4ELRA

Ferric binding protein with iron and carbonate
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
310
structure length
310
Chain Sequence
SPTLTIYSGRGQSLVEPLVKQFEAETGIRVQVRYSTDAQILAALQEEGSRSPADLFWANTAGALGQASAKGLLRPLGETLLEKPIAFVPASRTWVPVTVRLRVLAYNPDRIKAEELPESLLDLPRFAREKGLVGRVGWTPTYSSFQDMVAGMIALYGEEKTREWLLAMKALAPKAYPSNPAMLDAIRAGEVDLGSTNHYYVVRFRRAGYRLGMHHFRDGDAGNLALVTGAGLLKTSKNLAAATRFLTYLLSPQAQQYFVGNIGEYPLVKGVALDPNLLPLEEALAKSPKLDLEKLPLDRALRLLRETGVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of ferric binding protein A
rcsb
source organism Thermus thermophilus
molecule tags Metal transport
molecule keywords Iron ABC transporter, periplasmic iron-binding protein
total genus 108
structure length 310
sequence length 310
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13416 SBP_bac_8 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4elrA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4elrA02
3ILUB 1SW2A 5ITOA 3LSWA 3C4MA 3PD8A 3K02A 2QMWA 4X1BA 4DCXA 5H8HB 3FIRA 3FZVA 4ECFA 1H3DA 1B1XA 2YJPA 5JTYB 4XTCQ 2HZKA 4Z7EA 5I56B 2OWTA 3S9MC 1MXVA 1JVXA 4FECA 2F36A 4GL0A 1A55A 2DE3A 1ELJA 2DP8A 2H99A 2PT1A 1A8FA 3C36A 4GFRA 5FHNA 4NF4A 3IL1B 5HBCA 5L9OA 1B7UA 2FA7A 4MF3A 4O3AA 1LAXA 2Z8DA 2Z8FA 3FATA 5H8NB 3TQLA 3MP8A 2REGA 5TP9B 5I84A 4HTGA 3FUZA 1SW4A 1VFDA 2DWIA 3GBAA 3K0VA 2I4CA 3KOSA 4JDFA 3TDJA 1DSNA 1UQWA 3U94A 1P1OA 1N3WA 5CMKA 3IO4A 3VFJA 2ZYOA 3ZS6A 1PB8A 2F5XA 4OEVA 3O29A 5KDTA 2V84A 4Z0IA 2OK2A 4G77A 1S9TA 4OFLA 2OWSA 1MXWA 2O6AA 2XD3A 2NVUB 3CG3A 2ONKE 4KYDA 3IB1A 4ZZEA 4YICA 1LAFE 1OLAA 4H8JA 5ISUA 4LA9A 5J1DA 2DXRA 3I5OA 3VE1B 2QPQA 1TWYA 5I59A 1SW1A 1UTHB 4GRKA 4IO7A 3RY3A 4XKNA 2VD3A 4EXKA 3K6WA 1PB9A 1O7TA 3MPLA 1FTKA 4U1OA 4POXA 5BUUA 4KCCA 2QS1A 4KPTA 1N3XA 1UTHA 1WVJA 2PT2A 1OLCA 3R26A 2PX1A 2A5TB 3CI8A 3SESA 5I2NA 4HS7A 4OZ9A 2O84X 3T93B 4G68A 3BKIB 5AA4A 1R9QA 3LC8A 3N6TA 1S50A 1B4HA 3C32A 2I48A 1Y1MA 4NMYA 5F7VA 1L5TA 4BDQA 3HO7A 5L8DA 5H8FB 2I0BA 1LGBC 3DM0A 1WODA 4U22A 4UA8A 2Q9TA 3VVDA 2F7BA 4PFTA 3TKDA 1MPDA 3VV5A 4HW8A 4RK9A 4ISUA 1Z7NE 4R6KA 3PV0E 3Q29A 1SYIA 1LCTA 3IOTA 2ESNA 4O3BA 1NL5A 2I3WA 3ODBA 2XXRA 3QK6A 3V8XB 4GXSB 1VE4A 3TQWA 4QF9A 3FV2A 2F97A 3PUWE 3K1MA 1B3EA 3IX1A 5KDTB 3CSGA 2D5WA 1QUKA 2QS2A 4OMBA 1URDA 4OQOA 2DWAA 5H8QB 4ONYA 3VLWA 3PMVA 1MY2A 3G3FA 1SI1A 3OELA 1DTZA 3MP1A 4R9FA 1GTKA 2WKYA 2UVHA 3KJ7A 4G8MA 2Q88A 2VOZA 2ZNUA 4PP0A 4X1DA 4FORA 4R72A 3RPWA 3TFLA 2XX9A 1B3GA 1UIVA 1LB8A 5I2KB 1O63A 1JEVA 3M8UA 3PPPA 4C1UA 3MVYA 1DPEA 4F22A 1GV8A 1SI0A 3Q25A 2OLBA 3T96B 3QYTA 5I58A 4ELPA 3EHUA 2GHBA 4KYEA 3ZKKA 3K2DA 3IORA 3PPQA 1B05A 4R6YA 5DVFA 1N04A 1B7ZA 1NNTA 5CRYA 2HAVA 1LBBA 2AYSA 1LSTA 2HZLA 2XXPA 5DVJA 2X7PA 3C33A 4HCWA 3RGYA 4GXAA 2FYIA 1T0KA 2P0SA 4UACA 4PQJA 5JEIA 1PEBA 5AE4A 3MAMA 3E4RA 3T66A 2R71A 2ONSA 3OO8A 2DXYA 4GOTA 4DCYA 4F39A 1KWHA 1A8EA 4P0IA 1POY1 2GFEA 4H0WA 1A40A 3RQTA 1SBPA 4XKQA 4OTEA 3O28A 5I2NB 2ZNSA 4QSEA 1D4NA 3TCHA 2DVCA 2H9BA 4PFYA 3U93A 1AH5A 4F1UA 1P1WA 2XX7A 4GF8A 1Y20A 4OETA 3OO6A 3K6XA 2QMXA 3W9WA 5JTYA 1IZ1A 1IEJA 1MXXA 3GLBA 2Q8JA 4EXLA 1I6QA 3FXQA 1Y1ZA 4OWDA 3T9HB 4F2OA 4YKPA 2GH9A 2V3UA 4C0RA 2G29A 3TAJA 4OYVA 1CE2A 2Z8EA 3H06B 1FCKA 1XHYA 4N07A 1B0LA 2XXVA 3GBBA 1TFDA 2RCAA 4FIMA 4RJZA 1UTBA 1QJMA 1PC3A 3KN7A 3FV1A 3M3FA 5HPQA 1EZPA 2PYYA 1MXZA 4BDMA 2A5TA 1B5HA 1ZBMA 3SEVA 3RT8A 3OD7A 3ONMA 1B3LA 4N6PA 1JEUA 2O7UA 4FEDA 3E13X 4ZEDA 2W7YA 5I57A 1NNKA 1EZ9A 2R6GE 5I59B 1ANFA 3PUZE 3ZKLA 2P1SA 3QIMA 1GGGA 3IOUA 4G4PA 3O2AA 3VXCA 3USDA 2V3QA 4R74A 3JV9A 1OIBA 1P1NA 1BKAA 2I0CA 3G7WA 3H6WA 2AL4A 2H25A 3IJOB 4G8HA 4LONB 3LSLA 1NNFA 2V3TA 1US4A 1LFGA 4RK2A 3TEPA 4XIGQ 1ZTYA 3JZJA 3D4CA 2RCBA 4ELRA 3IB2A 3CIJA 4H6DA 4YKKA 3MBPA 1JETA 4EF1A 5A5XA 3R6UA 5CC2A 4TQUQ 5B70A 2Z23A 3CSBA 3QAXA 4TLLB 1M5BA 2XXQA 4THIA 4OXVA 4E0XA 4F2QA 5ICTA 2UVGA 5KCJB 3PGFA 2I58A 2IA4A 1Q1KA 4I8CA 4NF6B 5DVIA 4H5FA 3A3UA 5TPAA 1IITA 1Y9UA 2E0SA 2HEUA 2XXTA 1NH8A 4YMAA 3MZ9A 1SW5A 3SERA 1QKBA 3HHFA 2HAUA 3QUJA 4ESXA 4G8NA 1BLFA 2XXWA 4M1VA 4BDLA 3H6VA 4IY5A 1B5IA 3O6HA 1FQAA 1FQCA 1SVXB 2DOJA 3PUVE 5CM6A 2O1LA 3HCQA 4R75A 1OQHA 1M5EA 3WAFA 1D9YA 2O51A 4KFQA 3TODA 1FW0A 1NNPA 4LP2B 4U1ZA 1TT1A 3N94A 4XKPA 5DYHA 4X9TA 4IO3A 1IXGA 2DWHA 2QRYA 1EZOA 5TPAB 2ZXTA 2ZYKA 3HPIA 4NE4A 1H43A 5DEXA 4GVOA 1VFEA 2YPNA 1JVYA 1VSOA 1ZMGA 2GRVA 2NXOA 3PPOA 1UIUA 2Y7PA 4BDRA 2V93A 4DZ1A 4RPNA 4Q5TA 3H03A 5AA3A 1IIWA 3TTMA 5A5XB 3M3LA 4IO4A 1AIVA 3SEYA 2G93A 1ATGA 4H65A 5BWJA 1US5A 1Y4CA 2QJEA 1ZU0A 5L9MA 2ZNTA 4FE8A 2ZYMA 2UVIA 1H76A 3IR1A 1I69A 1ZJLA 4G68B 3VXBA 4AQ4A 4ZE9A 3EHSA 4WKMA 4OFJA 1MY4A 4WEPA 4IGRA 3K6UA 1N76A 1B2HA 2DSFA 2NUVA 4KD5A 3PPNA 3HSTA 4JSDA 1M5DA 2XXHA 1FTLA 1FQDA 3FVOA 2XX8A 2PMSA 5IAIA 5TU0A 4YMBA 1PB7A 1XOCA 3IK6B 3KOTA 3T22A 2B3BA 1A54A 5AA1A 3OSQA 3UORA 2H4IA 1P99A 3MW0A 4OFOA 3G3JA 4ZEFA 1FQBA 3Q28A 4GIZA 3G3IA 4RYAA 3SEXA 4IGTA 1MRPA 1PBPA 1R6ZA 4JB7A 1MG1A 4OERA 3RNNA 2Q89A 1FTOA 1OQGA 5FTIA 2Z22A 3FVKA 1USYH 3K1PA 4JWOA 5JK4A 1P1UA 2D21A 1B4ZA 2I6EA 1DTGA 1TFAA 2O68A 2ONRA 3PUXE 4F31B 3B7DA 3BBRA 3H6UA 2XXUA 5ICQA 3KBRA 3SEWA 4ZDMA 2O69A 3MWBA 2NWJA 3S4UA 4LZ8A 5CBSA 4TOZA 3N5LA 1QW0A 4YKIA 1MM7A 4GD5A 5H8NA 4GQOA 1EH3A 1SQYA 3FJGA 4ESWA 3UA8A 5I2KA 1XT8A 1MPCA 4DXBA 3I6VA 3FXUA 2DWJA 4R6HA 4RY1A 3TMGA 1QUJA 2F7AA 3K1NA 3HN0A 3IB0A 4X48A 3OEKA 5AA4B 1IXCA 4IY6A 5H8QA 1JNFA 2REJA 2QL3A 3FD3A 3MVZA 3Q27A 3V89B 1N7XA 4H8IA 1ZLQA 2LAOA 1XVXA 4LVQA 1NH7A 3SDFA 2V25A 1YCJA 4U2RA 3TPAA 4LZ5A 3DLNA 3VLVA 5DT6A 1B6HA 5FHOA 1JW4A 3C31A 3F11A 5KCJA 2RKMA 4ZECA 1QVSA 3ECRA 4U21A 4I62A 3H7MA 1B58A 3T9UA 4Q0CA 1DMBA 2PBWA 3WAEA 2F6PA 2FNCA 3TTLA 1SYHA 2OJTA 4NTLA 1IQ7A 1SDXA 3N26A 5FHMA 3U8QA 2RC9A 4EQ9A 2E1SA 3C35A 2QSXA 3DP6A 4R9GA 4NF8A 1USYE 2HQ0A 2F8DA 3IOWA 2RC7A 3KN8A 4RNSA 1II5A 3RTFB 3H4ZA 1UTBB 2M8CA 2Y7IA 4KI0E 2ZMBA 3GXAA 4R2BA 2X26A 5CMCA 4I1DA 2THIA 3QSLA 4MBPA 3O9PA 4KQPA 1XC1A 4EDPA 3D4GA 4F29A 2HXWA 2XXXA 4OESA 1FTJA 4YB6A 3TELA 3SETA 3MZ1A 1D3KA 4QRZA 4H5GA 4ZS9A 4F18A 3MQ9A 4ZEKA 2UVJA 2B3FA 2F6GA 4KR5A 4U4XA 4ZE8A 3TCFA 3C9HA 1MQIA 3LSFB 5AA2B 3MUQA 5AA2A 4NWDA 3UGWA 2R9JA 5CMMA 4FEBA 1BIYA 1OVTA 1GR2A 1MQGA 4RA1A 1LFIA 2PVUA 4QFLA 3OEMA 3W15C 3PMWA 1R1NA 1WDNA 4GLIA 4Q8RA 3S9LC 1D9VA 4DIGA 1LCFA 1MXYA 1HSEA 3CFXA 1LLSA 1OMPA 4K3FA 3RN8A 4F3GA 2RF1A 2H98A 4NF6A 3GZGA 1MH3A 3CG1A 3T9VA 4QSCA 2NOOA 3O97A 1MS7A 3LUYA 5F1QA 1IUDA 4ND9A 4F3PA 2O7IA 2DQVA 3K4UA 4MFIA 1M5CA 4PETA 1VR5A 3ILTB 3SEUA 1R9LA 3V83A 1AL3A 5KZTA 5DEXB 3MZBA 1MDQA 4FATA 2Y7RA 2VD2A 2DE2A 1M5FA 1Y3PA 1JW1A 3FGSA 1LAGE 3FJMA 4OHNA 1B32A 5EYFA 1Y3QA 3CVGA 1MQDA 5CI5A 5IKBA 2F35A 1ZIUA 2Q2CA 3OENA 4PFWA 5I56A 2XD2A 2DE4A 3A3CA 3V5AA 1H44A 3IJXB 3S2VA 2VP1A 3JYRA 3PMXA 1FQEA 4JWXA 4YU0A 3RTWB 3T9XB 1DOTA 1HSJA 3TUSA 4ZEIA 5LOMA 3K01A 3H6TA 2I49A 1PBQA 3UIFA 3SKPA 4HCYA 3K00A 1FTMA 4IO2A 3TCGA 3B6WA 1MPBA 2YLNA 4XXUA 4ELQA 3UP9A 3KGCA 4KCDA 2X7QA 1DPPA 4F1VA 1I6BA 5EHMA 3EHTA 3LSXA 4U4SA 2OCUA 4LZ7A 3I3VA 4MLVA 1N84A 3KSXA 2UYEA 3QUFA 3MVWA 5ITPA 1N7WA 2B65A 3LBSA 3BFUA 3OXNA 1B46A 4JSOA 4KYSA 1J1NA 3N6UA 4WXJA 3O66A 3KG2A 2F78A 2ZYNA 2P2AA 1NKXA 2OBGA 5CMBA 2HCAA 4LATA 3HV1A 2Y84A 2Y7WA 4IB2A 4F19A 1MXUA 2D3IA 3IO6A 4XKRA 3FASA 4G68C 3U72A 5AA2D 3G3HA 3H3GA 3TTNA 2VHAA 2XXIA 3U92A 3OO9A 1B51A 3E3KA 3EN3A 1MDP1 2I4BA 2QS4A 3KEIA 2IEEA 1OVBA 5H8HA 1S7YA 1O64A 3O6GA 4OENA 4QFOA 1IXHA 1POTA 1MY1A 1Y3NA 2CZLA 5HM4B 3E9XA 1ZKBA 3UN6A 4IO6A 4QHQA 1GVCA 4NEDA 4ZEBA 1MY0A 3TZAA 1AMFA 4LQ5A 5H8FA 3RT6B 1NMUA 2OZZA 1B52A 2I3VA 3A09A 4PE5B 4QFNA 5K2XA 4AB6A 1B1HA 4MLQA 1F9BA 1XS5A 2BJJX 3AXFA 3CFLA 3CR9A 4P11A 3FJ7A 4BLAA 3BFTA 3RLFE 5I58B 1BTJA 2AIXA 1AOVA 4FJPA 1B7HA 3L6HA 2F34A 3QXMA 1B3HA 1MM6A 2UYFA 4YZZA 4TLMB 4GWOA 5TP9A 1B3FA 4G2ZA 4EF2A 4Q30B 2ABHA 5I57B 1Z7ME 1A7LA 2Q2AA 4QFKA 3W9VA 1XVYA 5K2YA 2F7CA 1RYXA 3KJTA 5FTHA 3VLUA 4EQ7A 4FAJA 3S9EA 1YAEA 4DDDA 4YKJA 1IXIA 3OOAA 1MY3A 2AL5A 3IAZA 3B6QA 1QUIA 3MVXA 3MC2A 4KHZE 4NF5A 1BP5A 3K6VA 2H5YA 3TTRA 4AB5A 1RKMA 4R2FA 5EHSA 4C1TA 3OSRA 3PUYE 1SD3A 3VVFA 1URSA 4DXUA 3FVGA 4ELOA 1B40A 2XHDA 4RXLA 3DELB 3FXRA 1LB9A 1NFTA 1URGA 3MP6A 3OO7A 4LQ2A 2VGQA 1Y4TA 2XXYA 4NF8B 4POWA 4WEDA 4R73A 4O3CA 4PFUA 4YB5A 4GL8A 3DP8A 1HSLA 1JQFA 2ANJA 3PPRA 4JWYA 2DVZA 2DYXA 3UK4A 4L17A 3ZSFA 4DLDA 5CBRA 2RC8A 4BDOA 1QKAA 1TXFA 4EQBA 4JBZA 4QSDA 3OMBA 4IO5A 2KLFA 1YTVA 3RUMA 3S9NC 3FVNA 1MQJA 1PDAA 1LFHA 2CMOA 2UXAA 1FQFA 3EF7A 3MPKA 1CB6A 3P7IA 1EU8A 2RINA 3IOVA 4H1XA 4NF4B 3CRBA 4NF5B 3PD9A 4ZZAA 3U1OA 3VDFA 4U23A 1Q35A 5B7DA 4DXCA 5L9SA 4JXIA 3EQ1A 3KFMA 1LBCA 3KSJA 1MH4A 3G3KA 2A5SA 1B5JA 1MQHA 2QS3A 3KN3A 4I9DA 1RYOA 1N0TA 1JW5A 3Q26A 3O6IA 3L6GA 2Y7KA 4NWCA 2GHAA 1I6AA 4F3SA 2DS9A 1A99A 4MH5A 4OEUA 4LUBA 3HHGA 3DP4A 4QFPA 4BDNA 3B6TA 3PU5A 3LR1A 4N13A 3EPEA 3TTKA 3KZGA 1LAHE 4F1YA 1H45A 3C34A 2O1MA 4OVJA 2HFBA 1QULA 5DTBA 4RPOA 2ALUA 4F3BA 4M4GA 4P0GA 3TYHA 3VVEA 3MJNA 4YAHX 4DE8A 3CFZA 5H8SA 4YB7A 5ELVA 1B0HA 4H67A 1YPNA 3R7XA 4E0WA 3M3KA 4EUOA 1B9JA 3THIA 1P1QA 5M2VA 3G3GA
chains in the Genus database with same CATH superfamily
1SW2A 1NUYA 2QMWA 5H8HB 2YJPA 5JTYB 4XTCQ 2HZKA 4PDHA 1A55A 4QBAA 2H99A 3C36A 5L9OA 1B7UA 3TQLA 1IMDA 4HTGA 2DWIA 3KOSA 3GBAA 2I4CA 1FPFA 1N3WA 1PB8A 3O29A 4Z0IA 4OFLA 3SKPA 2O6AA 4KYDA 3IB1A 2KR0A 4LA9A 5I59A 3VE1B 2QPQA 1TWYA 1SW1A 1PB9A 5BUUA 4KPTA 1UTHA 2PT2A 4OZ9A 3LC8A 3C32A 1B4HA 3HO7A 5H8FB 3DM0A 1LGBC 4U22A 1WODA 3TKDA 1MPDA 5DW8A 4RK9A 4ISUA 1Z7NE 1LCTA 3IOTA 4GWWA 4GXSB 1VE4A 4QF9A 1FBCA 1B3EA 2FIEA 3CSGA 2QS2A 4OMBA 1URDA 4OQOA 2DWAA 5H8QB 3VLWA 1MY2A 1K9ZA 1DTZA 2ZNUA 4KXPA 2XX9A 5I2KB 1O63A 1JEVA 3M8UA 3PPPA 1LBWA 1GV8A 1SI0A 4ELPA 3EHUA 2GHBA 3K2DA 3IORA 1LBBA 2HZLA 4GXAA 1T0KA 2P0SA 4PQJA 4PBHA 3T66A 2ONSA 4F39A 1KWHA 4P0IA 4XKQA 4QSEA 3TCHA 1AH5A 2XX7A 1QGXA 2QMXA 1IEJA 1MXXA 3GLBA 4YKPA 2V3UA 4OYVA 3GBBA 1TFDA 3CHGA 1ZBMA 3OD7A 1B3LA 4N15A 4O7MA 3NOHA 4ZEDA 2W7YA 5I57A 1LBYA 2Q8MA 5I59B 1NV7A 3ZKLA 2P1SA 1GGGA 4G4PA 1EYJA 3VXCA 4PGPA 2V3QA 1BKAA 1Q9DA 2AL4A 5EQ7A 1ZTYA 3JZJA 3D4CA 4ELRA 3LV0A 1VDWA 3IB2A 4H6DA 4EF1A 3R6UA 4TQUQ 3CSBA 1DCUA 1M5BA 4E0XA 2IA4A 4NF6B 3A3UA 2E0SA 2HEUA 3MZ9A 3SERA 4G8NA 2XXWA 4M1VA 2FBPA 1FQCA 2DOJA 5CM6A 4LP2B 4NHBA 3N94A 1KA0A 5DYHA 4MMPA 2DWHA 2ZYKA 1H43A 1FBFA 2P3VA 1JVYA 1VSOA 1ZMGA 2F3DA 2Y7PA 5AA3A 4N91A 3H03A 4N8GA 5A5XB 1NV2A 4H65A 5BWJA 4GWSA 5L9MA 2ZYMA 4AQ4A 3EHSA 1NUZA 4IGRA 3K6UA 1N76A 1B2HA 3FVOA 2PMSA 4YMBA 1XOCA 3IK6B 3T22A 5AA1A 3MW0A 4P8BA 4NN3A 4GIZA 3SEXA 1R6ZA 4JB7A 4OERA 5FTIA 2Z22A 1USYH 4JWOA 1P1UA 1B4ZA 2ONRA 1TFAA 3H6UA 4LZ8A 5CBSA 4TOZA 4JVDA 4GWXA 1MPCA 4DXBA 4R6HA 4X48A 5AA4B 4IY6A 2V25A 4LZ5A 1QVSA 4U21A 3T9UA 4Q0CA 1DMBA 3A29A 2OJTA 2RC9A 2QSXA 1USYE 2HQ0A 4RNSA 1II5A 5JEIA 3GXAA 4R2BA 2X26A 4KQPA 1FTJA 4ZEKA 2UVJA 4KR5A 4ZE8A 4GWUA 4OANA 1D9VA 4DIGA 1MXYA 3CFXA 1OMPA 2B4MA 2RF1A 4NF6A 3CG1A 4QSCA 4PETA 1AL3A 5KZTA 5DEXB 1MDQA 3FGSA 5EYFA 1B32A 1MQDA 5CI5A 4P3LA 5I56A 3IJXB 3JYRA 3PMXA 1FQEA 2FIXA 3TUSA 2I49A 1LBVA 2OX3A 1FTMA 5IZ3A 4KCDA 4F1VA 4U4SA 3E78A 3I3VA 3MVWA 3BFUA 4KYSA 4WXJA 3O66A 3KG2A 2ZYNA 2P2AA 1NKXA 5CMBA 2HCAA 2Y7WA 4IB2A 3G3HA 2VHAA 3OO9A 3B8BA 1MDP1 2I4BA 1S7YA 4OENA 5HM4B 3UN6A 1NMUA 4AB6A 3RLFE 4QXDA 3L6HA 1MM6A 2PCRA 4MJOA 3W9VA 5FTHA 4YKJA 1IXIA 3B6QA 3TTRA 4AB5A 2H5YA 4R2FA 4C1TA 3PUYE 1SD3A 3FVGA 3V8XB 3OO7A 4WEDA 1RDZA 4GL8A 4XF5A 2ANJA 2DVZA 2DYXA 1TXFA 3OMBA 2KLFA 3MPKA 1FPKA 2XWKA 3IOVA 4NX1A 2FVZA 3VDFA 4DXCA 4X8RA 2CZKA 3EQ1A 3KFMA 3G3KA 1B5JA 3KN3A 1RYOA 3B50A 3Q26A 3O6IA 4LUBA 3PU5A 2VT5A 3TTKA 1LAHE 4GBWA 2ALUA 4PDDA 4YAHX 5H8SA 4YB7A 2OWZA 4H67A 3R7XA 4KHZE 1FTAA 4N81A 4YMAA 1P1QA 4EXLA 2PFYA 4N8YA 4NGUA 3QMFA 4DCXA 3FIRA 1H3DA 1ELJA 2PT1A 5FHNA 2Z8DA 3FUZA 4JDFA 3TDJA 1DSNA 1UQWA 1P1OA 3IO4A 4OVRA 4OA4A 2OK2A 4G77A 2NVUB 2XD3A 2ONKE 5ISUA 5J1DA 4GRKA 1O7TA 4POXA 4KCCA 2WBBA 3R26A 2PX1A 2A5TB 3SESA 5I2NA 4IR8A 4HS7A 1R9QA 2I48A 1Y1MA 4BDQA 3VV5A 3PV0E 2ESNA 2I3WA 2FHYA 3PUWE 3K1MA 5IZ3B 5KDTB 3GYYA 3PMVA 2WKYA 2UVHA 3KJ7A 2Q88A 2QVRA 3TFLA 4R72A 3IFCA 1FBEA 1LB8A 3MVYA 4F22A 3Q25A 2OLBA 1G0HA 3PPQA 1B05A 2P3NA 5DVFA 1N04A 4JVCA 4FAJA 5EYHA 3C33A 4HCWA 2VPNA 1A8EA 5F24A 1POY1 1SBPA 4OTEA 3O28A 1D4NA 2H9BA 3U93A 1Y20A 3OO6A 5JTYA 1IZ1A 5LTCA 4PGNA 1XI6A 4MHFA 3TAJA 2Z8EA 1FCKA 4N07A 1B0LA 1NV3A 3SZPA 1UTBA 1QJMA 3M3FA 1B5HA 3SEVA 3ONMA 3T0JA 1JEUA 4FEDA 3USDA 4R74A 3JV9A 1OIBA 1P1NA 3G7WA 2H25A 3LSLA 1NNFA 3ISPA 1FJ9A 1US4A 1LFGA 4RK2A 2Z23A 4TLLB 2XXQA 5ICTA 2UVGA 5KCJB 1Q1KA 5DVIA 1IITA 1Y9UA 1NH8A 1SW5A 1FBGA 2VPOA 4BDLA 3H6VA 1SVXB 3PUVE 3HCQA 1OQHA 3WAFA 4AS5A 1D9YA 1FW0A 1NNPA 4XKPA 1EZOA 5IZZA 2ZXTA 3HPIA 5DEXA 2YPNA 2CEYA 1UIUA 4DZ1A 4BDRA 2V93A 4I3EA 4RPNA 2V4CA 3TTMA 1AIVA 4PTKA 2G93A 1US5A 1Y4CA 2QJEA 4FE8A 3FBPA 1ZJLA 3LUZA 2NUVA 3PPNA 3HSTA 1M5DA 2XXHA 1FTLA 1FQDA 2WBDA 5IM2A 1PB7A 1A54A 3G3JA 3G3IA 4RYAA 1MRPA 3RPLB 1MG1A 4NAPA 3B7DA 3BBRA 5ICQA 4I3YA 4ZDMA 2NWJA 3S4UA 1MM7A 3KBZA 4GQOA 4MCOA 3FJGA 4ESWA 3I6VA 2F7AA 3K1NA 1INPA 3HN0A 1IXCA 4MNCA 3FD3A 1N7XA 1NH7A 2XWIA 3SDFA 3TPAA 1B6HA 3F11A 2RKMA 4ZECA 1B58A 4NTLA 1IQ7A 5FHMA 3DP6A 2ZMBA 1AWBA 3O9PA 4EDPA 4YB6A 1NV1A 2F3BA 4ZS9A 4F18A 1LBZA 3C9HA 3HFUA 3MUQA 5AA2A 4NWDA 3UGWA 4FEBA 1BIYA 1OVTA 1GR2A 1FPLA 3W15C 3OEMA 1R1NA 4GLIA 3S9LC 4HE1A 3T9VA 3O97A 4JVIA 4ND9A 3K4UA 1M5CA 1VR5A 3V83A 3KC1A 2DE2A 4OHNA 1Y3QA 1H44A 3S2VA 4JWXA 3T9XB 1DOTA 1PBQA 3LSXA 2OCUA 4PCDA 4MLVA 3KSXA 3QUFA 1YXIA 1J1NA 3N6UA 4XEQA 2OBGA 2WYKA 4LATA 3HV1A 2Y84A 4F19A 2D3IA 5A5LA 3IO6A 3U72A 4G68C 1DBZA 4NF0A 1B51A 3E3KA 3KEIA 2IEEA 5H8HA 2CZLA 1ZKBA 4IO6A 1GVCA 1MY0A 1AMFA 5H8FA 3CFLA 1XS5A 3AXFA 4BLAA 3CR9A 3BFTA 5I58B 4GX3A 4FJPA 4O8MA 5IGAA 3QXMA 4TLMB 4Q30B 1K9YA 2ABHA 5I57B 1Z7ME 1A7LA 2Q2AA 5K2YA 3VLUA 3KJTA 3S9EA 2AL5A 3MVXA 3K6VA 3RYDA 3VVFA 1B40A 4RXLA 3MP6A 3T1BA 1LB9A 2QFLA 1Y4TA 2L5VA 2VGQA 4R73A 1IMBA 4YB5A 1BK4A 4FBPA 4JWYA 4DLDA 3ZSFA 4L17A 1QKAA 3RUMA 1MQJA 2CEXA 4H1XA 1EU8A 1SPIA 2RINA 4ZZAA 3PD9A 5L9SA 4JXIA 5I2KA 1N0TA 3L6GA 1I6AA 3FXBA 3DP4A 4F1YA 2O1MA 2HFBA 1QULA 5DTBA 4RPOA 3MJNA 2XXKA 3CFZA 4PBQA 4EUOA 1B9JA 3G3GA 3ILUB 5ITOA 3C4MA 4ECFA 1B1XA 3S9MC 1NV5A 1MXVA 2F36A 2XA5A 4GL0A 1FBPA 2DE3A 4GFRA 3IL1B 5HBCA 4O3AA 1LAXA 2Z8FA 5H8NB 3MP8A 5TP9B 5I84A 4O94A 4OEVA 4NQ8A 2OWSA 4G61A 4ZZEA 1OLAA 4XFEA 1UTHB 3RY3A 4IO7A 2VD3A 4EXKA 3MPLA 1IMCA 1FTKA 4U1OA 1N3XA 1WVJA 1OLCA 4OVQA 3CI8A 2O84X 3T93B 4G68A 3BKIB 3N6TA 1S50A 1FRPA 5F7VA 1L5TA 5L8DA 2I0BA 4UA8A 2Q9TA 2F7BA 4PFTA 4HW8A 1SYIA 4O3BA 3ODBA 3QK6A 3TQWA 3FV2A 2F97A 4ONYA 3G3FA 1SI1A 3MP1A 2Y5LA 4G8MA 3RPWA 3QYTA 3ZKKA 4R6YA 1B7ZA 2FYIA 4UACA 4AS4A 1PEBA 5AE4A 3MAMA 3OO8A 4GOTA 2GFEA 5I2NB 4GF8A 3FXQA 1Y1ZA 3T9HB 4F2OA 2G29A 1XHYA 2XXVA 4RJZA 1PC3A 3FV1A 5HPQA 2PYYA 1MXZA 4P1LA 4N6PA 2O7UA 1EZ9A 4N4UA 3IOUA 5ET8A 5ET5A 3H6WA 2I0CA 5KDTA 4XIGQ 3CIJA 5A5XA 1JETA 5CC2A 5B70A 3QAXA 4F2QA 4OXVA 5FBPA 3PGFA 2I58A 5TPAA 4OVSA 1QKBA 3QUJA 4ESXA 2QVUA 4MAGA 1B5IA 2QVVA 4MIJA 1FQAA 2O1LA 4R75A 2O51A 4U1ZA 4IO3A 1IXGA 2Y5KA 4NE4A 3EKIA 4GVOA 2GRVA 4Q5TA 4NG7A 4P1EA 1ATGA 2ZNTA 2UVIA 1H76A 3IR1A 1I69A 4ZE9A 1MY4A 2DSFA 4KD5A 2XX8A 5TU0A 2ZZWA 3OSQA 4OFOA 4ZEFA 1FQBA 3Q28A 2Q89A 1FTOA 3FVKA 5JK4A 2WEFA 2D21A 2I6EA 4F31B 2XXUA 4P56A 3KBRA 4PF6A 1QW0A 4YKIA 4GD5A 5H8NA 1EH3A 1SQYA 3UA8A 3RPLA 4OVPA 2DWJA 4RY1A 1JP4A 4PFRA 2REJA 2QL3A 3MVZA 3V89B 4H8IA 1ZLQA 2LAOA 1YCJA 4U2RA 3VLVA 3DLNA 5DT6A 3C31A 3ECRA 2PBWA 3WAEA 2F6PA 1SYHA 3U8QA 1SDXA 4EQ9A 2F8DA 2RC7A 3KN8A 3RTFB 3H4ZA 4KI0E 2M8CA 2Y7IA 5CMCA 2THIA 4F29A 2R8TA 1XC1A 4OESA 3TELA 3MZ1A 1D3KA 1KA1A 4H5GA 2B3FA 4U4XA 2XWVA 1MQIA 2R9JA 4HE2A 4RA1A 1FBDA 1LFIA 4QFLA 3PMWA 3GZGA 5ET7A 2WX9A 4N6KA 1MS7A 3LUYA 1IUDA 4F3PA 3SEUA 3MZBA 2Y7RA 1M5FA 2F35A 3BIGA 3OENA 3A3CA 2GQ1A 4YU0A 3RTWB 4ZEIA 5LOMA 3K01A 3H6TA 4H46A 3UIFA 3K00A 1NUXA 2ZZVA 3TCGA 3KGCA 1DPPA 4O7IA 2UYEA 5ITPA 1B46A 2F78A 2KQZA 1FPDA 1D9QA 4XKRA 1NV0A 3TTNA 2XXIA 3U92A 3EN3A 4PFIA 1OVBA 1O64A 3O6GA 1IXHA 2B4LA 3E9XA 4MEVA 1EYIA 2BJIA 4HE0A 3TZAA 2I3VA 3A09A 4PE5B 5K2XA 1B1HA 5ET6A 1BTJA 2AIXA 1AOVA 4PF8A 4X04A 4YZZA 4GWOA 5TP9A 1B3FA 4PC9A 4EQ7A 1XVYA 2F7CA 1YAEA 4NF5A 4N17A 1URSA 3FXRA 4LQ2A 1NFTA 1NI9A 2XXYA 4O3CA 1HSLA 3PPRA 1IMFA 3UK4A 2RC8A 4EQBA 4JBZA 4IO5A 5EYGA 3FVNA 3S9NC 1LFHA 2CMOA 2UXAA 1FQFA 4QRZA 4NF4B 3EF7A 4Z7EA 3U1OA 1Q35A 4GWZA 4LVQA 2A5SA 4MX6A 1MQHA 4I9DA 1IMEA 4NWCA 1NV4A 2GHAA 3HHGA 4QFPA 4BDNA 3B6TA 3KZGA 1H45A 3ROJA 1YYZA 4GX4A 4P0GA 3KC0A 3TYHA 1CNQA 1YPNA 3M3KA 5M2VA 3I5OA 3LSWA 3D1RA 3PD8A 3K02A 4X1BA 3FZVA 2HXRA 5I56B 2OWTA 1JVXA 3PTYA 4FECA 2DP8A 1A8FA 4NF4A 2FA7A 4MF3A 1RDXA 3FATA 1EYKA 2REGA 3BIHA 3K0VA 1SW4A 1VFDA 3U94A 5CMKA 3VFJA 3ZS6A 2ZYOA 4PAFA 2F5XA 2V84A 1S9TA 1MXWA 3CG3A 4I40A 4YICA 1LAFE 4H8JA 2DXRA 4PE3A 4XKNA 3K6WA 2QS1A 5ESYA 5EQAA 4P9KA 5AA4A 4NMYA 3VVDA 4R6KA 3Q29A 1LBXA 1FPIA 1NL5A 2XXRA 4LN5A 3IX1A 2D5WA 1QUKA 5EQ9A 4P47A 3OELA 4R9FA 1GTKA 2VOZA 4PP0A 4X1DA 4FORA 1B3GA 1UIVA 4C1UA 1DPEA 1YZ0A 2HPGA 4H45A 3T96B 5I58A 4KYEA 5CRYA 1NNTA 2HAVA 2AYSA 3RGYA 1LSTA 5DVJA 2XXPA 2X7PA 3E4RA 2R71A 4N6DA 2DXYA 4DCYA 4H0WA 1A40A 3RQTA 4MNPA 2ZNSA 2DVCA 4PFYA 2ZZXA 4F1UA 1P1WA 4OETA 3K6XA 3W9WA 2Q8JA 1I6QA 4OWDA 2GH9A 4C0RA 2XWOA 1CE2A 1NV6A 5J16A 3H06B 2RCAA 4FIMA 3KN7A 1EZPA 1FPEA 4BDMA 2A5TA 3RT8A 3E13X 1NNKA 2R6GE 4OVTA 1ANFA 3PUZE 3QIMA 3O2AA 3IFAA 3IJOB 4G8HA 4LONB 2V3TA 3TEPA 2RCBA 4YKKA 3MBPA 4THIA 4I8CA 4H5FA 2XXTA 3HHFA 2HAUA 4GWYA 1BLFA 4IY5A 3O6HA 1M5EA 2CZHA 4KFQA 3TODA 1TT1A 4X9TA 2QRYA 5TPAB 4PAKA 1FPGA 1VFEA 2NXOA 1FSAA 3PPOA 1FBHA 2PFZA 1IIWA 4DI3D 3M3LA 4IO4A 3SEYA 1ZU0A 3VXBA 4G68B 5LDZA 4WKMA 4OFJA 4WEPA 5EHSA 4JSDA 2HHMA 1FPJA 5IAIA 3KOTA 2B3BA 3UORA 2H4IA 1P99A 4GBVA 4IGTA 1PBPA 3RNNA 1OQGA 3K1PA 1DTGA 3PUXE 2O68A 4MNIA 3SEWA 3U65A 2O69A 3MWBA 3N5LA 1XT8A 3FXUA 3TMGA 1QUJA 3IB0A 3OEKA 5H8QA 1JNFA 3Q27A 4GX6A 2Q74A 1XVXA 5FHOA 1JW4A 5KCJA 4I62A 3H7MA 2FNCA 3TTLA 3N26A 2E1SA 3C35A 4R9GA 4NF8A 3IOWA 1UTBB 4I1DA 3QSLA 4MBPA 3D4GA 2HXWA 2XXXA 3SETA 3MQ9A 2F6GA 3TCFA 5AA2B 3LSFB 5CMMA 1LEVA 1MQGA 2PVUA 1FPBA 1WDNA 4Q8RA 1LCFA 1HSEA 1LLSA 4F3GA 4K3FA 3RN8A 4UABA 2H98A 3MYUA 1MH3A 2JJKA 2NOOA 5F1QA 2O7IA 2DQVA 4MFIA 3ILTB 1R9LA 4FATA 5I5PA 4POWA 2VD2A 1Y3PA 1JW1A 1LAGE 3FJMA 3CVGA 5IKBA 1ZIUA 2Q2CA 4PFWA 2XD2A 2DE4A 3V5AA 2VP1A 5IZ1A 1HSJA 4HCYA 4IO2A 3B6WA 1MPBA 2YLNA 4XXUA 4ELQA 3UP9A 5EQ8A 2X7QA 1KZ8A 1I6BA 5EHMA 3EHTA 1G0IA 4LZ7A 5I7IA 1N84A 1N7WA 2B65A 3LBSA 1RDYA 3OXNA 4JSOA 3E79A 4PFBA 2MKZA 4PAIA 1MXUA 3FASA 5AA2D 3H3GA 2QS4A 4QFOA 1POTA 1MY1A 1Y3NA 5T3JA 4QHQA 4NEDA 4ZEBA 4LQ5A 3RT6B 2OZZA 1B52A 4QFNA 4DI4B 4MLQA 1F9BA 2BJJX 4P11A 3FJ7A 1DK4A 4HXVA 1B7HA 5I3SA 2F34A 1B3HA 2UYFA 4G2ZA 4EF2A 4QFKA 1RYXA 4DDDA 3OOAA 1IMAA 1MY3A 3IAZA 1QUIA 2WYPA 3MC2A 1BP5A 1RKMA 3OSRA 1NUWA 4F3BA 4ELOA 4DXUA 2XHDA 3DELB 1URGA 1FJ6A 4NF8B 4PFUA 2DDKA 3DP8A 1JQFA 5CBRA 4BDOA 4QSDA 1YTVA 1PDAA 3P7IA 1CB6A 2CZIA 4NF5B 3CRBA 5B7DA 4U23A 3KSJA 1LBCA 1MH4A 2QS3A 1JW5A 2Y7KA 4F3SA 2DS9A 1A99A 4MH5A 4OEUA 3LR1A 4N13A 3EPEA 3C34A 4OVJA 3MSTA 4M4GA 3VVEA 4DE8A 5ELVA 1B0HA 4E0WA 3THIA
chains in the Genus database with same CATH topology
3ILUB 1SW2A 5ITOA 3LSWA 3C4MA 3PD8A 3K02A 2QMWA 4X1BA 4DCXA 5H8HB 3FIRA 3FZVA 4ECFA 1H3DA 1B1XA 2YJPA 5JTYB 4XTCQ 2HZKA 4Z7EA 5I56B 2OWTA 3S9MC 1MXVA 1JVXA 4FECA 2F36A 4GL0A 1A55A 2DE3A 1ELJA 2DP8A 2H99A 2PT1A 1A8FA 3C36A 4GFRA 5FHNA 4NF4A 3IL1B 5HBCA 5L9OA 1B7UA 2FA7A 4MF3A 4O3AA 1LAXA 2Z8DA 2Z8FA 3FATA 5H8NB 3TQLA 3MP8A 2REGA 5TP9B 5I84A 4HTGA 3FUZA 1SW4A 1VFDA 2DWIA 3GBAA 3K0VA 2I4CA 3KOSA 4JDFA 3TDJA 1DSNA 1UQWA 3U94A 1P1OA 1N3WA 5CMKA 3IO4A 3VFJA 2ZYOA 3ZS6A 1PB8A 2F5XA 4OEVA 3O29A 5KDTA 2V84A 4Z0IA 2OK2A 4G77A 1S9TA 4OFLA 2OWSA 1MXWA 2O6AA 2XD3A 2NVUB 3CG3A 2ONKE 4KYDA 3IB1A 4ZZEA 4YICA 1LAFE 1OLAA 4H8JA 5ISUA 4LA9A 5J1DA 2DXRA 3I5OA 3VE1B 2QPQA 1TWYA 5I59A 1SW1A 1UTHB 4GRKA 4IO7A 3RY3A 4XKNA 2VD3A 4EXKA 3K6WA 1PB9A 1O7TA 3MPLA 1FTKA 4U1OA 4POXA 5BUUA 4KCCA 2QS1A 4KPTA 1N3XA 1UTHA 1WVJA 2PT2A 1OLCA 3R26A 2PX1A 2A5TB 3CI8A 3SESA 5I2NA 4HS7A 4OZ9A 2O84X 3T93B 4G68A 3BKIB 5AA4A 1R9QA 3LC8A 3N6TA 1S50A 1B4HA 3C32A 2I48A 1Y1MA 4NMYA 5F7VA 1L5TA 4BDQA 3HO7A 5L8DA 5H8FB 2I0BA 1LGBC 3DM0A 1WODA 4U22A 4UA8A 2Q9TA 3VVDA 2F7BA 4PFTA 3TKDA 1MPDA 3VV5A 4HW8A 4RK9A 4ISUA 1Z7NE 4R6KA 3PV0E 3Q29A 1SYIA 1LCTA 3IOTA 2ESNA 4O3BA 1NL5A 2I3WA 3ODBA 2XXRA 3QK6A 3V8XB 4GXSB 1VE4A 3TQWA 4QF9A 3FV2A 2F97A 3PUWE 3K1MA 1B3EA 3IX1A 5KDTB 3CSGA 2D5WA 1QUKA 2QS2A 4OMBA 1URDA 4OQOA 2DWAA 5H8QB 4ONYA 3VLWA 3PMVA 1MY2A 3G3FA 1SI1A 3OELA 1DTZA 3MP1A 4R9FA 1GTKA 2WKYA 2UVHA 3KJ7A 4G8MA 2Q88A 2VOZA 2ZNUA 4PP0A 4X1DA 4FORA 4R72A 3RPWA 3TFLA 2XX9A 1B3GA 1UIVA 1LB8A 5I2KB 1O63A 1JEVA 3M8UA 3PPPA 4C1UA 3MVYA 1DPEA 4F22A 1GV8A 1SI0A 3Q25A 2OLBA 3T96B 3QYTA 5I58A 4ELPA 3EHUA 2GHBA 4KYEA 3ZKKA 3K2DA 3IORA 3PPQA 1B05A 4R6YA 5DVFA 1N04A 1B7ZA 1NNTA 5CRYA 2HAVA 1LBBA 2AYSA 1LSTA 2HZLA 2XXPA 5DVJA 2X7PA 3C33A 4HCWA 3RGYA 4GXAA 2FYIA 1T0KA 2P0SA 4UACA 4PQJA 5JEIA 1PEBA 5AE4A 3MAMA 3E4RA 3T66A 2R71A 2ONSA 3OO8A 2DXYA 4GOTA 4DCYA 4F39A 1KWHA 1A8EA 4P0IA 1POY1 2GFEA 4H0WA 1A40A 3RQTA 1SBPA 4XKQA 4OTEA 3O28A 5I2NB 2ZNSA 4QSEA 1D4NA 3TCHA 2DVCA 2H9BA 4PFYA 3U93A 1AH5A 4F1UA 1P1WA 2XX7A 4GF8A 1Y20A 4OETA 3OO6A 3K6XA 2QMXA 3W9WA 5JTYA 1IZ1A 1IEJA 1MXXA 3GLBA 2Q8JA 4EXLA 1I6QA 3FXQA 1Y1ZA 4OWDA 3T9HB 4F2OA 4YKPA 2GH9A 2V3UA 4C0RA 2G29A 3TAJA 4OYVA 1CE2A 2Z8EA 3H06B 1FCKA 1XHYA 4N07A 1B0LA 2XXVA 3GBBA 1TFDA 2RCAA 4FIMA 4RJZA 1UTBA 1QJMA 1PC3A 3KN7A 3FV1A 3M3FA 5HPQA 1EZPA 2PYYA 1MXZA 4BDMA 2A5TA 1B5HA 1ZBMA 3SEVA 3RT8A 3OD7A 3ONMA 1B3LA 4N6PA 1JEUA 2O7UA 4FEDA 3E13X 4ZEDA 2W7YA 5I57A 1NNKA 1EZ9A 2R6GE 5I59B 1ANFA 3PUZE 3ZKLA 2P1SA 3QIMA 1GGGA 3IOUA 4G4PA 3O2AA 3VXCA 3USDA 2V3QA 4R74A 3JV9A 1OIBA 1P1NA 1BKAA 2I0CA 3G7WA 3H6WA 2AL4A 2H25A 3IJOB 4G8HA 4LONB 3LSLA 1NNFA 2V3TA 1US4A 1LFGA 4RK2A 3TEPA 4XIGQ 1ZTYA 3JZJA 3D4CA 2RCBA 4ELRA 3IB2A 3CIJA 4H6DA 4YKKA 3MBPA 1JETA 4EF1A 5A5XA 3R6UA 5CC2A 4TQUQ 5B70A 2Z23A 3CSBA 3QAXA 4TLLB 1M5BA 2XXQA 4THIA 4OXVA 4E0XA 4F2QA 5ICTA 2UVGA 5KCJB 3PGFA 2I58A 2IA4A 1Q1KA 4I8CA 4NF6B 5DVIA 4H5FA 3A3UA 5TPAA 1IITA 1Y9UA 2E0SA 2HEUA 2XXTA 1NH8A 4YMAA 3MZ9A 1SW5A 3SERA 1QKBA 3HHFA 2HAUA 3QUJA 4ESXA 4G8NA 1BLFA 2XXWA 4M1VA 4BDLA 3H6VA 4IY5A 1B5IA 3O6HA 1FQAA 1FQCA 1SVXB 2DOJA 3PUVE 5CM6A 2O1LA 3HCQA 4R75A 1OQHA 1M5EA 3WAFA 1D9YA 2O51A 4KFQA 3TODA 1FW0A 1NNPA 4LP2B 4U1ZA 1TT1A 3N94A 4XKPA 5DYHA 4X9TA 4IO3A 1IXGA 2DWHA 2QRYA 1EZOA 5TPAB 2ZXTA 2ZYKA 3HPIA 4NE4A 1H43A 5DEXA 4GVOA 1VFEA 2YPNA 1JVYA 1VSOA 1ZMGA 2GRVA 2NXOA 3PPOA 1UIUA 2Y7PA 4BDRA 2V93A 4DZ1A 4RPNA 4Q5TA 3H03A 5AA3A 1IIWA 3TTMA 5A5XB 3M3LA 4IO4A 1AIVA 3SEYA 2G93A 1ATGA 4H65A 5BWJA 1US5A 1Y4CA 2QJEA 1ZU0A 5L9MA 2ZNTA 4FE8A 2ZYMA 2UVIA 1H76A 3IR1A 1I69A 1ZJLA 4G68B 3VXBA 4AQ4A 4ZE9A 3EHSA 4WKMA 4OFJA 1MY4A 4WEPA 4IGRA 3K6UA 1N76A 1B2HA 2DSFA 2NUVA 4KD5A 3PPNA 3HSTA 4JSDA 1M5DA 2XXHA 1FTLA 1FQDA 3FVOA 2XX8A 2PMSA 5IAIA 5TU0A 4YMBA 1PB7A 1XOCA 3IK6B 3KOTA 3T22A 2B3BA 1A54A 5AA1A 3OSQA 3UORA 2H4IA 1P99A 3MW0A 4OFOA 3G3JA 4ZEFA 1FQBA 3Q28A 4GIZA 3G3IA 4RYAA 3SEXA 4IGTA 1MRPA 1PBPA 1R6ZA 4JB7A 1MG1A 4OERA 3RNNA 2Q89A 1FTOA 1OQGA 5FTIA 2Z22A 3FVKA 1USYH 3K1PA 4JWOA 5JK4A 1P1UA 2D21A 1B4ZA 2I6EA 1DTGA 1TFAA 2O68A 2ONRA 3PUXE 4F31B 3B7DA 3BBRA 3H6UA 2XXUA 5ICQA 3KBRA 3SEWA 4ZDMA 2O69A 3MWBA 2NWJA 3S4UA 4LZ8A 5CBSA 4TOZA 3N5LA 1QW0A 4YKIA 1MM7A 4GD5A 5H8NA 4GQOA 1EH3A 1SQYA 3FJGA 4ESWA 3UA8A 5I2KA 1XT8A 1MPCA 4DXBA 3I6VA 3FXUA 2DWJA 4R6HA 4RY1A 3TMGA 1QUJA 2F7AA 3K1NA 3HN0A 3IB0A 4X48A 3OEKA 5AA4B 1IXCA 4IY6A 5H8QA 1JNFA 2REJA 2QL3A 3FD3A 3MVZA 3Q27A 3V89B 1N7XA 4H8IA 1ZLQA 2LAOA 1XVXA 4LVQA 1NH7A 3SDFA 2V25A 1YCJA 4U2RA 3TPAA 4LZ5A 3DLNA 3VLVA 5DT6A 1B6HA 5FHOA 1JW4A 3C31A 3F11A 5KCJA 2RKMA 4ZECA 1QVSA 3ECRA 4U21A 4I62A 3H7MA 1B58A 3T9UA 4Q0CA 1DMBA 2PBWA 3WAEA 2F6PA 2FNCA 3TTLA 1SYHA 2OJTA 4NTLA 1IQ7A 1SDXA 3N26A 5FHMA 3U8QA 2RC9A 4EQ9A 2E1SA 3C35A 2QSXA 3DP6A 4R9GA 4NF8A 1USYE 2HQ0A 2F8DA 3IOWA 2RC7A 3KN8A 4RNSA 1II5A 3RTFB 3H4ZA 1UTBB 2M8CA 2Y7IA 4KI0E 2ZMBA 3GXAA 4R2BA 2X26A 5CMCA 4I1DA 2THIA 3QSLA 4MBPA 3O9PA 4KQPA 1XC1A 4EDPA 3D4GA 4F29A 2HXWA 2XXXA 4OESA 1FTJA 4YB6A 3TELA 3SETA 3MZ1A 1D3KA 4QRZA 4H5GA 4ZS9A 4F18A 3MQ9A 4ZEKA 2UVJA 2B3FA 2F6GA 4KR5A 4U4XA 4ZE8A 3TCFA 3C9HA 1MQIA 3LSFB 5AA2B 3MUQA 5AA2A 4NWDA 3UGWA 2R9JA 5CMMA 4FEBA 1BIYA 1OVTA 1GR2A 1MQGA 4RA1A 1LFIA 2PVUA 4QFLA 3OEMA 3W15C 3PMWA 1R1NA 1WDNA 4GLIA 4Q8RA 3S9LC 1D9VA 4DIGA 1LCFA 1MXYA 1HSEA 3CFXA 1LLSA 1OMPA 4K3FA 3RN8A 4F3GA 2RF1A 2H98A 4NF6A 3GZGA 1MH3A 3CG1A 3T9VA 4QSCA 2NOOA 3O97A 1MS7A 3LUYA 5F1QA 1IUDA 4ND9A 4F3PA 2O7IA 2DQVA 3K4UA 4MFIA 1M5CA 4PETA 1VR5A 3ILTB 3SEUA 1R9LA 3V83A 1AL3A 5KZTA 5DEXB 3MZBA 1MDQA 4FATA 2Y7RA 2VD2A 2DE2A 1M5FA 1Y3PA 1JW1A 3FGSA 1LAGE 3FJMA 4OHNA 1B32A 5EYFA 1Y3QA 3CVGA 1MQDA 5CI5A 5IKBA 2F35A 1ZIUA 2Q2CA 3OENA 4PFWA 5I56A 2XD2A 2DE4A 3A3CA 3V5AA 1H44A 3IJXB 3S2VA 2VP1A 3JYRA 3PMXA 1FQEA 4JWXA 4YU0A 3RTWB 3T9XB 1DOTA 1HSJA 3TUSA 4ZEIA 5LOMA 3K01A 3H6TA 2I49A 1PBQA 3UIFA 3SKPA 4HCYA 3K00A 1FTMA 4IO2A 3TCGA 3B6WA 1MPBA 2YLNA 4XXUA 4ELQA 3UP9A 3KGCA 4KCDA 2X7QA 1DPPA 4F1VA 1I6BA 5EHMA 3EHTA 3LSXA 4U4SA 2OCUA 4LZ7A 3I3VA 4MLVA 1N84A 3KSXA 2UYEA 3QUFA 3MVWA 5ITPA 1N7WA 2B65A 3LBSA 3BFUA 3OXNA 1B46A 4JSOA 4KYSA 1J1NA 3N6UA 4WXJA 3O66A 3KG2A 2F78A 2ZYNA 2P2AA 1NKXA 2OBGA 5CMBA 2HCAA 4LATA 3HV1A 2Y84A 2Y7WA 4IB2A 4F19A 1MXUA 2D3IA 3IO6A 4XKRA 3FASA 4G68C 3U72A 5AA2D 3G3HA 3H3GA 3TTNA 2VHAA 2XXIA 3U92A 3OO9A 1B51A 3E3KA 3EN3A 1MDP1 2I4BA 2QS4A 3KEIA 2IEEA 1OVBA 5H8HA 1S7YA 1O64A 3O6GA 4OENA 4QFOA 1IXHA 1POTA 1MY1A 1Y3NA 2CZLA 5HM4B 3E9XA 1ZKBA 3UN6A 4IO6A 4QHQA 1GVCA 4NEDA 4ZEBA 1MY0A 3TZAA 1AMFA 4LQ5A 5H8FA 3RT6B 1NMUA 2OZZA 1B52A 2I3VA 3A09A 4PE5B 4QFNA 5K2XA 4AB6A 1B1HA 4MLQA 1F9BA 1XS5A 2BJJX 3AXFA 3CFLA 3CR9A 4P11A 3FJ7A 4BLAA 3BFTA 3RLFE 5I58B 1BTJA 2AIXA 1AOVA 4FJPA 1B7HA 3L6HA 2F34A 3QXMA 1B3HA 1MM6A 2UYFA 4YZZA 4TLMB 4GWOA 5TP9A 1B3FA 4G2ZA 4EF2A 4Q30B 2ABHA 5I57B 1Z7ME 1A7LA 2Q2AA 4QFKA 3W9VA 1XVYA 5K2YA 2F7CA 1RYXA 3KJTA 5FTHA 3VLUA 4EQ7A 4FAJA 3S9EA 1YAEA 4DDDA 4YKJA 1IXIA 3OOAA 1MY3A 2AL5A 3IAZA 3B6QA 1QUIA 3MVXA 3MC2A 4KHZE 4NF5A 1BP5A 3K6VA 2H5YA 3TTRA 4AB5A 1RKMA 4R2FA 5EHSA 4C1TA 3OSRA 3PUYE 1SD3A 3VVFA 1URSA 4DXUA 3FVGA 4ELOA 1B40A 2XHDA 4RXLA 3DELB 3FXRA 1LB9A 1NFTA 1URGA 3MP6A 3OO7A 4LQ2A 2VGQA 1Y4TA 2XXYA 4NF8B 4POWA 4WEDA 4R73A 4O3CA 4PFUA 4YB5A 4GL8A 3DP8A 1HSLA 1JQFA 2ANJA 3PPRA 4JWYA 2DVZA 2DYXA 3UK4A 4L17A 3ZSFA 4DLDA 5CBRA 2RC8A 4BDOA 1QKAA 1TXFA 4EQBA 4JBZA 4QSDA 3OMBA 4IO5A 2KLFA 1YTVA 3RUMA 3S9NC 3FVNA 1MQJA 1PDAA 1LFHA 2CMOA 2UXAA 1FQFA 3EF7A 3MPKA 1CB6A 3P7IA 1EU8A 2RINA 3IOVA 4H1XA 4NF4B 3CRBA 4NF5B 3PD9A 4ZZAA 3U1OA 3VDFA 4U23A 1Q35A 5B7DA 4DXCA 5L9SA 4JXIA 3EQ1A 3KFMA 1LBCA 3KSJA 1MH4A 3G3KA 2A5SA 1B5JA 1MQHA 2QS3A 3KN3A 4I9DA 1RYOA 1N0TA 1JW5A 3Q26A 3O6IA 3L6GA 2Y7KA 4NWCA 2GHAA 1I6AA 4F3SA 2DS9A 1A99A 4MH5A 4OEUA 4LUBA 3HHGA 3DP4A 4QFPA 4BDNA 3B6TA 3PU5A 3LR1A 4N13A 3EPEA 3TTKA 3KZGA 1LAHE 4F1YA 1H45A 3C34A 2O1MA 4OVJA 2HFBA 1QULA 5DTBA 4RPOA 2ALUA 4F3BA 4M4GA 4P0GA 3TYHA 3VVEA 3MJNA 4YAHX 4DE8A 3CFZA 5H8SA 4YB7A 5ELVA 1B0HA 4H67A 1YPNA 3R7XA 4E0WA 3M3KA 4EUOA 1B9JA 3THIA 1P1QA 5M2VA 3G3GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ILU B;  1SW2 A;  5ITO A;  3LSW A;  3C4M A;  3PD8 A;  3K02 A;  2QMW A;  4X1B A;  4DCX A;  5H8H B;  3FIR A;  3FZV A;  4ECF A;  1H3D A;  1B1X A;  2YJP A;  5JTY B;  4XTC Q;  2HZK A;  4Z7E A;  5I56 B;  2OWT A;  3S9M C;  1MXV A;  1JVX A;  4FEC A;  2F36 A;  4GL0 A;  1A55 A;  2DE3 A;  1ELJ A;  2DP8 A;  2H99 A;  2PT1 A;  1A8F A;  3C36 A;  4GFR A;  5FHN A;  4NF4 A;  3IL1 B;  5HBC A;  5L9O A;  1B7U A;  2FA7 A;  4MF3 A;  4O3A A;  1LAX A;  2Z8D A;  2Z8F A;  3FAT A;  5H8N B;  3TQL A;  3MP8 A;  2REG A;  5TP9 B;  5I84 A;  4HTG A;  3FUZ A;  1SW4 A;  1VFD A;  2DWI A;  3GBA A;  3K0V A;  2I4C A;  3KOS A;  4JDF A;  3TDJ A;  1DSN A;  1UQW A;  3U94 A;  1P1O A;  1N3W A;  5CMK A;  3IO4 A;  3VFJ A;  2ZYO A;  3ZS6 A;  1PB8 A;  2F5X A;  4OEV A;  3O29 A;  5KDT A;  2V84 A;  4Z0I A;  2OK2 A;  4G77 A;  1S9T A;  4OFL A;  2OWS A;  1MXW A;  2O6A A;  2XD3 A;  2NVU B;  3CG3 A;  2ONK E;  4KYD A;  3IB1 A;  4ZZE A;  4YIC A;  1LAF E;  1OLA A;  4H8J A;  5ISU A;  4LA9 A;  5J1D A;  2DXR A;  3I5O A;  3VE1 B;  2QPQ A;  1TWY A;  5I59 A;  1SW1 A;  1UTH B;  4GRK A;  4IO7 A;  3RY3 A;  4XKN A;  2VD3 A;  4EXK A;  3K6W A;  1PB9 A;  1O7T A;  3MPL A;  1FTK A;  4U1O A;  4POX A;  5BUU A;  4KCC A;  2QS1 A;  4KPT A;  1N3X A;  1UTH A;  1WVJ A;  2PT2 A;  1OLC A;  3R26 A;  2PX1 A;  2A5T B;  3CI8 A;  3SES A;  5I2N A;  4HS7 A;  4OZ9 A;  2O84 X;  3T93 B;  4G68 A;  3BKI B;  5AA4 A;  1R9Q A;  3LC8 A;  3N6T A;  1S50 A;  1B4H A;  3C32 A;  2I48 A;  1Y1M A;  4NMY A;  5F7V A;  1L5T A;  4BDQ A;  3HO7 A;  5L8D A;  5H8F B;  2I0B A;  1LGB C;  3DM0 A;  1WOD A;  4U22 A;  4UA8 A;  2Q9T A;  3VVD A;  2F7B A;  4PFT A;  3TKD A;  1MPD A;  3VV5 A;  4HW8 A;  4RK9 A;  4ISU A;  1Z7N E;  4R6K A;  3PV0 E;  3Q29 A;  1SYI A;  1LCT A;  3IOT A;  2ESN A;  4O3B A;  1NL5 A;  2I3W A;  3ODB A;  2XXR A;  3QK6 A;  3V8X B;  4GXS B;  1VE4 A;  3TQW A;  4QF9 A;  3FV2 A;  2F97 A;  3PUW E;  3K1M A;  1B3E A;  3IX1 A;  5KDT B;  3CSG A;  2D5W A;  1QUK A;  2QS2 A;  4OMB A;  1URD A;  4OQO A;  2DWA A;  5H8Q B;  4ONY A;  3VLW A;  3PMV A;  1MY2 A;  3G3F A;  1SI1 A;  3OEL A;  1DTZ A;  3MP1 A;  4R9F A;  1GTK A;  2WKY A;  2UVH A;  3KJ7 A;  4G8M A;  2Q88 A;  2VOZ A;  2ZNU A;  4PP0 A;  4X1D A;  4FOR A;  4R72 A;  3RPW A;  3TFL A;  2XX9 A;  1B3G A;  1UIV A;  1LB8 A;  5I2K B;  1O63 A;  1JEV A;  3M8U A;  3PPP A;  4C1U A;  3MVY A;  1DPE A;  4F22 A;  1GV8 A;  1SI0 A;  3Q25 A;  2OLB A;  3T96 B;  3QYT A;  5I58 A;  4ELP A;  3EHU A;  2GHB A;  4KYE A;  3ZKK A;  3K2D A;  3IOR A;  3PPQ A;  1B05 A;  4R6Y A;  5DVF A;  1N04 A;  1B7Z A;  1NNT A;  5CRY A;  2HAV A;  1LBB A;  2AYS A;  1LST A;  2HZL A;  2XXP A;  5DVJ A;  2X7P A;  3C33 A;  4HCW A;  3RGY A;  4GXA A;  2FYI A;  1T0K A;  2P0S A;  4UAC A;  4PQJ A;  5JEI A;  1PEB A;  5AE4 A;  3MAM A;  3E4R A;  3T66 A;  2R71 A;  2ONS A;  3OO8 A;  2DXY A;  4GOT A;  4DCY A;  4F39 A;  1KWH A;  1A8E A;  4P0I A;  1POY 1;  2GFE A;  4H0W A;  1A40 A;  3RQT A;  1SBP A;  4XKQ A;  4OTE A;  3O28 A;  5I2N B;  2ZNS A;  4QSE A;  1D4N A;  3TCH A;  2DVC A;  2H9B A;  4PFY A;  3U93 A;  1AH5 A;  4F1U A;  1P1W A;  2XX7 A;  4GF8 A;  1Y20 A;  4OET A;  3OO6 A;  3K6X A;  2QMX A;  3W9W A;  5JTY A;  1IZ1 A;  1IEJ A;  1MXX A;  3GLB A;  2Q8J A;  4EXL A;  1I6Q A;  3FXQ A;  1Y1Z A;  4OWD A;  3T9H B;  4F2O A;  4YKP A;  2GH9 A;  2V3U A;  4C0R A;  2G29 A;  3TAJ A;  4OYV A;  1CE2 A;  2Z8E A;  3H06 B;  1FCK A;  1XHY A;  4N07 A;  1B0L A;  2XXV A;  3GBB A;  1TFD A;  2RCA A;  4FIM A;  4RJZ A;  1UTB A;  1QJM A;  1PC3 A;  3KN7 A;  3FV1 A;  3M3F A;  5HPQ A;  1EZP A;  2PYY A;  1MXZ A;  4BDM A;  2A5T A;  1B5H A;  1ZBM A;  3SEV A;  3RT8 A;  3OD7 A;  3ONM A;  1B3L A;  4N6P A;  1JEU A;  2O7U A;  4FED A;  3E13 X;  4ZED A;  2W7Y A;  5I57 A;  1NNK A;  1EZ9 A;  2R6G E;  5I59 B;  1ANF A;  3PUZ E;  3ZKL A;  2P1S A;  3QIM A;  1GGG A;  3IOU A;  4G4P A;  3O2A A;  3VXC A;  3USD A;  2V3Q A;  4R74 A;  3JV9 A;  1OIB A;  1P1N A;  1BKA A;  2I0C A;  3G7W A;  3H6W A;  2AL4 A;  2H25 A;  3IJO B;  4G8H A;  4LON B;  3LSL A;  1NNF A;  2V3T A;  1US4 A;  1LFG A;  4RK2 A;  3TEP A;  4XIG Q;  1ZTY A;  3JZJ A;  3D4C A;  2RCB A;  4ELR A;  3IB2 A;  3CIJ A;  4H6D A;  4YKK A;  3MBP A;  1JET A;  4EF1 A;  5A5X A;  3R6U A;  5CC2 A;  4TQU Q;  5B70 A;  2Z23 A;  3CSB A;  3QAX A;  4TLL B;  1M5B A;  2XXQ A;  4THI A;  4OXV A;  4E0X A;  4F2Q A;  5ICT A;  2UVG A;  5KCJ B;  3PGF A;  2I58 A;  2IA4 A;  1Q1K A;  4I8C A;  4NF6 B;  5DVI A;  4H5F A;  3A3U A;  5TPA A;  1IIT A;  1Y9U A;  2E0S A;  2HEU A;  2XXT A;  1NH8 A;  4YMA A;  3MZ9 A;  1SW5 A;  3SER A;  1QKB A;  3HHF A;  2HAU A;  3QUJ A;  4ESX A;  4G8N A;  1BLF A;  2XXW A;  4M1V A;  4BDL A;  3H6V A;  4IY5 A;  1B5I A;  3O6H A;  1FQA A;  1FQC A;  1SVX B;  2DOJ A;  3PUV E;  5CM6 A;  2O1L A;  3HCQ A;  4R75 A;  1OQH A;  1M5E A;  3WAF A;  1D9Y A;  2O51 A;  4KFQ A;  3TOD A;  1FW0 A;  1NNP A;  4LP2 B;  4U1Z A;  1TT1 A;  3N94 A;  4XKP A;  5DYH A;  4X9T A;  4IO3 A;  1IXG A;  2DWH A;  2QRY A;  1EZO A;  5TPA B;  2ZXT A;  2ZYK A;  3HPI A;  4NE4 A;  1H43 A;  5DEX A;  4GVO A;  1VFE A;  2YPN A;  1JVY A;  1VSO A;  1ZMG A;  2GRV A;  2NXO A;  3PPO A;  1UIU A;  2Y7P A;  4BDR A;  2V93 A;  4DZ1 A;  4RPN A;  4Q5T A;  3H03 A;  5AA3 A;  1IIW A;  3TTM A;  5A5X B;  3M3L A;  4IO4 A;  1AIV A;  3SEY A;  2G93 A;  1ATG A;  4H65 A;  5BWJ A;  1US5 A;  1Y4C A;  2QJE A;  1ZU0 A;  5L9M A;  2ZNT A;  4FE8 A;  2ZYM A;  2UVI A;  1H76 A;  3IR1 A;  1I69 A;  1ZJL A;  4G68 B;  3VXB A;  4AQ4 A;  4ZE9 A;  3EHS A;  4WKM A;  4OFJ A;  1MY4 A;  4WEP A;  4IGR A;  3K6U A;  1N76 A;  1B2H A;  2DSF A;  2NUV A;  4KD5 A;  3PPN A;  3HST A;  4JSD A;  1M5D A;  2XXH A;  1FTL A;  1FQD A;  3FVO A;  2XX8 A;  2PMS A;  5IAI A;  5TU0 A;  4YMB A;  1PB7 A;  1XOC A;  3IK6 B;  3KOT A;  3T22 A;  2B3B A;  1A54 A;  5AA1 A;  3OSQ A;  3UOR A;  2H4I A;  1P99 A;  3MW0 A;  4OFO A;  3G3J A;  4ZEF A;  1FQB A;  3Q28 A;  4GIZ A;  3G3I A;  4RYA A;  3SEX A;  4IGT A;  1MRP A;  1PBP A;  1R6Z A;  4JB7 A;  1MG1 A;  4OER A;  3RNN A;  2Q89 A;  1FTO A;  1OQG A;  5FTI A;  2Z22 A;  3FVK A;  1USY H;  3K1P A;  4JWO A;  5JK4 A;  1P1U A;  2D21 A;  1B4Z A;  2I6E A;  1DTG A;  1TFA A;  2O68 A;  2ONR A;  3PUX E;  4F31 B;  3B7D A;  3BBR A;  3H6U A;  2XXU A;  5ICQ A;  3KBR A;  3SEW A;  4ZDM A;  2O69 A;  3MWB A;  2NWJ A;  3S4U A;  4LZ8 A;  5CBS A;  4TOZ A;  3N5L A;  1QW0 A;  4YKI A;  1MM7 A;  4GD5 A;  5H8N A;  4GQO A;  1EH3 A;  1SQY A;  3FJG A;  4ESW A;  3UA8 A;  5I2K A;  1XT8 A;  1MPC A;  4DXB A;  3I6V A;  3FXU A;  2DWJ A;  4R6H A;  4RY1 A;  3TMG A;  1QUJ A;  2F7A A;  3K1N A;  3HN0 A;  3IB0 A;  4X48 A;  3OEK A;  5AA4 B;  1IXC A;  4IY6 A;  5H8Q A;  1JNF A;  2REJ A;  2QL3 A;  3FD3 A;  3MVZ A;  3Q27 A;  3V89 B;  1N7X A;  4H8I A;  1ZLQ A;  2LAO A;  1XVX A;  4LVQ A;  1NH7 A;  3SDF A;  2V25 A;  1YCJ A;  4U2R A;  3TPA A;  4LZ5 A;  3DLN A;  3VLV A;  5DT6 A;  1B6H A;  5FHO A;  1JW4 A;  3C31 A;  3F11 A;  5KCJ A;  2RKM A;  4ZEC A;  1QVS A;  3ECR A;  4U21 A;  4I62 A;  3H7M A;  1B58 A;  3T9U A;  4Q0C A;  1DMB A;  2PBW A;  3WAE A;  2F6P A;  2FNC A;  3TTL A;  1SYH A;  2OJT A;  4NTL A;  1IQ7 A;  1SDX A;  3N26 A;  5FHM A;  3U8Q A;  2RC9 A;  4EQ9 A;  2E1S A;  3C35 A;  2QSX A;  3DP6 A;  4R9G A;  4NF8 A;  1USY E;  2HQ0 A;  2F8D A;  3IOW A;  2RC7 A;  3KN8 A;  4RNS A;  1II5 A;  3RTF B;  3H4Z A;  1UTB B;  2M8C A;  2Y7I A;  4KI0 E;  2ZMB A;  3GXA A;  4R2B A;  2X26 A;  5CMC A;  4I1D A;  2THI A;  3QSL A;  4MBP A;  3O9P A;  4KQP A;  1XC1 A;  4EDP A;  3D4G A;  4F29 A;  2HXW A;  2XXX A;  4OES A;  1FTJ A;  4YB6 A;  3TEL A;  3SET A;  3MZ1 A;  1D3K A;  4QRZ A;  4H5G A;  4ZS9 A;  4F18 A;  3MQ9 A;  4ZEK A;  2UVJ A;  2B3F A;  2F6G A;  4KR5 A;  4U4X A;  4ZE8 A;  3TCF A;  3C9H A;  1MQI A;  3LSF B;  5AA2 B;  3MUQ A;  5AA2 A;  4NWD A;  3UGW A;  2R9J A;  5CMM A;  4FEB A;  1BIY A;  1OVT A;  1GR2 A;  1MQG A;  4RA1 A;  1LFI A;  2PVU A;  4QFL A;  3OEM A;  3W15 C;  3PMW A;  1R1N A;  1WDN A;  4GLI A;  4Q8R A;  3S9L C;  1D9V A;  4DIG A;  1LCF A;  1MXY A;  1HSE A;  3CFX A;  1LLS A;  1OMP A;  4K3F A;  3RN8 A;  4F3G A;  2RF1 A;  2H98 A;  4NF6 A;  3GZG A;  1MH3 A;  3CG1 A;  3T9V A;  4QSC A;  2NOO A;  3O97 A;  1MS7 A;  3LUY A;  5F1Q A;  1IUD A;  4ND9 A;  4F3P A;  2O7I A;  2DQV A;  3K4U A;  4MFI A;  1M5C A;  4PET A;  1VR5 A;  3ILT B;  3SEU A;  1R9L A;  3V83 A;  1AL3 A;  5KZT A;  5DEX B;  3MZB A;  1MDQ A;  4FAT A;  2Y7R A;  2VD2 A;  2DE2 A;  1M5F A;  1Y3P A;  1JW1 A;  3FGS A;  1LAG E;  3FJM A;  4OHN A;  1B32 A;  5EYF A;  1Y3Q A;  3CVG A;  1MQD A;  5CI5 A;  5IKB A;  2F35 A;  1ZIU A;  2Q2C A;  3OEN A;  4PFW A;  5I56 A;  2XD2 A;  2DE4 A;  3A3C A;  3V5A A;  1H44 A;  3IJX B;  3S2V A;  2VP1 A;  3JYR A;  3PMX A;  1FQE A;  4JWX A;  4YU0 A;  3RTW B;  3T9X B;  1DOT A;  1HSJ A;  3TUS A;  4ZEI A;  5LOM A;  3K01 A;  3H6T A;  2I49 A;  1PBQ A;  3UIF A;  3SKP A;  4HCY A;  3K00 A;  1FTM A;  4IO2 A;  3TCG A;  3B6W A;  1MPB A;  2YLN A;  4XXU A;  4ELQ A;  3UP9 A;  3KGC A;  4KCD A;  2X7Q A;  1DPP A;  4F1V A;  1I6B A;  5EHM A;  3EHT A;  3LSX A;  4U4S A;  2OCU A;  4LZ7 A;  3I3V A;  4MLV A;  1N84 A;  3KSX A;  2UYE A;  3QUF A;  3MVW A;  5ITP A;  1N7W A;  2B65 A;  3LBS A;  3BFU A;  3OXN A;  1B46 A;  4JSO A;  4KYS A;  1J1N A;  3N6U A;  4WXJ A;  3O66 A;  3KG2 A;  2F78 A;  2ZYN A;  2P2A A;  1NKX A;  2OBG A;  5CMB A;  2HCA A;  4LAT A;  3HV1 A;  2Y84 A;  2Y7W A;  4IB2 A;  4F19 A;  1MXU A;  2D3I A;  3IO6 A;  4XKR A;  3FAS A;  4G68 C;  3U72 A;  5AA2 D;  3G3H A;  3H3G A;  3TTN A;  2VHA A;  2XXI A;  3U92 A;  3OO9 A;  1B51 A;  3E3K A;  3EN3 A;  1MDP 1;  2I4B A;  2QS4 A;  3KEI A;  2IEE A;  1OVB A;  5H8H A;  1S7Y A;  1O64 A;  3O6G A;  4OEN A;  4QFO A;  1IXH A;  1POT A;  1MY1 A;  1Y3N A;  2CZL A;  5HM4 B;  3E9X A;  1ZKB A;  3UN6 A;  4IO6 A;  4QHQ A;  1GVC A;  4NED A;  4ZEB A;  1MY0 A;  3TZA A;  1AMF A;  4LQ5 A;  5H8F A;  3RT6 B;  1NMU A;  2OZZ A;  1B52 A;  2I3V A;  3A09 A;  4PE5 B;  4QFN A;  5K2X A;  4AB6 A;  1B1H A;  4MLQ A;  1F9B A;  1XS5 A;  2BJJ X;  3AXF A;  3CFL A;  3CR9 A;  4P11 A;  3FJ7 A;  4BLA A;  3BFT A;  3RLF E;  5I58 B;  1BTJ A;  2AIX A;  1AOV A;  4FJP A;  1B7H A;  3L6H A;  2F34 A;  3QXM A;  1B3H A;  1MM6 A;  2UYF A;  4YZZ A;  4TLM B;  4GWO A;  5TP9 A;  1B3F A;  4G2Z A;  4EF2 A;  4Q30 B;  2ABH A;  5I57 B;  1Z7M E;  1A7L A;  2Q2A A;  4QFK A;  3W9V A;  1XVY A;  5K2Y A;  2F7C A;  1RYX A;  3KJT A;  5FTH A;  3VLU A;  4EQ7 A;  4FAJ A;  3S9E A;  1YAE A;  4DDD A;  4YKJ A;  1IXI A;  3OOA A;  1MY3 A;  2AL5 A;  3IAZ A;  3B6Q A;  1QUI A;  3MVX A;  3MC2 A;  4KHZ E;  4NF5 A;  1BP5 A;  3K6V A;  2H5Y A;  3TTR A;  4AB5 A;  1RKM A;  4R2F A;  5EHS A;  4C1T A;  3OSR A;  3PUY E;  1SD3 A;  3VVF A;  1URS A;  4DXU A;  3FVG A;  4ELO A;  1B40 A;  2XHD A;  4RXL A;  3DEL B;  3FXR A;  1LB9 A;  1NFT A;  1URG A;  3MP6 A;  3OO7 A;  4LQ2 A;  2VGQ A;  1Y4T A;  2XXY A;  4NF8 B;  4POW A;  4WED A;  4R73 A;  4O3C A;  4PFU A;  4YB5 A;  4GL8 A;  3DP8 A;  1HSL A;  1JQF A;  2ANJ A;  3PPR A;  4JWY A;  2DVZ A;  2DYX A;  3UK4 A;  4L17 A;  3ZSF A;  4DLD A;  5CBR A;  2RC8 A;  4BDO A;  1QKA A;  1TXF A;  4EQB A;  4JBZ A;  4QSD A;  3OMB A;  4IO5 A;  2KLF A;  1YTV A;  3RUM A;  3S9N C;  3FVN A;  1MQJ A;  1PDA A;  1LFH A;  2CMO A;  2UXA A;  1FQF A;  3EF7 A;  3MPK A;  1CB6 A;  3P7I A;  1EU8 A;  2RIN A;  3IOV A;  4H1X A;  4NF4 B;  3CRB A;  4NF5 B;  3PD9 A;  4ZZA A;  3U1O A;  3VDF A;  4U23 A;  1Q35 A;  5B7D A;  4DXC A;  5L9S A;  4JXI A;  3EQ1 A;  3KFM A;  1LBC A;  3KSJ A;  1MH4 A;  3G3K A;  2A5S A;  1B5J A;  1MQH A;  2QS3 A;  3KN3 A;  4I9D A;  1RYO A;  1N0T A;  1JW5 A;  3Q26 A;  3O6I A;  3L6G A;  2Y7K A;  4NWC A;  2GHA A;  1I6A A;  4F3S A;  2DS9 A;  1A99 A;  4MH5 A;  4OEU A;  4LUB A;  3HHG A;  3DP4 A;  4QFP A;  4BDN A;  3B6T A;  3PU5 A;  3LR1 A;  4N13 A;  3EPE A;  3TTK A;  3KZG A;  1LAH E;  4F1Y A;  1H45 A;  3C34 A;  2O1M A;  4OVJ A;  2HFB A;  1QUL A;  5DTB A;  4RPO A;  2ALU A;  4F3B A;  4M4G A;  4P0G A;  3TYH A;  3VVE A;  3MJN A;  4YAH X;  4DE8 A;  3CFZ A;  5H8S A;  4YB7 A;  5ELV A;  1B0H A;  4H67 A;  1YPN A;  3R7X A;  4E0W A;  3M3K A;  4EUO A;  1B9J A;  3THI A;  1P1Q A;  5M2V A;  3G3G A; 
#chains in the Genus database with same CATH topology
 1SW2 A;  1NUY A;  2QMW A;  5H8H B;  2YJP A;  5JTY B;  4XTC Q;  2HZK A;  4PDH A;  1A55 A;  4QBA A;  2H99 A;  3C36 A;  5L9O A;  1B7U A;  3TQL A;  1IMD A;  4HTG A;  2DWI A;  3KOS A;  3GBA A;  2I4C A;  1FPF A;  1N3W A;  1PB8 A;  3O29 A;  4Z0I A;  4OFL A;  3SKP A;  2O6A A;  4KYD A;  3IB1 A;  2KR0 A;  4LA9 A;  5I59 A;  3VE1 B;  2QPQ A;  1TWY A;  1SW1 A;  1PB9 A;  5BUU A;  4KPT A;  1UTH A;  2PT2 A;  4OZ9 A;  3LC8 A;  3C32 A;  1B4H A;  3HO7 A;  5H8F B;  3DM0 A;  1LGB C;  4U22 A;  1WOD A;  3TKD A;  1MPD A;  5DW8 A;  4RK9 A;  4ISU A;  1Z7N E;  1LCT A;  3IOT A;  4GWW A;  4GXS B;  1VE4 A;  4QF9 A;  1FBC A;  1B3E A;  2FIE A;  3CSG A;  2QS2 A;  4OMB A;  1URD A;  4OQO A;  2DWA A;  5H8Q B;  3VLW A;  1MY2 A;  1K9Z A;  1DTZ A;  2ZNU A;  4KXP A;  2XX9 A;  5I2K B;  1O63 A;  1JEV A;  3M8U A;  3PPP A;  1LBW A;  1GV8 A;  1SI0 A;  4ELP A;  3EHU A;  2GHB A;  3K2D A;  3IOR A;  1LBB A;  2HZL A;  4GXA A;  1T0K A;  2P0S A;  4PQJ A;  4PBH A;  3T66 A;  2ONS A;  4F39 A;  1KWH A;  4P0I A;  4XKQ A;  4QSE A;  3TCH A;  1AH5 A;  2XX7 A;  1QGX A;  2QMX A;  1IEJ A;  1MXX A;  3GLB A;  4YKP A;  2V3U A;  4OYV A;  3GBB A;  1TFD A;  3CHG A;  1ZBM A;  3OD7 A;  1B3L A;  4N15 A;  4O7M A;  3NOH A;  4ZED A;  2W7Y A;  5I57 A;  1LBY A;  2Q8M A;  5I59 B;  1NV7 A;  3ZKL A;  2P1S A;  1GGG A;  4G4P A;  1EYJ A;  3VXC A;  4PGP A;  2V3Q A;  1BKA A;  1Q9D A;  2AL4 A;  5EQ7 A;  1ZTY A;  3JZJ A;  3D4C A;  4ELR A;  3LV0 A;  1VDW A;  3IB2 A;  4H6D A;  4EF1 A;  3R6U A;  4TQU Q;  3CSB A;  1DCU A;  1M5B A;  4E0X A;  2IA4 A;  4NF6 B;  3A3U A;  2E0S A;  2HEU A;  3MZ9 A;  3SER A;  4G8N A;  2XXW A;  4M1V A;  2FBP A;  1FQC A;  2DOJ A;  5CM6 A;  4LP2 B;  4NHB A;  3N94 A;  1KA0 A;  5DYH A;  4MMP A;  2DWH A;  2ZYK A;  1H43 A;  1FBF A;  2P3V A;  1JVY A;  1VSO A;  1ZMG A;  2F3D A;  2Y7P A;  5AA3 A;  4N91 A;  3H03 A;  4N8G A;  5A5X B;  1NV2 A;  4H65 A;  5BWJ A;  4GWS A;  5L9M A;  2ZYM A;  4AQ4 A;  3EHS A;  1NUZ A;  4IGR A;  3K6U A;  1N76 A;  1B2H A;  3FVO A;  2PMS A;  4YMB A;  1XOC A;  3IK6 B;  3T22 A;  5AA1 A;  3MW0 A;  4P8B A;  4NN3 A;  4GIZ A;  3SEX A;  1R6Z A;  4JB7 A;  4OER A;  5FTI A;  2Z22 A;  1USY H;  4JWO A;  1P1U A;  1B4Z A;  2ONR A;  1TFA A;  3H6U A;  4LZ8 A;  5CBS A;  4TOZ A;  4JVD A;  4GWX A;  1MPC A;  4DXB A;  4R6H A;  4X48 A;  5AA4 B;  4IY6 A;  2V25 A;  4LZ5 A;  1QVS A;  4U21 A;  3T9U A;  4Q0C A;  1DMB A;  3A29 A;  2OJT A;  2RC9 A;  2QSX A;  1USY E;  2HQ0 A;  4RNS A;  1II5 A;  5JEI A;  3GXA A;  4R2B A;  2X26 A;  4KQP A;  1FTJ A;  4ZEK A;  2UVJ A;  4KR5 A;  4ZE8 A;  4GWU A;  4OAN A;  1D9V A;  4DIG A;  1MXY A;  3CFX A;  1OMP A;  2B4M A;  2RF1 A;  4NF6 A;  3CG1 A;  4QSC A;  4PET A;  1AL3 A;  5KZT A;  5DEX B;  1MDQ A;  3FGS A;  5EYF A;  1B32 A;  1MQD A;  5CI5 A;  4P3L A;  5I56 A;  3IJX B;  3JYR A;  3PMX A;  1FQE A;  2FIX A;  3TUS A;  2I49 A;  1LBV A;  2OX3 A;  1FTM A;  5IZ3 A;  4KCD A;  4F1V A;  4U4S A;  3E78 A;  3I3V A;  3MVW A;  3BFU A;  4KYS A;  4WXJ A;  3O66 A;  3KG2 A;  2ZYN A;  2P2A A;  1NKX A;  5CMB A;  2HCA A;  2Y7W A;  4IB2 A;  3G3H A;  2VHA A;  3OO9 A;  3B8B A;  1MDP 1;  2I4B A;  1S7Y A;  4OEN A;  5HM4 B;  3UN6 A;  1NMU A;  4AB6 A;  3RLF E;  4QXD A;  3L6H A;  1MM6 A;  2PCR A;  4MJO A;  3W9V A;  5FTH A;  4YKJ A;  1IXI A;  3B6Q A;  3TTR A;  4AB5 A;  2H5Y A;  4R2F A;  4C1T A;  3PUY E;  1SD3 A;  3FVG A;  3V8X B;  3OO7 A;  4WED A;  1RDZ A;  4GL8 A;  4XF5 A;  2ANJ A;  2DVZ A;  2DYX A;  1TXF A;  3OMB A;  2KLF A;  3MPK A;  1FPK A;  2XWK A;  3IOV A;  4NX1 A;  2FVZ A;  3VDF A;  4DXC A;  4X8R A;  2CZK A;  3EQ1 A;  3KFM A;  3G3K A;  1B5J A;  3KN3 A;  1RYO A;  3B50 A;  3Q26 A;  3O6I A;  4LUB A;  3PU5 A;  2VT5 A;  3TTK A;  1LAH E;  4GBW A;  2ALU A;  4PDD A;  4YAH X;  5H8S A;  4YB7 A;  2OWZ A;  4H67 A;  3R7X A;  4KHZ E;  1FTA A;  4N81 A;  4YMA A;  1P1Q A;  4EXL A;  2PFY A;  4N8Y A;  4NGU A;  3QMF A;  4DCX A;  3FIR A;  1H3D A;  1ELJ A;  2PT1 A;  5FHN A;  2Z8D A;  3FUZ A;  4JDF A;  3TDJ A;  1DSN A;  1UQW A;  1P1O A;  3IO4 A;  4OVR A;  4OA4 A;  2OK2 A;  4G77 A;  2NVU B;  2XD3 A;  2ONK E;  5ISU A;  5J1D A;  4GRK A;  1O7T A;  4POX A;  4KCC A;  2WBB A;  3R26 A;  2PX1 A;  2A5T B;  3SES A;  5I2N A;  4IR8 A;  4HS7 A;  1R9Q A;  2I48 A;  1Y1M A;  4BDQ A;  3VV5 A;  3PV0 E;  2ESN A;  2I3W A;  2FHY A;  3PUW E;  3K1M A;  5IZ3 B;  5KDT B;  3GYY A;  3PMV A;  2WKY A;  2UVH A;  3KJ7 A;  2Q88 A;  2QVR A;  3TFL A;  4R72 A;  3IFC A;  1FBE A;  1LB8 A;  3MVY A;  4F22 A;  3Q25 A;  2OLB A;  1G0H A;  3PPQ A;  1B05 A;  2P3N A;  5DVF A;  1N04 A;  4JVC A;  4FAJ A;  5EYH A;  3C33 A;  4HCW A;  2VPN A;  1A8E A;  5F24 A;  1POY 1;  1SBP A;  4OTE A;  3O28 A;  1D4N A;  2H9B A;  3U93 A;  1Y20 A;  3OO6 A;  5JTY A;  1IZ1 A;  5LTC A;  4PGN A;  1XI6 A;  4MHF A;  3TAJ A;  2Z8E A;  1FCK A;  4N07 A;  1B0L A;  1NV3 A;  3SZP A;  1UTB A;  1QJM A;  3M3F A;  1B5H A;  3SEV A;  3ONM A;  3T0J A;  1JEU A;  4FED A;  3USD A;  4R74 A;  3JV9 A;  1OIB A;  1P1N A;  3G7W A;  2H25 A;  3LSL A;  1NNF A;  3ISP A;  1FJ9 A;  1US4 A;  1LFG A;  4RK2 A;  2Z23 A;  4TLL B;  2XXQ A;  5ICT A;  2UVG A;  5KCJ B;  1Q1K A;  5DVI A;  1IIT A;  1Y9U A;  1NH8 A;  1SW5 A;  1FBG A;  2VPO A;  4BDL A;  3H6V A;  1SVX B;  3PUV E;  3HCQ A;  1OQH A;  3WAF A;  4AS5 A;  1D9Y A;  1FW0 A;  1NNP A;  4XKP A;  1EZO A;  5IZZ A;  2ZXT A;  3HPI A;  5DEX A;  2YPN A;  2CEY A;  1UIU A;  4DZ1 A;  4BDR A;  2V93 A;  4I3E A;  4RPN A;  2V4C A;  3TTM A;  1AIV A;  4PTK A;  2G93 A;  1US5 A;  1Y4C A;  2QJE A;  4FE8 A;  3FBP A;  1ZJL A;  3LUZ A;  2NUV A;  3PPN A;  3HST A;  1M5D A;  2XXH A;  1FTL A;  1FQD A;  2WBD A;  5IM2 A;  1PB7 A;  1A54 A;  3G3J A;  3G3I A;  4RYA A;  1MRP A;  3RPL B;  1MG1 A;  4NAP A;  3B7D A;  3BBR A;  5ICQ A;  4I3Y A;  4ZDM A;  2NWJ A;  3S4U A;  1MM7 A;  3KBZ A;  4GQO A;  4MCO A;  3FJG A;  4ESW A;  3I6V A;  2F7A A;  3K1N A;  1INP A;  3HN0 A;  1IXC A;  4MNC A;  3FD3 A;  1N7X A;  1NH7 A;  2XWI A;  3SDF A;  3TPA A;  1B6H A;  3F11 A;  2RKM A;  4ZEC A;  1B58 A;  4NTL A;  1IQ7 A;  5FHM A;  3DP6 A;  2ZMB A;  1AWB A;  3O9P A;  4EDP A;  4YB6 A;  1NV1 A;  2F3B A;  4ZS9 A;  4F18 A;  1LBZ A;  3C9H A;  3HFU A;  3MUQ A;  5AA2 A;  4NWD A;  3UGW A;  4FEB A;  1BIY A;  1OVT A;  1GR2 A;  1FPL A;  3W15 C;  3OEM A;  1R1N A;  4GLI A;  3S9L C;  4HE1 A;  3T9V A;  3O97 A;  4JVI A;  4ND9 A;  3K4U A;  1M5C A;  1VR5 A;  3V83 A;  3KC1 A;  2DE2 A;  4OHN A;  1Y3Q A;  1H44 A;  3S2V A;  4JWX A;  3T9X B;  1DOT A;  1PBQ A;  3LSX A;  2OCU A;  4PCD A;  4MLV A;  3KSX A;  3QUF A;  1YXI A;  1J1N A;  3N6U A;  4XEQ A;  2OBG A;  2WYK A;  4LAT A;  3HV1 A;  2Y84 A;  4F19 A;  2D3I A;  5A5L A;  3IO6 A;  3U72 A;  4G68 C;  1DBZ A;  4NF0 A;  1B51 A;  3E3K A;  3KEI A;  2IEE A;  5H8H A;  2CZL A;  1ZKB A;  4IO6 A;  1GVC A;  1MY0 A;  1AMF A;  5H8F A;  3CFL A;  1XS5 A;  3AXF A;  4BLA A;  3CR9 A;  3BFT A;  5I58 B;  4GX3 A;  4FJP A;  4O8M A;  5IGA A;  3QXM A;  4TLM B;  4Q30 B;  1K9Y A;  2ABH A;  5I57 B;  1Z7M E;  1A7L A;  2Q2A A;  5K2Y A;  3VLU A;  3KJT A;  3S9E A;  2AL5 A;  3MVX A;  3K6V A;  3RYD A;  3VVF A;  1B40 A;  4RXL A;  3MP6 A;  3T1B A;  1LB9 A;  2QFL A;  1Y4T A;  2L5V A;  2VGQ A;  4R73 A;  1IMB A;  4YB5 A;  1BK4 A;  4FBP A;  4JWY A;  4DLD A;  3ZSF A;  4L17 A;  1QKA A;  3RUM A;  1MQJ A;  2CEX A;  4H1X A;  1EU8 A;  1SPI A;  2RIN A;  4ZZA A;  3PD9 A;  5L9S A;  4JXI A;  5I2K A;  1N0T A;  3L6G A;  1I6A A;  3FXB A;  3DP4 A;  4F1Y A;  2O1M A;  2HFB A;  1QUL A;  5DTB A;  4RPO A;  3MJN A;  2XXK A;  3CFZ A;  4PBQ A;  4EUO A;  1B9J A;  3G3G A;  3ILU B;  5ITO A;  3C4M A;  4ECF A;  1B1X A;  3S9M C;  1NV5 A;  1MXV A;  2F36 A;  2XA5 A;  4GL0 A;  1FBP A;  2DE3 A;  4GFR A;  3IL1 B;  5HBC A;  4O3A A;  1LAX A;  2Z8F A;  5H8N B;  3MP8 A;  5TP9 B;  5I84 A;  4O94 A;  4OEV A;  4NQ8 A;  2OWS A;  4G61 A;  4ZZE A;  1OLA A;  4XFE A;  1UTH B;  3RY3 A;  4IO7 A;  2VD3 A;  4EXK A;  3MPL A;  1IMC A;  1FTK A;  4U1O A;  1N3X A;  1WVJ A;  1OLC A;  4OVQ A;  3CI8 A;  2O84 X;  3T93 B;  4G68 A;  3BKI B;  3N6T A;  1S50 A;  1FRP A;  5F7V A;  1L5T A;  5L8D A;  2I0B A;  4UA8 A;  2Q9T A;  2F7B A;  4PFT A;  4HW8 A;  1SYI A;  4O3B A;  3ODB A;  3QK6 A;  3TQW A;  3FV2 A;  2F97 A;  4ONY A;  3G3F A;  1SI1 A;  3MP1 A;  2Y5L A;  4G8M A;  3RPW A;  3QYT A;  3ZKK A;  4R6Y A;  1B7Z A;  2FYI A;  4UAC A;  4AS4 A;  1PEB A;  5AE4 A;  3MAM A;  3OO8 A;  4GOT A;  2GFE A;  5I2N B;  4GF8 A;  3FXQ A;  1Y1Z A;  3T9H B;  4F2O A;  2G29 A;  1XHY A;  2XXV A;  4RJZ A;  1PC3 A;  3FV1 A;  5HPQ A;  2PYY A;  1MXZ A;  4P1L A;  4N6P A;  2O7U A;  1EZ9 A;  4N4U A;  3IOU A;  5ET8 A;  5ET5 A;  3H6W A;  2I0C A;  5KDT A;  4XIG Q;  3CIJ A;  5A5X A;  1JET A;  5CC2 A;  5B70 A;  3QAX A;  4F2Q A;  4OXV A;  5FBP A;  3PGF A;  2I58 A;  5TPA A;  4OVS A;  1QKB A;  3QUJ A;  4ESX A;  2QVU A;  4MAG A;  1B5I A;  2QVV A;  4MIJ A;  1FQA A;  2O1L A;  4R75 A;  2O51 A;  4U1Z A;  4IO3 A;  1IXG A;  2Y5K A;  4NE4 A;  3EKI A;  4GVO A;  2GRV A;  4Q5T A;  4NG7 A;  4P1E A;  1ATG A;  2ZNT A;  2UVI A;  1H76 A;  3IR1 A;  1I69 A;  4ZE9 A;  1MY4 A;  2DSF A;  4KD5 A;  2XX8 A;  5TU0 A;  2ZZW A;  3OSQ A;  4OFO A;  4ZEF A;  1FQB A;  3Q28 A;  2Q89 A;  1FTO A;  3FVK A;  5JK4 A;  2WEF A;  2D21 A;  2I6E A;  4F31 B;  2XXU A;  4P56 A;  3KBR A;  4PF6 A;  1QW0 A;  4YKI A;  4GD5 A;  5H8N A;  1EH3 A;  1SQY A;  3UA8 A;  3RPL A;  4OVP A;  2DWJ A;  4RY1 A;  1JP4 A;  4PFR A;  2REJ A;  2QL3 A;  3MVZ A;  3V89 B;  4H8I A;  1ZLQ A;  2LAO A;  1YCJ A;  4U2R A;  3VLV A;  3DLN A;  5DT6 A;  3C31 A;  3ECR A;  2PBW A;  3WAE A;  2F6P A;  1SYH A;  3U8Q A;  1SDX A;  4EQ9 A;  2F8D A;  2RC7 A;  3KN8 A;  3RTF B;  3H4Z A;  4KI0 E;  2M8C A;  2Y7I A;  5CMC A;  2THI A;  4F29 A;  2R8T A;  1XC1 A;  4OES A;  3TEL A;  3MZ1 A;  1D3K A;  1KA1 A;  4H5G A;  2B3F A;  4U4X A;  2XWV A;  1MQI A;  2R9J A;  4HE2 A;  4RA1 A;  1FBD A;  1LFI A;  4QFL A;  3PMW A;  3GZG A;  5ET7 A;  2WX9 A;  4N6K A;  1MS7 A;  3LUY A;  1IUD A;  4F3P A;  3SEU A;  3MZB A;  2Y7R A;  1M5F A;  2F35 A;  3BIG A;  3OEN A;  3A3C A;  2GQ1 A;  4YU0 A;  3RTW B;  4ZEI A;  5LOM A;  3K01 A;  3H6T A;  4H46 A;  3UIF A;  3K00 A;  1NUX A;  2ZZV A;  3TCG A;  3KGC A;  1DPP A;  4O7I A;  2UYE A;  5ITP A;  1B46 A;  2F78 A;  2KQZ A;  1FPD A;  1D9Q A;  4XKR A;  1NV0 A;  3TTN A;  2XXI A;  3U92 A;  3EN3 A;  4PFI A;  1OVB A;  1O64 A;  3O6G A;  1IXH A;  2B4L A;  3E9X A;  4MEV A;  1EYI A;  2BJI A;  4HE0 A;  3TZA A;  2I3V A;  3A09 A;  4PE5 B;  5K2X A;  1B1H A;  5ET6 A;  1BTJ A;  2AIX A;  1AOV A;  4PF8 A;  4X04 A;  4YZZ A;  4GWO A;  5TP9 A;  1B3F A;  4PC9 A;  4EQ7 A;  1XVY A;  2F7C A;  1YAE A;  4NF5 A;  4N17 A;  1URS A;  3FXR A;  4LQ2 A;  1NFT A;  1NI9 A;  2XXY A;  4O3C A;  1HSL A;  3PPR A;  1IMF A;  3UK4 A;  2RC8 A;  4EQB A;  4JBZ A;  4IO5 A;  5EYG A;  3FVN A;  3S9N C;  1LFH A;  2CMO A;  2UXA A;  1FQF A;  4QRZ A;  4NF4 B;  3EF7 A;  4Z7E A;  3U1O A;  1Q35 A;  4GWZ A;  4LVQ A;  2A5S A;  4MX6 A;  1MQH A;  4I9D A;  1IME A;  4NWC A;  1NV4 A;  2GHA A;  3HHG A;  4QFP A;  4BDN A;  3B6T A;  3KZG A;  1H45 A;  3ROJ A;  1YYZ A;  4GX4 A;  4P0G A;  3KC0 A;  3TYH A;  1CNQ A;  1YPN A;  3M3K A;  5M2V A;  3I5O A;  3LSW A;  3D1R A;  3PD8 A;  3K02 A;  4X1B A;  3FZV A;  2HXR A;  5I56 B;  2OWT A;  1JVX A;  3PTY A;  4FEC A;  2DP8 A;  1A8F A;  4NF4 A;  2FA7 A;  4MF3 A;  1RDX A;  3FAT A;  1EYK A;  2REG A;  3BIH A;  3K0V A;  1SW4 A;  1VFD A;  3U94 A;  5CMK A;  3VFJ A;  3ZS6 A;  2ZYO A;  4PAF A;  2F5X A;  2V84 A;  1S9T A;  1MXW A;  3CG3 A;  4I40 A;  4YIC A;  1LAF E;  4H8J A;  2DXR A;  4PE3 A;  4XKN A;  3K6W A;  2QS1 A;  5ESY A;  5EQA A;  4P9K A;  5AA4 A;  4NMY A;  3VVD A;  4R6K A;  3Q29 A;  1LBX A;  1FPI A;  1NL5 A;  2XXR A;  4LN5 A;  3IX1 A;  2D5W A;  1QUK A;  5EQ9 A;  4P47 A;  3OEL A;  4R9F A;  1GTK A;  2VOZ A;  4PP0 A;  4X1D A;  4FOR A;  1B3G A;  1UIV A;  4C1U A;  1DPE A;  1YZ0 A;  2HPG A;  4H45 A;  3T96 B;  5I58 A;  4KYE A;  5CRY A;  1NNT A;  2HAV A;  2AYS A;  3RGY A;  1LST A;  5DVJ A;  2XXP A;  2X7P A;  3E4R A;  2R71 A;  4N6D A;  2DXY A;  4DCY A;  4H0W A;  1A40 A;  3RQT A;  4MNP A;  2ZNS A;  2DVC A;  4PFY A;  2ZZX A;  4F1U A;  1P1W A;  4OET A;  3K6X A;  3W9W A;  2Q8J A;  1I6Q A;  4OWD A;  2GH9 A;  4C0R A;  2XWO A;  1CE2 A;  1NV6 A;  5J16 A;  3H06 B;  2RCA A;  4FIM A;  3KN7 A;  1EZP A;  1FPE A;  4BDM A;  2A5T A;  3RT8 A;  3E13 X;  1NNK A;  2R6G E;  4OVT A;  1ANF A;  3PUZ E;  3QIM A;  3O2A A;  3IFA A;  3IJO B;  4G8H A;  4LON B;  2V3T A;  3TEP A;  2RCB A;  4YKK A;  3MBP A;  4THI A;  4I8C A;  4H5F A;  2XXT A;  3HHF A;  2HAU A;  4GWY A;  1BLF A;  4IY5 A;  3O6H A;  1M5E A;  2CZH A;  4KFQ A;  3TOD A;  1TT1 A;  4X9T A;  2QRY A;  5TPA B;  4PAK A;  1FPG A;  1VFE A;  2NXO A;  1FSA A;  3PPO A;  1FBH A;  2PFZ A;  1IIW A;  4DI3 D;  3M3L A;  4IO4 A;  3SEY A;  1ZU0 A;  3VXB A;  4G68 B;  5LDZ A;  4WKM A;  4OFJ A;  4WEP A;  5EHS A;  4JSD A;  2HHM A;  1FPJ A;  5IAI A;  3KOT A;  2B3B A;  3UOR A;  2H4I A;  1P99 A;  4GBV A;  4IGT A;  1PBP A;  3RNN A;  1OQG A;  3K1P A;  1DTG A;  3PUX E;  2O68 A;  4MNI A;  3SEW A;  3U65 A;  2O69 A;  3MWB A;  3N5L A;  1XT8 A;  3FXU A;  3TMG A;  1QUJ A;  3IB0 A;  3OEK A;  5H8Q A;  1JNF A;  3Q27 A;  4GX6 A;  2Q74 A;  1XVX A;  5FHO A;  1JW4 A;  5KCJ A;  4I62 A;  3H7M A;  2FNC A;  3TTL A;  3N26 A;  2E1S A;  3C35 A;  4R9G A;  4NF8 A;  3IOW A;  1UTB B;  4I1D A;  3QSL A;  4MBP A;  3D4G A;  2HXW A;  2XXX A;  3SET A;  3MQ9 A;  2F6G A;  3TCF A;  5AA2 B;  3LSF B;  5CMM A;  1LEV A;  1MQG A;  2PVU A;  1FPB A;  1WDN A;  4Q8R A;  1LCF A;  1HSE A;  1LLS A;  4F3G A;  4K3F A;  3RN8 A;  4UAB A;  2H98 A;  3MYU A;  1MH3 A;  2JJK A;  2NOO A;  5F1Q A;  2O7I A;  2DQV A;  4MFI A;  3ILT B;  1R9L A;  4FAT A;  5I5P A;  4POW A;  2VD2 A;  1Y3P A;  1JW1 A;  1LAG E;  3FJM A;  3CVG A;  5IKB A;  1ZIU A;  2Q2C A;  4PFW A;  2XD2 A;  2DE4 A;  3V5A A;  2VP1 A;  5IZ1 A;  1HSJ A;  4HCY A;  4IO2 A;  3B6W A;  1MPB A;  2YLN A;  4XXU A;  4ELQ A;  3UP9 A;  5EQ8 A;  2X7Q A;  1KZ8 A;  1I6B A;  5EHM A;  3EHT A;  1G0I A;  4LZ7 A;  5I7I A;  1N84 A;  1N7W A;  2B65 A;  3LBS A;  1RDY A;  3OXN A;  4JSO A;  3E79 A;  4PFB A;  2MKZ A;  4PAI A;  1MXU A;  3FAS A;  5AA2 D;  3H3G A;  2QS4 A;  4QFO A;  1POT A;  1MY1 A;  1Y3N A;  5T3J A;  4QHQ A;  4NED A;  4ZEB A;  4LQ5 A;  3RT6 B;  2OZZ A;  1B52 A;  4QFN A;  4DI4 B;  4MLQ A;  1F9B A;  2BJJ X;  4P11 A;  3FJ7 A;  1DK4 A;  4HXV A;  1B7H A;  5I3S A;  2F34 A;  1B3H A;  2UYF A;  4G2Z A;  4EF2 A;  4QFK A;  1RYX A;  4DDD A;  3OOA A;  1IMA A;  1MY3 A;  3IAZ A;  1QUI A;  2WYP A;  3MC2 A;  1BP5 A;  1RKM A;  3OSR A;  1NUW A;  4F3B A;  4ELO A;  4DXU A;  2XHD A;  3DEL B;  1URG A;  1FJ6 A;  4NF8 B;  4PFU A;  2DDK A;  3DP8 A;  1JQF A;  5CBR A;  4BDO A;  4QSD A;  1YTV A;  1PDA A;  3P7I A;  1CB6 A;  2CZI A;  4NF5 B;  3CRB A;  5B7D A;  4U23 A;  3KSJ A;  1LBC A;  1MH4 A;  2QS3 A;  1JW5 A;  2Y7K A;  4F3S A;  2DS9 A;  1A99 A;  4MH5 A;  4OEU A;  3LR1 A;  4N13 A;  3EPE A;  3C34 A;  4OVJ A;  3MST A;  4M4G A;  3VVE A;  4DE8 A;  5ELV A;  1B0H A;  4E0W A;  3THI A; 
#chains in the Genus database with same CATH homology
 3ILU B;  1SW2 A;  5ITO A;  3LSW A;  3C4M A;  3PD8 A;  3K02 A;  2QMW A;  4X1B A;  4DCX A;  5H8H B;  3FIR A;  3FZV A;  4ECF A;  1H3D A;  1B1X A;  2YJP A;  5JTY B;  4XTC Q;  2HZK A;  4Z7E A;  5I56 B;  2OWT A;  3S9M C;  1MXV A;  1JVX A;  4FEC A;  2F36 A;  4GL0 A;  1A55 A;  2DE3 A;  1ELJ A;  2DP8 A;  2H99 A;  2PT1 A;  1A8F A;  3C36 A;  4GFR A;  5FHN A;  4NF4 A;  3IL1 B;  5HBC A;  5L9O A;  1B7U A;  2FA7 A;  4MF3 A;  4O3A A;  1LAX A;  2Z8D A;  2Z8F A;  3FAT A;  5H8N B;  3TQL A;  3MP8 A;  2REG A;  5TP9 B;  5I84 A;  4HTG A;  3FUZ A;  1SW4 A;  1VFD A;  2DWI A;  3GBA A;  3K0V A;  2I4C A;  3KOS A;  4JDF A;  3TDJ A;  1DSN A;  1UQW A;  3U94 A;  1P1O A;  1N3W A;  5CMK A;  3IO4 A;  3VFJ A;  2ZYO A;  3ZS6 A;  1PB8 A;  2F5X A;  4OEV A;  3O29 A;  5KDT A;  2V84 A;  4Z0I A;  2OK2 A;  4G77 A;  1S9T A;  4OFL A;  2OWS A;  1MXW A;  2O6A A;  2XD3 A;  2NVU B;  3CG3 A;  2ONK E;  4KYD A;  3IB1 A;  4ZZE A;  4YIC A;  1LAF E;  1OLA A;  4H8J A;  5ISU A;  4LA9 A;  5J1D A;  2DXR A;  3I5O A;  3VE1 B;  2QPQ A;  1TWY A;  5I59 A;  1SW1 A;  1UTH B;  4GRK A;  4IO7 A;  3RY3 A;  4XKN A;  2VD3 A;  4EXK A;  3K6W A;  1PB9 A;  1O7T A;  3MPL A;  1FTK A;  4U1O A;  4POX A;  5BUU A;  4KCC A;  2QS1 A;  4KPT A;  1N3X A;  1UTH A;  1WVJ A;  2PT2 A;  1OLC A;  3R26 A;  2PX1 A;  2A5T B;  3CI8 A;  3SES A;  5I2N A;  4HS7 A;  4OZ9 A;  2O84 X;  3T93 B;  4G68 A;  3BKI B;  5AA4 A;  1R9Q A;  3LC8 A;  3N6T A;  1S50 A;  1B4H A;  3C32 A;  2I48 A;  1Y1M A;  4NMY A;  5F7V A;  1L5T A;  4BDQ A;  3HO7 A;  5L8D A;  5H8F B;  2I0B A;  1LGB C;  3DM0 A;  1WOD A;  4U22 A;  4UA8 A;  2Q9T A;  3VVD A;  2F7B A;  4PFT A;  3TKD A;  1MPD A;  3VV5 A;  4HW8 A;  4RK9 A;  4ISU A;  1Z7N E;  4R6K A;  3PV0 E;  3Q29 A;  1SYI A;  1LCT A;  3IOT A;  2ESN A;  4O3B A;  1NL5 A;  2I3W A;  3ODB A;  2XXR A;  3QK6 A;  3V8X B;  4GXS B;  1VE4 A;  3TQW A;  4QF9 A;  3FV2 A;  2F97 A;  3PUW E;  3K1M A;  1B3E A;  3IX1 A;  5KDT B;  3CSG A;  2D5W A;  1QUK A;  2QS2 A;  4OMB A;  1URD A;  4OQO A;  2DWA A;  5H8Q B;  4ONY A;  3VLW A;  3PMV A;  1MY2 A;  3G3F A;  1SI1 A;  3OEL A;  1DTZ A;  3MP1 A;  4R9F A;  1GTK A;  2WKY A;  2UVH A;  3KJ7 A;  4G8M A;  2Q88 A;  2VOZ A;  2ZNU A;  4PP0 A;  4X1D A;  4FOR A;  4R72 A;  3RPW A;  3TFL A;  2XX9 A;  1B3G A;  1UIV A;  1LB8 A;  5I2K B;  1O63 A;  1JEV A;  3M8U A;  3PPP A;  4C1U A;  3MVY A;  1DPE A;  4F22 A;  1GV8 A;  1SI0 A;  3Q25 A;  2OLB A;  3T96 B;  3QYT A;  5I58 A;  4ELP A;  3EHU A;  2GHB A;  4KYE A;  3ZKK A;  3K2D A;  3IOR A;  3PPQ A;  1B05 A;  4R6Y A;  5DVF A;  1N04 A;  1B7Z A;  1NNT A;  5CRY A;  2HAV A;  1LBB A;  2AYS A;  1LST A;  2HZL A;  2XXP A;  5DVJ A;  2X7P A;  3C33 A;  4HCW A;  3RGY A;  4GXA A;  2FYI A;  1T0K A;  2P0S A;  4UAC A;  4PQJ A;  5JEI A;  1PEB A;  5AE4 A;  3MAM A;  3E4R A;  3T66 A;  2R71 A;  2ONS A;  3OO8 A;  2DXY A;  4GOT A;  4DCY A;  4F39 A;  1KWH A;  1A8E A;  4P0I A;  1POY 1;  2GFE A;  4H0W A;  1A40 A;  3RQT A;  1SBP A;  4XKQ A;  4OTE A;  3O28 A;  5I2N B;  2ZNS A;  4QSE A;  1D4N A;  3TCH A;  2DVC A;  2H9B A;  4PFY A;  3U93 A;  1AH5 A;  4F1U A;  1P1W A;  2XX7 A;  4GF8 A;  1Y20 A;  4OET A;  3OO6 A;  3K6X A;  2QMX A;  3W9W A;  5JTY A;  1IZ1 A;  1IEJ A;  1MXX A;  3GLB A;  2Q8J A;  4EXL A;  1I6Q A;  3FXQ A;  1Y1Z A;  4OWD A;  3T9H B;  4F2O A;  4YKP A;  2GH9 A;  2V3U A;  4C0R A;  2G29 A;  3TAJ A;  4OYV A;  1CE2 A;  2Z8E A;  3H06 B;  1FCK A;  1XHY A;  4N07 A;  1B0L A;  2XXV A;  3GBB A;  1TFD A;  2RCA A;  4FIM A;  4RJZ A;  1UTB A;  1QJM A;  1PC3 A;  3KN7 A;  3FV1 A;  3M3F A;  5HPQ A;  1EZP A;  2PYY A;  1MXZ A;  4BDM A;  2A5T A;  1B5H A;  1ZBM A;  3SEV A;  3RT8 A;  3OD7 A;  3ONM A;  1B3L A;  4N6P A;  1JEU A;  2O7U A;  4FED A;  3E13 X;  4ZED A;  2W7Y A;  5I57 A;  1NNK A;  1EZ9 A;  2R6G E;  5I59 B;  1ANF A;  3PUZ E;  3ZKL A;  2P1S A;  3QIM A;  1GGG A;  3IOU A;  4G4P A;  3O2A A;  3VXC A;  3USD A;  2V3Q A;  4R74 A;  3JV9 A;  1OIB A;  1P1N A;  1BKA A;  2I0C A;  3G7W A;  3H6W A;  2AL4 A;  2H25 A;  3IJO B;  4G8H A;  4LON B;  3LSL A;  1NNF A;  2V3T A;  1US4 A;  1LFG A;  4RK2 A;  3TEP A;  4XIG Q;  1ZTY A;  3JZJ A;  3D4C A;  2RCB A;  4ELR A;  3IB2 A;  3CIJ A;  4H6D A;  4YKK A;  3MBP A;  1JET A;  4EF1 A;  5A5X A;  3R6U A;  5CC2 A;  4TQU Q;  5B70 A;  2Z23 A;  3CSB A;  3QAX A;  4TLL B;  1M5B A;  2XXQ A;  4THI A;  4OXV A;  4E0X A;  4F2Q A;  5ICT A;  2UVG A;  5KCJ B;  3PGF A;  2I58 A;  2IA4 A;  1Q1K A;  4I8C A;  4NF6 B;  5DVI A;  4H5F A;  3A3U A;  5TPA A;  1IIT A;  1Y9U A;  2E0S A;  2HEU A;  2XXT A;  1NH8 A;  4YMA A;  3MZ9 A;  1SW5 A;  3SER A;  1QKB A;  3HHF A;  2HAU A;  3QUJ A;  4ESX A;  4G8N A;  1BLF A;  2XXW A;  4M1V A;  4BDL A;  3H6V A;  4IY5 A;  1B5I A;  3O6H A;  1FQA A;  1FQC A;  1SVX B;  2DOJ A;  3PUV E;  5CM6 A;  2O1L A;  3HCQ A;  4R75 A;  1OQH A;  1M5E A;  3WAF A;  1D9Y A;  2O51 A;  4KFQ A;  3TOD A;  1FW0 A;  1NNP A;  4LP2 B;  4U1Z A;  1TT1 A;  3N94 A;  4XKP A;  5DYH A;  4X9T A;  4IO3 A;  1IXG A;  2DWH A;  2QRY A;  1EZO A;  5TPA B;  2ZXT A;  2ZYK A;  3HPI A;  4NE4 A;  1H43 A;  5DEX A;  4GVO A;  1VFE A;  2YPN A;  1JVY A;  1VSO A;  1ZMG A;  2GRV A;  2NXO A;  3PPO A;  1UIU A;  2Y7P A;  4BDR A;  2V93 A;  4DZ1 A;  4RPN A;  4Q5T A;  3H03 A;  5AA3 A;  1IIW A;  3TTM A;  5A5X B;  3M3L A;  4IO4 A;  1AIV A;  3SEY A;  2G93 A;  1ATG A;  4H65 A;  5BWJ A;  1US5 A;  1Y4C A;  2QJE A;  1ZU0 A;  5L9M A;  2ZNT A;  4FE8 A;  2ZYM A;  2UVI A;  1H76 A;  3IR1 A;  1I69 A;  1ZJL A;  4G68 B;  3VXB A;  4AQ4 A;  4ZE9 A;  3EHS A;  4WKM A;  4OFJ A;  1MY4 A;  4WEP A;  4IGR A;  3K6U A;  1N76 A;  1B2H A;  2DSF A;  2NUV A;  4KD5 A;  3PPN A;  3HST A;  4JSD A;  1M5D A;  2XXH A;  1FTL A;  1FQD A;  3FVO A;  2XX8 A;  2PMS A;  5IAI A;  5TU0 A;  4YMB A;  1PB7 A;  1XOC A;  3IK6 B;  3KOT A;  3T22 A;  2B3B A;  1A54 A;  5AA1 A;  3OSQ A;  3UOR A;  2H4I A;  1P99 A;  3MW0 A;  4OFO A;  3G3J A;  4ZEF A;  1FQB A;  3Q28 A;  4GIZ A;  3G3I A;  4RYA A;  3SEX A;  4IGT A;  1MRP A;  1PBP A;  1R6Z A;  4JB7 A;  1MG1 A;  4OER A;  3RNN A;  2Q89 A;  1FTO A;  1OQG A;  5FTI A;  2Z22 A;  3FVK A;  1USY H;  3K1P A;  4JWO A;  5JK4 A;  1P1U A;  2D21 A;  1B4Z A;  2I6E A;  1DTG A;  1TFA A;  2O68 A;  2ONR A;  3PUX E;  4F31 B;  3B7D A;  3BBR A;  3H6U A;  2XXU A;  5ICQ A;  3KBR A;  3SEW A;  4ZDM A;  2O69 A;  3MWB A;  2NWJ A;  3S4U A;  4LZ8 A;  5CBS A;  4TOZ A;  3N5L A;  1QW0 A;  4YKI A;  1MM7 A;  4GD5 A;  5H8N A;  4GQO A;  1EH3 A;  1SQY A;  3FJG A;  4ESW A;  3UA8 A;  5I2K A;  1XT8 A;  1MPC A;  4DXB A;  3I6V A;  3FXU A;  2DWJ A;  4R6H A;  4RY1 A;  3TMG A;  1QUJ A;  2F7A A;  3K1N A;  3HN0 A;  3IB0 A;  4X48 A;  3OEK A;  5AA4 B;  1IXC A;  4IY6 A;  5H8Q A;  1JNF A;  2REJ A;  2QL3 A;  3FD3 A;  3MVZ A;  3Q27 A;  3V89 B;  1N7X A;  4H8I A;  1ZLQ A;  2LAO A;  1XVX A;  4LVQ A;  1NH7 A;  3SDF A;  2V25 A;  1YCJ A;  4U2R A;  3TPA A;  4LZ5 A;  3DLN A;  3VLV A;  5DT6 A;  1B6H A;  5FHO A;  1JW4 A;  3C31 A;  3F11 A;  5KCJ A;  2RKM A;  4ZEC A;  1QVS A;  3ECR A;  4U21 A;  4I62 A;  3H7M A;  1B58 A;  3T9U A;  4Q0C A;  1DMB A;  2PBW A;  3WAE A;  2F6P A;  2FNC A;  3TTL A;  1SYH A;  2OJT A;  4NTL A;  1IQ7 A;  1SDX A;  3N26 A;  5FHM A;  3U8Q A;  2RC9 A;  4EQ9 A;  2E1S A;  3C35 A;  2QSX A;  3DP6 A;  4R9G A;  4NF8 A;  1USY E;  2HQ0 A;  2F8D A;  3IOW A;  2RC7 A;  3KN8 A;  4RNS A;  1II5 A;  3RTF B;  3H4Z A;  1UTB B;  2M8C A;  2Y7I A;  4KI0 E;  2ZMB A;  3GXA A;  4R2B A;  2X26 A;  5CMC A;  4I1D A;  2THI A;  3QSL A;  4MBP A;  3O9P A;  4KQP A;  1XC1 A;  4EDP A;  3D4G A;  4F29 A;  2HXW A;  2XXX A;  4OES A;  1FTJ A;  4YB6 A;  3TEL A;  3SET A;  3MZ1 A;  1D3K A;  4QRZ A;  4H5G A;  4ZS9 A;  4F18 A;  3MQ9 A;  4ZEK A;  2UVJ A;  2B3F A;  2F6G A;  4KR5 A;  4U4X A;  4ZE8 A;  3TCF A;  3C9H A;  1MQI A;  3LSF B;  5AA2 B;  3MUQ A;  5AA2 A;  4NWD A;  3UGW A;  2R9J A;  5CMM A;  4FEB A;  1BIY A;  1OVT A;  1GR2 A;  1MQG A;  4RA1 A;  1LFI A;  2PVU A;  4QFL A;  3OEM A;  3W15 C;  3PMW A;  1R1N A;  1WDN A;  4GLI A;  4Q8R A;  3S9L C;  1D9V A;  4DIG A;  1LCF A;  1MXY A;  1HSE A;  3CFX A;  1LLS A;  1OMP A;  4K3F A;  3RN8 A;  4F3G A;  2RF1 A;  2H98 A;  4NF6 A;  3GZG A;  1MH3 A;  3CG1 A;  3T9V A;  4QSC A;  2NOO A;  3O97 A;  1MS7 A;  3LUY A;  5F1Q A;  1IUD A;  4ND9 A;  4F3P A;  2O7I A;  2DQV A;  3K4U A;  4MFI A;  1M5C A;  4PET A;  1VR5 A;  3ILT B;  3SEU A;  1R9L A;  3V83 A;  1AL3 A;  5KZT A;  5DEX B;  3MZB A;  1MDQ A;  4FAT A;  2Y7R A;  2VD2 A;  2DE2 A;  1M5F A;  1Y3P A;  1JW1 A;  3FGS A;  1LAG E;  3FJM A;  4OHN A;  1B32 A;  5EYF A;  1Y3Q A;  3CVG A;  1MQD A;  5CI5 A;  5IKB A;  2F35 A;  1ZIU A;  2Q2C A;  3OEN A;  4PFW A;  5I56 A;  2XD2 A;  2DE4 A;  3A3C A;  3V5A A;  1H44 A;  3IJX B;  3S2V A;  2VP1 A;  3JYR A;  3PMX A;  1FQE A;  4JWX A;  4YU0 A;  3RTW B;  3T9X B;  1DOT A;  1HSJ A;  3TUS A;  4ZEI A;  5LOM A;  3K01 A;  3H6T A;  2I49 A;  1PBQ A;  3UIF A;  3SKP A;  4HCY A;  3K00 A;  1FTM A;  4IO2 A;  3TCG A;  3B6W A;  1MPB A;  2YLN A;  4XXU A;  4ELQ A;  3UP9 A;  3KGC A;  4KCD A;  2X7Q A;  1DPP A;  4F1V A;  1I6B A;  5EHM A;  3EHT A;  3LSX A;  4U4S A;  2OCU A;  4LZ7 A;  3I3V A;  4MLV A;  1N84 A;  3KSX A;  2UYE A;  3QUF A;  3MVW A;  5ITP A;  1N7W A;  2B65 A;  3LBS A;  3BFU A;  3OXN A;  1B46 A;  4JSO A;  4KYS A;  1J1N A;  3N6U A;  4WXJ A;  3O66 A;  3KG2 A;  2F78 A;  2ZYN A;  2P2A A;  1NKX A;  2OBG A;  5CMB A;  2HCA A;  4LAT A;  3HV1 A;  2Y84 A;  2Y7W A;  4IB2 A;  4F19 A;  1MXU A;  2D3I A;  3IO6 A;  4XKR A;  3FAS A;  4G68 C;  3U72 A;  5AA2 D;  3G3H A;  3H3G A;  3TTN A;  2VHA A;  2XXI A;  3U92 A;  3OO9 A;  1B51 A;  3E3K A;  3EN3 A;  1MDP 1;  2I4B A;  2QS4 A;  3KEI A;  2IEE A;  1OVB A;  5H8H A;  1S7Y A;  1O64 A;  3O6G A;  4OEN A;  4QFO A;  1IXH A;  1POT A;  1MY1 A;  1Y3N A;  2CZL A;  5HM4 B;  3E9X A;  1ZKB A;  3UN6 A;  4IO6 A;  4QHQ A;  1GVC A;  4NED A;  4ZEB A;  1MY0 A;  3TZA A;  1AMF A;  4LQ5 A;  5H8F A;  3RT6 B;  1NMU A;  2OZZ A;  1B52 A;  2I3V A;  3A09 A;  4PE5 B;  4QFN A;  5K2X A;  4AB6 A;  1B1H A;  4MLQ A;  1F9B A;  1XS5 A;  2BJJ X;  3AXF A;  3CFL A;  3CR9 A;  4P11 A;  3FJ7 A;  4BLA A;  3BFT A;  3RLF E;  5I58 B;  1BTJ A;  2AIX A;  1AOV A;  4FJP A;  1B7H A;  3L6H A;  2F34 A;  3QXM A;  1B3H A;  1MM6 A;  2UYF A;  4YZZ A;  4TLM B;  4GWO A;  5TP9 A;  1B3F A;  4G2Z A;  4EF2 A;  4Q30 B;  2ABH A;  5I57 B;  1Z7M E;  1A7L A;  2Q2A A;  4QFK A;  3W9V A;  1XVY A;  5K2Y A;  2F7C A;  1RYX A;  3KJT A;  5FTH A;  3VLU A;  4EQ7 A;  4FAJ A;  3S9E A;  1YAE A;  4DDD A;  4YKJ A;  1IXI A;  3OOA A;  1MY3 A;  2AL5 A;  3IAZ A;  3B6Q A;  1QUI A;  3MVX A;  3MC2 A;  4KHZ E;  4NF5 A;  1BP5 A;  3K6V A;  2H5Y A;  3TTR A;  4AB5 A;  1RKM A;  4R2F A;  5EHS A;  4C1T A;  3OSR A;  3PUY E;  1SD3 A;  3VVF A;  1URS A;  4DXU A;  3FVG A;  4ELO A;  1B40 A;  2XHD A;  4RXL A;  3DEL B;  3FXR A;  1LB9 A;  1NFT A;  1URG A;  3MP6 A;  3OO7 A;  4LQ2 A;  2VGQ A;  1Y4T A;  2XXY A;  4NF8 B;  4POW A;  4WED A;  4R73 A;  4O3C A;  4PFU A;  4YB5 A;  4GL8 A;  3DP8 A;  1HSL A;  1JQF A;  2ANJ A;  3PPR A;  4JWY A;  2DVZ A;  2DYX A;  3UK4 A;  4L17 A;  3ZSF A;  4DLD A;  5CBR A;  2RC8 A;  4BDO A;  1QKA A;  1TXF A;  4EQB A;  4JBZ A;  4QSD A;  3OMB A;  4IO5 A;  2KLF A;  1YTV A;  3RUM A;  3S9N C;  3FVN A;  1MQJ A;  1PDA A;  1LFH A;  2CMO A;  2UXA A;  1FQF A;  3EF7 A;  3MPK A;  1CB6 A;  3P7I A;  1EU8 A;  2RIN A;  3IOV A;  4H1X A;  4NF4 B;  3CRB A;  4NF5 B;  3PD9 A;  4ZZA A;  3U1O A;  3VDF A;  4U23 A;  1Q35 A;  5B7D A;  4DXC A;  5L9S A;  4JXI A;  3EQ1 A;  3KFM A;  1LBC A;  3KSJ A;  1MH4 A;  3G3K A;  2A5S A;  1B5J A;  1MQH A;  2QS3 A;  3KN3 A;  4I9D A;  1RYO A;  1N0T A;  1JW5 A;  3Q26 A;  3O6I A;  3L6G A;  2Y7K A;  4NWC A;  2GHA A;  1I6A A;  4F3S A;  2DS9 A;  1A99 A;  4MH5 A;  4OEU A;  4LUB A;  3HHG A;  3DP4 A;  4QFP A;  4BDN A;  3B6T A;  3PU5 A;  3LR1 A;  4N13 A;  3EPE A;  3TTK A;  3KZG A;  1LAH E;  4F1Y A;  1H45 A;  3C34 A;  2O1M A;  4OVJ A;  2HFB A;  1QUL A;  5DTB A;  4RPO A;  2ALU A;  4F3B A;  4M4G A;  4P0G A;  3TYH A;  3VVE A;  3MJN A;  4YAH X;  4DE8 A;  3CFZ A;  5H8S A;  4YB7 A;  5ELV A;  1B0H A;  4H67 A;  1YPN A;  3R7X A;  4E0W A;  3M3K A;  4EUO A;  1B9J A;  3THI A;  1P1Q A;  5M2V A;  3G3G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...