4UABA

Crystal structure of a trap periplasmic solute binding protein from chromohalobacter salexigens dsm 3043 (csal_0678), target efi-501078, with bound ethanolamine
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
315
structure length
315
Chain Sequence
TIKWRMQTYAGAALAEHVAKPAIDLFNRIAGDRMQIELYSADQLVPTGELFRAMQRGTIDAVQSDDDSMASPTEVTVFGGYFPFGCRYSLDVPVLFNQYGLKEIWEEEYAKVGVKHVSAGAWDPCHFATKEPIRSLKDLEGKRVFTFPTAGRFLSRFGVVPVTLPWEDIEVALQTGELDGIAWSGITEDYTVGWANVTNYFLTNNISGAWIGHFFVNMERWEELPEDLRLLFEVCCEQSHYHRQYWYWGGEARLRVHGDKLELTSIPDAEWDQVETAAQEFWDEIAAQSETKAKVVEIFKQYNADMRKAGRPYRY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Experimental strategies for functional annotation and metabolism discovery: targeted screening of solute binding proteins and unbiased panning of metabolomes.
pubmed doi rcsb
source organism Chromohalobacter salexigens
molecule tags Transport protein
molecule keywords Twin-arginine translocation pathway signal
total genus 116
structure length 315
sequence length 315
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4uabA00
4MCOA 4P3LA 4X04A 2PFYA 5IZZA 4NAPA 4OANA 4PDDA 4P47A 2WX9A 2XXKA 4XF5A 2PFZA 5IM2A 4NN3A 2VPOA 2ZZVA 4PDHA 4NX1A 2ZZXA 4P9KA 5IGAA 4MHFA 4OVPA 4MMPA 4PCDA 2XWOA 4MNCA 4PFIA 3FXBA 4PF6A 4N6DA 2VPNA 5LTCA 4XEQA 2WYKA 4O7MA 4DI4B 4N15A 4PETA 4N17A 2WYPA 2CEXA 3GYYA 4P8BA 4PF8A 4NQ8A 4MAGA 2XWVA 4NGUA 4PFRA 2HZLA 4PAIA 4N8YA 4NG7A 4OVRA 4YZZA 2V4CA 2HPGA 4N6KA 4NF0A 5I5PA 2CEYA 4PFBA 4P1EA 4PC9A 4MEVA 4XFEA 4MX6A 3U65A 2HZKA 4NHBA 4PAKA 4OVSA 4X8RA 4N4UA 4O8MA 4UABA 3B50A 4PGPA 4MIJA 4MNPA 2ZZWA 4PBHA 4N91A 4OVTA 4MNIA 4OA4A 4YICA 4N8GA 5CM6A 4P56A 4P1LA 4O94A 4DI3D 4OVQA 5I7IA 4LN5A 4PAFA 2XWKA 2XA5A 2XWIA 4PBQA 4PE3A 4PGNA
chains in the Genus database with same CATH superfamily
1ZBMA 2RF1A 4MLQA 4NF5A 5EYGA 3G3KA 1MS7A 3K6VA 3PUXE 1MXWA 1B58A 5JTYB 4U4XA 5J1DA 2X7PA 1D9YA 3SEVA 3C32A 4OYVA 3KG2A 5FTIA 3MVWA 4QFOA 1Y9UA 4G8MA 4I3YA 1IMFA 1B3LA 2RCAA 3IOVA 2Z22A 3TTKA 1A8EA 5EQAA 3B6TA 2O7IA 3TFLA 4BDLA 3PU5A 1EZOA 5T3JA 4F29A 3C36A 5DW8A 3DELB 4BLAA 4PC9A 2Q2AA 3O2AA 4G8HA 2H9BA 3UORA 2UVIA 3FXRA 4NHBA 1FQAA 4MIJA 4JSOA 2O69A 4MNPA 2GHAA 3FJGA 1FBHA 1NNPA 3S9EA 4G61A 5ITOA 4DXBA 4R2BA 4OFOA 4QRZA 3FXUA 2WBDA 3GXAA 4DCXA 3H3GA 2DDKA 3LSLA 1DBZA 4ZZAA 4GRKA 5I58B 3VVDA 3RY3A 1PB8A 1IMBA 2HAUA 3KJTA 4JXIA 1URSA 1N3WA 3IAZA 1AH5A 5I57B 1SI1A 5DVJA 1LCFA 1IXGA 2O84X 5JTYA 4GX6A 2QRYA 4GWUA 3I5OA 1P1NA 2V3UA 4EUOA 4O7MA 4JBZA 4KQPA 3R6UA 4GF8A 2I4BA 2RCBA 2DWAA 4K3FA 1JW1A 2HHMA 2F8DA 2UYEA 1P1QA 1N7WA 4XTCQ 3B8BA 3Q27A 4Q0CA 2OCUA 2OX3A 5H8HA 3U92A 2PYYA 1FPEA 2ZYOA 3PUWE 1ZLQA 5I84A 3EQ1A 4AS4A 3S9LC 4PFUA 2UVGA 1S7YA 3UGWA 2JJKA 2QL3A 1Y3PA 5BWJA 2AIXA 1RDZA 4LZ8A 3KFMA 1URGA 3W15C 2H4IA 1FPIA 1QGXA 2O1LA 2Z8DA 4UA8A 1NNKA 4FEBA 1LBWA 5I2KA 3MVYA 1DPEA 2P0SA 1NUXA 3CVGA 3IO6A 2ZNSA 4TLMB 4IB2A 3RTFB 4NF8A 3JV9A 1FRPA 5CRYA 4X04A 4JVDA 5L9MA 4H1XA 3PD8A 4NAPA 1K9YA 3HPIA 5ET7A 4I8CA 1FPLA 4JWYA 4NN3A 3SDFA 2ZZVA 2FIXA 4NMYA 5H8QB 1VR5A 2RC7A 2ZZXA 4XKPA 2WEFA 3FD3A 4OVJA 2XWOA 2RC8A 3TCFA 1FPFA 3FXBA 4O3CA 4O3BA 3SEUA 3W9WA 3FXQA 4YKIA 3RQTA 2F5XA 4RPOA 1H43A 4EDPA 1G0HA 1JVXA 4MAGA 1NV2A 4OETA 3RNNA 2XXRA 1N04A 1WODA 4ZDMA 4EF1A 1IMEA 4PAIA 5A5XB 4N8YA 4RK2A 3TPAA 2I3VA 4YZZA 1P99A 2HPGA 4YKPA 2ANJA 4ZZEA 4TOZA 4JSDA 1Y3NA 4RPNA 3O6GA 3QSLA 3C9HA 2ZYKA 5L9OA 1KA1A 4E0WA 2AYSA 3TTLA 2WBBA 4JVIA 2Y7IA 1MXVA 2Z8EA 3OO8A 4PBHA 4G68C 1ZMGA 3FV1A 3QIMA 1QW0A 3OOAA 2A5TA 3T9UA 4OVQA 2DE4A 2F3DA 4F18A 2XX7A 3PV0E 2ALUA 3PUYE 3LUYA 1JQFA 2V84A 4PBQA 4PE3A 1RYOA 3HHFA 3MC2A 3OO6A 2VOZA 5TPAB 3KBRA 4HXVA 2A5TB 3FVGA 5H8HB 2XHDA 1LFGA 3KSJA 3OXNA 4LQ5A 1MQHA 1MM7A 2F6PA 2NUVA 5H8SA 3MW0A 3MSTA 5IGAA 2MKZA 2CZLA 5KDTA 4ISUA 2KR0A 2O7UA 4OFJA 5ITPA 4C1TA 5TPAA 4OQOA 4PE5B 2OBGA 4I3EA 1B5IA 3RPLB 3BFTA 3KN3A 3KEIA 3E78A 3HO7A 2UXAA 4YAHX 3IJOB 4KYEA 4P8BA 1B6HA 1Y4CA 4IO2A 4TQUQ 4YB5A 3BIHA 2GQ1A 4BDQA 4FIMA 2XXIA 1PBQA 1NV4A 3USDA 5EYHA 5IZ1A 3RPLA 3D4GA 2QPQA 1MXYA 5I5PA 3LSFB 5CMMA 2I0CA 4FJPA 1NKXA 3B7DA 5I3SA 4RJZA 1DCUA 2ZYNA 2DSFA 4MX6A 1YPNA 4N81A 1FTOA 4GVOA 4OXVA 1FBDA 2FBPA 4GD5A 2ZNTA 3TCGA 1MRPA 5H8QA 4Q8RA 1RDXA 3G3HA 1MQGA 3PMVA 2PT2A 4NF4A 4RXLA 1N3XA 3N6TA 4R9GA 3QUJA 2VD3A 3H4ZA 2F7BA 4PAFA 3HHGA 3LC8A 1B4HA 3MPLA 4H5GA 3RT6B 1BTJA 3FGSA 2DWIA 1M5BA 3G3GA 3C31A 2QS2A 1B46A 5EYFA 3M3FA 3K6UA 5FHMA 4MF3A 2CZKA 1USYE 4G2ZA 3TQLA 1RKMA 2H99A 5KDTB 2WKYA 4MHFA 1P1OA 1FTJA 1ELJA 3PUZE 3QK6A 3OEKA 2Q88A 4PF6A 3KZGA 3H03A 1LAGE 3RYDA 2D3IA 1SD3A 1B7UA 4R6YA 4Z7EA 4U1ZA 4PF8A 3PD9A 1FQCA 1IMDA 3E13X 2RC9A 1TWYA 2HZLA 2QVVA 1MH3A 4BDNA 3HSTA 4F3BA 4THIA 3UA8A 4ESWA 4DXUA 3RLFE 1QKBA 1MXUA 3DP8A 5L8DA 1LGBC 1N84A 4PAKA 1Z7NE 2D5WA 4KR5A 5FTHA 2OWZA 3LR1A 2YLNA 3ZS6A 3SEXA 2FVZA 2PCRA 2XX8A 2Y7PA 1GGGA 3VFJA 1NUZA 4ND9A 2R8TA 3N6UA 2I48A 1US5A 3T93B 4M4GA 2XWIA 1J1NA 1P1WA 3VLWA 3SEWA 1MPBA 3QUFA 3A09A 3E9XA 3DP6A 1OQGA 4F1YA 1CE2A 1Y1MA 4HE0A 1M5DA 4PDDA 2V3QA 1QVSA 4P0GA 1B3GA 2FA7A 4F3GA 1UIUA 4ZE8A 5F1QA 4ELRA 4XF5A 3FATA 3RN8A 1PB7A 1OMPA 2PT1A 4GL0A 1XHYA 4OTEA 2NWJA 1LBCA 5A5LA 4ZEIA 4DI4B 5KCJB 1A55A 1G0IA 1Y3QA 1B3HA 3CI8A 3KN8A 5FHNA 2NXOA 3LSXA 1FQEA 2X7QA 1DSNA 5ESYA 3BFUA 2QS3A 2F3BA 2R6GE 5TP9A 1B9JA 4H8IA 4QFLA 5DEXB 2GH9A 5IKBA 1GTKA 3KJ7A 5HBCA 4OEVA 1QUJA 4IR8A 1ZKBA 4GOTA 2Z23A 1Q35A 1JVYA 3Q26A 4MEVA 2Y7KA 3EKIA 3O97A 3OENA 2F7CA 4QF9A 1A7LA 1EYKA 2R71A 4EQBA 4PFTA 4OVSA 4DZ1A 1NMUA 4PGPA 3K6WA 3Q28A 1SW1A 2Q89A 4N91A 3O9PA 4ELOA 3EHUA 4NTLA 2ZXTA 5B70A 1LEVA 1XC1A 3BKIB 1QULA 4H46A 4X48A 1FJ9A 4R9FA 1AOVA 3SZPA 5I2NA 3FVKA 1B0LA 3E3KA 5EQ9A 3CFXA 3KC1A 1B3FA 2F6GA 1XS5A 2DVCA 5I59B 1CB6A 4MJOA 4MBPA 2VT5A 1NV6A 4ZEKA 1VDWA 2F97A 4R6KA 4OZ9A 3IL1B 3C35A 2HXRA 1DTZA 3EHTA 4P0IA 4HE1A 4LZ7A 1VFDA 4N6DA 3D1RA 3IB1A 5TP9B 4EXKA 4FATA 1FTAA 3FZVA 1OLAA 3TCHA 4YB7A 3CG1A 3SETA 4GIZA 4FORA 1FTKA 1PEBA 4AB6A 3IORA 3H6UA 3C4MA 4NG7A 3TEPA 4N6KA 1IEJA 4PFBA 1AL3A 3K2DA 4IGTA 2DE2A 3IOTA 3RPWA 1B05A 5LDZA 4H6DA 3K6XA 2V25A 5AA2B 1UTHA 1N76A 2Y84A 4JVCA 3G3FA 2OK2A 2CMOA 1NI9A 2OJTA 1LBYA 4GWZA 4DI3D 5K2YA 2ZYMA 2OWSA 4OWDA 1XI6A 4GQOA 1Y4TA 2XA5A 3GZGA 1D3KA 3IOUA 1KA0A 5M2VA 3Q25A 2ABHA 4KCDA 3JZJA 1JW5A 1MPCA 2B4LA 4ZEDA 3UN6A 4U1OA 1DPPA 4MMPA 3LUZA 4GWXA 4XKNA 3THIA 4MNCA 1FPKA 4LVQA 1NL5A 1MY0A 4XEQA 2B4MA 4JWOA 3FIRA 4GXAA 4N15A 3MPKA 2XXXA 3FJMA 4IO6A 1GV8A 2AL5A 2PX1A 3OSRA 4DDDA 1FPBA 1UTBA 5JEIA 2UYFA 4I62A 3MQ9A 4KXPA 3F11A 2UVHA 1FPJA 4HS7A 3G3IA 4ELPA 3M3KA 4O8MA 4OMBA 3TYHA 2VHAA 1MG1A 4FAJA 4U2RA 4NF6B 3A29A 2DWHA 4P1LA 1A40A 2B3BA 4LN5A 2F36A 5H8FA 1PC3A 1KZ8A 3ROJA 2XXYA 2AL4A 3N94A 2XD2A 5ET5A 3K1MA 5EQ7A 1D4NA 3FBPA 1NV7A 4FE8A 3FJ7A 1B51A 1B5HA 5IZZA 3S9NC 3TQWA 3OMBA 1BKAA 2H5YA 3H6TA 4NX1A 5I57A 4P9KA 2VP1A 1NH8A 5DVFA 4GWSA 2B65A 1SI0A 3Q29A 2VPNA 4DLDA 2E1SA 2ONRA 3MP6A 4R72A 5J16A 1MXZA 3FUZA 4GL8A 4N17A 1M5EA 3CG3A 5I56A 3S9MC 4QBAA 4G77A 4PFYA 3PPQA 5H8NA 5ELVA 1JEUA 3OSQA 1PB9A 3K4UA 4POWA 1M5FA 1JNFA 3ZSFA 1ZIUA 3I6VA 4TLLB 1OIBA 3R26A 5DEXA 3FASA 1O7TA 5ICTA 3T66A 1HSLA 2VD2A 4XKQA 1FBPA 1N0TA 5CI5A 3V8XB 4U22A 3U65A 1MY3A 2HZKA 3IO4A 3HN0A 2FNCA 2O68A 4GBWA 4RK9A 2H25A 3N26A 3RT8A 5I58A 1RDYA 4N8GA 2H98A 4H0WA 4EQ9A 4FEDA 4E0XA 3KGCA 5I7IA 1UIVA 1XVXA 2YPNA 2LAOA 5F24A 1FBFA 4LQ2A 1TT1A 3VXCA 3VV5A 1OLCA 1O64A 2GHBA 3H06B 3TUSA 3O6IA 4U21A 4F3PA 1B4ZA 4ZS9A 2BJIA 4POXA 5KCJA 4XXUA 1YAEA 2FHYA 4NE4A 1MY4A 1IZ1A 5H8FB 3CFLA 2PFZA 1S9TA 2DS9A 2DWJA 3CR9A 1IMCA 1IIWA 1B3EA 1YCJA 1LSTA 3PPOA 2Q74A 4IO5A 4QSCA 3QMFA 4ELQA 2O1MA 2ZMBA 5LTCA 3G3JA 4UACA 4OENA 4YU0A 2CEXA 2ZNUA 3U72A 3K1NA 3OO7A 1MDP1 2A5SA 3U1OA 3V89B 1MXXA 1XOCA 3DLNA 1T0KA 4QXDA 4Q30B 2Y5LA 4U4SA 3TKDA 3IB2A 1CNQA 2CEYA 1IXIA 1AMFA 1B5JA 1M5CA 4PP0A 1HSJA 4GWOA 1Q1KA 1LFHA 3G7WA 4QFPA 1R1NA 3CRBA 1INPA 4FBPA 4WEPA 1BP5A 1ATGA 3ZKKA 5CMCA 1LAFE 2P3VA 1IMAA 1SVXB 3GLBA 1UTHB 3C34A 1AIVA 3FVNA 1R9LA 3PPPA 5DYHA 1NNTA 4GBVA 3OELA 2HQ0A 3HCQA 2QS1A 1SBPA 3MZ9A 4NF5B 3AXFA 4P3LA 1URDA 2W7YA 3RUMA 2ONKE 1Y20A 4OANA 3IJXB 4F31B 4NWCA 2WX9A 3ODBA 5AA2A 4ZEBA 4PDHA 3MP8A 2Y7RA 3K02A 3HV1A 4I40A 2HCAA 2I58A 1FW0A 4R75A 2NOOA 1NUYA 2P3NA 4C1UA 3KOTA 3SESA 5EHMA 4EF2A 4PFWA 1D9QA 3W9VA 2F35A 1JW4A 3VLVA 2UVJA 3M3LA 1LAXA 1BLFA 3TELA 5DT6A 4F2QA 5IAIA 1LBZA 4GLIA 4NF0A 3O6HA 2I4CA 2F34A 1NV5A 1JETA 3U8QA 4EXLA 2F78A 4F1UA 3MVXA 2DXRA 1B1XA 3QAXA 3VVEA 1FTMA 4H67A 3LV0A 2ZZWA 1R9QA 3MP1A 4QFKA 4MNIA 2OLBA 1I69A 3D4CA 1O63A 3WAEA 3I3VA 2O6AA 1FBEA 4P56A 1B2HA 2PBWA 2QSXA 4KD5A 1UTBB 5AA1A 3OD7A 1VE4A 2HAVA 2Q9TA 1JP4A 1Z7ME 2KQZA 5CMKA 5B7DA 4NWDA 4NEDA 4ONYA 2L5VA 2D21A 2XXTA 1YXIA 2R9JA 4AQ4A 5EHSA 1EZ9A 3PMWA 3FV2A 1H3DA 2QMXA 2QFLA 1USYH 4QSEA 3E4RA 2I49A 2XXKA 5A5XA 3K01A 3UIFA 5I2KB 5CC2A 3TMGA 4HCYA 4QFNA 2QMWA 1A54A 1NH7A 1HSEA 4H65A 4NF8B 4GX4A 4G4PA 4LATA 3MYUA 3SKPA 4Z0IA 2GRVA 4PETA 5L9SA 4LZ5A 4MH5A 4ESXA 3PUVE 3H6VA 2V93A 3GYYA 3RTWB 2DXYA 1MQJA 3A3CA 2V3TA 4QSDA 4OVRA 1MDQA 4DE8A 1IQ7A 3HFUA 5TU0A 3C33A 4YKJA 4ZE9A 1PBPA 3EPEA 3T1BA 1MY1A 1LAHE 4F2OA 5IZ3B 4C0RA 4DIGA 5CBRA 2ESNA 4IY6A 1RYXA 4ZEFA 4R73A 3L6GA 1EYJA 2THIA 2QVRA 2XXVA 4RA1A 1EZPA 4I9DA 1QJMA 1SDXA 2KLFA 2O51A 4H8JA 4IGRA 5AE4A 4RY1A 4HW8A 1BIYA 4OESA 2I0BA 4GWYA 1POTA 2DQVA 3FVOA 1SW2A 4AS5A 1N7XA 3KBZA 4X1BA 4AB5A 5AA4B 2Q2CA 5CBSA 4WXJA 3OO9A 3ECRA 4BDMA 5IM2A 4PQJA 4GX3A 4OVPA 4IO3A 3P7IA 4U23A 1NNFA 3ONMA 4PFIA 3ISPA 1QUKA 5HPQA 3TTRA 2P2AA 4N13A 1EYIA 2HXWA 3TTNA 1NFTA 2I3WA 1I6BA 4HCWA 1F9BA 5FBPA 4NQ8A 4ECFA 1IUDA 4KYSA 1SYIA 4PFRA 4FECA 4X1DA 4YMAA 2YJPA 4F22A 1YTVA 1SW5A 2XD3A 5F7VA 4MFIA 1MQDA 4N07A 3PPRA 3O29A 4GFRA 3GBAA 1S50A 1GR2A 4KHZE 3R7XA 2QJEA 3L6HA 1FPDA 2IEEA 2RKMA 4Q5TA 3EHSA 5ISUA 1MM6A 3T22A 2XWKA 5EQ8A 2Y5KA 3PMXA 3JYRA 3VE1B 3H7MA 3RGYA 1TFAA 4MCOA 1ANFA 3CIJA 3PPNA 1KWHA 1QUIA 1DK4A 1LBBA 1B40A 4LUBA 1Y1ZA 3PGFA 4O7IA 1II5A 5I56B 2HFBA 4NF4B 3S2VA 2BJJX 3VVFA 4R2FA 5AA3A 4GWWA 4JDFA 1DOTA 3QXMA 4G68B 2DVZA 3EF7A 3K0VA 3TZAA 3NOHA 1UQWA 3IB0A 4XIGQ 3T9XB 5H8NB 2DOJA 2REGA 2PMSA 2G93A 5KZTA 1MY2A 1LB8A 2XXWA 1EU8A 4OHNA 1FCKA 4IO4A 1VFEA 4R6HA 4QHQA 2V4CA 4WKMA 3LBSA 4DXCA 4RYAA 3VLUA 1PDAA 1OVTA 2PVUA 4I1DA 4N4UA 1MH4A 3B50A 4RNSA 4HE2A 1FPGA 5CM6A 3O28A 1XT8A 2ONSA 3MZBA 1B32A 3KSXA 4G68A 3IFCA 1YYZA 1BK4A 1JEVA 1NV1A 2OZZA 1SYHA 1I6AA 1FBCA 4PTKA 4IY5A 4H5FA 1LFIA 5LOMA 3S4UA 3B6QA 1US4A 4R74A 1H44A 1POY1 4OERA 4P47A 2IA4A 3ILUB 3IFAA 4F39A 3U93A 1YZ0A 5ET8A 2CZHA 4XKRA 1SW4A 3PTYA 4KYDA 3T9VA 1MQIA 4PCDA 3U94A 2E0SA 4BDOA 1LBVA 5AA2D 3OEMA 3BIGA 1GVCA 3T96B 2WYKA 2B3FA 2QS4A 4KCCA 1SPIA 5FHOA 4G8NA 4KFQA 1OQHA 1NV3A 3CHGA 1NUWA 3UP9A 1WDNA 2XWVA 4GXSB 1A99A 2GFEA 1B7ZA 4N6PA 2M8CA 4KI0E 1MPDA 1B52A 1ZJLA 4BDRA 2FYIA 1OVBA 4P1EA 4MLVA 1H76A 1IITA 4IO7A 2OWTA 1TXFA 2XXQA 3VDFA 2XXUA 4LP2B 1EH3A 4X9TA 3MUQA 4X8RA 3DP4A 3MVZA 4UABA 2Y7WA 2RINA 4WEDA 3BBRA 3K1PA 3IR1A 5HM4B 1Q9DA 1WVJA 2P1SA 3N5LA 1QKAA 5ICQA 3MZ1A 2Q8MA 4F1VA 4OA4A 1B7HA 4YICA 1NV0A 3GBBA 3T9HB 1A8FA 4YKKA 2NVUB 2F7AA 2FIEA 2G29A 3IX1A 3SEYA 4YB6A 3O66A 4F19A 4EQ7A 3B6WA 1B1HA 3E79A 3EN3A 5BUUA 5JK4A 1SQYA 3CSGA 2PFYA 4DCYA 5I59A 3TDJA 3VXBA 1K9ZA 5AA4A 5IZ3A 4P11A 1ZU0A 3IK6B 3ZKLA 1FQBA 4L17A 1FTLA 2VPOA 3CFZA 3K00A 3M8UA 1LCTA 4JB7A 3QYTA 1FJ6A 4OFLA 1FSAA 3KN7A 5DVIA 3SERA 1LLSA 2Z8FA 4ZECA 3V5AA 2XXHA 3MJNA 2HEUA 4H45A 1FQFA 5CMBA 2CZIA 1VSOA 2WYPA 4LA9A 2DP8A 4LONB 4M1VA 3MAMA 1ZTYA 4OEUA 1P1UA 1IXHA 1XVYA 4NGUA 1H45A 4F3SA 3TODA 1LBXA 1I6QA 2XX9A 2DE3A 3KOSA 5ET6A 1FBGA 2X26A 3MWBA 4NF6A 3V83A 4KPTA 2QVUA 2VGQA 3IOWA 4XFEA 1AWBA 3LSWA 1DMBA 2REJA 4HTGA 1TFDA 1B0HA 3T0JA 3TAJA 3WAFA 1DTGA 4O3AA 3KC0A 5DTBA 4JWXA 4OVTA 3MBPA 2DYXA 3DM0A 2Q8JA 4YMBA 1R6ZA 4O94A 3A3UA 3UK4A 2XXPA 5K2XA 5I2NB 2I6EA 3CSBA 3TTMA 1LB9A 3ILTB 1IXCA 1D9VA 3H6WA 1FQDA 1L5TA 4PGNA
chains in the Genus database with same CATH topology
4MCOA 5JK4A 1FRPA 3KC1A 4P3LA 4PFIA 1KA0A 4JVDA 4X04A 4HXVA 3KBZA 4HE0A 2PFYA 5IZZA 4NAPA 4OANA 4PDDA 1DK4A 2BJIA 2QFLA 2V3QA 1K9ZA 4P47A 1IMBA 1K9YA 2B4LA 2FHYA 5ET7A 2CZKA 5IZ3A 2WX9A 2XXKA 4MJOA 5EYGA 4XF5A 1FPLA 2PFZA 5IM2A 4NN3A 2VPOA 2ZZVA 2FIXA 3IFAA 4GX3A 4HCYA 4NX1A 4PDHA 2ZZXA 1YZ0A 4P9KA 2VT5A 4O7IA 3MSTA 5ET8A 2CZHA 1NV6A 5IGAA 1VDWA 2MKZA 3PTYA 4GX6A 4I40A 2WEFA 4MHFA 1FJ6A 4OVPA 4MMPA 5J1DA 1IMCA 3LUZA 4GWXA 2KR0A 4PCDA 1FSAA 2HXRA 2XWOA 2Q74A 4GWUA 4GWWA 3QMFA 1FPKA 4GWSA 1FPFA 3ISPA 4HE1A 3FXBA 4MNCA 4GX4A 1LBVA 4N6DA 4PF6A 2VPNA 3MYUA 1NUYA 2P3NA 5LTCA 3D1RA 4XEQA 4I3EA 5A5LA 3BIGA 2DVZA 2B4MA 2WYKA 1EYIA 4O7MA 4DI4B 3RYDA 3RPLB 5J16A 3NOHA 4N15A 1G0IA 1SPIA 4H45A 3W9WA 1FTAA 3E78A 4PETA 4N17A 2CZIA 2F5XA 2WYPA 4I3YA 1IMFA 4QBAA 2CEXA 4HCWA 2HHMA 3GYYA 4M1VA 4P8BA 1D9QA 4PF8A 1G0HA 3W9VA 5FBPA 4NQ8A 5ESYA 1NV3A 4MAGA 5EQAA 3CHGA 1NUWA 1NV2A 1IMDA 1FPBA 2XWVA 3BIHA 2GQ1A 2F3BA 3B8BA 4NGUA 2OX3A 1NV4A 1IMEA 4PFRA 2HZLA 1LBXA 1FPEA 2QVVA 4N8YA 4PAIA 4QXDA 1LBZA 2Y5LA 4NG7A 4OVRA 2V4CA 2HPGA 4N6KA 4YZZA 5IZ1A 3RPLA 2QPQA 4NF0A 5T3JA 2DE3A 4IR8A 1CNQA 5ET6A 5I5PA 1FBGA 5DW8A 2CEYA 3HFUA 4PFBA 4P1EA 4KXPA 5I3SA 2QVUA 1FBPA 1NV5A 2DE2A 4MEVA 3EKIA 4PC9A 4XFEA 5EYHA 1DCUA 1FPJA 1AWBA 4F1UA 4MX6A 4N81A 4AS4A 1EYKA 1KA1A 3U65A 2HZKA 4NHBA 4PAKA 3T1BA 4X9TA 4OVSA 1FBDA 2FBPA 4X8RA 5LDZA 4N4UA 4O8MA 2WBBA 4JVIA 4UABA 5IZ3B 3T0JA 3B50A 4PGPA 2JJKA 4GBWA 4MIJA 4MNPA 1Q9DA 1FBHA 2ZZWA 3LV0A 4PBHA 3KC0A 2OWZA 4JVCA 1RDZA 4N91A 4HE2A 1INPA 4OVTA 4G61A 1RDXA 4FBPA 4MNIA 2Q8MA 4F1VA 1FPGA 4OA4A 4YICA 1RDYA 2FVZA 2PCRA 1LEVA 1NV0A 1FBEA 1EYJA 1NI9A 2P3VA 3A29A 4N8GA 4P56A 1LBYA 2QVRA 4H46A 1IMAA 1FPDA 4P1LA 1FPIA 4GWZA 4O94A 1QGXA 2WBDA 4DI3D 4OVQA 1NUZA 5I7IA 2DE4A 1FJ9A 2F3DA 3IFCA 4LN5A 1YYZA 4F18A 2Q9TA 1BK4A 1JP4A 2FIEA 1XI6A 2KQZA 2R8TA 1NV1A 1LBWA 2XWKA 2DDKA 2Y5KA 4PAFA 5EQ8A 5F24A 2XA5A 1DBZA 1FBCA 1FBFA 1KZ8A 4PTKA 2L5VA 4GBVA 3ROJA 5CM6A 3SZPA 1NUXA 4F19A 2XWIA 4PBQA 5EQ9A 5ET5A 1YXIA 4PE3A 4GWYA 3FBPA 5EQ7A 1NV7A 3E79A 4AS5A 4PGNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MCO A;  4P3L A;  4X04 A;  2PFY A;  5IZZ A;  4NAP A;  4OAN A;  4PDD A;  4P47 A;  2WX9 A;  2XXK A;  4XF5 A;  2PFZ A;  5IM2 A;  4NN3 A;  2VPO A;  2ZZV A;  4PDH A;  4NX1 A;  2ZZX A;  4P9K A;  5IGA A;  4MHF A;  4OVP A;  4MMP A;  4PCD A;  2XWO A;  4MNC A;  4PFI A;  3FXB A;  4PF6 A;  4N6D A;  2VPN A;  5LTC A;  4XEQ A;  2WYK A;  4O7M A;  4DI4 B;  4N15 A;  4PET A;  4N17 A;  2WYP A;  2CEX A;  3GYY A;  4P8B A;  4PF8 A;  4NQ8 A;  4MAG A;  2XWV A;  4NGU A;  4PFR A;  2HZL A;  4PAI A;  4N8Y A;  4NG7 A;  4OVR A;  4YZZ A;  2V4C A;  2HPG A;  4N6K A;  4NF0 A;  5I5P A;  2CEY A;  4PFB A;  4P1E A;  4PC9 A;  4MEV A;  4XFE A;  4MX6 A;  3U65 A;  2HZK A;  4NHB A;  4PAK A;  4OVS A;  4X8R A;  4N4U A;  4O8M A;  4UAB A;  3B50 A;  4PGP A;  4MIJ A;  4MNP A;  2ZZW A;  4PBH A;  4N91 A;  4OVT A;  4MNI A;  4OA4 A;  4YIC A;  4N8G A;  5CM6 A;  4P56 A;  4P1L A;  4O94 A;  4DI3 D;  4OVQ A;  5I7I A;  4LN5 A;  4PAF A;  2XWK A;  2XA5 A;  2XWI A;  4PBQ A;  4PE3 A;  4PGN A; 
#chains in the Genus database with same CATH topology
 1ZBM A;  2RF1 A;  4MLQ A;  4NF5 A;  5EYG A;  3G3K A;  1MS7 A;  3K6V A;  3PUX E;  1MXW A;  1B58 A;  5JTY B;  4U4X A;  5J1D A;  2X7P A;  1D9Y A;  3SEV A;  3C32 A;  4OYV A;  3KG2 A;  5FTI A;  3MVW A;  4QFO A;  1Y9U A;  4G8M A;  4I3Y A;  1IMF A;  1B3L A;  2RCA A;  3IOV A;  2Z22 A;  3TTK A;  1A8E A;  5EQA A;  3B6T A;  2O7I A;  3TFL A;  4BDL A;  3PU5 A;  1EZO A;  5T3J A;  4F29 A;  3C36 A;  5DW8 A;  3DEL B;  4BLA A;  4PC9 A;  2Q2A A;  3O2A A;  4G8H A;  2H9B A;  3UOR A;  2UVI A;  3FXR A;  4NHB A;  1FQA A;  4MIJ A;  4JSO A;  2O69 A;  4MNP A;  2GHA A;  3FJG A;  1FBH A;  1NNP A;  3S9E A;  4G61 A;  5ITO A;  4DXB A;  4R2B A;  4OFO A;  4QRZ A;  3FXU A;  2WBD A;  3GXA A;  4DCX A;  3H3G A;  2DDK A;  3LSL A;  1DBZ A;  4ZZA A;  4GRK A;  5I58 B;  3VVD A;  3RY3 A;  1PB8 A;  1IMB A;  2HAU A;  3KJT A;  4JXI A;  1URS A;  1N3W A;  3IAZ A;  1AH5 A;  5I57 B;  1SI1 A;  5DVJ A;  1LCF A;  1IXG A;  2O84 X;  5JTY A;  4GX6 A;  2QRY A;  4GWU A;  3I5O A;  1P1N A;  2V3U A;  4EUO A;  4O7M A;  4JBZ A;  4KQP A;  3R6U A;  4GF8 A;  2I4B A;  2RCB A;  2DWA A;  4K3F A;  1JW1 A;  2HHM A;  2F8D A;  2UYE A;  1P1Q A;  1N7W A;  4XTC Q;  3B8B A;  3Q27 A;  4Q0C A;  2OCU A;  2OX3 A;  5H8H A;  3U92 A;  2PYY A;  1FPE A;  2ZYO A;  3PUW E;  1ZLQ A;  5I84 A;  3EQ1 A;  4AS4 A;  3S9L C;  4PFU A;  2UVG A;  1S7Y A;  3UGW A;  2JJK A;  2QL3 A;  1Y3P A;  5BWJ A;  2AIX A;  1RDZ A;  4LZ8 A;  3KFM A;  1URG A;  3W15 C;  2H4I A;  1FPI A;  1QGX A;  2O1L A;  2Z8D A;  4UA8 A;  1NNK A;  4FEB A;  1LBW A;  5I2K A;  3MVY A;  1DPE A;  2P0S A;  1NUX A;  3CVG A;  3IO6 A;  2ZNS A;  4TLM B;  4IB2 A;  3RTF B;  4NF8 A;  3JV9 A;  1FRP A;  5CRY A;  4X04 A;  4JVD A;  5L9M A;  4H1X A;  3PD8 A;  4NAP A;  1K9Y A;  3HPI A;  5ET7 A;  4I8C A;  1FPL A;  4JWY A;  4NN3 A;  3SDF A;  2ZZV A;  2FIX A;  4NMY A;  5H8Q B;  1VR5 A;  2RC7 A;  2ZZX A;  4XKP A;  2WEF A;  3FD3 A;  4OVJ A;  2XWO A;  2RC8 A;  3TCF A;  1FPF A;  3FXB A;  4O3C A;  4O3B A;  3SEU A;  3W9W A;  3FXQ A;  4YKI A;  3RQT A;  2F5X A;  4RPO A;  1H43 A;  4EDP A;  1G0H A;  1JVX A;  4MAG A;  1NV2 A;  4OET A;  3RNN A;  2XXR A;  1N04 A;  1WOD A;  4ZDM A;  4EF1 A;  1IME A;  4PAI A;  5A5X B;  4N8Y A;  4RK2 A;  3TPA A;  2I3V A;  4YZZ A;  1P99 A;  2HPG A;  4YKP A;  2ANJ A;  4ZZE A;  4TOZ A;  4JSD A;  1Y3N A;  4RPN A;  3O6G A;  3QSL A;  3C9H A;  2ZYK A;  5L9O A;  1KA1 A;  4E0W A;  2AYS A;  3TTL A;  2WBB A;  4JVI A;  2Y7I A;  1MXV A;  2Z8E A;  3OO8 A;  4PBH A;  4G68 C;  1ZMG A;  3FV1 A;  3QIM A;  1QW0 A;  3OOA A;  2A5T A;  3T9U A;  4OVQ A;  2DE4 A;  2F3D A;  4F18 A;  2XX7 A;  3PV0 E;  2ALU A;  3PUY E;  3LUY A;  1JQF A;  2V84 A;  4PBQ A;  4PE3 A;  1RYO A;  3HHF A;  3MC2 A;  3OO6 A;  2VOZ A;  5TPA B;  3KBR A;  4HXV A;  2A5T B;  3FVG A;  5H8H B;  2XHD A;  1LFG A;  3KSJ A;  3OXN A;  4LQ5 A;  1MQH A;  1MM7 A;  2F6P A;  2NUV A;  5H8S A;  3MW0 A;  3MST A;  5IGA A;  2MKZ A;  2CZL A;  5KDT A;  4ISU A;  2KR0 A;  2O7U A;  4OFJ A;  5ITP A;  4C1T A;  5TPA A;  4OQO A;  4PE5 B;  2OBG A;  4I3E A;  1B5I A;  3RPL B;  3BFT A;  3KN3 A;  3KEI A;  3E78 A;  3HO7 A;  2UXA A;  4YAH X;  3IJO B;  4KYE A;  4P8B A;  1B6H A;  1Y4C A;  4IO2 A;  4TQU Q;  4YB5 A;  3BIH A;  2GQ1 A;  4BDQ A;  4FIM A;  2XXI A;  1PBQ A;  1NV4 A;  3USD A;  5EYH A;  5IZ1 A;  3RPL A;  3D4G A;  2QPQ A;  1MXY A;  5I5P A;  3LSF B;  5CMM A;  2I0C A;  4FJP A;  1NKX A;  3B7D A;  5I3S A;  4RJZ A;  1DCU A;  2ZYN A;  2DSF A;  4MX6 A;  1YPN A;  4N81 A;  1FTO A;  4GVO A;  4OXV A;  1FBD A;  2FBP A;  4GD5 A;  2ZNT A;  3TCG A;  1MRP A;  5H8Q A;  4Q8R A;  1RDX A;  3G3H A;  1MQG A;  3PMV A;  2PT2 A;  4NF4 A;  4RXL A;  1N3X A;  3N6T A;  4R9G A;  3QUJ A;  2VD3 A;  3H4Z A;  2F7B A;  4PAF A;  3HHG A;  3LC8 A;  1B4H A;  3MPL A;  4H5G A;  3RT6 B;  1BTJ A;  3FGS A;  2DWI A;  1M5B A;  3G3G A;  3C31 A;  2QS2 A;  1B46 A;  5EYF A;  3M3F A;  3K6U A;  5FHM A;  4MF3 A;  2CZK A;  1USY E;  4G2Z A;  3TQL A;  1RKM A;  2H99 A;  5KDT B;  2WKY A;  4MHF A;  1P1O A;  1FTJ A;  1ELJ A;  3PUZ E;  3QK6 A;  3OEK A;  2Q88 A;  4PF6 A;  3KZG A;  3H03 A;  1LAG E;  3RYD A;  2D3I A;  1SD3 A;  1B7U A;  4R6Y A;  4Z7E A;  4U1Z A;  4PF8 A;  3PD9 A;  1FQC A;  1IMD A;  3E13 X;  2RC9 A;  1TWY A;  2HZL A;  2QVV A;  1MH3 A;  4BDN A;  3HST A;  4F3B A;  4THI A;  3UA8 A;  4ESW A;  4DXU A;  3RLF E;  1QKB A;  1MXU A;  3DP8 A;  5L8D A;  1LGB C;  1N84 A;  4PAK A;  1Z7N E;  2D5W A;  4KR5 A;  5FTH A;  2OWZ A;  3LR1 A;  2YLN A;  3ZS6 A;  3SEX A;  2FVZ A;  2PCR A;  2XX8 A;  2Y7P A;  1GGG A;  3VFJ A;  1NUZ A;  4ND9 A;  2R8T A;  3N6U A;  2I48 A;  1US5 A;  3T93 B;  4M4G A;  2XWI A;  1J1N A;  1P1W A;  3VLW A;  3SEW A;  1MPB A;  3QUF A;  3A09 A;  3E9X A;  3DP6 A;  1OQG A;  4F1Y A;  1CE2 A;  1Y1M A;  4HE0 A;  1M5D A;  4PDD A;  2V3Q A;  1QVS A;  4P0G A;  1B3G A;  2FA7 A;  4F3G A;  1UIU A;  4ZE8 A;  5F1Q A;  4ELR A;  4XF5 A;  3FAT A;  3RN8 A;  1PB7 A;  1OMP A;  2PT1 A;  4GL0 A;  1XHY A;  4OTE A;  2NWJ A;  1LBC A;  5A5L A;  4ZEI A;  4DI4 B;  5KCJ B;  1A55 A;  1G0I A;  1Y3Q A;  1B3H A;  3CI8 A;  3KN8 A;  5FHN A;  2NXO A;  3LSX A;  1FQE A;  2X7Q A;  1DSN A;  5ESY A;  3BFU A;  2QS3 A;  2F3B A;  2R6G E;  5TP9 A;  1B9J A;  4H8I A;  4QFL A;  5DEX B;  2GH9 A;  5IKB A;  1GTK A;  3KJ7 A;  5HBC A;  4OEV A;  1QUJ A;  4IR8 A;  1ZKB A;  4GOT A;  2Z23 A;  1Q35 A;  1JVY A;  3Q26 A;  4MEV A;  2Y7K A;  3EKI A;  3O97 A;  3OEN A;  2F7C A;  4QF9 A;  1A7L A;  1EYK A;  2R71 A;  4EQB A;  4PFT A;  4OVS A;  4DZ1 A;  1NMU A;  4PGP A;  3K6W A;  3Q28 A;  1SW1 A;  2Q89 A;  4N91 A;  3O9P A;  4ELO A;  3EHU A;  4NTL A;  2ZXT A;  5B70 A;  1LEV A;  1XC1 A;  3BKI B;  1QUL A;  4H46 A;  4X48 A;  1FJ9 A;  4R9F A;  1AOV A;  3SZP A;  5I2N A;  3FVK A;  1B0L A;  3E3K A;  5EQ9 A;  3CFX A;  3KC1 A;  1B3F A;  2F6G A;  1XS5 A;  2DVC A;  5I59 B;  1CB6 A;  4MJO A;  4MBP A;  2VT5 A;  1NV6 A;  4ZEK A;  1VDW A;  2F97 A;  4R6K A;  4OZ9 A;  3IL1 B;  3C35 A;  2HXR A;  1DTZ A;  3EHT A;  4P0I A;  4HE1 A;  4LZ7 A;  1VFD A;  4N6D A;  3D1R A;  3IB1 A;  5TP9 B;  4EXK A;  4FAT A;  1FTA A;  3FZV A;  1OLA A;  3TCH A;  4YB7 A;  3CG1 A;  3SET A;  4GIZ A;  4FOR A;  1FTK A;  1PEB A;  4AB6 A;  3IOR A;  3H6U A;  3C4M A;  4NG7 A;  3TEP A;  4N6K A;  1IEJ A;  4PFB A;  1AL3 A;  3K2D A;  4IGT A;  2DE2 A;  3IOT A;  3RPW A;  1B05 A;  5LDZ A;  4H6D A;  3K6X A;  2V25 A;  5AA2 B;  1UTH A;  1N76 A;  2Y84 A;  4JVC A;  3G3F A;  2OK2 A;  2CMO A;  1NI9 A;  2OJT A;  1LBY A;  4GWZ A;  4DI3 D;  5K2Y A;  2ZYM A;  2OWS A;  4OWD A;  1XI6 A;  4GQO A;  1Y4T A;  2XA5 A;  3GZG A;  1D3K A;  3IOU A;  1KA0 A;  5M2V A;  3Q25 A;  2ABH A;  4KCD A;  3JZJ A;  1JW5 A;  1MPC A;  2B4L A;  4ZED A;  3UN6 A;  4U1O A;  1DPP A;  4MMP A;  3LUZ A;  4GWX A;  4XKN A;  3THI A;  4MNC A;  1FPK A;  4LVQ A;  1NL5 A;  1MY0 A;  4XEQ A;  2B4M A;  4JWO A;  3FIR A;  4GXA A;  4N15 A;  3MPK A;  2XXX A;  3FJM A;  4IO6 A;  1GV8 A;  2AL5 A;  2PX1 A;  3OSR A;  4DDD A;  1FPB A;  1UTB A;  5JEI A;  2UYF A;  4I62 A;  3MQ9 A;  4KXP A;  3F11 A;  2UVH A;  1FPJ A;  4HS7 A;  3G3I A;  4ELP A;  3M3K A;  4O8M A;  4OMB A;  3TYH A;  2VHA A;  1MG1 A;  4FAJ A;  4U2R A;  4NF6 B;  3A29 A;  2DWH A;  4P1L A;  1A40 A;  2B3B A;  4LN5 A;  2F36 A;  5H8F A;  1PC3 A;  1KZ8 A;  3ROJ A;  2XXY A;  2AL4 A;  3N94 A;  2XD2 A;  5ET5 A;  3K1M A;  5EQ7 A;  1D4N A;  3FBP A;  1NV7 A;  4FE8 A;  3FJ7 A;  1B51 A;  1B5H A;  5IZZ A;  3S9N C;  3TQW A;  3OMB A;  1BKA A;  2H5Y A;  3H6T A;  4NX1 A;  5I57 A;  4P9K A;  2VP1 A;  1NH8 A;  5DVF A;  4GWS A;  2B65 A;  1SI0 A;  3Q29 A;  2VPN A;  4DLD A;  2E1S A;  2ONR A;  3MP6 A;  4R72 A;  5J16 A;  1MXZ A;  3FUZ A;  4GL8 A;  4N17 A;  1M5E A;  3CG3 A;  5I56 A;  3S9M C;  4QBA A;  4G77 A;  4PFY A;  3PPQ A;  5H8N A;  5ELV A;  1JEU A;  3OSQ A;  1PB9 A;  3K4U A;  4POW A;  1M5F A;  1JNF A;  3ZSF A;  1ZIU A;  3I6V A;  4TLL B;  1OIB A;  3R26 A;  5DEX A;  3FAS A;  1O7T A;  5ICT A;  3T66 A;  1HSL A;  2VD2 A;  4XKQ A;  1FBP A;  1N0T A;  5CI5 A;  3V8X B;  4U22 A;  3U65 A;  1MY3 A;  2HZK A;  3IO4 A;  3HN0 A;  2FNC A;  2O68 A;  4GBW A;  4RK9 A;  2H25 A;  3N26 A;  3RT8 A;  5I58 A;  1RDY A;  4N8G A;  2H98 A;  4H0W A;  4EQ9 A;  4FED A;  4E0X A;  3KGC A;  5I7I A;  1UIV A;  1XVX A;  2YPN A;  2LAO A;  5F24 A;  1FBF A;  4LQ2 A;  1TT1 A;  3VXC A;  3VV5 A;  1OLC A;  1O64 A;  2GHB A;  3H06 B;  3TUS A;  3O6I A;  4U21 A;  4F3P A;  1B4Z A;  4ZS9 A;  2BJI A;  4POX A;  5KCJ A;  4XXU A;  1YAE A;  2FHY A;  4NE4 A;  1MY4 A;  1IZ1 A;  5H8F B;  3CFL A;  2PFZ A;  1S9T A;  2DS9 A;  2DWJ A;  3CR9 A;  1IMC A;  1IIW A;  1B3E A;  1YCJ A;  1LST A;  3PPO A;  2Q74 A;  4IO5 A;  4QSC A;  3QMF A;  4ELQ A;  2O1M A;  2ZMB A;  5LTC A;  3G3J A;  4UAC A;  4OEN A;  4YU0 A;  2CEX A;  2ZNU A;  3U72 A;  3K1N A;  3OO7 A;  1MDP 1;  2A5S A;  3U1O A;  3V89 B;  1MXX A;  1XOC A;  3DLN A;  1T0K A;  4QXD A;  4Q30 B;  2Y5L A;  4U4S A;  3TKD A;  3IB2 A;  1CNQ A;  2CEY A;  1IXI A;  1AMF A;  1B5J A;  1M5C A;  4PP0 A;  1HSJ A;  4GWO A;  1Q1K A;  1LFH A;  3G7W A;  4QFP A;  1R1N A;  3CRB A;  1INP A;  4FBP A;  4WEP A;  1BP5 A;  1ATG A;  3ZKK A;  5CMC A;  1LAF E;  2P3V A;  1IMA A;  1SVX B;  3GLB A;  1UTH B;  3C34 A;  1AIV A;  3FVN A;  1R9L A;  3PPP A;  5DYH A;  1NNT A;  4GBV A;  3OEL A;  2HQ0 A;  3HCQ A;  2QS1 A;  1SBP A;  3MZ9 A;  4NF5 B;  3AXF A;  4P3L A;  1URD A;  2W7Y A;  3RUM A;  2ONK E;  1Y20 A;  4OAN A;  3IJX B;  4F31 B;  4NWC A;  2WX9 A;  3ODB A;  5AA2 A;  4ZEB A;  4PDH A;  3MP8 A;  2Y7R A;  3K02 A;  3HV1 A;  4I40 A;  2HCA A;  2I58 A;  1FW0 A;  4R75 A;  2NOO A;  1NUY A;  2P3N A;  4C1U A;  3KOT A;  3SES A;  5EHM A;  4EF2 A;  4PFW A;  1D9Q A;  3W9V A;  2F35 A;  1JW4 A;  3VLV A;  2UVJ A;  3M3L A;  1LAX A;  1BLF A;  3TEL A;  5DT6 A;  4F2Q A;  5IAI A;  1LBZ A;  4GLI A;  4NF0 A;  3O6H A;  2I4C A;  2F34 A;  1NV5 A;  1JET A;  3U8Q A;  4EXL A;  2F78 A;  4F1U A;  3MVX A;  2DXR A;  1B1X A;  3QAX A;  3VVE A;  1FTM A;  4H67 A;  3LV0 A;  2ZZW A;  1R9Q A;  3MP1 A;  4QFK A;  4MNI A;  2OLB A;  1I69 A;  3D4C A;  1O63 A;  3WAE A;  3I3V A;  2O6A A;  1FBE A;  4P56 A;  1B2H A;  2PBW A;  2QSX A;  4KD5 A;  1UTB B;  5AA1 A;  3OD7 A;  1VE4 A;  2HAV A;  2Q9T A;  1JP4 A;  1Z7M E;  2KQZ A;  5CMK A;  5B7D A;  4NWD A;  4NED A;  4ONY A;  2L5V A;  2D21 A;  2XXT A;  1YXI A;  2R9J A;  4AQ4 A;  5EHS A;  1EZ9 A;  3PMW A;  3FV2 A;  1H3D A;  2QMX A;  2QFL A;  1USY H;  4QSE A;  3E4R A;  2I49 A;  2XXK A;  5A5X A;  3K01 A;  3UIF A;  5I2K B;  5CC2 A;  3TMG A;  4HCY A;  4QFN A;  2QMW A;  1A54 A;  1NH7 A;  1HSE A;  4H65 A;  4NF8 B;  4GX4 A;  4G4P A;  4LAT A;  3MYU A;  3SKP A;  4Z0I A;  2GRV A;  4PET A;  5L9S A;  4LZ5 A;  4MH5 A;  4ESX A;  3PUV E;  3H6V A;  2V93 A;  3GYY A;  3RTW B;  2DXY A;  1MQJ A;  3A3C A;  2V3T A;  4QSD A;  4OVR A;  1MDQ A;  4DE8 A;  1IQ7 A;  3HFU A;  5TU0 A;  3C33 A;  4YKJ A;  4ZE9 A;  1PBP A;  3EPE A;  3T1B A;  1MY1 A;  1LAH E;  4F2O A;  5IZ3 B;  4C0R A;  4DIG A;  5CBR A;  2ESN A;  4IY6 A;  1RYX A;  4ZEF A;  4R73 A;  3L6G A;  1EYJ A;  2THI A;  2QVR A;  2XXV A;  4RA1 A;  1EZP A;  4I9D A;  1QJM A;  1SDX A;  2KLF A;  2O51 A;  4H8J A;  4IGR A;  5AE4 A;  4RY1 A;  4HW8 A;  1BIY A;  4OES A;  2I0B A;  4GWY A;  1POT A;  2DQV A;  3FVO A;  1SW2 A;  4AS5 A;  1N7X A;  3KBZ A;  4X1B A;  4AB5 A;  5AA4 B;  2Q2C A;  5CBS A;  4WXJ A;  3OO9 A;  3ECR A;  4BDM A;  5IM2 A;  4PQJ A;  4GX3 A;  4OVP A;  4IO3 A;  3P7I A;  4U23 A;  1NNF A;  3ONM A;  4PFI A;  3ISP A;  1QUK A;  5HPQ A;  3TTR A;  2P2A A;  4N13 A;  1EYI A;  2HXW A;  3TTN A;  1NFT A;  2I3W A;  1I6B A;  4HCW A;  1F9B A;  5FBP A;  4NQ8 A;  4ECF A;  1IUD A;  4KYS A;  1SYI A;  4PFR A;  4FEC A;  4X1D A;  4YMA A;  2YJP A;  4F22 A;  1YTV A;  1SW5 A;  2XD3 A;  5F7V A;  4MFI A;  1MQD A;  4N07 A;  3PPR A;  3O29 A;  4GFR A;  3GBA A;  1S50 A;  1GR2 A;  4KHZ E;  3R7X A;  2QJE A;  3L6H A;  1FPD A;  2IEE A;  2RKM A;  4Q5T A;  3EHS A;  5ISU A;  1MM6 A;  3T22 A;  2XWK A;  5EQ8 A;  2Y5K A;  3PMX A;  3JYR A;  3VE1 B;  3H7M A;  3RGY A;  1TFA A;  4MCO A;  1ANF A;  3CIJ A;  3PPN A;  1KWH A;  1QUI A;  1DK4 A;  1LBB A;  1B40 A;  4LUB A;  1Y1Z A;  3PGF A;  4O7I A;  1II5 A;  5I56 B;  2HFB A;  4NF4 B;  3S2V A;  2BJJ X;  3VVF A;  4R2F A;  5AA3 A;  4GWW A;  4JDF A;  1DOT A;  3QXM A;  4G68 B;  2DVZ A;  3EF7 A;  3K0V A;  3TZA A;  3NOH A;  1UQW A;  3IB0 A;  4XIG Q;  3T9X B;  5H8N B;  2DOJ A;  2REG A;  2PMS A;  2G93 A;  5KZT A;  1MY2 A;  1LB8 A;  2XXW A;  1EU8 A;  4OHN A;  1FCK A;  4IO4 A;  1VFE A;  4R6H A;  4QHQ A;  2V4C A;  4WKM A;  3LBS A;  4DXC A;  4RYA A;  3VLU A;  1PDA A;  1OVT A;  2PVU A;  4I1D A;  4N4U A;  1MH4 A;  3B50 A;  4RNS A;  4HE2 A;  1FPG A;  5CM6 A;  3O28 A;  1XT8 A;  2ONS A;  3MZB A;  1B32 A;  3KSX A;  4G68 A;  3IFC A;  1YYZ A;  1BK4 A;  1JEV A;  1NV1 A;  2OZZ A;  1SYH A;  1I6A A;  1FBC A;  4PTK A;  4IY5 A;  4H5F A;  1LFI A;  5LOM A;  3S4U A;  3B6Q A;  1US4 A;  4R74 A;  1H44 A;  1POY 1;  4OER A;  4P47 A;  2IA4 A;  3ILU B;  3IFA A;  4F39 A;  3U93 A;  1YZ0 A;  5ET8 A;  2CZH A;  4XKR A;  1SW4 A;  3PTY A;  4KYD A;  3T9V A;  1MQI A;  4PCD A;  3U94 A;  2E0S A;  4BDO A;  1LBV A;  5AA2 D;  3OEM A;  3BIG A;  1GVC A;  3T96 B;  2WYK A;  2B3F A;  2QS4 A;  4KCC A;  1SPI A;  5FHO A;  4G8N A;  4KFQ A;  1OQH A;  1NV3 A;  3CHG A;  1NUW A;  3UP9 A;  1WDN A;  2XWV A;  4GXS B;  1A99 A;  2GFE A;  1B7Z A;  4N6P A;  2M8C A;  4KI0 E;  1MPD A;  1B52 A;  1ZJL A;  4BDR A;  2FYI A;  1OVB A;  4P1E A;  4MLV A;  1H76 A;  1IIT A;  4IO7 A;  2OWT A;  1TXF A;  2XXQ A;  3VDF A;  2XXU A;  4LP2 B;  1EH3 A;  4X9T A;  3MUQ A;  4X8R A;  3DP4 A;  3MVZ A;  4UAB A;  2Y7W A;  2RIN A;  4WED A;  3BBR A;  3K1P A;  3IR1 A;  5HM4 B;  1Q9D A;  1WVJ A;  2P1S A;  3N5L A;  1QKA A;  5ICQ A;  3MZ1 A;  2Q8M A;  4F1V A;  4OA4 A;  1B7H A;  4YIC A;  1NV0 A;  3GBB A;  3T9H B;  1A8F A;  4YKK A;  2NVU B;  2F7A A;  2FIE A;  2G29 A;  3IX1 A;  3SEY A;  4YB6 A;  3O66 A;  4F19 A;  4EQ7 A;  3B6W A;  1B1H A;  3E79 A;  3EN3 A;  5BUU A;  5JK4 A;  1SQY A;  3CSG A;  2PFY A;  4DCY A;  5I59 A;  3TDJ A;  3VXB A;  1K9Z A;  5AA4 A;  5IZ3 A;  4P11 A;  1ZU0 A;  3IK6 B;  3ZKL A;  1FQB A;  4L17 A;  1FTL A;  2VPO A;  3CFZ A;  3K00 A;  3M8U A;  1LCT A;  4JB7 A;  3QYT A;  1FJ6 A;  4OFL A;  1FSA A;  3KN7 A;  5DVI A;  3SER A;  1LLS A;  2Z8F A;  4ZEC A;  3V5A A;  2XXH A;  3MJN A;  2HEU A;  4H45 A;  1FQF A;  5CMB A;  2CZI A;  1VSO A;  2WYP A;  4LA9 A;  2DP8 A;  4LON B;  4M1V A;  3MAM A;  1ZTY A;  4OEU A;  1P1U A;  1IXH A;  1XVY A;  4NGU A;  1H45 A;  4F3S A;  3TOD A;  1LBX A;  1I6Q A;  2XX9 A;  2DE3 A;  3KOS A;  5ET6 A;  1FBG A;  2X26 A;  3MWB A;  4NF6 A;  3V83 A;  4KPT A;  2QVU A;  2VGQ A;  3IOW A;  4XFE A;  1AWB A;  3LSW A;  1DMB A;  2REJ A;  4HTG A;  1TFD A;  1B0H A;  3T0J A;  3TAJ A;  3WAF A;  1DTG A;  4O3A A;  3KC0 A;  5DTB A;  4JWX A;  4OVT A;  3MBP A;  2DYX A;  3DM0 A;  2Q8J A;  4YMB A;  1R6Z A;  4O94 A;  3A3U A;  3UK4 A;  2XXP A;  5K2X A;  5I2N B;  2I6E A;  3CSB A;  3TTM A;  1LB9 A;  3ILT B;  1IXC A;  1D9V A;  3H6W A;  1FQD A;  1L5T A;  4PGN A; 
#chains in the Genus database with same CATH homology
 4MCO A;  5JK4 A;  1FRP A;  3KC1 A;  4P3L A;  4PFI A;  1KA0 A;  4JVD A;  4X04 A;  4HXV A;  3KBZ A;  4HE0 A;  2PFY A;  5IZZ A;  4NAP A;  4OAN A;  4PDD A;  1DK4 A;  2BJI A;  2QFL A;  2V3Q A;  1K9Z A;  4P47 A;  1IMB A;  1K9Y A;  2B4L A;  2FHY A;  5ET7 A;  2CZK A;  5IZ3 A;  2WX9 A;  2XXK A;  4MJO A;  5EYG A;  4XF5 A;  1FPL A;  2PFZ A;  5IM2 A;  4NN3 A;  2VPO A;  2ZZV A;  2FIX A;  3IFA A;  4GX3 A;  4HCY A;  4NX1 A;  4PDH A;  2ZZX A;  1YZ0 A;  4P9K A;  2VT5 A;  4O7I A;  3MST A;  5ET8 A;  2CZH A;  1NV6 A;  5IGA A;  1VDW A;  2MKZ A;  3PTY A;  4GX6 A;  4I40 A;  2WEF A;  4MHF A;  1FJ6 A;  4OVP A;  4MMP A;  5J1D A;  1IMC A;  3LUZ A;  4GWX A;  2KR0 A;  4PCD A;  1FSA A;  2HXR A;  2XWO A;  2Q74 A;  4GWU A;  4GWW A;  3QMF A;  1FPK A;  4GWS A;  1FPF A;  3ISP A;  4HE1 A;  3FXB A;  4MNC A;  4GX4 A;  1LBV A;  4N6D A;  4PF6 A;  2VPN A;  3MYU A;  1NUY A;  2P3N A;  5LTC A;  3D1R A;  4XEQ A;  4I3E A;  5A5L A;  3BIG A;  2DVZ A;  2B4M A;  2WYK A;  1EYI A;  4O7M A;  4DI4 B;  3RYD A;  3RPL B;  5J16 A;  3NOH A;  4N15 A;  1G0I A;  1SPI A;  4H45 A;  3W9W A;  1FTA A;  3E78 A;  4PET A;  4N17 A;  2CZI A;  2F5X A;  2WYP A;  4I3Y A;  1IMF A;  4QBA A;  2CEX A;  4HCW A;  2HHM A;  3GYY A;  4M1V A;  4P8B A;  1D9Q A;  4PF8 A;  1G0H A;  3W9V A;  5FBP A;  4NQ8 A;  5ESY A;  1NV3 A;  4MAG A;  5EQA A;  3CHG A;  1NUW A;  1NV2 A;  1IMD A;  1FPB A;  2XWV A;  3BIH A;  2GQ1 A;  2F3B A;  3B8B A;  4NGU A;  2OX3 A;  1NV4 A;  1IME A;  4PFR A;  2HZL A;  1LBX A;  1FPE A;  2QVV A;  4N8Y A;  4PAI A;  4QXD A;  1LBZ A;  2Y5L A;  4NG7 A;  4OVR A;  2V4C A;  2HPG A;  4N6K A;  4YZZ A;  5IZ1 A;  3RPL A;  2QPQ A;  4NF0 A;  5T3J A;  2DE3 A;  4IR8 A;  1CNQ A;  5ET6 A;  5I5P A;  1FBG A;  5DW8 A;  2CEY A;  3HFU A;  4PFB A;  4P1E A;  4KXP A;  5I3S A;  2QVU A;  1FBP A;  1NV5 A;  2DE2 A;  4MEV A;  3EKI A;  4PC9 A;  4XFE A;  5EYH A;  1DCU A;  1FPJ A;  1AWB A;  4F1U A;  4MX6 A;  4N81 A;  4AS4 A;  1EYK A;  1KA1 A;  3U65 A;  2HZK A;  4NHB A;  4PAK A;  3T1B A;  4X9T A;  4OVS A;  1FBD A;  2FBP A;  4X8R A;  5LDZ A;  4N4U A;  4O8M A;  2WBB A;  4JVI A;  4UAB A;  5IZ3 B;  3T0J A;  3B50 A;  4PGP A;  2JJK A;  4GBW A;  4MIJ A;  4MNP A;  1Q9D A;  1FBH A;  2ZZW A;  3LV0 A;  4PBH A;  3KC0 A;  2OWZ A;  4JVC A;  1RDZ A;  4N91 A;  4HE2 A;  1INP A;  4OVT A;  4G61 A;  1RDX A;  4FBP A;  4MNI A;  2Q8M A;  4F1V A;  1FPG A;  4OA4 A;  4YIC A;  1RDY A;  2FVZ A;  2PCR A;  1LEV A;  1NV0 A;  1FBE A;  1EYJ A;  1NI9 A;  2P3V A;  3A29 A;  4N8G A;  4P56 A;  1LBY A;  2QVR A;  4H46 A;  1IMA A;  1FPD A;  4P1L A;  1FPI A;  4GWZ A;  4O94 A;  1QGX A;  2WBD A;  4DI3 D;  4OVQ A;  1NUZ A;  5I7I A;  2DE4 A;  1FJ9 A;  2F3D A;  3IFC A;  4LN5 A;  1YYZ A;  4F18 A;  2Q9T A;  1BK4 A;  1JP4 A;  2FIE A;  1XI6 A;  2KQZ A;  2R8T A;  1NV1 A;  1LBW A;  2XWK A;  2DDK A;  2Y5K A;  4PAF A;  5EQ8 A;  5F24 A;  2XA5 A;  1DBZ A;  1FBC A;  1FBF A;  1KZ8 A;  4PTK A;  2L5V A;  4GBV A;  3ROJ A;  5CM6 A;  3SZP A;  1NUX A;  4F19 A;  2XWI A;  4PBQ A;  5EQ9 A;  5ET5 A;  1YXI A;  4PE3 A;  4GWY A;  3FBP A;  5EQ7 A;  1NV7 A;  3E79 A;  4AS5 A;  4PGN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...