4ELRA

Ferric binding protein with iron and carbonate
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
310
structure length
310
Chain Sequence
SPTLTIYSGRGQSLVEPLVKQFEAETGIRVQVRYSTDAQILAALQEEGSRSPADLFWANTAGALGQASAKGLLRPLGETLLEKPIAFVPASRTWVPVTVRLRVLAYNPDRIKAEELPESLLDLPRFAREKGLVGRVGWTPTYSSFQDMVAGMIALYGEEKTREWLLAMKALAPKAYPSNPAMLDAIRAGEVDLGSTNHYYVVRFRRAGYRLGMHHFRDGDAGNLALVTGAGLLKTSKNLAAATRFLTYLLSPQAQQYFVGNIGEYPLVKGVALDPNLLPLEEALAKSPKLDLEKLPLDRALRLLRETGVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Iron ABC transporter, periplasmic iron-binding protein
publication title Crystal structure of ferric binding protein A
rcsb
source organism Thermus thermophilus
molecule tags Metal transport
total genus 108
structure length 310
sequence length 310
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13416 SBP_bac_8 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4elrA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4elrA02
4DXUA 4NWDA 1NH8A 4PFYA 3O6HA 3H6WA 3UIFA 4G68A 1BIYA 1USYH 3H6VA 2DP8A 1H43A 3TODA 1XT8A 5I2KB 2XXRA 2V25A 3W15C 4F39A 4IO2A 1UTBA 4ZE9A 1MS7A 2QRYA 2D5WA 2RCAA 2RC9A 5JEIA 4NF4A 4F19A 1OMPA 3M3KA 3UA8A 1LB9A 2ZXTA 3MZ9A 2IA4A 4U2RA 2D21A 2OCUA 4OEUA 1SBPA 1GV8A 5L9MA 3S4UA 4KYSA 4G68C 4Q8RA 1NMUA 2ZNUA 1Y4CA 3G3KA 3OXNA 3TCHA 1N0TA 4F18A 5I2NA 2E1SA 3CFXA 3VVFA 2DQVA 1BTJA 2F78A 2O1LA 1KWHA 5H8SA 3KJTA 3S9LC 4RYAA 3C33A 4M1VA 4H0WA 3U8QA 4YAHX 3C4MA 5FTIA 5M2VA 3K01A 1A54A 4EXLA 3G3FA 4OTEA 3OEMA 4BDMA 3RT8A 4EXKA 3RUMA 4JSDA 1OQHA 1TFAA 4KR5A 1S50A 2F6GA 3RTWB 4XKQA 4FECA 4KHZE 4OXVA 3MPKA 3FVKA 3FV1A 1UTHB 2F6PA 1HSEA 3H6UA 5CMKA 1Y1ZA 2I0CA 3IR1A 3IX1A 4TOZA 3IO4A 4ELOA 3OENA 4QSCA 2Y7RA 1QKBA 1SVXB 4Q30B 1LAXA 2NOOA 5K2XA 4R72A 1JW1A 1NKXA 2BJJX 2D3IA 3IB0A 4MBPA 2O7UA 3OEKA 1B3LA 4E0WA 3T9UA 1EZOA 5H8NB 4XKRA 3SEXA 3Q26A 3PUWE 1B05A 1FQAA 4AB5A 2IEEA 3UGWA 3G7WA 5AA4A 2XXTA 1IEJA 3G3IA 4MF3A 4KQPA 2Z22A 3V8XB 1EZPA 1ZTYA 2HCAA 3QYTA 2VOZA 3ILTB 3KSXA 2QPQA 4GXAA 3RGYA 2W7YA 4JWXA 1QUJA 3I6VA 2V3QA 3KSJA 4ZS9A 3HCQA 4LONB 2GHBA 5H8FB 4FATA 4RPOA 2V84A 4ZZEA 2P2AA 4H1XA 3TUSA 2NUVA 4HCYA 4KI0E 5CM6A 3T9XB 1MY4A 3OO9A 1RYXA 4ONYA 2H99A 3H6TA 1B3HA 1GR2A 4JB7A 2Y7WA 4FJPA 4NF5A 5JK4A 1AL3A 1WVJA 3O28A 3T22A 3BFUA 4QFOA 3THIA 4N6PA 5H8QB 4NWCA 4QFPA 4GRKA 1SW4A 3V89B 3PUVE 4NF8B 5DTBA 4PE5B 2RC8A 4R6HA 4XKNA 1ZJLA 1H44A 1LSTA 1DTGA 4ISUA 4G8HA 1B4HA 4GL0A 4THIA 2KLFA 3CG1A 1B0HA 3PD8A 4YB7A 2QS1A 3F11A 2HAVA 1EU8A 1I69A 4ECFA 1NNFA 1Y3QA 1Y9UA 1MQHA 4RY1A 2XHDA 4OHNA 3I5OA 5KDTA 3MP8A 2AL4A 1CB6A 2O68A 5I59A 1SI1A 2UVJA 5TPAA 2UYFA 2H5YA 3GLBA 3O97A 2O7IA 3TCFA 5KCJA 5AA2D 4IO6A 1SW2A 3N6TA 1B9JA 3FATA 4DXCA 5I56B 2QS4A 3SERA 2Q2AA 4GLIA 1VFEA 2F8DA 3DLNA 4F1VA 3O9PA 4PFTA 1Y20A 4DLDA 4EF2A 2XD3A 1SQYA 5CMMA 4OVJA 4OERA 4FIMA 4ZECA 1LLSA 1JEVA 2V93A 1LFHA 1SI0A 3MZBA 1N3WA 1XVYA 3Q28A 5CBRA 1B2HA 4U4XA 1GGGA 4EQBA 4Z7EA 4OQOA 2B65A 4F3PA 5F1QA 1P1NA 3KN7A 3FJGA 3QUFA 2Y84A 1Y4TA 3OO6A 4XIGQ 4PETA 3H7MA 2FYIA 4H5GA 2F7AA 4FEDA 3KG2A 4ZEKA 4DCXA 1OVBA 3N5LA 2NVUB 5I2KA 3UK4A 3RNNA 2V3TA 3EF7A 4R75A 3CFLA 4OESA 3TTNA 3ZSFA 5H8HB 2RC7A 4BDOA 2H9BA 1LCFA 3PPNA 2ZYNA 3K6VA 4PFUA 4R74A 3KN8A 4YMBA 4YKKA 3LBSA 2RINA 3OSRA 2Y7IA 5DVFA 4I1DA 4GL8A 4F3GA 3PPOA 3Q27A 1YCJA 1ZIUA 3T9HB 5I58A 1B5IA 2DS9A 1FTJA 5HBCA 5CC2A 3ECRA 2VD2A 1P1OA 2AL5A 1MQIA 3SESA 3O2AA 2XD2A 4IO3A 3CI8A 4KPTA 3K1PA 3CSBA 4MFIA 1OLCA 3KZGA 3LSWA 4ELRA 2Q89A 4K3FA 2QL3A 2I48A 2PT1A 3MVXA 4JDFA 1A40A 3MUQA 1B4ZA 1ATGA 4F22A 4WXJA 2X7PA 2OLBA 1QULA 4NF6B 2DWJA 4O3CA 4YB6A 4P0GA 3QIMA 4GD5A 3VLVA 1M5EA 2I3WA 3SDFA 1B6HA 4HCWA 3ZKKA 1B51A 1B1XA 2F7CA 1A8FA 3M8UA 1LCTA 4KFQA 3RY3A 2PBWA 3TFLA 1O7TA 1UTHA 3T9VA 2I4CA 3OSQA 3VDFA 2VGQA 1SDXA 1VE4A 3SEWA 4E0XA 1RKMA 4X9TA 2DYXA 1M5BA 2CZLA 3R26A 3S9NC 2DE4A 5DYHA 1D4NA 1N7XA 4RA1A 1RYOA 4F1UA 2QSXA 3S9EA 4FORA 3KEIA 4F29A 4KYDA 1BP5A 1MQJA 2A5SA 3S9MC 5B7DA 5H8NA 1IIWA 1LB8A 3MP1A 4OZ9A 3U93A 5A5XA 1M5DA 1B46A 3RLFE 2XXUA 5CRYA 2PX1A 4I62A 4QSDA 3LUYA 3L6GA 3TYHA 5DVJA 2I3VA 5EHSA 3PMXA 5KZTA 2OWTA 3UP9A 4R2BA 3MP6A 1MPBA 5LOMA 1FQDA 3KOTA 1FQCA 3E4RA 4IY6A 2ZYOA 2M8CA 5DEXB 4U23A 5H8FA 1MXXA 1PDAA 3JYRA 3A09A 2HFBA 2H25A 4DE8A 4F1YA 3L6HA 4BDQA 3TELA 4GXSB 2XXHA 1ZMGA 4QFNA 1VSOA 2XXPA 3E9XA 3OD7A 2HXWA 4YICA 3PPRA 3ILUB 3TTKA 3OO8A 3M3LA 3SETA 5H8QA 3KGCA 1Q1KA 1D9YA 3QK6A 1LBCA 2REJA 1FTKA 5ELVA 4AB6A 1NH7A 1LFGA 4KCDA 3OMBA 3FJMA 4YZZA 4Z0IA 4JWOA 1EZ9A 1FTMA 4PQJA 2R6GE 3MVWA 3PUZE 1YTVA 1XHYA 4NF4B 3TPAA 4OFOA 3T66A 2ANJA 1XOCA 2GFEA 4RJZA 4OEVA 4I9DA 3CSGA 3W9WA 4OMBA 3UORA 4ZEDA 4I8CA 3V5AA 3FV2A 3N26A 3N94A 1Z7NE 1Y1MA 1PB8A 4ZEFA 5I2NB 1QKAA 3HSTA 1WDNA 2H98A 3IOTA 3CFZA 2XXXA 1CE2A 5BWJA 4F31B 4LA9A 4QF9A 3LSFB 2Z8EA 3CVGA 4IO7A 3JZJA 1TWYA 4EF1A 1UIUA 4G8NA 2XXVA 4R6KA 3MC2A 5I56A 4KD5A 3VLWA 2REGA 1I6AA 4EDPA 3C32A 1MH4A 1B52A 4RNSA 5AA2A 2DWHA 4H5FA 4IY5A 1N84A 1GTKA 3K4UA 2QMXA 1OLAA 3WAFA 4H65A 5L8DA 1ZBMA 4H8IA 3RN8A 4R9GA 3D4CA 4OFLA 2XX9A 5IKBA 2HQ0A 4LZ5A 5J1DA 4RK2A 1PEBA 3PV0E 2AYSA 4XTCQ 1FQEA 3ONMA 3BKIB 4ZEIA 1MDP1 4F2OA 4NEDA 1JVXA 3DM0A 2X26A 4NTLA 3OO7A 1LBBA 2ZNSA 1AH5A 1H45A 3BBRA 1IZ1A 5EHMA 2Y7KA 3VFJA 3O29A 1XC1A 3EHUA 4QFLA 2I6EA 2NXOA 3FXRA 2P0SA 4M4GA 4YU0A 1VR5A 1LFIA 1IUDA 3SEYA 2F36A 1YAEA 5AA4B 3VVEA 1FQBA 1JEUA 4HTGA 2DSFA 2HZKA 4DDDA 5K2YA 2A5TB 5DT6A 4YKJA 4KYEA 1AMFA 3TTRA 2OBGA 2QS2A 2F97A 1URDA 2CMOA 4R2FA 3C34A 1MG1A 4DZ1A 3TKDA 5TP9A 1O63A 4F3BA 2Q9TA 3K1MA 2XX8A 2FA7A 4KCCA 1SYIA 4WEDA 4DCYA 3PMVA 3T93B 1MPDA 1TXFA 3MVZA 3HN0A 1DPEA 4H8JA 4LVQA 4GIZA 3IL1B 5L9OA 3K0VA 4JSOA 5L9SA 3EHTA 3FVNA 1B5HA 5ICTA 4NF5B 1BLFA 5FHNA 5F7VA 2I0BA 1ZKBA 4QSEA 2GHAA 5FHOA 4R9FA 1M5CA 1Y3PA 1M5FA 1JETA 4ESWA 1OIBA 1XS5A 5CI5A 2HEUA 4EUOA 4LUBA 1N76A 1USYE 2DVCA 3FUZA 1GVCA 4WKMA 5JTYB 1US4A 3DELB 2DE3A 1MXZA 2F35A 4FEBA 1MY2A 4P0IA 2GRVA 3CG3A 3HPIA 3O66A 1N04A 2PT2A 1URGA 4FE8A 3IJXB 5ITPA 2UXAA 3C9HA 2YLNA 1SD3A 2ZYKA 3B6QA 4NE4A 1B7HA 2WKYA 5CBSA 3CIJA 2DXRA 3MPLA 4JBZA 2ZMBA 1FTLA 1B58A 3HV1A 1J1NA 1R9QA 1AOVA 1A7LA 1MY3A 4P11A 3K6WA 3TEPA 2R71A 1PBQA 1TT1A 1NNPA 4XKPA 1MXYA 1IXHA 4IO4A 3PGFA 2OK2A 5I59B 1R6ZA 2P1SA 3MQ9A 1N7WA 5CMCA 4F2QA 2F7BA 3KOSA 4MH5A 3U94A 4DIGA 2ONKE 1B3EA 3O6IA 3TQWA 5KCJB 4LQ5A 3Q29A 4LATA 1JW4A 2Q88A 5DEXA 5BUUA 1R9LA 2NWJA 3MWBA 3VV5A 3LSXA 4JXIA 5FHMA 3QAXA 2B3BA 2H4IA 3H4ZA 3M3FA 1Y3NA 3CR9A 1JQFA 3U92A 2UYEA 4IB2A 1DSNA 2XX7A 4DXBA 3VVDA 5I57B 3PD9A 4QHQA 1MQGA 5ICQA 1T0KA 1P1UA 4IGTA 1B1HA 4JWYA 4H6DA 3FVGA 4OYVA 3TZAA 3RT6B 5IAIA 4POXA 1MY0A 1A99A 4Q0CA 3ZS6A 4TLMB 2DE2A 1MDQA 2YJPA 3E3KA 4EQ9A 3GXAA 2I4BA 2Q2CA 2ESNA 1B40A 2Z8FA 2R9JA 3TMGA 5AA1A 2DWAA 3PU5A 3R7XA 2QJEA 2ALUA 5CMBA 1IXGA 4RXLA 1MRPA 1MPCA 4U22A 1LAHE 4ZZAA 3IOWA 2ONRA 1NNTA 4TQUQ 1B32A 1MY1A 2Y7PA 4U1ZA 1FQFA 1POTA 1D9VA 3KJ7A 5I58B 4N13A 2VD3A 1UQWA 2HAUA 3GBBA 1NFTA 5AE4A 3B6WA 1QVSA 3MBPA 2Z23A 3OOAA 1MXUA 4O3AA 3PUXE 4G4PA 4MLQA 2XXYA 1ELJA 4U1OA 4U4SA 3VXCA 4XXUA 3FD3A 1OVTA 3LSLA 2O1MA 3G3JA 1S7YA 1NNKA 1URSA 2XXWA 3KFMA 1VFDA 1B7ZA 3QXMA 3EPEA 1HSJA 4YMAA 1JW5A 4NMYA 1NL5A 3PUYE 1ZU0A 3EQ1A 1DOTA 4G68B 3VLUA 4FAJA 4NF8A 3MJNA 1A55A 2XXIA 3H03A 1LAGE 4PP0A 4YB5A 4RPNA 2F34A 3D4GA 1PC3A 3C36A 1FW0A 1S9TA 1P99A 1QJMA 3CRBA 2VP1A 4G77A 4GQOA 3T96B 1QW0A 2QMWA 3U72A 1UTBB 1DMBA 3OELA 4F3SA 3VE1B 3UN6A 4EQ7A 3K6XA 3MAMA 4BDNA 4QFKA 4R6YA 4GWOA 5A5XB 2OJTA 1QUKA 1ANFA 2RF1A 1Q35A 2AIXA 2UVGA 1F9BA 1MM7A 3FZVA 1JVYA 3PPQA 3O6GA 1IXIA 2ZNTA 2A5TA 1B7UA 3EN3A 1P1WA 5HPQA 2Z8DA 3EHSA 3ODBA 3S2VA 1WODA 1LAFE 4MLVA 3LC8A 1II5A 3FIRA 1PB9A 3IOVA 3MZ1A 3V83A 2O51A 4ESXA 3A3CA 4HS7A 3H06B 2HZLA 3PMWA 2GH9A 3TDJA 3K6UA 2UVHA 3QSLA 3G3GA 1D3KA 3QUJA 3IJOB 2QS3A 2X7QA 3A3UA 2OWSA 3RTFB 5DVIA 3U1OA 3I3VA 3WAEA 2PMSA 3FXUA 1HSLA 4Q5TA 5FTHA 3IAZA 1PBPA 4AQ4A 1N3XA 3H3GA 3RQTA 1TFDA 3SEVA 4IO5A 4WEPA 5ISUA 1IITA 4ELPA 4RK9A 1AIVA 2O84X 1JNFA 5JTYA 5H8HA 4GF8A 2DOJA 4YKPA 3W9VA 1MM6A 3C31A 3SKPA 4POWA 1O64A 2UVIA 3Q25A 2B3FA 2PYYA 2V3UA 3TAJA 1POY1 4ZDMA 2XXQA 3FASA 2I58A 1MXWA 3PPPA 3P7IA 3IK6B 3B6TA 2DWIA 4QRZA 2PVUA 3BFTA 1P1QA 3DP4A 3GBAA 1SW1A 1I6QA 4LZ7A 5B70A 4O3BA 1FTOA 1OQGA 4G8MA 3IORA 3USDA 3DP6A 4ELQA 4OWDA 2Q8JA 1QUIA 1BKAA 1US5A 4OETA 3HHGA 2DVZA 4G2ZA 2E0SA 5HM4B 1H76A 3TQLA 1DPPA 4BDRA 5EYFA 2RKMA 3SEUA 3TCGA 1A8EA 3LR1A 3TTMA 1SW5A 3E13X 4IGRA 2YPNA 1I6BA 4NF6A 2FNCA 3N6UA 4R73A 5AA2B 3K2DA 1MH3A 1MXVA 2THIA 5TU0A 3JV9A 5I84A 3VXBA 5I57A 1IQ7A 3KBRA 2O6AA 2G29A 3ZKLA 3FXQA 1LGBC 3R6UA 2RCBA 3K00A 4LP2B 4PFWA 4HW8A 4GFRA 4N07A 3FVOA 5ITOA 4U21A 4OENA 3IOUA 1XVXA 4ND9A 1DTZA 4OFJA 3C35A 1PB7A 1R1NA 3DP8A 3HO7A 1H3DA 4GVOA 2I49A 4C1UA 1B5JA 2DXYA 2LAOA 2O69A 4X1BA 1SYHA 5AA3A 3B7DA 4UA8A 5KDTB 3TTLA 4C1TA 4ZE8A 2OZZA 3K02A 4X1DA 3G3HA 5TPAB 4UACA 1B3FA 3GZGA 4LQ2A 3FJ7A 1FCKA 3IB2A 1MQDA 2ABHA 4BDLA 2ZYMA 2VHAA 3FGSA 1ZLQA 3HHFA 5TP9B 1YPNA 1L5TA 3AXFA 1IXCA 2G93A 4YKIA 3RPWA 4L17A 3IO6A 4BLAA 1UIVA 1B0LA 3K1NA 4LZ8A 3KN3A 3MW0A 4X48A 4C0RA 4TLLB 1EH3A 2F5XA 1Z7ME 1B3GA 4GOTA 4ZEBA 4H67A 3IB1A 3MVYA 2ONSA
chains in the Genus database with same CATH superfamily
4DXUA 4NWDA 1NH8A 4PFYA 3O6HA 3H6WA 3UIFA 4G68A 1BIYA 1USYH 3H6VA 2DP8A 1H43A 3TODA 1XT8A 5I2KB 2XXRA 2V25A 3W15C 4F39A 4IO2A 1UTBA 4ZE9A 1MS7A 2QRYA 2D5WA 2RCAA 2RC9A 5JEIA 4NF4A 4F19A 2FBPA 1OMPA 2OWZA 3M3KA 3UA8A 1LBXA 1LB9A 2ZXTA 3MZ9A 2IA4A 4U2RA 2D21A 2OCUA 4OEUA 1FBCA 1SBPA 1GV8A 5L9MA 3S4UA 4KYSA 4G68C 4Q8RA 1NMUA 2VT5A 2ZNUA 1KZ8A 1Y4CA 3G3KA 3OXNA 3TCHA 1N0TA 4F18A 2CZHA 5I2NA 2E1SA 3CFXA 2BJIA 3VVFA 2DQVA 1BTJA 2F78A 2O1LA 1KWHA 5H8SA 3KJTA 3S9LC 5LTCA 4RYAA 3C33A 4M1VA 4H0WA 3U8QA 4YAHX 4JVCA 3C4MA 5FTIA 5M2VA 2XWOA 3K01A 1A54A 4EXLA 3G3FA 4OTEA 3FBPA 3OEMA 4BDMA 3RT8A 4EXKA 3RUMA 4JSDA 1OQHA 1TFAA 4KR5A 1S50A 2F6GA 3RTWB 4XKQA 4FECA 4KHZE 4OXVA 2B4MA 3MPKA 3FVKA 3FV1A 1UTHB 2F6PA 1EYJA 1HSEA 3H6UA 5CMKA 1Y1ZA 2I0CA 3IR1A 3IX1A 4TOZA 3IO4A 4ELOA 3OENA 4JVDA 4QSCA 2Y7RA 1QKBA 1SVXB 4Q30B 1LAXA 2NOOA 5K2XA 4R72A 1JW1A 1NKXA 1RDYA 2BJJX 2D3IA 3IB0A 4MBPA 1NUWA 2O7UA 3OEKA 1B3LA 3ROJA 4E0WA 4JVIA 1FBFA 3T9UA 1EZOA 5H8NB 4XKRA 3SEXA 3Q26A 3PUWE 1B05A 1FQAA 4AB5A 2IEEA 3UGWA 3G7WA 5AA4A 2XXTA 1IEJA 3G3IA 1NV2A 4KQPA 4MF3A 1DBZA 2Z22A 4NHBA 3V8XB 1EZPA 1ZTYA 2HCAA 3QYTA 2XWKA 2VOZA 4OVRA 3ILTB 3KSXA 4N17A 2QPQA 4GXAA 4NGUA 3RGYA 2W7YA 4JWXA 2VPNA 1QUJA 3I6VA 1LEVA 2V3QA 3KSJA 4ZS9A 3HCQA 4LONB 4GWYA 2GHBA 2MKZA 5H8FB 4FATA 4RPOA 2V84A 4ZZEA 2P2AA 4H1XA 3TUSA 2NUVA 4HCYA 4KI0E 5CM6A 3T9XB 1MY4A 3OO9A 1RYXA 4ONYA 2H99A 3MYUA 4HE2A 1FPIA 3H6TA 1B3HA 1FBPA 4OVQA 1GR2A 4GX4A 4JB7A 2Y7WA 1NUXA 4FJPA 4NF5A 5JK4A 1AL3A 1WVJA 3O28A 3T22A 3BFUA 4QFOA 3THIA 4N6PA 5H8QB 4NWCA 4QFPA 4GRKA 1SW4A 3V89B 3PUVE 4NF8B 5DTBA 2WBBA 4NX1A 4PE5B 2RC8A 4R6HA 4XKNA 1JP4A 1ZJLA 4P47A 1H44A 1LSTA 1DTGA 1D9QA 4ISUA 4G8HA 1B4HA 4GL0A 4THIA 2KLFA 3CG1A 1B0HA 5EYHA 1RDXA 3PD8A 4YB7A 2QS1A 5I7IA 3F11A 2HAVA 4KXPA 3PTYA 1EU8A 1I69A 4ECFA 1NNFA 1Y3QA 1Y9UA 1MQHA 3B8BA 4RY1A 3KC1A 4GWWA 2XHDA 4OHNA 4HXVA 3I5OA 5KDTA 3MP8A 2AL4A 4H45A 5IZZA 5A5LA 1CB6A 2O68A 4GWXA 5I59A 1SI1A 2UVJA 5TPAA 2UYFA 2H5YA 3GLBA 3O97A 2O7IA 3TCFA 5KCJA 5AA2D 3RYDA 1NV0A 4IO6A 1SW2A 3N6TA 1B9JA 3FATA 4DXCA 4GBWA 5I56B 2QS4A 3SERA 2Q2AA 4GLIA 1VFEA 2F8DA 3DLNA 4F1VA 3O9PA 4PFTA 1Y20A 4DLDA 4EF2A 2XD3A 1SQYA 5CMMA 4OVJA 4OERA 4FIMA 4ZECA 1LLSA 1JEVA 2V93A 1LFHA 1SI0A 3MZBA 4OVSA 1FPKA 1N3WA 1XVYA 3Q28A 1K9ZA 5CBRA 1B2HA 4U4XA 1GGGA 4EQBA 4Z7EA 4OQOA 2B65A 4PCDA 4F3PA 5F1QA 1P1NA 3KN7A 3FJGA 3QUFA 2Y84A 1Y4TA 3OO6A 4XIGQ 4PETA 3H7MA 2FYIA 4H5GA 2F7AA 4FEDA 3KG2A 4ZEKA 4DCXA 2F3BA 1OVBA 3N5LA 2NVUB 5I2KA 3UK4A 3RNNA 4XEQA 2V3TA 3EF7A 4R75A 3CFLA 4OESA 1AWBA 3TTNA 3ZSFA 5H8HB 2RC7A 4BDOA 2WX9A 2H9BA 1LCFA 3PPNA 2ZYNA 5ET7A 3K6VA 4PFUA 4R74A 2QVRA 3KN8A 4YMBA 4PGNA 4YKKA 3LBSA 2RINA 3OSRA 4GX3A 2Y7IA 5DVFA 4I1DA 4GL8A 4F3GA 3PPOA 2KQZA 3Q27A 1YCJA 1ZIUA 3T9HB 5I58A 1B5IA 2DS9A 1FTJA 5HBCA 5CC2A 3ECRA 2VD2A 1P1OA 2AL5A 1MQIA 3SESA 3O2AA 2XD2A 4IO3A 3CI8A 4KPTA 3K1PA 3CSBA 4MFIA 1OLCA 3KZGA 3LSWA 4ELRA 2Q89A 4K3FA 2QL3A 2I48A 1IMCA 2PT1A 3MVXA 4JDFA 1VDWA 5ESYA 1A40A 3MUQA 1B4ZA 1ATGA 4F22A 4WXJA 4O7MA 2X7PA 2OLBA 1QULA 4NF6B 1XI6A 2DWJA 1INPA 1LBZA 4O3CA 4YB6A 1IMEA 2WYKA 4P0GA 3QIMA 2L5VA 4GD5A 3VLVA 1FPLA 1M5EA 2I3WA 4P8BA 3SDFA 1B6HA 2OX3A 4HCWA 3ZKKA 1B51A 1B1XA 2VPOA 2F7CA 1A8FA 3M8UA 1LCTA 4KFQA 3RY3A 2PBWA 3TFLA 1O7TA 1UTHA 3T9VA 2I4CA 3OSQA 3VDFA 2VGQA 1FPJA 1SDXA 1VE4A 3T1BA 3SEWA 4E0XA 1RKMA 4X9TA 2DYXA 1M5BA 2CZIA 2CZLA 3R26A 4O8MA 3S9NC 2DE4A 5DYHA 1NUYA 1D4NA 5I3SA 1N7XA 4RA1A 1RYOA 4F1UA 2QSXA 2Q8MA 3S9EA 4FORA 3KEIA 4F29A 4KYDA 1BP5A 1MQJA 2A5SA 3S9MC 5B7DA 5H8NA 1IIWA 1LB8A 3MP1A 4OZ9A 1DCUA 3U93A 5A5XA 1M5DA 1B46A 3RLFE 3ISPA 2XXUA 5CRYA 2PX1A 4I62A 4QSDA 3IFCA 2WBDA 4P56A 3LUYA 3L6GA 2FVZA 3TYHA 5IZ3A 5DVJA 2I3VA 1YYZA 5EHSA 5ET8A 3PMXA 5KZTA 2OWTA 3UP9A 4R2BA 3MP6A 4NQ8A 1MPBA 3KC0A 5J16A 5LOMA 1FQDA 3KOTA 1FQCA 3E4RA 4IY6A 2ZYOA 2M8CA 5DEXB 4U23A 5H8FA 3SZPA 1MXXA 1PDAA 3JYRA 3A09A 2HFBA 2H25A 4DE8A 4F1YA 2R8TA 3L6HA 4BDQA 3TELA 4P1LA 4GXSB 2XXHA 1ZMGA 4QFNA 1VSOA 2XXPA 2KR0A 3E9XA 3OD7A 3A29A 2HXWA 4YICA 3PPRA 3ILUB 3NOHA 3CHGA 3TTKA 3OO8A 3M3LA 3SETA 3KBZA 5H8QA 3KGCA 1Q1KA 1D9YA 3QK6A 1LBCA 2REJA 1FTKA 5EQ8A 5ELVA 4AB6A 1NH7A 1LFGA 4KCDA 3OMBA 5IZ1A 3FJMA 4YZZA 4Z0IA 4JWOA 4MX6A 1EZ9A 1FSAA 1FTMA 4PQJA 1IMBA 2R6GE 3MVWA 3PUZE 1YTVA 1XHYA 4NF4B 3TPAA 4OFOA 3HFUA 3T66A 2ANJA 1KA1A 1XOCA 2GFEA 1YZ0A 4RJZA 4OEVA 4IR8A 4I9DA 3CSGA 3W9WA 4OMBA 3UORA 4ZEDA 4I8CA 3V5AA 3FV2A 3N26A 3N94A 1Z7NE 1Y1MA 1PB8A 4ZEFA 5I2NB 1QKAA 4N8GA 3HSTA 1WDNA 2H98A 3IOTA 3CFZA 2XXXA 1CE2A 4NN3A 4F31B 5BWJA 4LA9A 4QF9A 3LSFB 1RDZA 1FBEA 2Z8EA 3CVGA 4IO7A 3JZJA 1TWYA 4EF1A 1UIUA 4G8NA 2XXVA 4R6KA 2GQ1A 3MC2A 5I56A 4KD5A 3VLWA 3BIHA 2REGA 1I6AA 4EDPA 3C32A 1MH4A 1B52A 4RNSA 5AA2A 2DWHA 4PAKA 4H5FA 4IY5A 1N84A 1GTKA 3K4UA 4GWZA 2QMXA 1OLAA 3WAFA 4H65A 5L8DA 5EYGA 3MSTA 1ZBMA 4H8IA 3RN8A 4R9GA 3D4CA 5ET6A 4OFLA 4PAFA 2XX9A 5IKBA 2HQ0A 4LZ5A 5J1DA 4RK2A 1PEBA 3PV0E 2CEXA 2AYSA 4XTCQ 1FQEA 3ONMA 3BKIB 4ZEIA 1MDP1 4F2OA 2Y5KA 4NEDA 1JVXA 4N6DA 3DM0A 4OVPA 2X26A 4NTLA 3OO7A 1LBBA 2ZNSA 1AH5A 1H45A 3BBRA 1IZ1A 5EHMA 2Y7KA 2PFZA 3VFJA 1NV5A 3O29A 1XC1A 3EHUA 4QFLA 2I6EA 2NXOA 3FXRA 3B50A 2P0SA 4M4GA 4YU0A 1VR5A 1LFIA 1IUDA 3SEYA 2F36A 1YAEA 5AA4B 3VVEA 1FQBA 1JEUA 2HHMA 4HTGA 2DSFA 2HZKA 4DDDA 4I3EA 5T3JA 5K2YA 2A5TB 3U65A 4OANA 5DT6A 4YKJA 4PDDA 4KYEA 5FBPA 1AMFA 3TTRA 1IMAA 2OBGA 2QS2A 4MEVA 2F97A 1URDA 2CMOA 4R2FA 3C34A 1MG1A 4DZ1A 3TKDA 5TP9A 1O63A 4F3BA 2Q9TA 3K1MA 2XX8A 2FA7A 4KCCA 1DK4A 1FJ9A 1SYIA 4WEDA 4DCYA 3PMVA 3T93B 4DI3D 1MPDA 1TXFA 3MVZA 3HN0A 1DPEA 4H8JA 4LVQA 3RPLB 4GIZA 3IL1B 1EYIA 5L9OA 3K0VA 1FBHA 4JSOA 5L9SA 3EHTA 3FVNA 1B5HA 4MCOA 5ICTA 4NF5B 1BLFA 5FHNA 3EKIA 5F7VA 2I0BA 3E78A 1ZKBA 4QSEA 2GHAA 5FHOA 4R9FA 1M5CA 1Y3PA 1M5FA 5IGAA 1JETA 4ESWA 1OIBA 1QGXA 1XS5A 5CI5A 2HEUA 4EUOA 4LUBA 4MIJA 1N76A 1USYE 2DVCA 3FUZA 1GVCA 4WKMA 5JTYB 1US4A 3DELB 1FBDA 2F3DA 2DE3A 1LBYA 1MXZA 4N91A 2V4CA 2F35A 4FEBA 1MY2A 4P0IA 2GRVA 3CG3A 3HPIA 3O66A 1EYKA 1N04A 1NUZA 2PT2A 1URGA 4FE8A 3IJXB 5ITPA 2UXAA 4P1EA 3C9HA 2YLNA 1SD3A 2ZYKA 3B6QA 2FIXA 4NE4A 1B7HA 2WKYA 5CBSA 3CIJA 5DW8A 2DXRA 3MPLA 4JBZA 2ZMBA 1FTLA 1B58A 3BIGA 3HV1A 1J1NA 1R9QA 2XWVA 1AOVA 1A7LA 1MY3A 4P11A 3K6WA 3TEPA 2R71A 2ZZWA 1PBQA 4AS5A 4PE3A 1TT1A 1NNPA 4XKPA 1MXYA 1IXHA 1NI9A 4IO4A 3PGFA 2OK2A 4N81A 5I59B 1R6ZA 1KA0A 2P1SA 3MQ9A 1N7WA 5CMCA 4F2QA 2F7BA 3KOSA 4MH5A 3FXBA 3U94A 2ONKE 4DIGA 1B3EA 3O6IA 3TQWA 5KCJB 4N6KA 1FBGA 4LQ5A 2B4LA 3Q29A 4LATA 1JW4A 2Q88A 5DEXA 5BUUA 1R9LA 4PDHA 2NWJA 3MWBA 3VV5A 3LSXA 1FPBA 4JXIA 5FHMA 3QAXA 2B3BA 4FBPA 5EQAA 2H4IA 3H4ZA 3M3FA 1Y3NA 3CR9A 1JQFA 3U92A 2UYEA 2P3VA 4IB2A 1DSNA 2XX7A 2P3NA 5EQ9A 4DXBA 2FHYA 3VVDA 5I57B 3PD9A 4QHQA 1MQGA 5ICQA 4P3LA 2PCRA 1T0KA 1P1UA 4IGTA 1B1HA 2JJKA 4JWYA 4H6DA 3FVGA 4OYVA 3TZAA 4PFIA 3RT6B 5IAIA 4POXA 1MY0A 1A99A 4OA4A 4Q0CA 3ZS6A 4TLMB 2DE2A 1G0HA 1MDQA 2YJPA 3E3KA 4EQ9A 3GXAA 2I4BA 2Q2CA 5F24A 2ESNA 1B40A 2Z8FA 2R9JA 3TMGA 5AA1A 2DWAA 3PU5A 3R7XA 2QJEA 4PGPA 2FIEA 2ALUA 5CMBA 1IXGA 4RXLA 1MRPA 1MPCA 4U22A 1LAHE 4ZZAA 4PFRA 3IOWA 2ONRA 1NNTA 4TQUQ 1B32A 1MY1A 2Y7PA 4U1ZA 4N4UA 1FQFA 1POTA 1D9VA 3KJ7A 5I58B 4N13A 2HXRA 2VD3A 1UQWA 2HAUA 4OVTA 4QXDA 3GBBA 1NFTA 5AE4A 4QBAA 3B6WA 1QVSA 3MBPA 1FJ6A 4XF5A 2Z23A 3OOAA 1MXUA 4O3AA 3PUXE 4G4PA 4MLQA 2XXYA 1FTAA 1ELJA 4U1OA 4U4SA 3VXCA 4XXUA 3FD3A 1OVTA 3LSLA 4O94A 2O1MA 3G3JA 1S7YA 1NNKA 1LBWA 1URSA 2XXWA 3KFMA 1VFDA 1B7ZA 3QXMA 3EPEA 1HSJA 1FRPA 4YMAA 1JW5A 4GBVA 4NMYA 1NL5A 3PUYE 1ZU0A 2HPGA 3EQ1A 1DOTA 4G68B 3VLUA 4FAJA 4NF8A 3MJNA 1A55A 2WYPA 2ZZVA 2PFYA 2XXIA 3H03A 1LAGE 4PP0A 4YB5A 3QMFA 4MNCA 4RPNA 2F34A 3D4GA 1PC3A 3C36A 1FW0A 1S9TA 1G0IA 1P99A 1QJMA 3CRBA 4GWSA 2VP1A 4G77A 4GQOA 4HE0A 3T96B 1QW0A 2QMWA 3U72A 1UTBB 1DMBA 3OELA 4F3SA 4G61A 3VE1B 1YXIA 1NV3A 3UN6A 4EQ7A 4PF8A 3K6XA 3MAMA 4BDNA 4QFKA 1NV7A 4R6YA 4GWOA 4H46A 5A5XB 2OJTA 1QUKA 2DDKA 1ANFA 2RF1A 2QFLA 1Q35A 2AIXA 4MAGA 2UVGA 1F9BA 1MM7A 3FZVA 1JVYA 3PPQA 3O6GA 5IZ3B 2CZKA 4NG7A 1IXIA 1CNQA 2ZNTA 2A5TA 1B7UA 3EN3A 1P1WA 5HPQA 4I40A 2Z8DA 4O7IA 5EQ7A 3EHSA 3ODBA 3S2VA 1WODA 1LAFE 4MLVA 3LC8A 1II5A 2XWIA 3FIRA 1PB9A 3IOVA 3MZ1A 3V83A 2O51A 4ESXA 3A3CA 4HS7A 3H06B 4NF0A 4HE1A 2HZLA 4AS4A 3PMWA 5I5PA 2GH9A 3TDJA 3K6UA 2UVHA 3QSLA 3RPLA 3G3GA 1D3KA 3QUJA 3IJOB 4N8YA 2QS3A 2X7QA 3A3UA 2OWSA 4N15A 3RTFB 5DVIA 3U1OA 3I3VA 3WAEA 2PMSA 3FXUA 2Y5LA 2WEFA 1HSLA 4Q5TA 5FTHA 3IAZA 1PBPA 4NAPA 4AQ4A 1N3XA 2XXKA 3H3GA 3RQTA 1TFDA 4PTKA 3SEVA 4IO5A 4WEPA 5IM2A 5ISUA 1IITA 2CEYA 4ELPA 4RK9A 1AIVA 2O84X 1JNFA 5JTYA 5LDZA 1FPGA 5H8HA 4GWUA 4GF8A 2DOJA 4YKPA 4MNPA 3W9VA 1MM6A 3C31A 3SKPA 4POWA 1O64A 2UVIA 3Q25A 2B3FA 2PYYA 4P9KA 2V3UA 3TAJA 1POY1 4ZDMA 2XXQA 3FASA 2I58A 1MXWA 3PPPA 3P7IA 1NV4A 3IK6B 1NV6A 3B6TA 2DWIA 3LUZA 4QRZA 2PVUA 3BFTA 1P1QA 4UABA 3DP4A 3GBAA 1SW1A 1I6QA 4LZ7A 5B70A 4O3BA 1FTOA 1OQGA 4PC9A 4PBQA 4G8MA 3IORA 3USDA 3DP6A 4PAIA 4ELQA 4OWDA 2Q8JA 1QUIA 1BKAA 4X04A 5ET5A 1US5A 4OETA 3HHGA 2Q74A 2DVZA 4G2ZA 4PFBA 2E0SA 5HM4B 1H76A 3TQLA 1DPPA 4BDRA 5EYFA 2RKMA 3SEUA 3TCGA 1A8EA 3LR1A 3TTMA 1SW5A 2ZZXA 3E13X 4IGRA 2YPNA 1I6BA 4NF6A 2FNCA 3N6UA 4R73A 5AA2B 3K2DA 1MH3A 1IMDA 3T0JA 1MXVA 4DI4B 2THIA 5TU0A 3JV9A 5I84A 3VXBA 5I57A 1IQ7A 3KBRA 2O6AA 2G29A 3ZKLA 3FXQA 1LGBC 3R6UA 2RCBA 3K00A 4LP2B 3D1RA 4PFWA 4HW8A 4GFRA 4N07A 3FVOA 5ITOA 4U21A 4LN5A 4OENA 4PF6A 3IOUA 1XVXA 4ND9A 1DTZA 4OFJA 3C35A 1PB7A 4MHFA 1R1NA 3DP8A 3HO7A 1IMFA 4GX6A 1H3DA 4GVOA 2I49A 4C1UA 1B5JA 2DXYA 2LAOA 2O69A 3IFAA 3LV0A 4XFEA 4X1BA 1SYHA 1BK4A 1K9YA 5AA3A 1LBVA 3B7DA 4UA8A 1NV1A 5KDTB 4X8RA 3TTLA 4MJOA 4C1TA 4ZE8A 2OZZA 3K02A 4MMPA 4X1DA 3G3HA 1FPEA 5TPAB 1Q9DA 4UACA 3GYYA 1B3FA 3GZGA 3E79A 4LQ2A 3FJ7A 1FPFA 1FCKA 3IB2A 1MQDA 2ABHA 1SPIA 4BDLA 2ZYMA 2VHAA 3FGSA 1ZLQA 1FPDA 4MNIA 4I3YA 3HHFA 5TP9B 1YPNA 1L5TA 3AXFA 1IXCA 2XA5A 2G93A 4YKIA 3RPWA 4L17A 3IO6A 4BLAA 1UIVA 1B0LA 3K1NA 4LZ8A 3KN3A 2QVUA 3MW0A 4X48A 4C0RA 4TLLB 1EH3A 2QVVA 4PBHA 2F5XA 1Z7ME 1B3GA 4GOTA 4ZEBA 4H67A 3IB1A 3MVYA 2ONSA
chains in the Genus database with same CATH topology
4DXUA 4NWDA 1NH8A 4PFYA 3O6HA 3H6WA 3UIFA 4G68A 1BIYA 1USYH 3H6VA 2DP8A 1H43A 3TODA 1XT8A 5I2KB 2XXRA 2V25A 3W15C 4F39A 4IO2A 1UTBA 4ZE9A 1MS7A 2QRYA 2D5WA 2RCAA 2RC9A 5JEIA 4NF4A 4F19A 1OMPA 3M3KA 3UA8A 1LB9A 2ZXTA 3MZ9A 2IA4A 4U2RA 2D21A 2OCUA 4OEUA 1SBPA 1GV8A 5L9MA 3S4UA 4KYSA 4G68C 4Q8RA 1NMUA 2ZNUA 1Y4CA 3G3KA 3OXNA 3TCHA 1N0TA 4F18A 5I2NA 2E1SA 3CFXA 3VVFA 2DQVA 1BTJA 2F78A 2O1LA 1KWHA 5H8SA 3KJTA 3S9LC 4RYAA 3C33A 4M1VA 4H0WA 3U8QA 4YAHX 3C4MA 5FTIA 5M2VA 3K01A 1A54A 4EXLA 3G3FA 4OTEA 3OEMA 4BDMA 3RT8A 4EXKA 3RUMA 4JSDA 1OQHA 1TFAA 4KR5A 1S50A 2F6GA 3RTWB 4XKQA 4FECA 4KHZE 4OXVA 3MPKA 3FVKA 3FV1A 1UTHB 2F6PA 1HSEA 3H6UA 5CMKA 1Y1ZA 2I0CA 3IR1A 3IX1A 4TOZA 3IO4A 4ELOA 3OENA 4QSCA 2Y7RA 1QKBA 1SVXB 4Q30B 1LAXA 2NOOA 5K2XA 4R72A 1JW1A 1NKXA 2BJJX 2D3IA 3IB0A 4MBPA 2O7UA 3OEKA 1B3LA 4E0WA 3T9UA 1EZOA 5H8NB 4XKRA 3SEXA 3Q26A 3PUWE 1B05A 1FQAA 4AB5A 2IEEA 3UGWA 3G7WA 5AA4A 2XXTA 1IEJA 3G3IA 4MF3A 4KQPA 2Z22A 3V8XB 1EZPA 1ZTYA 2HCAA 3QYTA 2VOZA 3ILTB 3KSXA 2QPQA 4GXAA 3RGYA 2W7YA 4JWXA 1QUJA 3I6VA 2V3QA 3KSJA 4ZS9A 3HCQA 4LONB 2GHBA 5H8FB 4FATA 4RPOA 2V84A 4ZZEA 2P2AA 4H1XA 3TUSA 2NUVA 4HCYA 4KI0E 5CM6A 3T9XB 1MY4A 3OO9A 1RYXA 4ONYA 2H99A 3H6TA 1B3HA 1GR2A 4JB7A 2Y7WA 4FJPA 4NF5A 5JK4A 1AL3A 1WVJA 3O28A 3T22A 3BFUA 4QFOA 3THIA 4N6PA 5H8QB 4NWCA 4QFPA 4GRKA 1SW4A 3V89B 3PUVE 4NF8B 5DTBA 4PE5B 2RC8A 4R6HA 4XKNA 1ZJLA 1H44A 1LSTA 1DTGA 4ISUA 4G8HA 1B4HA 4GL0A 4THIA 2KLFA 3CG1A 1B0HA 3PD8A 4YB7A 2QS1A 3F11A 2HAVA 1EU8A 1I69A 4ECFA 1NNFA 1Y3QA 1Y9UA 1MQHA 4RY1A 2XHDA 4OHNA 3I5OA 5KDTA 3MP8A 2AL4A 1CB6A 2O68A 5I59A 1SI1A 2UVJA 5TPAA 2UYFA 2H5YA 3GLBA 3O97A 2O7IA 3TCFA 5KCJA 5AA2D 4IO6A 1SW2A 3N6TA 1B9JA 3FATA 4DXCA 5I56B 2QS4A 3SERA 2Q2AA 4GLIA 1VFEA 2F8DA 3DLNA 4F1VA 3O9PA 4PFTA 1Y20A 4DLDA 4EF2A 2XD3A 1SQYA 5CMMA 4OVJA 4OERA 4FIMA 4ZECA 1LLSA 1JEVA 2V93A 1LFHA 1SI0A 3MZBA 1N3WA 1XVYA 3Q28A 5CBRA 1B2HA 4U4XA 1GGGA 4EQBA 4Z7EA 4OQOA 2B65A 4F3PA 5F1QA 1P1NA 3KN7A 3FJGA 3QUFA 2Y84A 1Y4TA 3OO6A 4XIGQ 4PETA 3H7MA 2FYIA 4H5GA 2F7AA 4FEDA 3KG2A 4ZEKA 4DCXA 1OVBA 3N5LA 2NVUB 5I2KA 3UK4A 3RNNA 2V3TA 3EF7A 4R75A 3CFLA 4OESA 3TTNA 3ZSFA 5H8HB 2RC7A 4BDOA 2H9BA 1LCFA 3PPNA 2ZYNA 3K6VA 4PFUA 4R74A 3KN8A 4YMBA 4YKKA 3LBSA 2RINA 3OSRA 2Y7IA 5DVFA 4I1DA 4GL8A 4F3GA 3PPOA 3Q27A 1YCJA 1ZIUA 3T9HB 5I58A 1B5IA 2DS9A 1FTJA 5HBCA 5CC2A 3ECRA 2VD2A 1P1OA 2AL5A 1MQIA 3SESA 3O2AA 2XD2A 4IO3A 3CI8A 4KPTA 3K1PA 3CSBA 4MFIA 1OLCA 3KZGA 3LSWA 4ELRA 2Q89A 4K3FA 2QL3A 2I48A 2PT1A 3MVXA 4JDFA 1A40A 3MUQA 1B4ZA 1ATGA 4F22A 4WXJA 2X7PA 2OLBA 1QULA 4NF6B 2DWJA 4O3CA 4YB6A 4P0GA 3QIMA 4GD5A 3VLVA 1M5EA 2I3WA 3SDFA 1B6HA 4HCWA 3ZKKA 1B51A 1B1XA 2F7CA 1A8FA 3M8UA 1LCTA 4KFQA 3RY3A 2PBWA 3TFLA 1O7TA 1UTHA 3T9VA 2I4CA 3OSQA 3VDFA 2VGQA 1SDXA 1VE4A 3SEWA 4E0XA 1RKMA 4X9TA 2DYXA 1M5BA 2CZLA 3R26A 3S9NC 2DE4A 5DYHA 1D4NA 1N7XA 4RA1A 1RYOA 4F1UA 2QSXA 3S9EA 4FORA 3KEIA 4F29A 4KYDA 1BP5A 1MQJA 2A5SA 3S9MC 5B7DA 5H8NA 1IIWA 1LB8A 3MP1A 4OZ9A 3U93A 5A5XA 1M5DA 1B46A 3RLFE 2XXUA 5CRYA 2PX1A 4I62A 4QSDA 3LUYA 3L6GA 3TYHA 5DVJA 2I3VA 5EHSA 3PMXA 5KZTA 2OWTA 3UP9A 4R2BA 3MP6A 1MPBA 5LOMA 1FQDA 3KOTA 1FQCA 3E4RA 4IY6A 2ZYOA 2M8CA 5DEXB 4U23A 5H8FA 1MXXA 1PDAA 3JYRA 3A09A 2HFBA 2H25A 4DE8A 4F1YA 3L6HA 4BDQA 3TELA 4GXSB 2XXHA 1ZMGA 4QFNA 1VSOA 2XXPA 3E9XA 3OD7A 2HXWA 4YICA 3PPRA 3ILUB 3TTKA 3OO8A 3M3LA 3SETA 5H8QA 3KGCA 1Q1KA 1D9YA 3QK6A 1LBCA 2REJA 1FTKA 5ELVA 4AB6A 1NH7A 1LFGA 4KCDA 3OMBA 3FJMA 4YZZA 4Z0IA 4JWOA 1EZ9A 1FTMA 4PQJA 2R6GE 3MVWA 3PUZE 1YTVA 1XHYA 4NF4B 3TPAA 4OFOA 3T66A 2ANJA 1XOCA 2GFEA 4RJZA 4OEVA 4I9DA 3CSGA 3W9WA 4OMBA 3UORA 4ZEDA 4I8CA 3V5AA 3FV2A 3N26A 3N94A 1Z7NE 1Y1MA 1PB8A 4ZEFA 5I2NB 1QKAA 3HSTA 1WDNA 2H98A 3IOTA 3CFZA 2XXXA 1CE2A 5BWJA 4F31B 4LA9A 4QF9A 3LSFB 2Z8EA 3CVGA 4IO7A 3JZJA 1TWYA 4EF1A 1UIUA 4G8NA 2XXVA 4R6KA 3MC2A 5I56A 4KD5A 3VLWA 2REGA 1I6AA 4EDPA 3C32A 1MH4A 1B52A 4RNSA 5AA2A 2DWHA 4H5FA 4IY5A 1N84A 1GTKA 3K4UA 2QMXA 1OLAA 3WAFA 4H65A 5L8DA 1ZBMA 4H8IA 3RN8A 4R9GA 3D4CA 4OFLA 2XX9A 5IKBA 2HQ0A 4LZ5A 5J1DA 4RK2A 1PEBA 3PV0E 2AYSA 4XTCQ 1FQEA 3ONMA 3BKIB 4ZEIA 1MDP1 4F2OA 4NEDA 1JVXA 3DM0A 2X26A 4NTLA 3OO7A 1LBBA 2ZNSA 1AH5A 1H45A 3BBRA 1IZ1A 5EHMA 2Y7KA 3VFJA 3O29A 1XC1A 3EHUA 4QFLA 2I6EA 2NXOA 3FXRA 2P0SA 4M4GA 4YU0A 1VR5A 1LFIA 1IUDA 3SEYA 2F36A 1YAEA 5AA4B 3VVEA 1FQBA 1JEUA 4HTGA 2DSFA 2HZKA 4DDDA 5K2YA 2A5TB 5DT6A 4YKJA 4KYEA 1AMFA 3TTRA 2OBGA 2QS2A 2F97A 1URDA 2CMOA 4R2FA 3C34A 1MG1A 4DZ1A 3TKDA 5TP9A 1O63A 4F3BA 2Q9TA 3K1MA 2XX8A 2FA7A 4KCCA 1SYIA 4WEDA 4DCYA 3PMVA 3T93B 1MPDA 1TXFA 3MVZA 3HN0A 1DPEA 4H8JA 4LVQA 4GIZA 3IL1B 5L9OA 3K0VA 4JSOA 5L9SA 3EHTA 3FVNA 1B5HA 5ICTA 4NF5B 1BLFA 5FHNA 5F7VA 2I0BA 1ZKBA 4QSEA 2GHAA 5FHOA 4R9FA 1M5CA 1Y3PA 1M5FA 1JETA 4ESWA 1OIBA 1XS5A 5CI5A 2HEUA 4EUOA 4LUBA 1N76A 1USYE 2DVCA 3FUZA 1GVCA 4WKMA 5JTYB 1US4A 3DELB 2DE3A 1MXZA 2F35A 4FEBA 1MY2A 4P0IA 2GRVA 3CG3A 3HPIA 3O66A 1N04A 2PT2A 1URGA 4FE8A 3IJXB 5ITPA 2UXAA 3C9HA 2YLNA 1SD3A 2ZYKA 3B6QA 4NE4A 1B7HA 2WKYA 5CBSA 3CIJA 2DXRA 3MPLA 4JBZA 2ZMBA 1FTLA 1B58A 3HV1A 1J1NA 1R9QA 1AOVA 1A7LA 1MY3A 4P11A 3K6WA 3TEPA 2R71A 1PBQA 1TT1A 1NNPA 4XKPA 1MXYA 1IXHA 4IO4A 3PGFA 2OK2A 5I59B 1R6ZA 2P1SA 3MQ9A 1N7WA 5CMCA 4F2QA 2F7BA 3KOSA 4MH5A 3U94A 4DIGA 2ONKE 1B3EA 3O6IA 3TQWA 5KCJB 4LQ5A 3Q29A 4LATA 1JW4A 2Q88A 5DEXA 5BUUA 1R9LA 2NWJA 3MWBA 3VV5A 3LSXA 4JXIA 5FHMA 3QAXA 2B3BA 2H4IA 3H4ZA 3M3FA 1Y3NA 3CR9A 1JQFA 3U92A 2UYEA 4IB2A 1DSNA 2XX7A 4DXBA 3VVDA 5I57B 3PD9A 4QHQA 1MQGA 5ICQA 1T0KA 1P1UA 4IGTA 1B1HA 4JWYA 4H6DA 3FVGA 4OYVA 3TZAA 3RT6B 5IAIA 4POXA 1MY0A 1A99A 4Q0CA 3ZS6A 4TLMB 2DE2A 1MDQA 2YJPA 3E3KA 4EQ9A 3GXAA 2I4BA 2Q2CA 2ESNA 1B40A 2Z8FA 2R9JA 3TMGA 5AA1A 2DWAA 3PU5A 3R7XA 2QJEA 2ALUA 5CMBA 1IXGA 4RXLA 1MRPA 1MPCA 4U22A 1LAHE 4ZZAA 3IOWA 2ONRA 1NNTA 4TQUQ 1B32A 1MY1A 2Y7PA 4U1ZA 1FQFA 1POTA 1D9VA 3KJ7A 5I58B 4N13A 2VD3A 1UQWA 2HAUA 3GBBA 1NFTA 5AE4A 3B6WA 1QVSA 3MBPA 2Z23A 3OOAA 1MXUA 4O3AA 3PUXE 4G4PA 4MLQA 2XXYA 1ELJA 4U1OA 4U4SA 3VXCA 4XXUA 3FD3A 1OVTA 3LSLA 2O1MA 3G3JA 1S7YA 1NNKA 1URSA 2XXWA 3KFMA 1VFDA 1B7ZA 3QXMA 3EPEA 1HSJA 4YMAA 1JW5A 4NMYA 1NL5A 3PUYE 1ZU0A 3EQ1A 1DOTA 4G68B 3VLUA 4FAJA 4NF8A 3MJNA 1A55A 2XXIA 3H03A 1LAGE 4PP0A 4YB5A 4RPNA 2F34A 3D4GA 1PC3A 3C36A 1FW0A 1S9TA 1P99A 1QJMA 3CRBA 2VP1A 4G77A 4GQOA 3T96B 1QW0A 2QMWA 3U72A 1UTBB 1DMBA 3OELA 4F3SA 3VE1B 3UN6A 4EQ7A 3K6XA 3MAMA 4BDNA 4QFKA 4R6YA 4GWOA 5A5XB 2OJTA 1QUKA 1ANFA 2RF1A 1Q35A 2AIXA 2UVGA 1F9BA 1MM7A 3FZVA 1JVYA 3PPQA 3O6GA 1IXIA 2ZNTA 2A5TA 1B7UA 3EN3A 1P1WA 5HPQA 2Z8DA 3EHSA 3ODBA 3S2VA 1WODA 1LAFE 4MLVA 3LC8A 1II5A 3FIRA 1PB9A 3IOVA 3MZ1A 3V83A 2O51A 4ESXA 3A3CA 4HS7A 3H06B 2HZLA 3PMWA 2GH9A 3TDJA 3K6UA 2UVHA 3QSLA 3G3GA 1D3KA 3QUJA 3IJOB 2QS3A 2X7QA 3A3UA 2OWSA 3RTFB 5DVIA 3U1OA 3I3VA 3WAEA 2PMSA 3FXUA 1HSLA 4Q5TA 5FTHA 3IAZA 1PBPA 4AQ4A 1N3XA 3H3GA 3RQTA 1TFDA 3SEVA 4IO5A 4WEPA 5ISUA 1IITA 4ELPA 4RK9A 1AIVA 2O84X 1JNFA 5JTYA 5H8HA 4GF8A 2DOJA 4YKPA 3W9VA 1MM6A 3C31A 3SKPA 4POWA 1O64A 2UVIA 3Q25A 2B3FA 2PYYA 2V3UA 3TAJA 1POY1 4ZDMA 2XXQA 3FASA 2I58A 1MXWA 3PPPA 3P7IA 3IK6B 3B6TA 2DWIA 4QRZA 2PVUA 3BFTA 1P1QA 3DP4A 3GBAA 1SW1A 1I6QA 4LZ7A 5B70A 4O3BA 1FTOA 1OQGA 4G8MA 3IORA 3USDA 3DP6A 4ELQA 4OWDA 2Q8JA 1QUIA 1BKAA 1US5A 4OETA 3HHGA 2DVZA 4G2ZA 2E0SA 5HM4B 1H76A 3TQLA 1DPPA 4BDRA 5EYFA 2RKMA 3SEUA 3TCGA 1A8EA 3LR1A 3TTMA 1SW5A 3E13X 4IGRA 2YPNA 1I6BA 4NF6A 2FNCA 3N6UA 4R73A 5AA2B 3K2DA 1MH3A 1MXVA 2THIA 5TU0A 3JV9A 5I84A 3VXBA 5I57A 1IQ7A 3KBRA 2O6AA 2G29A 3ZKLA 3FXQA 1LGBC 3R6UA 2RCBA 3K00A 4LP2B 4PFWA 4HW8A 4GFRA 4N07A 3FVOA 5ITOA 4U21A 4OENA 3IOUA 1XVXA 4ND9A 1DTZA 4OFJA 3C35A 1PB7A 1R1NA 3DP8A 3HO7A 1H3DA 4GVOA 2I49A 4C1UA 1B5JA 2DXYA 2LAOA 2O69A 4X1BA 1SYHA 5AA3A 3B7DA 4UA8A 5KDTB 3TTLA 4C1TA 4ZE8A 2OZZA 3K02A 4X1DA 3G3HA 5TPAB 4UACA 1B3FA 3GZGA 4LQ2A 3FJ7A 1FCKA 3IB2A 1MQDA 2ABHA 4BDLA 2ZYMA 2VHAA 3FGSA 1ZLQA 3HHFA 5TP9B 1YPNA 1L5TA 3AXFA 1IXCA 2G93A 4YKIA 3RPWA 4L17A 3IO6A 4BLAA 1UIVA 1B0LA 3K1NA 4LZ8A 3KN3A 3MW0A 4X48A 4C0RA 4TLLB 1EH3A 2F5XA 1Z7ME 1B3GA 4GOTA 4ZEBA 4H67A 3IB1A 3MVYA 2ONSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DXU A;  4NWD A;  1NH8 A;  4PFY A;  3O6H A;  3H6W A;  3UIF A;  4G68 A;  1BIY A;  1USY H;  3H6V A;  2DP8 A;  1H43 A;  3TOD A;  1XT8 A;  5I2K B;  2XXR A;  2V25 A;  3W15 C;  4F39 A;  4IO2 A;  1UTB A;  4ZE9 A;  1MS7 A;  2QRY A;  2D5W A;  2RCA A;  2RC9 A;  5JEI A;  4NF4 A;  4F19 A;  1OMP A;  3M3K A;  3UA8 A;  1LB9 A;  2ZXT A;  3MZ9 A;  2IA4 A;  4U2R A;  2D21 A;  2OCU A;  4OEU A;  1SBP A;  1GV8 A;  5L9M A;  3S4U A;  4KYS A;  4G68 C;  4Q8R A;  1NMU A;  2ZNU A;  1Y4C A;  3G3K A;  3OXN A;  3TCH A;  1N0T A;  4F18 A;  5I2N A;  2E1S A;  3CFX A;  3VVF A;  2DQV A;  1BTJ A;  2F78 A;  2O1L A;  1KWH A;  5H8S A;  3KJT A;  3S9L C;  4RYA A;  3C33 A;  4M1V A;  4H0W A;  3U8Q A;  4YAH X;  3C4M A;  5FTI A;  5M2V A;  3K01 A;  1A54 A;  4EXL A;  3G3F A;  4OTE A;  3OEM A;  4BDM A;  3RT8 A;  4EXK A;  3RUM A;  4JSD A;  1OQH A;  1TFA A;  4KR5 A;  1S50 A;  2F6G A;  3RTW B;  4XKQ A;  4FEC A;  4KHZ E;  4OXV A;  3MPK A;  3FVK A;  3FV1 A;  1UTH B;  2F6P A;  1HSE A;  3H6U A;  5CMK A;  1Y1Z A;  2I0C A;  3IR1 A;  3IX1 A;  4TOZ A;  3IO4 A;  4ELO A;  3OEN A;  4QSC A;  2Y7R A;  1QKB A;  1SVX B;  4Q30 B;  1LAX A;  2NOO A;  5K2X A;  4R72 A;  1JW1 A;  1NKX A;  2BJJ X;  2D3I A;  3IB0 A;  4MBP A;  2O7U A;  3OEK A;  1B3L A;  4E0W A;  3T9U A;  1EZO A;  5H8N B;  4XKR A;  3SEX A;  3Q26 A;  3PUW E;  1B05 A;  1FQA A;  4AB5 A;  2IEE A;  3UGW A;  3G7W A;  5AA4 A;  2XXT A;  1IEJ A;  3G3I A;  4MF3 A;  4KQP A;  2Z22 A;  3V8X B;  1EZP A;  1ZTY A;  2HCA A;  3QYT A;  2VOZ A;  3ILT B;  3KSX A;  2QPQ A;  4GXA A;  3RGY A;  2W7Y A;  4JWX A;  1QUJ A;  3I6V A;  2V3Q A;  3KSJ A;  4ZS9 A;  3HCQ A;  4LON B;  2GHB A;  5H8F B;  4FAT A;  4RPO A;  2V84 A;  4ZZE A;  2P2A A;  4H1X A;  3TUS A;  2NUV A;  4HCY A;  4KI0 E;  5CM6 A;  3T9X B;  1MY4 A;  3OO9 A;  1RYX A;  4ONY A;  2H99 A;  3H6T A;  1B3H A;  1GR2 A;  4JB7 A;  2Y7W A;  4FJP A;  4NF5 A;  5JK4 A;  1AL3 A;  1WVJ A;  3O28 A;  3T22 A;  3BFU A;  4QFO A;  3THI A;  4N6P A;  5H8Q B;  4NWC A;  4QFP A;  4GRK A;  1SW4 A;  3V89 B;  3PUV E;  4NF8 B;  5DTB A;  4PE5 B;  2RC8 A;  4R6H A;  4XKN A;  1ZJL A;  1H44 A;  1LST A;  1DTG A;  4ISU A;  4G8H A;  1B4H A;  4GL0 A;  4THI A;  2KLF A;  3CG1 A;  1B0H A;  3PD8 A;  4YB7 A;  2QS1 A;  3F11 A;  2HAV A;  1EU8 A;  1I69 A;  4ECF A;  1NNF A;  1Y3Q A;  1Y9U A;  1MQH A;  4RY1 A;  2XHD A;  4OHN A;  3I5O A;  5KDT A;  3MP8 A;  2AL4 A;  1CB6 A;  2O68 A;  5I59 A;  1SI1 A;  2UVJ A;  5TPA A;  2UYF A;  2H5Y A;  3GLB A;  3O97 A;  2O7I A;  3TCF A;  5KCJ A;  5AA2 D;  4IO6 A;  1SW2 A;  3N6T A;  1B9J A;  3FAT A;  4DXC A;  5I56 B;  2QS4 A;  3SER A;  2Q2A A;  4GLI A;  1VFE A;  2F8D A;  3DLN A;  4F1V A;  3O9P A;  4PFT A;  1Y20 A;  4DLD A;  4EF2 A;  2XD3 A;  1SQY A;  5CMM A;  4OVJ A;  4OER A;  4FIM A;  4ZEC A;  1LLS A;  1JEV A;  2V93 A;  1LFH A;  1SI0 A;  3MZB A;  1N3W A;  1XVY A;  3Q28 A;  5CBR A;  1B2H A;  4U4X A;  1GGG A;  4EQB A;  4Z7E A;  4OQO A;  2B65 A;  4F3P A;  5F1Q A;  1P1N A;  3KN7 A;  3FJG A;  3QUF A;  2Y84 A;  1Y4T A;  3OO6 A;  4XIG Q;  4PET A;  3H7M A;  2FYI A;  4H5G A;  2F7A A;  4FED A;  3KG2 A;  4ZEK A;  4DCX A;  1OVB A;  3N5L A;  2NVU B;  5I2K A;  3UK4 A;  3RNN A;  2V3T A;  3EF7 A;  4R75 A;  3CFL A;  4OES A;  3TTN A;  3ZSF A;  5H8H B;  2RC7 A;  4BDO A;  2H9B A;  1LCF A;  3PPN A;  2ZYN A;  3K6V A;  4PFU A;  4R74 A;  3KN8 A;  4YMB A;  4YKK A;  3LBS A;  2RIN A;  3OSR A;  2Y7I A;  5DVF A;  4I1D A;  4GL8 A;  4F3G A;  3PPO A;  3Q27 A;  1YCJ A;  1ZIU A;  3T9H B;  5I58 A;  1B5I A;  2DS9 A;  1FTJ A;  5HBC A;  5CC2 A;  3ECR A;  2VD2 A;  1P1O A;  2AL5 A;  1MQI A;  3SES A;  3O2A A;  2XD2 A;  4IO3 A;  3CI8 A;  4KPT A;  3K1P A;  3CSB A;  4MFI A;  1OLC A;  3KZG A;  3LSW A;  4ELR A;  2Q89 A;  4K3F A;  2QL3 A;  2I48 A;  2PT1 A;  3MVX A;  4JDF A;  1A40 A;  3MUQ A;  1B4Z A;  1ATG A;  4F22 A;  4WXJ A;  2X7P A;  2OLB A;  1QUL A;  4NF6 B;  2DWJ A;  4O3C A;  4YB6 A;  4P0G A;  3QIM A;  4GD5 A;  3VLV A;  1M5E A;  2I3W A;  3SDF A;  1B6H A;  4HCW A;  3ZKK A;  1B51 A;  1B1X A;  2F7C A;  1A8F A;  3M8U A;  1LCT A;  4KFQ A;  3RY3 A;  2PBW A;  3TFL A;  1O7T A;  1UTH A;  3T9V A;  2I4C A;  3OSQ A;  3VDF A;  2VGQ A;  1SDX A;  1VE4 A;  3SEW A;  4E0X A;  1RKM A;  4X9T A;  2DYX A;  1M5B A;  2CZL A;  3R26 A;  3S9N C;  2DE4 A;  5DYH A;  1D4N A;  1N7X A;  4RA1 A;  1RYO A;  4F1U A;  2QSX A;  3S9E A;  4FOR A;  3KEI A;  4F29 A;  4KYD A;  1BP5 A;  1MQJ A;  2A5S A;  3S9M C;  5B7D A;  5H8N A;  1IIW A;  1LB8 A;  3MP1 A;  4OZ9 A;  3U93 A;  5A5X A;  1M5D A;  1B46 A;  3RLF E;  2XXU A;  5CRY A;  2PX1 A;  4I62 A;  4QSD A;  3LUY A;  3L6G A;  3TYH A;  5DVJ A;  2I3V A;  5EHS A;  3PMX A;  5KZT A;  2OWT A;  3UP9 A;  4R2B A;  3MP6 A;  1MPB A;  5LOM A;  1FQD A;  3KOT A;  1FQC A;  3E4R A;  4IY6 A;  2ZYO A;  2M8C A;  5DEX B;  4U23 A;  5H8F A;  1MXX A;  1PDA A;  3JYR A;  3A09 A;  2HFB A;  2H25 A;  4DE8 A;  4F1Y A;  3L6H A;  4BDQ A;  3TEL A;  4GXS B;  2XXH A;  1ZMG A;  4QFN A;  1VSO A;  2XXP A;  3E9X A;  3OD7 A;  2HXW A;  4YIC A;  3PPR A;  3ILU B;  3TTK A;  3OO8 A;  3M3L A;  3SET A;  5H8Q A;  3KGC A;  1Q1K A;  1D9Y A;  3QK6 A;  1LBC A;  2REJ A;  1FTK A;  5ELV A;  4AB6 A;  1NH7 A;  1LFG A;  4KCD A;  3OMB A;  3FJM A;  4YZZ A;  4Z0I A;  4JWO A;  1EZ9 A;  1FTM A;  4PQJ A;  2R6G E;  3MVW A;  3PUZ E;  1YTV A;  1XHY A;  4NF4 B;  3TPA A;  4OFO A;  3T66 A;  2ANJ A;  1XOC A;  2GFE A;  4RJZ A;  4OEV A;  4I9D A;  3CSG A;  3W9W A;  4OMB A;  3UOR A;  4ZED A;  4I8C A;  3V5A A;  3FV2 A;  3N26 A;  3N94 A;  1Z7N E;  1Y1M A;  1PB8 A;  4ZEF A;  5I2N B;  1QKA A;  3HST A;  1WDN A;  2H98 A;  3IOT A;  3CFZ A;  2XXX A;  1CE2 A;  5BWJ A;  4F31 B;  4LA9 A;  4QF9 A;  3LSF B;  2Z8E A;  3CVG A;  4IO7 A;  3JZJ A;  1TWY A;  4EF1 A;  1UIU A;  4G8N A;  2XXV A;  4R6K A;  3MC2 A;  5I56 A;  4KD5 A;  3VLW A;  2REG A;  1I6A A;  4EDP A;  3C32 A;  1MH4 A;  1B52 A;  4RNS A;  5AA2 A;  2DWH A;  4H5F A;  4IY5 A;  1N84 A;  1GTK A;  3K4U A;  2QMX A;  1OLA A;  3WAF A;  4H65 A;  5L8D A;  1ZBM A;  4H8I A;  3RN8 A;  4R9G A;  3D4C A;  4OFL A;  2XX9 A;  5IKB A;  2HQ0 A;  4LZ5 A;  5J1D A;  4RK2 A;  1PEB A;  3PV0 E;  2AYS A;  4XTC Q;  1FQE A;  3ONM A;  3BKI B;  4ZEI A;  1MDP 1;  4F2O A;  4NED A;  1JVX A;  3DM0 A;  2X26 A;  4NTL A;  3OO7 A;  1LBB A;  2ZNS A;  1AH5 A;  1H45 A;  3BBR A;  1IZ1 A;  5EHM A;  2Y7K A;  3VFJ A;  3O29 A;  1XC1 A;  3EHU A;  4QFL A;  2I6E A;  2NXO A;  3FXR A;  2P0S A;  4M4G A;  4YU0 A;  1VR5 A;  1LFI A;  1IUD A;  3SEY A;  2F36 A;  1YAE A;  5AA4 B;  3VVE A;  1FQB A;  1JEU A;  4HTG A;  2DSF A;  2HZK A;  4DDD A;  5K2Y A;  2A5T B;  5DT6 A;  4YKJ A;  4KYE A;  1AMF A;  3TTR A;  2OBG A;  2QS2 A;  2F97 A;  1URD A;  2CMO A;  4R2F A;  3C34 A;  1MG1 A;  4DZ1 A;  3TKD A;  5TP9 A;  1O63 A;  4F3B A;  2Q9T A;  3K1M A;  2XX8 A;  2FA7 A;  4KCC A;  1SYI A;  4WED A;  4DCY A;  3PMV A;  3T93 B;  1MPD A;  1TXF A;  3MVZ A;  3HN0 A;  1DPE A;  4H8J A;  4LVQ A;  4GIZ A;  3IL1 B;  5L9O A;  3K0V A;  4JSO A;  5L9S A;  3EHT A;  3FVN A;  1B5H A;  5ICT A;  4NF5 B;  1BLF A;  5FHN A;  5F7V A;  2I0B A;  1ZKB A;  4QSE A;  2GHA A;  5FHO A;  4R9F A;  1M5C A;  1Y3P A;  1M5F A;  1JET A;  4ESW A;  1OIB A;  1XS5 A;  5CI5 A;  2HEU A;  4EUO A;  4LUB A;  1N76 A;  1USY E;  2DVC A;  3FUZ A;  1GVC A;  4WKM A;  5JTY B;  1US4 A;  3DEL B;  2DE3 A;  1MXZ A;  2F35 A;  4FEB A;  1MY2 A;  4P0I A;  2GRV A;  3CG3 A;  3HPI A;  3O66 A;  1N04 A;  2PT2 A;  1URG A;  4FE8 A;  3IJX B;  5ITP A;  2UXA A;  3C9H A;  2YLN A;  1SD3 A;  2ZYK A;  3B6Q A;  4NE4 A;  1B7H A;  2WKY A;  5CBS A;  3CIJ A;  2DXR A;  3MPL A;  4JBZ A;  2ZMB A;  1FTL A;  1B58 A;  3HV1 A;  1J1N A;  1R9Q A;  1AOV A;  1A7L A;  1MY3 A;  4P11 A;  3K6W A;  3TEP A;  2R71 A;  1PBQ A;  1TT1 A;  1NNP A;  4XKP A;  1MXY A;  1IXH A;  4IO4 A;  3PGF A;  2OK2 A;  5I59 B;  1R6Z A;  2P1S A;  3MQ9 A;  1N7W A;  5CMC A;  4F2Q A;  2F7B A;  3KOS A;  4MH5 A;  3U94 A;  4DIG A;  2ONK E;  1B3E A;  3O6I A;  3TQW A;  5KCJ B;  4LQ5 A;  3Q29 A;  4LAT A;  1JW4 A;  2Q88 A;  5DEX A;  5BUU A;  1R9L A;  2NWJ A;  3MWB A;  3VV5 A;  3LSX A;  4JXI A;  5FHM A;  3QAX A;  2B3B A;  2H4I A;  3H4Z A;  3M3F A;  1Y3N A;  3CR9 A;  1JQF A;  3U92 A;  2UYE A;  4IB2 A;  1DSN A;  2XX7 A;  4DXB A;  3VVD A;  5I57 B;  3PD9 A;  4QHQ A;  1MQG A;  5ICQ A;  1T0K A;  1P1U A;  4IGT A;  1B1H A;  4JWY A;  4H6D A;  3FVG A;  4OYV A;  3TZA A;  3RT6 B;  5IAI A;  4POX A;  1MY0 A;  1A99 A;  4Q0C A;  3ZS6 A;  4TLM B;  2DE2 A;  1MDQ A;  2YJP A;  3E3K A;  4EQ9 A;  3GXA A;  2I4B A;  2Q2C A;  2ESN A;  1B40 A;  2Z8F A;  2R9J A;  3TMG A;  5AA1 A;  2DWA A;  3PU5 A;  3R7X A;  2QJE A;  2ALU A;  5CMB A;  1IXG A;  4RXL A;  1MRP A;  1MPC A;  4U22 A;  1LAH E;  4ZZA A;  3IOW A;  2ONR A;  1NNT A;  4TQU Q;  1B32 A;  1MY1 A;  2Y7P A;  4U1Z A;  1FQF A;  1POT A;  1D9V A;  3KJ7 A;  5I58 B;  4N13 A;  2VD3 A;  1UQW A;  2HAU A;  3GBB A;  1NFT A;  5AE4 A;  3B6W A;  1QVS A;  3MBP A;  2Z23 A;  3OOA A;  1MXU A;  4O3A A;  3PUX E;  4G4P A;  4MLQ A;  2XXY A;  1ELJ A;  4U1O A;  4U4S A;  3VXC A;  4XXU A;  3FD3 A;  1OVT A;  3LSL A;  2O1M A;  3G3J A;  1S7Y A;  1NNK A;  1URS A;  2XXW A;  3KFM A;  1VFD A;  1B7Z A;  3QXM A;  3EPE A;  1HSJ A;  4YMA A;  1JW5 A;  4NMY A;  1NL5 A;  3PUY E;  1ZU0 A;  3EQ1 A;  1DOT A;  4G68 B;  3VLU A;  4FAJ A;  4NF8 A;  3MJN A;  1A55 A;  2XXI A;  3H03 A;  1LAG E;  4PP0 A;  4YB5 A;  4RPN A;  2F34 A;  3D4G A;  1PC3 A;  3C36 A;  1FW0 A;  1S9T A;  1P99 A;  1QJM A;  3CRB A;  2VP1 A;  4G77 A;  4GQO A;  3T96 B;  1QW0 A;  2QMW A;  3U72 A;  1UTB B;  1DMB A;  3OEL A;  4F3S A;  3VE1 B;  3UN6 A;  4EQ7 A;  3K6X A;  3MAM A;  4BDN A;  4QFK A;  4R6Y A;  4GWO A;  5A5X B;  2OJT A;  1QUK A;  1ANF A;  2RF1 A;  1Q35 A;  2AIX A;  2UVG A;  1F9B A;  1MM7 A;  3FZV A;  1JVY A;  3PPQ A;  3O6G A;  1IXI A;  2ZNT A;  2A5T A;  1B7U A;  3EN3 A;  1P1W A;  5HPQ A;  2Z8D A;  3EHS A;  3ODB A;  3S2V A;  1WOD A;  1LAF E;  4MLV A;  3LC8 A;  1II5 A;  3FIR A;  1PB9 A;  3IOV A;  3MZ1 A;  3V83 A;  2O51 A;  4ESX A;  3A3C A;  4HS7 A;  3H06 B;  2HZL A;  3PMW A;  2GH9 A;  3TDJ A;  3K6U A;  2UVH A;  3QSL A;  3G3G A;  1D3K A;  3QUJ A;  3IJO B;  2QS3 A;  2X7Q A;  3A3U A;  2OWS A;  3RTF B;  5DVI A;  3U1O A;  3I3V A;  3WAE A;  2PMS A;  3FXU A;  1HSL A;  4Q5T A;  5FTH A;  3IAZ A;  1PBP A;  4AQ4 A;  1N3X A;  3H3G A;  3RQT A;  1TFD A;  3SEV A;  4IO5 A;  4WEP A;  5ISU A;  1IIT A;  4ELP A;  4RK9 A;  1AIV A;  2O84 X;  1JNF A;  5JTY A;  5H8H A;  4GF8 A;  2DOJ A;  4YKP A;  3W9V A;  1MM6 A;  3C31 A;  3SKP A;  4POW A;  1O64 A;  2UVI A;  3Q25 A;  2B3F A;  2PYY A;  2V3U A;  3TAJ A;  1POY 1;  4ZDM A;  2XXQ A;  3FAS A;  2I58 A;  1MXW A;  3PPP A;  3P7I A;  3IK6 B;  3B6T A;  2DWI A;  4QRZ A;  2PVU A;  3BFT A;  1P1Q A;  3DP4 A;  3GBA A;  1SW1 A;  1I6Q A;  4LZ7 A;  5B70 A;  4O3B A;  1FTO A;  1OQG A;  4G8M A;  3IOR A;  3USD A;  3DP6 A;  4ELQ A;  4OWD A;  2Q8J A;  1QUI A;  1BKA A;  1US5 A;  4OET A;  3HHG A;  2DVZ A;  4G2Z A;  2E0S A;  5HM4 B;  1H76 A;  3TQL A;  1DPP A;  4BDR A;  5EYF A;  2RKM A;  3SEU A;  3TCG A;  1A8E A;  3LR1 A;  3TTM A;  1SW5 A;  3E13 X;  4IGR A;  2YPN A;  1I6B A;  4NF6 A;  2FNC A;  3N6U A;  4R73 A;  5AA2 B;  3K2D A;  1MH3 A;  1MXV A;  2THI A;  5TU0 A;  3JV9 A;  5I84 A;  3VXB A;  5I57 A;  1IQ7 A;  3KBR A;  2O6A A;  2G29 A;  3ZKL A;  3FXQ A;  1LGB C;  3R6U A;  2RCB A;  3K00 A;  4LP2 B;  4PFW A;  4HW8 A;  4GFR A;  4N07 A;  3FVO A;  5ITO A;  4U21 A;  4OEN A;  3IOU A;  1XVX A;  4ND9 A;  1DTZ A;  4OFJ A;  3C35 A;  1PB7 A;  1R1N A;  3DP8 A;  3HO7 A;  1H3D A;  4GVO A;  2I49 A;  4C1U A;  1B5J A;  2DXY A;  2LAO A;  2O69 A;  4X1B A;  1SYH A;  5AA3 A;  3B7D A;  4UA8 A;  5KDT B;  3TTL A;  4C1T A;  4ZE8 A;  2OZZ A;  3K02 A;  4X1D A;  3G3H A;  5TPA B;  4UAC A;  1B3F A;  3GZG A;  4LQ2 A;  3FJ7 A;  1FCK A;  3IB2 A;  1MQD A;  2ABH A;  4BDL A;  2ZYM A;  2VHA A;  3FGS A;  1ZLQ A;  3HHF A;  5TP9 B;  1YPN A;  1L5T A;  3AXF A;  1IXC A;  2G93 A;  4YKI A;  3RPW A;  4L17 A;  3IO6 A;  4BLA A;  1UIV A;  1B0L A;  3K1N A;  4LZ8 A;  3KN3 A;  3MW0 A;  4X48 A;  4C0R A;  4TLL B;  1EH3 A;  2F5X A;  1Z7M E;  1B3G A;  4GOT A;  4ZEB A;  4H67 A;  3IB1 A;  3MVY A;  2ONS A; 
#chains in the Genus database with same CATH topology
 4DXU A;  4NWD A;  1NH8 A;  4PFY A;  3O6H A;  3H6W A;  3UIF A;  4G68 A;  1BIY A;  1USY H;  3H6V A;  2DP8 A;  1H43 A;  3TOD A;  1XT8 A;  5I2K B;  2XXR A;  2V25 A;  3W15 C;  4F39 A;  4IO2 A;  1UTB A;  4ZE9 A;  1MS7 A;  2QRY A;  2D5W A;  2RCA A;  2RC9 A;  5JEI A;  4NF4 A;  4F19 A;  2FBP A;  1OMP A;  2OWZ A;  3M3K A;  3UA8 A;  1LBX A;  1LB9 A;  2ZXT A;  3MZ9 A;  2IA4 A;  4U2R A;  2D21 A;  2OCU A;  4OEU A;  1FBC A;  1SBP A;  1GV8 A;  5L9M A;  3S4U A;  4KYS A;  4G68 C;  4Q8R A;  1NMU A;  2VT5 A;  2ZNU A;  1KZ8 A;  1Y4C A;  3G3K A;  3OXN A;  3TCH A;  1N0T A;  4F18 A;  2CZH A;  5I2N A;  2E1S A;  3CFX A;  2BJI A;  3VVF A;  2DQV A;  1BTJ A;  2F78 A;  2O1L A;  1KWH A;  5H8S A;  3KJT A;  3S9L C;  5LTC A;  4RYA A;  3C33 A;  4M1V A;  4H0W A;  3U8Q A;  4YAH X;  4JVC A;  3C4M A;  5FTI A;  5M2V A;  2XWO A;  3K01 A;  1A54 A;  4EXL A;  3G3F A;  4OTE A;  3FBP A;  3OEM A;  4BDM A;  3RT8 A;  4EXK A;  3RUM A;  4JSD A;  1OQH A;  1TFA A;  4KR5 A;  1S50 A;  2F6G A;  3RTW B;  4XKQ A;  4FEC A;  4KHZ E;  4OXV A;  2B4M A;  3MPK A;  3FVK A;  3FV1 A;  1UTH B;  2F6P A;  1EYJ A;  1HSE A;  3H6U A;  5CMK A;  1Y1Z A;  2I0C A;  3IR1 A;  3IX1 A;  4TOZ A;  3IO4 A;  4ELO A;  3OEN A;  4JVD A;  4QSC A;  2Y7R A;  1QKB A;  1SVX B;  4Q30 B;  1LAX A;  2NOO A;  5K2X A;  4R72 A;  1JW1 A;  1NKX A;  1RDY A;  2BJJ X;  2D3I A;  3IB0 A;  4MBP A;  1NUW A;  2O7U A;  3OEK A;  1B3L A;  3ROJ A;  4E0W A;  4JVI A;  1FBF A;  3T9U A;  1EZO A;  5H8N B;  4XKR A;  3SEX A;  3Q26 A;  3PUW E;  1B05 A;  1FQA A;  4AB5 A;  2IEE A;  3UGW A;  3G7W A;  5AA4 A;  2XXT A;  1IEJ A;  3G3I A;  1NV2 A;  4KQP A;  4MF3 A;  1DBZ A;  2Z22 A;  4NHB A;  3V8X B;  1EZP A;  1ZTY A;  2HCA A;  3QYT A;  2XWK A;  2VOZ A;  4OVR A;  3ILT B;  3KSX A;  4N17 A;  2QPQ A;  4GXA A;  4NGU A;  3RGY A;  2W7Y A;  4JWX A;  2VPN A;  1QUJ A;  3I6V A;  1LEV A;  2V3Q A;  3KSJ A;  4ZS9 A;  3HCQ A;  4LON B;  4GWY A;  2GHB A;  2MKZ A;  5H8F B;  4FAT A;  4RPO A;  2V84 A;  4ZZE A;  2P2A A;  4H1X A;  3TUS A;  2NUV A;  4HCY A;  4KI0 E;  5CM6 A;  3T9X B;  1MY4 A;  3OO9 A;  1RYX A;  4ONY A;  2H99 A;  3MYU A;  4HE2 A;  1FPI A;  3H6T A;  1B3H A;  1FBP A;  4OVQ A;  1GR2 A;  4GX4 A;  4JB7 A;  2Y7W A;  1NUX A;  4FJP A;  4NF5 A;  5JK4 A;  1AL3 A;  1WVJ A;  3O28 A;  3T22 A;  3BFU A;  4QFO A;  3THI A;  4N6P A;  5H8Q B;  4NWC A;  4QFP A;  4GRK A;  1SW4 A;  3V89 B;  3PUV E;  4NF8 B;  5DTB A;  2WBB A;  4NX1 A;  4PE5 B;  2RC8 A;  4R6H A;  4XKN A;  1JP4 A;  1ZJL A;  4P47 A;  1H44 A;  1LST A;  1DTG A;  1D9Q A;  4ISU A;  4G8H A;  1B4H A;  4GL0 A;  4THI A;  2KLF A;  3CG1 A;  1B0H A;  5EYH A;  1RDX A;  3PD8 A;  4YB7 A;  2QS1 A;  5I7I A;  3F11 A;  2HAV A;  4KXP A;  3PTY A;  1EU8 A;  1I69 A;  4ECF A;  1NNF A;  1Y3Q A;  1Y9U A;  1MQH A;  3B8B A;  4RY1 A;  3KC1 A;  4GWW A;  2XHD A;  4OHN A;  4HXV A;  3I5O A;  5KDT A;  3MP8 A;  2AL4 A;  4H45 A;  5IZZ A;  5A5L A;  1CB6 A;  2O68 A;  4GWX A;  5I59 A;  1SI1 A;  2UVJ A;  5TPA A;  2UYF A;  2H5Y A;  3GLB A;  3O97 A;  2O7I A;  3TCF A;  5KCJ A;  5AA2 D;  3RYD A;  1NV0 A;  4IO6 A;  1SW2 A;  3N6T A;  1B9J A;  3FAT A;  4DXC A;  4GBW A;  5I56 B;  2QS4 A;  3SER A;  2Q2A A;  4GLI A;  1VFE A;  2F8D A;  3DLN A;  4F1V A;  3O9P A;  4PFT A;  1Y20 A;  4DLD A;  4EF2 A;  2XD3 A;  1SQY A;  5CMM A;  4OVJ A;  4OER A;  4FIM A;  4ZEC A;  1LLS A;  1JEV A;  2V93 A;  1LFH A;  1SI0 A;  3MZB A;  4OVS A;  1FPK A;  1N3W A;  1XVY A;  3Q28 A;  1K9Z A;  5CBR A;  1B2H A;  4U4X A;  1GGG A;  4EQB A;  4Z7E A;  4OQO A;  2B65 A;  4PCD A;  4F3P A;  5F1Q A;  1P1N A;  3KN7 A;  3FJG A;  3QUF A;  2Y84 A;  1Y4T A;  3OO6 A;  4XIG Q;  4PET A;  3H7M A;  2FYI A;  4H5G A;  2F7A A;  4FED A;  3KG2 A;  4ZEK A;  4DCX A;  2F3B A;  1OVB A;  3N5L A;  2NVU B;  5I2K A;  3UK4 A;  3RNN A;  4XEQ A;  2V3T A;  3EF7 A;  4R75 A;  3CFL A;  4OES A;  1AWB A;  3TTN A;  3ZSF A;  5H8H B;  2RC7 A;  4BDO A;  2WX9 A;  2H9B A;  1LCF A;  3PPN A;  2ZYN A;  5ET7 A;  3K6V A;  4PFU A;  4R74 A;  2QVR A;  3KN8 A;  4YMB A;  4PGN A;  4YKK A;  3LBS A;  2RIN A;  3OSR A;  4GX3 A;  2Y7I A;  5DVF A;  4I1D A;  4GL8 A;  4F3G A;  3PPO A;  2KQZ A;  3Q27 A;  1YCJ A;  1ZIU A;  3T9H B;  5I58 A;  1B5I A;  2DS9 A;  1FTJ A;  5HBC A;  5CC2 A;  3ECR A;  2VD2 A;  1P1O A;  2AL5 A;  1MQI A;  3SES A;  3O2A A;  2XD2 A;  4IO3 A;  3CI8 A;  4KPT A;  3K1P A;  3CSB A;  4MFI A;  1OLC A;  3KZG A;  3LSW A;  4ELR A;  2Q89 A;  4K3F A;  2QL3 A;  2I48 A;  1IMC A;  2PT1 A;  3MVX A;  4JDF A;  1VDW A;  5ESY A;  1A40 A;  3MUQ A;  1B4Z A;  1ATG A;  4F22 A;  4WXJ A;  4O7M A;  2X7P A;  2OLB A;  1QUL A;  4NF6 B;  1XI6 A;  2DWJ A;  1INP A;  1LBZ A;  4O3C A;  4YB6 A;  1IME A;  2WYK A;  4P0G A;  3QIM A;  2L5V A;  4GD5 A;  3VLV A;  1FPL A;  1M5E A;  2I3W A;  4P8B A;  3SDF A;  1B6H A;  2OX3 A;  4HCW A;  3ZKK A;  1B51 A;  1B1X A;  2VPO A;  2F7C A;  1A8F A;  3M8U A;  1LCT A;  4KFQ A;  3RY3 A;  2PBW A;  3TFL A;  1O7T A;  1UTH A;  3T9V A;  2I4C A;  3OSQ A;  3VDF A;  2VGQ A;  1FPJ A;  1SDX A;  1VE4 A;  3T1B A;  3SEW A;  4E0X A;  1RKM A;  4X9T A;  2DYX A;  1M5B A;  2CZI A;  2CZL A;  3R26 A;  4O8M A;  3S9N C;  2DE4 A;  5DYH A;  1NUY A;  1D4N A;  5I3S A;  1N7X A;  4RA1 A;  1RYO A;  4F1U A;  2QSX A;  2Q8M A;  3S9E A;  4FOR A;  3KEI A;  4F29 A;  4KYD A;  1BP5 A;  1MQJ A;  2A5S A;  3S9M C;  5B7D A;  5H8N A;  1IIW A;  1LB8 A;  3MP1 A;  4OZ9 A;  1DCU A;  3U93 A;  5A5X A;  1M5D A;  1B46 A;  3RLF E;  3ISP A;  2XXU A;  5CRY A;  2PX1 A;  4I62 A;  4QSD A;  3IFC A;  2WBD A;  4P56 A;  3LUY A;  3L6G A;  2FVZ A;  3TYH A;  5IZ3 A;  5DVJ A;  2I3V A;  1YYZ A;  5EHS A;  5ET8 A;  3PMX A;  5KZT A;  2OWT A;  3UP9 A;  4R2B A;  3MP6 A;  4NQ8 A;  1MPB A;  3KC0 A;  5J16 A;  5LOM A;  1FQD A;  3KOT A;  1FQC A;  3E4R A;  4IY6 A;  2ZYO A;  2M8C A;  5DEX B;  4U23 A;  5H8F A;  3SZP A;  1MXX A;  1PDA A;  3JYR A;  3A09 A;  2HFB A;  2H25 A;  4DE8 A;  4F1Y A;  2R8T A;  3L6H A;  4BDQ A;  3TEL A;  4P1L A;  4GXS B;  2XXH A;  1ZMG A;  4QFN A;  1VSO A;  2XXP A;  2KR0 A;  3E9X A;  3OD7 A;  3A29 A;  2HXW A;  4YIC A;  3PPR A;  3ILU B;  3NOH A;  3CHG A;  3TTK A;  3OO8 A;  3M3L A;  3SET A;  3KBZ A;  5H8Q A;  3KGC A;  1Q1K A;  1D9Y A;  3QK6 A;  1LBC A;  2REJ A;  1FTK A;  5EQ8 A;  5ELV A;  4AB6 A;  1NH7 A;  1LFG A;  4KCD A;  3OMB A;  5IZ1 A;  3FJM A;  4YZZ A;  4Z0I A;  4JWO A;  4MX6 A;  1EZ9 A;  1FSA A;  1FTM A;  4PQJ A;  1IMB A;  2R6G E;  3MVW A;  3PUZ E;  1YTV A;  1XHY A;  4NF4 B;  3TPA A;  4OFO A;  3HFU A;  3T66 A;  2ANJ A;  1KA1 A;  1XOC A;  2GFE A;  1YZ0 A;  4RJZ A;  4OEV A;  4IR8 A;  4I9D A;  3CSG A;  3W9W A;  4OMB A;  3UOR A;  4ZED A;  4I8C A;  3V5A A;  3FV2 A;  3N26 A;  3N94 A;  1Z7N E;  1Y1M A;  1PB8 A;  4ZEF A;  5I2N B;  1QKA A;  4N8G A;  3HST A;  1WDN A;  2H98 A;  3IOT A;  3CFZ A;  2XXX A;  1CE2 A;  4NN3 A;  4F31 B;  5BWJ A;  4LA9 A;  4QF9 A;  3LSF B;  1RDZ A;  1FBE A;  2Z8E A;  3CVG A;  4IO7 A;  3JZJ A;  1TWY A;  4EF1 A;  1UIU A;  4G8N A;  2XXV A;  4R6K A;  2GQ1 A;  3MC2 A;  5I56 A;  4KD5 A;  3VLW A;  3BIH A;  2REG A;  1I6A A;  4EDP A;  3C32 A;  1MH4 A;  1B52 A;  4RNS A;  5AA2 A;  2DWH A;  4PAK A;  4H5F A;  4IY5 A;  1N84 A;  1GTK A;  3K4U A;  4GWZ A;  2QMX A;  1OLA A;  3WAF A;  4H65 A;  5L8D A;  5EYG A;  3MST A;  1ZBM A;  4H8I A;  3RN8 A;  4R9G A;  3D4C A;  5ET6 A;  4OFL A;  4PAF A;  2XX9 A;  5IKB A;  2HQ0 A;  4LZ5 A;  5J1D A;  4RK2 A;  1PEB A;  3PV0 E;  2CEX A;  2AYS A;  4XTC Q;  1FQE A;  3ONM A;  3BKI B;  4ZEI A;  1MDP 1;  4F2O A;  2Y5K A;  4NED A;  1JVX A;  4N6D A;  3DM0 A;  4OVP A;  2X26 A;  4NTL A;  3OO7 A;  1LBB A;  2ZNS A;  1AH5 A;  1H45 A;  3BBR A;  1IZ1 A;  5EHM A;  2Y7K A;  2PFZ A;  3VFJ A;  1NV5 A;  3O29 A;  1XC1 A;  3EHU A;  4QFL A;  2I6E A;  2NXO A;  3FXR A;  3B50 A;  2P0S A;  4M4G A;  4YU0 A;  1VR5 A;  1LFI A;  1IUD A;  3SEY A;  2F36 A;  1YAE A;  5AA4 B;  3VVE A;  1FQB A;  1JEU A;  2HHM A;  4HTG A;  2DSF A;  2HZK A;  4DDD A;  4I3E A;  5T3J A;  5K2Y A;  2A5T B;  3U65 A;  4OAN A;  5DT6 A;  4YKJ A;  4PDD A;  4KYE A;  5FBP A;  1AMF A;  3TTR A;  1IMA A;  2OBG A;  2QS2 A;  4MEV A;  2F97 A;  1URD A;  2CMO A;  4R2F A;  3C34 A;  1MG1 A;  4DZ1 A;  3TKD A;  5TP9 A;  1O63 A;  4F3B A;  2Q9T A;  3K1M A;  2XX8 A;  2FA7 A;  4KCC A;  1DK4 A;  1FJ9 A;  1SYI A;  4WED A;  4DCY A;  3PMV A;  3T93 B;  4DI3 D;  1MPD A;  1TXF A;  3MVZ A;  3HN0 A;  1DPE A;  4H8J A;  4LVQ A;  3RPL B;  4GIZ A;  3IL1 B;  1EYI A;  5L9O A;  3K0V A;  1FBH A;  4JSO A;  5L9S A;  3EHT A;  3FVN A;  1B5H A;  4MCO A;  5ICT A;  4NF5 B;  1BLF A;  5FHN A;  3EKI A;  5F7V A;  2I0B A;  3E78 A;  1ZKB A;  4QSE A;  2GHA A;  5FHO A;  4R9F A;  1M5C A;  1Y3P A;  1M5F A;  5IGA A;  1JET A;  4ESW A;  1OIB A;  1QGX A;  1XS5 A;  5CI5 A;  2HEU A;  4EUO A;  4LUB A;  4MIJ A;  1N76 A;  1USY E;  2DVC A;  3FUZ A;  1GVC A;  4WKM A;  5JTY B;  1US4 A;  3DEL B;  1FBD A;  2F3D A;  2DE3 A;  1LBY A;  1MXZ A;  4N91 A;  2V4C A;  2F35 A;  4FEB A;  1MY2 A;  4P0I A;  2GRV A;  3CG3 A;  3HPI A;  3O66 A;  1EYK A;  1N04 A;  1NUZ A;  2PT2 A;  1URG A;  4FE8 A;  3IJX B;  5ITP A;  2UXA A;  4P1E A;  3C9H A;  2YLN A;  1SD3 A;  2ZYK A;  3B6Q A;  2FIX A;  4NE4 A;  1B7H A;  2WKY A;  5CBS A;  3CIJ A;  5DW8 A;  2DXR A;  3MPL A;  4JBZ A;  2ZMB A;  1FTL A;  1B58 A;  3BIG A;  3HV1 A;  1J1N A;  1R9Q A;  2XWV A;  1AOV A;  1A7L A;  1MY3 A;  4P11 A;  3K6W A;  3TEP A;  2R71 A;  2ZZW A;  1PBQ A;  4AS5 A;  4PE3 A;  1TT1 A;  1NNP A;  4XKP A;  1MXY A;  1IXH A;  1NI9 A;  4IO4 A;  3PGF A;  2OK2 A;  4N81 A;  5I59 B;  1R6Z A;  1KA0 A;  2P1S A;  3MQ9 A;  1N7W A;  5CMC A;  4F2Q A;  2F7B A;  3KOS A;  4MH5 A;  3FXB A;  3U94 A;  2ONK E;  4DIG A;  1B3E A;  3O6I A;  3TQW A;  5KCJ B;  4N6K A;  1FBG A;  4LQ5 A;  2B4L A;  3Q29 A;  4LAT A;  1JW4 A;  2Q88 A;  5DEX A;  5BUU A;  1R9L A;  4PDH A;  2NWJ A;  3MWB A;  3VV5 A;  3LSX A;  1FPB A;  4JXI A;  5FHM A;  3QAX A;  2B3B A;  4FBP A;  5EQA A;  2H4I A;  3H4Z A;  3M3F A;  1Y3N A;  3CR9 A;  1JQF A;  3U92 A;  2UYE A;  2P3V A;  4IB2 A;  1DSN A;  2XX7 A;  2P3N A;  5EQ9 A;  4DXB A;  2FHY A;  3VVD A;  5I57 B;  3PD9 A;  4QHQ A;  1MQG A;  5ICQ A;  4P3L A;  2PCR A;  1T0K A;  1P1U A;  4IGT A;  1B1H A;  2JJK A;  4JWY A;  4H6D A;  3FVG A;  4OYV A;  3TZA A;  4PFI A;  3RT6 B;  5IAI A;  4POX A;  1MY0 A;  1A99 A;  4OA4 A;  4Q0C A;  3ZS6 A;  4TLM B;  2DE2 A;  1G0H A;  1MDQ A;  2YJP A;  3E3K A;  4EQ9 A;  3GXA A;  2I4B A;  2Q2C A;  5F24 A;  2ESN A;  1B40 A;  2Z8F A;  2R9J A;  3TMG A;  5AA1 A;  2DWA A;  3PU5 A;  3R7X A;  2QJE A;  4PGP A;  2FIE A;  2ALU A;  5CMB A;  1IXG A;  4RXL A;  1MRP A;  1MPC A;  4U22 A;  1LAH E;  4ZZA A;  4PFR A;  3IOW A;  2ONR A;  1NNT A;  4TQU Q;  1B32 A;  1MY1 A;  2Y7P A;  4U1Z A;  4N4U A;  1FQF A;  1POT A;  1D9V A;  3KJ7 A;  5I58 B;  4N13 A;  2HXR A;  2VD3 A;  1UQW A;  2HAU A;  4OVT A;  4QXD A;  3GBB A;  1NFT A;  5AE4 A;  4QBA A;  3B6W A;  1QVS A;  3MBP A;  1FJ6 A;  4XF5 A;  2Z23 A;  3OOA A;  1MXU A;  4O3A A;  3PUX E;  4G4P A;  4MLQ A;  2XXY A;  1FTA A;  1ELJ A;  4U1O A;  4U4S A;  3VXC A;  4XXU A;  3FD3 A;  1OVT A;  3LSL A;  4O94 A;  2O1M A;  3G3J A;  1S7Y A;  1NNK A;  1LBW A;  1URS A;  2XXW A;  3KFM A;  1VFD A;  1B7Z A;  3QXM A;  3EPE A;  1HSJ A;  1FRP A;  4YMA A;  1JW5 A;  4GBV A;  4NMY A;  1NL5 A;  3PUY E;  1ZU0 A;  2HPG A;  3EQ1 A;  1DOT A;  4G68 B;  3VLU A;  4FAJ A;  4NF8 A;  3MJN A;  1A55 A;  2WYP A;  2ZZV A;  2PFY A;  2XXI A;  3H03 A;  1LAG E;  4PP0 A;  4YB5 A;  3QMF A;  4MNC A;  4RPN A;  2F34 A;  3D4G A;  1PC3 A;  3C36 A;  1FW0 A;  1S9T A;  1G0I A;  1P99 A;  1QJM A;  3CRB A;  4GWS A;  2VP1 A;  4G77 A;  4GQO A;  4HE0 A;  3T96 B;  1QW0 A;  2QMW A;  3U72 A;  1UTB B;  1DMB A;  3OEL A;  4F3S A;  4G61 A;  3VE1 B;  1YXI A;  1NV3 A;  3UN6 A;  4EQ7 A;  4PF8 A;  3K6X A;  3MAM A;  4BDN A;  4QFK A;  1NV7 A;  4R6Y A;  4GWO A;  4H46 A;  5A5X B;  2OJT A;  1QUK A;  2DDK A;  1ANF A;  2RF1 A;  2QFL A;  1Q35 A;  2AIX A;  4MAG A;  2UVG A;  1F9B A;  1MM7 A;  3FZV A;  1JVY A;  3PPQ A;  3O6G A;  5IZ3 B;  2CZK A;  4NG7 A;  1IXI A;  1CNQ A;  2ZNT A;  2A5T A;  1B7U A;  3EN3 A;  1P1W A;  5HPQ A;  4I40 A;  2Z8D A;  4O7I A;  5EQ7 A;  3EHS A;  3ODB A;  3S2V A;  1WOD A;  1LAF E;  4MLV A;  3LC8 A;  1II5 A;  2XWI A;  3FIR A;  1PB9 A;  3IOV A;  3MZ1 A;  3V83 A;  2O51 A;  4ESX A;  3A3C A;  4HS7 A;  3H06 B;  4NF0 A;  4HE1 A;  2HZL A;  4AS4 A;  3PMW A;  5I5P A;  2GH9 A;  3TDJ A;  3K6U A;  2UVH A;  3QSL A;  3RPL A;  3G3G A;  1D3K A;  3QUJ A;  3IJO B;  4N8Y A;  2QS3 A;  2X7Q A;  3A3U A;  2OWS A;  4N15 A;  3RTF B;  5DVI A;  3U1O A;  3I3V A;  3WAE A;  2PMS A;  3FXU A;  2Y5L A;  2WEF A;  1HSL A;  4Q5T A;  5FTH A;  3IAZ A;  1PBP A;  4NAP A;  4AQ4 A;  1N3X A;  2XXK A;  3H3G A;  3RQT A;  1TFD A;  4PTK A;  3SEV A;  4IO5 A;  4WEP A;  5IM2 A;  5ISU A;  1IIT A;  2CEY A;  4ELP A;  4RK9 A;  1AIV A;  2O84 X;  1JNF A;  5JTY A;  5LDZ A;  1FPG A;  5H8H A;  4GWU A;  4GF8 A;  2DOJ A;  4YKP A;  4MNP A;  3W9V A;  1MM6 A;  3C31 A;  3SKP A;  4POW A;  1O64 A;  2UVI A;  3Q25 A;  2B3F A;  2PYY A;  4P9K A;  2V3U A;  3TAJ A;  1POY 1;  4ZDM A;  2XXQ A;  3FAS A;  2I58 A;  1MXW A;  3PPP A;  3P7I A;  1NV4 A;  3IK6 B;  1NV6 A;  3B6T A;  2DWI A;  3LUZ A;  4QRZ A;  2PVU A;  3BFT A;  1P1Q A;  4UAB A;  3DP4 A;  3GBA A;  1SW1 A;  1I6Q A;  4LZ7 A;  5B70 A;  4O3B A;  1FTO A;  1OQG A;  4PC9 A;  4PBQ A;  4G8M A;  3IOR A;  3USD A;  3DP6 A;  4PAI A;  4ELQ A;  4OWD A;  2Q8J A;  1QUI A;  1BKA A;  4X04 A;  5ET5 A;  1US5 A;  4OET A;  3HHG A;  2Q74 A;  2DVZ A;  4G2Z A;  4PFB A;  2E0S A;  5HM4 B;  1H76 A;  3TQL A;  1DPP A;  4BDR A;  5EYF A;  2RKM A;  3SEU A;  3TCG A;  1A8E A;  3LR1 A;  3TTM A;  1SW5 A;  2ZZX A;  3E13 X;  4IGR A;  2YPN A;  1I6B A;  4NF6 A;  2FNC A;  3N6U A;  4R73 A;  5AA2 B;  3K2D A;  1MH3 A;  1IMD A;  3T0J A;  1MXV A;  4DI4 B;  2THI A;  5TU0 A;  3JV9 A;  5I84 A;  3VXB A;  5I57 A;  1IQ7 A;  3KBR A;  2O6A A;  2G29 A;  3ZKL A;  3FXQ A;  1LGB C;  3R6U A;  2RCB A;  3K00 A;  4LP2 B;  3D1R A;  4PFW A;  4HW8 A;  4GFR A;  4N07 A;  3FVO A;  5ITO A;  4U21 A;  4LN5 A;  4OEN A;  4PF6 A;  3IOU A;  1XVX A;  4ND9 A;  1DTZ A;  4OFJ A;  3C35 A;  1PB7 A;  4MHF A;  1R1N A;  3DP8 A;  3HO7 A;  1IMF A;  4GX6 A;  1H3D A;  4GVO A;  2I49 A;  4C1U A;  1B5J A;  2DXY A;  2LAO A;  2O69 A;  3IFA A;  3LV0 A;  4XFE A;  4X1B A;  1SYH A;  1BK4 A;  1K9Y A;  5AA3 A;  1LBV A;  3B7D A;  4UA8 A;  1NV1 A;  5KDT B;  4X8R A;  3TTL A;  4MJO A;  4C1T A;  4ZE8 A;  2OZZ A;  3K02 A;  4MMP A;  4X1D A;  3G3H A;  1FPE A;  5TPA B;  1Q9D A;  4UAC A;  3GYY A;  1B3F A;  3GZG A;  3E79 A;  4LQ2 A;  3FJ7 A;  1FPF A;  1FCK A;  3IB2 A;  1MQD A;  2ABH A;  1SPI A;  4BDL A;  2ZYM A;  2VHA A;  3FGS A;  1ZLQ A;  1FPD A;  4MNI A;  4I3Y A;  3HHF A;  5TP9 B;  1YPN A;  1L5T A;  3AXF A;  1IXC A;  2XA5 A;  2G93 A;  4YKI A;  3RPW A;  4L17 A;  3IO6 A;  4BLA A;  1UIV A;  1B0L A;  3K1N A;  4LZ8 A;  3KN3 A;  2QVU A;  3MW0 A;  4X48 A;  4C0R A;  4TLL B;  1EH3 A;  2QVV A;  4PBH A;  2F5X A;  1Z7M E;  1B3G A;  4GOT A;  4ZEB A;  4H67 A;  3IB1 A;  3MVY A;  2ONS A; 
#chains in the Genus database with same CATH homology
 4DXU A;  4NWD A;  1NH8 A;  4PFY A;  3O6H A;  3H6W A;  3UIF A;  4G68 A;  1BIY A;  1USY H;  3H6V A;  2DP8 A;  1H43 A;  3TOD A;  1XT8 A;  5I2K B;  2XXR A;  2V25 A;  3W15 C;  4F39 A;  4IO2 A;  1UTB A;  4ZE9 A;  1MS7 A;  2QRY A;  2D5W A;  2RCA A;  2RC9 A;  5JEI A;  4NF4 A;  4F19 A;  1OMP A;  3M3K A;  3UA8 A;  1LB9 A;  2ZXT A;  3MZ9 A;  2IA4 A;  4U2R A;  2D21 A;  2OCU A;  4OEU A;  1SBP A;  1GV8 A;  5L9M A;  3S4U A;  4KYS A;  4G68 C;  4Q8R A;  1NMU A;  2ZNU A;  1Y4C A;  3G3K A;  3OXN A;  3TCH A;  1N0T A;  4F18 A;  5I2N A;  2E1S A;  3CFX A;  3VVF A;  2DQV A;  1BTJ A;  2F78 A;  2O1L A;  1KWH A;  5H8S A;  3KJT A;  3S9L C;  4RYA A;  3C33 A;  4M1V A;  4H0W A;  3U8Q A;  4YAH X;  3C4M A;  5FTI A;  5M2V A;  3K01 A;  1A54 A;  4EXL A;  3G3F A;  4OTE A;  3OEM A;  4BDM A;  3RT8 A;  4EXK A;  3RUM A;  4JSD A;  1OQH A;  1TFA A;  4KR5 A;  1S50 A;  2F6G A;  3RTW B;  4XKQ A;  4FEC A;  4KHZ E;  4OXV A;  3MPK A;  3FVK A;  3FV1 A;  1UTH B;  2F6P A;  1HSE A;  3H6U A;  5CMK A;  1Y1Z A;  2I0C A;  3IR1 A;  3IX1 A;  4TOZ A;  3IO4 A;  4ELO A;  3OEN A;  4QSC A;  2Y7R A;  1QKB A;  1SVX B;  4Q30 B;  1LAX A;  2NOO A;  5K2X A;  4R72 A;  1JW1 A;  1NKX A;  2BJJ X;  2D3I A;  3IB0 A;  4MBP A;  2O7U A;  3OEK A;  1B3L A;  4E0W A;  3T9U A;  1EZO A;  5H8N B;  4XKR A;  3SEX A;  3Q26 A;  3PUW E;  1B05 A;  1FQA A;  4AB5 A;  2IEE A;  3UGW A;  3G7W A;  5AA4 A;  2XXT A;  1IEJ A;  3G3I A;  4MF3 A;  4KQP A;  2Z22 A;  3V8X B;  1EZP A;  1ZTY A;  2HCA A;  3QYT A;  2VOZ A;  3ILT B;  3KSX A;  2QPQ A;  4GXA A;  3RGY A;  2W7Y A;  4JWX A;  1QUJ A;  3I6V A;  2V3Q A;  3KSJ A;  4ZS9 A;  3HCQ A;  4LON B;  2GHB A;  5H8F B;  4FAT A;  4RPO A;  2V84 A;  4ZZE A;  2P2A A;  4H1X A;  3TUS A;  2NUV A;  4HCY A;  4KI0 E;  5CM6 A;  3T9X B;  1MY4 A;  3OO9 A;  1RYX A;  4ONY A;  2H99 A;  3H6T A;  1B3H A;  1GR2 A;  4JB7 A;  2Y7W A;  4FJP A;  4NF5 A;  5JK4 A;  1AL3 A;  1WVJ A;  3O28 A;  3T22 A;  3BFU A;  4QFO A;  3THI A;  4N6P A;  5H8Q B;  4NWC A;  4QFP A;  4GRK A;  1SW4 A;  3V89 B;  3PUV E;  4NF8 B;  5DTB A;  4PE5 B;  2RC8 A;  4R6H A;  4XKN A;  1ZJL A;  1H44 A;  1LST A;  1DTG A;  4ISU A;  4G8H A;  1B4H A;  4GL0 A;  4THI A;  2KLF A;  3CG1 A;  1B0H A;  3PD8 A;  4YB7 A;  2QS1 A;  3F11 A;  2HAV A;  1EU8 A;  1I69 A;  4ECF A;  1NNF A;  1Y3Q A;  1Y9U A;  1MQH A;  4RY1 A;  2XHD A;  4OHN A;  3I5O A;  5KDT A;  3MP8 A;  2AL4 A;  1CB6 A;  2O68 A;  5I59 A;  1SI1 A;  2UVJ A;  5TPA A;  2UYF A;  2H5Y A;  3GLB A;  3O97 A;  2O7I A;  3TCF A;  5KCJ A;  5AA2 D;  4IO6 A;  1SW2 A;  3N6T A;  1B9J A;  3FAT A;  4DXC A;  5I56 B;  2QS4 A;  3SER A;  2Q2A A;  4GLI A;  1VFE A;  2F8D A;  3DLN A;  4F1V A;  3O9P A;  4PFT A;  1Y20 A;  4DLD A;  4EF2 A;  2XD3 A;  1SQY A;  5CMM A;  4OVJ A;  4OER A;  4FIM A;  4ZEC A;  1LLS A;  1JEV A;  2V93 A;  1LFH A;  1SI0 A;  3MZB A;  1N3W A;  1XVY A;  3Q28 A;  5CBR A;  1B2H A;  4U4X A;  1GGG A;  4EQB A;  4Z7E A;  4OQO A;  2B65 A;  4F3P A;  5F1Q A;  1P1N A;  3KN7 A;  3FJG A;  3QUF A;  2Y84 A;  1Y4T A;  3OO6 A;  4XIG Q;  4PET A;  3H7M A;  2FYI A;  4H5G A;  2F7A A;  4FED A;  3KG2 A;  4ZEK A;  4DCX A;  1OVB A;  3N5L A;  2NVU B;  5I2K A;  3UK4 A;  3RNN A;  2V3T A;  3EF7 A;  4R75 A;  3CFL A;  4OES A;  3TTN A;  3ZSF A;  5H8H B;  2RC7 A;  4BDO A;  2H9B A;  1LCF A;  3PPN A;  2ZYN A;  3K6V A;  4PFU A;  4R74 A;  3KN8 A;  4YMB A;  4YKK A;  3LBS A;  2RIN A;  3OSR A;  2Y7I A;  5DVF A;  4I1D A;  4GL8 A;  4F3G A;  3PPO A;  3Q27 A;  1YCJ A;  1ZIU A;  3T9H B;  5I58 A;  1B5I A;  2DS9 A;  1FTJ A;  5HBC A;  5CC2 A;  3ECR A;  2VD2 A;  1P1O A;  2AL5 A;  1MQI A;  3SES A;  3O2A A;  2XD2 A;  4IO3 A;  3CI8 A;  4KPT A;  3K1P A;  3CSB A;  4MFI A;  1OLC A;  3KZG A;  3LSW A;  4ELR A;  2Q89 A;  4K3F A;  2QL3 A;  2I48 A;  2PT1 A;  3MVX A;  4JDF A;  1A40 A;  3MUQ A;  1B4Z A;  1ATG A;  4F22 A;  4WXJ A;  2X7P A;  2OLB A;  1QUL A;  4NF6 B;  2DWJ A;  4O3C A;  4YB6 A;  4P0G A;  3QIM A;  4GD5 A;  3VLV A;  1M5E A;  2I3W A;  3SDF A;  1B6H A;  4HCW A;  3ZKK A;  1B51 A;  1B1X A;  2F7C A;  1A8F A;  3M8U A;  1LCT A;  4KFQ A;  3RY3 A;  2PBW A;  3TFL A;  1O7T A;  1UTH A;  3T9V A;  2I4C A;  3OSQ A;  3VDF A;  2VGQ A;  1SDX A;  1VE4 A;  3SEW A;  4E0X A;  1RKM A;  4X9T A;  2DYX A;  1M5B A;  2CZL A;  3R26 A;  3S9N C;  2DE4 A;  5DYH A;  1D4N A;  1N7X A;  4RA1 A;  1RYO A;  4F1U A;  2QSX A;  3S9E A;  4FOR A;  3KEI A;  4F29 A;  4KYD A;  1BP5 A;  1MQJ A;  2A5S A;  3S9M C;  5B7D A;  5H8N A;  1IIW A;  1LB8 A;  3MP1 A;  4OZ9 A;  3U93 A;  5A5X A;  1M5D A;  1B46 A;  3RLF E;  2XXU A;  5CRY A;  2PX1 A;  4I62 A;  4QSD A;  3LUY A;  3L6G A;  3TYH A;  5DVJ A;  2I3V A;  5EHS A;  3PMX A;  5KZT A;  2OWT A;  3UP9 A;  4R2B A;  3MP6 A;  1MPB A;  5LOM A;  1FQD A;  3KOT A;  1FQC A;  3E4R A;  4IY6 A;  2ZYO A;  2M8C A;  5DEX B;  4U23 A;  5H8F A;  1MXX A;  1PDA A;  3JYR A;  3A09 A;  2HFB A;  2H25 A;  4DE8 A;  4F1Y A;  3L6H A;  4BDQ A;  3TEL A;  4GXS B;  2XXH A;  1ZMG A;  4QFN A;  1VSO A;  2XXP A;  3E9X A;  3OD7 A;  2HXW A;  4YIC A;  3PPR A;  3ILU B;  3TTK A;  3OO8 A;  3M3L A;  3SET A;  5H8Q A;  3KGC A;  1Q1K A;  1D9Y A;  3QK6 A;  1LBC A;  2REJ A;  1FTK A;  5ELV A;  4AB6 A;  1NH7 A;  1LFG A;  4KCD A;  3OMB A;  3FJM A;  4YZZ A;  4Z0I A;  4JWO A;  1EZ9 A;  1FTM A;  4PQJ A;  2R6G E;  3MVW A;  3PUZ E;  1YTV A;  1XHY A;  4NF4 B;  3TPA A;  4OFO A;  3T66 A;  2ANJ A;  1XOC A;  2GFE A;  4RJZ A;  4OEV A;  4I9D A;  3CSG A;  3W9W A;  4OMB A;  3UOR A;  4ZED A;  4I8C A;  3V5A A;  3FV2 A;  3N26 A;  3N94 A;  1Z7N E;  1Y1M A;  1PB8 A;  4ZEF A;  5I2N B;  1QKA A;  3HST A;  1WDN A;  2H98 A;  3IOT A;  3CFZ A;  2XXX A;  1CE2 A;  5BWJ A;  4F31 B;  4LA9 A;  4QF9 A;  3LSF B;  2Z8E A;  3CVG A;  4IO7 A;  3JZJ A;  1TWY A;  4EF1 A;  1UIU A;  4G8N A;  2XXV A;  4R6K A;  3MC2 A;  5I56 A;  4KD5 A;  3VLW A;  2REG A;  1I6A A;  4EDP A;  3C32 A;  1MH4 A;  1B52 A;  4RNS A;  5AA2 A;  2DWH A;  4H5F A;  4IY5 A;  1N84 A;  1GTK A;  3K4U A;  2QMX A;  1OLA A;  3WAF A;  4H65 A;  5L8D A;  1ZBM A;  4H8I A;  3RN8 A;  4R9G A;  3D4C A;  4OFL A;  2XX9 A;  5IKB A;  2HQ0 A;  4LZ5 A;  5J1D A;  4RK2 A;  1PEB A;  3PV0 E;  2AYS A;  4XTC Q;  1FQE A;  3ONM A;  3BKI B;  4ZEI A;  1MDP 1;  4F2O A;  4NED A;  1JVX A;  3DM0 A;  2X26 A;  4NTL A;  3OO7 A;  1LBB A;  2ZNS A;  1AH5 A;  1H45 A;  3BBR A;  1IZ1 A;  5EHM A;  2Y7K A;  3VFJ A;  3O29 A;  1XC1 A;  3EHU A;  4QFL A;  2I6E A;  2NXO A;  3FXR A;  2P0S A;  4M4G A;  4YU0 A;  1VR5 A;  1LFI A;  1IUD A;  3SEY A;  2F36 A;  1YAE A;  5AA4 B;  3VVE A;  1FQB A;  1JEU A;  4HTG A;  2DSF A;  2HZK A;  4DDD A;  5K2Y A;  2A5T B;  5DT6 A;  4YKJ A;  4KYE A;  1AMF A;  3TTR A;  2OBG A;  2QS2 A;  2F97 A;  1URD A;  2CMO A;  4R2F A;  3C34 A;  1MG1 A;  4DZ1 A;  3TKD A;  5TP9 A;  1O63 A;  4F3B A;  2Q9T A;  3K1M A;  2XX8 A;  2FA7 A;  4KCC A;  1SYI A;  4WED A;  4DCY A;  3PMV A;  3T93 B;  1MPD A;  1TXF A;  3MVZ A;  3HN0 A;  1DPE A;  4H8J A;  4LVQ A;  4GIZ A;  3IL1 B;  5L9O A;  3K0V A;  4JSO A;  5L9S A;  3EHT A;  3FVN A;  1B5H A;  5ICT A;  4NF5 B;  1BLF A;  5FHN A;  5F7V A;  2I0B A;  1ZKB A;  4QSE A;  2GHA A;  5FHO A;  4R9F A;  1M5C A;  1Y3P A;  1M5F A;  1JET A;  4ESW A;  1OIB A;  1XS5 A;  5CI5 A;  2HEU A;  4EUO A;  4LUB A;  1N76 A;  1USY E;  2DVC A;  3FUZ A;  1GVC A;  4WKM A;  5JTY B;  1US4 A;  3DEL B;  2DE3 A;  1MXZ A;  2F35 A;  4FEB A;  1MY2 A;  4P0I A;  2GRV A;  3CG3 A;  3HPI A;  3O66 A;  1N04 A;  2PT2 A;  1URG A;  4FE8 A;  3IJX B;  5ITP A;  2UXA A;  3C9H A;  2YLN A;  1SD3 A;  2ZYK A;  3B6Q A;  4NE4 A;  1B7H A;  2WKY A;  5CBS A;  3CIJ A;  2DXR A;  3MPL A;  4JBZ A;  2ZMB A;  1FTL A;  1B58 A;  3HV1 A;  1J1N A;  1R9Q A;  1AOV A;  1A7L A;  1MY3 A;  4P11 A;  3K6W A;  3TEP A;  2R71 A;  1PBQ A;  1TT1 A;  1NNP A;  4XKP A;  1MXY A;  1IXH A;  4IO4 A;  3PGF A;  2OK2 A;  5I59 B;  1R6Z A;  2P1S A;  3MQ9 A;  1N7W A;  5CMC A;  4F2Q A;  2F7B A;  3KOS A;  4MH5 A;  3U94 A;  4DIG A;  2ONK E;  1B3E A;  3O6I A;  3TQW A;  5KCJ B;  4LQ5 A;  3Q29 A;  4LAT A;  1JW4 A;  2Q88 A;  5DEX A;  5BUU A;  1R9L A;  2NWJ A;  3MWB A;  3VV5 A;  3LSX A;  4JXI A;  5FHM A;  3QAX A;  2B3B A;  2H4I A;  3H4Z A;  3M3F A;  1Y3N A;  3CR9 A;  1JQF A;  3U92 A;  2UYE A;  4IB2 A;  1DSN A;  2XX7 A;  4DXB A;  3VVD A;  5I57 B;  3PD9 A;  4QHQ A;  1MQG A;  5ICQ A;  1T0K A;  1P1U A;  4IGT A;  1B1H A;  4JWY A;  4H6D A;  3FVG A;  4OYV A;  3TZA A;  3RT6 B;  5IAI A;  4POX A;  1MY0 A;  1A99 A;  4Q0C A;  3ZS6 A;  4TLM B;  2DE2 A;  1MDQ A;  2YJP A;  3E3K A;  4EQ9 A;  3GXA A;  2I4B A;  2Q2C A;  2ESN A;  1B40 A;  2Z8F A;  2R9J A;  3TMG A;  5AA1 A;  2DWA A;  3PU5 A;  3R7X A;  2QJE A;  2ALU A;  5CMB A;  1IXG A;  4RXL A;  1MRP A;  1MPC A;  4U22 A;  1LAH E;  4ZZA A;  3IOW A;  2ONR A;  1NNT A;  4TQU Q;  1B32 A;  1MY1 A;  2Y7P A;  4U1Z A;  1FQF A;  1POT A;  1D9V A;  3KJ7 A;  5I58 B;  4N13 A;  2VD3 A;  1UQW A;  2HAU A;  3GBB A;  1NFT A;  5AE4 A;  3B6W A;  1QVS A;  3MBP A;  2Z23 A;  3OOA A;  1MXU A;  4O3A A;  3PUX E;  4G4P A;  4MLQ A;  2XXY A;  1ELJ A;  4U1O A;  4U4S A;  3VXC A;  4XXU A;  3FD3 A;  1OVT A;  3LSL A;  2O1M A;  3G3J A;  1S7Y A;  1NNK A;  1URS A;  2XXW A;  3KFM A;  1VFD A;  1B7Z A;  3QXM A;  3EPE A;  1HSJ A;  4YMA A;  1JW5 A;  4NMY A;  1NL5 A;  3PUY E;  1ZU0 A;  3EQ1 A;  1DOT A;  4G68 B;  3VLU A;  4FAJ A;  4NF8 A;  3MJN A;  1A55 A;  2XXI A;  3H03 A;  1LAG E;  4PP0 A;  4YB5 A;  4RPN A;  2F34 A;  3D4G A;  1PC3 A;  3C36 A;  1FW0 A;  1S9T A;  1P99 A;  1QJM A;  3CRB A;  2VP1 A;  4G77 A;  4GQO A;  3T96 B;  1QW0 A;  2QMW A;  3U72 A;  1UTB B;  1DMB A;  3OEL A;  4F3S A;  3VE1 B;  3UN6 A;  4EQ7 A;  3K6X A;  3MAM A;  4BDN A;  4QFK A;  4R6Y A;  4GWO A;  5A5X B;  2OJT A;  1QUK A;  1ANF A;  2RF1 A;  1Q35 A;  2AIX A;  2UVG A;  1F9B A;  1MM7 A;  3FZV A;  1JVY A;  3PPQ A;  3O6G A;  1IXI A;  2ZNT A;  2A5T A;  1B7U A;  3EN3 A;  1P1W A;  5HPQ A;  2Z8D A;  3EHS A;  3ODB A;  3S2V A;  1WOD A;  1LAF E;  4MLV A;  3LC8 A;  1II5 A;  3FIR A;  1PB9 A;  3IOV A;  3MZ1 A;  3V83 A;  2O51 A;  4ESX A;  3A3C A;  4HS7 A;  3H06 B;  2HZL A;  3PMW A;  2GH9 A;  3TDJ A;  3K6U A;  2UVH A;  3QSL A;  3G3G A;  1D3K A;  3QUJ A;  3IJO B;  2QS3 A;  2X7Q A;  3A3U A;  2OWS A;  3RTF B;  5DVI A;  3U1O A;  3I3V A;  3WAE A;  2PMS A;  3FXU A;  1HSL A;  4Q5T A;  5FTH A;  3IAZ A;  1PBP A;  4AQ4 A;  1N3X A;  3H3G A;  3RQT A;  1TFD A;  3SEV A;  4IO5 A;  4WEP A;  5ISU A;  1IIT A;  4ELP A;  4RK9 A;  1AIV A;  2O84 X;  1JNF A;  5JTY A;  5H8H A;  4GF8 A;  2DOJ A;  4YKP A;  3W9V A;  1MM6 A;  3C31 A;  3SKP A;  4POW A;  1O64 A;  2UVI A;  3Q25 A;  2B3F A;  2PYY A;  2V3U A;  3TAJ A;  1POY 1;  4ZDM A;  2XXQ A;  3FAS A;  2I58 A;  1MXW A;  3PPP A;  3P7I A;  3IK6 B;  3B6T A;  2DWI A;  4QRZ A;  2PVU A;  3BFT A;  1P1Q A;  3DP4 A;  3GBA A;  1SW1 A;  1I6Q A;  4LZ7 A;  5B70 A;  4O3B A;  1FTO A;  1OQG A;  4G8M A;  3IOR A;  3USD A;  3DP6 A;  4ELQ A;  4OWD A;  2Q8J A;  1QUI A;  1BKA A;  1US5 A;  4OET A;  3HHG A;  2DVZ A;  4G2Z A;  2E0S A;  5HM4 B;  1H76 A;  3TQL A;  1DPP A;  4BDR A;  5EYF A;  2RKM A;  3SEU A;  3TCG A;  1A8E A;  3LR1 A;  3TTM A;  1SW5 A;  3E13 X;  4IGR A;  2YPN A;  1I6B A;  4NF6 A;  2FNC A;  3N6U A;  4R73 A;  5AA2 B;  3K2D A;  1MH3 A;  1MXV A;  2THI A;  5TU0 A;  3JV9 A;  5I84 A;  3VXB A;  5I57 A;  1IQ7 A;  3KBR A;  2O6A A;  2G29 A;  3ZKL A;  3FXQ A;  1LGB C;  3R6U A;  2RCB A;  3K00 A;  4LP2 B;  4PFW A;  4HW8 A;  4GFR A;  4N07 A;  3FVO A;  5ITO A;  4U21 A;  4OEN A;  3IOU A;  1XVX A;  4ND9 A;  1DTZ A;  4OFJ A;  3C35 A;  1PB7 A;  1R1N A;  3DP8 A;  3HO7 A;  1H3D A;  4GVO A;  2I49 A;  4C1U A;  1B5J A;  2DXY A;  2LAO A;  2O69 A;  4X1B A;  1SYH A;  5AA3 A;  3B7D A;  4UA8 A;  5KDT B;  3TTL A;  4C1T A;  4ZE8 A;  2OZZ A;  3K02 A;  4X1D A;  3G3H A;  5TPA B;  4UAC A;  1B3F A;  3GZG A;  4LQ2 A;  3FJ7 A;  1FCK A;  3IB2 A;  1MQD A;  2ABH A;  4BDL A;  2ZYM A;  2VHA A;  3FGS A;  1ZLQ A;  3HHF A;  5TP9 B;  1YPN A;  1L5T A;  3AXF A;  1IXC A;  2G93 A;  4YKI A;  3RPW A;  4L17 A;  3IO6 A;  4BLA A;  1UIV A;  1B0L A;  3K1N A;  4LZ8 A;  3KN3 A;  3MW0 A;  4X48 A;  4C0R A;  4TLL B;  1EH3 A;  2F5X A;  1Z7M E;  1B3G A;  4GOT A;  4ZEB A;  4H67 A;  3IB1 A;  3MVY A;  2ONS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...