4UABA

Crystal structure of a trap periplasmic solute binding protein from chromohalobacter salexigens dsm 3043 (csal_0678), target efi-501078, with bound ethanolamine
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
315
structure length
315
Chain Sequence
TIKWRMQTYAGAALAEHVAKPAIDLFNRIAGDRMQIELYSADQLVPTGELFRAMQRGTIDAVQSDDDSMASPTEVTVFGGYFPFGCRYSLDVPVLFNQYGLKEIWEEEYAKVGVKHVSAGAWDPCHFATKEPIRSLKDLEGKRVFTFPTAGRFLSRFGVVPVTLPWEDIEVALQTGELDGIAWSGITEDYTVGWANVTNYFLTNNISGAWIGHFFVNMERWEELPEDLRLLFEVCCEQSHYHRQYWYWGGEARLRVHGDKLELTSIPDAEWDQVETAAQEFWDEIAAQSETKAKVVEIFKQYNADMRKAGRPYRY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Experimental strategies for functional annotation and metabolism discovery: targeted screening of solute binding proteins and unbiased panning of metabolomes.
pubmed doi rcsb
source organism Chromohalobacter salexigens
molecule tags Transport protein
molecule keywords Twin-arginine translocation pathway signal
total genus 116
structure length 315
sequence length 315
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4uabA00
4P3LA 4XFEA 4P56A 4OVQA 4XF5A 2VPNA 4NGUA 4OA4A 4N6KA 3FXBA 2XWIA 4NG7A 4NN3A 3B50A 4MEVA 4NF0A 4O8MA 4P47A 4PAKA 2WYKA 2VPOA 4N8YA 2XWVA 4N6DA 4P1LA 2ZZXA 4PDHA 4N15A 4PGNA 4UABA 4MX6A 4O94A 2PFYA 5CM6A 4OANA 4P8BA 4PFIA 4X8RA 2CEYA 4PFRA 4PAFA 4MAGA 4MCOA 4PCDA 4OVPA 4NAPA 4MIJA 4MMPA 4XEQA 2XA5A 4PETA 2HZLA 4O7MA 4OVTA 4PBQA 4PFBA 5LTCA 3GYYA 4MNIA 5IZZA 2CEXA 2HZKA 4PDDA 4N4UA 4PE3A 4YZZA 5I5PA 4PF8A 4N17A 3U65A 4DI3D 2WX9A 2ZZWA 4DI4B 4NQ8A 4P1EA 2XWKA 4NX1A 2XWOA 2HPGA 4NHBA 2XXKA 2ZZVA 4OVRA 2V4CA 4LN5A 4X04A 5I7IA 4P9KA 4MHFA 4PAIA 4PBHA 4PF6A 5IGAA 2WYPA 4N91A 4YICA 4PGPA 2PFZA 4PC9A 4MNPA 4OVSA 4N8GA 4MNCA 5IM2A
chains in the Genus database with same CATH superfamily
1Y20A 4WXJA 2WBDA 4G68B 1KA0A 3TKDA 2Q8JA 3E9XA 3H7MA 2GH9A 4MEVA 2VOZA 4R6HA 2I4CA 1WODA 2WYKA 1ZBMA 1NNTA 3E13X 2ZZXA 1MXYA 3OO9A 5CM6A 4GL0A 1DK4A 3Q27A 1B5JA 4MCOA 3ODBA 4OVPA 3UN6A 1VFEA 1ZIUA 2XXWA 3LBSA 1MDP1 3HV1A 3CG3A 4GLIA 4GFRA 3F11A 3CFXA 2R8TA 1DTGA 1H3DA 5CBRA 1XS5A 3VVEA 3SEXA 2PT1A 2HFBA 1MQDA 1XVXA 4L17A 2XXTA 1RYOA 3M3KA 2H5YA 1PB9A 1QKAA 2H25A 5H8HA 2V4CA 2H9BA 4YB6A 4Z7EA 3O6HA 3PU5A 3C34A 3MPLA 5CI5A 4FIMA 2ALUA 3W15C 2Y5LA 3FXQA 4PQJA 4N91A 4HW8A 1TWYA 2PFZA 4E0XA 1MQJA 3MVZA 1NKXA 4GWWA 4HTGA 4XKPA 1MY0A 3T93B 2QVUA 3C36A 4UA8A 4XFEA 2V3TA 4MLQA 3K6VA 1URGA 3VFJA 3IORA 2KR0A 1RDYA 3A29A 1URSA 2UVIA 2Q9TA 1US5A 1YCJA 2VGQA 3LV0A 4MF3A 3V83A 1AH5A 4U1OA 1N76A 3PMVA 1N3XA 4EF2A 3LSWA 1K9YA 4YKPA 3BIHA 1NFTA 4MAGA 3PUWE 1B7UA 4EXLA 1KWHA 2E1SA 2OWTA 3A3UA 3RPLB 3W9VA 1H45A 4PBQA 1FPLA 2XXPA 2FYIA 4C0RA 4OHNA 2XXVA 3D4CA 1FW0A 3KZGA 3IOUA 4NF5B 5KDTA 3O6IA 2HZKA 3O9PA 4EUOA 2P3VA 1Q35A 5B70A 4FE8A 1BIYA 5L8DA 2O7UA 4DI3D 1LBCA 3VVDA 3T9UA 4AS4A 2FNCA 3PD8A 1AIVA 3BFUA 4I3EA 3P7IA 4KYSA 3MUQA 3Q29A 2ANJA 3PUZE 4LN5A 3DP6A 3TODA 1OVTA 1LBXA 1Y3PA 1UTBA 3FVGA 1NI9A 5I59B 4XF5A 1I6BA 4H8JA 5AA2D 4RNSA 4N6KA 1Q9DA 2I0CA 1CB6A 2Z23A 4ZEDA 4PAKA 2IEEA 2RKMA 2VPOA 3FIRA 2XWVA 4M1VA 4PGNA 4YKKA 4QSCA 4OANA 3PPRA 3ISPA 1B6HA 1SDXA 4PFRA 3DP4A 3S9MC 2XXHA 2P0SA 4PAFA 4R75A 4KR5A 4R6YA 2DS9A 4ELQA 5I57B 1FTOA 3FD3A 1UQWA 3KJTA 4O7MA 3C32A 3G3FA 4X1BA 1J1NA 2ZYNA 5IZZA 1VDWA 4AB6A 2F7BA 4ESWA 1NV7A 4N4UA 5CBSA 1OVBA 3NOHA 3ONMA 3O29A 2QMXA 3FBPA 3RY3A 1JW5A 4R9FA 4H1XA 4R6KA 3IJOB 1IEJA 2F34A 4M4GA 4DI4B 5CMCA 4LUBA 5L9OA 3QXMA 1ZMGA 3SEVA 2I58A 3OSRA 5I2NB 4YMBA 1B32A 3DM0A 2OJTA 3S9NC 3S9LC 4JWOA 3KOTA 3ILUB 1PBQA 1EZ9A 3UK4A 4N6PA 4YMAA 3SZPA 3BFTA 3RTFB 3RTWB 3FV2A 1KA1A 4PBHA 4PF6A 3U1OA 4H65A 3HSTA 4OVSA 4DCYA 1NUXA 3SKPA 2PYYA 1DSNA 1US4A 4RK9A 1DPPA 2AL5A 3MZ1A 2M8CA 2G93A 4FATA 1M5BA 3FVKA 3GBBA 5CC2A 1NV3A 3TCHA 4GWSA 4LP2B 5EQ8A 2DXYA 3I6VA 4F1YA 5LOMA 1B05A 3B7DA 4U4SA 1NV2A 2RCBA 4O3AA 2OZZA 1OQHA 1S9TA 4I9DA 5HM4B 1P1UA 1JNFA 1ZLQA 4JB7A 3N6UA 4PETA 1IMCA 3GYYA 1LLSA 1MQIA 1ANFA 2DE2A 2DSFA 2X7QA 3JZJA 2B3FA 3VLVA 4BDQA 1B3HA 1IMDA 2ZNUA 1ZU0A 1DOTA 1LSTA 4PE3A 3U65A 1JW4A 5I56A 3GBAA 3DELB 4TOZA 4NE4A 4E0WA 1IMFA 3SESA 1SD3A 2O69A 1Y3QA 3IOWA 2GFEA 1LFIA 2QVRA 1I6QA 3VDFA 5CMBA 4ECFA 1OLAA 2QS3A 3Q28A 2GQ1A 1GR2A 1GTKA 2Y84A 2DP8A 2DOJA 3VE1B 1FPEA 4DZ1A 2OWSA 1S7YA 4RK2A 1DPEA 4JVIA 4G68C 4YB5A 2XD2A 4PC9A 1NNKA 2FVZA 1LAHE 5IM2A 3SERA 3H6VA 4KI0E 3U72A 1G0HA 2V84A 3RLFE 3CR9A 2V3QA 3B50A 4HE0A 2XX7A 5DT6A 3TQLA 2I48A 1B3GA 3G3IA 1FBEA 5IZ3B 1IXCA 3UA8A 1FTAA 4PDHA 4U23A 3KN8A 4UABA 1R9LA 1EU8A 3HO7A 3G3GA 2CEYA 4GWOA 5FHOA 3CSGA 4R2BA 4KFQA 1XI6A 3JV9A 1GV8A 4LZ7A 4H6DA 4U4XA 4GQOA 4IO5A 2Y7WA 3FASA 1FPDA 4ND9A 3A3CA 2OX3A 5LTCA 2DQVA 2PX1A 3JYRA 3FUZA 4R74A 5A5XA 1IMEA 1FQEA 1JEUA 2UYFA 2F3BA 4NX1A 4LVQA 4GWYA 3R26A 4GXSB 5TP9A 2KLFA 5CMKA 4PFYA 1A99A 3OEKA 3LR1A 1HSJA 2H98A 2ESNA 5DEXA 5ELVA 3EF7A 3THIA 4N13A 4OZ9A 1MH4A 3IFAA 4OFJA 1LCFA 4ZE9A 3OELA 1F9BA 4I3YA 1BLFA 2HEUA 3T9HB 3K6XA 3FXBA 3OO7A 2PT2A 4NN3A 4LA9A 3FJGA 2F36A 3RUMA 5F24A 2VHAA 2B65A 1Y1ZA 1Y3NA 4KCDA 5L9MA 2HXRA 4H5GA 2BJIA 3HN0A 4OVJA 1XHYA 3U92A 2HHMA 2HQ0A 1JETA 1FPBA 4IGTA 1YZ0A 4MIJA 2B3BA 1HSEA 2HCAA 2O84X 3B6TA 4N07A 3RYDA 4ESXA 3ZSFA 1B40A 4AQ4A 1FPFA 2CEXA 3K6UA 4F3SA 1SI1A 5ESYA 2REJA 1II5A 4MFIA 1NV6A 4NF4A 4RPOA 4H5FA 4GF8A 5ITOA 3T22A 1LBBA 3MVYA 4WKMA 2I49A 4POXA 4ZZEA 2ZZWA 1A54A 3K02A 5I2KB 2Y7PA 1P1OA 1AWBA 3MVWA 4F1VA 4AS5A 1JVXA 1EH3A 3PUXE 5TPAB 3L6HA 3ZS6A 1FPJA 3MW0A 2DWJA 4OVRA 5I56B 4R72A 3ILTB 1FJ6A 2RF1A 5IZ1A 3HPIA 1I6AA 4PAIA 4AB5A 1YPNA 5T3JA 2Q88A 1RYXA 1WVJA 4QSEA 3BBRA 2YPNA 3OOAA 3CFZA 3K2DA 1GVCA 1B58A 5FTIA 1FBPA 1MXXA 3BIGA 2PBWA 1O7TA 1FPIA 1PBPA 5AA1A 3LUYA 3C9HA 2CZLA 1GGGA 4EXKA 3K01A 5F7VA 3OEMA 4XKRA 1QJMA 2FIEA 4X9TA 4Q30B 3MAMA 4FAJA 4OESA 3T9VA 1B7HA 3T9XB 2O6AA 3MZ9A 3TCGA 3EKIA 2WKYA 2B4LA 2HZLA 2V25A 4X1DA 1R9QA 1B0HA 3TTRA 1UIUA 1YXIA 2XX8A 3H4ZA 1MY2A 5CMMA 4DXCA 1QGXA 4JDFA 4FBPA 1NV5A 3HHFA 1S50A 3GLBA 2Y7KA 2NUVA 5FHNA 3E3KA 1RKMA 5DW8A 1A7LA 2I4BA 1FQDA 2CZKA 4YB7A 5FTHA 3IB1A 4MHFA 2BJJX 3VXCA 3Q25A 4ZS9A 1MPBA 1VFDA 4PGPA 1POTA 4I62A 1B9JA 1MQGA 5ET5A 4ZE8A 5ICQA 4HE1A 4X48A 3C35A 5F1QA 1B1XA 3IO4A 4JVDA 3FVNA 3TTLA 4QBAA 2GRVA 4Z0IA 3V8XB 3FZVA 2QVVA 4NWCA 2MKZA 4O8MA 4KQPA 4P47A 4RYAA 4G8MA 2H99A 1CE2A 5IKBA 1T0KA 3OD7A 3KBRA 4JWXA 3K00A 3MSTA 2UXAA 4R73A 3C4MA 1NV4A 3PPOA 2XXRA 2F5XA 1SW1A 4JXIA 5ET7A 3IX1A 3KSJA 3PMWA 3CSBA 3VLWA 5EYGA 1FBDA 4ISUA 1PC3A 3EQ1A 4GWZA 1DCUA 4PFTA 1EYIA 1QUIA 1ZTYA 4G4PA 5DTBA 4QXDA 4HXVA 5EYHA 4OMBA 2X7PA 1OIBA 2DE3A 4NQ8A 3IO6A 2D5WA 2DXRA 1UIVA 1FQBA 1TFAA 1H43A 1LB9A 1B5HA 5IAIA 4X04A 5I7IA 3VV5A 4P9KA 3RQTA 3CI8A 3MZBA 1EZPA 2XXQA 2ONSA 1MY3A 3H03A 2VD3A 4H45A 4MNCA 3OO6A 4P56A 3OSQA 2F7CA 1MPCA 1JEVA 2VD2A 2RCAA 2A5TA 1JQFA 4G68A 1URDA 3CIJA 1IMBA 4G2ZA 1BP5A 3KOSA 3SEWA 1SVXB 2ZXTA 3N5LA 5EYFA 1IITA 3MP6A 1LBVA 4QFPA 5BWJA 1R6ZA 4GBVA 3PPNA 4POWA 3N6TA 4ELRA 2O1MA 4WEPA 5B7DA 3H6TA 1N3WA 1D3KA 1A8EA 3N26A 3TQWA 1EYJA 3TTKA 1MXVA 1IXHA 3IJXB 4QFLA 1FSAA 3B8BA 1B0LA 3B6QA 1B4HA 1B51A 5ET6A 2XHDA 2PVUA 1OLCA 3O97A 5I57A 3FVOA 3TCFA 4YZZA 2V3UA 2WX9A 3T66A 4JSOA 3QSLA 4RY1A 5DVJA 4FECA 2OBGA 1XOCA 4IGRA 1N0TA 1IMAA 1PB8A 4QF9A 2QS4A 3RT8A 1FJ9A 5FHMA 3MBPA 1LBWA 4NF8B 4KD5A 5I59A 1MG1A 2B4MA 3C33A 4MNPA 5JEIA 4MH5A 4ZEFA 3MP8A 3TEPA 4O3BA 2JJKA 3RNNA 1UTBB 2L5VA 3MYUA 2P3NA 4G61A 1DBZA 5ET8A 4O3CA 4U22A 1NV0A 3O66A 1P1QA 5H8QB 1FRPA 5TPAA 3E78A 3K1MA 1YAEA 4DDDA 3QUJA 4ZEKA 1L5TA 4FEBA 4F18A 2V93A 3QK6A 4ZECA 3SEUA 1O64A 2H4IA 2XXIA 2OCUA 2XA5A 1NUZA 5K2YA 1SPIA 2Q8MA 1MXWA 1LBYA 1JW1A 3FJ7A 3MP1A 3N94A 3KEIA 5HBCA 1IQ7A 3G3HA 4THIA 3H6UA 1B52A 2DVZA 3I3VA 5KCJA 4PFWA 1WDNA 1ZJLA 3RPLA 2IA4A 3E79A 2UYEA 4O7IA 4IO3A 1NNFA 4PTKA 3TTMA 3KN3A 4G8HA 4I1DA 2HAVA 3VXBA 3D1RA 3K0VA 4UACA 3CFLA 3G3JA 4XIGQ 1DMBA 2XX9A 1AL3A 5M2VA 4GRKA 4DXUA 1UTHB 1MRPA 4YKJA 4NHBA 2NXOA 2ZZVA 5A5XB 4HCYA 4IY5A 2QMWA 2GHBA 4KHZE 2G29A 1SW4A 2Q2CA 2F3DA 3DP8A 4GXAA 4LZ5A 2QPQA 1O63A 3CRBA 1INPA 3QUFA 2ZYOA 1MXZA 3H6WA 4F3GA 5I3SA 2OWZA 4Q5TA 1D9VA 3E4RA 4OEVA 2ABHA 1MH3A 4JVCA 5L9SA 4IB2A 4NF0A 2VP1A 1N84A 3KG2A 4R2FA 3W9WA 2VT5A 2FIXA 2F97A 4QRZA 3S9EA 4FORA 5DVIA 1Y4TA 4U1ZA 4X8RA 3K6WA 1B1HA 4K3FA 5BUUA 4EF1A 3CG1A 4LATA 1NUWA 1NV1A 4FJPA 3RT6B 4F3PA 3LSXA 5EQ9A 1JVYA 3MPKA 5LDZA 1MDQA 5H8SA 3K4UA 2ZYKA 4F39A 3HCQA 2PMSA 5H8FB 3PPPA 2F35A 2GHAA 4YU0A 4LZ8A 4YAHX 1EZOA 3IB0A 4BDOA 1M5FA 3BKIB 1FBCA 1Y1MA 1D4NA 1IZ1A 4RJZA 2A5TB 1BTJA 5ICTA 1LGBC 1NH7A 3EHUA 4N17A 3ROJA 3OO8A 4GOTA 5J1DA 1QUKA 2XWKA 5KCJB 2XWOA 1NMUA 2Q74A 1M5EA 1G0IA 1IXIA 4XXUA 3MVXA 4QFKA 1LFHA 1B3EA 4KYEA 2ONRA 4DXBA 2QRYA 1R1NA 3T1BA 1HSLA 3M3LA 2QFLA 3U8QA 1LAXA 4YKIA 3EHSA 1VE4A 4HE2A 5AA4A 4EDPA 2CZHA 3IR1A 1FBFA 4NGUA 3L6GA 1RDXA 2I6EA 4QHQA 1LAFE 1MM6A 3R7XA 1FQFA 1MY1A 2D21A 2P1SA 3B6WA 1QUJA 1RDZA 3HFUA 3QAXA 4OERA 2R6GE 4I8CA 2F8DA 1Q1KA 3TZAA 1FQCA 2QSXA 2Z8FA 4GX6A 4BDMA 5JTYA 2XXUA 1FTMA 1PEBA 2ONKE 1M5CA 4XEQA 2PCRA 5JTYB 1USYE 3IAZA 4Q8RA 2XXYA 2XXXA 3KN7A 4U2RA 2O7IA 1QVSA 1A8FA 3O2AA 4PFUA 4XKNA 5FBPA 5CRYA 4PE5B 2ZMBA 2F7AA 4KPTA 1N7WA 3UORA 4N81A 4LQ2A 2ZYMA 4G8NA 4KXPA 2R9JA 5H8HB 1EYKA 1A40A 4NTLA 1LBZA 2NVUB 2XXKA 3ZKLA 3T96B 3FJMA 4KCCA 3USDA 3QIMA 1B2HA 3RN8A 1ZKBA 3LSFB 4H67A 5IGAA 4OQOA 4YICA 2QJEA 1XC1A 5KDTB 2QS1A 1QW0A 4MBPA 3KC0A 1B3FA 1SI0A 3PTYA 1N7XA 3KSXA 2FA7A 1BKAA 3SDFA 1B46A 1SQYA 1MY4A 5EQAA 4RXLA 1NH8A 4ZDMA 3PPQA 2YJPA 2DWAA 2F6PA 4N8YA 4P1LA 4F29A 3U93A 5DYHA 3KBZA 4OWDA 1H44A 1DTZA 5H8FA 2UVGA 3WAEA 3MQ9A 3U94A 2AYSA 2AIXA 5AA2B 4PCDA 4NAPA 1MPDA 4OXVA 3RPWA 4GIZA 1I69A 2DYXA 1CNQA 2DDKA 3QMFA 2RC9A 3C31A 4C1TA 1JP4A 1B7ZA 1FPKA 4OTEA 4IO7A 3Q26A 1TXFA 4XTCQ 5DVFA 3PD9A 4ELOA 2UVJA 4NWDA 3SETA 1OQGA 4NF6B 1FTKA 4P1EA 4OYVA 4F2QA 3K1NA 4QFNA 3QYTA 3MC2A 3EHTA 3RGYA 1IXGA 3IL1B 3MJNA 3LC8A 1LAGE 2FBPA 2F78A 3OXNA 1MXUA 4IO6A 2RC8A 5ISUA 3PUVE 2WYPA 4DE8A 3TTNA 1UTHA 4FEDA 4GBWA 4BDNA 1P1WA 5IZ3A 1OMPA 4NMYA 3V89B 4OVQA 2VPNA 4NEDA 3TAJA 4F22A 1MQHA 3A09A 4BDRA 1D9QA 2KQZA 4JSDA 1D9YA 1FPGA 3PV0E 5AA2A 1SBPA 4TLLB 4N15A 2Q89A 2Y7RA 2Y7IA 2PFYA 4GWUA 4H0WA 4P8BA 1TT1A 4QFOA 1A55A 5EQ7A 1FBGA 5EHMA 1KZ8A 3DLNA 4R9GA 3D4GA 3PMXA 5AA3A 1IUDA 5KZTA 1B5IA 3LSLA 2REGA 4OVTA 2XD3A 4F3BA 2DE4A 2RC7A 4GWXA 4PFBA 1FCKA 2DWHA 2THIA 2R71A 3O6GA 4Q0CA 4GX4A 3TELA 3UGWA 5I2NA 5AA4B 2Z8EA 1SYIA 2O51A 2CZIA 1H76A 4NF8A 4MJOA 3TDJA 2UVHA 4ZZAA 2I3VA 4HS7A 2I0BA 1ELJA 4IY6A 3FV1A 1USYH 4OEUA 4OFLA 5AE4A 2D3IA 4ZEIA 3KGCA 3M8UA 1LFGA 2Z8DA 3EPEA 5I58B 4G77A 4DIGA 5JK4A 4P0GA 5K2XA 1FTJA 1YTVA 1VR5A 1B3LA 1NL5A 3LUZA 4IR8A 4QSDA 4JWYA 1P99A 4BLAA 3H06B 5I2KA 4H8IA 4LQ5A 4TLMB 1XT8A 3UIFA 3TUSA 4F19A 2NOOA 4OA4A 5I58A 2XWIA 3H3GA 2W7YA 1VSOA 2LAOA 4MLVA 4RPNA 3HHGA 4EQBA 5ITPA 2WBBA 1BK4A 3KC1A 3G3KA 3IOVA 4N6DA 4WEDA 4LONB 4MX6A 4O94A 2QL3A 1AMFA 1PDAA 1AOVA 3S4UA 3GZGA 3ZKKA 5HPQA 2P2AA 2I3WA 3IK6B 3SEYA 1Y9UA 4DCXA 4HCWA 2NWJA 2X26A 2QS2A 1M5DA 4PDDA 3V5AA 3CHGA 3IOTA 1QULA 2E0SA 4IO2A 3MWBA 1POY1 3FXRA 3R6UA 4GX3A 1Y4CA 5I5PA 4NF4B 4JBZA 2Q2AA 2ZNTA 1TFDA 3VVFA 1YYZA 2HPGA 3G7WA 3O28A 3OMBA 5H8QA 2O68A 4OENA 3FGSA 2AL4A 1IIWA 4F1UA 4F31B 1FBHA 1MS7A 4GL8A 3VLUA 4EQ9A 4ONYA 1P1NA 4OETA 2OK2A 1K9ZA 2ZNSA 3KFMA 3IFCA 1MM7A 4ELPA 1PB7A 1NNPA 4N8GA 3M3FA 4P3LA 3ECRA 2Z22A 4P0IA 4ZEBA 3WAFA 5H8NA 4NG7A 4F2OA 1ATGA 2A5SA 4U21A 1FTLA 1N04A 2YLNA 5EHSA 2HXWA 5A5LA 4PFIA 3PGFA 4H46A 1SW2A 4C1UA 5H8NB 4MMPA 3T0JA 1FQAA 4GD5A 4IO4A 5DEXB 3FATA 3K1PA 4KYDA 4EQ7A 3KJ7A 4RA1A 3PUYE 1B4ZA 5TP9B 2F6GA 4MNIA 4BDLA 3UP9A 2FHYA 2CMOA 3TMGA 4PP0A 4PF8A 2HAUA 4OFOA 3S2VA 4NF5A 1Z7NE 4TQUQ 5I84A 3IB2A 2O1LA 3GXAA 1Z7ME 2DWIA 1SYHA 2DVCA 2RINA 1XVYA 3I5OA 1NUYA 1SW5A 3FXUA 2Y5KA 3CVGA 2OLBA 4XKQA 3TFLA 3EN3A 4NF6A 1LEVA 3TPAA 4DLDA 2WEFA 5TU0A 1LB8A 4GVOA 4P11A 5J16A 4I40A 3OENA 3AXFA 3TYHA 1QKBA 1LCTA
chains in the Genus database with same CATH topology
4I3YA 4P3LA 4XFEA 4P56A 4OVQA 4XF5A 2VPNA 3KC0A 4JVDA 2JJKA 1FBFA 3PTYA 4NGUA 1G0HA 2WBDA 4QBAA 4F19A 5F24A 4OA4A 1KA0A 4JVCA 3W9WA 1RDXA 2L5VA 4N6KA 1Q9DA 3FXBA 2XWIA 2P3NA 3MYUA 2V3QA 4G61A 1DBZA 1D9QA 1FBPA 3B50A 4NG7A 3BIGA 4NN3A 5ET8A 4HE0A 5EQAA 2KR0A 4MEVA 1RDYA 3A29A 2QVVA 2KQZA 4NF0A 1NV3A 2MKZA 2Q9TA 2WBBA 1BK4A 3KC1A 1FPGA 3LV0A 1FBEA 4GWSA 4O8MA 4P47A 4PAKA 5IZ3B 2WYKA 2VPOA 1NV0A 4N8YA 2XWVA 1IMBA 1RDZA 4M1VA 2ZZXA 1FTAA 2VT5A 4N15A 4N6DA 2FIXA 1FPIA 3HFUA 4MX6A 4O94A 4PDHA 2PFYA 4UABA 5A5LA 1FRPA 3KBZA 4GWUA 5EQ8A 4OANA 4P8BA 3E78A 4PFIA 5CM6A 2HXRA 2BJIA 1DK4A 2CEYA 4X8RA 3ISPA 1LBVA 1K9YA 3MSTA 4PFRA 2FIEA 4X9TA 4F18A 3BIHA 5EQ7A 1FBGA 2HHMA 4H46A 1NUWA 4GBVA 1NV1A 4PAFA 1NV2A 4MAGA 4GX6A 1NV4A 1KZ8A 1FPBA 4MCOA 4PCDA 4OVPA 1XI6A 5IZ3A 4NAPA 1YZ0A 4MIJA 4MMPA 2F5XA 5EQ9A 3T0JA 4XEQA 5LDZA 2PCRA 3EKIA 5ET7A 2B4LA 2XA5A 1NUZA 3RYDA 4PETA 3RPLB 2HZLA 1SPIA 2Q8MA 3W9VA 4O7MA 4OVTA 1LBYA 5EYGA 1IMCA 1CNQA 1FPDA 2DE4A 4PBQA 1FBDA 1FPLA 4GWXA 4HCWA 1EYJA 2OX3A 2DDKA 3QMFA 4GWZA 4PFBA 5LTCA 3GYYA 1DCUA 4MNIA 1FSAA 1JP4A 1FPFA 2DE2A 3B8BA 4GX4A 5IZZA 1EYIA 2CEXA 1FBCA 1VDWA 1FPKA 2HZKA 2DVZA 4PDDA 5ET6A 2R8TA 1YXIA 5ESYA 5FBPA 3CHGA 1NV7A 4N4UA 4QXDA 1NV6A 2CZIA 1IMDA 2FHYA 2P3VA 4HXVA 4MJOA 5EYHA 5IM2A 3NOHA 3RPLA 3E79A 1IMEA 3FBPA 1QGXA 4GX3A 4N81A 4O7IA 4PE3A 4YZZA 5I5PA 4FBPA 4PF8A 4PTKA 4N17A 3U65A 2DE3A 1NV5A 3D1RA 3ROJA 4DI3D 2WX9A 2ZZWA 5J1DA 4DI4B 2F3BA 4NQ8A 4P1EA 2XWKA 4NX1A 4KXPA 4AS4A 1IMFA 1AWBA 4P1LA 4F1VA 4GWYA 2XWOA 1YYZA 4I3EA 2HPGA 4AS5A 2Q74A 2QVRA 1EYKA 1NUYA 1IMAA 1G0IA 4NHBA 5DW8A 1FPJA 1LBZA 4F1UA 2XXKA 2ZZVA 4OVRA 2V4CA 2GQ1A 2Y5KA 1FBHA 2CZKA 2OWZA 4LN5A 4X04A 5I7IA 1FJ6A 4HCYA 4P9KA 4MHFA 1FJ9A 2FBPA 5IZ1A 4PAIA 1LBWA 1LEVA 1LBXA 3SZPA 1FPEA 5JK4A 3T1BA 2Y5LA 1K9ZA 2F3DA 1KA1A 4PBHA 4PF6A 5T3JA 5IGAA 2QPQA 2WEFA 2WYPA 3LUZA 4JVIA 4PGNA 4N91A 3IFAA 2QFLA 4IR8A 4YICA 4PGPA 3IFCA 5J16A 4I40A 2PFZA 1NI9A 4PC9A 5ET5A 4GWWA 4HE1A 2B4MA 1INPA 4GBWA 4MNPA 2FVZA 4HE2A 4OVSA 4H45A 4N8GA 4MNCA 2QVUA 1NUXA 5I3SA 2CZHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P3L A;  4XFE A;  4P56 A;  4OVQ A;  4XF5 A;  2VPN A;  4NGU A;  4OA4 A;  4N6K A;  3FXB A;  2XWI A;  4NG7 A;  4NN3 A;  3B50 A;  4MEV A;  4NF0 A;  4O8M A;  4P47 A;  4PAK A;  2WYK A;  2VPO A;  4N8Y A;  2XWV A;  4N6D A;  4P1L A;  2ZZX A;  4PDH A;  4N15 A;  4PGN A;  4UAB A;  4MX6 A;  4O94 A;  2PFY A;  5CM6 A;  4OAN A;  4P8B A;  4PFI A;  4X8R A;  2CEY A;  4PFR A;  4PAF A;  4MAG A;  4MCO A;  4PCD A;  4OVP A;  4NAP A;  4MIJ A;  4MMP A;  4XEQ A;  2XA5 A;  4PET A;  2HZL A;  4O7M A;  4OVT A;  4PBQ A;  4PFB A;  5LTC A;  3GYY A;  4MNI A;  5IZZ A;  2CEX A;  2HZK A;  4PDD A;  4N4U A;  4PE3 A;  4YZZ A;  5I5P A;  4PF8 A;  4N17 A;  3U65 A;  4DI3 D;  2WX9 A;  2ZZW A;  4DI4 B;  4NQ8 A;  4P1E A;  2XWK A;  4NX1 A;  2XWO A;  2HPG A;  4NHB A;  2XXK A;  2ZZV A;  4OVR A;  2V4C A;  4LN5 A;  4X04 A;  5I7I A;  4P9K A;  4MHF A;  4PAI A;  4PBH A;  4PF6 A;  5IGA A;  2WYP A;  4N91 A;  4YIC A;  4PGP A;  2PFZ A;  4PC9 A;  4MNP A;  4OVS A;  4N8G A;  4MNC A;  5IM2 A; 
#chains in the Genus database with same CATH topology
 1Y20 A;  4WXJ A;  2WBD A;  4G68 B;  1KA0 A;  3TKD A;  2Q8J A;  3E9X A;  3H7M A;  2GH9 A;  4MEV A;  2VOZ A;  4R6H A;  2I4C A;  1WOD A;  2WYK A;  1ZBM A;  1NNT A;  3E13 X;  2ZZX A;  1MXY A;  3OO9 A;  5CM6 A;  4GL0 A;  1DK4 A;  3Q27 A;  1B5J A;  4MCO A;  3ODB A;  4OVP A;  3UN6 A;  1VFE A;  1ZIU A;  2XXW A;  3LBS A;  1MDP 1;  3HV1 A;  3CG3 A;  4GLI A;  4GFR A;  3F11 A;  3CFX A;  2R8T A;  1DTG A;  1H3D A;  5CBR A;  1XS5 A;  3VVE A;  3SEX A;  2PT1 A;  2HFB A;  1MQD A;  1XVX A;  4L17 A;  2XXT A;  1RYO A;  3M3K A;  2H5Y A;  1PB9 A;  1QKA A;  2H25 A;  5H8H A;  2V4C A;  2H9B A;  4YB6 A;  4Z7E A;  3O6H A;  3PU5 A;  3C34 A;  3MPL A;  5CI5 A;  4FIM A;  2ALU A;  3W15 C;  2Y5L A;  3FXQ A;  4PQJ A;  4N91 A;  4HW8 A;  1TWY A;  2PFZ A;  4E0X A;  1MQJ A;  3MVZ A;  1NKX A;  4GWW A;  4HTG A;  4XKP A;  1MY0 A;  3T93 B;  2QVU A;  3C36 A;  4UA8 A;  4XFE A;  2V3T A;  4MLQ A;  3K6V A;  1URG A;  3VFJ A;  3IOR A;  2KR0 A;  1RDY A;  3A29 A;  1URS A;  2UVI A;  2Q9T A;  1US5 A;  1YCJ A;  2VGQ A;  3LV0 A;  4MF3 A;  3V83 A;  1AH5 A;  4U1O A;  1N76 A;  3PMV A;  1N3X A;  4EF2 A;  3LSW A;  1K9Y A;  4YKP A;  3BIH A;  1NFT A;  4MAG A;  3PUW E;  1B7U A;  4EXL A;  1KWH A;  2E1S A;  2OWT A;  3A3U A;  3RPL B;  3W9V A;  1H45 A;  4PBQ A;  1FPL A;  2XXP A;  2FYI A;  4C0R A;  4OHN A;  2XXV A;  3D4C A;  1FW0 A;  3KZG A;  3IOU A;  4NF5 B;  5KDT A;  3O6I A;  2HZK A;  3O9P A;  4EUO A;  2P3V A;  1Q35 A;  5B70 A;  4FE8 A;  1BIY A;  5L8D A;  2O7U A;  4DI3 D;  1LBC A;  3VVD A;  3T9U A;  4AS4 A;  2FNC A;  3PD8 A;  1AIV A;  3BFU A;  4I3E A;  3P7I A;  4KYS A;  3MUQ A;  3Q29 A;  2ANJ A;  3PUZ E;  4LN5 A;  3DP6 A;  3TOD A;  1OVT A;  1LBX A;  1Y3P A;  1UTB A;  3FVG A;  1NI9 A;  5I59 B;  4XF5 A;  1I6B A;  4H8J A;  5AA2 D;  4RNS A;  4N6K A;  1Q9D A;  2I0C A;  1CB6 A;  2Z23 A;  4ZED A;  4PAK A;  2IEE A;  2RKM A;  2VPO A;  3FIR A;  2XWV A;  4M1V A;  4PGN A;  4YKK A;  4QSC A;  4OAN A;  3PPR A;  3ISP A;  1B6H A;  1SDX A;  4PFR A;  3DP4 A;  3S9M C;  2XXH A;  2P0S A;  4PAF A;  4R75 A;  4KR5 A;  4R6Y A;  2DS9 A;  4ELQ A;  5I57 B;  1FTO A;  3FD3 A;  1UQW A;  3KJT A;  4O7M A;  3C32 A;  3G3F A;  4X1B A;  1J1N A;  2ZYN A;  5IZZ A;  1VDW A;  4AB6 A;  2F7B A;  4ESW A;  1NV7 A;  4N4U A;  5CBS A;  1OVB A;  3NOH A;  3ONM A;  3O29 A;  2QMX A;  3FBP A;  3RY3 A;  1JW5 A;  4R9F A;  4H1X A;  4R6K A;  3IJO B;  1IEJ A;  2F34 A;  4M4G A;  4DI4 B;  5CMC A;  4LUB A;  5L9O A;  3QXM A;  1ZMG A;  3SEV A;  2I58 A;  3OSR A;  5I2N B;  4YMB A;  1B32 A;  3DM0 A;  2OJT A;  3S9N C;  3S9L C;  4JWO A;  3KOT A;  3ILU B;  1PBQ A;  1EZ9 A;  3UK4 A;  4N6P A;  4YMA A;  3SZP A;  3BFT A;  3RTF B;  3RTW B;  3FV2 A;  1KA1 A;  4PBH A;  4PF6 A;  3U1O A;  4H65 A;  3HST A;  4OVS A;  4DCY A;  1NUX A;  3SKP A;  2PYY A;  1DSN A;  1US4 A;  4RK9 A;  1DPP A;  2AL5 A;  3MZ1 A;  2M8C A;  2G93 A;  4FAT A;  1M5B A;  3FVK A;  3GBB A;  5CC2 A;  1NV3 A;  3TCH A;  4GWS A;  4LP2 B;  5EQ8 A;  2DXY A;  3I6V A;  4F1Y A;  5LOM A;  1B05 A;  3B7D A;  4U4S A;  1NV2 A;  2RCB A;  4O3A A;  2OZZ A;  1OQH A;  1S9T A;  4I9D A;  5HM4 B;  1P1U A;  1JNF A;  1ZLQ A;  4JB7 A;  3N6U A;  4PET A;  1IMC A;  3GYY A;  1LLS A;  1MQI A;  1ANF A;  2DE2 A;  2DSF A;  2X7Q A;  3JZJ A;  2B3F A;  3VLV A;  4BDQ A;  1B3H A;  1IMD A;  2ZNU A;  1ZU0 A;  1DOT A;  1LST A;  4PE3 A;  3U65 A;  1JW4 A;  5I56 A;  3GBA A;  3DEL B;  4TOZ A;  4NE4 A;  4E0W A;  1IMF A;  3SES A;  1SD3 A;  2O69 A;  1Y3Q A;  3IOW A;  2GFE A;  1LFI A;  2QVR A;  1I6Q A;  3VDF A;  5CMB A;  4ECF A;  1OLA A;  2QS3 A;  3Q28 A;  2GQ1 A;  1GR2 A;  1GTK A;  2Y84 A;  2DP8 A;  2DOJ A;  3VE1 B;  1FPE A;  4DZ1 A;  2OWS A;  1S7Y A;  4RK2 A;  1DPE A;  4JVI A;  4G68 C;  4YB5 A;  2XD2 A;  4PC9 A;  1NNK A;  2FVZ A;  1LAH E;  5IM2 A;  3SER A;  3H6V A;  4KI0 E;  3U72 A;  1G0H A;  2V84 A;  3RLF E;  3CR9 A;  2V3Q A;  3B50 A;  4HE0 A;  2XX7 A;  5DT6 A;  3TQL A;  2I48 A;  1B3G A;  3G3I A;  1FBE A;  5IZ3 B;  1IXC A;  3UA8 A;  1FTA A;  4PDH A;  4U23 A;  3KN8 A;  4UAB A;  1R9L A;  1EU8 A;  3HO7 A;  3G3G A;  2CEY A;  4GWO A;  5FHO A;  3CSG A;  4R2B A;  4KFQ A;  1XI6 A;  3JV9 A;  1GV8 A;  4LZ7 A;  4H6D A;  4U4X A;  4GQO A;  4IO5 A;  2Y7W A;  3FAS A;  1FPD A;  4ND9 A;  3A3C A;  2OX3 A;  5LTC A;  2DQV A;  2PX1 A;  3JYR A;  3FUZ A;  4R74 A;  5A5X A;  1IME A;  1FQE A;  1JEU A;  2UYF A;  2F3B A;  4NX1 A;  4LVQ A;  4GWY A;  3R26 A;  4GXS B;  5TP9 A;  2KLF A;  5CMK A;  4PFY A;  1A99 A;  3OEK A;  3LR1 A;  1HSJ A;  2H98 A;  2ESN A;  5DEX A;  5ELV A;  3EF7 A;  3THI A;  4N13 A;  4OZ9 A;  1MH4 A;  3IFA A;  4OFJ A;  1LCF A;  4ZE9 A;  3OEL A;  1F9B A;  4I3Y A;  1BLF A;  2HEU A;  3T9H B;  3K6X A;  3FXB A;  3OO7 A;  2PT2 A;  4NN3 A;  4LA9 A;  3FJG A;  2F36 A;  3RUM A;  5F24 A;  2VHA A;  2B65 A;  1Y1Z A;  1Y3N A;  4KCD A;  5L9M A;  2HXR A;  4H5G A;  2BJI A;  3HN0 A;  4OVJ A;  1XHY A;  3U92 A;  2HHM A;  2HQ0 A;  1JET A;  1FPB A;  4IGT A;  1YZ0 A;  4MIJ A;  2B3B A;  1HSE A;  2HCA A;  2O84 X;  3B6T A;  4N07 A;  3RYD A;  4ESX A;  3ZSF A;  1B40 A;  4AQ4 A;  1FPF A;  2CEX A;  3K6U A;  4F3S A;  1SI1 A;  5ESY A;  2REJ A;  1II5 A;  4MFI A;  1NV6 A;  4NF4 A;  4RPO A;  4H5F A;  4GF8 A;  5ITO A;  3T22 A;  1LBB A;  3MVY A;  4WKM A;  2I49 A;  4POX A;  4ZZE A;  2ZZW A;  1A54 A;  3K02 A;  5I2K B;  2Y7P A;  1P1O A;  1AWB A;  3MVW A;  4F1V A;  4AS5 A;  1JVX A;  1EH3 A;  3PUX E;  5TPA B;  3L6H A;  3ZS6 A;  1FPJ A;  3MW0 A;  2DWJ A;  4OVR A;  5I56 B;  4R72 A;  3ILT B;  1FJ6 A;  2RF1 A;  5IZ1 A;  3HPI A;  1I6A A;  4PAI A;  4AB5 A;  1YPN A;  5T3J A;  2Q88 A;  1RYX A;  1WVJ A;  4QSE A;  3BBR A;  2YPN A;  3OOA A;  3CFZ A;  3K2D A;  1GVC A;  1B58 A;  5FTI A;  1FBP A;  1MXX A;  3BIG A;  2PBW A;  1O7T A;  1FPI A;  1PBP A;  5AA1 A;  3LUY A;  3C9H A;  2CZL A;  1GGG A;  4EXK A;  3K01 A;  5F7V A;  3OEM A;  4XKR A;  1QJM A;  2FIE A;  4X9T A;  4Q30 B;  3MAM A;  4FAJ A;  4OES A;  3T9V A;  1B7H A;  3T9X B;  2O6A A;  3MZ9 A;  3TCG A;  3EKI A;  2WKY A;  2B4L A;  2HZL A;  2V25 A;  4X1D A;  1R9Q A;  1B0H A;  3TTR A;  1UIU A;  1YXI A;  2XX8 A;  3H4Z A;  1MY2 A;  5CMM A;  4DXC A;  1QGX A;  4JDF A;  4FBP A;  1NV5 A;  3HHF A;  1S50 A;  3GLB A;  2Y7K A;  2NUV A;  5FHN A;  3E3K A;  1RKM A;  5DW8 A;  1A7L A;  2I4B A;  1FQD A;  2CZK A;  4YB7 A;  5FTH A;  3IB1 A;  4MHF A;  2BJJ X;  3VXC A;  3Q25 A;  4ZS9 A;  1MPB A;  1VFD A;  4PGP A;  1POT A;  4I62 A;  1B9J A;  1MQG A;  5ET5 A;  4ZE8 A;  5ICQ A;  4HE1 A;  4X48 A;  3C35 A;  5F1Q A;  1B1X A;  3IO4 A;  4JVD A;  3FVN A;  3TTL A;  4QBA A;  2GRV A;  4Z0I A;  3V8X B;  3FZV A;  2QVV A;  4NWC A;  2MKZ A;  4O8M A;  4KQP A;  4P47 A;  4RYA A;  4G8M A;  2H99 A;  1CE2 A;  5IKB A;  1T0K A;  3OD7 A;  3KBR A;  4JWX A;  3K00 A;  3MST A;  2UXA A;  4R73 A;  3C4M A;  1NV4 A;  3PPO A;  2XXR A;  2F5X A;  1SW1 A;  4JXI A;  5ET7 A;  3IX1 A;  3KSJ A;  3PMW A;  3CSB A;  3VLW A;  5EYG A;  1FBD A;  4ISU A;  1PC3 A;  3EQ1 A;  4GWZ A;  1DCU A;  4PFT A;  1EYI A;  1QUI A;  1ZTY A;  4G4P A;  5DTB A;  4QXD A;  4HXV A;  5EYH A;  4OMB A;  2X7P A;  1OIB A;  2DE3 A;  4NQ8 A;  3IO6 A;  2D5W A;  2DXR A;  1UIV A;  1FQB A;  1TFA A;  1H43 A;  1LB9 A;  1B5H A;  5IAI A;  4X04 A;  5I7I A;  3VV5 A;  4P9K A;  3RQT A;  3CI8 A;  3MZB A;  1EZP A;  2XXQ A;  2ONS A;  1MY3 A;  3H03 A;  2VD3 A;  4H45 A;  4MNC A;  3OO6 A;  4P56 A;  3OSQ A;  2F7C A;  1MPC A;  1JEV A;  2VD2 A;  2RCA A;  2A5T A;  1JQF A;  4G68 A;  1URD A;  3CIJ A;  1IMB A;  4G2Z A;  1BP5 A;  3KOS A;  3SEW A;  1SVX B;  2ZXT A;  3N5L A;  5EYF A;  1IIT A;  3MP6 A;  1LBV A;  4QFP A;  5BWJ A;  1R6Z A;  4GBV A;  3PPN A;  4POW A;  3N6T A;  4ELR A;  2O1M A;  4WEP A;  5B7D A;  3H6T A;  1N3W A;  1D3K A;  1A8E A;  3N26 A;  3TQW A;  1EYJ A;  3TTK A;  1MXV A;  1IXH A;  3IJX B;  4QFL A;  1FSA A;  3B8B A;  1B0L A;  3B6Q A;  1B4H A;  1B51 A;  5ET6 A;  2XHD A;  2PVU A;  1OLC A;  3O97 A;  5I57 A;  3FVO A;  3TCF A;  4YZZ A;  2V3U A;  2WX9 A;  3T66 A;  4JSO A;  3QSL A;  4RY1 A;  5DVJ A;  4FEC A;  2OBG A;  1XOC A;  4IGR A;  1N0T A;  1IMA A;  1PB8 A;  4QF9 A;  2QS4 A;  3RT8 A;  1FJ9 A;  5FHM A;  3MBP A;  1LBW A;  4NF8 B;  4KD5 A;  5I59 A;  1MG1 A;  2B4M A;  3C33 A;  4MNP A;  5JEI A;  4MH5 A;  4ZEF A;  3MP8 A;  3TEP A;  4O3B A;  2JJK A;  3RNN A;  1UTB B;  2L5V A;  3MYU A;  2P3N A;  4G61 A;  1DBZ A;  5ET8 A;  4O3C A;  4U22 A;  1NV0 A;  3O66 A;  1P1Q A;  5H8Q B;  1FRP A;  5TPA A;  3E78 A;  3K1M A;  1YAE A;  4DDD A;  3QUJ A;  4ZEK A;  1L5T A;  4FEB A;  4F18 A;  2V93 A;  3QK6 A;  4ZEC A;  3SEU A;  1O64 A;  2H4I A;  2XXI A;  2OCU A;  2XA5 A;  1NUZ A;  5K2Y A;  1SPI A;  2Q8M A;  1MXW A;  1LBY A;  1JW1 A;  3FJ7 A;  3MP1 A;  3N94 A;  3KEI A;  5HBC A;  1IQ7 A;  3G3H A;  4THI A;  3H6U A;  1B52 A;  2DVZ A;  3I3V A;  5KCJ A;  4PFW A;  1WDN A;  1ZJL A;  3RPL A;  2IA4 A;  3E79 A;  2UYE A;  4O7I A;  4IO3 A;  1NNF A;  4PTK A;  3TTM A;  3KN3 A;  4G8H A;  4I1D A;  2HAV A;  3VXB A;  3D1R A;  3K0V A;  4UAC A;  3CFL A;  3G3J A;  4XIG Q;  1DMB A;  2XX9 A;  1AL3 A;  5M2V A;  4GRK A;  4DXU A;  1UTH B;  1MRP A;  4YKJ A;  4NHB A;  2NXO A;  2ZZV A;  5A5X B;  4HCY A;  4IY5 A;  2QMW A;  2GHB A;  4KHZ E;  2G29 A;  1SW4 A;  2Q2C A;  2F3D A;  3DP8 A;  4GXA A;  4LZ5 A;  2QPQ A;  1O63 A;  3CRB A;  1INP A;  3QUF A;  2ZYO A;  1MXZ A;  3H6W A;  4F3G A;  5I3S A;  2OWZ A;  4Q5T A;  1D9V A;  3E4R A;  4OEV A;  2ABH A;  1MH3 A;  4JVC A;  5L9S A;  4IB2 A;  4NF0 A;  2VP1 A;  1N84 A;  3KG2 A;  4R2F A;  3W9W A;  2VT5 A;  2FIX A;  2F97 A;  4QRZ A;  3S9E A;  4FOR A;  5DVI A;  1Y4T A;  4U1Z A;  4X8R A;  3K6W A;  1B1H A;  4K3F A;  5BUU A;  4EF1 A;  3CG1 A;  4LAT A;  1NUW A;  1NV1 A;  4FJP A;  3RT6 B;  4F3P A;  3LSX A;  5EQ9 A;  1JVY A;  3MPK A;  5LDZ A;  1MDQ A;  5H8S A;  3K4U A;  2ZYK A;  4F39 A;  3HCQ A;  2PMS A;  5H8F B;  3PPP A;  2F35 A;  2GHA A;  4YU0 A;  4LZ8 A;  4YAH X;  1EZO A;  3IB0 A;  4BDO A;  1M5F A;  3BKI B;  1FBC A;  1Y1M A;  1D4N A;  1IZ1 A;  4RJZ A;  2A5T B;  1BTJ A;  5ICT A;  1LGB C;  1NH7 A;  3EHU A;  4N17 A;  3ROJ A;  3OO8 A;  4GOT A;  5J1D A;  1QUK A;  2XWK A;  5KCJ B;  2XWO A;  1NMU A;  2Q74 A;  1M5E A;  1G0I A;  1IXI A;  4XXU A;  3MVX A;  4QFK A;  1LFH A;  1B3E A;  4KYE A;  2ONR A;  4DXB A;  2QRY A;  1R1N A;  3T1B A;  1HSL A;  3M3L A;  2QFL A;  3U8Q A;  1LAX A;  4YKI A;  3EHS A;  1VE4 A;  4HE2 A;  5AA4 A;  4EDP A;  2CZH A;  3IR1 A;  1FBF A;  4NGU A;  3L6G A;  1RDX A;  2I6E A;  4QHQ A;  1LAF E;  1MM6 A;  3R7X A;  1FQF A;  1MY1 A;  2D21 A;  2P1S A;  3B6W A;  1QUJ A;  1RDZ A;  3HFU A;  3QAX A;  4OER A;  2R6G E;  4I8C A;  2F8D A;  1Q1K A;  3TZA A;  1FQC A;  2QSX A;  2Z8F A;  4GX6 A;  4BDM A;  5JTY A;  2XXU A;  1FTM A;  1PEB A;  2ONK E;  1M5C A;  4XEQ A;  2PCR A;  5JTY B;  1USY E;  3IAZ A;  4Q8R A;  2XXY A;  2XXX A;  3KN7 A;  4U2R A;  2O7I A;  1QVS A;  1A8F A;  3O2A A;  4PFU A;  4XKN A;  5FBP A;  5CRY A;  4PE5 B;  2ZMB A;  2F7A A;  4KPT A;  1N7W A;  3UOR A;  4N81 A;  4LQ2 A;  2ZYM A;  4G8N A;  4KXP A;  2R9J A;  5H8H B;  1EYK A;  1A40 A;  4NTL A;  1LBZ A;  2NVU B;  2XXK A;  3ZKL A;  3T96 B;  3FJM A;  4KCC A;  3USD A;  3QIM A;  1B2H A;  3RN8 A;  1ZKB A;  3LSF B;  4H67 A;  5IGA A;  4OQO A;  4YIC A;  2QJE A;  1XC1 A;  5KDT B;  2QS1 A;  1QW0 A;  4MBP A;  3KC0 A;  1B3F A;  1SI0 A;  3PTY A;  1N7X A;  3KSX A;  2FA7 A;  1BKA A;  3SDF A;  1B46 A;  1SQY A;  1MY4 A;  5EQA A;  4RXL A;  1NH8 A;  4ZDM A;  3PPQ A;  2YJP A;  2DWA A;  2F6P A;  4N8Y A;  4P1L A;  4F29 A;  3U93 A;  5DYH A;  3KBZ A;  4OWD A;  1H44 A;  1DTZ A;  5H8F A;  2UVG A;  3WAE A;  3MQ9 A;  3U94 A;  2AYS A;  2AIX A;  5AA2 B;  4PCD A;  4NAP A;  1MPD A;  4OXV A;  3RPW A;  4GIZ A;  1I69 A;  2DYX A;  1CNQ A;  2DDK A;  3QMF A;  2RC9 A;  3C31 A;  4C1T A;  1JP4 A;  1B7Z A;  1FPK A;  4OTE A;  4IO7 A;  3Q26 A;  1TXF A;  4XTC Q;  5DVF A;  3PD9 A;  4ELO A;  2UVJ A;  4NWD A;  3SET A;  1OQG A;  4NF6 B;  1FTK A;  4P1E A;  4OYV A;  4F2Q A;  3K1N A;  4QFN A;  3QYT A;  3MC2 A;  3EHT A;  3RGY A;  1IXG A;  3IL1 B;  3MJN A;  3LC8 A;  1LAG E;  2FBP A;  2F78 A;  3OXN A;  1MXU A;  4IO6 A;  2RC8 A;  5ISU A;  3PUV E;  2WYP A;  4DE8 A;  3TTN A;  1UTH A;  4FED A;  4GBW A;  4BDN A;  1P1W A;  5IZ3 A;  1OMP A;  4NMY A;  3V89 B;  4OVQ A;  2VPN A;  4NED A;  3TAJ A;  4F22 A;  1MQH A;  3A09 A;  4BDR A;  1D9Q A;  2KQZ A;  4JSD A;  1D9Y A;  1FPG A;  3PV0 E;  5AA2 A;  1SBP A;  4TLL B;  4N15 A;  2Q89 A;  2Y7R A;  2Y7I A;  2PFY A;  4GWU A;  4H0W A;  4P8B A;  1TT1 A;  4QFO A;  1A55 A;  5EQ7 A;  1FBG A;  5EHM A;  1KZ8 A;  3DLN A;  4R9G A;  3D4G A;  3PMX A;  5AA3 A;  1IUD A;  5KZT A;  1B5I A;  3LSL A;  2REG A;  4OVT A;  2XD3 A;  4F3B A;  2DE4 A;  2RC7 A;  4GWX A;  4PFB A;  1FCK A;  2DWH A;  2THI A;  2R71 A;  3O6G A;  4Q0C A;  4GX4 A;  3TEL A;  3UGW A;  5I2N A;  5AA4 B;  2Z8E A;  1SYI A;  2O51 A;  2CZI A;  1H76 A;  4NF8 A;  4MJO A;  3TDJ A;  2UVH A;  4ZZA A;  2I3V A;  4HS7 A;  2I0B A;  1ELJ A;  4IY6 A;  3FV1 A;  1USY H;  4OEU A;  4OFL A;  5AE4 A;  2D3I A;  4ZEI A;  3KGC A;  3M8U A;  1LFG A;  2Z8D A;  3EPE A;  5I58 B;  4G77 A;  4DIG A;  5JK4 A;  4P0G A;  5K2X A;  1FTJ A;  1YTV A;  1VR5 A;  1B3L A;  1NL5 A;  3LUZ A;  4IR8 A;  4QSD A;  4JWY A;  1P99 A;  4BLA A;  3H06 B;  5I2K A;  4H8I A;  4LQ5 A;  4TLM B;  1XT8 A;  3UIF A;  3TUS A;  4F19 A;  2NOO A;  4OA4 A;  5I58 A;  2XWI A;  3H3G A;  2W7Y A;  1VSO A;  2LAO A;  4MLV A;  4RPN A;  3HHG A;  4EQB A;  5ITP A;  2WBB A;  1BK4 A;  3KC1 A;  3G3K A;  3IOV A;  4N6D A;  4WED A;  4LON B;  4MX6 A;  4O94 A;  2QL3 A;  1AMF A;  1PDA A;  1AOV A;  3S4U A;  3GZG A;  3ZKK A;  5HPQ A;  2P2A A;  2I3W A;  3IK6 B;  3SEY A;  1Y9U A;  4DCX A;  4HCW A;  2NWJ A;  2X26 A;  2QS2 A;  1M5D A;  4PDD A;  3V5A A;  3CHG A;  3IOT A;  1QUL A;  2E0S A;  4IO2 A;  3MWB A;  1POY 1;  3FXR A;  3R6U A;  4GX3 A;  1Y4C A;  5I5P A;  4NF4 B;  4JBZ A;  2Q2A A;  2ZNT A;  1TFD A;  3VVF A;  1YYZ A;  2HPG A;  3G7W A;  3O28 A;  3OMB A;  5H8Q A;  2O68 A;  4OEN A;  3FGS A;  2AL4 A;  1IIW A;  4F1U A;  4F31 B;  1FBH A;  1MS7 A;  4GL8 A;  3VLU A;  4EQ9 A;  4ONY A;  1P1N A;  4OET A;  2OK2 A;  1K9Z A;  2ZNS A;  3KFM A;  3IFC A;  1MM7 A;  4ELP A;  1PB7 A;  1NNP A;  4N8G A;  3M3F A;  4P3L A;  3ECR A;  2Z22 A;  4P0I A;  4ZEB A;  3WAF A;  5H8N A;  4NG7 A;  4F2O A;  1ATG A;  2A5S A;  4U21 A;  1FTL A;  1N04 A;  2YLN A;  5EHS A;  2HXW A;  5A5L A;  4PFI A;  3PGF A;  4H46 A;  1SW2 A;  4C1U A;  5H8N B;  4MMP A;  3T0J A;  1FQA A;  4GD5 A;  4IO4 A;  5DEX B;  3FAT A;  3K1P A;  4KYD A;  4EQ7 A;  3KJ7 A;  4RA1 A;  3PUY E;  1B4Z A;  5TP9 B;  2F6G A;  4MNI A;  4BDL A;  3UP9 A;  2FHY A;  2CMO A;  3TMG A;  4PP0 A;  4PF8 A;  2HAU A;  4OFO A;  3S2V A;  4NF5 A;  1Z7N E;  4TQU Q;  5I84 A;  3IB2 A;  2O1L A;  3GXA A;  1Z7M E;  2DWI A;  1SYH A;  2DVC A;  2RIN A;  1XVY A;  3I5O A;  1NUY A;  1SW5 A;  3FXU A;  2Y5K A;  3CVG A;  2OLB A;  4XKQ A;  3TFL A;  3EN3 A;  4NF6 A;  1LEV A;  3TPA A;  4DLD A;  2WEF A;  5TU0 A;  1LB8 A;  4GVO A;  4P11 A;  5J16 A;  4I40 A;  3OEN A;  3AXF A;  3TYH A;  1QKB A;  1LCT A; 
#chains in the Genus database with same CATH homology
 4I3Y A;  4P3L A;  4XFE A;  4P56 A;  4OVQ A;  4XF5 A;  2VPN A;  3KC0 A;  4JVD A;  2JJK A;  1FBF A;  3PTY A;  4NGU A;  1G0H A;  2WBD A;  4QBA A;  4F19 A;  5F24 A;  4OA4 A;  1KA0 A;  4JVC A;  3W9W A;  1RDX A;  2L5V A;  4N6K A;  1Q9D A;  3FXB A;  2XWI A;  2P3N A;  3MYU A;  2V3Q A;  4G61 A;  1DBZ A;  1D9Q A;  1FBP A;  3B50 A;  4NG7 A;  3BIG A;  4NN3 A;  5ET8 A;  4HE0 A;  5EQA A;  2KR0 A;  4MEV A;  1RDY A;  3A29 A;  2QVV A;  2KQZ A;  4NF0 A;  1NV3 A;  2MKZ A;  2Q9T A;  2WBB A;  1BK4 A;  3KC1 A;  1FPG A;  3LV0 A;  1FBE A;  4GWS A;  4O8M A;  4P47 A;  4PAK A;  5IZ3 B;  2WYK A;  2VPO A;  1NV0 A;  4N8Y A;  2XWV A;  1IMB A;  1RDZ A;  4M1V A;  2ZZX A;  1FTA A;  2VT5 A;  4N15 A;  4N6D A;  2FIX A;  1FPI A;  3HFU A;  4MX6 A;  4O94 A;  4PDH A;  2PFY A;  4UAB A;  5A5L A;  1FRP A;  3KBZ A;  4GWU A;  5EQ8 A;  4OAN A;  4P8B A;  3E78 A;  4PFI A;  5CM6 A;  2HXR A;  2BJI A;  1DK4 A;  2CEY A;  4X8R A;  3ISP A;  1LBV A;  1K9Y A;  3MST A;  4PFR A;  2FIE A;  4X9T A;  4F18 A;  3BIH A;  5EQ7 A;  1FBG A;  2HHM A;  4H46 A;  1NUW A;  4GBV A;  1NV1 A;  4PAF A;  1NV2 A;  4MAG A;  4GX6 A;  1NV4 A;  1KZ8 A;  1FPB A;  4MCO A;  4PCD A;  4OVP A;  1XI6 A;  5IZ3 A;  4NAP A;  1YZ0 A;  4MIJ A;  4MMP A;  2F5X A;  5EQ9 A;  3T0J A;  4XEQ A;  5LDZ A;  2PCR A;  3EKI A;  5ET7 A;  2B4L A;  2XA5 A;  1NUZ A;  3RYD A;  4PET A;  3RPL B;  2HZL A;  1SPI A;  2Q8M A;  3W9V A;  4O7M A;  4OVT A;  1LBY A;  5EYG A;  1IMC A;  1CNQ A;  1FPD A;  2DE4 A;  4PBQ A;  1FBD A;  1FPL A;  4GWX A;  4HCW A;  1EYJ A;  2OX3 A;  2DDK A;  3QMF A;  4GWZ A;  4PFB A;  5LTC A;  3GYY A;  1DCU A;  4MNI A;  1FSA A;  1JP4 A;  1FPF A;  2DE2 A;  3B8B A;  4GX4 A;  5IZZ A;  1EYI A;  2CEX A;  1FBC A;  1VDW A;  1FPK A;  2HZK A;  2DVZ A;  4PDD A;  5ET6 A;  2R8T A;  1YXI A;  5ESY A;  5FBP A;  3CHG A;  1NV7 A;  4N4U A;  4QXD A;  1NV6 A;  2CZI A;  1IMD A;  2FHY A;  2P3V A;  4HXV A;  4MJO A;  5EYH A;  5IM2 A;  3NOH A;  3RPL A;  3E79 A;  1IME A;  3FBP A;  1QGX A;  4GX3 A;  4N81 A;  4O7I A;  4PE3 A;  4YZZ A;  5I5P A;  4FBP A;  4PF8 A;  4PTK A;  4N17 A;  3U65 A;  2DE3 A;  1NV5 A;  3D1R A;  3ROJ A;  4DI3 D;  2WX9 A;  2ZZW A;  5J1D A;  4DI4 B;  2F3B A;  4NQ8 A;  4P1E A;  2XWK A;  4NX1 A;  4KXP A;  4AS4 A;  1IMF A;  1AWB A;  4P1L A;  4F1V A;  4GWY A;  2XWO A;  1YYZ A;  4I3E A;  2HPG A;  4AS5 A;  2Q74 A;  2QVR A;  1EYK A;  1NUY A;  1IMA A;  1G0I A;  4NHB A;  5DW8 A;  1FPJ A;  1LBZ A;  4F1U A;  2XXK A;  2ZZV A;  4OVR A;  2V4C A;  2GQ1 A;  2Y5K A;  1FBH A;  2CZK A;  2OWZ A;  4LN5 A;  4X04 A;  5I7I A;  1FJ6 A;  4HCY A;  4P9K A;  4MHF A;  1FJ9 A;  2FBP A;  5IZ1 A;  4PAI A;  1LBW A;  1LEV A;  1LBX A;  3SZP A;  1FPE A;  5JK4 A;  3T1B A;  2Y5L A;  1K9Z A;  2F3D A;  1KA1 A;  4PBH A;  4PF6 A;  5T3J A;  5IGA A;  2QPQ A;  2WEF A;  2WYP A;  3LUZ A;  4JVI A;  4PGN A;  4N91 A;  3IFA A;  2QFL A;  4IR8 A;  4YIC A;  4PGP A;  3IFC A;  5J16 A;  4I40 A;  2PFZ A;  1NI9 A;  4PC9 A;  5ET5 A;  4GWW A;  4HE1 A;  2B4M A;  1INP A;  4GBW A;  4MNP A;  2FVZ A;  4HE2 A;  4OVS A;  4H45 A;  4N8G A;  4MNC A;  2QVU A;  1NUX A;  5I3S A;  2CZH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...