1LAHE

Structural bases for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
238
structure length
238
Chain Sequence
ALPQTVRIGTDTTYAPFSSKDAKGEFIGFDIDLGNEMCKRMQVKCTWVASDFDALIPSLKAKKIDAIISSLSITDKRQQEIAFSDKLYAADSRLIAAKGSPIQPTLESLKGKHVGVLQGSTQEAYANDNWRTKGVDVVAYANQDLIYSDLTAGRLDAALQDEVAASEGFLKQPAGKEYAFAGPSVKDKKYFGDGTGVGLRKDDTELKAAFDKALTELRQDGTYDKMAKKYFDFNVYGDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Amino acid transport
molecule keywords LYSINE, ARGININE, ORNITHINE-BINDING PROTEIN
publication title Structural basis for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein.
pubmed rcsb
source organism Salmonella typhimurium
total genus 83
structure length 238
sequence length 238
ec nomenclature
pdb deposition date 1993-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1lahE01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1lahE02
4R2BA 3TPAA 3W15C 3KOSA 2DE4A 1N7WA 2XD2A 5A5XB 4U23A 2ANJA 1N0TA 4I9DA 4G8MA 4G2ZA 4Q0CA 4I1DA 2RC8A 4R9GA 4TLLB 4ZS9A 4NWDA 4F18A 4ESWA 4BDMA 2VD2A 1H43A 3O28A 4IY6A 1ZKBA 1Q1KA 3RGYA 5HBCA 1AMFA 1N76A 4BDQA 3H6UA 3T9HB 1NH7A 3T9VA 1H44A 3AXFA 3A3UA 2HEUA 4PQJA 2NXOA 1LSTA 2OBGA 3OD7A 3RTFB 3SDFA 4H65A 2PT2A 3OSQA 2OZZA 3UA8A 3OO6A 1MY4A 4EF1A 2DXYA 3A3CA 4EDPA 1MDP1 1SYHA 1FQDA 4U1ZA 1BTJA 4NF6A 4G77A 3VE1B 4MF3A 3JYRA 2AYSA 1UTHA 5L9MA 3MVYA 3O66A 4F39A 3UP9A 2Z22A 5FHOA 5BUUA 4RK2A 4O3CA 1P1NA 3C35A 1YAEA 1A55A 4YKKA 2VP1A 3K02A 4GVOA 3TAJA 1IITA 1CB6A 2R6GE 3FGSA 4KHZE 2DE3A 4IGRA 1Q35A 3V5AA 4ELRA 1N3XA 3IOTA 2O69A 4YB7A 3OOAA 3M3KA 4P0IA 1SW5A 4ZE8A 4MFIA 3OEMA 3LSFB 1B7UA 3GBBA 4AQ4A 3QAXA 4FJPA 1B52A 2A5SA 1B3GA 3HO7A 2I0CA 4KI0E 1IXIA 2ZXTA 4O3AA 2XXIA 4NEDA 3TYHA 3K0VA 4OWDA 1HSEA 3C32A 1JQFA 3HPIA 4E0XA 1WODA 4OFJA 1H45A 1Y4TA 3TTLA 3N6UA 1IZ1A 2QS2A 2ONSA 3ODBA 4F22A 3HN0A 1PB9A 3FUZA 2DVCA 2UVHA 1OIBA 2I0BA 2QSXA 5JTYA 1MXZA 3LBSA 4H8JA 4PFYA 3TCHA 1TFDA 1BP5A 5TPAB 1QUIA 4OENA 1KWHA 5I2KA 5ISUA 2FYIA 3O6IA 5I57B 4F31B 3QUFA 1PEBA 2V93A 2PT1A 3G3IA 2ZYNA 3UN6A 3HHGA 4QFOA 3K2DA 4KD5A 2OLBA 4XXUA 4ND9A 4PFWA 4NE4A 1LLSA 1PBPA 4NF8A 4GIZA 5AA4B 3K6XA 3KJTA 2O1MA 4KPTA 1N7XA 3PV0E 4TQUQ 3WAEA 3JZJA 1JVYA 5AA1A 3SKPA 4NF4B 3SEYA 3FVGA 2F8DA 3T22A 2GFEA 5JK4A 3BFUA 4LVQA 3Q25A 4QRZA 1P99A 3R26A 4FEBA 4YMAA 2XXPA 3TODA 1MPDA 2CMOA 3MC2A 3USDA 3QSLA 1QW0A 1FTOA 1LGBC 1UTBB 3TCFA 3KN3A 4RY1A 4DDDA 4ECFA 3SEWA 4M4GA 2NVUB 2H5YA 4G68B 1XVYA 2IEEA 5I2NB 5LOMA 1FTKA 1JEUA 4XTCQ 4H1XA 3BBRA 3JV9A 4R6HA 4F3PA 3IO6A 1B58A 3PUVE 2H98A 3CFLA 3IR1A 3DM0A 4FAJA 4G68C 1Y20A 1LBBA 1GVCA 1USYE 3O97A 2ZYMA 5AA3A 2B3BA 2YPNA 3EHTA 5I84A 1MM6A 3H4ZA 4ZEBA 2V25A 3PPPA 1US5A 1QUKA 4BLAA 5H8FA 4G4PA 4BDRA 5I59A 3N26A 3FJ7A 1M5EA 2Q2AA 4P11A 5KCJB 4QSEA 3ILUB 4QFPA 1R6ZA 5ELVA 2RINA 3R6UA 3K6WA 4OEVA 4FORA 3FJGA 2DP8A 1A54A 3K4UA 1ZMGA 3GBAA 3P7IA 1O7TA 4OFLA 4LQ5A 2G93A 4EQ7A 1SW4A 2QS1A 1EZ9A 3PD9A 3B6TA 4R72A 4WXJA 3KN7A 1B2HA 3PUYE 3VV5A 3VLVA 5AA2A 2H4IA 4JBZA 2REJA 1Z7NE 5KZTA 4EUOA 4ZEFA 3CFZA 1OQHA 1MRPA 2XXUA 2Z8DA 4ISUA 1UIVA 4UACA 2XXWA 3C33A 3O9PA 4ONYA 2PBWA 3OELA 2YLNA 4YICA 3S2VA 2I4CA 1US4A 5KDTB 4PP0A 5TP9A 4OZ9A 3IK6B 3U92A 3LSXA 3FVNA 4R6KA 3CSGA 2PVUA 1ZIUA 2V3UA 3S9MC 1PC3A 5DVFA 2F97A 2DQVA 1SDXA 1PB8A 1Y3NA 1SI1A 1D4NA 3L6HA 2HAUA 2ALUA 5H8QA 2DWJA 1D9YA 3UK4A 4I8CA 4I62A 4XKPA 4DE8A 3K00A 2ZNSA 4HCWA 4DCYA 2XXQA 5FTHA 3EHSA 3RT6B 1FQEA 1DOTA 1M5BA 3DP8A 4DLDA 1B4HA 4OESA 4KFQA 3DELB 3MQ9A 4GL0A 3PMXA 2LAOA 1D9VA 1H3DA 2A5TA 3M8UA 2QRYA 1SBPA 1PBQA 1MM7A 1O64A 4MH5A 4YB5A 2W7YA 3H7MA 1XVXA 1MXXA 4RNSA 3N94A 3H6VA 2HZKA 1GTKA 4NF6B 1HSJA 1ANFA 5CRYA 2DSFA 1AOVA 3S9LC 4U22A 1UTHB 3KJ7A 3KSJA 3T9UA 3GLBA 2DOJA 3QK6A 4NF5A 4PFUA 3RUMA 2Y7WA 1VE4A 3LC8A 1B46A 3E13X 4QHQA 1NFTA 1FQBA 4Z0IA 3UIFA 2E1SA 3HSTA 2D21A 4XKNA 1D3KA 3B6QA 1GR2A 2P0SA 4G8NA 1PDAA 2I6EA 2O1LA 3TZAA 3D4GA 2I58A 5EYFA 5H8HA 3EHUA 1B05A 3TEPA 3FJMA 1RYXA 2P2AA 3PD8A 1FW0A 2Q88A 2THIA 3SEUA 3KN8A 3E3KA 4JSOA 1A40A 4PE5B 3BKIB 4OTEA 2QMXA 3K1MA 5L8DA 1IIWA 2O51A 5ICTA 3GZGA 1B0LA 2Q89A 5H8NA 1MG1A 4HW8A 5JTYB 1IUDA 1NNFA 1P1WA 4QFKA 4E0WA 1Y4CA 3KBRA 1RYOA 3N5LA 3ILTB 5I2KB 2Z8EA 3HCQA 4GWOA 2AIXA 3DP6A 3ECRA 1YCJA 3ZKKA 3C4MA 4JWOA 3MAMA 1MPBA 5F7VA 1LB8A 5EHMA 3MP6A 4WKMA 3IAZA 2XX7A 3FV1A 4N07A 3S4UA 3MVZA 2E0SA 4FIMA 5ICQA 4ZZEA 3EN3A 2AL5A 1BKAA 1MS7A 3H6TA 2F6PA 1L5TA 3SESA 3L6GA 2ZYKA 4NF8B 1TT1A 3S9NC 4FECA 4F3SA 3RPWA 2UVGA 5HPQA 3SEXA 3PU5A 3VLUA 5CM6A 3E9XA 2PMSA 4YKJA 1POY1 3TQLA 4NWCA 5F1QA 4LZ7A 3O2AA 4U2RA 1IXCA 2OCUA 2UXAA 3A09A 4LATA 4ZE9A 4YKPA 3QXMA 1B5JA 2V3QA 1N3WA 4K3FA 4KYEA 2RKMA 4IY5A 3IB1A 3G3JA 2NUVA 4RYAA 3U1OA 5AA2D 1QKAA 4H0WA 2Y7IA 3IL1B 4OMBA 2OJTA 2ZNTA 1IQ7A 4GXSB 3IB0A 1B3EA 3OO7A 4EQBA 2H99A 3MP8A 4PETA 3MP1A 1Y9UA 3T96B 4WEPA 2F7CA 4JXIA 4IO3A 1URSA 2RCAA 4JB7A 5J1DA 2ZNUA 2XXVA 5K2XA 1NNTA 4F3BA 4AB5A 2QMWA 1AIVA 1EH3A 2HAVA 4ZEKA 4ZDMA 4DIGA 3I6VA 3O29A 2H25A 3M3LA 2NOOA 1FQFA 4M1VA 5I56A 4YZZA 3RT8A 4R2FA 4X48A 3W9VA 5H8FB 1BIYA 1MH4A 3EQ1A 5I59B 4Q8RA 3SETA 3KG2A 1MQJA 3FVOA 1RKMA 4LZ8A 2I3WA 3MZBA 4FE8A 3RY3A 2XXXA 4R73A 4AB6A 4NTLA 4RJZA 2Y7PA 2Q2CA 3H06B 1POTA 2F5XA 3W9WA 1MH3A 1FTJA 1A8FA 3TQWA 2F7AA 3M3FA 4XIGQ 2XD3A 2F7BA 4OETA 1ELJA 4DZ1A 3VVFA 1GGGA 1II5A 1SD3A 5CC2A 5K2YA 2KLFA 4RA1A 1JEVA 3PUZE 1B40A 5AA2B 4H67A 5B70A 3ZSFA 1XC1A 1LFHA 1NH8A 4R74A 3VXCA 1IEJA 4QF9A 4JDFA 3CIJA 3QUJA 3FXQA 2F35A 2ESNA 1FQAA 1JETA 5I58A 3G3GA 4UA8A 2I4BA 1ZBMA 5M2VA 3RLFE 3PPNA 2DWIA 3C34A 3V8XB 5TP9B 4Z7EA 2UVIA 4IO5A 5BWJA 1Y1ZA 4YU0A 3QIMA 1YPNA 2Z23A 3ONMA 4ZEIA 4DXCA 1LB9A 2DVZA 2GHAA 3KFMA 4POXA 1URDA 1ZU0A 3MZ9A 5H8QB 1MXWA 1S7YA 3MVWA 2X7QA 4OERA 2B3FA 5FHNA 3TTNA 4OHNA 4U4XA 3FXRA 2RF1A 3RTWB 3TTKA 3VVEA 2ONRA 5DEXA 5DVJA 3VVDA 1DMBA 4GQOA 3CRBA 3PMVA 4RPNA 4RXLA 4THIA 3H3GA 3T93B 2X7PA 2A5TB 1MDQA 4EF2A 1B1XA 1R9QA 1MY1A 3C31A 1M5DA 2O7IA 2V3TA 1J1NA 4RK9A 2FNCA 1N04A 1WDNA 3U93A 4GOTA 4GD5A 5AE4A 4Q30B 4XKRA 4OXVA 2WKYA 1Y1MA 3TMGA 2VHAA 4Q5TA 5CBRA 1FTMA 3VLWA 1HSLA 3O6GA 2FA7A 3HV1A 2VD3A 1MQGA 3PUXE 1M5FA 5CMBA 3KEIA 5FHMA 4F1YA 2F36A 1QKBA 3CR9A 2GRVA 5ITOA 3OEKA 4GXAA 3R7XA 4N6PA 5IAIA 1URGA 4NF5B 2XXTA 4C1UA 1NL5A 3IX1A 4KCCA 1OVTA 2NWJA 3GXAA 5CMKA 1QJMA 3C36A 3KOTA 3RNNA 1R1NA 2O6AA 3HHFA 2OWSA 4MLQA 5CI5A 1IXGA 3MVXA 1P1OA 3Q29A 4O3BA 2D5WA 3RN8A 2XX9A 3CI8A 4DXBA 1MQDA 1DPEA 1UQWA 1GV8A 2D3IA 3LUYA 3CG3A 4YAHX 1MY2A 4DXUA 1AH5A 1DTGA 3THIA 1USYH 2ZMBA 5H8HB 3TUSA 1ZJLA 2UVJA 2QL3A 4ELPA 3CSBA 1YTVA 3OXNA 1I69A 5CMMA 3MWBA 3TDJA 3S9EA 3QYTA 1B5HA 1IXHA 1QVSA 3TTMA 4HS7A 3PPRA 1VR5A 3OO8A 3U72A 4OYVA 5CBSA 2F78A 2O68A 4LONB 5H8NB 1NNPA 3PPQA 4L17A 5JEIA 3I3VA 5A5XA 1SW1A 1B0HA 1Y3PA 1Y3QA 4G8HA 3U8QA 4FEDA 3MJNA 1SYIA 4JWXA 4ZZAA 2Y7RA 4GLIA 5HM4B 3OENA 4LP2B 4WEDA 2DXRA 4ELOA 2F6GA 1B3LA 1NMUA 3ZKLA 2R71A 4TOZA 1XHYA 1OLAA 5FTIA 2BJJX 4KCDA 3Q26A 1R9LA 4IB2A 3N6TA 4KYDA 1B4ZA 1S9TA 1B5IA 2HQ0A 3ZS6A 1P1UA 2Q8JA 3U94A 2QS3A 2XXYA 2O7UA 2REGA 3H03A 1A7LA 2Y84A 2HFBA 4RPOA 4NMYA 1B9JA 4KYSA 3FD3A 1OLCA 1B3FA 4JWYA 1JW4A 3IORA 2IA4A 3E4RA 2AL4A 4C0RA 2VGQA 3I5OA 2DYXA 3O6HA 4F29A 1QUJA 4EQ9A 3IOWA 3LR1A 2OK2A 2F34A 1MQIA 4C1TA 1T0KA 5DVIA 3BFTA 2RC7A 4HTGA 3FXUA 1JW1A 3KSXA 3MW0A 1LAXA 3PPOA 4H6DA 5L9OA 2UYEA 4OEUA 1OQGA 4LUBA 1DPPA 1I6QA 2I48A 3FIRA 3G3KA 4F3GA 3VFJA 3CFXA 3MBPA 3T66A 2V84A 2ONKE 1MXYA 1VFDA 1F9BA 4IO2A 1NKXA 3IOVA 4GRKA 4PFTA 1SVXB 3VDFA 2O84X 1EZOA 1MY0A 3B7DA 4TLMB 4R75A 5IKBA 2GHBA 1DSNA 5H8SA 4QSCA 2GH9A 3MPKA 3G3HA 2XX8A 5I56B 4HCYA 3V89B 4QFLA 1PB7A 1O63A 2HXWA 2ABHA 4F1VA 4X1BA 1JW5A 2H9BA 3SEVA 3K6UA 4F19A 4X1DA 4QFNA 3UGWA 1N84A 4LQ2A 5TPAA 2XHDA 3K6VA 2XXRA 4R9FA 3OO9A 1UIUA 5L9SA 3IOUA 1MXUA 1VFEA 1B32A 5I57A 3UORA 1TFAA 3TELA 1OMPA 1MQHA 1NNKA 3IB2A 1B6HA 2QJEA 2Y7KA 4OQOA 2M8CA 1OVBA 2I3VA 5B7DA 4DCXA 3Q27A 3TTRA 1XT8A 4IO7A 1MPCA 1LCTA 2P1SA 1SQYA 3LSWA 5AA4A 1Z7ME 4YB6A 1LFIA 3FASA 3OMBA 4POWA 4NF4A 1TWYA 2R9JA 3D4CA 1A99A 3G3FA 3DLNA 3MPLA 2QPQA 3FATA 3EPEA 5I58B 1VSOA 4H8IA 5ITPA 4QSDA 4ZEDA 4FATA 3RQTA 4ESXA 2YJPA 4H5FA 1EZPA 4OFOA 1SW2A 4U21A 5DTBA 2X26A 1EU8A 4ELQA 1FCKA 2QS4A 1UTBA 3F11A 4XKQA 1S50A 1JNFA 2DE2A 3WAFA 4X9TA 2B65A 1CE2A 1QULA 2CZLA 3PUWE 4G68A 4BDLA 5I2NA 1XS5A 3OSRA 4U4SA 4EXKA 1BLFA 1LAFE 1DTZA 3FVKA 2XXHA 5DEXB 3T9XB 2PX1A 2VOZA 3IJOB 1WVJA 1B7ZA 4IGTA 3K1PA 3H6WA 1P1QA 2RC9A 1M5CA 4LA9A 4GL8A 3V83A 3FZVA 3FV2A 5DYHA 1LAGE 4BDNA 2HCAA 4F2QA 3C9HA 2OWTA 4YKIA 1MXVA 3DP4A 5CMCA 4EXLA 3PMWA 4JSDA 2ZYOA 3CVGA 4GF8A 4P0GA 4ZECA 3SERA 3Q28A 3PGFA 3MUQA 3TKDA 4U1OA 1ZLQA 4YMBA 1SI0A 1B1HA 1B7HA 5KCJA 4KQPA 4MBPA 3IO4A 4F2OA 3EF7A 4OVJA 1A8EA 2DWAA 3TCGA 2Z8FA 1TXFA 1XOCA 1LBCA 2G29A 3K01A 1B3HA 3TFLA 1FQCA 2DWHA 1LAHE 2HZLA 3MZ1A 4MLVA 1ZTYA 4KR5A 4H5GA 1LCFA 2RCBA 3KGCA 3LSLA 4R6YA 4IO6A 4GFRA 4LZ5A 1B51A 3K1NA 3G7WA 1LFGA 4N13A 1JVXA 3VXBA 3CG1A 3KZGA 3IJXB 1FTLA 4F1UA 2DS9A 2UYFA 1I6AA 1MY3A 1H76A 5DT6A 1ATGA 2PYYA 1I6BA 2Q9TA 5EHSA 2I49A 5KDTA 3B6WA 4IO4A 4BDOA 1AL3A 5TU0A
chains in the Genus database with same CATH superfamily
4R2BA 1G0IA 3TPAA 3W15C 3KOSA 4HE2A 2DE4A 2F3DA 1N7WA 2XD2A 5A5XB 4U23A 2ANJA 1N0TA 4I9DA 4G8MA 4OA4A 4G2ZA 4HE0A 4Q0CA 4I1DA 2RC8A 1FSAA 4R9GA 4TLLB 4PAIA 4ZS9A 4NWDA 4F18A 4XF5A 4HE1A 4ESWA 4BDMA 4MAGA 4O7MA 2VD2A 2B4LA 3T1BA 1H43A 3O28A 4IY6A 1Q1KA 1ZKBA 3RGYA 5I7IA 5HBCA 1AMFA 1N76A 5LDZA 4BDQA 3H6UA 4KXPA 3T9HB 1NH7A 3T9VA 1H44A 5ESYA 3AXFA 3A3UA 2HEUA 4PQJA 2NXOA 1LSTA 4P1LA 2OBGA 3OD7A 3RTFB 3SDFA 4H65A 2PT2A 3OSQA 2OZZA 3UA8A 3OO6A 1MY4A 2VPNA 4EF1A 2DXYA 3A3CA 4EDPA 1MDP1 1SYHA 1FQDA 1FJ9A 4U1ZA 1BTJA 4NF6A 4G77A 3VE1B 4MF3A 3JYRA 2AYSA 1UTHA 2XA5A 5L9MA 3MVYA 3O66A 4F39A 3UP9A 3KC1A 2Z22A 5FHOA 2QVRA 5BUUA 4RK2A 4O3CA 1P1NA 3C35A 1YAEA 1A55A 4YKKA 2VP1A 3K02A 5EYGA 4GVOA 3TAJA 1IITA 1IMDA 4NX1A 1CB6A 2R6GE 3FGSA 4KHZE 4P56A 2DE3A 4IGRA 1Q35A 3V5AA 4ELRA 1N3XA 3IOTA 2O69A 4YB7A 3OOAA 3M3KA 4P0IA 1SW5A 4ZE8A 5F24A 4MFIA 3OEMA 3LSFB 1B7UA 3GBBA 4AQ4A 3QAXA 4FJPA 1B52A 2A5SA 1B3GA 3HO7A 4NQ8A 2I0CA 4KI0E 1IXIA 2ZXTA 4X8RA 4O3AA 2XXIA 4NEDA 3TYHA 1FPJA 3K0VA 4OWDA 1HSEA 4PF8A 3C32A 1JQFA 3HPIA 4E0XA 1WODA 4OFJA 2XWKA 3E79A 1H45A 1Y4TA 3TTLA 3N6UA 1IZ1A 1NV2A 2ONSA 2QS2A 4GWUA 3ODBA 2VPOA 4F22A 3HN0A 1PB9A 3FUZA 1NV4A 2DVCA 3KBZA 2UVHA 4MX6A 1OIBA 2I0BA 2QSXA 5JTYA 1FBEA 1MXZA 3LBSA 1LEVA 4H8JA 4PFYA 3TCHA 1TFDA 1BP5A 5TPAB 1QUIA 4OENA 1KWHA 5I2KA 5ISUA 2FYIA 3O6IA 1IMCA 5I57B 1CNQA 4F31B 4OANA 1KA0A 3QUFA 1PEBA 2Y5LA 2V93A 4X04A 2PT1A 3G3IA 2ZYNA 3UN6A 1NV0A 3HHGA 4P3LA 4QFOA 3K2DA 4KD5A 2OLBA 4XXUA 1FBHA 1LBWA 4ND9A 4PFWA 4NE4A 1LLSA 1PBPA 4NF8A 4GIZA 5AA4B 3K6XA 3KJTA 2O1MA 4KPTA 2ZZXA 1N7XA 3PV0E 4TQUQ 3WAEA 3JZJA 1JVYA 4H46A 2V4CA 1AWBA 5AA1A 3SKPA 4NF4B 3SEYA 3FVGA 2F8DA 3T22A 2GFEA 2BJIA 5JK4A 3BFUA 4LVQA 3Q25A 2MKZA 4QRZA 1P99A 3R26A 4FEBA 4YMAA 2XXPA 3TODA 1MPDA 2CMOA 3MC2A 3B8BA 3LUZA 3USDA 3QSLA 1IMEA 1QW0A 1FTOA 1LGBC 1UTBB 3TCFA 3KN3A 4RY1A 4DDDA 4ECFA 1NUZA 5T3JA 3SEWA 4M4GA 2NVUB 2H5YA 4G68B 1XVYA 2IEEA 5I2NB 5LOMA 1FTKA 1JEUA 1KA1A 4XTCQ 4H1XA 3BBRA 3JV9A 4R6HA 4HXVA 4F3PA 3IO6A 1B58A 3PUVE 2H98A 3ISPA 3CFLA 3IR1A 3DM0A 4FAJA 4G68C 1Y20A 1LBBA 1GVCA 1USYE 3O97A 2ZYMA 5AA3A 2B3BA 2YPNA 3EHTA 5I84A 1MM6A 4MHFA 3H4ZA 1LBYA 4ZEBA 4PFBA 2V25A 3PPPA 1US5A 4NGUA 1QUKA 4BLAA 5H8FA 4G4PA 4BDRA 5I59A 3N26A 3FJ7A 1M5EA 2Q2AA 5DW8A 4P11A 5KCJB 4QSEA 3ILUB 4QFPA 1R6ZA 5ELVA 2RINA 1SPIA 3R6UA 3K6WA 4N4UA 4OEVA 4FORA 3FJGA 2DP8A 1A54A 3E78A 3BIHA 3K4UA 1ZMGA 3GBAA 3P7IA 1O7TA 4OFLA 4LQ5A 2G93A 4EQ7A 4AS5A 1SW4A 2QS1A 1EZ9A 3PD9A 3B6TA 1DK4A 4R72A 2QVUA 4WXJA 3KN7A 1B2HA 3PUYE 3VV5A 3VLVA 4LN5A 5AA2A 2H4IA 4JBZA 2REJA 1Z7NE 5KZTA 4EUOA 4ZEFA 3CFZA 4GBVA 1OQHA 1MRPA 2XXUA 2Z8DA 4ISUA 5EYHA 1NV6A 1UIVA 2FVZA 4UACA 2XXWA 2FBPA 3C33A 3O9PA 4ONYA 2QVVA 2PBWA 3OELA 4GX3A 2YLNA 4JVCA 1JP4A 4YICA 4NHBA 4QBAA 3S2VA 2I4CA 1US4A 5KDTB 4PP0A 5TP9A 4OZ9A 3IK6B 3U92A 3LSXA 3FVNA 2F3BA 2P3NA 4R6KA 3CSGA 2PVUA 1ZIUA 2V3UA 1LBVA 3S9MC 1PC3A 3GYYA 4PDHA 5DVFA 2F97A 2QFLA 2DQVA 1SDXA 1PB8A 1Y3NA 1SI1A 1D4NA 3L6HA 2HAUA 2ALUA 5H8QA 2DWJA 1D9YA 3UK4A 4I8CA 4I62A 5ET6A 4XKPA 4DE8A 3K00A 2ZNSA 4HCWA 4DCYA 2XXQA 5FTHA 3EHSA 3RT6B 1FQEA 1DOTA 1M5BA 3DP8A 4DLDA 1B4HA 4OESA 4KFQA 3DELB 3MQ9A 4PCDA 4GL0A 3PMXA 2LAOA 1D9VA 1H3DA 2A5TA 3M8UA 4IR8A 2QRYA 1SBPA 1PBQA 1MM7A 1O64A 4MH5A 4YB5A 2W7YA 3H7MA 3D1RA 1XVXA 1MXXA 4RNSA 2JJKA 3N94A 3H6VA 2HZKA 5IZ3A 1GTKA 4NF6B 1HSJA 1ANFA 5CRYA 2DSFA 1AOVA 3S9LC 5I5PA 4U22A 1FRPA 1UTHB 3KJ7A 1Q9DA 3KSJA 3T9UA 3GLBA 2DOJA 3QK6A 3HFUA 4NF5A 4PFUA 3LV0A 2R8TA 3RUMA 4N6KA 1RDXA 2Y7WA 2WEFA 1VE4A 3LC8A 1B46A 3E13X 4QHQA 1NFTA 1DCUA 4XEQA 1FQBA 4Z0IA 3BIGA 3UIFA 2E1SA 3HSTA 2D21A 4XKNA 1D3KA 3B6QA 1GR2A 2PFZA 2P0SA 4G8NA 1PDAA 2I6EA 2O1LA 1FPDA 3TZAA 3D4GA 2I58A 5EYFA 5H8HA 3EHUA 4OVTA 1B05A 3TEPA 3FJMA 1RYXA 2P2AA 3PD8A 4PGNA 1FW0A 2Q88A 2THIA 3SEUA 3KN8A 3E3KA 3B50A 4JSOA 1A40A 4PE5B 3BKIB 4OTEA 1NV5A 2QMXA 1YZ0A 3K1MA 3A29A 2GQ1A 5L8DA 1IIWA 2O51A 5ICTA 3GZGA 1B0LA 2Q89A 5H8NA 1MG1A 4PTKA 4HW8A 5JTYB 1IUDA 1NNFA 2VT5A 1P1WA 4QFKA 4E0WA 1Y4CA 3KBRA 1RYOA 3N5LA 3ILTB 2FIEA 2Z8EA 3HCQA 5I2KB 5I3SA 4GWOA 2AIXA 3DP6A 3ECRA 1YCJA 4PC9A 3ZKKA 3C4MA 4JWOA 2Q74A 3MAMA 1MPBA 5F7VA 1LB8A 5EHMA 3MP6A 4WKMA 3IAZA 2XX7A 3FV1A 4N07A 3S4UA 3MVZA 2E0SA 4FIMA 5ICQA 4ZZEA 3EN3A 2AL5A 1BKAA 1D9QA 1MS7A 3H6TA 2F6PA 1L5TA 3SESA 4O94A 3L6GA 2ZYKA 4NF8B 3FXBA 1TT1A 3S9NC 4FECA 4F3SA 3RPWA 1NUWA 2UVGA 5HPQA 3SEXA 3PU5A 3VLUA 5CM6A 1IMFA 3E9XA 2PMSA 4YKJA 1POY1 3TQLA 4NWCA 4PDDA 5F1QA 4LZ7A 5FBPA 3T0JA 3O2AA 2PCRA 4U2RA 1IXCA 2OCUA 2UXAA 1QGXA 3A09A 3RPLA 4LATA 4ZE9A 4YKPA 5ET8A 3QXMA 1B5JA 2V3QA 1N3WA 4K3FA 4KYEA 2RKMA 4IY5A 5IGAA 3IB1A 3G3JA 2NUVA 4RYAA 3U1OA 5AA2D 1FPIA 1QKAA 4H0WA 2Y7IA 3IL1B 4AS4A 4OMBA 2OJTA 2ZNTA 1IQ7A 4GXSB 1FPGA 3IB0A 1B3EA 3OO7A 4EQBA 2H99A 3MP8A 4PETA 3MP1A 1Y9UA 1INPA 3T96B 2WBDA 2OX3A 4WEPA 2F7CA 5IM2A 4JXIA 3RYDA 4IO3A 1RDYA 1URSA 2RCAA 4JB7A 5J1DA 2ZNUA 2XXVA 5K2XA 1NNTA 4F3BA 4AB5A 2QMWA 1AIVA 1EH3A 2HAVA 4ZEKA 4ZDMA 4DIGA 3I6VA 4MNIA 3O29A 5ET5A 2H25A 3M3LA 2NOOA 4PBQA 2Y5KA 1FQFA 4MNCA 4M1VA 5I56A 4YZZA 3RT8A 4R2FA 1BK4A 4N8YA 1RDZA 4X48A 3W9VA 2HHMA 5H8FB 5ET7A 1BIYA 1MH4A 3EQ1A 5I59B 4Q8RA 3SETA 3KG2A 1MQJA 3FVOA 1RKMA 2CEYA 4LZ8A 2I3WA 3MZBA 4FE8A 3RY3A 2XXXA 4R73A 4AB6A 4NTLA 4RJZA 2WBBA 1DBZA 2Y7PA 2CZIA 2Q2CA 3H06B 1POTA 2F5XA 3W9WA 1MH3A 1FTJA 1A8FA 3TQWA 2F7AA 3M3FA 3SZPA 4XIGQ 1EYKA 2XD3A 2F7BA 4OVQA 4OETA 1ELJA 4DZ1A 3IFCA 3VVFA 1GGGA 1II5A 1SD3A 5CC2A 5K2YA 2KLFA 4RA1A 4GWWA 1JEVA 3PUZE 1B40A 5AA2B 4H67A 5B70A 3ZSFA 1XC1A 1LFHA 1NH8A 4R74A 3VXCA 1IEJA 2CZHA 4QF9A 4JDFA 3CIJA 3QUJA 3FXQA 2F35A 1FBGA 2ESNA 1FQAA 4GWXA 1JETA 5I58A 2OWZA 3G3GA 4UA8A 2I4BA 1ZBMA 5M2VA 3RLFE 4P9KA 3PPNA 2DWIA 3C34A 3V8XB 5TP9B 4Z7EA 2UVIA 4IO5A 5BWJA 1Y1ZA 1FJ6A 4YU0A 3QIMA 2HXRA 1YPNA 2DDKA 2Z23A 3ONMA 4ZEIA 4DXCA 1LB9A 2CZKA 2DVZA 2GHAA 3KFMA 4POXA 1URDA 1FBCA 1ZU0A 3MZ9A 5H8QB 1MXWA 1S7YA 4PFRA 3MVWA 2X7QA 4OERA 2B3FA 5FHNA 4NF0A 3TTNA 4OHNA 4U4XA 3FXRA 2RF1A 3RTWB 3TTKA 3VVEA 3IFAA 2ONRA 5DEXA 5DVJA 3VVDA 1DMBA 4GQOA 3CRBA 3PMVA 4RPNA 4RXLA 4THIA 3H3GA 3T93B 2X7PA 4GX4A 2A5TB 1MDQA 4GWYA 4PFIA 4EF2A 1B1XA 1R9QA 1MY1A 3C31A 1M5DA 2O7IA 2V3TA 1J1NA 4RK9A 2FNCA 1N04A 1WDNA 3U93A 2WYPA 4GOTA 4GD5A 5AE4A 1FPFA 4Q30B 4XKRA 4OXVA 2WKYA 1Y1MA 3TMGA 2VHAA 4Q5TA 1NUYA 5CBRA 1FTMA 4P47A 3VLWA 1HSLA 3O6GA 2FA7A 5IZ3B 3HV1A 2VD3A 1MQGA 3PUXE 1M5FA 5CMBA 2L5VA 3KEIA 1NI9A 5FHMA 4F1YA 2F36A 1LBZA 1QKBA 3CR9A 1FPKA 2GRVA 2PFYA 5ITOA 1LBXA 1EYJA 3OEKA 4GXAA 3R7XA 4N6PA 5IAIA 1URGA 4NF5B 2XXTA 4C1UA 1NL5A 3IX1A 4KCCA 1OVTA 2NWJA 3GXAA 5CMKA 1FBDA 1QJMA 3C36A 3MSTA 3KOTA 2B4MA 3RNNA 1R1NA 2O6AA 3HHFA 5LTCA 2OWSA 4MLQA 5CI5A 4JVIA 1IXGA 3MVXA 1P1OA 5J16A 3KC0A 3Q29A 4O3BA 2D5WA 3QMFA 3RN8A 2XX9A 3CI8A 4I3EA 4DXBA 1MQDA 1DPEA 1UQWA 1GV8A 2D3IA 1FTAA 3LUYA 3CG3A 4YAHX 2WX9A 1MY2A 1FPBA 4DXUA 1AH5A 1DTGA 3THIA 1USYH 4GWSA 2ZMBA 5H8HB 3TUSA 1ZJLA 2UVJA 2QL3A 4ELPA 3CSBA 1K9YA 1YTVA 3OXNA 1I69A 5CMMA 3MWBA 3TDJA 3S9EA 3QYTA 1B5HA 1IXHA 1QVSA 3TTMA 4HS7A 4N81A 3FBPA 3PPRA 1VR5A 3OO8A 3U72A 4OYVA 5CBSA 2F78A 2O68A 4LONB 5H8NB 2XWOA 3NOHA 4O8MA 4I40A 1NNPA 3PPQA 4L17A 5JEIA 3I3VA 5A5XA 1SW1A 1B0HA 1EYIA 1Y3PA 1Y3QA 4G8HA 3U8QA 4FEDA 3MJNA 1SYIA 4GBWA 3PTYA 4JWXA 4ZZAA 2Y7RA 4DI4B 4GLIA 4N6DA 5HM4B 2XWIA 3OENA 4LP2B 4WEDA 2DXRA 4ELOA 2F6GA 1G0HA 4NN3A 1B3LA 1NMUA 2R71A 4TOZA 3ZKLA 1YYZA 1XHYA 2XWVA 1OLAA 5FTIA 2BJJX 4KCDA 3Q26A 1R9LA 4IB2A 3N6TA 4KYDA 1B4ZA 1S9TA 1B5IA 3ROJA 2HQ0A 3ZS6A 1P1UA 2Q8JA 3U94A 2QS3A 2XXYA 2O7UA 4PGPA 4OVPA 4OVRA 2REGA 3H03A 1A7LA 2Y84A 2HFBA 4RPOA 4NMYA 1B9JA 4KYSA 3FD3A 1OLCA 2HPGA 1XI6A 1B3FA 2ZZVA 4JWYA 1KZ8A 1JW4A 3IORA 2IA4A 3E4RA 3RPLB 2AL4A 4C0RA 2VGQA 3I5OA 2DYXA 3O6HA 4F29A 4NG7A 1QUJA 4EQ9A 3IOWA 3LR1A 2OK2A 2F34A 1MQIA 4C1TA 4MJOA 1T0KA 5DVIA 3BFTA 2RC7A 4HTGA 3FXUA 1JW1A 3KSXA 3MW0A 1LAXA 3PPOA 4H6DA 5L9OA 2UYEA 4OEUA 1OQGA 4LUBA 1DPPA 1I6QA 2I48A 3FIRA 3G3KA 4F3GA 3VFJA 3CFXA 4N17A 3MBPA 3T66A 2V84A 2ONKE 2FIXA 1MXYA 1VFDA 1F9BA 4IO2A 1NKXA 3IOVA 4GRKA 4G61A 4PFTA 1SVXB 3VDFA 2O84X 1EZOA 1MY0A 3B7DA 4TLMB 2FHYA 4R75A 5IKBA 2GHBA 1DSNA 5H8SA 4QSCA 2GH9A 3MPKA 3G3HA 2XX8A 5I56B 4NAPA 4HCYA 3V89B 4QFLA 1PB7A 1O63A 2HXWA 2ABHA 1NV3A 4F1VA 4X1BA 1JW5A 2H9BA 3SEVA 4H45A 3K6UA 4F19A 4X1DA 4QFNA 3UGWA 1N84A 4LQ2A 5TPAA 2XHDA 3K6VA 4MMPA 2XXRA 2Q8MA 4R9FA 3OO9A 1UIUA 5L9SA 5EQ9A 3IOUA 1MXUA 1VFEA 4N91A 1B32A 5I57A 1VDWA 1FPEA 4I3YA 3UORA 1TFAA 4FBPA 3TELA 4PAFA 1OMPA 1MQHA 1NNKA 3IB2A 1B6HA 2QJEA 2Y7KA 4OQOA 2M8CA 1OVBA 2I3VA 5B7DA 4DCXA 1FPLA 3Q27A 3TTRA 1XT8A 4IO7A 2KR0A 1MPCA 1LCTA 2P1SA 1SQYA 3LSWA 1K9ZA 3MYUA 5AA4A 5IZZA 1Z7ME 4YB6A 4GWZA 1LFIA 3FASA 3OMBA 4POWA 4PAKA 4NF4A 1TWYA 2R9JA 3D4CA 1A99A 3G3FA 3DLNA 3MPLA 2QPQA 4DI3D 3FATA 3EPEA 5I58B 4MIJA 1FBFA 1VSOA 4H8IA 5ITPA 4QSDA 5EQ7A 4ZEDA 4FATA 3RQTA 4UABA 4ESXA 2YJPA 4H5FA 1EZPA 1IMAA 4OFOA 2CEXA 1SW2A 4U21A 5DTBA 2X26A 1EU8A 4ELQA 1FCKA 2QS4A 1UTBA 3F11A 4XKQA 1S50A 1JNFA 2DE2A 3WAFA 4X9TA 2P3VA 2ZZWA 2B65A 1CE2A 1QULA 2CZLA 3PUWE 4G68A 4BDLA 5I2NA 4N8GA 1XS5A 4PBHA 3OSRA 4U4SA 4EXKA 1BLFA 1LAFE 1DTZA 3FVKA 2XXHA 5DEXB 1NUXA 3T9XB 2PX1A 4P8BA 2VOZA 3IJOB 4MCOA 1WVJA 1B7ZA 2WYKA 4IGTA 3K1PA 4MNPA 3H6WA 1P1QA 2RC9A 1M5CA 4LA9A 4GL8A 3V83A 3FZVA 3FV2A 5DYHA 1LAGE 4BDNA 2HCAA 4XFEA 4F2QA 3EKIA 3C9HA 2OWTA 4YKIA 1MXVA 1YXIA 3DP4A 5CMCA 4EXLA 5EQ8A 3PMWA 4JSDA 4P1EA 1FBPA 2KQZA 2ZYOA 3CVGA 4GF8A 4P0GA 4ZECA 3SERA 3Q28A 3PGFA 3MUQA 5IZ1A 3TKDA 4U1OA 1ZLQA 4YMBA 1SI0A 1B1HA 1B7HA 5KCJA 4KQPA 4MBPA 3IO4A 4O7IA 4F2OA 3U65A 3EF7A 4OVJA 2XXKA 1NV7A 1A8EA 2DWAA 3TCGA 2Z8FA 1TXFA 1XOCA 1LBCA 2G29A 3K01A 1B3HA 3TFLA 1FQCA 2DWHA 1LAHE 2HZLA 3MZ1A 4MLVA 1ZTYA 4KR5A 4H5GA 1LCFA 2RCBA 3KGCA 3LSLA 3CHGA 4R6YA 4IO6A 4MEVA 5A5LA 4GFRA 4LZ5A 1B51A 3K1NA 4JVDA 3G7WA 1LFGA 4N13A 1JVXA 3VXBA 4PE3A 3CG1A 3KZGA 3IJXB 1FTLA 4F1UA 2DS9A 2UYFA 1I6AA 1MY3A 4QXDA 1H76A 5DT6A 1ATGA 2PYYA 1I6BA 4OVSA 1NV1A 2Q9TA 1IMBA 5EHSA 2I49A 5KDTA 3B6WA 4IO4A 4BDOA 4PF6A 4N15A 5EQAA 1AL3A 5TU0A 4GX6A
chains in the Genus database with same CATH topology
4R2BA 3TPAA 3W15C 3KOSA 2DE4A 1N7WA 2XD2A 5A5XB 4U23A 2ANJA 1N0TA 4I9DA 4G8MA 4G2ZA 4Q0CA 4I1DA 2RC8A 4R9GA 4TLLB 4ZS9A 4NWDA 4F18A 4ESWA 4BDMA 2VD2A 1H43A 3O28A 4IY6A 1ZKBA 1Q1KA 3RGYA 5HBCA 1AMFA 1N76A 4BDQA 3H6UA 3T9HB 1NH7A 3T9VA 1H44A 3AXFA 3A3UA 2HEUA 4PQJA 2NXOA 1LSTA 2OBGA 3OD7A 3RTFB 3SDFA 4H65A 2PT2A 3OSQA 2OZZA 3UA8A 3OO6A 1MY4A 4EF1A 2DXYA 3A3CA 4EDPA 1MDP1 1SYHA 1FQDA 4U1ZA 1BTJA 4NF6A 4G77A 3VE1B 4MF3A 3JYRA 2AYSA 1UTHA 5L9MA 3MVYA 3O66A 4F39A 3UP9A 2Z22A 5FHOA 5BUUA 4RK2A 4O3CA 1P1NA 3C35A 1YAEA 1A55A 4YKKA 2VP1A 3K02A 4GVOA 3TAJA 1IITA 1CB6A 2R6GE 3FGSA 4KHZE 2DE3A 4IGRA 1Q35A 3V5AA 4ELRA 1N3XA 3IOTA 2O69A 4YB7A 3OOAA 3M3KA 4P0IA 1SW5A 4ZE8A 4MFIA 3OEMA 3LSFB 1B7UA 3GBBA 4AQ4A 3QAXA 4FJPA 1B52A 2A5SA 1B3GA 3HO7A 2I0CA 4KI0E 1IXIA 2ZXTA 4O3AA 2XXIA 4NEDA 3TYHA 3K0VA 4OWDA 1HSEA 3C32A 1JQFA 3HPIA 4E0XA 1WODA 4OFJA 1H45A 1Y4TA 3TTLA 3N6UA 1IZ1A 2QS2A 2ONSA 3ODBA 4F22A 3HN0A 1PB9A 3FUZA 2DVCA 2UVHA 1OIBA 2I0BA 2QSXA 5JTYA 1MXZA 3LBSA 4H8JA 4PFYA 3TCHA 1TFDA 1BP5A 5TPAB 1QUIA 4OENA 1KWHA 5I2KA 5ISUA 2FYIA 3O6IA 5I57B 4F31B 3QUFA 1PEBA 2V93A 2PT1A 3G3IA 2ZYNA 3UN6A 3HHGA 4QFOA 3K2DA 4KD5A 2OLBA 4XXUA 4ND9A 4PFWA 4NE4A 1LLSA 1PBPA 4NF8A 4GIZA 5AA4B 3K6XA 3KJTA 2O1MA 4KPTA 1N7XA 3PV0E 4TQUQ 3WAEA 3JZJA 1JVYA 5AA1A 3SKPA 4NF4B 3SEYA 3FVGA 2F8DA 3T22A 2GFEA 5JK4A 3BFUA 4LVQA 3Q25A 4QRZA 1P99A 3R26A 4FEBA 4YMAA 2XXPA 3TODA 1MPDA 2CMOA 3MC2A 3USDA 3QSLA 1QW0A 1FTOA 1LGBC 1UTBB 3TCFA 3KN3A 4RY1A 4DDDA 4ECFA 3SEWA 4M4GA 2NVUB 2H5YA 4G68B 1XVYA 2IEEA 5I2NB 5LOMA 1FTKA 1JEUA 4XTCQ 4H1XA 3BBRA 3JV9A 4R6HA 4F3PA 3IO6A 1B58A 3PUVE 2H98A 3CFLA 3IR1A 3DM0A 4FAJA 4G68C 1Y20A 1LBBA 1GVCA 1USYE 3O97A 2ZYMA 5AA3A 2B3BA 2YPNA 3EHTA 5I84A 1MM6A 3H4ZA 4ZEBA 2V25A 3PPPA 1US5A 1QUKA 4BLAA 5H8FA 4G4PA 4BDRA 5I59A 3N26A 3FJ7A 1M5EA 2Q2AA 4P11A 5KCJB 4QSEA 3ILUB 4QFPA 1R6ZA 5ELVA 2RINA 3R6UA 3K6WA 4OEVA 4FORA 3FJGA 2DP8A 1A54A 3K4UA 1ZMGA 3GBAA 3P7IA 1O7TA 4OFLA 4LQ5A 2G93A 4EQ7A 1SW4A 2QS1A 1EZ9A 3PD9A 3B6TA 4R72A 4WXJA 3KN7A 1B2HA 3PUYE 3VV5A 3VLVA 5AA2A 2H4IA 4JBZA 2REJA 1Z7NE 5KZTA 4EUOA 4ZEFA 3CFZA 1OQHA 1MRPA 2XXUA 2Z8DA 4ISUA 1UIVA 4UACA 2XXWA 3C33A 3O9PA 4ONYA 2PBWA 3OELA 2YLNA 4YICA 3S2VA 2I4CA 1US4A 5KDTB 4PP0A 5TP9A 4OZ9A 3IK6B 3U92A 3LSXA 3FVNA 4R6KA 3CSGA 2PVUA 1ZIUA 2V3UA 3S9MC 1PC3A 5DVFA 2F97A 2DQVA 1SDXA 1PB8A 1Y3NA 1SI1A 1D4NA 3L6HA 2HAUA 2ALUA 5H8QA 2DWJA 1D9YA 3UK4A 4I8CA 4I62A 4XKPA 4DE8A 3K00A 2ZNSA 4HCWA 4DCYA 2XXQA 5FTHA 3EHSA 3RT6B 1FQEA 1DOTA 1M5BA 3DP8A 4DLDA 1B4HA 4OESA 4KFQA 3DELB 3MQ9A 4GL0A 3PMXA 2LAOA 1D9VA 1H3DA 2A5TA 3M8UA 2QRYA 1SBPA 1PBQA 1MM7A 1O64A 4MH5A 4YB5A 2W7YA 3H7MA 1XVXA 1MXXA 4RNSA 3N94A 3H6VA 2HZKA 1GTKA 4NF6B 1HSJA 1ANFA 5CRYA 2DSFA 1AOVA 3S9LC 4U22A 1UTHB 3KJ7A 3KSJA 3T9UA 3GLBA 2DOJA 3QK6A 4NF5A 4PFUA 3RUMA 2Y7WA 1VE4A 3LC8A 1B46A 3E13X 4QHQA 1NFTA 1FQBA 4Z0IA 3UIFA 2E1SA 3HSTA 2D21A 4XKNA 1D3KA 3B6QA 1GR2A 2P0SA 4G8NA 1PDAA 2I6EA 2O1LA 3TZAA 3D4GA 2I58A 5EYFA 5H8HA 3EHUA 1B05A 3TEPA 3FJMA 1RYXA 2P2AA 3PD8A 1FW0A 2Q88A 2THIA 3SEUA 3KN8A 3E3KA 4JSOA 1A40A 4PE5B 3BKIB 4OTEA 2QMXA 3K1MA 5L8DA 1IIWA 2O51A 5ICTA 3GZGA 1B0LA 2Q89A 5H8NA 1MG1A 4HW8A 5JTYB 1IUDA 1NNFA 1P1WA 4QFKA 4E0WA 1Y4CA 3KBRA 1RYOA 3N5LA 3ILTB 5I2KB 2Z8EA 3HCQA 4GWOA 2AIXA 3DP6A 3ECRA 1YCJA 3ZKKA 3C4MA 4JWOA 3MAMA 1MPBA 5F7VA 1LB8A 5EHMA 3MP6A 4WKMA 3IAZA 2XX7A 3FV1A 4N07A 3S4UA 3MVZA 2E0SA 4FIMA 5ICQA 4ZZEA 3EN3A 2AL5A 1BKAA 1MS7A 3H6TA 2F6PA 1L5TA 3SESA 3L6GA 2ZYKA 4NF8B 1TT1A 3S9NC 4FECA 4F3SA 3RPWA 2UVGA 5HPQA 3SEXA 3PU5A 3VLUA 5CM6A 3E9XA 2PMSA 4YKJA 1POY1 3TQLA 4NWCA 5F1QA 4LZ7A 3O2AA 4U2RA 1IXCA 2OCUA 2UXAA 3A09A 4LATA 4ZE9A 4YKPA 3QXMA 1B5JA 2V3QA 1N3WA 4K3FA 4KYEA 2RKMA 4IY5A 3IB1A 3G3JA 2NUVA 4RYAA 3U1OA 5AA2D 1QKAA 4H0WA 2Y7IA 3IL1B 4OMBA 2OJTA 2ZNTA 1IQ7A 4GXSB 3IB0A 1B3EA 3OO7A 4EQBA 2H99A 3MP8A 4PETA 3MP1A 1Y9UA 3T96B 4WEPA 2F7CA 4JXIA 4IO3A 1URSA 2RCAA 4JB7A 5J1DA 2ZNUA 2XXVA 5K2XA 1NNTA 4F3BA 4AB5A 2QMWA 1AIVA 1EH3A 2HAVA 4ZEKA 4ZDMA 4DIGA 3I6VA 3O29A 2H25A 3M3LA 2NOOA 1FQFA 4M1VA 5I56A 4YZZA 3RT8A 4R2FA 4X48A 3W9VA 5H8FB 1BIYA 1MH4A 3EQ1A 5I59B 4Q8RA 3SETA 3KG2A 1MQJA 3FVOA 1RKMA 4LZ8A 2I3WA 3MZBA 4FE8A 3RY3A 2XXXA 4R73A 4AB6A 4NTLA 4RJZA 2Y7PA 2Q2CA 3H06B 1POTA 2F5XA 3W9WA 1MH3A 1FTJA 1A8FA 3TQWA 2F7AA 3M3FA 4XIGQ 2XD3A 2F7BA 4OETA 1ELJA 4DZ1A 3VVFA 1GGGA 1II5A 1SD3A 5CC2A 5K2YA 2KLFA 4RA1A 1JEVA 3PUZE 1B40A 5AA2B 4H67A 5B70A 3ZSFA 1XC1A 1LFHA 1NH8A 4R74A 3VXCA 1IEJA 4QF9A 4JDFA 3CIJA 3QUJA 3FXQA 2F35A 2ESNA 1FQAA 1JETA 5I58A 3G3GA 4UA8A 2I4BA 1ZBMA 5M2VA 3RLFE 3PPNA 2DWIA 3C34A 3V8XB 5TP9B 4Z7EA 2UVIA 4IO5A 5BWJA 1Y1ZA 4YU0A 3QIMA 1YPNA 2Z23A 3ONMA 4ZEIA 4DXCA 1LB9A 2DVZA 2GHAA 3KFMA 4POXA 1URDA 1ZU0A 3MZ9A 5H8QB 1MXWA 1S7YA 3MVWA 2X7QA 4OERA 2B3FA 5FHNA 3TTNA 4OHNA 4U4XA 3FXRA 2RF1A 3RTWB 3TTKA 3VVEA 2ONRA 5DEXA 5DVJA 3VVDA 1DMBA 4GQOA 3CRBA 3PMVA 4RPNA 4RXLA 4THIA 3H3GA 3T93B 2X7PA 2A5TB 1MDQA 4EF2A 1B1XA 1R9QA 1MY1A 3C31A 1M5DA 2O7IA 2V3TA 1J1NA 4RK9A 2FNCA 1N04A 1WDNA 3U93A 4GOTA 4GD5A 5AE4A 4Q30B 4XKRA 4OXVA 2WKYA 1Y1MA 3TMGA 2VHAA 4Q5TA 5CBRA 1FTMA 3VLWA 1HSLA 3O6GA 2FA7A 3HV1A 2VD3A 1MQGA 3PUXE 1M5FA 5CMBA 3KEIA 5FHMA 4F1YA 2F36A 1QKBA 3CR9A 2GRVA 5ITOA 3OEKA 4GXAA 3R7XA 4N6PA 5IAIA 1URGA 4NF5B 2XXTA 4C1UA 1NL5A 3IX1A 4KCCA 1OVTA 2NWJA 3GXAA 5CMKA 1QJMA 3C36A 3KOTA 3RNNA 1R1NA 2O6AA 3HHFA 2OWSA 4MLQA 5CI5A 1IXGA 3MVXA 1P1OA 3Q29A 4O3BA 2D5WA 3RN8A 2XX9A 3CI8A 4DXBA 1MQDA 1DPEA 1UQWA 1GV8A 2D3IA 3LUYA 3CG3A 4YAHX 1MY2A 4DXUA 1AH5A 1DTGA 3THIA 1USYH 2ZMBA 5H8HB 3TUSA 1ZJLA 2UVJA 2QL3A 4ELPA 3CSBA 1YTVA 3OXNA 1I69A 5CMMA 3MWBA 3TDJA 3S9EA 3QYTA 1B5HA 1IXHA 1QVSA 3TTMA 4HS7A 3PPRA 1VR5A 3OO8A 3U72A 4OYVA 5CBSA 2F78A 2O68A 4LONB 5H8NB 1NNPA 3PPQA 4L17A 5JEIA 3I3VA 5A5XA 1SW1A 1B0HA 1Y3PA 1Y3QA 4G8HA 3U8QA 4FEDA 3MJNA 1SYIA 4JWXA 4ZZAA 2Y7RA 4GLIA 5HM4B 3OENA 4LP2B 4WEDA 2DXRA 4ELOA 2F6GA 1B3LA 1NMUA 3ZKLA 2R71A 4TOZA 1XHYA 1OLAA 5FTIA 2BJJX 4KCDA 3Q26A 1R9LA 4IB2A 3N6TA 4KYDA 1B4ZA 1S9TA 1B5IA 2HQ0A 3ZS6A 1P1UA 2Q8JA 3U94A 2QS3A 2XXYA 2O7UA 2REGA 3H03A 1A7LA 2Y84A 2HFBA 4RPOA 4NMYA 1B9JA 4KYSA 3FD3A 1OLCA 1B3FA 4JWYA 1JW4A 3IORA 2IA4A 3E4RA 2AL4A 4C0RA 2VGQA 3I5OA 2DYXA 3O6HA 4F29A 1QUJA 4EQ9A 3IOWA 3LR1A 2OK2A 2F34A 1MQIA 4C1TA 1T0KA 5DVIA 3BFTA 2RC7A 4HTGA 3FXUA 1JW1A 3KSXA 3MW0A 1LAXA 3PPOA 4H6DA 5L9OA 2UYEA 4OEUA 1OQGA 4LUBA 1DPPA 1I6QA 2I48A 3FIRA 3G3KA 4F3GA 3VFJA 3CFXA 3MBPA 3T66A 2V84A 2ONKE 1MXYA 1VFDA 1F9BA 4IO2A 1NKXA 3IOVA 4GRKA 4PFTA 1SVXB 3VDFA 2O84X 1EZOA 1MY0A 3B7DA 4TLMB 4R75A 5IKBA 2GHBA 1DSNA 5H8SA 4QSCA 2GH9A 3MPKA 3G3HA 2XX8A 5I56B 4HCYA 3V89B 4QFLA 1PB7A 1O63A 2HXWA 2ABHA 4F1VA 4X1BA 1JW5A 2H9BA 3SEVA 3K6UA 4F19A 4X1DA 4QFNA 3UGWA 1N84A 4LQ2A 5TPAA 2XHDA 3K6VA 2XXRA 4R9FA 3OO9A 1UIUA 5L9SA 3IOUA 1MXUA 1VFEA 1B32A 5I57A 3UORA 1TFAA 3TELA 1OMPA 1MQHA 1NNKA 3IB2A 1B6HA 2QJEA 2Y7KA 4OQOA 2M8CA 1OVBA 2I3VA 5B7DA 4DCXA 3Q27A 3TTRA 1XT8A 4IO7A 1MPCA 1LCTA 2P1SA 1SQYA 3LSWA 5AA4A 1Z7ME 4YB6A 1LFIA 3FASA 3OMBA 4POWA 4NF4A 1TWYA 2R9JA 3D4CA 1A99A 3G3FA 3DLNA 3MPLA 2QPQA 3FATA 3EPEA 5I58B 1VSOA 4H8IA 5ITPA 4QSDA 4ZEDA 4FATA 3RQTA 4ESXA 2YJPA 4H5FA 1EZPA 4OFOA 1SW2A 4U21A 5DTBA 2X26A 1EU8A 4ELQA 1FCKA 2QS4A 1UTBA 3F11A 4XKQA 1S50A 1JNFA 2DE2A 3WAFA 4X9TA 2B65A 1CE2A 1QULA 2CZLA 3PUWE 4G68A 4BDLA 5I2NA 1XS5A 3OSRA 4U4SA 4EXKA 1BLFA 1LAFE 1DTZA 3FVKA 2XXHA 5DEXB 3T9XB 2PX1A 2VOZA 3IJOB 1WVJA 1B7ZA 4IGTA 3K1PA 3H6WA 1P1QA 2RC9A 1M5CA 4LA9A 4GL8A 3V83A 3FZVA 3FV2A 5DYHA 1LAGE 4BDNA 2HCAA 4F2QA 3C9HA 2OWTA 4YKIA 1MXVA 3DP4A 5CMCA 4EXLA 3PMWA 4JSDA 2ZYOA 3CVGA 4GF8A 4P0GA 4ZECA 3SERA 3Q28A 3PGFA 3MUQA 3TKDA 4U1OA 1ZLQA 4YMBA 1SI0A 1B1HA 1B7HA 5KCJA 4KQPA 4MBPA 3IO4A 4F2OA 3EF7A 4OVJA 1A8EA 2DWAA 3TCGA 2Z8FA 1TXFA 1XOCA 1LBCA 2G29A 3K01A 1B3HA 3TFLA 1FQCA 2DWHA 1LAHE 2HZLA 3MZ1A 4MLVA 1ZTYA 4KR5A 4H5GA 1LCFA 2RCBA 3KGCA 3LSLA 4R6YA 4IO6A 4GFRA 4LZ5A 1B51A 3K1NA 3G7WA 1LFGA 4N13A 1JVXA 3VXBA 3CG1A 3KZGA 3IJXB 1FTLA 4F1UA 2DS9A 2UYFA 1I6AA 1MY3A 1H76A 5DT6A 1ATGA 2PYYA 1I6BA 2Q9TA 5EHSA 2I49A 5KDTA 3B6WA 4IO4A 4BDOA 1AL3A 5TU0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R2B A;  3TPA A;  3W15 C;  3KOS A;  2DE4 A;  1N7W A;  2XD2 A;  5A5X B;  4U23 A;  2ANJ A;  1N0T A;  4I9D A;  4G8M A;  4G2Z A;  4Q0C A;  4I1D A;  2RC8 A;  4R9G A;  4TLL B;  4ZS9 A;  4NWD A;  4F18 A;  4ESW A;  4BDM A;  2VD2 A;  1H43 A;  3O28 A;  4IY6 A;  1ZKB A;  1Q1K A;  3RGY A;  5HBC A;  1AMF A;  1N76 A;  4BDQ A;  3H6U A;  3T9H B;  1NH7 A;  3T9V A;  1H44 A;  3AXF A;  3A3U A;  2HEU A;  4PQJ A;  2NXO A;  1LST A;  2OBG A;  3OD7 A;  3RTF B;  3SDF A;  4H65 A;  2PT2 A;  3OSQ A;  2OZZ A;  3UA8 A;  3OO6 A;  1MY4 A;  4EF1 A;  2DXY A;  3A3C A;  4EDP A;  1MDP 1;  1SYH A;  1FQD A;  4U1Z A;  1BTJ A;  4NF6 A;  4G77 A;  3VE1 B;  4MF3 A;  3JYR A;  2AYS A;  1UTH A;  5L9M A;  3MVY A;  3O66 A;  4F39 A;  3UP9 A;  2Z22 A;  5FHO A;  5BUU A;  4RK2 A;  4O3C A;  1P1N A;  3C35 A;  1YAE A;  1A55 A;  4YKK A;  2VP1 A;  3K02 A;  4GVO A;  3TAJ A;  1IIT A;  1CB6 A;  2R6G E;  3FGS A;  4KHZ E;  2DE3 A;  4IGR A;  1Q35 A;  3V5A A;  4ELR A;  1N3X A;  3IOT A;  2O69 A;  4YB7 A;  3OOA A;  3M3K A;  4P0I A;  1SW5 A;  4ZE8 A;  4MFI A;  3OEM A;  3LSF B;  1B7U A;  3GBB A;  4AQ4 A;  3QAX A;  4FJP A;  1B52 A;  2A5S A;  1B3G A;  3HO7 A;  2I0C A;  4KI0 E;  1IXI A;  2ZXT A;  4O3A A;  2XXI A;  4NED A;  3TYH A;  3K0V A;  4OWD A;  1HSE A;  3C32 A;  1JQF A;  3HPI A;  4E0X A;  1WOD A;  4OFJ A;  1H45 A;  1Y4T A;  3TTL A;  3N6U A;  1IZ1 A;  2QS2 A;  2ONS A;  3ODB A;  4F22 A;  3HN0 A;  1PB9 A;  3FUZ A;  2DVC A;  2UVH A;  1OIB A;  2I0B A;  2QSX A;  5JTY A;  1MXZ A;  3LBS A;  4H8J A;  4PFY A;  3TCH A;  1TFD A;  1BP5 A;  5TPA B;  1QUI A;  4OEN A;  1KWH A;  5I2K A;  5ISU A;  2FYI A;  3O6I A;  5I57 B;  4F31 B;  3QUF A;  1PEB A;  2V93 A;  2PT1 A;  3G3I A;  2ZYN A;  3UN6 A;  3HHG A;  4QFO A;  3K2D A;  4KD5 A;  2OLB A;  4XXU A;  4ND9 A;  4PFW A;  4NE4 A;  1LLS A;  1PBP A;  4NF8 A;  4GIZ A;  5AA4 B;  3K6X A;  3KJT A;  2O1M A;  4KPT A;  1N7X A;  3PV0 E;  4TQU Q;  3WAE A;  3JZJ A;  1JVY A;  5AA1 A;  3SKP A;  4NF4 B;  3SEY A;  3FVG A;  2F8D A;  3T22 A;  2GFE A;  5JK4 A;  3BFU A;  4LVQ A;  3Q25 A;  4QRZ A;  1P99 A;  3R26 A;  4FEB A;  4YMA A;  2XXP A;  3TOD A;  1MPD A;  2CMO A;  3MC2 A;  3USD A;  3QSL A;  1QW0 A;  1FTO A;  1LGB C;  1UTB B;  3TCF A;  3KN3 A;  4RY1 A;  4DDD A;  4ECF A;  3SEW A;  4M4G A;  2NVU B;  2H5Y A;  4G68 B;  1XVY A;  2IEE A;  5I2N B;  5LOM A;  1FTK A;  1JEU A;  4XTC Q;  4H1X A;  3BBR A;  3JV9 A;  4R6H A;  4F3P A;  3IO6 A;  1B58 A;  3PUV E;  2H98 A;  3CFL A;  3IR1 A;  3DM0 A;  4FAJ A;  4G68 C;  1Y20 A;  1LBB A;  1GVC A;  1USY E;  3O97 A;  2ZYM A;  5AA3 A;  2B3B A;  2YPN A;  3EHT A;  5I84 A;  1MM6 A;  3H4Z A;  4ZEB A;  2V25 A;  3PPP A;  1US5 A;  1QUK A;  4BLA A;  5H8F A;  4G4P A;  4BDR A;  5I59 A;  3N26 A;  3FJ7 A;  1M5E A;  2Q2A A;  4P11 A;  5KCJ B;  4QSE A;  3ILU B;  4QFP A;  1R6Z A;  5ELV A;  2RIN A;  3R6U A;  3K6W A;  4OEV A;  4FOR A;  3FJG A;  2DP8 A;  1A54 A;  3K4U A;  1ZMG A;  3GBA A;  3P7I A;  1O7T A;  4OFL A;  4LQ5 A;  2G93 A;  4EQ7 A;  1SW4 A;  2QS1 A;  1EZ9 A;  3PD9 A;  3B6T A;  4R72 A;  4WXJ A;  3KN7 A;  1B2H A;  3PUY E;  3VV5 A;  3VLV A;  5AA2 A;  2H4I A;  4JBZ A;  2REJ A;  1Z7N E;  5KZT A;  4EUO A;  4ZEF A;  3CFZ A;  1OQH A;  1MRP A;  2XXU A;  2Z8D A;  4ISU A;  1UIV A;  4UAC A;  2XXW A;  3C33 A;  3O9P A;  4ONY A;  2PBW A;  3OEL A;  2YLN A;  4YIC A;  3S2V A;  2I4C A;  1US4 A;  5KDT B;  4PP0 A;  5TP9 A;  4OZ9 A;  3IK6 B;  3U92 A;  3LSX A;  3FVN A;  4R6K A;  3CSG A;  2PVU A;  1ZIU A;  2V3U A;  3S9M C;  1PC3 A;  5DVF A;  2F97 A;  2DQV A;  1SDX A;  1PB8 A;  1Y3N A;  1SI1 A;  1D4N A;  3L6H A;  2HAU A;  2ALU A;  5H8Q A;  2DWJ A;  1D9Y A;  3UK4 A;  4I8C A;  4I62 A;  4XKP A;  4DE8 A;  3K00 A;  2ZNS A;  4HCW A;  4DCY A;  2XXQ A;  5FTH A;  3EHS A;  3RT6 B;  1FQE A;  1DOT A;  1M5B A;  3DP8 A;  4DLD A;  1B4H A;  4OES A;  4KFQ A;  3DEL B;  3MQ9 A;  4GL0 A;  3PMX A;  2LAO A;  1D9V A;  1H3D A;  2A5T A;  3M8U A;  2QRY A;  1SBP A;  1PBQ A;  1MM7 A;  1O64 A;  4MH5 A;  4YB5 A;  2W7Y A;  3H7M A;  1XVX A;  1MXX A;  4RNS A;  3N94 A;  3H6V A;  2HZK A;  1GTK A;  4NF6 B;  1HSJ A;  1ANF A;  5CRY A;  2DSF A;  1AOV A;  3S9L C;  4U22 A;  1UTH B;  3KJ7 A;  3KSJ A;  3T9U A;  3GLB A;  2DOJ A;  3QK6 A;  4NF5 A;  4PFU A;  3RUM A;  2Y7W A;  1VE4 A;  3LC8 A;  1B46 A;  3E13 X;  4QHQ A;  1NFT A;  1FQB A;  4Z0I A;  3UIF A;  2E1S A;  3HST A;  2D21 A;  4XKN A;  1D3K A;  3B6Q A;  1GR2 A;  2P0S A;  4G8N A;  1PDA A;  2I6E A;  2O1L A;  3TZA A;  3D4G A;  2I58 A;  5EYF A;  5H8H A;  3EHU A;  1B05 A;  3TEP A;  3FJM A;  1RYX A;  2P2A A;  3PD8 A;  1FW0 A;  2Q88 A;  2THI A;  3SEU A;  3KN8 A;  3E3K A;  4JSO A;  1A40 A;  4PE5 B;  3BKI B;  4OTE A;  2QMX A;  3K1M A;  5L8D A;  1IIW A;  2O51 A;  5ICT A;  3GZG A;  1B0L A;  2Q89 A;  5H8N A;  1MG1 A;  4HW8 A;  5JTY B;  1IUD A;  1NNF A;  1P1W A;  4QFK A;  4E0W A;  1Y4C A;  3KBR A;  1RYO A;  3N5L A;  3ILT B;  5I2K B;  2Z8E A;  3HCQ A;  4GWO A;  2AIX A;  3DP6 A;  3ECR A;  1YCJ A;  3ZKK A;  3C4M A;  4JWO A;  3MAM A;  1MPB A;  5F7V A;  1LB8 A;  5EHM A;  3MP6 A;  4WKM A;  3IAZ A;  2XX7 A;  3FV1 A;  4N07 A;  3S4U A;  3MVZ A;  2E0S A;  4FIM A;  5ICQ A;  4ZZE A;  3EN3 A;  2AL5 A;  1BKA A;  1MS7 A;  3H6T A;  2F6P A;  1L5T A;  3SES A;  3L6G A;  2ZYK A;  4NF8 B;  1TT1 A;  3S9N C;  4FEC A;  4F3S A;  3RPW A;  2UVG A;  5HPQ A;  3SEX A;  3PU5 A;  3VLU A;  5CM6 A;  3E9X A;  2PMS A;  4YKJ A;  1POY 1;  3TQL A;  4NWC A;  5F1Q A;  4LZ7 A;  3O2A A;  4U2R A;  1IXC A;  2OCU A;  2UXA A;  3A09 A;  4LAT A;  4ZE9 A;  4YKP A;  3QXM A;  1B5J A;  2V3Q A;  1N3W A;  4K3F A;  4KYE A;  2RKM A;  4IY5 A;  3IB1 A;  3G3J A;  2NUV A;  4RYA A;  3U1O A;  5AA2 D;  1QKA A;  4H0W A;  2Y7I A;  3IL1 B;  4OMB A;  2OJT A;  2ZNT A;  1IQ7 A;  4GXS B;  3IB0 A;  1B3E A;  3OO7 A;  4EQB A;  2H99 A;  3MP8 A;  4PET A;  3MP1 A;  1Y9U A;  3T96 B;  4WEP A;  2F7C A;  4JXI A;  4IO3 A;  1URS A;  2RCA A;  4JB7 A;  5J1D A;  2ZNU A;  2XXV A;  5K2X A;  1NNT A;  4F3B A;  4AB5 A;  2QMW A;  1AIV A;  1EH3 A;  2HAV A;  4ZEK A;  4ZDM A;  4DIG A;  3I6V A;  3O29 A;  2H25 A;  3M3L A;  2NOO A;  1FQF A;  4M1V A;  5I56 A;  4YZZ A;  3RT8 A;  4R2F A;  4X48 A;  3W9V A;  5H8F B;  1BIY A;  1MH4 A;  3EQ1 A;  5I59 B;  4Q8R A;  3SET A;  3KG2 A;  1MQJ A;  3FVO A;  1RKM A;  4LZ8 A;  2I3W A;  3MZB A;  4FE8 A;  3RY3 A;  2XXX A;  4R73 A;  4AB6 A;  4NTL A;  4RJZ A;  2Y7P A;  2Q2C A;  3H06 B;  1POT A;  2F5X A;  3W9W A;  1MH3 A;  1FTJ A;  1A8F A;  3TQW A;  2F7A A;  3M3F A;  4XIG Q;  2XD3 A;  2F7B A;  4OET A;  1ELJ A;  4DZ1 A;  3VVF A;  1GGG A;  1II5 A;  1SD3 A;  5CC2 A;  5K2Y A;  2KLF A;  4RA1 A;  1JEV A;  3PUZ E;  1B40 A;  5AA2 B;  4H67 A;  5B70 A;  3ZSF A;  1XC1 A;  1LFH A;  1NH8 A;  4R74 A;  3VXC A;  1IEJ A;  4QF9 A;  4JDF A;  3CIJ A;  3QUJ A;  3FXQ A;  2F35 A;  2ESN A;  1FQA A;  1JET A;  5I58 A;  3G3G A;  4UA8 A;  2I4B A;  1ZBM A;  5M2V A;  3RLF E;  3PPN A;  2DWI A;  3C34 A;  3V8X B;  5TP9 B;  4Z7E A;  2UVI A;  4IO5 A;  5BWJ A;  1Y1Z A;  4YU0 A;  3QIM A;  1YPN A;  2Z23 A;  3ONM A;  4ZEI A;  4DXC A;  1LB9 A;  2DVZ A;  2GHA A;  3KFM A;  4POX A;  1URD A;  1ZU0 A;  3MZ9 A;  5H8Q B;  1MXW A;  1S7Y A;  3MVW A;  2X7Q A;  4OER A;  2B3F A;  5FHN A;  3TTN A;  4OHN A;  4U4X A;  3FXR A;  2RF1 A;  3RTW B;  3TTK A;  3VVE A;  2ONR A;  5DEX A;  5DVJ A;  3VVD A;  1DMB A;  4GQO A;  3CRB A;  3PMV A;  4RPN A;  4RXL A;  4THI A;  3H3G A;  3T93 B;  2X7P A;  2A5T B;  1MDQ A;  4EF2 A;  1B1X A;  1R9Q A;  1MY1 A;  3C31 A;  1M5D A;  2O7I A;  2V3T A;  1J1N A;  4RK9 A;  2FNC A;  1N04 A;  1WDN A;  3U93 A;  4GOT A;  4GD5 A;  5AE4 A;  4Q30 B;  4XKR A;  4OXV A;  2WKY A;  1Y1M A;  3TMG A;  2VHA A;  4Q5T A;  5CBR A;  1FTM A;  3VLW A;  1HSL A;  3O6G A;  2FA7 A;  3HV1 A;  2VD3 A;  1MQG A;  3PUX E;  1M5F A;  5CMB A;  3KEI A;  5FHM A;  4F1Y A;  2F36 A;  1QKB A;  3CR9 A;  2GRV A;  5ITO A;  3OEK A;  4GXA A;  3R7X A;  4N6P A;  5IAI A;  1URG A;  4NF5 B;  2XXT A;  4C1U A;  1NL5 A;  3IX1 A;  4KCC A;  1OVT A;  2NWJ A;  3GXA A;  5CMK A;  1QJM A;  3C36 A;  3KOT A;  3RNN A;  1R1N A;  2O6A A;  3HHF A;  2OWS A;  4MLQ A;  5CI5 A;  1IXG A;  3MVX A;  1P1O A;  3Q29 A;  4O3B A;  2D5W A;  3RN8 A;  2XX9 A;  3CI8 A;  4DXB A;  1MQD A;  1DPE A;  1UQW A;  1GV8 A;  2D3I A;  3LUY A;  3CG3 A;  4YAH X;  1MY2 A;  4DXU A;  1AH5 A;  1DTG A;  3THI A;  1USY H;  2ZMB A;  5H8H B;  3TUS A;  1ZJL A;  2UVJ A;  2QL3 A;  4ELP A;  3CSB A;  1YTV A;  3OXN A;  1I69 A;  5CMM A;  3MWB A;  3TDJ A;  3S9E A;  3QYT A;  1B5H A;  1IXH A;  1QVS A;  3TTM A;  4HS7 A;  3PPR A;  1VR5 A;  3OO8 A;  3U72 A;  4OYV A;  5CBS A;  2F78 A;  2O68 A;  4LON B;  5H8N B;  1NNP A;  3PPQ A;  4L17 A;  5JEI A;  3I3V A;  5A5X A;  1SW1 A;  1B0H A;  1Y3P A;  1Y3Q A;  4G8H A;  3U8Q A;  4FED A;  3MJN A;  1SYI A;  4JWX A;  4ZZA A;  2Y7R A;  4GLI A;  5HM4 B;  3OEN A;  4LP2 B;  4WED A;  2DXR A;  4ELO A;  2F6G A;  1B3L A;  1NMU A;  3ZKL A;  2R71 A;  4TOZ A;  1XHY A;  1OLA A;  5FTI A;  2BJJ X;  4KCD A;  3Q26 A;  1R9L A;  4IB2 A;  3N6T A;  4KYD A;  1B4Z A;  1S9T A;  1B5I A;  2HQ0 A;  3ZS6 A;  1P1U A;  2Q8J A;  3U94 A;  2QS3 A;  2XXY A;  2O7U A;  2REG A;  3H03 A;  1A7L A;  2Y84 A;  2HFB A;  4RPO A;  4NMY A;  1B9J A;  4KYS A;  3FD3 A;  1OLC A;  1B3F A;  4JWY A;  1JW4 A;  3IOR A;  2IA4 A;  3E4R A;  2AL4 A;  4C0R A;  2VGQ A;  3I5O A;  2DYX A;  3O6H A;  4F29 A;  1QUJ A;  4EQ9 A;  3IOW A;  3LR1 A;  2OK2 A;  2F34 A;  1MQI A;  4C1T A;  1T0K A;  5DVI A;  3BFT A;  2RC7 A;  4HTG A;  3FXU A;  1JW1 A;  3KSX A;  3MW0 A;  1LAX A;  3PPO A;  4H6D A;  5L9O A;  2UYE A;  4OEU A;  1OQG A;  4LUB A;  1DPP A;  1I6Q A;  2I48 A;  3FIR A;  3G3K A;  4F3G A;  3VFJ A;  3CFX A;  3MBP A;  3T66 A;  2V84 A;  2ONK E;  1MXY A;  1VFD A;  1F9B A;  4IO2 A;  1NKX A;  3IOV A;  4GRK A;  4PFT A;  1SVX B;  3VDF A;  2O84 X;  1EZO A;  1MY0 A;  3B7D A;  4TLM B;  4R75 A;  5IKB A;  2GHB A;  1DSN A;  5H8S A;  4QSC A;  2GH9 A;  3MPK A;  3G3H A;  2XX8 A;  5I56 B;  4HCY A;  3V89 B;  4QFL A;  1PB7 A;  1O63 A;  2HXW A;  2ABH A;  4F1V A;  4X1B A;  1JW5 A;  2H9B A;  3SEV A;  3K6U A;  4F19 A;  4X1D A;  4QFN A;  3UGW A;  1N84 A;  4LQ2 A;  5TPA A;  2XHD A;  3K6V A;  2XXR A;  4R9F A;  3OO9 A;  1UIU A;  5L9S A;  3IOU A;  1MXU A;  1VFE A;  1B32 A;  5I57 A;  3UOR A;  1TFA A;  3TEL A;  1OMP A;  1MQH A;  1NNK A;  3IB2 A;  1B6H A;  2QJE A;  2Y7K A;  4OQO A;  2M8C A;  1OVB A;  2I3V A;  5B7D A;  4DCX A;  3Q27 A;  3TTR A;  1XT8 A;  4IO7 A;  1MPC A;  1LCT A;  2P1S A;  1SQY A;  3LSW A;  5AA4 A;  1Z7M E;  4YB6 A;  1LFI A;  3FAS A;  3OMB A;  4POW A;  4NF4 A;  1TWY A;  2R9J A;  3D4C A;  1A99 A;  3G3F A;  3DLN A;  3MPL A;  2QPQ A;  3FAT A;  3EPE A;  5I58 B;  1VSO A;  4H8I A;  5ITP A;  4QSD A;  4ZED A;  4FAT A;  3RQT A;  4ESX A;  2YJP A;  4H5F A;  1EZP A;  4OFO A;  1SW2 A;  4U21 A;  5DTB A;  2X26 A;  1EU8 A;  4ELQ A;  1FCK A;  2QS4 A;  1UTB A;  3F11 A;  4XKQ A;  1S50 A;  1JNF A;  2DE2 A;  3WAF A;  4X9T A;  2B65 A;  1CE2 A;  1QUL A;  2CZL A;  3PUW E;  4G68 A;  4BDL A;  5I2N A;  1XS5 A;  3OSR A;  4U4S A;  4EXK A;  1BLF A;  1LAF E;  1DTZ A;  3FVK A;  2XXH A;  5DEX B;  3T9X B;  2PX1 A;  2VOZ A;  3IJO B;  1WVJ A;  1B7Z A;  4IGT A;  3K1P A;  3H6W A;  1P1Q A;  2RC9 A;  1M5C A;  4LA9 A;  4GL8 A;  3V83 A;  3FZV A;  3FV2 A;  5DYH A;  1LAG E;  4BDN A;  2HCA A;  4F2Q A;  3C9H A;  2OWT A;  4YKI A;  1MXV A;  3DP4 A;  5CMC A;  4EXL A;  3PMW A;  4JSD A;  2ZYO A;  3CVG A;  4GF8 A;  4P0G A;  4ZEC A;  3SER A;  3Q28 A;  3PGF A;  3MUQ A;  3TKD A;  4U1O A;  1ZLQ A;  4YMB A;  1SI0 A;  1B1H A;  1B7H A;  5KCJ A;  4KQP A;  4MBP A;  3IO4 A;  4F2O A;  3EF7 A;  4OVJ A;  1A8E A;  2DWA A;  3TCG A;  2Z8F A;  1TXF A;  1XOC A;  1LBC A;  2G29 A;  3K01 A;  1B3H A;  3TFL A;  1FQC A;  2DWH A;  1LAH E;  2HZL A;  3MZ1 A;  4MLV A;  1ZTY A;  4KR5 A;  4H5G A;  1LCF A;  2RCB A;  3KGC A;  3LSL A;  4R6Y A;  4IO6 A;  4GFR A;  4LZ5 A;  1B51 A;  3K1N A;  3G7W A;  1LFG A;  4N13 A;  1JVX A;  3VXB A;  3CG1 A;  3KZG A;  3IJX B;  1FTL A;  4F1U A;  2DS9 A;  2UYF A;  1I6A A;  1MY3 A;  1H76 A;  5DT6 A;  1ATG A;  2PYY A;  1I6B A;  2Q9T A;  5EHS A;  2I49 A;  5KDT A;  3B6W A;  4IO4 A;  4BDO A;  1AL3 A;  5TU0 A; 
#chains in the Genus database with same CATH topology
 4R2B A;  1G0I A;  3TPA A;  3W15 C;  3KOS A;  4HE2 A;  2DE4 A;  2F3D A;  1N7W A;  2XD2 A;  5A5X B;  4U23 A;  2ANJ A;  1N0T A;  4I9D A;  4G8M A;  4OA4 A;  4G2Z A;  4HE0 A;  4Q0C A;  4I1D A;  2RC8 A;  1FSA A;  4R9G A;  4TLL B;  4PAI A;  4ZS9 A;  4NWD A;  4F18 A;  4XF5 A;  4HE1 A;  4ESW A;  4BDM A;  4MAG A;  4O7M A;  2VD2 A;  2B4L A;  3T1B A;  1H43 A;  3O28 A;  4IY6 A;  1Q1K A;  1ZKB A;  3RGY A;  5I7I A;  5HBC A;  1AMF A;  1N76 A;  5LDZ A;  4BDQ A;  3H6U A;  4KXP A;  3T9H B;  1NH7 A;  3T9V A;  1H44 A;  5ESY A;  3AXF A;  3A3U A;  2HEU A;  4PQJ A;  2NXO A;  1LST A;  4P1L A;  2OBG A;  3OD7 A;  3RTF B;  3SDF A;  4H65 A;  2PT2 A;  3OSQ A;  2OZZ A;  3UA8 A;  3OO6 A;  1MY4 A;  2VPN A;  4EF1 A;  2DXY A;  3A3C A;  4EDP A;  1MDP 1;  1SYH A;  1FQD A;  1FJ9 A;  4U1Z A;  1BTJ A;  4NF6 A;  4G77 A;  3VE1 B;  4MF3 A;  3JYR A;  2AYS A;  1UTH A;  2XA5 A;  5L9M A;  3MVY A;  3O66 A;  4F39 A;  3UP9 A;  3KC1 A;  2Z22 A;  5FHO A;  2QVR A;  5BUU A;  4RK2 A;  4O3C A;  1P1N A;  3C35 A;  1YAE A;  1A55 A;  4YKK A;  2VP1 A;  3K02 A;  5EYG A;  4GVO A;  3TAJ A;  1IIT A;  1IMD A;  4NX1 A;  1CB6 A;  2R6G E;  3FGS A;  4KHZ E;  4P56 A;  2DE3 A;  4IGR A;  1Q35 A;  3V5A A;  4ELR A;  1N3X A;  3IOT A;  2O69 A;  4YB7 A;  3OOA A;  3M3K A;  4P0I A;  1SW5 A;  4ZE8 A;  5F24 A;  4MFI A;  3OEM A;  3LSF B;  1B7U A;  3GBB A;  4AQ4 A;  3QAX A;  4FJP A;  1B52 A;  2A5S A;  1B3G A;  3HO7 A;  4NQ8 A;  2I0C A;  4KI0 E;  1IXI A;  2ZXT A;  4X8R A;  4O3A A;  2XXI A;  4NED A;  3TYH A;  1FPJ A;  3K0V A;  4OWD A;  1HSE A;  4PF8 A;  3C32 A;  1JQF A;  3HPI A;  4E0X A;  1WOD A;  4OFJ A;  2XWK A;  3E79 A;  1H45 A;  1Y4T A;  3TTL A;  3N6U A;  1IZ1 A;  1NV2 A;  2ONS A;  2QS2 A;  4GWU A;  3ODB A;  2VPO A;  4F22 A;  3HN0 A;  1PB9 A;  3FUZ A;  1NV4 A;  2DVC A;  3KBZ A;  2UVH A;  4MX6 A;  1OIB A;  2I0B A;  2QSX A;  5JTY A;  1FBE A;  1MXZ A;  3LBS A;  1LEV A;  4H8J A;  4PFY A;  3TCH A;  1TFD A;  1BP5 A;  5TPA B;  1QUI A;  4OEN A;  1KWH A;  5I2K A;  5ISU A;  2FYI A;  3O6I A;  1IMC A;  5I57 B;  1CNQ A;  4F31 B;  4OAN A;  1KA0 A;  3QUF A;  1PEB A;  2Y5L A;  2V93 A;  4X04 A;  2PT1 A;  3G3I A;  2ZYN A;  3UN6 A;  1NV0 A;  3HHG A;  4P3L A;  4QFO A;  3K2D A;  4KD5 A;  2OLB A;  4XXU A;  1FBH A;  1LBW A;  4ND9 A;  4PFW A;  4NE4 A;  1LLS A;  1PBP A;  4NF8 A;  4GIZ A;  5AA4 B;  3K6X A;  3KJT A;  2O1M A;  4KPT A;  2ZZX A;  1N7X A;  3PV0 E;  4TQU Q;  3WAE A;  3JZJ A;  1JVY A;  4H46 A;  2V4C A;  1AWB A;  5AA1 A;  3SKP A;  4NF4 B;  3SEY A;  3FVG A;  2F8D A;  3T22 A;  2GFE A;  2BJI A;  5JK4 A;  3BFU A;  4LVQ A;  3Q25 A;  2MKZ A;  4QRZ A;  1P99 A;  3R26 A;  4FEB A;  4YMA A;  2XXP A;  3TOD A;  1MPD A;  2CMO A;  3MC2 A;  3B8B A;  3LUZ A;  3USD A;  3QSL A;  1IME A;  1QW0 A;  1FTO A;  1LGB C;  1UTB B;  3TCF A;  3KN3 A;  4RY1 A;  4DDD A;  4ECF A;  1NUZ A;  5T3J A;  3SEW A;  4M4G A;  2NVU B;  2H5Y A;  4G68 B;  1XVY A;  2IEE A;  5I2N B;  5LOM A;  1FTK A;  1JEU A;  1KA1 A;  4XTC Q;  4H1X A;  3BBR A;  3JV9 A;  4R6H A;  4HXV A;  4F3P A;  3IO6 A;  1B58 A;  3PUV E;  2H98 A;  3ISP A;  3CFL A;  3IR1 A;  3DM0 A;  4FAJ A;  4G68 C;  1Y20 A;  1LBB A;  1GVC A;  1USY E;  3O97 A;  2ZYM A;  5AA3 A;  2B3B A;  2YPN A;  3EHT A;  5I84 A;  1MM6 A;  4MHF A;  3H4Z A;  1LBY A;  4ZEB A;  4PFB A;  2V25 A;  3PPP A;  1US5 A;  4NGU A;  1QUK A;  4BLA A;  5H8F A;  4G4P A;  4BDR A;  5I59 A;  3N26 A;  3FJ7 A;  1M5E A;  2Q2A A;  5DW8 A;  4P11 A;  5KCJ B;  4QSE A;  3ILU B;  4QFP A;  1R6Z A;  5ELV A;  2RIN A;  1SPI A;  3R6U A;  3K6W A;  4N4U A;  4OEV A;  4FOR A;  3FJG A;  2DP8 A;  1A54 A;  3E78 A;  3BIH A;  3K4U A;  1ZMG A;  3GBA A;  3P7I A;  1O7T A;  4OFL A;  4LQ5 A;  2G93 A;  4EQ7 A;  4AS5 A;  1SW4 A;  2QS1 A;  1EZ9 A;  3PD9 A;  3B6T A;  1DK4 A;  4R72 A;  2QVU A;  4WXJ A;  3KN7 A;  1B2H A;  3PUY E;  3VV5 A;  3VLV A;  4LN5 A;  5AA2 A;  2H4I A;  4JBZ A;  2REJ A;  1Z7N E;  5KZT A;  4EUO A;  4ZEF A;  3CFZ A;  4GBV A;  1OQH A;  1MRP A;  2XXU A;  2Z8D A;  4ISU A;  5EYH A;  1NV6 A;  1UIV A;  2FVZ A;  4UAC A;  2XXW A;  2FBP A;  3C33 A;  3O9P A;  4ONY A;  2QVV A;  2PBW A;  3OEL A;  4GX3 A;  2YLN A;  4JVC A;  1JP4 A;  4YIC A;  4NHB A;  4QBA A;  3S2V A;  2I4C A;  1US4 A;  5KDT B;  4PP0 A;  5TP9 A;  4OZ9 A;  3IK6 B;  3U92 A;  3LSX A;  3FVN A;  2F3B A;  2P3N A;  4R6K A;  3CSG A;  2PVU A;  1ZIU A;  2V3U A;  1LBV A;  3S9M C;  1PC3 A;  3GYY A;  4PDH A;  5DVF A;  2F97 A;  2QFL A;  2DQV A;  1SDX A;  1PB8 A;  1Y3N A;  1SI1 A;  1D4N A;  3L6H A;  2HAU A;  2ALU A;  5H8Q A;  2DWJ A;  1D9Y A;  3UK4 A;  4I8C A;  4I62 A;  5ET6 A;  4XKP A;  4DE8 A;  3K00 A;  2ZNS A;  4HCW A;  4DCY A;  2XXQ A;  5FTH A;  3EHS A;  3RT6 B;  1FQE A;  1DOT A;  1M5B A;  3DP8 A;  4DLD A;  1B4H A;  4OES A;  4KFQ A;  3DEL B;  3MQ9 A;  4PCD A;  4GL0 A;  3PMX A;  2LAO A;  1D9V A;  1H3D A;  2A5T A;  3M8U A;  4IR8 A;  2QRY A;  1SBP A;  1PBQ A;  1MM7 A;  1O64 A;  4MH5 A;  4YB5 A;  2W7Y A;  3H7M A;  3D1R A;  1XVX A;  1MXX A;  4RNS A;  2JJK A;  3N94 A;  3H6V A;  2HZK A;  5IZ3 A;  1GTK A;  4NF6 B;  1HSJ A;  1ANF A;  5CRY A;  2DSF A;  1AOV A;  3S9L C;  5I5P A;  4U22 A;  1FRP A;  1UTH B;  3KJ7 A;  1Q9D A;  3KSJ A;  3T9U A;  3GLB A;  2DOJ A;  3QK6 A;  3HFU A;  4NF5 A;  4PFU A;  3LV0 A;  2R8T A;  3RUM A;  4N6K A;  1RDX A;  2Y7W A;  2WEF A;  1VE4 A;  3LC8 A;  1B46 A;  3E13 X;  4QHQ A;  1NFT A;  1DCU A;  4XEQ A;  1FQB A;  4Z0I A;  3BIG A;  3UIF A;  2E1S A;  3HST A;  2D21 A;  4XKN A;  1D3K A;  3B6Q A;  1GR2 A;  2PFZ A;  2P0S A;  4G8N A;  1PDA A;  2I6E A;  2O1L A;  1FPD A;  3TZA A;  3D4G A;  2I58 A;  5EYF A;  5H8H A;  3EHU A;  4OVT A;  1B05 A;  3TEP A;  3FJM A;  1RYX A;  2P2A A;  3PD8 A;  4PGN A;  1FW0 A;  2Q88 A;  2THI A;  3SEU A;  3KN8 A;  3E3K A;  3B50 A;  4JSO A;  1A40 A;  4PE5 B;  3BKI B;  4OTE A;  1NV5 A;  2QMX A;  1YZ0 A;  3K1M A;  3A29 A;  2GQ1 A;  5L8D A;  1IIW A;  2O51 A;  5ICT A;  3GZG A;  1B0L A;  2Q89 A;  5H8N A;  1MG1 A;  4PTK A;  4HW8 A;  5JTY B;  1IUD A;  1NNF A;  2VT5 A;  1P1W A;  4QFK A;  4E0W A;  1Y4C A;  3KBR A;  1RYO A;  3N5L A;  3ILT B;  2FIE A;  2Z8E A;  3HCQ A;  5I2K B;  5I3S A;  4GWO A;  2AIX A;  3DP6 A;  3ECR A;  1YCJ A;  4PC9 A;  3ZKK A;  3C4M A;  4JWO A;  2Q74 A;  3MAM A;  1MPB A;  5F7V A;  1LB8 A;  5EHM A;  3MP6 A;  4WKM A;  3IAZ A;  2XX7 A;  3FV1 A;  4N07 A;  3S4U A;  3MVZ A;  2E0S A;  4FIM A;  5ICQ A;  4ZZE A;  3EN3 A;  2AL5 A;  1BKA A;  1D9Q A;  1MS7 A;  3H6T A;  2F6P A;  1L5T A;  3SES A;  4O94 A;  3L6G A;  2ZYK A;  4NF8 B;  3FXB A;  1TT1 A;  3S9N C;  4FEC A;  4F3S A;  3RPW A;  1NUW A;  2UVG A;  5HPQ A;  3SEX A;  3PU5 A;  3VLU A;  5CM6 A;  1IMF A;  3E9X A;  2PMS A;  4YKJ A;  1POY 1;  3TQL A;  4NWC A;  4PDD A;  5F1Q A;  4LZ7 A;  5FBP A;  3T0J A;  3O2A A;  2PCR A;  4U2R A;  1IXC A;  2OCU A;  2UXA A;  1QGX A;  3A09 A;  3RPL A;  4LAT A;  4ZE9 A;  4YKP A;  5ET8 A;  3QXM A;  1B5J A;  2V3Q A;  1N3W A;  4K3F A;  4KYE A;  2RKM A;  4IY5 A;  5IGA A;  3IB1 A;  3G3J A;  2NUV A;  4RYA A;  3U1O A;  5AA2 D;  1FPI A;  1QKA A;  4H0W A;  2Y7I A;  3IL1 B;  4AS4 A;  4OMB A;  2OJT A;  2ZNT A;  1IQ7 A;  4GXS B;  1FPG A;  3IB0 A;  1B3E A;  3OO7 A;  4EQB A;  2H99 A;  3MP8 A;  4PET A;  3MP1 A;  1Y9U A;  1INP A;  3T96 B;  2WBD A;  2OX3 A;  4WEP A;  2F7C A;  5IM2 A;  4JXI A;  3RYD A;  4IO3 A;  1RDY A;  1URS A;  2RCA A;  4JB7 A;  5J1D A;  2ZNU A;  2XXV A;  5K2X A;  1NNT A;  4F3B A;  4AB5 A;  2QMW A;  1AIV A;  1EH3 A;  2HAV A;  4ZEK A;  4ZDM A;  4DIG A;  3I6V A;  4MNI A;  3O29 A;  5ET5 A;  2H25 A;  3M3L A;  2NOO A;  4PBQ A;  2Y5K A;  1FQF A;  4MNC A;  4M1V A;  5I56 A;  4YZZ A;  3RT8 A;  4R2F A;  1BK4 A;  4N8Y A;  1RDZ A;  4X48 A;  3W9V A;  2HHM A;  5H8F B;  5ET7 A;  1BIY A;  1MH4 A;  3EQ1 A;  5I59 B;  4Q8R A;  3SET A;  3KG2 A;  1MQJ A;  3FVO A;  1RKM A;  2CEY A;  4LZ8 A;  2I3W A;  3MZB A;  4FE8 A;  3RY3 A;  2XXX A;  4R73 A;  4AB6 A;  4NTL A;  4RJZ A;  2WBB A;  1DBZ A;  2Y7P A;  2CZI A;  2Q2C A;  3H06 B;  1POT A;  2F5X A;  3W9W A;  1MH3 A;  1FTJ A;  1A8F A;  3TQW A;  2F7A A;  3M3F A;  3SZP A;  4XIG Q;  1EYK A;  2XD3 A;  2F7B A;  4OVQ A;  4OET A;  1ELJ A;  4DZ1 A;  3IFC A;  3VVF A;  1GGG A;  1II5 A;  1SD3 A;  5CC2 A;  5K2Y A;  2KLF A;  4RA1 A;  4GWW A;  1JEV A;  3PUZ E;  1B40 A;  5AA2 B;  4H67 A;  5B70 A;  3ZSF A;  1XC1 A;  1LFH A;  1NH8 A;  4R74 A;  3VXC A;  1IEJ A;  2CZH A;  4QF9 A;  4JDF A;  3CIJ A;  3QUJ A;  3FXQ A;  2F35 A;  1FBG A;  2ESN A;  1FQA A;  4GWX A;  1JET A;  5I58 A;  2OWZ A;  3G3G A;  4UA8 A;  2I4B A;  1ZBM A;  5M2V A;  3RLF E;  4P9K A;  3PPN A;  2DWI A;  3C34 A;  3V8X B;  5TP9 B;  4Z7E A;  2UVI A;  4IO5 A;  5BWJ A;  1Y1Z A;  1FJ6 A;  4YU0 A;  3QIM A;  2HXR A;  1YPN A;  2DDK A;  2Z23 A;  3ONM A;  4ZEI A;  4DXC A;  1LB9 A;  2CZK A;  2DVZ A;  2GHA A;  3KFM A;  4POX A;  1URD A;  1FBC A;  1ZU0 A;  3MZ9 A;  5H8Q B;  1MXW A;  1S7Y A;  4PFR A;  3MVW A;  2X7Q A;  4OER A;  2B3F A;  5FHN A;  4NF0 A;  3TTN A;  4OHN A;  4U4X A;  3FXR A;  2RF1 A;  3RTW B;  3TTK A;  3VVE A;  3IFA A;  2ONR A;  5DEX A;  5DVJ A;  3VVD A;  1DMB A;  4GQO A;  3CRB A;  3PMV A;  4RPN A;  4RXL A;  4THI A;  3H3G A;  3T93 B;  2X7P A;  4GX4 A;  2A5T B;  1MDQ A;  4GWY A;  4PFI A;  4EF2 A;  1B1X A;  1R9Q A;  1MY1 A;  3C31 A;  1M5D A;  2O7I A;  2V3T A;  1J1N A;  4RK9 A;  2FNC A;  1N04 A;  1WDN A;  3U93 A;  2WYP A;  4GOT A;  4GD5 A;  5AE4 A;  1FPF A;  4Q30 B;  4XKR A;  4OXV A;  2WKY A;  1Y1M A;  3TMG A;  2VHA A;  4Q5T A;  1NUY A;  5CBR A;  1FTM A;  4P47 A;  3VLW A;  1HSL A;  3O6G A;  2FA7 A;  5IZ3 B;  3HV1 A;  2VD3 A;  1MQG A;  3PUX E;  1M5F A;  5CMB A;  2L5V A;  3KEI A;  1NI9 A;  5FHM A;  4F1Y A;  2F36 A;  1LBZ A;  1QKB A;  3CR9 A;  1FPK A;  2GRV A;  2PFY A;  5ITO A;  1LBX A;  1EYJ A;  3OEK A;  4GXA A;  3R7X A;  4N6P A;  5IAI A;  1URG A;  4NF5 B;  2XXT A;  4C1U A;  1NL5 A;  3IX1 A;  4KCC A;  1OVT A;  2NWJ A;  3GXA A;  5CMK A;  1FBD A;  1QJM A;  3C36 A;  3MST A;  3KOT A;  2B4M A;  3RNN A;  1R1N A;  2O6A A;  3HHF A;  5LTC A;  2OWS A;  4MLQ A;  5CI5 A;  4JVI A;  1IXG A;  3MVX A;  1P1O A;  5J16 A;  3KC0 A;  3Q29 A;  4O3B A;  2D5W A;  3QMF A;  3RN8 A;  2XX9 A;  3CI8 A;  4I3E A;  4DXB A;  1MQD A;  1DPE A;  1UQW A;  1GV8 A;  2D3I A;  1FTA A;  3LUY A;  3CG3 A;  4YAH X;  2WX9 A;  1MY2 A;  1FPB A;  4DXU A;  1AH5 A;  1DTG A;  3THI A;  1USY H;  4GWS A;  2ZMB A;  5H8H B;  3TUS A;  1ZJL A;  2UVJ A;  2QL3 A;  4ELP A;  3CSB A;  1K9Y A;  1YTV A;  3OXN A;  1I69 A;  5CMM A;  3MWB A;  3TDJ A;  3S9E A;  3QYT A;  1B5H A;  1IXH A;  1QVS A;  3TTM A;  4HS7 A;  4N81 A;  3FBP A;  3PPR A;  1VR5 A;  3OO8 A;  3U72 A;  4OYV A;  5CBS A;  2F78 A;  2O68 A;  4LON B;  5H8N B;  2XWO A;  3NOH A;  4O8M A;  4I40 A;  1NNP A;  3PPQ A;  4L17 A;  5JEI A;  3I3V A;  5A5X A;  1SW1 A;  1B0H A;  1EYI A;  1Y3P A;  1Y3Q A;  4G8H A;  3U8Q A;  4FED A;  3MJN A;  1SYI A;  4GBW A;  3PTY A;  4JWX A;  4ZZA A;  2Y7R A;  4DI4 B;  4GLI A;  4N6D A;  5HM4 B;  2XWI A;  3OEN A;  4LP2 B;  4WED A;  2DXR A;  4ELO A;  2F6G A;  1G0H A;  4NN3 A;  1B3L A;  1NMU A;  2R71 A;  4TOZ A;  3ZKL A;  1YYZ A;  1XHY A;  2XWV A;  1OLA A;  5FTI A;  2BJJ X;  4KCD A;  3Q26 A;  1R9L A;  4IB2 A;  3N6T A;  4KYD A;  1B4Z A;  1S9T A;  1B5I A;  3ROJ A;  2HQ0 A;  3ZS6 A;  1P1U A;  2Q8J A;  3U94 A;  2QS3 A;  2XXY A;  2O7U A;  4PGP A;  4OVP A;  4OVR A;  2REG A;  3H03 A;  1A7L A;  2Y84 A;  2HFB A;  4RPO A;  4NMY A;  1B9J A;  4KYS A;  3FD3 A;  1OLC A;  2HPG A;  1XI6 A;  1B3F A;  2ZZV A;  4JWY A;  1KZ8 A;  1JW4 A;  3IOR A;  2IA4 A;  3E4R A;  3RPL B;  2AL4 A;  4C0R A;  2VGQ A;  3I5O A;  2DYX A;  3O6H A;  4F29 A;  4NG7 A;  1QUJ A;  4EQ9 A;  3IOW A;  3LR1 A;  2OK2 A;  2F34 A;  1MQI A;  4C1T A;  4MJO A;  1T0K A;  5DVI A;  3BFT A;  2RC7 A;  4HTG A;  3FXU A;  1JW1 A;  3KSX A;  3MW0 A;  1LAX A;  3PPO A;  4H6D A;  5L9O A;  2UYE A;  4OEU A;  1OQG A;  4LUB A;  1DPP A;  1I6Q A;  2I48 A;  3FIR A;  3G3K A;  4F3G A;  3VFJ A;  3CFX A;  4N17 A;  3MBP A;  3T66 A;  2V84 A;  2ONK E;  2FIX A;  1MXY A;  1VFD A;  1F9B A;  4IO2 A;  1NKX A;  3IOV A;  4GRK A;  4G61 A;  4PFT A;  1SVX B;  3VDF A;  2O84 X;  1EZO A;  1MY0 A;  3B7D A;  4TLM B;  2FHY A;  4R75 A;  5IKB A;  2GHB A;  1DSN A;  5H8S A;  4QSC A;  2GH9 A;  3MPK A;  3G3H A;  2XX8 A;  5I56 B;  4NAP A;  4HCY A;  3V89 B;  4QFL A;  1PB7 A;  1O63 A;  2HXW A;  2ABH A;  1NV3 A;  4F1V A;  4X1B A;  1JW5 A;  2H9B A;  3SEV A;  4H45 A;  3K6U A;  4F19 A;  4X1D A;  4QFN A;  3UGW A;  1N84 A;  4LQ2 A;  5TPA A;  2XHD A;  3K6V A;  4MMP A;  2XXR A;  2Q8M A;  4R9F A;  3OO9 A;  1UIU A;  5L9S A;  5EQ9 A;  3IOU A;  1MXU A;  1VFE A;  4N91 A;  1B32 A;  5I57 A;  1VDW A;  1FPE A;  4I3Y A;  3UOR A;  1TFA A;  4FBP A;  3TEL A;  4PAF A;  1OMP A;  1MQH A;  1NNK A;  3IB2 A;  1B6H A;  2QJE A;  2Y7K A;  4OQO A;  2M8C A;  1OVB A;  2I3V A;  5B7D A;  4DCX A;  1FPL A;  3Q27 A;  3TTR A;  1XT8 A;  4IO7 A;  2KR0 A;  1MPC A;  1LCT A;  2P1S A;  1SQY A;  3LSW A;  1K9Z A;  3MYU A;  5AA4 A;  5IZZ A;  1Z7M E;  4YB6 A;  4GWZ A;  1LFI A;  3FAS A;  3OMB A;  4POW A;  4PAK A;  4NF4 A;  1TWY A;  2R9J A;  3D4C A;  1A99 A;  3G3F A;  3DLN A;  3MPL A;  2QPQ A;  4DI3 D;  3FAT A;  3EPE A;  5I58 B;  4MIJ A;  1FBF A;  1VSO A;  4H8I A;  5ITP A;  4QSD A;  5EQ7 A;  4ZED A;  4FAT A;  3RQT A;  4UAB A;  4ESX A;  2YJP A;  4H5F A;  1EZP A;  1IMA A;  4OFO A;  2CEX A;  1SW2 A;  4U21 A;  5DTB A;  2X26 A;  1EU8 A;  4ELQ A;  1FCK A;  2QS4 A;  1UTB A;  3F11 A;  4XKQ A;  1S50 A;  1JNF A;  2DE2 A;  3WAF A;  4X9T A;  2P3V A;  2ZZW A;  2B65 A;  1CE2 A;  1QUL A;  2CZL A;  3PUW E;  4G68 A;  4BDL A;  5I2N A;  4N8G A;  1XS5 A;  4PBH A;  3OSR A;  4U4S A;  4EXK A;  1BLF A;  1LAF E;  1DTZ A;  3FVK A;  2XXH A;  5DEX B;  1NUX A;  3T9X B;  2PX1 A;  4P8B A;  2VOZ A;  3IJO B;  4MCO A;  1WVJ A;  1B7Z A;  2WYK A;  4IGT A;  3K1P A;  4MNP A;  3H6W A;  1P1Q A;  2RC9 A;  1M5C A;  4LA9 A;  4GL8 A;  3V83 A;  3FZV A;  3FV2 A;  5DYH A;  1LAG E;  4BDN A;  2HCA A;  4XFE A;  4F2Q A;  3EKI A;  3C9H A;  2OWT A;  4YKI A;  1MXV A;  1YXI A;  3DP4 A;  5CMC A;  4EXL A;  5EQ8 A;  3PMW A;  4JSD A;  4P1E A;  1FBP A;  2KQZ A;  2ZYO A;  3CVG A;  4GF8 A;  4P0G A;  4ZEC A;  3SER A;  3Q28 A;  3PGF A;  3MUQ A;  5IZ1 A;  3TKD A;  4U1O A;  1ZLQ A;  4YMB A;  1SI0 A;  1B1H A;  1B7H A;  5KCJ A;  4KQP A;  4MBP A;  3IO4 A;  4O7I A;  4F2O A;  3U65 A;  3EF7 A;  4OVJ A;  2XXK A;  1NV7 A;  1A8E A;  2DWA A;  3TCG A;  2Z8F A;  1TXF A;  1XOC A;  1LBC A;  2G29 A;  3K01 A;  1B3H A;  3TFL A;  1FQC A;  2DWH A;  1LAH E;  2HZL A;  3MZ1 A;  4MLV A;  1ZTY A;  4KR5 A;  4H5G A;  1LCF A;  2RCB A;  3KGC A;  3LSL A;  3CHG A;  4R6Y A;  4IO6 A;  4MEV A;  5A5L A;  4GFR A;  4LZ5 A;  1B51 A;  3K1N A;  4JVD A;  3G7W A;  1LFG A;  4N13 A;  1JVX A;  3VXB A;  4PE3 A;  3CG1 A;  3KZG A;  3IJX B;  1FTL A;  4F1U A;  2DS9 A;  2UYF A;  1I6A A;  1MY3 A;  4QXD A;  1H76 A;  5DT6 A;  1ATG A;  2PYY A;  1I6B A;  4OVS A;  1NV1 A;  2Q9T A;  1IMB A;  5EHS A;  2I49 A;  5KDT A;  3B6W A;  4IO4 A;  4BDO A;  4PF6 A;  4N15 A;  5EQA A;  1AL3 A;  5TU0 A;  4GX6 A; 
#chains in the Genus database with same CATH homology
 4R2B A;  3TPA A;  3W15 C;  3KOS A;  2DE4 A;  1N7W A;  2XD2 A;  5A5X B;  4U23 A;  2ANJ A;  1N0T A;  4I9D A;  4G8M A;  4G2Z A;  4Q0C A;  4I1D A;  2RC8 A;  4R9G A;  4TLL B;  4ZS9 A;  4NWD A;  4F18 A;  4ESW A;  4BDM A;  2VD2 A;  1H43 A;  3O28 A;  4IY6 A;  1ZKB A;  1Q1K A;  3RGY A;  5HBC A;  1AMF A;  1N76 A;  4BDQ A;  3H6U A;  3T9H B;  1NH7 A;  3T9V A;  1H44 A;  3AXF A;  3A3U A;  2HEU A;  4PQJ A;  2NXO A;  1LST A;  2OBG A;  3OD7 A;  3RTF B;  3SDF A;  4H65 A;  2PT2 A;  3OSQ A;  2OZZ A;  3UA8 A;  3OO6 A;  1MY4 A;  4EF1 A;  2DXY A;  3A3C A;  4EDP A;  1MDP 1;  1SYH A;  1FQD A;  4U1Z A;  1BTJ A;  4NF6 A;  4G77 A;  3VE1 B;  4MF3 A;  3JYR A;  2AYS A;  1UTH A;  5L9M A;  3MVY A;  3O66 A;  4F39 A;  3UP9 A;  2Z22 A;  5FHO A;  5BUU A;  4RK2 A;  4O3C A;  1P1N A;  3C35 A;  1YAE A;  1A55 A;  4YKK A;  2VP1 A;  3K02 A;  4GVO A;  3TAJ A;  1IIT A;  1CB6 A;  2R6G E;  3FGS A;  4KHZ E;  2DE3 A;  4IGR A;  1Q35 A;  3V5A A;  4ELR A;  1N3X A;  3IOT A;  2O69 A;  4YB7 A;  3OOA A;  3M3K A;  4P0I A;  1SW5 A;  4ZE8 A;  4MFI A;  3OEM A;  3LSF B;  1B7U A;  3GBB A;  4AQ4 A;  3QAX A;  4FJP A;  1B52 A;  2A5S A;  1B3G A;  3HO7 A;  2I0C A;  4KI0 E;  1IXI A;  2ZXT A;  4O3A A;  2XXI A;  4NED A;  3TYH A;  3K0V A;  4OWD A;  1HSE A;  3C32 A;  1JQF A;  3HPI A;  4E0X A;  1WOD A;  4OFJ A;  1H45 A;  1Y4T A;  3TTL A;  3N6U A;  1IZ1 A;  2QS2 A;  2ONS A;  3ODB A;  4F22 A;  3HN0 A;  1PB9 A;  3FUZ A;  2DVC A;  2UVH A;  1OIB A;  2I0B A;  2QSX A;  5JTY A;  1MXZ A;  3LBS A;  4H8J A;  4PFY A;  3TCH A;  1TFD A;  1BP5 A;  5TPA B;  1QUI A;  4OEN A;  1KWH A;  5I2K A;  5ISU A;  2FYI A;  3O6I A;  5I57 B;  4F31 B;  3QUF A;  1PEB A;  2V93 A;  2PT1 A;  3G3I A;  2ZYN A;  3UN6 A;  3HHG A;  4QFO A;  3K2D A;  4KD5 A;  2OLB A;  4XXU A;  4ND9 A;  4PFW A;  4NE4 A;  1LLS A;  1PBP A;  4NF8 A;  4GIZ A;  5AA4 B;  3K6X A;  3KJT A;  2O1M A;  4KPT A;  1N7X A;  3PV0 E;  4TQU Q;  3WAE A;  3JZJ A;  1JVY A;  5AA1 A;  3SKP A;  4NF4 B;  3SEY A;  3FVG A;  2F8D A;  3T22 A;  2GFE A;  5JK4 A;  3BFU A;  4LVQ A;  3Q25 A;  4QRZ A;  1P99 A;  3R26 A;  4FEB A;  4YMA A;  2XXP A;  3TOD A;  1MPD A;  2CMO A;  3MC2 A;  3USD A;  3QSL A;  1QW0 A;  1FTO A;  1LGB C;  1UTB B;  3TCF A;  3KN3 A;  4RY1 A;  4DDD A;  4ECF A;  3SEW A;  4M4G A;  2NVU B;  2H5Y A;  4G68 B;  1XVY A;  2IEE A;  5I2N B;  5LOM A;  1FTK A;  1JEU A;  4XTC Q;  4H1X A;  3BBR A;  3JV9 A;  4R6H A;  4F3P A;  3IO6 A;  1B58 A;  3PUV E;  2H98 A;  3CFL A;  3IR1 A;  3DM0 A;  4FAJ A;  4G68 C;  1Y20 A;  1LBB A;  1GVC A;  1USY E;  3O97 A;  2ZYM A;  5AA3 A;  2B3B A;  2YPN A;  3EHT A;  5I84 A;  1MM6 A;  3H4Z A;  4ZEB A;  2V25 A;  3PPP A;  1US5 A;  1QUK A;  4BLA A;  5H8F A;  4G4P A;  4BDR A;  5I59 A;  3N26 A;  3FJ7 A;  1M5E A;  2Q2A A;  4P11 A;  5KCJ B;  4QSE A;  3ILU B;  4QFP A;  1R6Z A;  5ELV A;  2RIN A;  3R6U A;  3K6W A;  4OEV A;  4FOR A;  3FJG A;  2DP8 A;  1A54 A;  3K4U A;  1ZMG A;  3GBA A;  3P7I A;  1O7T A;  4OFL A;  4LQ5 A;  2G93 A;  4EQ7 A;  1SW4 A;  2QS1 A;  1EZ9 A;  3PD9 A;  3B6T A;  4R72 A;  4WXJ A;  3KN7 A;  1B2H A;  3PUY E;  3VV5 A;  3VLV A;  5AA2 A;  2H4I A;  4JBZ A;  2REJ A;  1Z7N E;  5KZT A;  4EUO A;  4ZEF A;  3CFZ A;  1OQH A;  1MRP A;  2XXU A;  2Z8D A;  4ISU A;  1UIV A;  4UAC A;  2XXW A;  3C33 A;  3O9P A;  4ONY A;  2PBW A;  3OEL A;  2YLN A;  4YIC A;  3S2V A;  2I4C A;  1US4 A;  5KDT B;  4PP0 A;  5TP9 A;  4OZ9 A;  3IK6 B;  3U92 A;  3LSX A;  3FVN A;  4R6K A;  3CSG A;  2PVU A;  1ZIU A;  2V3U A;  3S9M C;  1PC3 A;  5DVF A;  2F97 A;  2DQV A;  1SDX A;  1PB8 A;  1Y3N A;  1SI1 A;  1D4N A;  3L6H A;  2HAU A;  2ALU A;  5H8Q A;  2DWJ A;  1D9Y A;  3UK4 A;  4I8C A;  4I62 A;  4XKP A;  4DE8 A;  3K00 A;  2ZNS A;  4HCW A;  4DCY A;  2XXQ A;  5FTH A;  3EHS A;  3RT6 B;  1FQE A;  1DOT A;  1M5B A;  3DP8 A;  4DLD A;  1B4H A;  4OES A;  4KFQ A;  3DEL B;  3MQ9 A;  4GL0 A;  3PMX A;  2LAO A;  1D9V A;  1H3D A;  2A5T A;  3M8U A;  2QRY A;  1SBP A;  1PBQ A;  1MM7 A;  1O64 A;  4MH5 A;  4YB5 A;  2W7Y A;  3H7M A;  1XVX A;  1MXX A;  4RNS A;  3N94 A;  3H6V A;  2HZK A;  1GTK A;  4NF6 B;  1HSJ A;  1ANF A;  5CRY A;  2DSF A;  1AOV A;  3S9L C;  4U22 A;  1UTH B;  3KJ7 A;  3KSJ A;  3T9U A;  3GLB A;  2DOJ A;  3QK6 A;  4NF5 A;  4PFU A;  3RUM A;  2Y7W A;  1VE4 A;  3LC8 A;  1B46 A;  3E13 X;  4QHQ A;  1NFT A;  1FQB A;  4Z0I A;  3UIF A;  2E1S A;  3HST A;  2D21 A;  4XKN A;  1D3K A;  3B6Q A;  1GR2 A;  2P0S A;  4G8N A;  1PDA A;  2I6E A;  2O1L A;  3TZA A;  3D4G A;  2I58 A;  5EYF A;  5H8H A;  3EHU A;  1B05 A;  3TEP A;  3FJM A;  1RYX A;  2P2A A;  3PD8 A;  1FW0 A;  2Q88 A;  2THI A;  3SEU A;  3KN8 A;  3E3K A;  4JSO A;  1A40 A;  4PE5 B;  3BKI B;  4OTE A;  2QMX A;  3K1M A;  5L8D A;  1IIW A;  2O51 A;  5ICT A;  3GZG A;  1B0L A;  2Q89 A;  5H8N A;  1MG1 A;  4HW8 A;  5JTY B;  1IUD A;  1NNF A;  1P1W A;  4QFK A;  4E0W A;  1Y4C A;  3KBR A;  1RYO A;  3N5L A;  3ILT B;  5I2K B;  2Z8E A;  3HCQ A;  4GWO A;  2AIX A;  3DP6 A;  3ECR A;  1YCJ A;  3ZKK A;  3C4M A;  4JWO A;  3MAM A;  1MPB A;  5F7V A;  1LB8 A;  5EHM A;  3MP6 A;  4WKM A;  3IAZ A;  2XX7 A;  3FV1 A;  4N07 A;  3S4U A;  3MVZ A;  2E0S A;  4FIM A;  5ICQ A;  4ZZE A;  3EN3 A;  2AL5 A;  1BKA A;  1MS7 A;  3H6T A;  2F6P A;  1L5T A;  3SES A;  3L6G A;  2ZYK A;  4NF8 B;  1TT1 A;  3S9N C;  4FEC A;  4F3S A;  3RPW A;  2UVG A;  5HPQ A;  3SEX A;  3PU5 A;  3VLU A;  5CM6 A;  3E9X A;  2PMS A;  4YKJ A;  1POY 1;  3TQL A;  4NWC A;  5F1Q A;  4LZ7 A;  3O2A A;  4U2R A;  1IXC A;  2OCU A;  2UXA A;  3A09 A;  4LAT A;  4ZE9 A;  4YKP A;  3QXM A;  1B5J A;  2V3Q A;  1N3W A;  4K3F A;  4KYE A;  2RKM A;  4IY5 A;  3IB1 A;  3G3J A;  2NUV A;  4RYA A;  3U1O A;  5AA2 D;  1QKA A;  4H0W A;  2Y7I A;  3IL1 B;  4OMB A;  2OJT A;  2ZNT A;  1IQ7 A;  4GXS B;  3IB0 A;  1B3E A;  3OO7 A;  4EQB A;  2H99 A;  3MP8 A;  4PET A;  3MP1 A;  1Y9U A;  3T96 B;  4WEP A;  2F7C A;  4JXI A;  4IO3 A;  1URS A;  2RCA A;  4JB7 A;  5J1D A;  2ZNU A;  2XXV A;  5K2X A;  1NNT A;  4F3B A;  4AB5 A;  2QMW A;  1AIV A;  1EH3 A;  2HAV A;  4ZEK A;  4ZDM A;  4DIG A;  3I6V A;  3O29 A;  2H25 A;  3M3L A;  2NOO A;  1FQF A;  4M1V A;  5I56 A;  4YZZ A;  3RT8 A;  4R2F A;  4X48 A;  3W9V A;  5H8F B;  1BIY A;  1MH4 A;  3EQ1 A;  5I59 B;  4Q8R A;  3SET A;  3KG2 A;  1MQJ A;  3FVO A;  1RKM A;  4LZ8 A;  2I3W A;  3MZB A;  4FE8 A;  3RY3 A;  2XXX A;  4R73 A;  4AB6 A;  4NTL A;  4RJZ A;  2Y7P A;  2Q2C A;  3H06 B;  1POT A;  2F5X A;  3W9W A;  1MH3 A;  1FTJ A;  1A8F A;  3TQW A;  2F7A A;  3M3F A;  4XIG Q;  2XD3 A;  2F7B A;  4OET A;  1ELJ A;  4DZ1 A;  3VVF A;  1GGG A;  1II5 A;  1SD3 A;  5CC2 A;  5K2Y A;  2KLF A;  4RA1 A;  1JEV A;  3PUZ E;  1B40 A;  5AA2 B;  4H67 A;  5B70 A;  3ZSF A;  1XC1 A;  1LFH A;  1NH8 A;  4R74 A;  3VXC A;  1IEJ A;  4QF9 A;  4JDF A;  3CIJ A;  3QUJ A;  3FXQ A;  2F35 A;  2ESN A;  1FQA A;  1JET A;  5I58 A;  3G3G A;  4UA8 A;  2I4B A;  1ZBM A;  5M2V A;  3RLF E;  3PPN A;  2DWI A;  3C34 A;  3V8X B;  5TP9 B;  4Z7E A;  2UVI A;  4IO5 A;  5BWJ A;  1Y1Z A;  4YU0 A;  3QIM A;  1YPN A;  2Z23 A;  3ONM A;  4ZEI A;  4DXC A;  1LB9 A;  2DVZ A;  2GHA A;  3KFM A;  4POX A;  1URD A;  1ZU0 A;  3MZ9 A;  5H8Q B;  1MXW A;  1S7Y A;  3MVW A;  2X7Q A;  4OER A;  2B3F A;  5FHN A;  3TTN A;  4OHN A;  4U4X A;  3FXR A;  2RF1 A;  3RTW B;  3TTK A;  3VVE A;  2ONR A;  5DEX A;  5DVJ A;  3VVD A;  1DMB A;  4GQO A;  3CRB A;  3PMV A;  4RPN A;  4RXL A;  4THI A;  3H3G A;  3T93 B;  2X7P A;  2A5T B;  1MDQ A;  4EF2 A;  1B1X A;  1R9Q A;  1MY1 A;  3C31 A;  1M5D A;  2O7I A;  2V3T A;  1J1N A;  4RK9 A;  2FNC A;  1N04 A;  1WDN A;  3U93 A;  4GOT A;  4GD5 A;  5AE4 A;  4Q30 B;  4XKR A;  4OXV A;  2WKY A;  1Y1M A;  3TMG A;  2VHA A;  4Q5T A;  5CBR A;  1FTM A;  3VLW A;  1HSL A;  3O6G A;  2FA7 A;  3HV1 A;  2VD3 A;  1MQG A;  3PUX E;  1M5F A;  5CMB A;  3KEI A;  5FHM A;  4F1Y A;  2F36 A;  1QKB A;  3CR9 A;  2GRV A;  5ITO A;  3OEK A;  4GXA A;  3R7X A;  4N6P A;  5IAI A;  1URG A;  4NF5 B;  2XXT A;  4C1U A;  1NL5 A;  3IX1 A;  4KCC A;  1OVT A;  2NWJ A;  3GXA A;  5CMK A;  1QJM A;  3C36 A;  3KOT A;  3RNN A;  1R1N A;  2O6A A;  3HHF A;  2OWS A;  4MLQ A;  5CI5 A;  1IXG A;  3MVX A;  1P1O A;  3Q29 A;  4O3B A;  2D5W A;  3RN8 A;  2XX9 A;  3CI8 A;  4DXB A;  1MQD A;  1DPE A;  1UQW A;  1GV8 A;  2D3I A;  3LUY A;  3CG3 A;  4YAH X;  1MY2 A;  4DXU A;  1AH5 A;  1DTG A;  3THI A;  1USY H;  2ZMB A;  5H8H B;  3TUS A;  1ZJL A;  2UVJ A;  2QL3 A;  4ELP A;  3CSB A;  1YTV A;  3OXN A;  1I69 A;  5CMM A;  3MWB A;  3TDJ A;  3S9E A;  3QYT A;  1B5H A;  1IXH A;  1QVS A;  3TTM A;  4HS7 A;  3PPR A;  1VR5 A;  3OO8 A;  3U72 A;  4OYV A;  5CBS A;  2F78 A;  2O68 A;  4LON B;  5H8N B;  1NNP A;  3PPQ A;  4L17 A;  5JEI A;  3I3V A;  5A5X A;  1SW1 A;  1B0H A;  1Y3P A;  1Y3Q A;  4G8H A;  3U8Q A;  4FED A;  3MJN A;  1SYI A;  4JWX A;  4ZZA A;  2Y7R A;  4GLI A;  5HM4 B;  3OEN A;  4LP2 B;  4WED A;  2DXR A;  4ELO A;  2F6G A;  1B3L A;  1NMU A;  3ZKL A;  2R71 A;  4TOZ A;  1XHY A;  1OLA A;  5FTI A;  2BJJ X;  4KCD A;  3Q26 A;  1R9L A;  4IB2 A;  3N6T A;  4KYD A;  1B4Z A;  1S9T A;  1B5I A;  2HQ0 A;  3ZS6 A;  1P1U A;  2Q8J A;  3U94 A;  2QS3 A;  2XXY A;  2O7U A;  2REG A;  3H03 A;  1A7L A;  2Y84 A;  2HFB A;  4RPO A;  4NMY A;  1B9J A;  4KYS A;  3FD3 A;  1OLC A;  1B3F A;  4JWY A;  1JW4 A;  3IOR A;  2IA4 A;  3E4R A;  2AL4 A;  4C0R A;  2VGQ A;  3I5O A;  2DYX A;  3O6H A;  4F29 A;  1QUJ A;  4EQ9 A;  3IOW A;  3LR1 A;  2OK2 A;  2F34 A;  1MQI A;  4C1T A;  1T0K A;  5DVI A;  3BFT A;  2RC7 A;  4HTG A;  3FXU A;  1JW1 A;  3KSX A;  3MW0 A;  1LAX A;  3PPO A;  4H6D A;  5L9O A;  2UYE A;  4OEU A;  1OQG A;  4LUB A;  1DPP A;  1I6Q A;  2I48 A;  3FIR A;  3G3K A;  4F3G A;  3VFJ A;  3CFX A;  3MBP A;  3T66 A;  2V84 A;  2ONK E;  1MXY A;  1VFD A;  1F9B A;  4IO2 A;  1NKX A;  3IOV A;  4GRK A;  4PFT A;  1SVX B;  3VDF A;  2O84 X;  1EZO A;  1MY0 A;  3B7D A;  4TLM B;  4R75 A;  5IKB A;  2GHB A;  1DSN A;  5H8S A;  4QSC A;  2GH9 A;  3MPK A;  3G3H A;  2XX8 A;  5I56 B;  4HCY A;  3V89 B;  4QFL A;  1PB7 A;  1O63 A;  2HXW A;  2ABH A;  4F1V A;  4X1B A;  1JW5 A;  2H9B A;  3SEV A;  3K6U A;  4F19 A;  4X1D A;  4QFN A;  3UGW A;  1N84 A;  4LQ2 A;  5TPA A;  2XHD A;  3K6V A;  2XXR A;  4R9F A;  3OO9 A;  1UIU A;  5L9S A;  3IOU A;  1MXU A;  1VFE A;  1B32 A;  5I57 A;  3UOR A;  1TFA A;  3TEL A;  1OMP A;  1MQH A;  1NNK A;  3IB2 A;  1B6H A;  2QJE A;  2Y7K A;  4OQO A;  2M8C A;  1OVB A;  2I3V A;  5B7D A;  4DCX A;  3Q27 A;  3TTR A;  1XT8 A;  4IO7 A;  1MPC A;  1LCT A;  2P1S A;  1SQY A;  3LSW A;  5AA4 A;  1Z7M E;  4YB6 A;  1LFI A;  3FAS A;  3OMB A;  4POW A;  4NF4 A;  1TWY A;  2R9J A;  3D4C A;  1A99 A;  3G3F A;  3DLN A;  3MPL A;  2QPQ A;  3FAT A;  3EPE A;  5I58 B;  1VSO A;  4H8I A;  5ITP A;  4QSD A;  4ZED A;  4FAT A;  3RQT A;  4ESX A;  2YJP A;  4H5F A;  1EZP A;  4OFO A;  1SW2 A;  4U21 A;  5DTB A;  2X26 A;  1EU8 A;  4ELQ A;  1FCK A;  2QS4 A;  1UTB A;  3F11 A;  4XKQ A;  1S50 A;  1JNF A;  2DE2 A;  3WAF A;  4X9T A;  2B65 A;  1CE2 A;  1QUL A;  2CZL A;  3PUW E;  4G68 A;  4BDL A;  5I2N A;  1XS5 A;  3OSR A;  4U4S A;  4EXK A;  1BLF A;  1LAF E;  1DTZ A;  3FVK A;  2XXH A;  5DEX B;  3T9X B;  2PX1 A;  2VOZ A;  3IJO B;  1WVJ A;  1B7Z A;  4IGT A;  3K1P A;  3H6W A;  1P1Q A;  2RC9 A;  1M5C A;  4LA9 A;  4GL8 A;  3V83 A;  3FZV A;  3FV2 A;  5DYH A;  1LAG E;  4BDN A;  2HCA A;  4F2Q A;  3C9H A;  2OWT A;  4YKI A;  1MXV A;  3DP4 A;  5CMC A;  4EXL A;  3PMW A;  4JSD A;  2ZYO A;  3CVG A;  4GF8 A;  4P0G A;  4ZEC A;  3SER A;  3Q28 A;  3PGF A;  3MUQ A;  3TKD A;  4U1O A;  1ZLQ A;  4YMB A;  1SI0 A;  1B1H A;  1B7H A;  5KCJ A;  4KQP A;  4MBP A;  3IO4 A;  4F2O A;  3EF7 A;  4OVJ A;  1A8E A;  2DWA A;  3TCG A;  2Z8F A;  1TXF A;  1XOC A;  1LBC A;  2G29 A;  3K01 A;  1B3H A;  3TFL A;  1FQC A;  2DWH A;  1LAH E;  2HZL A;  3MZ1 A;  4MLV A;  1ZTY A;  4KR5 A;  4H5G A;  1LCF A;  2RCB A;  3KGC A;  3LSL A;  4R6Y A;  4IO6 A;  4GFR A;  4LZ5 A;  1B51 A;  3K1N A;  3G7W A;  1LFG A;  4N13 A;  1JVX A;  3VXB A;  3CG1 A;  3KZG A;  3IJX B;  1FTL A;  4F1U A;  2DS9 A;  2UYF A;  1I6A A;  1MY3 A;  1H76 A;  5DT6 A;  1ATG A;  2PYY A;  1I6B A;  2Q9T A;  5EHS A;  2I49 A;  5KDT A;  3B6W A;  4IO4 A;  4BDO A;  1AL3 A;  5TU0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...