1D A;  2RC8 A;  4ZE8 A;  1PBP A;  3VE1 B;  3KZG A;  4TOZ A;  4DXB A;  3B6Q A;  1YYZ A;  2V3T A;  1Q9D A;  1RDX A;  2RCA A;  4MIJ A;  3GLB A;  5TP9 B;  1OLC A;  4XFE A;  5H8Q A;  3T1B A;  2GHA A;  5CM6 A;  3S9E A;  5A5X A;  1EYI A;  4YB7 A;  1PB8 A;  4ESX A;  5JK4 A;  3TTK A;  4AB5 A;  3BIH A;  1XS5 A;  3K02 A;  4JWO A;  2BJJ X;  3TFL A;  2I49 A;  4R2F A;  1FPB A;  3FUZ A;  1FBD A;  3K6V A;  1O63 A;  3PPQ A;  3MBP A;  4Q30 B;  3V83 A;  1S50 A;  5I59 B;  3UA8 A;  1EZ9 A;  2L5V A;  3UK4 A;  4JDF A;  3MP8 A;  4RK9 A;  2F7C A;  4QFK A;  3TPA A;  1UTB A;  2F8D A;  2CEY A;  1SI0 A;  1Y1Z A;  2Z23 A;  3AXF A;  2OWT A;  3GZG A;  2ZYK A;  1B5J A;  1XC1 A;  5KDT A;  3BIG A;  4ZZA A;  2ZNU A;  1EU8 A;  4DXU A;  1EZO A;  5IZ1 A;  5LDZ A;  4RPO A;  2DE2 A;  2QS4 A;  1MY1 A;  4XTC Q;  1MS7 A;  3MPL A;  4OFL A;  1N3W A;  1ZU0 A;  2O69 A;  2ONS A;  2RIN A;  4KI0 E;  1B7Z A;  2MKZ A;  4EF2 A;  3MWB A;  4MLQ A;  3U72 A;  1Y3Q A;  3EQ1 A;  4YAH X;  3LV0 A;  1JET A;  4R74 A;  5DVI A;  3QIM A;  4BDL A;  2A5S A;  3C36 A;  3HV1 A;  1NH7 A;  1AL3 A;  1I6Q A;  2H99 A;  4PAF A;  1ZMG A;  4NF6 B;  2XD2 A;  2AL5 A;  2OWS A;  4H6D A;  3U92 A;  3HCQ A;  4PFU A;  3U1O A;  4R2B A;  2F3D A;  3MAM A;  3UIF A;  4WXJ A;  3ZS6 A;  2H9B A;  1LFI A;  2R71 A;  4OWD A;  5EQ7 A;  4GWW A;  3D1R A;  5KCJ A;  3L6H A;  3TTR A;  3MJN A;  2NOO A;  5A5L A;  2Z8D A;  3PUV E;  3TEL A;  4P11 A;  2F6P A;  1MQG A;  3SZP A;  4NF8 A;  3OEN A;  2QS1 A;  4JB7 A;  4OVS A;  1H44 A;  2XX9 A;  4X8R A;  3Q27 A;  1A55 A;  1QVS A;  2DP8 A;  4DXC A;  4XF5 A;  3LC8 A;  1SYH A;  4F29 A;  2Y7P A;  4E0X A;  3R26 A;  2QFL A;  4ELO A;  3OEK A;  2XXT A;  4X9T A;  3LUZ A;  2XXP A;  4OER A;  5TPA B;  2FIX A;  3OXN A;  3BKI B;  1IEJ A;  4GX3 A;  4IR8 A;  1NUZ A;  2QMW A;  2FA7 A;  2ABH A;  1FPI A;  1FPL A;  4H46 A;  5HPQ A;  2OCU A;  4NX1 A;  5ESY A;  3RT6 B;  3PD8 A;  3MZ9 A;  1FBG A;  4X04 A;  3K4U A;  3ILT B;  1RDY A;  3D4G A;  4G8N A;  3KN8 A;  2WYK A;  4JXI A;  4GL0 A;  4QXD A;  4MNC A;  5DVF A;  3S9N C;  2GHB A;  4IY6 A;  1A8E A;  1HSJ A;  1NV4 A;  4HS7 A;  1AMF A;  4JSO A;  4MH5 A;  3IFA A;  4KYS A;  2VGQ A;  3HHF A;  4IGT A;  3V8X B;  1XI6 A;  3VLU A;  1NNK A;  2X7Q A;  2P3N A;  1L5T A;  4YU0 A;  2Q8M A;  1JVX A;  4QSC A;  5EYH A;  5KZT A;  4U21 A;  4KXP A;  5I2N A;  3OO9 A;  1IQ7 A;  5CI5 A;  3TTN A;  1SW1 A;  4FOR A;  4YKK A;  5F7V A;  4LZ7 A;  1N0T A;  1NKX A;  1FBF A;  4F2O A;  3IX1 A;  5H8F B;  4AB6 A;  4F31 B;  4KQP A;  5H8H B;  4FBP A;  5ISU A;  2REJ A;  3FVN A;  3VVD A;  5ICQ A;  3JZJ A;  5HBC A;  1FPE A;  4QSE A;  3B8B A;  1B58 A;  2F97 A;  4GF8 A;  4DCX A;  1KZ8 A;  4NED A;  4ELQ A;  4F3G A;  2XHD A;  3FVG A;  4OES A;  2V25 A;  3H6V A;  3HO7 A;  1FW0 A;  4HCY A;  5H8Q B;  3O29 A;  1Q1K A;  4WED A;  4FED A;  5I84 A;  3TOD A;  2HQ0 A;  4OFO A;  2UXA A;  1SD3 A;  2VPO A;  3TQW A;  2ZNT A;  1USY H;  1IMB A;  4Z7E A;  4GWU A;  5FHM A;  1P1Q A;  3NOH A;  2QVU A;  4OEN A;  1B1X A;  3V5A A;  5CBR A;  1MG1 A;  5CMC A;  2FVZ A;  3KEI A;  3C35 A;  4PFR A;  1MH4 A;  1JVY A;  2P0S A;  1TFA A;  3CFZ A;  3E4R A;  4ISU A;  4FEB A;  4QFO A;  3BFU A;  1MPC A;  3V89 B;  5EQ9 A;  5EHM A;  2G29 A;  1F9B A;  2V93 A;  5L9O A;  4I8C A;  3PMX A;  3QSL A;  1P99 A;  1AH5 A;  3JV9 A;  4F22 A;  4R6K A;  1PC3 A;  4XIG Q;  5DVJ A;  4N13 A;  3A3C A;  1Z7M E;  3VXB A;  4YB5 A;  1LAX A;  1USY E;  4NF4 A;  4F1U A;  1YXI A;  3VFJ A;  3H3G A;  2QS3 A;  2G93 A;  1II5 A;  1OVT A;  4NGU A;  1CB6 A;  1M5E A;  3OD7 A;  5M2V A;  4P1E A;  2O6A A;  3B6W A;  2F36 A;  4MNP A;  3Q25 A;  4IY5 A;  4PGN A;  3FAT A;  3CFX A;  4YMA A;  1VFE A;  1ANF A;  1VFD A;  2DVC A;  3SEX A;  4OEV A;  5IAI A;  1FSA A;  2ZMB A;  4LP2 B;  4KCC A;  3H6U A;  1FBC A;  1LB9 A;  3WAE A;  1FPF A;  1WDN A;  4N17 A;  1MM6 A;  2OWZ A;  2WX9 A;  1JNF A;  4LQ5 A;  1XT8 A;  4N4U A;  2HZL A;  1K9Z A;  3K2D A;  2CEX A;  2PT1 A;  3S2V A;  3Q29 A;  3QMF A;  3CRB A;  5ET6 A;  5AA1 A;  2P3V A;  5ET7 A;  2I3W A;  4F3B A;  5KCJ B;  4FJP A;  4P56 A;  1MY2 A;  3E79 A;  4GBW A;  4H5G A;  2ZYM A;  3C4M A;  1EYJ A;  1FBE A;  3N26 A;  1M5C A;  4YMB A;  5ELV A;  4H1X A;  1ZJL A;  5I3S A;  1AOV A;  4H8J A;  1SPI A;  2I0C A;  1GR2 A;  4F3S A;  3IOU A;  2XWV A;  3TQL A;  3S9M C;  4OYV A;  2DXY A;  2AIX A;  5EYF A;  4N6P A;  4NF5 A;  1B3E A;  3OO6 A;  3PV0 E;  4I1D A;  4RNS A;  3ONM A;  4LUB A;  3M8U A;  3LR1 A;  4O3C A;  1NNT A;  4G8M A;  3O9P A;  3D4C A;  3H06 B;  2VHA A;  3ZSF A;  1IME A;  2QVR A;  5ET5 A;  1IUD A;  1ZBM A;  2VT5 A;  3EF7 A;  4N91 A;  2KR0 A;  2DE4 A;  1AIV A;  1GTK A;  3OO7 A;  2OLB A;  3RY3 A;  2Y7W A;  4I9D A;  3HHG A;  2PCR A;  3R7X A;  1GVC A;  3IB0 A;  1BKA A;  1DSN A;  5J16 A;  5F24 A;  4N8G A;  4P0G A;  4ZED A;  2LAO A;  2CZI A;  3LBS A;  4OQO A;  1NV5 A;  2HZK A;  4H5F A;  4KCD A;  1SQY A;  4WEP A;  3N6U A;  3KJT A;  3K6X A;  4NTL A;  4G4P A;  1G0I A;  1OIB A;  1FQA A;  3FD3 A;  4C1T A;  1SVX B;  3K01 A;  5AA2 A;  2O68 A;  4LA9 A;  1LBB A;  2X26 A;  1FPJ A;  3C31 A;  1RDZ A;  4N6D A;  1P1O A;  5AE4 A;  1I6B A;  5L9S A;  3TYH A;  4DI4 B;  1B3L A;  1LB8 A;  5AA4 B;  1LBX A;  3CSB A;  4ECF A;  5EYG A;  5I2K A;  3RUM A;  2B3F A;  5B7D A;  2FIE A;  3FVK A;  4GRK A;  4PF8 A;  3C34 A;  4JWX A;  5DEX A;  5HM4 B;  5I57 A;  3ODB A;  1POT A;  5DW8 A;  4RXL A;  3CG1 A;  1SW4 A;  5FTH A;  4FIM A;  4Q8R A;  4AS4 A;  3K1N A;  3RYD A;  4KPT A;  3VLV A;  2D5W A;  1A8F A;  3IAZ A;  3FXQ A;  1JW4 A;  3FJM A;  1P1N A;  4N07 A;  1IXH A;  2DWA A;  2ZZX A;  1POY 1;  2CMO A;  5IZ3 A;  1LBW A;  3MST A;  2HAV A;  2FNC A;  4XKR A;  4ESW A;  4KYE A;  4MBP A;  1JEU A;  2UYE A;  3K00 A;  2QL3 A;  4R6H A;  2RC7 A;  1B3H A;  2FBP A;  4YB6 A;  3U8Q A;  2JJK A;  3CFL A;  4R6Y A;  1FPK A;  4FE8 A;  2XXR A;  2QS2 A;  3T22 A;  4OVR A;  4LAT A;  2V4C A;  1S7Y A;  4JBZ A;  2VOZ A;  1N3X A;  4GWZ A;  1US4 A;  2F35 A;  2DDK A;  5F1Q A;  3DP6 A;  4PE3 A;  5I56 B;  1GV8 A;  4DZ1 A;  5BUU A;  4BDN A;  1LBY A;  4NF4 B;  1K9Y A;  4GXS B;  3MUQ A;  5H8S A;  1XOC A;  4Z0I A;  3KG2 A;  4I62 A;  1CE2 A;  4MAG A;  4KFQ A;  3IB2 A;  3PUX E;  1Y9U A;  4P0I A;  1UTH A;  2QSX A;  1ELJ A;  3IO6 A;  2VP1 A;  1S9T A;  3EHT A;  2IA4 A;  4PFW A;  4P1L A;  1RKM A;  3O66 A;  3R6U A;  3RTW B;  2PVU A;  3ILU B;  1A54 A;  3SET A;  1NL5 A;  4ZZE A;  1TXF A;  4EXL A;  2CZK A;  2Y7K A;  1CNQ A;  1YZ0 A;  1O7T A;  1MRP A;  2XD3 A;  3ROJ A;  2QVV A;  3QUJ A;  3JYR A;  4YKP A;  3G3H A;  2WYP A;  3IOV A;  1MXY A;  1R9L A;  1VE4 A;  5T3J A;  4G68 A;  4NF0 A;  3CHG A;  3A09 A;  1FQB A;  3IO4 A;  4ONY A;  4GBV A;  3SES A;  2UVJ A;  1AWB A;  1UQW A;  5CMM A;  1FJ6 A;  4PDD A;  3G3K A;  5LOM A;  2ESN A;  2HXW A;  3A29 A;  3HST A;  2VPN A;  3FVO A;  4ZDM A;  3TKD A;  4OTE A;  4ZEK A;  4C1U A;  4RA1 A;  1SDX A;  1NNF A;  2O1L A;  4LN5 A;  1SYI A;  1B2H A;  2Q8J A;  4NE4 A;  4NF5 B;  5EQA A;  4LON B;  2THI A;  1IXC A;  4OXV A;  2Y5K A;  1LFH A;  4X1B A;  3T66 A;  4PET A;  1B0H A;  4I3Y A;  4BDO A;  1YCJ A;  4F1Y A;  4O8M A;  1D4N A;  4G8H A;  3TCG A;  5LTC A;  1FTO A;  3PMV A;  1INP A;  3PGF A;  2NWJ A;  2UYF A;  3VVE A;  1OLA A;  2OZZ A;  4O94 A;  1LBV A;  2DWH A;  1LCF A;  1N84 A;  3CG3 A;  4R73 A;  1LAH E;  3O28 A;  4ZS9 A;  3VDF A;  4IO6 A;  4GD5 A;  1N7X A;  5DYH A;  3GYY A;  1LBC A;  1N7W A;  4DE8 A;  1IXI A;  5JTY A;  4XKQ A;  2ZNS A;  2P2A A;  1FBP A;  1DPE A;  1PB9 A;  2I6E A;  1B40 A;  1B1H A;  3IR1 A;  4UA8 A;  1B7H A;  3SKP A;  2O84 X;  3IB1 A;  3VVF A;  4MJO A;  5I2K B;  1OQH A;  4GXA A;  4QFL A;  3LSL A;  5DEX B;  3FXB A;  4P9K A;  4K3F A;  5A5X B;  2XA5 A;  2Q88 A;  2KQZ A;  3SEU A;  1URD A;  5IKB A;  1URG A;  1NI9 A;  3M3L A;  1RYX A;  3B6T A;  2DXR A;  3KOS A;  2GQ1 A;  3OO8 A;  2UVH A;  1QJM A;  4YKI A;  4R75 A;  3KC1 A;  4KYD A;  1LEV A;  3FXR A;  4HCW A;  4ZEC A;  1B6H A;  2HEU A;  1FTA A;  1JQF A;  5IZ3 B;  4M4G A;  4N8Y A;  4N81 A;  4PC9 A;  3LSF B;  3SEY A;  4HE1 A;  3Q26 A;  1HSE A;  3EHU A;  1UTB B;  5BWJ A;  2YJP A;  3FZV A;  1SW2 A;  2XX7 A;  4AQ4 A;  3ZKL A;  5CMK A;  4GFR A;  1WVJ A;  3BBR A;  4DLD A;  3O6I A;  5KDT B;  1MM7 A;  2A5T A;  3T0J A;  4RYA A;  1JEV A;  3SEV A;  2F34 A;  1IMC A;  2DYX A;  1NUW A;  3I5O A;  3T93 B;  1MDQ A;  5L8D A;  1M5D A;  3IOR A;  4OFJ A;  1B4Z A;  4UAB A;  4MMP A;  4NG7 A;  3FXU A;  4L17 A;  2V3Q A;  2XXU A;  3LSX A;  1SI1 A;  2ALU A;  4OVJ A;  1H3D A;  2RC9 A;  3LSW A;  1NV3 A;  3E13 X;  1OVB A;  3QK6 A;  1B3G A;  3S9L C;  5ITP A;  3L6G A;  4WKM A;  3TZA A;  4F3P A;  1FQF A;  1BK4 A;  2XXX A;  3W9W A;  1Y20 A;  2D3I A;  3T9X B;  5CRY A;  2Q2C A;  4NF6 A;  4GX4 A;  5DTB A;  1UTH B;  4DIG A;  4NWD A;  4LZ8 A;  1MXW A;  2ZYO A;  1QUL A;  3WAF A;  4XKP A;  5JEI A;  1MXU A;  3MVW A;  3KGC A;  1P1U A;  3CIJ A;  1MXX A;  2V3U A;  2XXW A;  2H25 A;  3QXM A;  1YAE A;  4HE0 A;  5CMB A;  4F18 A;  2I48 A;  1DPP A;  1IIT A;  3KC0 A;  4GL8 A;  3PUZ E;  4NF8 B;  4C0R A;  1N04 A;  4QFN A;  2PFY A;  5I5P A;  3E9X A;  1QUK A;  3U94 A;  4Q0C A;  1B32 A;  4G68 C;  3O6H A;  1I6A A;  2OBG A;  3VLW A;  4PFY A;  4RJZ A;  3KN7 A;  4DDD A;  3B7D A;  3N5L A;  4BDM A;  2OX3 A;  2QRY A;  3EPE A;  3DM0 A;  3E78 A;  2H5Y A;  5I7I A;  3W9V A;  2DQV A;  2NXO A;  1DTZ A;  3G3F A;  3PPO A;  2BJI A;  1MXZ A;  1QKB A;  1NFT A;  3H6W A;  2DE3 A;  3O97 A;  2Y84 A;  3RN8 A;  1Y4C A;  1A40 A;  4PFI A;  4F39 A;  3FJG A;  1ZKB A;  3H03 A;  1IXG A;  1URS A;  2YPN A;  1RYO A;  1PDA A;  1MQJ A;  3OOA A;  4U23 A;  1H45 A;  2I0B A;  2HXR A;  1FRP A;  1Q35 A;  4KHZ E;  3ECR A;  3CR9 A;  4F19 A;  1R6Z A;  1MY0 A;  5EHS A;  1LAF E;  4MFI A;  1PB7 A;  3ZKK A;  1JW5 A;  3PU5 A;  4XXU A;  3RNN A;  1P1W A;  4PP0 A;  2H98 A;  4G77 A;  2AL4 A;  4OVT A;  3FJ7 A;  4EXK A;  1B5I A;  1UIU A;  4NAP A;  1FCK A;  3C9H A;  3O6G A;  2QMX A;  1NH8 A;  4EUO A;  3TCF A;  5CC2 A;  2H4I A;  4DCY A;  3FIR A;  5I2N B;  1MH3 A;  4OET A;  2B4L A;  3S4U A;  4TLM B;  1MQD A;  4MHF A;  4PGP A;  5H8F A;  2FYI A;  3K6U A;  3KFM A;  5H8H A;  4ND9 A;  2XXQ A;  1FQC A;  4PCD A;  4FEC A;  2PMS A;  5ITO A;  3G3J A;  4MX6 A;  3KOT A;  3SDF A;  1XVX A;  3M3K A;  4PFT A;  4U1Z A; 
#chains in the Genus database with same CATH homology
 3MYU A;  2PFZ A;  2WYP A;  4N6K A;  4HCY A;  4MNI A;  1JP4 A;  3PTY A;  5T3J A;  4NF0 A;  3CHG A;  4PBH A;  4OVQ A;  4GBV A;  1AWB A;  5FBP A;  4O7M A;  1FJ6 A;  2XWI A;  4PDD A;  2VPO A;  3A29 A;  1FBH A;  2DVZ A;  2VPN A;  2R8T A;  1IMB A;  4GWU A;  4GWY A;  3NOH A;  5EQ8 A;  2QVU A;  3FBP A;  4LN5 A;  1NV7 A;  2FVZ A;  5EQA A;  3RPL A;  4PFR A;  1NUX A;  2Y5K A;  4O7I A;  4PET A;  4I3Y A;  4P8B A;  5EQ9 A;  1D9Q A;  2QPQ A;  1DBZ A;  4PAI A;  4O8M A;  1IMD A;  5LTC A;  1INP A;  1LBZ A;  4G61 A;  1IMF A;  5IM2 A;  4F1U A;  2HPG A;  1YXI A;  4O94 A;  1LBV A;  2WEF A;  4NGU A;  4NN3 A;  2HHM A;  4P1E A;  2XXK A;  1KA1 A;  4MNP A;  4PGN A;  4PDH A;  1VDW A;  3GYY A;  4YZZ A;  2B4M A;  4JVD A;  4PF6 A;  3EKI A;  2F5X A;  1QGX A;  2F3B A;  1FSA A;  1FBC A;  4JVC A;  3U65 A;  4GWS A;  1FBP A;  5J1D A;  1IMA A;  2ZZW A;  1FPF A;  2XWK A;  4N17 A;  4MCO A;  2OWZ A;  1YYZ A;  1NV6 A;  2WX9 A;  1Q9D A;  4MJO A;  1NUY A;  1RDX A;  4MIJ A;  4N4U A;  2HZL A;  1K9Z A;  2CEX A;  4XFE A;  3QMF A;  3T1B A;  3FXB A;  4P9K A;  5ET6 A;  2P3V A;  5ET7 A;  5CM6 A;  4MEV A;  2XA5 A;  1EYI A;  4P56 A;  3HFU A;  5JK4 A;  3E79 A;  1NV1 A;  3BIH A;  4GBW A;  4P47 A;  1EYJ A;  2KQZ A;  1FBE A;  5I3S A;  4JVI A;  1NI9 A;  1FPD A;  4I3E A;  1SPI A;  1FPB A;  2GQ1 A;  2XWV A;  1EYK A;  1FBD A;  3ISP A;  3KC1 A;  1LEV A;  4HCW A;  4F1V A;  1FTA A;  5IZ3 B;  4N8Y A;  4N81 A;  1FJ9 A;  2L5V A;  4PC9 A;  4HE1 A;  3KBZ A;  4XEQ A;  1IME A;  2CEY A;  2QVR A;  4P3L A;  5ET5 A;  2Y5L A;  2VT5 A;  4N91 A;  2KR0 A;  4GWX A;  2DE4 A;  4HE2 A;  1DK4 A;  4PFB A;  1NV0 A;  2PCR A;  3BIG A;  5J16 A;  5F24 A;  3T0J A;  1FPG A;  4N8G A;  5IZ1 A;  5LDZ A;  1IMC A;  1NUW A;  2DE2 A;  2CZI A;  4UAB A;  4MMP A;  4NG7 A;  1NV5 A;  2HZK A;  2V3Q A;  2Q74 A;  2MKZ A;  1NV3 A;  3LV0 A;  1G0I A;  1BK4 A;  1FPJ A;  3W9W A;  1RDZ A;  4PBQ A;  4M1V A;  4N6D A;  4PAF A;  4DI4 B;  4GX4 A;  1LBX A;  5EYG A;  2WBD A;  2F3D A;  2FHY A;  4PTK A;  2FIE A;  4PF8 A;  5EQ7 A;  4GWW A;  5DW8 A;  4AS5 A;  3D1R A;  4PAK A;  4AS4 A;  3RYD A;  4HE0 A;  4F18 A;  5A5L A;  3KC0 A;  1NV2 A;  3SZP A;  4OVS A;  4OAN A;  2PFY A;  4OVP A;  5I5P A;  4X8R A;  4I40 A;  4XF5 A;  2ZZX A;  2QFL A;  5IZ3 A;  3MST A;  4X9T A;  3LUZ A;  2OX3 A;  3E78 A;  2FIX A;  5I7I A;  3W9V A;  4GX3 A;  4IR8 A;  2Q9T A;  1NUZ A;  3IFC A;  2BJI A;  2FBP A;  2JJK A;  2DE3 A;  1FPI A;  5IGA A;  5ET8 A;  3RPL B;  1FPL A;  4H46 A;  4NHB A;  2WBB A;  1FPK A;  4PFI A;  4NX1 A;  4OVR A;  5ESY A;  2V4C A;  1FBG A;  4X04 A;  4GWZ A;  1RDY A;  2WYK A;  4QXD A;  2DDK A;  4MNC A;  4HXV A;  2HXR A;  1FRP A;  2CZH A;  4PE3 A;  4QBA A;  4F19 A;  3B50 A;  4N15 A;  1NV4 A;  1LBY A;  1G0H A;  1K9Y A;  5IZZ A;  4NQ8 A;  2ZZV A;  3IFA A;  1KA0 A;  1DCU A;  1XI6 A;  4OVT A;  4MAG A;  2P3N A;  4NAP A;  2Q8M A;  5EYH A;  4KXP A;  2B4L A;  4GX6 A;  4DI3 D;  1FBF A;  4P1L A;  4MHF A;  4PGP A;  4YIC A;  4OA4 A;  4FBP A;  2CZK A;  1CNQ A;  4PCD A;  1YZ0 A;  1FPE A;  3ROJ A;  3B8B A;  2QVV A;  2XWO A;  4MX6 A;  1LBW A;  1KZ8 A;  4H45 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...