4ELRA

Ferric binding protein with iron and carbonate
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
310
structure length
310
Chain Sequence
SPTLTIYSGRGQSLVEPLVKQFEAETGIRVQVRYSTDAQILAALQEEGSRSPADLFWANTAGALGQASAKGLLRPLGETLLEKPIAFVPASRTWVPVTVRLRVLAYNPDRIKAEELPESLLDLPRFAREKGLVGRVGWTPTYSSFQDMVAGMIALYGEEKTREWLLAMKALAPKAYPSNPAMLDAIRAGEVDLGSTNHYYVVRFRRAGYRLGMHHFRDGDAGNLALVTGAGLLKTSKNLAAATRFLTYLLSPQAQQYFVGNIGEYPLVKGVALDPNLLPLEEALAKSPKLDLEKLPLDRALRLLRETGVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords Iron ABC transporter, periplasmic iron-binding protein
publication title Crystal structure of ferric binding protein A
rcsb
source organism Thermus thermophilus
total genus 108
structure length 310
sequence length 310
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13416 SBP_bac_8 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4elrA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4elrA02
1US5A 2GHBA 2H98A 3IAZA 1ATGA 1NFTA 1LSTA 3G3FA 2O1MA 2R9JA 4TOZA 2VD2A 3OEKA 1AL3A 3E4RA 2UYEA 2I0CA 1POY1 1NH7A 2PX1A 1QKAA 1MY3A 1JEUA 1DMBA 4YMBA 2Q88A 4N13A 1ZIUA 3U1OA 3L6GA 3UK4A 4G8HA 4ONYA 1GVCA 2QS4A 1SYHA 4ZZAA 2O69A 3T9UA 3OELA 3IO4A 5I2KA 2F7AA 4GL8A 1HSJA 3EHUA 3KZGA 2ZYKA 5I57B 2B3FA 3K1MA 1D4NA 4YB5A 1QVSA 1QUIA 1M5EA 3TUSA 1UTBB 3N6TA 4KYSA 2Z22A 1R6ZA 1SW2A 4ZEIA 4R2FA 2OLBA 4HTGA 3FXRA 3BFTA 1A55A 4Q0CA 3GZGA 1A7LA 4YKKA 3H6WA 3LR1A 3H4ZA 4GRKA 1LCFA 3HCQA 3EQ1A 5DT6A 3TELA 3AXFA 1POTA 4C1TA 3PMXA 4HCYA 1T0KA 2H4IA 3Q26A 2F7BA 2XXXA 3ILTB 4QFPA 3QAXA 1MXWA 3H6UA 1P99A 2QS2A 5L8DA 3SEWA 3VV5A 2DVZA 1SQYA 3A3CA 4RNSA 4OXVA 4WEDA 4ZZEA 2NXOA 1AMFA 3VXBA 1JW5A 5AA2B 4LQ5A 2BJJX 4NF4A 4X1DA 1IITA 3M3LA 1XHYA 4R6HA 4TLMB 3RNNA 4IO7A 2DVCA 5M2VA 4O3CA 3G3HA 4G68A 3TQLA 1A54A 1VE4A 2FYIA 5I2NA 1UIVA 1B58A 2Y7KA 4OMBA 3S9LC 3T96B 3FV2A 1BLFA 2P2AA 3DM0A 3FJMA 1QUKA 3OENA 3PD9A 3RPWA 2O68A 4M4GA 1S50A 3DELB 3OO6A 3T93B 3C34A 4EF2A 4BDQA 5TPAB 1PB7A 4YZZA 3FJGA 4YB7A 3S4UA 4QRZA 4IO3A 1MQIA 3FVKA 5LOMA 3K6UA 1MXUA 1XS5A 2ESNA 4X9TA 3SEYA 4FAJA 4JSDA 4NWCA 3ILUB 4OEUA 3IB0A 4LP2B 3KGCA 2UVJA 4TLLB 4RY1A 5K2XA 4PFUA 5AA4A 3HV1A 3JYRA 2GHAA 4YU0A 4BLAA 1BIYA 3T66A 1QW0A 3H06B 1M5DA 2I58A 5FTHA 4PFTA 4OVJA 3U94A 1OQHA 1EZ9A 2IA4A 4U1ZA 1B3EA 3FIRA 5L9OA 4ZEDA 5KDTB 1GTKA 1B32A 2A5TA 1NKXA 5I58B 4NF4B 2QJEA 1MXXA 3UN6A 3MP6A 1Y4CA 5DYHA 4QF9A 2O7IA 5BUUA 5CMBA 5ELVA 4JB7A 3UP9A 2RC8A 4IGTA 4RA1A 3VLVA 4H5GA 3DP8A 4P0GA 3U92A 2XD3A 1N3XA 3WAEA 2I48A 5F1QA 2YLNA 1YAEA 3QYTA 3M8UA 3PU5A 4M1VA 1H44A 2O84X 3LSWA 5JTYA 1TXFA 4NF8B 1B5IA 4IO5A 3PUYE 1LAHE 2V3TA 2I49A 4H67A 2UYFA 2NVUB 5AE4A 2REJA 1VFEA 3OO7A 4F18A 1MXVA 1DPEA 1VR5A 1SI1A 4NF6B 3ZS6A 3FASA 1JVXA 4PFWA 1ELJA 1B7ZA 1XT8A 3MP1A 4THIA 3K2DA 5L9SA 5AA4B 4XKRA 1JW1A 1FTLA 2RC7A 1LGBC 1B46A 1O64A 2Z8DA 1L5TA 2F34A 4XIGQ 1FCKA 3S9NC 1O7TA 3BBRA 3PV0E 3TAJA 4Q30B 4IO4A 4R9FA 2E0SA 4G68C 4E0XA 1B5HA 4DXUA 2DXRA 1HSLA 4R2BA 3W9WA 2ANJA 2G93A 3IORA 3KFMA 3A3UA 4HS7A 3EN3A 3HHGA 1BKAA 1B1HA 3N94A 3N6UA 1IXCA 4XXUA 1B3GA 4LONB 1DSNA 4X1BA 4E0WA 3TDJA 3B6TA 3QUJA 2VOZA 1LFGA 3V89B 3E9XA 4R6YA 2RINA 2V3UA 4XTCQ 1LB8A 1GR2A 3CR9A 3VXCA 4ESXA 4K3FA 2Z8FA 2DSFA 1B7UA 2I6EA 3TKDA 2D21A 3UA8A 1AIVA 5L9MA 3PUXE 1MH4A 4KCDA 5AA3A 1LLSA 1ZTYA 4KCCA 1IXGA 4PETA 4YKIA 4BDOA 3MW0A 3FV1A 2CZLA 4MF3A 3HO7A 5FHNA 1PB9A 3PMWA 2XHDA 1MQDA 4LZ7A 3EPEA 1MY1A 2XXIA 1MH3A 1A40A 3K4UA 1FQEA 5H8HA 3PUWE 3FATA 4R9GA 5TP9B 1NL5A 2IEEA 5DEXA 1Y4TA 4F2QA 1USYH 4PFYA 3ODBA 4GLIA 1Y3PA 1I6AA 1MQGA 4YKPA 4I1DA 3R6UA 1GV8A 3U8QA 2H25A 1EZOA 3GBAA 1D9YA 4U1OA 2P1SA 3R26A 4JDFA 1EZPA 4R6KA 1OVBA 5EHMA 4FJPA 4ELRA 1MXYA 1FTKA 5A5XB 1ZBMA 2B3BA 3B6WA 2D5WA 3MQ9A 4NTLA 1LFIA 1MQJA 3VDFA 1QULA 2Y7RA 2XX8A 4GL0A 3IL1B 3JZJA 3MAMA 4IO6A 4FATA 5HPQA 4EDPA 4QFLA 1ZU0A 4ELPA 2XX7A 4G2ZA 2ZNSA 3GLBA 2AL4A 1EH3A 4DZ1A 4JWXA 2H5YA 4KYDA 3TCGA 3MVYA 4POWA 4Q8RA 1IIWA 1N04A 3UORA 1LBCA 5ITPA 3SEVA 1Y20A 3MVZA 1FQBA 1WODA 2XXUA 3M3FA 3C9HA 1MRPA 1R9QA 3FVGA 3K6XA 4R72A 2X7PA 4OYVA 3O97A 4DXCA 5H8HB 2GH9A 1OIBA 5JEIA 2V84A 3PUZE 3H6TA 5DEXB 1Z7ME 4OWDA 4H1XA 4JSOA 4ZEKA 3K00A 2O51A 2F5XA 2I3WA 4LVQA 1N0TA 1VSOA 1Y1MA 2HCAA 3C31A 3QXMA 4Q5TA 3B7DA 5KCJB 3O6GA 4FECA 3CI8A 2FA7A 3IB2A 3MPLA 1BTJA 1P1WA 3C32A 4JBZA 2HFBA 1MG1A 2REGA 2X7QA 4KFQA 3CIJA 1M5BA 4NEDA 2F35A 2PT2A 5AA2D 1LAXA 1AH5A 2W7YA 1P1NA 1TFAA 3IB1A 5KZTA 4WXJA 2Q89A 1I6QA 5HM4B 3IOUA 4ZE9A 1IXHA 1UQWA 2HQ0A 3T9VA 3K02A 1DTZA 4KR5A 3Q25A 3CG3A 1MS7A 3KOSA 1P1OA 3HHFA 5I2KB 3BKIB 2Z23A 2DYXA 4R74A 4NE4A 3C36A 4QFNA 2R6GE 5FHOA 4F3BA 3C4MA 3BFUA 3CFZA 5CMCA 4UA8A 5B7DA 4AQ4A 3IR1A 3OO9A 1YPNA 1UTHA 2YJPA 5BWJA 1US4A 1XVYA 1MY2A 4UACA 4ECFA 4F3GA 3G3JA 3O6HA 3FVNA 3MBPA 3RT6B 4BDLA 4ZEBA 1IZ1A 4H65A 5EYFA 1J1NA 2D3IA 5CMKA 2NOOA 1JQFA 3HSTA 3G3GA 4FE8A 1ZMGA 3H03A 1N7XA 3KN3A 3KN7A 3L6HA 1B3LA 4QFOA 3D4CA 3W15C 3SEUA 4LATA 3TEPA 5IAIA 3C33A 4GD5A 1MPDA 3LSXA 4MLQA 1M5CA 1SDXA 3SERA 3TCFA 4Z7EA 1OVTA 1PC3A 4G68B 2WKYA 4EXKA 3CRBA 1WVJA 3OOAA 5I2NB 2OWSA 3H7MA 1PEBA 2NWJA 2Y7IA 2Z8EA 3V83A 2ZXTA 1JNFA 2Q9TA 3CG1A 4MH5A 3VLWA 5FTIA 2DE3A 3T9XB 2ZYMA 4NF5A 4EUOA 1B2HA 2AIXA 3SKPA 3TZAA 3TQWA 1LAFE 4EQ9A 4JWYA 3I6VA 3R7XA 2G29A 3VVFA 1VFDA 4KQPA 4YMAA 5CC2A 5JK4A 3O9PA 2DE2A 1IXIA 4NWDA 3OMBA 1URDA 3CFXA 3TTMA 3IOWA 4LQ2A 2XXTA 4LUBA 1D3KA 3EHSA 3TTRA 3IJXB 4NMYA 3HPIA 5CMMA 4F19A 3JV9A 1FQFA 1A8FA 4TQUQ 4MBPA 3RY3A 2Y7WA 4IY6A 3LSLA 5I59A 2DWHA 2RKMA 2DXYA 2KLFA 2PT1A 4U22A 3GBBA 4G8MA 3IOVA 3CSBA 3MZBA 4I62A 2F6PA 3K0VA 2HAVA 2A5TB 1RKMA 4F29A 5CI5A 1B1XA 1B0LA 1MPCA 2OWTA 2PYYA 2M8CA 1D9VA 4MLVA 4FIMA 2UXAA 4YICA 3FVOA 4F3PA 5DTBA 1Y3NA 3MUQA 3HN0A 4F39A 3THIA 1JW4A 5H8NA 4PQJA 5I84A 1H76A 4AB5A 1SW5A 4DIGA 5JTYB 3WAFA 3G7WA 5AA1A 1I69A 1MQHA 2VP1A 4JWOA 2I4CA 1B9JA 3KBRA 3RQTA 5I57A 4GVOA 1R9LA 3QIMA 2QRYA 5DVIA 2OJTA 2ZMBA 1UTBA 4XKQA 4LA9A 4U4SA 4GXAA 1FQAA 3LBSA 4OENA 3N26A 4FORA 1OQGA 2VD3A 4FEBA 3FJ7A 4ELQA 1MDQA 2P0SA 4I8CA 2GFEA 3LUYA 2OCUA 3SDFA 1I6BA 1WDNA 2R71A 3PPQA 3MJNA 1TWYA 3O66A 4EF1A 4F2OA 4OETA 3UGWA 1P1QA 3OEMA 2OK2A 3MWBA 1NNFA 5I59B 4H8JA 4ZS9A 2XXQA 1B3HA 3F11A 1NMUA 4RPOA 4R75A 1OLCA 4H5FA 3PD8A 3LC8A 1B51A 1R1NA 1LAGE 2HAUA 1LFHA 4PE5B 2ONRA 4U23A 2F8DA 1FTOA 2F97A 4U4XA 3RLFE 3RGYA 4L17A 2HZKA 1JVYA 2UVIA 2XXPA 2DWIA 1OLAA 3U72A 1S7YA 4RK2A 5H8NB 2RC9A 3RTFB 4QSDA 4ELOA 4F1UA 4FEDA 4GF8A 1RYOA 2HXWA 3VFJA 3ECRA 4F1YA 2F36A 3K01A 2LAOA 1HSEA 5TPAA 5CBRA 4JXIA 2HEUA 4KPTA 3C35A 3I5OA 1Y9UA 4R73A 2QPQA 1MM6A 4ISUA 3MZ9A 2DP8A 3IX1A 1BP5A 2DE4A 1QKBA 4ZDMA 3K1PA 5J1DA 3FXUA 4BDMA 4GXSB 2I4BA 4QHQA 1B3FA 5CRYA 1FTJA 3Q28A 4RXLA 3TMGA 1B0HA 3FZVA 1P1UA 1EU8A 3VVDA 4EQ7A 4RPNA 3KJTA 2PMSA 1Q35A 4RK9A 1B52A 2ALUA 3KSJA 1XVXA 2CMOA 3TTLA 3U93A 1MDP1 5DVJA 4GIZA 4QFKA 2Q2AA 1NNKA 3OXNA 2DWJA 4YB6A 2XXYA 3PGFA 4EQBA 3MVXA 5KDTA 4KHZE 4U2RA 2V3QA 3DP4A 1QJMA 2O7UA 3E3KA 5I58A 1PBQA 3SEXA 1QUJA 3MPKA 4GWOA 2PBWA 5K2YA 4BDNA 2DQVA 3M3KA 2YPNA 1JEVA 3OSRA 3S9EA 4KI0E 4Z0IA 1USYE 1FTMA 4O3BA 3A09A 4POXA 5CM6A 5IKBA 3QUFA 4GFRA 1N3WA 3S9MC 4F1VA 4I9DA 2RCAA 3TYHA 1DOTA 1ZKBA 5ICTA 1PBPA 4NF8A 2Y7PA 3TFLA 1B40A 1JETA 4RYAA 4F3SA 4KD5A 4HW8A 4F31B 5ISUA 1FQCA 3EF7A 3I3VA 4RJZA 4DDDA 3OSQA 1MM7A 1XOCA 4DXBA 2X26A 3KJ7A 5B70A 4NF6A 3FXQA 1SW4A 3KOTA 3B6QA 1PB8A 4ZE8A 3ZKKA 1CB6A 2QSXA 3CVGA 4X48A 4YAHX 3PMVA 1DTGA 5HBCA 4OHNA 1SBPA 1LBBA 1CE2A 1TT1A 2OZZA 3V5AA 3VVEA 3PPNA 3O29A 2ZNTA 4GOTA 4OQOA 3KEIA 1N84A 4YKJA 1H45A 3K1NA 2RCBA 3IOTA 4ZEFA 3V8XB 4P11A 3RN8A 2B65A 2H9BA 3PUVE 5ITOA 2DWAA 3ZSFA 1PDAA 1N7WA 4LZ8A 3RTWB 4C0RA 1Q1KA 4OERA 4WKMA 4U21A 3DLNA 2Q8JA 4WEPA 2DOJA 3PPOA 4OTEA 3ONMA 4G77A 2ZYNA 1LB9A 5I56A 2QS1A 2QMXA 2THIA 4DCXA 1B6HA 1DPPA 3N5LA 3K6WA 4N07A 2RF1A 3O28A 1XC1A 3LSFB 5EHSA 4DCYA 1B05A 2F7CA 1NNTA 1N76A 3KN8A 3D4GA 3TPAA 2F6GA 1SYIA 2Y84A 3CSGA 3QSLA 2DS9A 4IGRA 1II5A 3O2AA 3H3GA 4IO2A 3E13X 4QSEA 2UVGA 1MY4A 4MFIA 5H8QA 1FW0A 3OO8A 5TP9A 3UIFA 4HCWA 2XD2A 5H8SA 4DLDA 1Y3QA 1SVXB 1UTHB 2F78A 2QMWA 3PPPA 2I3VA 1SD3A 2QL3A 1SW1A 4ESWA 3IJOB 5F7VA 3G3IA 4OFJA 1GGGA 3PPRA 1Z7NE 2XX9A 1B7HA 1F9BA 5H8FA 4LZ5A 4ND9A 2ZNUA 3OD7A 3FGSA 2XXHA 3QK6A 3IK6B 2AL5A 4QSCA 4H6DA 3SESA 4C1UA 2FNCA 3VE1B 5FHMA 2ABHA 3USDA 3IO6A 3TODA 5A5XA 1KWHA 3CFLA 3MC2A 2ONKE 1B4HA 4XKNA 2A5SA 3MP8A 3VLUA 2O1LA 1B5JA 4OZ9A 4N6PA 1UIUA 1AOVA 2XXWA 1IQ7A 4XKPA 2V25A 2E1SA 3FUZA 3K6VA 3S2VA 1YTVA 3KG2A 5I56B 1TFDA 3P7IA 2I0BA 4P0IA 4OFLA 2GRVA 1MXZA 5CBSA 1M5FA 4OESA 4BDRA 1H3DA 1URSA 3ZKLA 4G4PA 4O3AA 1NNPA 4OEVA 2ONSA 1O63A 4G8NA 1FQDA 2PVUA 5DVFA 1OMPA 3GXAA 4NF5B 3TTNA 2VHAA 1RYXA 2HZLA 3G3KA 3W9VA 2AYSA 4ZECA 3MZ1A 3EHTA 2QS3A 3TTKA 1SI0A 3H6VA 1H43A 4EXLA 2UVHA 4AB6A 2XXVA 3TCHA 1IUDA 5TU0A 1MY0A 5H8QB 1URGA 2XXRA 3O6IA 1ZJLA 2VGQA 3RUMA 1YCJA 4IB2A 1S9TA 3T9HB 4IY5A 3SETA 2NUVA 4OFOA 3RT8A 5KCJA 1Y1ZA 2Q2CA 3T22A 3FD3A 3Q27A 5H8FB 4KYEA 1ANFA 2ZYOA 4PP0A 3Q29A 4H8IA 1LCTA 2O6AA 4H0WA 1ZLQA 2H99A 3KSXA 5AA2A 2OBGA 1NH8A 1B4ZA 2V93A 4F22A 3MVWA 4DE8A 1A99A 4GQOA 1IEJA 5ICQA 3DP6A 1MPBA 1A8EA
chains in the Genus database with same CATH superfamily
1US5A 2GHBA 2H98A 3IAZA 1ATGA 1NFTA 1LSTA 3G3FA 2O1MA 2R9JA 4TOZA 2VD2A 3OEKA 1AL3A 3E4RA 2UYEA 2I0CA 1POY1 1NH7A 2PX1A 5IZ3B 1QKAA 1MY3A 2ZZVA 3MSTA 1JEUA 4QXDA 1DMBA 4YMBA 2Q88A 4N13A 1ZIUA 3U1OA 3L6GA 3UK4A 4G8HA 4ONYA 2OWZA 1GVCA 2QS4A 1SYHA 2FIXA 2O69A 4ZZAA 3T9UA 3OELA 3IO4A 2FHYA 5I2KA 4PDHA 4JVIA 2F7AA 4GL8A 1HSJA 3EHUA 1QGXA 3KZGA 2ZYKA 4MX6A 5I57B 3RPLA 2B3FA 3K1MA 1D4NA 4YB5A 4N6KA 1QVSA 1QUIA 1M5EA 2ZZXA 3TUSA 1UTBB 3N6TA 4P1LA 4KYSA 2Z22A 1R6ZA 1SW2A 2XWVA 4R2FA 4ZEIA 2OLBA 4HTGA 5IZZA 3FXRA 3BFTA 1A55A 4Q0CA 3GZGA 1A7LA 4YKKA 3H6WA 3LR1A 4P3LA 3H4ZA 4GRKA 1LCFA 3HCQA 3EQ1A 5DT6A 3TELA 3AXFA 1POTA 4C1TA 1FBCA 3PMXA 4HCYA 1T0KA 2H4IA 3Q26A 2F7BA 4PFRA 1DBZA 2XXXA 3ILTB 4QFPA 3QAXA 4NF0A 1MXWA 3H6UA 4GX6A 1P99A 2QS2A 5L8DA 3SEWA 3VV5A 2DVZA 1SQYA 3A3CA 4RNSA 4OXVA 4WEDA 4ZZEA 2NXOA 1AMFA 3VXBA 1JW5A 5AA2B 4LQ5A 1XI6A 2BJJX 4NF4A 4X1DA 1IITA 3M3LA 2OX3A 1XHYA 2CZIA 4R6HA 4TLMB 3RNNA 4IO7A 4H46A 1EYKA 2DVCA 5M2VA 4O3CA 3G3HA 4G68A 1FPKA 3TQLA 1A54A 1VE4A 2FYIA 5I2NA 4JVDA 1UIVA 1B58A 4PGPA 2Y7KA 4OMBA 3S9LC 4DI4B 3T96B 3FV2A 1BLFA 4PBQA 2P2AA 3DM0A 3FJMA 1QUKA 3OENA 3PD9A 3RPWA 2O68A 4M4GA 1S50A 3DELB 3OO6A 3MYUA 3T93B 3C34A 3T0JA 4EF2A 4BDQA 5TPAB 1PB7A 4YZZA 4NX1A 3FJGA 4YB7A 3D1RA 3S4UA 4NN3A 4QRZA 4IO3A 3RPLB 1MQIA 3FVKA 5LOMA 3K6UA 1MXUA 1XS5A 2ESNA 4X9TA 3SEYA 4FAJA 4JSDA 1KA0A 3ILUB 4NWCA 4OEUA 1RDYA 3IB0A 4LP2B 4TLLB 3KGCA 2UVJA 4PE3A 4RY1A 5K2XA 4P56A 4PFIA 2R8TA 4PFUA 5AA4A 3HV1A 3JYRA 2GHAA 4YU0A 4BLAA 1BIYA 3T66A 3KC0A 1QW0A 3H06B 3HFUA 1M5DA 4OVQA 2I58A 2XWOA 5FTHA 4PFTA 4OVJA 3U94A 1OQHA 1EZ9A 4PF8A 2IA4A 4U1ZA 1B3EA 3FIRA 5L9OA 2HHMA 4ZEDA 5KDTB 1GTKA 1B32A 3IFCA 5J16A 2A5TA 1NKXA 4PDDA 5I58B 4NF4B 2QJEA 1MXXA 3UN6A 3MP6A 1Y4CA 5DYHA 4QF9A 2O7IA 5BUUA 5CMBA 5ELVA 4JB7A 3UP9A 2RC8A 4IGTA 4RA1A 3VLVA 4H5GA 3DP8A 4P0GA 3U92A 2XD3A 1N3XA 4OVPA 3WAEA 2I48A 5F1QA 2YLNA 1YAEA 3QYTA 1FSAA 3M8UA 3PU5A 4M1VA 4P47A 1H44A 2O84X 3LSWA 5JTYA 1TXFA 4NF8B 1B5IA 4IO5A 3PUYE 1LAHE 2V3TA 3GYYA 2I49A 4H67A 1FBGA 2UYFA 2NVUB 5AE4A 4I3YA 2REJA 1VFEA 4G61A 4OA4A 3OO7A 4F18A 1MXVA 1DPEA 1VR5A 1IMCA 1SI1A 4NF6B 3ZS6A 3FASA 1JVXA 4GWYA 4PFWA 1ELJA 1B7ZA 3EKIA 1XT8A 3MP1A 4THIA 3K2DA 5L9SA 4PTKA 5AA4B 4MAGA 4XKRA 1JW1A 1FJ6A 1FTLA 2RC7A 1LGBC 1B46A 1IMDA 1O64A 2Z8DA 1L5TA 2F34A 4XIGQ 1FPEA 1FCKA 3S9NC 1FPFA 1O7TA 3BBRA 3PV0E 3TAJA 4Q30B 4IO4A 4R9FA 2E0SA 4G68C 4E0XA 4HE1A 1B5HA 4DXUA 2DXRA 1HSLA 4R2BA 3W9WA 2ANJA 2G93A 3IORA 3KFMA 3A3UA 4HS7A 3EN3A 3HHGA 4N8GA 1BKAA 1B1HA 3N94A 3N6UA 1IXCA 4XXUA 1B3GA 4LONB 1DSNA 4X1BA 4E0WA 3TDJA 3B6TA 3E79A 3QUJA 2VOZA 4PGNA 1LFGA 3V89B 3E9XA 4R6YA 2QVVA 2RINA 2V3UA 4XTCQ 1LB8A 1GR2A 3CR9A 3VXCA 2VPNA 4ESXA 4K3FA 2Z8FA 2DSFA 2KR0A 1B7UA 2PFYA 2I6EA 4GWZA 3TKDA 2D21A 3UA8A 1AIVA 3ISPA 5L9MA 3PUXE 1DK4A 1MH4A 4KCDA 1FBPA 5AA3A 1LLSA 1ZTYA 4KCCA 1IXGA 4PETA 4YKIA 4BDOA 3MW0A 4O7MA 3FV1A 2CZLA 4MF3A 2QVUA 3HO7A 5FHNA 1FTAA 1PB9A 3PMWA 2XHDA 5LTCA 1MQDA 4LZ7A 3EPEA 4LN5A 1MY1A 2XXIA 1MH3A 1A40A 3K4UA 1FQEA 5H8HA 3PUWE 3FATA 4R9GA 5TP9B 1NL5A 1IMFA 4PBHA 2IEEA 4P9KA 5DEXA 1Y4TA 1EYJA 4F2QA 1USYH 4PFYA 3ODBA 4GLIA 1Y3PA 1I6AA 1MQGA 4YKPA 2XXKA 4I1DA 4IR8A 3R6UA 1GV8A 3U8QA 2H25A 1EZOA 3GBAA 1D9YA 4PFBA 4MNIA 2P1SA 3R26A 4U1OA 4JDFA 1EZPA 4R6KA 1OVBA 4N4UA 5EHMA 4FJPA 4ELRA 1MXYA 1FTKA 5A5XB 1ZBMA 2B3BA 3B6WA 2D5WA 3MQ9A 4NTLA 1LFIA 1MQJA 5EQAA 3VDFA 1QULA 2Y7RA 2XX8A 4GL0A 3IL1B 3JZJA 1NUYA 3MAMA 4IO6A 4O94A 4FATA 5HPQA 4EDPA 4QFLA 1ZU0A 4ELPA 2XX7A 4G2ZA 2ZNSA 3GLBA 4N81A 2AL4A 1EH3A 4DZ1A 2DDKA 3U65A 4JWXA 2H5YA 4KYDA 3TCGA 3MVYA 4POWA 1LEVA 2CZKA 4Q8RA 1IIWA 1N04A 3UORA 1LBCA 5ITPA 3SEVA 1Y20A 3MVZA 1FQBA 1WODA 2XXUA 3M3FA 3C9HA 1MRPA 1R9QA 3FVGA 3K6XA 1NV5A 4R72A 2X7PA 2Q8MA 4OYVA 3O97A 4MEVA 4DXCA 5H8HB 2GH9A 1OIBA 5JEIA 2V84A 3PUZE 3H6TA 4HE2A 5DEXB 1Z7ME 4OWDA 4H1XA 4JSOA 4ZEKA 3K00A 2O51A 2F5XA 1LBYA 2I3WA 4LVQA 5ET8A 1N0TA 1VSOA 1Y1MA 2HCAA 3C31A 5A5LA 3QXMA 4Q5TA 3B7DA 5KCJB 3O6GA 4FECA 1NI9A 1FJ9A 3CI8A 2B4MA 2FA7A 3IB2A 3MPLA 1BTJA 1P1WA 4N6DA 3C32A 4JBZA 2MKZA 4PAKA 1FPBA 2HFBA 1MG1A 2REGA 2X7QA 4KFQA 3CIJA 1M5BA 1G0HA 4NEDA 2F35A 5IM2A 2PT2A 5AA2D 1LAXA 1AH5A 2W7YA 2Y5LA 1P1NA 1TFAA 3IB1A 5KZTA 4WXJA 2P3NA 2Q89A 1I6QA 5HM4B 3IOUA 4ZE9A 1IXHA 1UQWA 2HQ0A 3T9VA 3K02A 1DTZA 4KR5A 3Q25A 4JVCA 4QBAA 3BIHA 3CG3A 1MS7A 1FBFA 1KZ8A 3KOSA 1P1OA 3HHFA 5EQ9A 5I2KB 2P3VA 3BKIB 2Z23A 2DYXA 4PAIA 4R74A 4NE4A 3C36A 4QFNA 1NV2A 2R6GE 5FHOA 4F3BA 3C4MA 3BFUA 4GBWA 3CFZA 5CMCA 4UA8A 5B7DA 4AQ4A 3IR1A 3OO9A 1EYIA 1YPNA 3FXBA 1UTHA 2YJPA 2WBBA 4OVSA 5BWJA 1US4A 1XVYA 1MY2A 4UACA 3QMFA 4ECFA 3KBZA 4F3GA 3G3JA 3O6HA 3FVNA 3MBPA 3RT6B 4BDLA 4NGUA 4ZEBA 1NV6A 3RYDA 2QVRA 1IZ1A 1LBXA 4H65A 5EYFA 1J1NA 2D3IA 5CMKA 4OVTA 2NOOA 1JQFA 3HSTA 1JP4A 3G3GA 1K9ZA 4FE8A 1ZMGA 3H03A 1N7XA 2CEXA 3KN3A 3KN7A 3L6HA 4FBPA 1B3LA 4XEQA 4QFOA 3D4CA 3W15C 3SEUA 4LATA 3TEPA 5IAIA 3C33A 4GD5A 1MPDA 3LSXA 4MLQA 1M5CA 1SDXA 3SERA 3TCFA 4Z7EA 1OVTA 4XF5A 1PC3A 2WBDA 4PAFA 4GBVA 4G68B 2WKYA 4EXKA 1VDWA 3CRBA 1FPIA 1WVJA 3OOAA 5I2NB 2OWSA 3H7MA 3E78A 1PEBA 2NWJA 2Y7IA 2Z8EA 3V83A 2ZXTA 1FBHA 2PFZA 1JNFA 2Q9TA 3CHGA 3CG1A 4MH5A 3VLWA 5FTIA 1FPLA 2DE3A 3T9XB 2ZYMA 4NF5A 4EUOA 1B2HA 2AIXA 1AWBA 1FBDA 3SKPA 3TZAA 5I5PA 3TQWA 1LAFE 4EQ9A 4JWYA 3I6VA 3R7XA 1RDZA 2G29A 3VVFA 1VFDA 4KQPA 4YMAA 5CC2A 5JK4A 3O9PA 2L5VA 2DE2A 1IXIA 4NWDA 3OMBA 1URDA 3CFXA 3TTMA 3IOWA 4LQ2A 2XXTA 4LUBA 1D3KA 3EHSA 3TTRA 3IJXB 1FRPA 4P8BA 3PTYA 4NMYA 3HPIA 5CMMA 4F19A 3JV9A 1FQFA 1A8FA 1YZ0A 4NG7A 4TQUQ 4MBPA 3RY3A 2Y7WA 4IY6A 3LSLA 5I59A 2DWHA 5FBPA 5ESYA 2RKMA 2DXYA 2KLFA 2PT1A 4U22A 3GBBA 4G8MA 3IOVA 3CSBA 3MZBA 4I62A 2F6PA 3K0VA 2HAVA 2A5TB 1RKMA 4F29A 5CI5A 1B1XA 1B0LA 1MPCA 2OWTA 2F3DA 2HXRA 2PYYA 2M8CA 1D9VA 2BJIA 4UABA 4MLVA 4FIMA 2UXAA 4YICA 3FVOA 5IZ3A 4F3PA 5DTBA 1Y3NA 3MUQA 3HN0A 1NUWA 4F39A 3LV0A 3THIA 1JW4A 5H8NA 4PQJA 5I84A 1H76A 4AB5A 1SW5A 4DIGA 5JTYB 3WAFA 3G7WA 5AA1A 1I69A 1MQHA 2VP1A 4JWOA 2I4CA 1B9JA 3KBRA 3RQTA 5I57A 4AS4A 4GVOA 4NAPA 1R9LA 3QIMA 2QRYA 5DVIA 2OJTA 4N17A 2ZMBA 5I7IA 3LUZA 1UTBA 4XKQA 1INPA 4LA9A 4U4SA 4GXAA 1FPGA 4OANA 1FQAA 4GWXA 3LBSA 4OENA 3N26A 4FORA 5EYHA 4MHFA 1OQGA 2VD3A 4FEBA 3FJ7A 4ELQA 1MDQA 2P0SA 1IMAA 4I8CA 2GFEA 3LUYA 2OCUA 3SDFA 1I6BA 1WDNA 2R71A 4N15A 3PPQA 1NV7A 3MJNA 1TWYA 3O66A 4EF1A 4F2OA 4OVRA 4OETA 2PCRA 3UGWA 4N8YA 1P1QA 3OEMA 2OK2A 3MWBA 1NNFA 5I59B 2JJKA 4H8JA 4ZS9A 2XXQA 4GX3A 2XA5A 1B3HA 3F11A 1NMUA 4RPOA 4R75A 1OLCA 4H5FA 3PD8A 3LC8A 1B51A 1G0IA 1R1NA 1LAGE 2HAUA 1LFHA 4PE5B 2ONRA 4U23A 2F8DA 1FTOA 2F97A 4U4XA 3RLFE 3RGYA 4L17A 2HZKA 3B50A 1JVYA 2CZHA 2UVIA 2XXPA 2DWIA 1OLAA 3U72A 3SZPA 1S7YA 4RK2A 5H8NB 2RC9A 3RTFB 4QSDA 4ELOA 4F1UA 4FEDA 4GF8A 1RYOA 2HXWA 3VFJA 2WX9A 3ECRA 4F1YA 2F36A 3K01A 2LAOA 1HSEA 1NUXA 5TPAA 5I3SA 5CBRA 4JXIA 2HEUA 4KPTA 3C35A 3I5OA 4O7IA 1Y9UA 4R73A 2QPQA 1MM6A 4ISUA 3MZ9A 2DP8A 3IX1A 1BP5A 2DE4A 1QKBA 1FPJA 4ZDMA 3K1PA 5J1DA 3FXUA 4BDMA 4GXSB 2I4BA 4QHQA 1B3FA 2CEYA 5CRYA 4PC9A 1FTJA 3Q28A 4RXLA 3TMGA 1B0HA 3FZVA 1P1UA 1EU8A 3VVDA 4EQ7A 4RPNA 3KJTA 2PMSA 4RK9A 1Q35A 1B52A 2ALUA 2KQZA 3KSJA 1XVXA 2CMOA 2WYPA 3TTLA 4NHBA 3U93A 1MDP1 5DVJA 4GIZA 4QFKA 2GQ1A 2Q2AA 1NNKA 3OXNA 2DWJA 2WEFA 4YB6A 2XXYA 3PGFA 4EQBA 3FBPA 3MVXA 5KDTA 4KHZE 4U2RA 2V3QA 3DP4A 1QJMA 2FVZA 2QFLA 1LBVA 4XFEA 2O7UA 3E3KA 5I58A 3A29A 1PBQA 3BIGA 3SEXA 1QUJA 3MPKA 4GWOA 2PBWA 5K2YA 4BDNA 2DQVA 3M3KA 2YPNA 1YXIA 1JEVA 3OSRA 3S9EA 4KI0E 4Z0IA 1USYE 1FTMA 2FIEA 4O3BA 3A09A 4POXA 5ET7A 5EQ7A 5CM6A 5IKBA 2FBPA 3QUFA 4GFRA 1N3WA 3S9MC 4F1VA 4I9DA 2RCAA 3TYHA 1FBEA 1DOTA 1ZKBA 5ICTA 1PBPA 4NF8A 2Y7PA 3TFLA 1B40A 1JETA 4GWUA 1RDXA 4I40A 4RYAA 4F3SA 2XWKA 4KD5A 4HW8A 4F31B 1NUZA 5IZ1A 1K9YA 5ISUA 1FQCA 5ET6A 3EF7A 3I3VA 4RJZA 4DDDA 3OSQA 4PF6A 1MM7A 1NV0A 1XOCA 3B8BA 4DXBA 4P1EA 1KA1A 2X26A 3KJ7A 5B70A 3ROJA 4NF6A 3FXQA 1SW4A 3KOTA 3B6QA 1PB8A 4ZE8A 3ZKKA 1CB6A 2QSXA 3CVGA 4X48A 2VPOA 4YAHX 3PMVA 1DTGA 5HBCA 4OHNA 1SBPA 1LBBA 1CE2A 4X04A 1TT1A 3T1BA 2OZZA 3V5AA 3VVEA 4N91A 4MMPA 3PPNA 3O29A 1NV1A 2ZNTA 4GOTA 4OQOA 3IFAA 3KEIA 5IGAA 1N84A 4GX4A 4YKJA 4X8RA 1H45A 3K1NA 2RCBA 3IOTA 4ZEFA 3V8XB 4P11A 3RN8A 2B65A 2H9BA 2VT5A 3PUVE 5ITOA 2WYKA 2DWAA 3ZSFA 1PDAA 1N7WA 4LZ8A 3RTWB 4C0RA 1Q1KA 4KXPA 4OERA 4WKMA 2F3BA 4U21A 3DLNA 2Q8JA 4WEPA 2DOJA 3PPOA 4OTEA 3ONMA 4G77A 5ET5A 1FPDA 2ZYNA 1LB9A 5I56A 4AS5A 2QS1A 1DCUA 2QMXA 2THIA 4DCXA 1B6HA 1DPPA 3N5LA 4MIJA 3K6WA 4N07A 2RF1A 1BK4A 3O28A 1XC1A 3LSFB 5EHSA 4DCYA 1B05A 2F7CA 1NNTA 1N76A 3KN8A 3D4GA 3TPAA 2F6GA 1SYIA 1IMEA 4MNCA 2Y84A 3CSGA 3QSLA 2DS9A 3KC1A 4IGRA 1II5A 3O2AA 3H3GA 4IO2A 3E13X 4QSEA 2UVGA 4MCOA 1LBZA 1MY4A 4MFIA 5H8QA 1FW0A 3OO8A 5TP9A 3UIFA 4HCWA 2XD2A 1NV3A 5H8SA 4DLDA 1Y3QA 1SVXB 1UTHB 2F78A 2Q74A 2QMWA 3PPPA 2I3VA 1SD3A 2B4LA 2QL3A 1SW1A 4ESWA 3IJOB 5LDZA 5F7VA 3G3IA 4OFJA 1GGGA 3PPRA 1Z7NE 2XX9A 4GWWA 1B7HA 1F9BA 5H8FA 4LZ5A 4ND9A 2ZNUA 3OD7A 3FGSA 2XWIA 2XXHA 3QK6A 3IK6B 2AL5A 4QSCA 4H6DA 3SESA 4C1UA 2FNCA 5FHMA 3VE1B 1LBWA 2ABHA 3USDA 3IO6A 3TODA 5A5XA 1KWHA 3CFLA 3MC2A 2ONKE 2ZZWA 1B4HA 1SPIA 4XKNA 2A5SA 3MP8A 3VLUA 2O1LA 1B5JA 4OZ9A 5EYGA 4DI3D 4N6PA 1UIUA 1AOVA 2XXWA 1NV4A 1IQ7A 4XKPA 2V25A 2E1SA 3FUZA 3K6VA 5DW8A 3S2VA 1YYZA 1YTVA 3KG2A 5I56B 1TFDA 3P7IA 2I0BA 4P0IA 4OFLA 2GRVA 1MXZA 5CBSA 1M5FA 4OESA 4BDRA 1H3DA 1URSA 3ZKLA 4G4PA 4MJOA 4O3AA 1NNPA 4OEVA 2ONSA 1O63A 4G8NA 1Q9DA 1FQDA 2PVUA 5DVFA 4GWSA 1OMPA 3GXAA 4HE0A 4NF5B 3TTNA 2VHAA 1RYXA 2HZLA 3G3KA 3W9VA 3NOHA 2AYSA 4ZECA 3MZ1A 3EHTA 2V4CA 2QS3A 3TTKA 1SI0A 3H6VA 1H43A 2HPGA 4EXLA 2UVHA 4AB6A 2XXVA 3TCHA 1IUDA 5TU0A 1MY0A 4HXVA 5H8QB 1URGA 2XXRA 3O6IA 4H45A 1ZJLA 2VGQA 5F24A 1IMBA 3RUMA 1YCJA 4IB2A 1S9TA 3T9HB 4IY5A 3SETA 1CNQA 2NUVA 4MNPA 1D9QA 4OFOA 4I3EA 3RT8A 5KCJA 1Y1ZA 2Q2CA 3T22A 3FD3A 3Q27A 5H8FB 4KYEA 4NQ8A 4PCDA 1ANFA 2ZYOA 4PP0A 3Q29A 4H8IA 1LCTA 2O6AA 4H0WA 1ZLQA 2H99A 3KSXA 5AA2A 2OBGA 5T3JA 1NH8A 1B4ZA 2V93A 5EQ8A 4F22A 3MVWA 4O8MA 4DE8A 1A99A 4GQOA 1IEJA 5ICQA 3DP6A 1MPBA 2Y5KA 1A8EA
chains in the Genus database with same CATH topology
1US5A 2GHBA 2H98A 3IAZA 1ATGA 1NFTA 1LSTA 3G3FA 2O1MA 2R9JA 4TOZA 2VD2A 3OEKA 1AL3A 3E4RA 2UYEA 2I0CA 1POY1 1NH7A 2PX1A 1QKAA 1MY3A 1JEUA 1DMBA 4YMBA 2Q88A 4N13A 1ZIUA 3U1OA 3L6GA 3UK4A 4G8HA 4ONYA 1GVCA 2QS4A 1SYHA 4ZZAA 2O69A 3T9UA 3OELA 3IO4A 5I2KA 2F7AA 4GL8A 1HSJA 3EHUA 3KZGA 2ZYKA 5I57B 2B3FA 3K1MA 1D4NA 4YB5A 1QVSA 1QUIA 1M5EA 3TUSA 1UTBB 3N6TA 4KYSA 2Z22A 1R6ZA 1SW2A 4ZEIA 4R2FA 2OLBA 4HTGA 3FXRA 3BFTA 1A55A 4Q0CA 3GZGA 1A7LA 4YKKA 3H6WA 3LR1A 3H4ZA 4GRKA 1LCFA 3HCQA 3EQ1A 5DT6A 3TELA 3AXFA 1POTA 4C1TA 3PMXA 4HCYA 1T0KA 2H4IA 3Q26A 2F7BA 2XXXA 3ILTB 4QFPA 3QAXA 1MXWA 3H6UA 1P99A 2QS2A 5L8DA 3SEWA 3VV5A 2DVZA 1SQYA 3A3CA 4RNSA 4OXVA 4WEDA 4ZZEA 2NXOA 1AMFA 3VXBA 1JW5A 5AA2B 4LQ5A 2BJJX 4NF4A 4X1DA 1IITA 3M3LA 1XHYA 4R6HA 4TLMB 3RNNA 4IO7A 2DVCA 5M2VA 4O3CA 3G3HA 4G68A 3TQLA 1A54A 1VE4A 2FYIA 5I2NA 1UIVA 1B58A 2Y7KA 4OMBA 3S9LC 3T96B 3FV2A 1BLFA 2P2AA 3DM0A 3FJMA 1QUKA 3OENA 3PD9A 3RPWA 2O68A 4M4GA 1S50A 3DELB 3OO6A 3T93B 3C34A 4EF2A 4BDQA 5TPAB 1PB7A 4YZZA 3FJGA 4YB7A 3S4UA 4QRZA 4IO3A 1MQIA 3FVKA 5LOMA 3K6UA 1MXUA 1XS5A 2ESNA 4X9TA 3SEYA 4FAJA 4JSDA 4NWCA 3ILUB 4OEUA 3IB0A 4LP2B 3KGCA 2UVJA 4TLLB 4RY1A 5K2XA 4PFUA 5AA4A 3HV1A 3JYRA 2GHAA 4YU0A 4BLAA 1BIYA 3T66A 1QW0A 3H06B 1M5DA 2I58A 5FTHA 4PFTA 4OVJA 3U94A 1OQHA 1EZ9A 2IA4A 4U1ZA 1B3EA 3FIRA 5L9OA 4ZEDA 5KDTB 1GTKA 1B32A 2A5TA 1NKXA 5I58B 4NF4B 2QJEA 1MXXA 3UN6A 3MP6A 1Y4CA 5DYHA 4QF9A 2O7IA 5BUUA 5CMBA 5ELVA 4JB7A 3UP9A 2RC8A 4IGTA 4RA1A 3VLVA 4H5GA 3DP8A 4P0GA 3U92A 2XD3A 1N3XA 3WAEA 2I48A 5F1QA 2YLNA 1YAEA 3QYTA 3M8UA 3PU5A 4M1VA 1H44A 2O84X 3LSWA 5JTYA 1TXFA 4NF8B 1B5IA 4IO5A 3PUYE 1LAHE 2V3TA 2I49A 4H67A 2UYFA 2NVUB 5AE4A 2REJA 1VFEA 3OO7A 4F18A 1MXVA 1DPEA 1VR5A 1SI1A 4NF6B 3ZS6A 3FASA 1JVXA 4PFWA 1ELJA 1B7ZA 1XT8A 3MP1A 4THIA 3K2DA 5L9SA 5AA4B 4XKRA 1JW1A 1FTLA 2RC7A 1LGBC 1B46A 1O64A 2Z8DA 1L5TA 2F34A 4XIGQ 1FCKA 3S9NC 1O7TA 3BBRA 3PV0E 3TAJA 4Q30B 4IO4A 4R9FA 2E0SA 4G68C 4E0XA 1B5HA 4DXUA 2DXRA 1HSLA 4R2BA 3W9WA 2ANJA 2G93A 3IORA 3KFMA 3A3UA 4HS7A 3EN3A 3HHGA 1BKAA 1B1HA 3N94A 3N6UA 1IXCA 4XXUA 1B3GA 4LONB 1DSNA 4X1BA 4E0WA 3TDJA 3B6TA 3QUJA 2VOZA 1LFGA 3V89B 3E9XA 4R6YA 2RINA 2V3UA 4XTCQ 1LB8A 1GR2A 3CR9A 3VXCA 4ESXA 4K3FA 2Z8FA 2DSFA 1B7UA 2I6EA 3TKDA 2D21A 3UA8A 1AIVA 5L9MA 3PUXE 1MH4A 4KCDA 5AA3A 1LLSA 1ZTYA 4KCCA 1IXGA 4PETA 4YKIA 4BDOA 3MW0A 3FV1A 2CZLA 4MF3A 3HO7A 5FHNA 1PB9A 3PMWA 2XHDA 1MQDA 4LZ7A 3EPEA 1MY1A 2XXIA 1MH3A 1A40A 3K4UA 1FQEA 5H8HA 3PUWE 3FATA 4R9GA 5TP9B 1NL5A 2IEEA 5DEXA 1Y4TA 4F2QA 1USYH 4PFYA 3ODBA 4GLIA 1Y3PA 1I6AA 1MQGA 4YKPA 4I1DA 3R6UA 1GV8A 3U8QA 2H25A 1EZOA 3GBAA 1D9YA 4U1OA 2P1SA 3R26A 4JDFA 1EZPA 4R6KA 1OVBA 5EHMA 4FJPA 4ELRA 1MXYA 1FTKA 5A5XB 1ZBMA 2B3BA 3B6WA 2D5WA 3MQ9A 4NTLA 1LFIA 1MQJA 3VDFA 1QULA 2Y7RA 2XX8A 4GL0A 3IL1B 3JZJA 3MAMA 4IO6A 4FATA 5HPQA 4EDPA 4QFLA 1ZU0A 4ELPA 2XX7A 4G2ZA 2ZNSA 3GLBA 2AL4A 1EH3A 4DZ1A 4JWXA 2H5YA 4KYDA 3TCGA 3MVYA 4POWA 4Q8RA 1IIWA 1N04A 3UORA 1LBCA 5ITPA 3SEVA 1Y20A 3MVZA 1FQBA 1WODA 2XXUA 3M3FA 3C9HA 1MRPA 1R9QA 3FVGA 3K6XA 4R72A 2X7PA 4OYVA 3O97A 4DXCA 5H8HB 2GH9A 1OIBA 5JEIA 2V84A 3PUZE 3H6TA 5DEXB 1Z7ME 4OWDA 4H1XA 4JSOA 4ZEKA 3K00A 2O51A 2F5XA 2I3WA 4LVQA 1N0TA 1VSOA 1Y1MA 2HCAA 3C31A 3QXMA 4Q5TA 3B7DA 5KCJB 3O6GA 4FECA 3CI8A 2FA7A 3IB2A 3MPLA 1BTJA 1P1WA 3C32A 4JBZA 2HFBA 1MG1A 2REGA 2X7QA 4KFQA 3CIJA 1M5BA 4NEDA 2F35A 2PT2A 5AA2D 1LAXA 1AH5A 2W7YA 1P1NA 1TFAA 3IB1A 5KZTA 4WXJA 2Q89A 1I6QA 5HM4B 3IOUA 4ZE9A 1IXHA 1UQWA 2HQ0A 3T9VA 3K02A 1DTZA 4KR5A 3Q25A 3CG3A 1MS7A 3KOSA 1P1OA 3HHFA 5I2KB 3BKIB 2Z23A 2DYXA 4R74A 4NE4A 3C36A 4QFNA 2R6GE 5FHOA 4F3BA 3C4MA 3BFUA 3CFZA 5CMCA 4UA8A 5B7DA 4AQ4A 3IR1A 3OO9A 1YPNA 1UTHA 2YJPA 5BWJA 1US4A 1XVYA 1MY2A 4UACA 4ECFA 4F3GA 3G3JA 3O6HA 3FVNA 3MBPA 3RT6B 4BDLA 4ZEBA 1IZ1A 4H65A 5EYFA 1J1NA 2D3IA 5CMKA 2NOOA 1JQFA 3HSTA 3G3GA 4FE8A 1ZMGA 3H03A 1N7XA 3KN3A 3KN7A 3L6HA 1B3LA 4QFOA 3D4CA 3W15C 3SEUA 4LATA 3TEPA 5IAIA 3C33A 4GD5A 1MPDA 3LSXA 4MLQA 1M5CA 1SDXA 3SERA 3TCFA 4Z7EA 1OVTA 1PC3A 4G68B 2WKYA 4EXKA 3CRBA 1WVJA 3OOAA 5I2NB 2OWSA 3H7MA 1PEBA 2NWJA 2Y7IA 2Z8EA 3V83A 2ZXTA 1JNFA 2Q9TA 3CG1A 4MH5A 3VLWA 5FTIA 2DE3A 3T9XB 2ZYMA 4NF5A 4EUOA 1B2HA 2AIXA 3SKPA 3TZAA 3TQWA 1LAFE 4EQ9A 4JWYA 3I6VA 3R7XA 2G29A 3VVFA 1VFDA 4KQPA 4YMAA 5CC2A 5JK4A 3O9PA 2DE2A 1IXIA 4NWDA 3OMBA 1URDA 3CFXA 3TTMA 3IOWA 4LQ2A 2XXTA 4LUBA 1D3KA 3EHSA 3TTRA 3IJXB 4NMYA 3HPIA 5CMMA 4F19A 3JV9A 1FQFA 1A8FA 4TQUQ 4MBPA 3RY3A 2Y7WA 4IY6A 3LSLA 5I59A 2DWHA 2RKMA 2DXYA 2KLFA 2PT1A 4U22A 3GBBA 4G8MA 3IOVA 3CSBA 3MZBA 4I62A 2F6PA 3K0VA 2HAVA 2A5TB 1RKMA 4F29A 5CI5A 1B1XA 1B0LA 1MPCA 2OWTA 2PYYA 2M8CA 1D9VA 4MLVA 4FIMA 2UXAA 4YICA 3FVOA 4F3PA 5DTBA 1Y3NA 3MUQA 3HN0A 4F39A 3THIA 1JW4A 5H8NA 4PQJA 5I84A 1H76A 4AB5A 1SW5A 4DIGA 5JTYB 3WAFA 3G7WA 5AA1A 1I69A 1MQHA 2VP1A 4JWOA 2I4CA 1B9JA 3KBRA 3RQTA 5I57A 4GVOA 1R9LA 3QIMA 2QRYA 5DVIA 2OJTA 2ZMBA 1UTBA 4XKQA 4LA9A 4U4SA 4GXAA 1FQAA 3LBSA 4OENA 3N26A 4FORA 1OQGA 2VD3A 4FEBA 3FJ7A 4ELQA 1MDQA 2P0SA 4I8CA 2GFEA 3LUYA 2OCUA 3SDFA 1I6BA 1WDNA 2R71A 3PPQA 3MJNA 1TWYA 3O66A 4EF1A 4F2OA 4OETA 3UGWA 1P1QA 3OEMA 2OK2A 3MWBA 1NNFA 5I59B 4H8JA 4ZS9A 2XXQA 1B3HA 3F11A 1NMUA 4RPOA 4R75A 1OLCA 4H5FA 3PD8A 3LC8A 1B51A 1R1NA 1LAGE 2HAUA 1LFHA 4PE5B 2ONRA 4U23A 2F8DA 1FTOA 2F97A 4U4XA 3RLFE 3RGYA 4L17A 2HZKA 1JVYA 2UVIA 2XXPA 2DWIA 1OLAA 3U72A 1S7YA 4RK2A 5H8NB 2RC9A 3RTFB 4QSDA 4ELOA 4F1UA 4FEDA 4GF8A 1RYOA 2HXWA 3VFJA 3ECRA 4F1YA 2F36A 3K01A 2LAOA 1HSEA 5TPAA 5CBRA 4JXIA 2HEUA 4KPTA 3C35A 3I5OA 1Y9UA 4R73A 2QPQA 1MM6A 4ISUA 3MZ9A 2DP8A 3IX1A 1BP5A 2DE4A 1QKBA 4ZDMA 3K1PA 5J1DA 3FXUA 4BDMA 4GXSB 2I4BA 4QHQA 1B3FA 5CRYA 1FTJA 3Q28A 4RXLA 3TMGA 1B0HA 3FZVA 1P1UA 1EU8A 3VVDA 4EQ7A 4RPNA 3KJTA 2PMSA 1Q35A 4RK9A 1B52A 2ALUA 3KSJA 1XVXA 2CMOA 3TTLA 3U93A 1MDP1 5DVJA 4GIZA 4QFKA 2Q2AA 1NNKA 3OXNA 2DWJA 4YB6A 2XXYA 3PGFA 4EQBA 3MVXA 5KDTA 4KHZE 4U2RA 2V3QA 3DP4A 1QJMA 2O7UA 3E3KA 5I58A 1PBQA 3SEXA 1QUJA 3MPKA 4GWOA 2PBWA 5K2YA 4BDNA 2DQVA 3M3KA 2YPNA 1JEVA 3OSRA 3S9EA 4KI0E 4Z0IA 1USYE 1FTMA 4O3BA 3A09A 4POXA 5CM6A 5IKBA 3QUFA 4GFRA 1N3WA 3S9MC 4F1VA 4I9DA 2RCAA 3TYHA 1DOTA 1ZKBA 5ICTA 1PBPA 4NF8A 2Y7PA 3TFLA 1B40A 1JETA 4RYAA 4F3SA 4KD5A 4HW8A 4F31B 5ISUA 1FQCA 3EF7A 3I3VA 4RJZA 4DDDA 3OSQA 1MM7A 1XOCA 4DXBA 2X26A 3KJ7A 5B70A 4NF6A 3FXQA 1SW4A 3KOTA 3B6QA 1PB8A 4ZE8A 3ZKKA 1CB6A 2QSXA 3CVGA 4X48A 4YAHX 3PMVA 1DTGA 5HBCA 4OHNA 1SBPA 1LBBA 1CE2A 1TT1A 2OZZA 3V5AA 3VVEA 3PPNA 3O29A 2ZNTA 4GOTA 4OQOA 3KEIA 1N84A 4YKJA 1H45A 3K1NA 2RCBA 3IOTA 4ZEFA 3V8XB 4P11A 3RN8A 2B65A 2H9BA 3PUVE 5ITOA 2DWAA 3ZSFA 1PDAA 1N7WA 4LZ8A 3RTWB 4C0RA 1Q1KA 4OERA 4WKMA 4U21A 3DLNA 2Q8JA 4WEPA 2DOJA 3PPOA 4OTEA 3ONMA 4G77A 2ZYNA 1LB9A 5I56A 2QS1A 2QMXA 2THIA 4DCXA 1B6HA 1DPPA 3N5LA 3K6WA 4N07A 2RF1A 3O28A 1XC1A 3LSFB 5EHSA 4DCYA 1B05A 2F7CA 1NNTA 1N76A 3KN8A 3D4GA 3TPAA 2F6GA 1SYIA 2Y84A 3CSGA 3QSLA 2DS9A 4IGRA 1II5A 3O2AA 3H3GA 4IO2A 3E13X 4QSEA 2UVGA 1MY4A 4MFIA 5H8QA 1FW0A 3OO8A 5TP9A 3UIFA 4HCWA 2XD2A 5H8SA 4DLDA 1Y3QA 1SVXB 1UTHB 2F78A 2QMWA 3PPPA 2I3VA 1SD3A 2QL3A 1SW1A 4ESWA 3IJOB 5F7VA 3G3IA 4OFJA 1GGGA 3PPRA 1Z7NE 2XX9A 1B7HA 1F9BA 5H8FA 4LZ5A 4ND9A 2ZNUA 3OD7A 3FGSA 2XXHA 3QK6A 3IK6B 2AL5A 4QSCA 4H6DA 3SESA 4C1UA 2FNCA 3VE1B 5FHMA 2ABHA 3USDA 3IO6A 3TODA 5A5XA 1KWHA 3CFLA 3MC2A 2ONKE 1B4HA 4XKNA 2A5SA 3MP8A 3VLUA 2O1LA 1B5JA 4OZ9A 4N6PA 1UIUA 1AOVA 2XXWA 1IQ7A 4XKPA 2V25A 2E1SA 3FUZA 3K6VA 3S2VA 1YTVA 3KG2A 5I56B 1TFDA 3P7IA 2I0BA 4P0IA 4OFLA 2GRVA 1MXZA 5CBSA 1M5FA 4OESA 4BDRA 1H3DA 1URSA 3ZKLA 4G4PA 4O3AA 1NNPA 4OEVA 2ONSA 1O63A 4G8NA 1FQDA 2PVUA 5DVFA 1OMPA 3GXAA 4NF5B 3TTNA 2VHAA 1RYXA 2HZLA 3G3KA 3W9VA 2AYSA 4ZECA 3MZ1A 3EHTA 2QS3A 3TTKA 1SI0A 3H6VA 1H43A 4EXLA 2UVHA 4AB6A 2XXVA 3TCHA 1IUDA 5TU0A 1MY0A 5H8QB 1URGA 2XXRA 3O6IA 1ZJLA 2VGQA 3RUMA 1YCJA 4IB2A 1S9TA 3T9HB 4IY5A 3SETA 2NUVA 4OFOA 3RT8A 5KCJA 1Y1ZA 2Q2CA 3T22A 3FD3A 3Q27A 5H8FB 4KYEA 1ANFA 2ZYOA 4PP0A 3Q29A 4H8IA 1LCTA 2O6AA 4H0WA 1ZLQA 2H99A 3KSXA 5AA2A 2OBGA 1NH8A 1B4ZA 2V93A 4F22A 3MVWA 4DE8A 1A99A 4GQOA 1IEJA 5ICQA 3DP6A 1MPBA 1A8EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1US5 A;  2GHB A;  2H98 A;  3IAZ A;  1ATG A;  1NFT A;  1LST A;  3G3F A;  2O1M A;  2R9J A;  4TOZ A;  2VD2 A;  3OEK A;  1AL3 A;  3E4R A;  2UYE A;  2I0C A;  1POY 1;  1NH7 A;  2PX1 A;  1QKA A;  1MY3 A;  1JEU A;  1DMB A;  4YMB A;  2Q88 A;  4N13 A;  1ZIU A;  3U1O A;  3L6G A;  3UK4 A;  4G8H A;  4ONY A;  1GVC A;  2QS4 A;  1SYH A;  4ZZA A;  2O69 A;  3T9U A;  3OEL A;  3IO4 A;  5I2K A;  2F7A A;  4GL8 A;  1HSJ A;  3EHU A;  3KZG A;  2ZYK A;  5I57 B;  2B3F A;  3K1M A;  1D4N A;  4YB5 A;  1QVS A;  1QUI A;  1M5E A;  3TUS A;  1UTB B;  3N6T A;  4KYS A;  2Z22 A;  1R6Z A;  1SW2 A;  4ZEI A;  4R2F A;  2OLB A;  4HTG A;  3FXR A;  3BFT A;  1A55 A;  4Q0C A;  3GZG A;  1A7L A;  4YKK A;  3H6W A;  3LR1 A;  3H4Z A;  4GRK A;  1LCF A;  3HCQ A;  3EQ1 A;  5DT6 A;  3TEL A;  3AXF A;  1POT A;  4C1T A;  3PMX A;  4HCY A;  1T0K A;  2H4I A;  3Q26 A;  2F7B A;  2XXX A;  3ILT B;  4QFP A;  3QAX A;  1MXW A;  3H6U A;  1P99 A;  2QS2 A;  5L8D A;  3SEW A;  3VV5 A;  2DVZ A;  1SQY A;  3A3C A;  4RNS A;  4OXV A;  4WED A;  4ZZE A;  2NXO A;  1AMF A;  3VXB A;  1JW5 A;  5AA2 B;  4LQ5 A;  2BJJ X;  4NF4 A;  4X1D A;  1IIT A;  3M3L A;  1XHY A;  4R6H A;  4TLM B;  3RNN A;  4IO7 A;  2DVC A;  5M2V A;  4O3C A;  3G3H A;  4G68 A;  3TQL A;  1A54 A;  1VE4 A;  2FYI A;  5I2N A;  1UIV A;  1B58 A;  2Y7K A;  4OMB A;  3S9L C;  3T96 B;  3FV2 A;  1BLF A;  2P2A A;  3DM0 A;  3FJM A;  1QUK A;  3OEN A;  3PD9 A;  3RPW A;  2O68 A;  4M4G A;  1S50 A;  3DEL B;  3OO6 A;  3T93 B;  3C34 A;  4EF2 A;  4BDQ A;  5TPA B;  1PB7 A;  4YZZ A;  3FJG A;  4YB7 A;  3S4U A;  4QRZ A;  4IO3 A;  1MQI A;  3FVK A;  5LOM A;  3K6U A;  1MXU A;  1XS5 A;  2ESN A;  4X9T A;  3SEY A;  4FAJ A;  4JSD A;  4NWC A;  3ILU B;  4OEU A;  3IB0 A;  4LP2 B;  3KGC A;  2UVJ A;  4TLL B;  4RY1 A;  5K2X A;  4PFU A;  5AA4 A;  3HV1 A;  3JYR A;  2GHA A;  4YU0 A;  4BLA A;  1BIY A;  3T66 A;  1QW0 A;  3H06 B;  1M5D A;  2I58 A;  5FTH A;  4PFT A;  4OVJ A;  3U94 A;  1OQH A;  1EZ9 A;  2IA4 A;  4U1Z A;  1B3E A;  3FIR A;  5L9O A;  4ZED A;  5KDT B;  1GTK A;  1B32 A;  2A5T A;  1NKX A;  5I58 B;  4NF4 B;  2QJE A;  1MXX A;  3UN6 A;  3MP6 A;  1Y4C A;  5DYH A;  4QF9 A;  2O7I A;  5BUU A;  5CMB A;  5ELV A;  4JB7 A;  3UP9 A;  2RC8 A;  4IGT A;  4RA1 A;  3VLV A;  4H5G A;  3DP8 A;  4P0G A;  3U92 A;  2XD3 A;  1N3X A;  3WAE A;  2I48 A;  5F1Q A;  2YLN A;  1YAE A;  3QYT A;  3M8U A;  3PU5 A;  4M1V A;  1H44 A;  2O84 X;  3LSW A;  5JTY A;  1TXF A;  4NF8 B;  1B5I A;  4IO5 A;  3PUY E;  1LAH E;  2V3T A;  2I49 A;  4H67 A;  2UYF A;  2NVU B;  5AE4 A;  2REJ A;  1VFE A;  3OO7 A;  4F18 A;  1MXV A;  1DPE A;  1VR5 A;  1SI1 A;  4NF6 B;  3ZS6 A;  3FAS A;  1JVX A;  4PFW A;  1ELJ A;  1B7Z A;  1XT8 A;  3MP1 A;  4THI A;  3K2D A;  5L9S A;  5AA4 B;  4XKR A;  1JW1 A;  1FTL A;  2RC7 A;  1LGB C;  1B46 A;  1O64 A;  2Z8D A;  1L5T A;  2F34 A;  4XIG Q;  1FCK A;  3S9N C;  1O7T A;  3BBR A;  3PV0 E;  3TAJ A;  4Q30 B;  4IO4 A;  4R9F A;  2E0S A;  4G68 C;  4E0X A;  1B5H A;  4DXU A;  2DXR A;  1HSL A;  4R2B A;  3W9W A;  2ANJ A;  2G93 A;  3IOR A;  3KFM A;  3A3U A;  4HS7 A;  3EN3 A;  3HHG A;  1BKA A;  1B1H A;  3N94 A;  3N6U A;  1IXC A;  4XXU A;  1B3G A;  4LON B;  1DSN A;  4X1B A;  4E0W A;  3TDJ A;  3B6T A;  3QUJ A;  2VOZ A;  1LFG A;  3V89 B;  3E9X A;  4R6Y A;  2RIN A;  2V3U A;  4XTC Q;  1LB8 A;  1GR2 A;  3CR9 A;  3VXC A;  4ESX A;  4K3F A;  2Z8F A;  2DSF A;  1B7U A;  2I6E A;  3TKD A;  2D21 A;  3UA8 A;  1AIV A;  5L9M A;  3PUX E;  1MH4 A;  4KCD A;  5AA3 A;  1LLS A;  1ZTY A;  4KCC A;  1IXG A;  4PET A;  4YKI A;  4BDO A;  3MW0 A;  3FV1 A;  2CZL A;  4MF3 A;  3HO7 A;  5FHN A;  1PB9 A;  3PMW A;  2XHD A;  1MQD A;  4LZ7 A;  3EPE A;  1MY1 A;  2XXI A;  1MH3 A;  1A40 A;  3K4U A;  1FQE A;  5H8H A;  3PUW E;  3FAT A;  4R9G A;  5TP9 B;  1NL5 A;  2IEE A;  5DEX A;  1Y4T A;  4F2Q A;  1USY H;  4PFY A;  3ODB A;  4GLI A;  1Y3P A;  1I6A A;  1MQG A;  4YKP A;  4I1D A;  3R6U A;  1GV8 A;  3U8Q A;  2H25 A;  1EZO A;  3GBA A;  1D9Y A;  4U1O A;  2P1S A;  3R26 A;  4JDF A;  1EZP A;  4R6K A;  1OVB A;  5EHM A;  4FJP A;  4ELR A;  1MXY A;  1FTK A;  5A5X B;  1ZBM A;  2B3B A;  3B6W A;  2D5W A;  3MQ9 A;  4NTL A;  1LFI A;  1MQJ A;  3VDF A;  1QUL A;  2Y7R A;  2XX8 A;  4GL0 A;  3IL1 B;  3JZJ A;  3MAM A;  4IO6 A;  4FAT A;  5HPQ A;  4EDP A;  4QFL A;  1ZU0 A;  4ELP A;  2XX7 A;  4G2Z A;  2ZNS A;  3GLB A;  2AL4 A;  1EH3 A;  4DZ1 A;  4JWX A;  2H5Y A;  4KYD A;  3TCG A;  3MVY A;  4POW A;  4Q8R A;  1IIW A;  1N04 A;  3UOR A;  1LBC A;  5ITP A;  3SEV A;  1Y20 A;  3MVZ A;  1FQB A;  1WOD A;  2XXU A;  3M3F A;  3C9H A;  1MRP A;  1R9Q A;  3FVG A;  3K6X A;  4R72 A;  2X7P A;  4OYV A;  3O97 A;  4DXC A;  5H8H B;  2GH9 A;  1OIB A;  5JEI A;  2V84 A;  3PUZ E;  3H6T A;  5DEX B;  1Z7M E;  4OWD A;  4H1X A;  4JSO A;  4ZEK A;  3K00 A;  2O51 A;  2F5X A;  2I3W A;  4LVQ A;  1N0T A;  1VSO A;  1Y1M A;  2HCA A;  3C31 A;  3QXM A;  4Q5T A;  3B7D A;  5KCJ B;  3O6G A;  4FEC A;  3CI8 A;  2FA7 A;  3IB2 A;  3MPL A;  1BTJ A;  1P1W A;  3C32 A;  4JBZ A;  2HFB A;  1MG1 A;  2REG A;  2X7Q A;  4KFQ A;  3CIJ A;  1M5B A;  4NED A;  2F35 A;  2PT2 A;  5AA2 D;  1LAX A;  1AH5 A;  2W7Y A;  1P1N A;  1TFA A;  3IB1 A;  5KZT A;  4WXJ A;  2Q89 A;  1I6Q A;  5HM4 B;  3IOU A;  4ZE9 A;  1IXH A;  1UQW A;  2HQ0 A;  3T9V A;  3K02 A;  1DTZ A;  4KR5 A;  3Q25 A;  3CG3 A;  1MS7 A;  3KOS A;  1P1O A;  3HHF A;  5I2K B;  3BKI B;  2Z23 A;  2DYX A;  4R74 A;  4NE4 A;  3C36 A;  4QFN A;  2R6G E;  5FHO A;  4F3B A;  3C4M A;  3BFU A;  3CFZ A;  5CMC A;  4UA8 A;  5B7D A;  4AQ4 A;  3IR1 A;  3OO9 A;  1YPN A;  1UTH A;  2YJP A;  5BWJ A;  1US4 A;  1XVY A;  1MY2 A;  4UAC A;  4ECF A;  4F3G A;  3G3J A;  3O6H A;  3FVN A;  3MBP A;  3RT6 B;  4BDL A;  4ZEB A;  1IZ1 A;  4H65 A;  5EYF A;  1J1N A;  2D3I A;  5CMK A;  2NOO A;  1JQF A;  3HST A;  3G3G A;  4FE8 A;  1ZMG A;  3H03 A;  1N7X A;  3KN3 A;  3KN7 A;  3L6H A;  1B3L A;  4QFO A;  3D4C A;  3W15 C;  3SEU A;  4LAT A;  3TEP A;  5IAI A;  3C33 A;  4GD5 A;  1MPD A;  3LSX A;  4MLQ A;  1M5C A;  1SDX A;  3SER A;  3TCF A;  4Z7E A;  1OVT A;  1PC3 A;  4G68 B;  2WKY A;  4EXK A;  3CRB A;  1WVJ A;  3OOA A;  5I2N B;  2OWS A;  3H7M A;  1PEB A;  2NWJ A;  2Y7I A;  2Z8E A;  3V83 A;  2ZXT A;  1JNF A;  2Q9T A;  3CG1 A;  4MH5 A;  3VLW A;  5FTI A;  2DE3 A;  3T9X B;  2ZYM A;  4NF5 A;  4EUO A;  1B2H A;  2AIX A;  3SKP A;  3TZA A;  3TQW A;  1LAF E;  4EQ9 A;  4JWY A;  3I6V A;  3R7X A;  2G29 A;  3VVF A;  1VFD A;  4KQP A;  4YMA A;  5CC2 A;  5JK4 A;  3O9P A;  2DE2 A;  1IXI A;  4NWD A;  3OMB A;  1URD A;  3CFX A;  3TTM A;  3IOW A;  4LQ2 A;  2XXT A;  4LUB A;  1D3K A;  3EHS A;  3TTR A;  3IJX B;  4NMY A;  3HPI A;  5CMM A;  4F19 A;  3JV9 A;  1FQF A;  1A8F A;  4TQU Q;  4MBP A;  3RY3 A;  2Y7W A;  4IY6 A;  3LSL A;  5I59 A;  2DWH A;  2RKM A;  2DXY A;  2KLF A;  2PT1 A;  4U22 A;  3GBB A;  4G8M A;  3IOV A;  3CSB A;  3MZB A;  4I62 A;  2F6P A;  3K0V A;  2HAV A;  2A5T B;  1RKM A;  4F29 A;  5CI5 A;  1B1X A;  1B0L A;  1MPC A;  2OWT A;  2PYY A;  2M8C A;  1D9V A;  4MLV A;  4FIM A;  2UXA A;  4YIC A;  3FVO A;  4F3P A;  5DTB A;  1Y3N A;  3MUQ A;  3HN0 A;  4F39 A;  3THI A;  1JW4 A;  5H8N A;  4PQJ A;  5I84 A;  1H76 A;  4AB5 A;  1SW5 A;  4DIG A;  5JTY B;  3WAF A;  3G7W A;  5AA1 A;  1I69 A;  1MQH A;  2VP1 A;  4JWO A;  2I4C A;  1B9J A;  3KBR A;  3RQT A;  5I57 A;  4GVO A;  1R9L A;  3QIM A;  2QRY A;  5DVI A;  2OJT A;  2ZMB A;  1UTB A;  4XKQ A;  4LA9 A;  4U4S A;  4GXA A;  1FQA A;  3LBS A;  4OEN A;  3N26 A;  4FOR A;  1OQG A;  2VD3 A;  4FEB A;  3FJ7 A;  4ELQ A;  1MDQ A;  2P0S A;  4I8C A;  2GFE A;  3LUY A;  2OCU A;  3SDF A;  1I6B A;  1WDN A;  2R71 A;  3PPQ A;  3MJN A;  1TWY A;  3O66 A;  4EF1 A;  4F2O A;  4OET A;  3UGW A;  1P1Q A;  3OEM A;  2OK2 A;  3MWB A;  1NNF A;  5I59 B;  4H8J A;  4ZS9 A;  2XXQ A;  1B3H A;  3F11 A;  1NMU A;  4RPO A;  4R75 A;  1OLC A;  4H5F A;  3PD8 A;  3LC8 A;  1B51 A;  1R1N A;  1LAG E;  2HAU A;  1LFH A;  4PE5 B;  2ONR A;  4U23 A;  2F8D A;  1FTO A;  2F97 A;  4U4X A;  3RLF E;  3RGY A;  4L17 A;  2HZK A;  1JVY A;  2UVI A;  2XXP A;  2DWI A;  1OLA A;  3U72 A;  1S7Y A;  4RK2 A;  5H8N B;  2RC9 A;  3RTF B;  4QSD A;  4ELO A;  4F1U A;  4FED A;  4GF8 A;  1RYO A;  2HXW A;  3VFJ A;  3ECR A;  4F1Y A;  2F36 A;  3K01 A;  2LAO A;  1HSE A;  5TPA A;  5CBR A;  4JXI A;  2HEU A;  4KPT A;  3C35 A;  3I5O A;  1Y9U A;  4R73 A;  2QPQ A;  1MM6 A;  4ISU A;  3MZ9 A;  2DP8 A;  3IX1 A;  1BP5 A;  2DE4 A;  1QKB A;  4ZDM A;  3K1P A;  5J1D A;  3FXU A;  4BDM A;  4GXS B;  2I4B A;  4QHQ A;  1B3F A;  5CRY A;  1FTJ A;  3Q28 A;  4RXL A;  3TMG A;  1B0H A;  3FZV A;  1P1U A;  1EU8 A;  3VVD A;  4EQ7 A;  4RPN A;  3KJT A;  2PMS A;  1Q35 A;  4RK9 A;  1B52 A;  2ALU A;  3KSJ A;  1XVX A;  2CMO A;  3TTL A;  3U93 A;  1MDP 1;  5DVJ A;  4GIZ A;  4QFK A;  2Q2A A;  1NNK A;  3OXN A;  2DWJ A;  4YB6 A;  2XXY A;  3PGF A;  4EQB A;  3MVX A;  5KDT A;  4KHZ E;  4U2R A;  2V3Q A;  3DP4 A;  1QJM A;  2O7U A;  3E3K A;  5I58 A;  1PBQ A;  3SEX A;  1QUJ A;  3MPK A;  4GWO A;  2PBW A;  5K2Y A;  4BDN A;  2DQV A;  3M3K A;  2YPN A;  1JEV A;  3OSR A;  3S9E A;  4KI0 E;  4Z0I A;  1USY E;  1FTM A;  4O3B A;  3A09 A;  4POX A;  5CM6 A;  5IKB A;  3QUF A;  4GFR A;  1N3W A;  3S9M C;  4F1V A;  4I9D A;  2RCA A;  3TYH A;  1DOT A;  1ZKB A;  5ICT A;  1PBP A;  4NF8 A;  2Y7P A;  3TFL A;  1B40 A;  1JET A;  4RYA A;  4F3S A;  4KD5 A;  4HW8 A;  4F31 B;  5ISU A;  1FQC A;  3EF7 A;  3I3V A;  4RJZ A;  4DDD A;  3OSQ A;  1MM7 A;  1XOC A;  4DXB A;  2X26 A;  3KJ7 A;  5B70 A;  4NF6 A;  3FXQ A;  1SW4 A;  3KOT A;  3B6Q A;  1PB8 A;  4ZE8 A;  3ZKK A;  1CB6 A;  2QSX A;  3CVG A;  4X48 A;  4YAH X;  3PMV A;  1DTG A;  5HBC A;  4OHN A;  1SBP A;  1LBB A;  1CE2 A;  1TT1 A;  2OZZ A;  3V5A A;  3VVE A;  3PPN A;  3O29 A;  2ZNT A;  4GOT A;  4OQO A;  3KEI A;  1N84 A;  4YKJ A;  1H45 A;  3K1N A;  2RCB A;  3IOT A;  4ZEF A;  3V8X B;  4P11 A;  3RN8 A;  2B65 A;  2H9B A;  3PUV E;  5ITO A;  2DWA A;  3ZSF A;  1PDA A;  1N7W A;  4LZ8 A;  3RTW B;  4C0R A;  1Q1K A;  4OER A;  4WKM A;  4U21 A;  3DLN A;  2Q8J A;  4WEP A;  2DOJ A;  3PPO A;  4OTE A;  3ONM A;  4G77 A;  2ZYN A;  1LB9 A;  5I56 A;  2QS1 A;  2QMX A;  2THI A;  4DCX A;  1B6H A;  1DPP A;  3N5L A;  3K6W A;  4N07 A;  2RF1 A;  3O28 A;  1XC1 A;  3LSF B;  5EHS A;  4DCY A;  1B05 A;  2F7C A;  1NNT A;  1N76 A;  3KN8 A;  3D4G A;  3TPA A;  2F6G A;  1SYI A;  2Y84 A;  3CSG A;  3QSL A;  2DS9 A;  4IGR A;  1II5 A;  3O2A A;  3H3G A;  4IO2 A;  3E13 X;  4QSE A;  2UVG A;  1MY4 A;  4MFI A;  5H8Q A;  1FW0 A;  3OO8 A;  5TP9 A;  3UIF A;  4HCW A;  2XD2 A;  5H8S A;  4DLD A;  1Y3Q A;  1SVX B;  1UTH B;  2F78 A;  2QMW A;  3PPP A;  2I3V A;  1SD3 A;  2QL3 A;  1SW1 A;  4ESW A;  3IJO B;  5F7V A;  3G3I A;  4OFJ A;  1GGG A;  3PPR A;  1Z7N E;  2XX9 A;  1B7H A;  1F9B A;  5H8F A;  4LZ5 A;  4ND9 A;  2ZNU A;  3OD7 A;  3FGS A;  2XXH A;  3QK6 A;  3IK6 B;  2AL5 A;  4QSC A;  4H6D A;  3SES A;  4C1U A;  2FNC A;  3VE1 B;  5FHM A;  2ABH A;  3USD A;  3IO6 A;  3TOD A;  5A5X A;  1KWH A;  3CFL A;  3MC2 A;  2ONK E;  1B4H A;  4XKN A;  2A5S A;  3MP8 A;  3VLU A;  2O1L A;  1B5J A;  4OZ9 A;  4N6P A;  1UIU A;  1AOV A;  2XXW A;  1IQ7 A;  4XKP A;  2V25 A;  2E1S A;  3FUZ A;  3K6V A;  3S2V A;  1YTV A;  3KG2 A;  5I56 B;  1TFD A;  3P7I A;  2I0B A;  4P0I A;  4OFL A;  2GRV A;  1MXZ A;  5CBS A;  1M5F A;  4OES A;  4BDR A;  1H3D A;  1URS A;  3ZKL A;  4G4P A;  4O3A A;  1NNP A;  4OEV A;  2ONS A;  1O63 A;  4G8N A;  1FQD A;  2PVU A;  5DVF A;  1OMP A;  3GXA A;  4NF5 B;  3TTN A;  2VHA A;  1RYX A;  2HZL A;  3G3K A;  3W9V A;  2AYS A;  4ZEC A;  3MZ1 A;  3EHT A;  2QS3 A;  3TTK A;  1SI0 A;  3H6V A;  1H43 A;  4EXL A;  2UVH A;  4AB6 A;  2XXV A;  3TCH A;  1IUD A;  5TU0 A;  1MY0 A;  5H8Q B;  1URG A;  2XXR A;  3O6I A;  1ZJL A;  2VGQ A;  3RUM A;  1YCJ A;  4IB2 A;  1S9T A;  3T9H B;  4IY5 A;  3SET A;  2NUV A;  4OFO A;  3RT8 A;  5KCJ A;  1Y1Z A;  2Q2C A;  3T22 A;  3FD3 A;  3Q27 A;  5H8F B;  4KYE A;  1ANF A;  2ZYO A;  4PP0 A;  3Q29 A;  4H8I A;  1LCT A;  2O6A A;  4H0W A;  1ZLQ A;  2H99 A;  3KSX A;  5AA2 A;  2OBG A;  1NH8 A;  1B4Z A;  2V93 A;  4F22 A;  3MVW A;  4DE8 A;  1A99 A;  4GQO A;  1IEJ A;  5ICQ A;  3DP6 A;  1MPB A;  1A8E A; 
#chains in the Genus database with same CATH topology
 1US5 A;  2GHB A;  2H98 A;  3IAZ A;  1ATG A;  1NFT A;  1LST A;  3G3F A;  2O1M A;  2R9J A;  4TOZ A;  2VD2 A;  3OEK A;  1AL3 A;  3E4R A;  2UYE A;  2I0C A;  1POY 1;  1NH7 A;  2PX1 A;  5IZ3 B;  1QKA A;  1MY3 A;  2ZZV A;  3MST A;  1JEU A;  4QXD A;  1DMB A;  4YMB A;  2Q88 A;  4N13 A;  1ZIU A;  3U1O A;  3L6G A;  3UK4 A;  4G8H A;  4ONY A;  2OWZ A;  1GVC A;  2QS4 A;  1SYH A;  2FIX A;  2O69 A;  4ZZA A;  3T9U A;  3OEL A;  3IO4 A;  2FHY A;  5I2K A;  4PDH A;  4JVI A;  2F7A A;  4GL8 A;  1HSJ A;  3EHU A;  1QGX A;  3KZG A;  2ZYK A;  4MX6 A;  5I57 B;  3RPL A;  2B3F A;  3K1M A;  1D4N A;  4YB5 A;  4N6K A;  1QVS A;  1QUI A;  1M5E A;  2ZZX A;  3TUS A;  1UTB B;  3N6T A;  4P1L A;  4KYS A;  2Z22 A;  1R6Z A;  1SW2 A;  2XWV A;  4R2F A;  4ZEI A;  2OLB A;  4HTG A;  5IZZ A;  3FXR A;  3BFT A;  1A55 A;  4Q0C A;  3GZG A;  1A7L A;  4YKK A;  3H6W A;  3LR1 A;  4P3L A;  3H4Z A;  4GRK A;  1LCF A;  3HCQ A;  3EQ1 A;  5DT6 A;  3TEL A;  3AXF A;  1POT A;  4C1T A;  1FBC A;  3PMX A;  4HCY A;  1T0K A;  2H4I A;  3Q26 A;  2F7B A;  4PFR A;  1DBZ A;  2XXX A;  3ILT B;  4QFP A;  3QAX A;  4NF0 A;  1MXW A;  3H6U A;  4GX6 A;  1P99 A;  2QS2 A;  5L8D A;  3SEW A;  3VV5 A;  2DVZ A;  1SQY A;  3A3C A;  4RNS A;  4OXV A;  4WED A;  4ZZE A;  2NXO A;  1AMF A;  3VXB A;  1JW5 A;  5AA2 B;  4LQ5 A;  1XI6 A;  2BJJ X;  4NF4 A;  4X1D A;  1IIT A;  3M3L A;  2OX3 A;  1XHY A;  2CZI A;  4R6H A;  4TLM B;  3RNN A;  4IO7 A;  4H46 A;  1EYK A;  2DVC A;  5M2V A;  4O3C A;  3G3H A;  4G68 A;  1FPK A;  3TQL A;  1A54 A;  1VE4 A;  2FYI A;  5I2N A;  4JVD A;  1UIV A;  1B58 A;  4PGP A;  2Y7K A;  4OMB A;  3S9L C;  4DI4 B;  3T96 B;  3FV2 A;  1BLF A;  4PBQ A;  2P2A A;  3DM0 A;  3FJM A;  1QUK A;  3OEN A;  3PD9 A;  3RPW A;  2O68 A;  4M4G A;  1S50 A;  3DEL B;  3OO6 A;  3MYU A;  3T93 B;  3C34 A;  3T0J A;  4EF2 A;  4BDQ A;  5TPA B;  1PB7 A;  4YZZ A;  4NX1 A;  3FJG A;  4YB7 A;  3D1R A;  3S4U A;  4NN3 A;  4QRZ A;  4IO3 A;  3RPL B;  1MQI A;  3FVK A;  5LOM A;  3K6U A;  1MXU A;  1XS5 A;  2ESN A;  4X9T A;  3SEY A;  4FAJ A;  4JSD A;  1KA0 A;  3ILU B;  4NWC A;  4OEU A;  1RDY A;  3IB0 A;  4LP2 B;  4TLL B;  3KGC A;  2UVJ A;  4PE3 A;  4RY1 A;  5K2X A;  4P56 A;  4PFI A;  2R8T A;  4PFU A;  5AA4 A;  3HV1 A;  3JYR A;  2GHA A;  4YU0 A;  4BLA A;  1BIY A;  3T66 A;  3KC0 A;  1QW0 A;  3H06 B;  3HFU A;  1M5D A;  4OVQ A;  2I58 A;  2XWO A;  5FTH A;  4PFT A;  4OVJ A;  3U94 A;  1OQH A;  1EZ9 A;  4PF8 A;  2IA4 A;  4U1Z A;  1B3E A;  3FIR A;  5L9O A;  2HHM A;  4ZED A;  5KDT B;  1GTK A;  1B32 A;  3IFC A;  5J16 A;  2A5T A;  1NKX A;  4PDD A;  5I58 B;  4NF4 B;  2QJE A;  1MXX A;  3UN6 A;  3MP6 A;  1Y4C A;  5DYH A;  4QF9 A;  2O7I A;  5BUU A;  5CMB A;  5ELV A;  4JB7 A;  3UP9 A;  2RC8 A;  4IGT A;  4RA1 A;  3VLV A;  4H5G A;  3DP8 A;  4P0G A;  3U92 A;  2XD3 A;  1N3X A;  4OVP A;  3WAE A;  2I48 A;  5F1Q A;  2YLN A;  1YAE A;  3QYT A;  1FSA A;  3M8U A;  3PU5 A;  4M1V A;  4P47 A;  1H44 A;  2O84 X;  3LSW A;  5JTY A;  1TXF A;  4NF8 B;  1B5I A;  4IO5 A;  3PUY E;  1LAH E;  2V3T A;  3GYY A;  2I49 A;  4H67 A;  1FBG A;  2UYF A;  2NVU B;  5AE4 A;  4I3Y A;  2REJ A;  1VFE A;  4G61 A;  4OA4 A;  3OO7 A;  4F18 A;  1MXV A;  1DPE A;  1VR5 A;  1IMC A;  1SI1 A;  4NF6 B;  3ZS6 A;  3FAS A;  1JVX A;  4GWY A;  4PFW A;  1ELJ A;  1B7Z A;  3EKI A;  1XT8 A;  3MP1 A;  4THI A;  3K2D A;  5L9S A;  4PTK A;  5AA4 B;  4MAG A;  4XKR A;  1JW1 A;  1FJ6 A;  1FTL A;  2RC7 A;  1LGB C;  1B46 A;  1IMD A;  1O64 A;  2Z8D A;  1L5T A;  2F34 A;  4XIG Q;  1FPE A;  1FCK A;  3S9N C;  1FPF A;  1O7T A;  3BBR A;  3PV0 E;  3TAJ A;  4Q30 B;  4IO4 A;  4R9F A;  2E0S A;  4G68 C;  4E0X A;  4HE1 A;  1B5H A;  4DXU A;  2DXR A;  1HSL A;  4R2B A;  3W9W A;  2ANJ A;  2G93 A;  3IOR A;  3KFM A;  3A3U A;  4HS7 A;  3EN3 A;  3HHG A;  4N8G A;  1BKA A;  1B1H A;  3N94 A;  3N6U A;  1IXC A;  4XXU A;  1B3G A;  4LON B;  1DSN A;  4X1B A;  4E0W A;  3TDJ A;  3B6T A;  3E79 A;  3QUJ A;  2VOZ A;  4PGN A;  1LFG A;  3V89 B;  3E9X A;  4R6Y A;  2QVV A;  2RIN A;  2V3U A;  4XTC Q;  1LB8 A;  1GR2 A;  3CR9 A;  3VXC A;  2VPN A;  4ESX A;  4K3F A;  2Z8F A;  2DSF A;  2KR0 A;  1B7U A;  2PFY A;  2I6E A;  4GWZ A;  3TKD A;  2D21 A;  3UA8 A;  1AIV A;  3ISP A;  5L9M A;  3PUX E;  1DK4 A;  1MH4 A;  4KCD A;  1FBP A;  5AA3 A;  1LLS A;  1ZTY A;  4KCC A;  1IXG A;  4PET A;  4YKI A;  4BDO A;  3MW0 A;  4O7M A;  3FV1 A;  2CZL A;  4MF3 A;  2QVU A;  3HO7 A;  5FHN A;  1FTA A;  1PB9 A;  3PMW A;  2XHD A;  5LTC A;  1MQD A;  4LZ7 A;  3EPE A;  4LN5 A;  1MY1 A;  2XXI A;  1MH3 A;  1A40 A;  3K4U A;  1FQE A;  5H8H A;  3PUW E;  3FAT A;  4R9G A;  5TP9 B;  1NL5 A;  1IMF A;  4PBH A;  2IEE A;  4P9K A;  5DEX A;  1Y4T A;  1EYJ A;  4F2Q A;  1USY H;  4PFY A;  3ODB A;  4GLI A;  1Y3P A;  1I6A A;  1MQG A;  4YKP A;  2XXK A;  4I1D A;  4IR8 A;  3R6U A;  1GV8 A;  3U8Q A;  2H25 A;  1EZO A;  3GBA A;  1D9Y A;  4PFB A;  4MNI A;  2P1S A;  3R26 A;  4U1O A;  4JDF A;  1EZP A;  4R6K A;  1OVB A;  4N4U A;  5EHM A;  4FJP A;  4ELR A;  1MXY A;  1FTK A;  5A5X B;  1ZBM A;  2B3B A;  3B6W A;  2D5W A;  3MQ9 A;  4NTL A;  1LFI A;  1MQJ A;  5EQA A;  3VDF A;  1QUL A;  2Y7R A;  2XX8 A;  4GL0 A;  3IL1 B;  3JZJ A;  1NUY A;  3MAM A;  4IO6 A;  4O94 A;  4FAT A;  5HPQ A;  4EDP A;  4QFL A;  1ZU0 A;  4ELP A;  2XX7 A;  4G2Z A;  2ZNS A;  3GLB A;  4N81 A;  2AL4 A;  1EH3 A;  4DZ1 A;  2DDK A;  3U65 A;  4JWX A;  2H5Y A;  4KYD A;  3TCG A;  3MVY A;  4POW A;  1LEV A;  2CZK A;  4Q8R A;  1IIW A;  1N04 A;  3UOR A;  1LBC A;  5ITP A;  3SEV A;  1Y20 A;  3MVZ A;  1FQB A;  1WOD A;  2XXU A;  3M3F A;  3C9H A;  1MRP A;  1R9Q A;  3FVG A;  3K6X A;  1NV5 A;  4R72 A;  2X7P A;  2Q8M A;  4OYV A;  3O97 A;  4MEV A;  4DXC A;  5H8H B;  2GH9 A;  1OIB A;  5JEI A;  2V84 A;  3PUZ E;  3H6T A;  4HE2 A;  5DEX B;  1Z7M E;  4OWD A;  4H1X A;  4JSO A;  4ZEK A;  3K00 A;  2O51 A;  2F5X A;  1LBY A;  2I3W A;  4LVQ A;  5ET8 A;  1N0T A;  1VSO A;  1Y1M A;  2HCA A;  3C31 A;  5A5L A;  3QXM A;  4Q5T A;  3B7D A;  5KCJ B;  3O6G A;  4FEC A;  1NI9 A;  1FJ9 A;  3CI8 A;  2B4M A;  2FA7 A;  3IB2 A;  3MPL A;  1BTJ A;  1P1W A;  4N6D A;  3C32 A;  4JBZ A;  2MKZ A;  4PAK A;  1FPB A;  2HFB A;  1MG1 A;  2REG A;  2X7Q A;  4KFQ A;  3CIJ A;  1M5B A;  1G0H A;  4NED A;  2F35 A;  5IM2 A;  2PT2 A;  5AA2 D;  1LAX A;  1AH5 A;  2W7Y A;  2Y5L A;  1P1N A;  1TFA A;  3IB1 A;  5KZT A;  4WXJ A;  2P3N A;  2Q89 A;  1I6Q A;  5HM4 B;  3IOU A;  4ZE9 A;  1IXH A;  1UQW A;  2HQ0 A;  3T9V A;  3K02 A;  1DTZ A;  4KR5 A;  3Q25 A;  4JVC A;  4QBA A;  3BIH A;  3CG3 A;  1MS7 A;  1FBF A;  1KZ8 A;  3KOS A;  1P1O A;  3HHF A;  5EQ9 A;  5I2K B;  2P3V A;  3BKI B;  2Z23 A;  2DYX A;  4PAI A;  4R74 A;  4NE4 A;  3C36 A;  4QFN A;  1NV2 A;  2R6G E;  5FHO A;  4F3B A;  3C4M A;  3BFU A;  4GBW A;  3CFZ A;  5CMC A;  4UA8 A;  5B7D A;  4AQ4 A;  3IR1 A;  3OO9 A;  1EYI A;  1YPN A;  3FXB A;  1UTH A;  2YJP A;  2WBB A;  4OVS A;  5BWJ A;  1US4 A;  1XVY A;  1MY2 A;  4UAC A;  3QMF A;  4ECF A;  3KBZ A;  4F3G A;  3G3J A;  3O6H A;  3FVN A;  3MBP A;  3RT6 B;  4BDL A;  4NGU A;  4ZEB A;  1NV6 A;  3RYD A;  2QVR A;  1IZ1 A;  1LBX A;  4H65 A;  5EYF A;  1J1N A;  2D3I A;  5CMK A;  4OVT A;  2NOO A;  1JQF A;  3HST A;  1JP4 A;  3G3G A;  1K9Z A;  4FE8 A;  1ZMG A;  3H03 A;  1N7X A;  2CEX A;  3KN3 A;  3KN7 A;  3L6H A;  4FBP A;  1B3L A;  4XEQ A;  4QFO A;  3D4C A;  3W15 C;  3SEU A;  4LAT A;  3TEP A;  5IAI A;  3C33 A;  4GD5 A;  1MPD A;  3LSX A;  4MLQ A;  1M5C A;  1SDX A;  3SER A;  3TCF A;  4Z7E A;  1OVT A;  4XF5 A;  1PC3 A;  2WBD A;  4PAF A;  4GBV A;  4G68 B;  2WKY A;  4EXK A;  1VDW A;  3CRB A;  1FPI A;  1WVJ A;  3OOA A;  5I2N B;  2OWS A;  3H7M A;  3E78 A;  1PEB A;  2NWJ A;  2Y7I A;  2Z8E A;  3V83 A;  2ZXT A;  1FBH A;  2PFZ A;  1JNF A;  2Q9T A;  3CHG A;  3CG1 A;  4MH5 A;  3VLW A;  5FTI A;  1FPL A;  2DE3 A;  3T9X B;  2ZYM A;  4NF5 A;  4EUO A;  1B2H A;  2AIX A;  1AWB A;  1FBD A;  3SKP A;  3TZA A;  5I5P A;  3TQW A;  1LAF E;  4EQ9 A;  4JWY A;  3I6V A;  3R7X A;  1RDZ A;  2G29 A;  3VVF A;  1VFD A;  4KQP A;  4YMA A;  5CC2 A;  5JK4 A;  3O9P A;  2L5V A;  2DE2 A;  1IXI A;  4NWD A;  3OMB A;  1URD A;  3CFX A;  3TTM A;  3IOW A;  4LQ2 A;  2XXT A;  4LUB A;  1D3K A;  3EHS A;  3TTR A;  3IJX B;  1FRP A;  4P8B A;  3PTY A;  4NMY A;  3HPI A;  5CMM A;  4F19 A;  3JV9 A;  1FQF A;  1A8F A;  1YZ0 A;  4NG7 A;  4TQU Q;  4MBP A;  3RY3 A;  2Y7W A;  4IY6 A;  3LSL A;  5I59 A;  2DWH A;  5FBP A;  5ESY A;  2RKM A;  2DXY A;  2KLF A;  2PT1 A;  4U22 A;  3GBB A;  4G8M A;  3IOV A;  3CSB A;  3MZB A;  4I62 A;  2F6P A;  3K0V A;  2HAV A;  2A5T B;  1RKM A;  4F29 A;  5CI5 A;  1B1X A;  1B0L A;  1MPC A;  2OWT A;  2F3D A;  2HXR A;  2PYY A;  2M8C A;  1D9V A;  2BJI A;  4UAB A;  4MLV A;  4FIM A;  2UXA A;  4YIC A;  3FVO A;  5IZ3 A;  4F3P A;  5DTB A;  1Y3N A;  3MUQ A;  3HN0 A;  1NUW A;  4F39 A;  3LV0 A;  3THI A;  1JW4 A;  5H8N A;  4PQJ A;  5I84 A;  1H76 A;  4AB5 A;  1SW5 A;  4DIG A;  5JTY B;  3WAF A;  3G7W A;  5AA1 A;  1I69 A;  1MQH A;  2VP1 A;  4JWO A;  2I4C A;  1B9J A;  3KBR A;  3RQT A;  5I57 A;  4AS4 A;  4GVO A;  4NAP A;  1R9L A;  3QIM A;  2QRY A;  5DVI A;  2OJT A;  4N17 A;  2ZMB A;  5I7I A;  3LUZ A;  1UTB A;  4XKQ A;  1INP A;  4LA9 A;  4U4S A;  4GXA A;  1FPG A;  4OAN A;  1FQA A;  4GWX A;  3LBS A;  4OEN A;  3N26 A;  4FOR A;  5EYH A;  4MHF A;  1OQG A;  2VD3 A;  4FEB A;  3FJ7 A;  4ELQ A;  1MDQ A;  2P0S A;  1IMA A;  4I8C A;  2GFE A;  3LUY A;  2OCU A;  3SDF A;  1I6B A;  1WDN A;  2R71 A;  4N15 A;  3PPQ A;  1NV7 A;  3MJN A;  1TWY A;  3O66 A;  4EF1 A;  4F2O A;  4OVR A;  4OET A;  2PCR A;  3UGW A;  4N8Y A;  1P1Q A;  3OEM A;  2OK2 A;  3MWB A;  1NNF A;  5I59 B;  2JJK A;  4H8J A;  4ZS9 A;  2XXQ A;  4GX3 A;  2XA5 A;  1B3H A;  3F11 A;  1NMU A;  4RPO A;  4R75 A;  1OLC A;  4H5F A;  3PD8 A;  3LC8 A;  1B51 A;  1G0I A;  1R1N A;  1LAG E;  2HAU A;  1LFH A;  4PE5 B;  2ONR A;  4U23 A;  2F8D A;  1FTO A;  2F97 A;  4U4X A;  3RLF E;  3RGY A;  4L17 A;  2HZK A;  3B50 A;  1JVY A;  2CZH A;  2UVI A;  2XXP A;  2DWI A;  1OLA A;  3U72 A;  3SZP A;  1S7Y A;  4RK2 A;  5H8N B;  2RC9 A;  3RTF B;  4QSD A;  4ELO A;  4F1U A;  4FED A;  4GF8 A;  1RYO A;  2HXW A;  3VFJ A;  2WX9 A;  3ECR A;  4F1Y A;  2F36 A;  3K01 A;  2LAO A;  1HSE A;  1NUX A;  5TPA A;  5I3S A;  5CBR A;  4JXI A;  2HEU A;  4KPT A;  3C35 A;  3I5O A;  4O7I A;  1Y9U A;  4R73 A;  2QPQ A;  1MM6 A;  4ISU A;  3MZ9 A;  2DP8 A;  3IX1 A;  1BP5 A;  2DE4 A;  1QKB A;  1FPJ A;  4ZDM A;  3K1P A;  5J1D A;  3FXU A;  4BDM A;  4GXS B;  2I4B A;  4QHQ A;  1B3F A;  2CEY A;  5CRY A;  4PC9 A;  1FTJ A;  3Q28 A;  4RXL A;  3TMG A;  1B0H A;  3FZV A;  1P1U A;  1EU8 A;  3VVD A;  4EQ7 A;  4RPN A;  3KJT A;  2PMS A;  4RK9 A;  1Q35 A;  1B52 A;  2ALU A;  2KQZ A;  3KSJ A;  1XVX A;  2CMO A;  2WYP A;  3TTL A;  4NHB A;  3U93 A;  1MDP 1;  5DVJ A;  4GIZ A;  4QFK A;  2GQ1 A;  2Q2A A;  1NNK A;  3OXN A;  2DWJ A;  2WEF A;  4YB6 A;  2XXY A;  3PGF A;  4EQB A;  3FBP A;  3MVX A;  5KDT A;  4KHZ E;  4U2R A;  2V3Q A;  3DP4 A;  1QJM A;  2FVZ A;  2QFL A;  1LBV A;  4XFE A;  2O7U A;  3E3K A;  5I58 A;  3A29 A;  1PBQ A;  3BIG A;  3SEX A;  1QUJ A;  3MPK A;  4GWO A;  2PBW A;  5K2Y A;  4BDN A;  2DQV A;  3M3K A;  2YPN A;  1YXI A;  1JEV A;  3OSR A;  3S9E A;  4KI0 E;  4Z0I A;  1USY E;  1FTM A;  2FIE A;  4O3B A;  3A09 A;  4POX A;  5ET7 A;  5EQ7 A;  5CM6 A;  5IKB A;  2FBP A;  3QUF A;  4GFR A;  1N3W A;  3S9M C;  4F1V A;  4I9D A;  2RCA A;  3TYH A;  1FBE A;  1DOT A;  1ZKB A;  5ICT A;  1PBP A;  4NF8 A;  2Y7P A;  3TFL A;  1B40 A;  1JET A;  4GWU A;  1RDX A;  4I40 A;  4RYA A;  4F3S A;  2XWK A;  4KD5 A;  4HW8 A;  4F31 B;  1NUZ A;  5IZ1 A;  1K9Y A;  5ISU A;  1FQC A;  5ET6 A;  3EF7 A;  3I3V A;  4RJZ A;  4DDD A;  3OSQ A;  4PF6 A;  1MM7 A;  1NV0 A;  1XOC A;  3B8B A;  4DXB A;  4P1E A;  1KA1 A;  2X26 A;  3KJ7 A;  5B70 A;  3ROJ A;  4NF6 A;  3FXQ A;  1SW4 A;  3KOT A;  3B6Q A;  1PB8 A;  4ZE8 A;  3ZKK A;  1CB6 A;  2QSX A;  3CVG A;  4X48 A;  2VPO A;  4YAH X;  3PMV A;  1DTG A;  5HBC A;  4OHN A;  1SBP A;  1LBB A;  1CE2 A;  4X04 A;  1TT1 A;  3T1B A;  2OZZ A;  3V5A A;  3VVE A;  4N91 A;  4MMP A;  3PPN A;  3O29 A;  1NV1 A;  2ZNT A;  4GOT A;  4OQO A;  3IFA A;  3KEI A;  5IGA A;  1N84 A;  4GX4 A;  4YKJ A;  4X8R A;  1H45 A;  3K1N A;  2RCB A;  3IOT A;  4ZEF A;  3V8X B;  4P11 A;  3RN8 A;  2B65 A;  2H9B A;  2VT5 A;  3PUV E;  5ITO A;  2WYK A;  2DWA A;  3ZSF A;  1PDA A;  1N7W A;  4LZ8 A;  3RTW B;  4C0R A;  1Q1K A;  4KXP A;  4OER A;  4WKM A;  2F3B A;  4U21 A;  3DLN A;  2Q8J A;  4WEP A;  2DOJ A;  3PPO A;  4OTE A;  3ONM A;  4G77 A;  5ET5 A;  1FPD A;  2ZYN A;  1LB9 A;  5I56 A;  4AS5 A;  2QS1 A;  1DCU A;  2QMX A;  2THI A;  4DCX A;  1B6H A;  1DPP A;  3N5L A;  4MIJ A;  3K6W A;  4N07 A;  2RF1 A;  1BK4 A;  3O28 A;  1XC1 A;  3LSF B;  5EHS A;  4DCY A;  1B05 A;  2F7C A;  1NNT A;  1N76 A;  3KN8 A;  3D4G A;  3TPA A;  2F6G A;  1SYI A;  1IME A;  4MNC A;  2Y84 A;  3CSG A;  3QSL A;  2DS9 A;  3KC1 A;  4IGR A;  1II5 A;  3O2A A;  3H3G A;  4IO2 A;  3E13 X;  4QSE A;  2UVG A;  4MCO A;  1LBZ A;  1MY4 A;  4MFI A;  5H8Q A;  1FW0 A;  3OO8 A;  5TP9 A;  3UIF A;  4HCW A;  2XD2 A;  1NV3 A;  5H8S A;  4DLD A;  1Y3Q A;  1SVX B;  1UTH B;  2F78 A;  2Q74 A;  2QMW A;  3PPP A;  2I3V A;  1SD3 A;  2B4L A;  2QL3 A;  1SW1 A;  4ESW A;  3IJO B;  5LDZ A;  5F7V A;  3G3I A;  4OFJ A;  1GGG A;  3PPR A;  1Z7N E;  2XX9 A;  4GWW A;  1B7H A;  1F9B A;  5H8F A;  4LZ5 A;  4ND9 A;  2ZNU A;  3OD7 A;  3FGS A;  2XWI A;  2XXH A;  3QK6 A;  3IK6 B;  2AL5 A;  4QSC A;  4H6D A;  3SES A;  4C1U A;  2FNC A;  5FHM A;  3VE1 B;  1LBW A;  2ABH A;  3USD A;  3IO6 A;  3TOD A;  5A5X A;  1KWH A;  3CFL A;  3MC2 A;  2ONK E;  2ZZW A;  1B4H A;  1SPI A;  4XKN A;  2A5S A;  3MP8 A;  3VLU A;  2O1L A;  1B5J A;  4OZ9 A;  5EYG A;  4DI3 D;  4N6P A;  1UIU A;  1AOV A;  2XXW A;  1NV4 A;  1IQ7 A;  4XKP A;  2V25 A;  2E1S A;  3FUZ A;  3K6V A;  5DW8 A;  3S2V A;  1YYZ A;  1YTV A;  3KG2 A;  5I56 B;  1TFD A;  3P7I A;  2I0B A;  4P0I A;  4OFL A;  2GRV A;  1MXZ A;  5CBS A;  1M5F A;  4OES A;  4BDR A;  1H3D A;  1URS A;  3ZKL A;  4G4P A;  4MJO A;  4O3A A;  1NNP A;  4OEV A;  2ONS A;  1O63 A;  4G8N A;  1Q9D A;  1FQD A;  2PVU A;  5DVF A;  4GWS A;  1OMP A;  3GXA A;  4HE0 A;  4NF5 B;  3TTN A;  2VHA A;  1RYX A;  2HZL A;  3G3K A;  3W9V A;  3NOH A;  2AYS A;  4ZEC A;  3MZ1 A;  3EHT A;  2V4C A;  2QS3 A;  3TTK A;  1SI0 A;  3H6V A;  1H43 A;  2HPG A;  4EXL A;  2UVH A;  4AB6 A;  2XXV A;  3TCH A;  1IUD A;  5TU0 A;  1MY0 A;  4HXV A;  5H8Q B;  1URG A;  2XXR A;  3O6I A;  4H45 A;  1ZJL A;  2VGQ A;  5F24 A;  1IMB A;  3RUM A;  1YCJ A;  4IB2 A;  1S9T A;  3T9H B;  4IY5 A;  3SET A;  1CNQ A;  2NUV A;  4MNP A;  1D9Q A;  4OFO A;  4I3E A;  3RT8 A;  5KCJ A;  1Y1Z A;  2Q2C A;  3T22 A;  3FD3 A;  3Q27 A;  5H8F B;  4KYE A;  4NQ8 A;  4PCD A;  1ANF A;  2ZYO A;  4PP0 A;  3Q29 A;  4H8I A;  1LCT A;  2O6A A;  4H0W A;  1ZLQ A;  2H99 A;  3KSX A;  5AA2 A;  2OBG A;  5T3J A;  1NH8 A;  1B4Z A;  2V93 A;  5EQ8 A;  4F22 A;  3MVW A;  4O8M A;  4DE8 A;  1A99 A;  4GQO A;  1IEJ A;  5ICQ A;  3DP6 A;  1MPB A;  2Y5K A;  1A8E A; 
#chains in the Genus database with same CATH homology
 1US5 A;  2GHB A;  2H98 A;  3IAZ A;  1ATG A;  1NFT A;  1LST A;  3G3F A;  2O1M A;  2R9J A;  4TOZ A;  2VD2 A;  3OEK A;  1AL3 A;  3E4R A;  2UYE A;  2I0C A;  1POY 1;  1NH7 A;  2PX1 A;  1QKA A;  1MY3 A;  1JEU A;  1DMB A;  4YMB A;  2Q88 A;  4N13 A;  1ZIU A;  3U1O A;  3L6G A;  3UK4 A;  4G8H A;  4ONY A;  1GVC A;  2QS4 A;  1SYH A;  4ZZA A;  2O69 A;  3T9U A;  3OEL A;  3IO4 A;  5I2K A;  2F7A A;  4GL8 A;  1HSJ A;  3EHU A;  3KZG A;  2ZYK A;  5I57 B;  2B3F A;  3K1M A;  1D4N A;  4YB5 A;  1QVS A;  1QUI A;  1M5E A;  3TUS A;  1UTB B;  3N6T A;  4KYS A;  2Z22 A;  1R6Z A;  1SW2 A;  4ZEI A;  4R2F A;  2OLB A;  4HTG A;  3FXR A;  3BFT A;  1A55 A;  4Q0C A;  3GZG A;  1A7L A;  4YKK A;  3H6W A;  3LR1 A;  3H4Z A;  4GRK A;  1LCF A;  3HCQ A;  3EQ1 A;  5DT6 A;  3TEL A;  3AXF A;  1POT A;  4C1T A;  3PMX A;  4HCY A;  1T0K A;  2H4I A;  3Q26 A;  2F7B A;  2XXX A;  3ILT B;  4QFP A;  3QAX A;  1MXW A;  3H6U A;  1P99 A;  2QS2 A;  5L8D A;  3SEW A;  3VV5 A;  2DVZ A;  1SQY A;  3A3C A;  4RNS A;  4OXV A;  4WED A;  4ZZE A;  2NXO A;  1AMF A;  3VXB A;  1JW5 A;  5AA2 B;  4LQ5 A;  2BJJ X;  4NF4 A;  4X1D A;  1IIT A;  3M3L A;  1XHY A;  4R6H A;  4TLM B;  3RNN A;  4IO7 A;  2DVC A;  5M2V A;  4O3C A;  3G3H A;  4G68 A;  3TQL A;  1A54 A;  1VE4 A;  2FYI A;  5I2N A;  1UIV A;  1B58 A;  2Y7K A;  4OMB A;  3S9L C;  3T96 B;  3FV2 A;  1BLF A;  2P2A A;  3DM0 A;  3FJM A;  1QUK A;  3OEN A;  3PD9 A;  3RPW A;  2O68 A;  4M4G A;  1S50 A;  3DEL B;  3OO6 A;  3T93 B;  3C34 A;  4EF2 A;  4BDQ A;  5TPA B;  1PB7 A;  4YZZ A;  3FJG A;  4YB7 A;  3S4U A;  4QRZ A;  4IO3 A;  1MQI A;  3FVK A;  5LOM A;  3K6U A;  1MXU A;  1XS5 A;  2ESN A;  4X9T A;  3SEY A;  4FAJ A;  4JSD A;  4NWC A;  3ILU B;  4OEU A;  3IB0 A;  4LP2 B;  3KGC A;  2UVJ A;  4TLL B;  4RY1 A;  5K2X A;  4PFU A;  5AA4 A;  3HV1 A;  3JYR A;  2GHA A;  4YU0 A;  4BLA A;  1BIY A;  3T66 A;  1QW0 A;  3H06 B;  1M5D A;  2I58 A;  5FTH A;  4PFT A;  4OVJ A;  3U94 A;  1OQH A;  1EZ9 A;  2IA4 A;  4U1Z A;  1B3E A;  3FIR A;  5L9O A;  4ZED A;  5KDT B;  1GTK A;  1B32 A;  2A5T A;  1NKX A;  5I58 B;  4NF4 B;  2QJE A;  1MXX A;  3UN6 A;  3MP6 A;  1Y4C A;  5DYH A;  4QF9 A;  2O7I A;  5BUU A;  5CMB A;  5ELV A;  4JB7 A;  3UP9 A;  2RC8 A;  4IGT A;  4RA1 A;  3VLV A;  4H5G A;  3DP8 A;  4P0G A;  3U92 A;  2XD3 A;  1N3X A;  3WAE A;  2I48 A;  5F1Q A;  2YLN A;  1YAE A;  3QYT A;  3M8U A;  3PU5 A;  4M1V A;  1H44 A;  2O84 X;  3LSW A;  5JTY A;  1TXF A;  4NF8 B;  1B5I A;  4IO5 A;  3PUY E;  1LAH E;  2V3T A;  2I49 A;  4H67 A;  2UYF A;  2NVU B;  5AE4 A;  2REJ A;  1VFE A;  3OO7 A;  4F18 A;  1MXV A;  1DPE A;  1VR5 A;  1SI1 A;  4NF6 B;  3ZS6 A;  3FAS A;  1JVX A;  4PFW A;  1ELJ A;  1B7Z A;  1XT8 A;  3MP1 A;  4THI A;  3K2D A;  5L9S A;  5AA4 B;  4XKR A;  1JW1 A;  1FTL A;  2RC7 A;  1LGB C;  1B46 A;  1O64 A;  2Z8D A;  1L5T A;  2F34 A;  4XIG Q;  1FCK A;  3S9N C;  1O7T A;  3BBR A;  3PV0 E;  3TAJ A;  4Q30 B;  4IO4 A;  4R9F A;  2E0S A;  4G68 C;  4E0X A;  1B5H A;  4DXU A;  2DXR A;  1HSL A;  4R2B A;  3W9W A;  2ANJ A;  2G93 A;  3IOR A;  3KFM A;  3A3U A;  4HS7 A;  3EN3 A;  3HHG A;  1BKA A;  1B1H A;  3N94 A;  3N6U A;  1IXC A;  4XXU A;  1B3G A;  4LON B;  1DSN A;  4X1B A;  4E0W A;  3TDJ A;  3B6T A;  3QUJ A;  2VOZ A;  1LFG A;  3V89 B;  3E9X A;  4R6Y A;  2RIN A;  2V3U A;  4XTC Q;  1LB8 A;  1GR2 A;  3CR9 A;  3VXC A;  4ESX A;  4K3F A;  2Z8F A;  2DSF A;  1B7U A;  2I6E A;  3TKD A;  2D21 A;  3UA8 A;  1AIV A;  5L9M A;  3PUX E;  1MH4 A;  4KCD A;  5AA3 A;  1LLS A;  1ZTY A;  4KCC A;  1IXG A;  4PET A;  4YKI A;  4BDO A;  3MW0 A;  3FV1 A;  2CZL A;  4MF3 A;  3HO7 A;  5FHN A;  1PB9 A;  3PMW A;  2XHD A;  1MQD A;  4LZ7 A;  3EPE A;  1MY1 A;  2XXI A;  1MH3 A;  1A40 A;  3K4U A;  1FQE A;  5H8H A;  3PUW E;  3FAT A;  4R9G A;  5TP9 B;  1NL5 A;  2IEE A;  5DEX A;  1Y4T A;  4F2Q A;  1USY H;  4PFY A;  3ODB A;  4GLI A;  1Y3P A;  1I6A A;  1MQG A;  4YKP A;  4I1D A;  3R6U A;  1GV8 A;  3U8Q A;  2H25 A;  1EZO A;  3GBA A;  1D9Y A;  4U1O A;  2P1S A;  3R26 A;  4JDF A;  1EZP A;  4R6K A;  1OVB A;  5EHM A;  4FJP A;  4ELR A;  1MXY A;  1FTK A;  5A5X B;  1ZBM A;  2B3B A;  3B6W A;  2D5W A;  3MQ9 A;  4NTL A;  1LFI A;  1MQJ A;  3VDF A;  1QUL A;  2Y7R A;  2XX8 A;  4GL0 A;  3IL1 B;  3JZJ A;  3MAM A;  4IO6 A;  4FAT A;  5HPQ A;  4EDP A;  4QFL A;  1ZU0 A;  4ELP A;  2XX7 A;  4G2Z A;  2ZNS A;  3GLB A;  2AL4 A;  1EH3 A;  4DZ1 A;  4JWX A;  2H5Y A;  4KYD A;  3TCG A;  3MVY A;  4POW A;  4Q8R A;  1IIW A;  1N04 A;  3UOR A;  1LBC A;  5ITP A;  3SEV A;  1Y20 A;  3MVZ A;  1FQB A;  1WOD A;  2XXU A;  3M3F A;  3C9H A;  1MRP A;  1R9Q A;  3FVG A;  3K6X A;  4R72 A;  2X7P A;  4OYV A;  3O97 A;  4DXC A;  5H8H B;  2GH9 A;  1OIB A;  5JEI A;  2V84 A;  3PUZ E;  3H6T A;  5DEX B;  1Z7M E;  4OWD A;  4H1X A;  4JSO A;  4ZEK A;  3K00 A;  2O51 A;  2F5X A;  2I3W A;  4LVQ A;  1N0T A;  1VSO A;  1Y1M A;  2HCA A;  3C31 A;  3QXM A;  4Q5T A;  3B7D A;  5KCJ B;  3O6G A;  4FEC A;  3CI8 A;  2FA7 A;  3IB2 A;  3MPL A;  1BTJ A;  1P1W A;  3C32 A;  4JBZ A;  2HFB A;  1MG1 A;  2REG A;  2X7Q A;  4KFQ A;  3CIJ A;  1M5B A;  4NED A;  2F35 A;  2PT2 A;  5AA2 D;  1LAX A;  1AH5 A;  2W7Y A;  1P1N A;  1TFA A;  3IB1 A;  5KZT A;  4WXJ A;  2Q89 A;  1I6Q A;  5HM4 B;  3IOU A;  4ZE9 A;  1IXH A;  1UQW A;  2HQ0 A;  3T9V A;  3K02 A;  1DTZ A;  4KR5 A;  3Q25 A;  3CG3 A;  1MS7 A;  3KOS A;  1P1O A;  3HHF A;  5I2K B;  3BKI B;  2Z23 A;  2DYX A;  4R74 A;  4NE4 A;  3C36 A;  4QFN A;  2R6G E;  5FHO A;  4F3B A;  3C4M A;  3BFU A;  3CFZ A;  5CMC A;  4UA8 A;  5B7D A;  4AQ4 A;  3IR1 A;  3OO9 A;  1YPN A;  1UTH A;  2YJP A;  5BWJ A;  1US4 A;  1XVY A;  1MY2 A;  4UAC A;  4ECF A;  4F3G A;  3G3J A;  3O6H A;  3FVN A;  3MBP A;  3RT6 B;  4BDL A;  4ZEB A;  1IZ1 A;  4H65 A;  5EYF A;  1J1N A;  2D3I A;  5CMK A;  2NOO A;  1JQF A;  3HST A;  3G3G A;  4FE8 A;  1ZMG A;  3H03 A;  1N7X A;  3KN3 A;  3KN7 A;  3L6H A;  1B3L A;  4QFO A;  3D4C A;  3W15 C;  3SEU A;  4LAT A;  3TEP A;  5IAI A;  3C33 A;  4GD5 A;  1MPD A;  3LSX A;  4MLQ A;  1M5C A;  1SDX A;  3SER A;  3TCF A;  4Z7E A;  1OVT A;  1PC3 A;  4G68 B;  2WKY A;  4EXK A;  3CRB A;  1WVJ A;  3OOA A;  5I2N B;  2OWS A;  3H7M A;  1PEB A;  2NWJ A;  2Y7I A;  2Z8E A;  3V83 A;  2ZXT A;  1JNF A;  2Q9T A;  3CG1 A;  4MH5 A;  3VLW A;  5FTI A;  2DE3 A;  3T9X B;  2ZYM A;  4NF5 A;  4EUO A;  1B2H A;  2AIX A;  3SKP A;  3TZA A;  3TQW A;  1LAF E;  4EQ9 A;  4JWY A;  3I6V A;  3R7X A;  2G29 A;  3VVF A;  1VFD A;  4KQP A;  4YMA A;  5CC2 A;  5JK4 A;  3O9P A;  2DE2 A;  1IXI A;  4NWD A;  3OMB A;  1URD A;  3CFX A;  3TTM A;  3IOW A;  4LQ2 A;  2XXT A;  4LUB A;  1D3K A;  3EHS A;  3TTR A;  3IJX B;  4NMY A;  3HPI A;  5CMM A;  4F19 A;  3JV9 A;  1FQF A;  1A8F A;  4TQU Q;  4MBP A;  3RY3 A;  2Y7W A;  4IY6 A;  3LSL A;  5I59 A;  2DWH A;  2RKM A;  2DXY A;  2KLF A;  2PT1 A;  4U22 A;  3GBB A;  4G8M A;  3IOV A;  3CSB A;  3MZB A;  4I62 A;  2F6P A;  3K0V A;  2HAV A;  2A5T B;  1RKM A;  4F29 A;  5CI5 A;  1B1X A;  1B0L A;  1MPC A;  2OWT A;  2PYY A;  2M8C A;  1D9V A;  4MLV A;  4FIM A;  2UXA A;  4YIC A;  3FVO A;  4F3P A;  5DTB A;  1Y3N A;  3MUQ A;  3HN0 A;  4F39 A;  3THI A;  1JW4 A;  5H8N A;  4PQJ A;  5I84 A;  1H76 A;  4AB5 A;  1SW5 A;  4DIG A;  5JTY B;  3WAF A;  3G7W A;  5AA1 A;  1I69 A;  1MQH A;  2VP1 A;  4JWO A;  2I4C A;  1B9J A;  3KBR A;  3RQT A;  5I57 A;  4GVO A;  1R9L A;  3QIM A;  2QRY A;  5DVI A;  2OJT A;  2ZMB A;  1UTB A;  4XKQ A;  4LA9 A;  4U4S A;  4GXA A;  1FQA A;  3LBS A;  4OEN A;  3N26 A;  4FOR A;  1OQG A;  2VD3 A;  4FEB A;  3FJ7 A;  4ELQ A;  1MDQ A;  2P0S A;  4I8C A;  2GFE A;  3LUY A;  2OCU A;  3SDF A;  1I6B A;  1WDN A;  2R71 A;  3PPQ A;  3MJN A;  1TWY A;  3O66 A;  4EF1 A;  4F2O A;  4OET A;  3UGW A;  1P1Q A;  3OEM A;  2OK2 A;  3MWB A;  1NNF A;  5I59 B;  4H8J A;  4ZS9 A;  2XXQ A;  1B3H A;  3F11 A;  1NMU A;  4RPO A;  4R75 A;  1OLC A;  4H5F A;  3PD8 A;  3LC8 A;  1B51 A;  1R1N A;  1LAG E;  2HAU A;  1LFH A;  4PE5 B;  2ONR A;  4U23 A;  2F8D A;  1FTO A;  2F97 A;  4U4X A;  3RLF E;  3RGY A;  4L17 A;  2HZK A;  1JVY A;  2UVI A;  2XXP A;  2DWI A;  1OLA A;  3U72 A;  1S7Y A;  4RK2 A;  5H8N B;  2RC9 A;  3RTF B;  4QSD A;  4ELO A;  4F1U A;  4FED A;  4GF8 A;  1RYO A;  2HXW A;  3VFJ A;  3ECR A;  4F1Y A;  2F36 A;  3K01 A;  2LAO A;  1HSE A;  5TPA A;  5CBR A;  4JXI A;  2HEU A;  4KPT A;  3C35 A;  3I5O A;  1Y9U A;  4R73 A;  2QPQ A;  1MM6 A;  4ISU A;  3MZ9 A;  2DP8 A;  3IX1 A;  1BP5 A;  2DE4 A;  1QKB A;  4ZDM A;  3K1P A;  5J1D A;  3FXU A;  4BDM A;  4GXS B;  2I4B A;  4QHQ A;  1B3F A;  5CRY A;  1FTJ A;  3Q28 A;  4RXL A;  3TMG A;  1B0H A;  3FZV A;  1P1U A;  1EU8 A;  3VVD A;  4EQ7 A;  4RPN A;  3KJT A;  2PMS A;  1Q35 A;  4RK9 A;  1B52 A;  2ALU A;  3KSJ A;  1XVX A;  2CMO A;  3TTL A;  3U93 A;  1MDP 1;  5DVJ A;  4GIZ A;  4QFK A;  2Q2A A;  1NNK A;  3OXN A;  2DWJ A;  4YB6 A;  2XXY A;  3PGF A;  4EQB A;  3MVX A;  5KDT A;  4KHZ E;  4U2R A;  2V3Q A;  3DP4 A;  1QJM A;  2O7U A;  3E3K A;  5I58 A;  1PBQ A;  3SEX A;  1QUJ A;  3MPK A;  4GWO A;  2PBW A;  5K2Y A;  4BDN A;  2DQV A;  3M3K A;  2YPN A;  1JEV A;  3OSR A;  3S9E A;  4KI0 E;  4Z0I A;  1USY E;  1FTM A;  4O3B A;  3A09 A;  4POX A;  5CM6 A;  5IKB A;  3QUF A;  4GFR A;  1N3W A;  3S9M C;  4F1V A;  4I9D A;  2RCA A;  3TYH A;  1DOT A;  1ZKB A;  5ICT A;  1PBP A;  4NF8 A;  2Y7P A;  3TFL A;  1B40 A;  1JET A;  4RYA A;  4F3S A;  4KD5 A;  4HW8 A;  4F31 B;  5ISU A;  1FQC A;  3EF7 A;  3I3V A;  4RJZ A;  4DDD A;  3OSQ A;  1MM7 A;  1XOC A;  4DXB A;  2X26 A;  3KJ7 A;  5B70 A;  4NF6 A;  3FXQ A;  1SW4 A;  3KOT A;  3B6Q A;  1PB8 A;  4ZE8 A;  3ZKK A;  1CB6 A;  2QSX A;  3CVG A;  4X48 A;  4YAH X;  3PMV A;  1DTG A;  5HBC A;  4OHN A;  1SBP A;  1LBB A;  1CE2 A;  1TT1 A;  2OZZ A;  3V5A A;  3VVE A;  3PPN A;  3O29 A;  2ZNT A;  4GOT A;  4OQO A;  3KEI A;  1N84 A;  4YKJ A;  1H45 A;  3K1N A;  2RCB A;  3IOT A;  4ZEF A;  3V8X B;  4P11 A;  3RN8 A;  2B65 A;  2H9B A;  3PUV E;  5ITO A;  2DWA A;  3ZSF A;  1PDA A;  1N7W A;  4LZ8 A;  3RTW B;  4C0R A;  1Q1K A;  4OER A;  4WKM A;  4U21 A;  3DLN A;  2Q8J A;  4WEP A;  2DOJ A;  3PPO A;  4OTE A;  3ONM A;  4G77 A;  2ZYN A;  1LB9 A;  5I56 A;  2QS1 A;  2QMX A;  2THI A;  4DCX A;  1B6H A;  1DPP A;  3N5L A;  3K6W A;  4N07 A;  2RF1 A;  3O28 A;  1XC1 A;  3LSF B;  5EHS A;  4DCY A;  1B05 A;  2F7C A;  1NNT A;  1N76 A;  3KN8 A;  3D4G A;  3TPA A;  2F6G A;  1SYI A;  2Y84 A;  3CSG A;  3QSL A;  2DS9 A;  4IGR A;  1II5 A;  3O2A A;  3H3G A;  4IO2 A;  3E13 X;  4QSE A;  2UVG A;  1MY4 A;  4MFI A;  5H8Q A;  1FW0 A;  3OO8 A;  5TP9 A;  3UIF A;  4HCW A;  2XD2 A;  5H8S A;  4DLD A;  1Y3Q A;  1SVX B;  1UTH B;  2F78 A;  2QMW A;  3PPP A;  2I3V A;  1SD3 A;  2QL3 A;  1SW1 A;  4ESW A;  3IJO B;  5F7V A;  3G3I A;  4OFJ A;  1GGG A;  3PPR A;  1Z7N E;  2XX9 A;  1B7H A;  1F9B A;  5H8F A;  4LZ5 A;  4ND9 A;  2ZNU A;  3OD7 A;  3FGS A;  2XXH A;  3QK6 A;  3IK6 B;  2AL5 A;  4QSC A;  4H6D A;  3SES A;  4C1U A;  2FNC A;  3VE1 B;  5FHM A;  2ABH A;  3USD A;  3IO6 A;  3TOD A;  5A5X A;  1KWH A;  3CFL A;  3MC2 A;  2ONK E;  1B4H A;  4XKN A;  2A5S A;  3MP8 A;  3VLU A;  2O1L A;  1B5J A;  4OZ9 A;  4N6P A;  1UIU A;  1AOV A;  2XXW A;  1IQ7 A;  4XKP A;  2V25 A;  2E1S A;  3FUZ A;  3K6V A;  3S2V A;  1YTV A;  3KG2 A;  5I56 B;  1TFD A;  3P7I A;  2I0B A;  4P0I A;  4OFL A;  2GRV A;  1MXZ A;  5CBS A;  1M5F A;  4OES A;  4BDR A;  1H3D A;  1URS A;  3ZKL A;  4G4P A;  4O3A A;  1NNP A;  4OEV A;  2ONS A;  1O63 A;  4G8N A;  1FQD A;  2PVU A;  5DVF A;  1OMP A;  3GXA A;  4NF5 B;  3TTN A;  2VHA A;  1RYX A;  2HZL A;  3G3K A;  3W9V A;  2AYS A;  4ZEC A;  3MZ1 A;  3EHT A;  2QS3 A;  3TTK A;  1SI0 A;  3H6V A;  1H43 A;  4EXL A;  2UVH A;  4AB6 A;  2XXV A;  3TCH A;  1IUD A;  5TU0 A;  1MY0 A;  5H8Q B;  1URG A;  2XXR A;  3O6I A;  1ZJL A;  2VGQ A;  3RUM A;  1YCJ A;  4IB2 A;  1S9T A;  3T9H B;  4IY5 A;  3SET A;  2NUV A;  4OFO A;  3RT8 A;  5KCJ A;  1Y1Z A;  2Q2C A;  3T22 A;  3FD3 A;  3Q27 A;  5H8F B;  4KYE A;  1ANF A;  2ZYO A;  4PP0 A;  3Q29 A;  4H8I A;  1LCT A;  2O6A A;  4H0W A;  1ZLQ A;  2H99 A;  3KSX A;  5AA2 A;  2OBG A;  1NH8 A;  1B4Z A;  2V93 A;  4F22 A;  3MVW A;  4DE8 A;  1A99 A;  4GQO A;  1IEJ A;  5ICQ A;  3DP6 A;  1MPB A;  1A8E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...