1LAHE

Structural bases for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
238
structure length
238
Chain Sequence
ALPQTVRIGTDTTYAPFSSKDAKGEFIGFDIDLGNEMCKRMQVKCTWVASDFDALIPSLKAKKIDAIISSLSITDKRQQEIAFSDKLYAADSRLIAAKGSPIQPTLESLKGKHVGVLQGSTQEAYANDNWRTKGVDVVAYANQDLIYSDLTAGRLDAALQDEVAASEGFLKQPAGKEYAFAGPSVKDKKYFGDGTGVGLRKDDTELKAAFDKALTELRQDGTYDKMAKKYFDFNVYGDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYSINE, ARGININE, ORNITHINE-BINDING PROTEIN
publication title Structural basis for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein.
pubmed rcsb
source organism Salmonella typhimurium
molecule tags Amino acid transport
total genus 83
structure length 238
sequence length 238
ec nomenclature
pdb deposition date 1993-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1lahE01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1lahE02
1SDXA 2VD3A 3JZJA 4POWA 4MLVA 4OEUA 4YMBA 2V93A 3GLBA 4Z0IA 3ZS6A 3HHGA 2XXQA 4PFYA 1B5JA 3KFMA 1SYHA 3K02A 4U21A 2I6EA 2D5WA 3MZ1A 1US4A 4EQ7A 2A5TA 3TDJA 2OCUA 3FV1A 3QSLA 1MQGA 2RCBA 2QMXA 1UTHA 3Q28A 1YPNA 3G3FA 4U1OA 1QW0A 2XX9A 3EF7A 3IO4A 1OLCA 3U94A 4C1TA 2FNCA 4N07A 1MY0A 3F11A 2WKYA 5CMMA 1IXIA 3K6UA 3KG2A 1SW5A 4P0IA 3U92A 4R6KA 4DIGA 3O2AA 4K3FA 3IB1A 1D9YA 2OZZA 4EDPA 3SESA 1OIBA 4YKPA 2ZYMA 5EHSA 4Q30B 1B52A 4DZ1A 2F5XA 2XX7A 3SETA 3KGCA 2DWJA 3PPPA 1JW5A 4ZZAA 2Q8JA 1D3KA 1FQEA 4FORA 4ONYA 2XXRA 4PETA 3U93A 1VR5A 4MLQA 2ZNTA 3S9NC 4ZEKA 1I69A 2DYXA 2GFEA 3UIFA 2XXTA 2H4IA 5CRYA 3V89B 5LOMA 2F7CA 1HSJA 3EQ1A 4PFUA 1IUDA 1JW4A 1B40A 1LB8A 2NOOA 1MXXA 3UORA 1UTBA 3BFTA 4X1DA 4YMAA 3RTWB 4RNSA 3MP1A 1Z7ME 3MZBA 3TEPA 3RLFE 2E1SA 1XHYA 3RT8A 4F39A 3FVKA 1M5EA 2DXYA 3U1OA 4BLAA 3W9WA 5AE4A 5H8HA 3ZSFA 5TPAB 2PMSA 3TTLA 4NWDA 2F97A 3KZGA 5CBSA 1B32A 2UYFA 3T66A 3D4GA 4JWXA 4XKPA 3KN7A 1VSOA 5J1DA 4ND9A 1N04A 2O84X 3LBSA 5ICQA 4P0GA 1OMPA 4R2FA 3IJOB 3DLNA 1I6BA 1YTVA 2I48A 1NL5A 3K1PA 1GVCA 3IO6A 4WKMA 2F36A 1N84A 2RC8A 5F1QA 2ZNUA 2I4BA 1IEJA 3IAZA 3IB2A 4OYVA 4QSEA 1B1XA 4RY1A 2XXXA 3DP6A 4ECFA 2REGA 4O3AA 2YLNA 3VVFA 1LBCA 4F2OA 3MPKA 3N26A 1UIVA 1L5TA 3K2DA 4RXLA 3KOTA 4RK9A 5I57A 3IORA 1IITA 3OXNA 5I2KB 3O97A 1FTMA 4F3PA 2DSFA 4YKIA 1A99A 3HO7A 1TXFA 3QUJA 1MY3A 5EYFA 2QS2A 2Z8DA 1A8EA 2DE2A 5DVJA 2Y7KA 2QSXA 4NF4B 1B3FA 4G8MA 1OLAA 2Z8EA 2QL3A 2F6PA 1MRPA 4RA1A 2HEUA 3R26A 1RYOA 3EHUA 3T93B 3T9HB 2G93A 4RPNA 1EZPA 1YCJA 4NMYA 3TPAA 3I3VA 3ILTB 4LONB 5AA1A 1RKMA 4FECA 2Q89A 1N76A 4IGTA 4ZEFA 4GQOA 2RF1A 2B3BA 2DE4A 4DCYA 4OWDA 4WEPA 3PPRA 1ZBMA 3TYHA 1MPBA 1ZTYA 3IR1A 5CI5A 4KYDA 3VXBA 4F31B 3HSTA 4OEVA 3TAJA 1POY1 1MS7A 4FAJA 4YZZA 1PB8A 4O3BA 3A3CA 1SW4A 2X7QA 4OXVA 1B0HA 5CMCA 3G3KA 3IOVA 3Q29A 2ABHA 3TMGA 1D4NA 3H6UA 4AB5A 3MQ9A 3VLUA 1T0KA 5AA4A 4KQPA 5H8SA 2I0CA 4ZDMA 3I6VA 4DXCA 2QS3A 2HAUA 4F19A 3RPWA 4LVQA 1DMBA 1B7UA 4DE8A 4MH5A 5JTYA 3IB0A 2RKMA 2V25A 3M3FA 1FQDA 5HPQA 1POTA 5A5XA 3SEVA 4ISUA 2V3QA 4I62A 5FHOA 1URSA 2PYYA 3U72A 3UA8A 3C35A 4HTGA 4Z7EA 1FCKA 4X9TA 3N6TA 4L17A 4Q5TA 4G2ZA 2DS9A 3KJ7A 5IKBA 1VFDA 2ZYKA 4GFRA 4GWOA 3MAMA 3FZVA 1UIUA 4R75A 1RYXA 4QRZA 4G68C 2XXWA 1EU8A 3H6WA 4U1ZA 4I9DA 1SQYA 4IO5A 4H8JA 4H8IA 3WAFA 1GV8A 1MDQA 3MVWA 3OEKA 1JVXA 3G7WA 4NE4A 2UVIA 1NNTA 2QJEA 1N3XA 3S2VA 4G68A 1ZU0A 2NWJA 4H65A 4XKRA 4NF5B 4KR5A 3H03A 1NNKA 4GRKA 2Y7PA 1MDP1 3U8QA 1LLSA 4GXSB 3G3HA 1IXHA 1DTZA 3K6VA 3TKDA 1B3EA 1MY2A 1ANFA 1N7XA 2F35A 4H0WA 1A54A 2R6GE 2RC7A 1HSEA 4R73A 1MXUA 3K00A 1BKAA 4IGRA 4FEDA 2F7BA 4JB7A 5H8QB 1PBQA 4ZEBA 3VLWA 4AB6A 3PUWE 1LAHE 5I56A 3DP8A 1FQBA 2XXYA 3V83A 4LATA 3N5LA 1QKBA 2AL5A 5B7DA 2THIA 1GTKA 1P1WA 1B2HA 1MM6A 2ZYOA 5I59A 3B6WA 3IK6B 5F7VA 3S9MC 4LZ8A 3MZ9A 4KCDA 2O7UA 1ZJLA 3FVOA 2VHAA 1TFDA 1OQGA 4YB7A 5FTHA 2F8DA 3BBRA 1I6QA 4JSOA 3OOAA 4EXKA 5DEXB 1OVTA 1URGA 3MW0A 3O6HA 2I0BA 2H9BA 2PT2A 1D9VA 1ZMGA 2O1LA 3CSBA 1VFEA 3G3IA 5TP9B 1S7YA 1USYH 3OMBA 1QULA 1Y3PA 3PPNA 1GGGA 3IOTA 1LAXA 5K2YA 1NFTA 3OO7A 1NH8A 4X1BA 3K6WA 3PMVA 4QFOA 4P11A 3CI8A 1XVYA 1IXGA 4QSDA 3RQTA 1SI1A 1JVYA 1EZ9A 1LAGE 3JYRA 4LP2B 2REJA 1WDNA 4N6PA 5FHMA 3S4UA 4YB6A 4F29A 1MY4A 1WODA 1PB7A 3CR9A 1B9JA 4GOTA 5DVIA 2OK2A 3OO8A 4G8HA 1DSNA 4PFTA 5KCJB 3FJGA 1S50A 1Y3QA 2AL4A 4QSCA 3MWBA 3C4MA 2QS4A 3B6TA 1IIWA 3ZKLA 2RC9A 3RT6B 3E4RA 2ZNSA 1QUIA 4EXLA 3SEUA 2DOJA 2RCAA 5I57B 4QHQA 4R9FA 2VP1A 1B4ZA 1NNPA 3VXCA 3IJXB 5DTBA 1USYE 5I58B 4F3GA 4HW8A 3QIMA 4OFLA 1Y3NA 5IAIA 3FXRA 3KN3A 4NWCA 1ELJA 4YB5A 3ONMA 5FTIA 1SW1A 4EF2A 4H5GA 1H45A 3T22A 3C32A 4NEDA 5JK4A 1TWYA 1SI0A 5ELVA 4AQ4A 1DTGA 2NXOA 3T9VA 2HFBA 4C0RA 4F3BA 3FIRA 3Q27A 3TTRA 4Q8RA 1MXYA 3T96B 4LQ5A 5AA2B 1N3WA 2CZLA 3R7XA 5H8NA 4HS7A 2VOZA 1B05A 3G3GA 1P1OA 5KDTB 3MVZA 5I2NA 4BDRA 1A55A 2XD2A 3SDFA 4BDNA 1MPDA 5L9MA 1Z7NE 1O64A 4NF6A 5DVFA 4M1VA 4XTCQ 2YPNA 2Z23A 4EQ9A 2DVZA 4UA8A 1B7ZA 1SD3A 4OESA 2G29A 4JWYA 3T9UA 2A5SA 3ILUB 3M3LA 2XXPA 5AA4B 1Y1ZA 4KFQA 2I3WA 1R9QA 5AA2D 5DT6A 5HBCA 2Y7WA 5L9OA 4LZ7A 3VVEA 3KBRA 4H5FA 1NH7A 2AIXA 2DWIA 3D4CA 1YAEA 4H6DA 2XXUA 2ALUA 3B6QA 4RJZA 5JTYB 3TZAA 3C9HA 3C34A 4KYEA 4XKQA 5A5XB 4JWOA 3TUSA 4ELQA 3OSRA 4OFOA 3WAEA 3HPIA 2X7PA 5ISUA 1H44A 1FQCA 2P0SA 3JV9A 2KLFA 4M4GA 1H3DA 1URDA 2M8CA 3SEYA 3TCGA 4RYAA 2HXWA 3K6XA 2UYEA 4U4XA 2H98A 4ESWA 4C1UA 4NF8B 4DLDA 4QF9A 4GIZA 3S9LC 1Q1KA 2XXHA 4BDQA 4I8CA 3E13X 4EUOA 4ELPA 3PUVE 5JEIA 3MP6A 2OWTA 4YKJA 4ELOA 3QXMA 1MXZA 3S9EA 1JETA 1ATGA 3FD3A 2PT1A 3M8UA 4JXIA 4E0WA 3V5AA 1P1UA 4R9GA 4FE8A 4TLMB 1B3GA 3CFZA 4R6YA 1FTJA 2O7IA 2QMWA 1P99A 3PUXE 3A3UA 1F9BA 2HAVA 3FASA 2CMOA 2RINA 1LFHA 2DQVA 4R6HA 3HCQA 1KWHA 4GL0A 5ICTA 1B4HA 3C31A 2DP8A 4OHNA 3QK6A 3PMWA 4LA9A 3QYTA 1M5DA 1XS5A 4GD5A 4NF4A 3PPOA 4IB2A 2QPQA 1AIVA 1DOTA 2Z8FA 4R72A 1JQFA 1ZIUA 4XIGQ 3DM0A 3UGWA 2PVUA 1SVXB 2GRVA 1MQHA 1BIYA 3OSQA 5CBRA 4DDDA 4H67A 3O66A 2A5TB 3FJ7A 3T9XB 1UTHB 4YU0A 1LFIA 3FXUA 1CB6A 3OD7A 3Q25A 3KJTA 2O1MA 1H76A 3L6GA 1P1QA 3O6IA 1XVXA 4H1XA 1QJMA 3LSXA 4BDMA 3CVGA 3FVGA 1R6ZA 1R1NA 4OERA 3TTKA 2R71A 5CMBA 4Q0CA 2IEEA 4OVJA 1MY1A 3UK4A 2XXIA 1MQDA 2DWHA 1MXVA 2XXVA 3IL1B 4JSDA 3LR1A 2Q9TA 1PB9A 1A40A 4XXUA 3TCFA 3UN6A 5M2VA 1M5CA 1QUKA 1MXWA 4ZS9A 2DVCA 1GR2A 3CRBA 3CFLA 2OWSA 3MUQA 2FA7A 3RGYA 2ONKE 3K1MA 4WEDA 3R6UA 4RPOA 3K1NA 4FATA 5FHNA 5BWJA 2DE3A 2E0SA 3ECRA 1US5A 4ZZEA 4PE5B 1UTBB 4KYSA 4TOZA 3VLVA 1B51A 3MVYA 1AH5A 3B7DA 2DXRA 1EZOA 5K2XA 4OQOA 2DWAA 4HCYA 3VV5A 4YKKA 1N0TA 3H4ZA 4G4PA 1EH3A 4FEBA 5H8HB 2Q88A 2O6AA 2Q2AA 1TFAA 2ONRA 1LFGA 3W9VA 2HZLA 1NKXA 3TQLA 3OO6A 3GZGA 1M5BA 4F3SA 1A8FA 1S9TA 1OQHA 1B0LA 4NF5A 3Q26A 5H8NB 4JDFA 3H7MA 3CIJA 3IOUA 3UP9A 3LSWA 4MBPA 2Q2CA 3ODBA 5I2NB 3M3KA 2ZXTA 3PU5A 4TQUQ 1B5HA 4U23A 3CG3A 1AL3A 1IXCA 4NF6B 4UACA 2B65A 2BJJX 5H8FA 3N94A 4R2BA 3ZKKA 3FV2A 4PFWA 4EQBA 2UVGA 3H6TA 4ZECA 3TODA 5H8QA 3I5OA 3THIA 4F1YA 3PMXA 1MPCA 2UXAA 1O7TA 1M5FA 3E3KA 4LQ2A 3RUMA 4G77A 2HQ0A 3PD8A 1Y4CA 4ESXA 1ZKBA 4LZ5A 4EF1A 4NTLA 2P2AA 3H6VA 3KSXA 1TT1A 4G8NA 1J1NA 3O28A 4FJPA 2Y84A 3V8XB 3TTNA 3TQWA 1Y9UA 1QUJA 3KOSA 4KHZE 1AOVA 2ANJA 4IO6A 4BDOA 1PBPA 1CE2A 4GVOA 4WXJA 3MC2A 5DEXA 1R9LA 1QVSA 2NUVA 3VVDA 1LGBC 4IO3A 2ZMBA 3O6GA 3MP8A 4KCCA 4OTEA 3EPEA 4HCWA 3GBAA 3EHTA 2AYSA 5TP9A 3FATA 3CSGA 4E0XA 3QAXA 3RY3A 3HHFA 1P1NA 3CG1A 1JW1A 2V84A 3TFLA 2F7AA 1SBPA 1B3LA 2OLBA 1LCTA 3QUFA 1MQJA 2O68A 3PD9A 4OZ9A 5KZTA 1MG1A 1DPEA 2FYIA 1B5IA 2P1SA 3MBPA 3BKIB 3OO9A 1XOCA 3LUYA 1II5A 3P7IA 1DPPA 3G3JA 2XD3A 3K01A 3C36A 1FW0A 3K0VA 2V3UA 2D3IA 1PDAA 1Q35A 5KCJA 5L8DA 1NNFA 3OELA 2O51A 4GXAA 1H43A 3GXAA 1B1HA 3PUYE 3E9XA 1I6AA 1BLFA 4IO4A 2ONSA 3USDA 3FUZA 3FVNA 4U2RA 1FTOA 3VE1B 3H3GA 4GLIA 4OMBA 2F6GA 2H99A 3EHSA 4XKNA 4RK2A 4U4SA 1LBBA 5I58A 3N6UA 1XT8A 2D21A 2W7YA 3VDFA 3HV1A 1LAFE 3RNNA 4KPTA 4QFPA 5TPAA 4F1UA 2Y7IA 3OEMA 3VFJA 4GF8A 2X26A 1FQAA 3SERA 4ZEDA 4MF3A 1Y20A 2QS1A 3SEXA 2GHAA 4DXUA 2VGQA 1WVJA 1MM7A 4I1DA 1XC1A 1JEUA 4POXA 1SW2A 2PBWA 2H5YA 5AA2A 1FTKA 4MFIA 5I84A 3KSJA 5KDTA 4OETA 4YAHX 3C33A 2I4CA 4TLLB 5ITPA 1LB9A 4DCXA 1PEBA 3IOWA 2GH9A 3MJNA 2YJPA 1HSLA 2Z22A 4OENA 5TU0A 4GL8A 1LSTA 4FIMA 2QRYA 4G68B 4LUBA 5AA3A 5HM4B 4ELRA 4IY6A 1FQFA 2I49A 1LCFA 5B70A 3LC8A 5CMKA 5I2KA 2XX8A 3O9PA 5DYHA 4QFKA 4ZE9A 1FTLA 5L9SA 3DP4A 4OFJA 1OVBA 3SKPA 2UVJA 2HZKA 2Y7RA 1Y4TA 2IA4A 2XHDA 3EN3A 3FXQA 2HCAA 3MPLA 1MH4A 4JBZA 2UVHA 1BTJA 4IO2A 3PGFA 3LSLA 1N7WA 3PUZE 1B3HA 4IO7A 5EHMA 4U22A 1B58A 5I56B 4PQJA 3DELB 2O69A 1BP5A 3L6HA 3FGSA 3BFUA 1IZ1A 2H25A 3AXFA 1B6HA 3KN8A 4O3CA 2ZYNA 2I3VA 3OENA 4KI0E 4R74A 4QFLA 3MVXA 4F18A 3GBBA 5ITOA 5CM6A 1A7LA 1QKAA 5I59B 1SYIA 3W15C 1O63A 4ZEIA 2F34A 1NMUA 2V3TA 1Y1MA 3KEIA 1PC3A 4QFNA 1MQIA 4NF8A 4THIA 3FJMA 4F1VA 4F2QA 2R9JA 3RN8A 3IX1A 2GHBA 3TCHA 3SEWA 1B7HA 1ZLQA 1AMFA 2NVUB 2F78A 2PX1A 1B46A 3PV0E 2B3FA 2LAOA 1JEVA 4KD5A 2VD2A 4DXBA 3H06B 3PPQA 3HN0A 4F22A 3O29A 1MH3A 4YICA 1IQ7A 1JNFA 3A09A 2ESNA 3LSFB 2OBGA 3TTMA 4X48A 4IY5A 4PP0A 4BDLA 3TELA 5BUUA 3CFXA 5CC2A 3RTFB 5H8FB 1VE4A 2I58A 3K4UA 4N13A 1UQWA 4ZE8A 2OJTA
chains in the Genus database with same CATH superfamily
4GWZA 1SDXA 2VD3A 3JZJA 4POWA 4MLVA 4OEUA 4PDHA 3IFAA 4YMBA 2V93A 3GLBA 4Z0IA 3ZS6A 3HHGA 2XXQA 4PFYA 1B5JA 3KFMA 1SYHA 2CZIA 3K02A 4U21A 2I6EA 2D5WA 1NV0A 3MZ1A 1US4A 4EQ7A 2A5TA 3TDJA 2OCUA 3FV1A 3QSLA 1MQGA 2RCBA 2QMXA 1UTHA 2L5VA 3Q28A 4MIJA 1YPNA 3G3FA 4U1OA 1QW0A 1DK4A 2XX9A 3EF7A 3IO4A 1OLCA 3U94A 4C1TA 2FNCA 2F3BA 4PAIA 4N07A 1KA0A 1MY0A 3F11A 2WKYA 5CMMA 1IXIA 3K6UA 4HE2A 3KG2A 1SW5A 4P0IA 4MCOA 3U92A 2P3VA 4R6KA 4DIGA 3O2AA 4K3FA 3IB1A 1D9YA 2OZZA 4EDPA 3SESA 4OANA 1OIBA 4YKPA 2ZYMA 5EHSA 4Q30B 1B52A 4P1LA 4XFEA 4DZ1A 2F5XA 2XX7A 3SETA 3KGCA 2DWJA 4XEQA 3PPPA 1JW5A 4ZZAA 4OVQA 4MX6A 2Q8JA 1D3KA 1FQEA 4FORA 4JVDA 4ONYA 2XXRA 4PETA 4OVSA 3U93A 1VR5A 4MLQA 2ZNTA 3S9NC 4ZEKA 1I69A 2DYXA 2GFEA 3UIFA 2XXTA 2H4IA 5CRYA 3V89B 3E78A 5LOMA 2F7CA 2WYKA 1HSJA 3EQ1A 4PFUA 1IUDA 1JW4A 1B40A 1LB8A 2NOOA 2ZZVA 1MXXA 3UORA 1UTBA 2V4CA 5LTCA 3BFTA 4X1DA 4YMAA 3RTWB 1NUZA 4RNSA 3MP1A 1Z7ME 3MZBA 3TEPA 3RLFE 2E1SA 5IZ3B 1XHYA 3RT8A 4F39A 4GX6A 3FVKA 3CHGA 1M5EA 2DXYA 3U1OA 4BLAA 2Q74A 3W9WA 5AE4A 5H8HA 3ZSFA 5TPAB 2PMSA 3TTLA 4NWDA 2F97A 3KZGA 5CBSA 1B32A 2UYFA 3T66A 4DI4B 1FBCA 3D4GA 4JWXA 4XKPA 3KN7A 1VSOA 5J1DA 4ND9A 1N04A 2O84X 3LBSA 5ICQA 4P0GA 1OMPA 4R2FA 3IJOB 2VPNA 3DLNA 1I6BA 1FBHA 1YTVA 2I48A 1NL5A 1FJ9A 3K1PA 1GVCA 3IO6A 4WKMA 2F36A 1N84A 2RC8A 5F1QA 2ZNUA 2I4BA 1IEJA 3IAZA 3IB2A 4OYVA 4QSEA 1B1XA 4RY1A 2XXXA 3DP6A 4ECFA 1AWBA 2REGA 4O3AA 2YLNA 3VVFA 1LBCA 4F2OA 3MPKA 4N6KA 3N26A 1UIVA 1L5TA 3K2DA 4RXLA 3KOTA 4RK9A 5I57A 3IORA 1IITA 3OXNA 5I2KB 3O97A 1FTMA 4F3PA 2PFYA 2DSFA 4YKIA 1A99A 3HO7A 1TXFA 1LEVA 3QUJA 1MY3A 5EYFA 2VT5A 2QS2A 2Z8DA 1A8EA 4GBWA 2DE2A 5DVJA 2Y7KA 2QSXA 1XI6A 4NF4B 1B3FA 4OVRA 4G8MA 1OLAA 1IMEA 2Z8EA 4NAPA 2QL3A 2F6PA 1MRPA 4RA1A 2HEUA 4AS5A 3R26A 1RYOA 3EHUA 3T93B 3T9HB 2G93A 4RPNA 1EZPA 1YCJA 4NMYA 3TPAA 1NV7A 3I3VA 3ILTB 4LONB 2QFLA 5AA1A 1RKMA 4FECA 4GWSA 2Q89A 1N76A 4IGTA 4ZEFA 4GQOA 2WYPA 2RF1A 2PCRA 2B3BA 2DE4A 4DCYA 4OWDA 4WEPA 3PPRA 1ZBMA 3TYHA 1MPBA 1ZTYA 3IR1A 5CI5A 5EQ9A 4KYDA 3VXBA 4F31B 3HSTA 4OEVA 3TAJA 1POY1 1MS7A 4FAJA 4YZZA 4MNCA 1PB8A 4O3BA 3A3CA 1SW4A 2X7QA 4OXVA 1B0HA 5CMCA 3G3KA 3IOVA 3Q29A 2ABHA 3TMGA 1D4NA 3H6UA 4AB5A 3MQ9A 3VLUA 1T0KA 5AA4A 4KQPA 4PFBA 2CEYA 5H8SA 2I0CA 1NV2A 4ZDMA 3I6VA 4DXCA 2QS3A 2HAUA 5ESYA 4F19A 3RPWA 4LVQA 1DMBA 1B7UA 4DE8A 4MH5A 5JTYA 3IB0A 2RKMA 2V25A 5DW8A 3M3FA 1FQDA 1KZ8A 5HPQA 1POTA 3D1RA 5A5XA 3SEVA 4ISUA 4GX3A 2V3QA 4I62A 5FHOA 1URSA 4G61A 2PYYA 3U72A 3UA8A 3C35A 4HTGA 4Z7EA 1FCKA 2B4MA 4MEVA 4X9TA 3N6TA 4L17A 4PTKA 2FBPA 4PAFA 4G2ZA 1YZ0A 4Q5TA 2DS9A 3KJ7A 5IKBA 5J16A 1VFDA 1DCUA 2ZYKA 4GFRA 4GWOA 3MAMA 2XA5A 3FZVA 4N6DA 1UIUA 4R75A 1RYXA 4QRZA 4G68C 2XXWA 1EU8A 3H6WA 4U1ZA 4I9DA 1SQYA 4IO5A 1NI9A 4H8JA 4H8IA 3WAFA 1GV8A 1MDQA 3MVWA 3OEKA 1JVXA 3G7WA 4NE4A 2UVIA 1NNTA 2QJEA 1N3XA 1CNQA 3S2VA 4G68A 1FJ6A 1LBXA 1ZU0A 2NWJA 4H65A 4XKRA 4NF5B 4KR5A 1QGXA 3H03A 1NNKA 4GRKA 2Y7PA 1MDP1 4QXDA 3U8QA 1LLSA 4GXSB 3G3HA 1IXHA 2KQZA 3FBPA 1DTZA 3K6VA 3TKDA 1B3EA 1LBWA 1MY2A 1ANFA 1N7XA 2F35A 4H0WA 2FHYA 1A54A 2R6GE 2RC7A 1IMDA 4N8YA 1FTAA 4MHFA 1HSEA 4R73A 1MXUA 4P1EA 3K00A 1BKAA 2JJKA 3SZPA 4IGRA 4FEDA 2F7BA 4JB7A 5H8QB 1PBQA 4ZEBA 3VLWA 4AB6A 3PUWE 1IMFA 4PAKA 1LAHE 5I56A 3DP8A 1FQBA 2XXYA 3V83A 4LATA 3N5LA 1QKBA 1YXIA 2AL5A 4GX4A 5IM2A 4PBHA 5B7DA 2THIA 1GTKA 1P1WA 1B2HA 4DI3D 4XF5A 1MM6A 2ZYOA 5I59A 3B6WA 3IK6B 5F7VA 3S9MC 5ET5A 4LZ8A 3B50A 3MZ9A 4KCDA 2O7UA 1ZJLA 3FVOA 4N8GA 2VHAA 1TFDA 1OQGA 3IFCA 4YB7A 5FTHA 2F8DA 3BBRA 4MNIA 1I6QA 4JSOA 1K9ZA 3OOAA 2QVRA 4EXKA 5DEXB 1OVTA 1URGA 3MW0A 3O6HA 3B8BA 2I0BA 2H9BA 2PT2A 1D9VA 3ISPA 1ZMGA 2O1LA 3CSBA 1D9QA 1VFEA 3G3IA 5TP9B 1S7YA 1USYH 3OMBA 1QULA 1Y3PA 3PPNA 1GGGA 3IOTA 1LAXA 5K2YA 1NFTA 3OO7A 5EQAA 1NH8A 3T0JA 4X1BA 3K6WA 3PMVA 1FPGA 2BJIA 4QFOA 4P11A 3CI8A 1XVYA 1IXGA 4QSDA 3RQTA 1SI1A 1JVYA 1EZ9A 1LAGE 3JYRA 4LP2B 2REJA 1WDNA 4N6PA 4P47A 5FHMA 3S4UA 4YB6A 1JP4A 4F29A 1MY4A 1WODA 1NUYA 1PB7A 3CR9A 1B9JA 1KA1A 4GOTA 5DVIA 2OK2A 5I7IA 3OO8A 4G8HA 1DSNA 4P56A 4PFTA 5KCJB 3FJGA 1S50A 2F3DA 1DBZA 1Y3QA 2AL4A 4QSCA 3MWBA 3C4MA 3PTYA 2QS4A 3B6TA 1IIWA 3ZKLA 2RC9A 3RT6B 3E4RA 2ZNSA 1QUIA 1Q9DA 4EXLA 3SEUA 2DOJA 5FBPA 2RCAA 5I57B 1FPIA 4QHQA 4R9FA 2VP1A 2WBBA 1B4ZA 1NNPA 3VXCA 3IJXB 5DTBA 1USYE 5I58B 4F3GA 4HW8A 3QIMA 2CZHA 4OFLA 1Y3NA 5IAIA 3FXRA 3KN3A 4NWCA 1ELJA 2MKZA 4YB5A 1NV1A 3ONMA 5FTIA 1SW1A 3GYYA 4JVIA 4EF2A 4H5GA 1H45A 2B4LA 3T22A 3C32A 4NEDA 5JK4A 1TWYA 1SI0A 5ELVA 4AQ4A 1DTGA 2NXOA 3T9VA 2HFBA 4C0RA 4F3BA 3FIRA 3Q27A 3TTRA 4Q8RA 1MXYA 3T96B 2XWOA 4LQ5A 5AA2B 1N3WA 2CZLA 2WX9A 3R7XA 5H8NA 4HS7A 2VOZA 1B05A 3G3GA 1P1OA 5KDTB 1YYZA 3MVZA 5I2NA 4BDRA 1A55A 2XD2A 3SDFA 4BDNA 1MPDA 5L9MA 1Z7NE 5IZ1A 3LUZA 1O64A 4NF6A 5DVFA 4M1VA 1FPFA 4XTCQ 2YPNA 5IZZA 2Z23A 4EQ9A 2DVZA 3BIHA 4N15A 1RDXA 4UA8A 1B7ZA 4PF8A 1SD3A 4OESA 2G29A 2HXRA 4JWYA 1EYJA 3T9UA 2A5SA 3ILUB 3M3LA 1FSAA 4NQ8A 2XXPA 5AA4B 1Y1ZA 4KFQA 2I3WA 1R9QA 5AA2D 1FBEA 5DT6A 5HBCA 2Y7WA 5L9OA 4LZ7A 5EYGA 3VVEA 3KBRA 4H5FA 1NH7A 2AIXA 2DWIA 3D4CA 4NX1A 1YAEA 5IZ3A 4H6DA 2XXUA 2ALUA 3B6QA 4RJZA 5JTYB 3TZAA 3C9HA 3C34A 2CEXA 4KYEA 4XKQA 3NOHA 5A5XB 4JWOA 2QVVA 3TUSA 4ELQA 3OSRA 4OFOA 3WAEA 3HPIA 2X7PA 5ISUA 1H44A 1FQCA 2P0SA 3JV9A 2KLFA 4M4GA 4P3LA 1H3DA 1URDA 1FPEA 2M8CA 3SEYA 3TCGA 4RYAA 2HXWA 3K6XA 2UYEA 4U4XA 2H98A 4ESWA 4C1UA 1NV3A 2XXKA 4NF8B 4DLDA 4QF9A 4GIZA 4N81A 3QMFA 3S9LC 1Q1KA 2XXHA 4BDQA 4I8CA 3E13X 4EUOA 1NV4A 4ELPA 3PUVE 5JEIA 3MP6A 2OWTA 4YKJA 4ELOA 3QXMA 2Y5LA 1MXZA 3S9EA 5EQ7A 1JETA 1ATGA 3FD3A 2PT1A 3M8UA 4JXIA 4E0WA 1NUWA 3V5AA 1P1UA 4R9GA 4FE8A 4TLMB 1B3GA 3CFZA 4R6YA 1FTJA 2O7IA 2KR0A 3FXBA 2QMWA 1P99A 3PUXE 3A3UA 1F9BA 2HAVA 3FASA 2CMOA 2RINA 1LFHA 4P9KA 2DQVA 2FIEA 4R6HA 1EYIA 3HCQA 4O7IA 1KWHA 4NF0A 4N17A 4GL0A 5ICTA 1B4HA 3C31A 2DP8A 4IR8A 4OHNA 3QK6A 3PMWA 4LA9A 4MMPA 3QYTA 1M5DA 1IMAA 1K9YA 1XS5A 4GBVA 4GD5A 1RDYA 4NF4A 3PPOA 4IB2A 2QPQA 4NN3A 1AIVA 1DOTA 2Z8FA 4R72A 1JQFA 1ZIUA 4XIGQ 3DM0A 3UGWA 2PVUA 3HFUA 3A29A 1SVXB 2GRVA 1MQHA 1BIYA 3OSQA 5CBRA 4DDDA 4H67A 2DDKA 3O66A 2A5TB 4O94A 2PFZA 3FJ7A 3T9XB 1UTHB 4YU0A 1LFIA 3FXUA 1CB6A 3OD7A 3Q25A 3KJTA 2O1MA 1H76A 3L6GA 5T3JA 1P1QA 3O6IA 1XVXA 4H1XA 1QJMA 3LSXA 4BDMA 3CVGA 4JVCA 2GQ1A 3FVGA 1R6ZA 1R1NA 4OERA 4OA4A 2R71A 5CMBA 3TTKA 4Q0CA 2XWVA 1BK4A 2IEEA 4OVJA 1FPJA 1MY1A 5LDZA 3UK4A 3BIGA 2FVZA 2XXIA 1MQDA 2DWHA 1MXVA 2XXVA 3IL1B 4JSDA 3LR1A 2Q9TA 1PB9A 3RPLA 1A40A 4XXUA 3TCFA 3UN6A 5M2VA 1M5CA 4HXVA 1QUKA 2ZZXA 5ET7A 1MXWA 4ZS9A 2DVCA 3E79A 4PGPA 1GR2A 3CRBA 3CFLA 2OWSA 4NHBA 3MUQA 2FA7A 3RGYA 4HE1A 2ONKE 3K1MA 4WEDA 3R6UA 4RPOA 3K1NA 4FATA 5FHNA 5BWJA 2DE3A 4MNPA 2E0SA 3ECRA 4P8BA 1US5A 4ZZEA 4PE5B 2CZKA 1UTBB 4KYSA 4TOZA 3VLVA 1B51A 3MVYA 1AH5A 3B7DA 2DXRA 1FPDA 1EZOA 5K2XA 1INPA 4OQOA 5ET8A 2DWAA 4HCYA 3VV5A 4YKKA 1N0TA 4KXPA 3H4ZA 4G4PA 4I40A 3MYUA 1EH3A 4FEBA 5H8HB 5A5LA 2Q88A 2O6AA 2Q2AA 1G0HA 1TFAA 2ONRA 3LV0A 1LFGA 3W9VA 5I3SA 4PCDA 2HZLA 1NKXA 3TQLA 3KC1A 3OO6A 3GZGA 3KC0A 1M5BA 1LBYA 1A8FA 4F3SA 1S9TA 1OQHA 1B0LA 4NF5A 3Q26A 5H8NB 4JDFA 3H7MA 3CIJA 3IOUA 3UP9A 3LSWA 4MBPA 2Q2CA 3ODBA 5I2NB 3M3KA 3T1BA 2ZXTA 3PU5A 4TQUQ 1B5HA 4U23A 2XWKA 3CG3A 1AL3A 1IXCA 4O7MA 4NF6B 4UACA 2B65A 2BJJX 5H8FA 3N94A 4R2BA 3ZKKA 3FV2A 4OVPA 4PFWA 4EQBA 2UVGA 3H6TA 4ZECA 5I5PA 3TODA 5H8QA 4PBQA 4H45A 3I5OA 3THIA 4F1YA 3PMXA 1IMCA 1MPCA 2UXAA 1O7TA 1M5FA 2WEFA 3ROJA 3E3KA 4LQ2A 3RUMA 4G77A 2HQ0A 3PD8A 1Y4CA 4ESXA 1ZKBA 4LZ5A 4EF1A 4NTLA 2P2AA 3H6VA 3KSXA 1TT1A 4QBAA 4G8NA 1J1NA 2WBDA 3O28A 4FJPA 1FPKA 2Y84A 3V8XB 3TTNA 3TQWA 4PE3A 4O8MA 2Y5KA 1FPLA 1Y9UA 1QUJA 3KOSA 4KHZE 1AOVA 2ANJA 4IO6A 4BDOA 1PBPA 1G0IA 1CE2A 4GVOA 4WXJA 3MC2A 5DEXA 1R9LA 1QVSA 2NUVA 3VVDA 1LGBC 4IO3A 2ZMBA 3O6GA 3MP8A 4KCCA 4OTEA 3EPEA 4HCWA 3GBAA 3EHTA 2AYSA 5TP9A 4PC9A 3FATA 3CSGA 4E0XA 3QAXA 3RY3A 3HHFA 1P1NA 3CG1A 1JW1A 2V84A 3TFLA 2F7AA 1SBPA 1B3LA 2OLBA 1LCTA 4H46A 3QUFA 1MQJA 2O68A 3PD9A 4OZ9A 5KZTA 1MG1A 1NUXA 1DPEA 2FYIA 4HE0A 1B5IA 2P1SA 3MBPA 3BKIB 3OO9A 1XOCA 3LUYA 1II5A 4NG7A 1SPIA 3P7IA 4AS4A 1DPPA 3G3JA 2XD3A 3K01A 3C36A 3EKIA 1FW0A 3K0VA 2V3UA 2D3IA 1PDAA 1Q35A 5KCJA 5L8DA 1NNFA 3OELA 4X8RA 2O51A 5EYHA 4GXAA 1H43A 3RYDA 4I3YA 3GXAA 1B1HA 3PUYE 3E9XA 1I6AA 1BLFA 4IO4A 2ONSA 3USDA 3FUZA 3FVNA 4U2RA 1FTOA 3VE1B 3H3GA 4GLIA 4OMBA 2F6GA 1FBGA 1FBFA 2H99A 3EHSA 4XKNA 4RK2A 4U4SA 1LBBA 5I58A 3N6UA 1XT8A 2D21A 2W7YA 3VDFA 3HV1A 1LAFE 3RNNA 4KPTA 3KBZA 4MAGA 4QFPA 5IGAA 5TPAA 4F1UA 2Y7IA 3OEMA 3VFJA 4GF8A 2X26A 1FQAA 3SERA 4ZEDA 2R8TA 4MF3A 1Y20A 2QS1A 3SEXA 2GHAA 4DXUA 4OVTA 2VGQA 1WVJA 2XWIA 1MM7A 4I1DA 1XC1A 2ZZWA 1JEUA 4POXA 1SW2A 2PBWA 2H5YA 5AA2A 1FTKA 5F24A 4MFIA 5I84A 3KSJA 5KDTA 4OETA 4YAHX 3C33A 4PGNA 2I4CA 2QVUA 1IMBA 4TLLB 5ITPA 1LB9A 4DCXA 1PEBA 3IOWA 1LBVA 2GH9A 3MJNA 2YJPA 1HSLA 2Z22A 4OENA 5TU0A 4GL8A 1LSTA 4FIMA 2QRYA 4G68B 4LUBA 5AA3A 5HM4B 4ELRA 1FRPA 4IY6A 1FQFA 2I49A 4PFRA 1LCFA 5B70A 3LC8A 5CMKA 3U65A 1NV5A 5I2KA 2VPOA 2XX8A 3O9PA 1VDWA 4MJOA 3RPLB 5DYHA 4QFKA 4ZE9A 4PF6A 1FTLA 2HHMA 5L9SA 3DP4A 4OFJA 1OVBA 3SKPA 2UVJA 2HZKA 2Y7RA 1Y4TA 2IA4A 2XHDA 3EN3A 3FXQA 2HCAA 3MPLA 1MH4A 4JBZA 2UVHA 1BTJA 4IO2A 1NV6A 3PGFA 1FBDA 3LSLA 1N7WA 3PUZE 1B3HA 4IO7A 5EQ8A 5EHMA 1FPBA 4U22A 1B58A 5I56B 4PQJA 3DELB 2O69A 1BP5A 3L6HA 3FGSA 3BFUA 1IZ1A 2H25A 3AXFA 1B6HA 4UABA 3KN8A 4O3CA 2ZYNA 2I3VA 3OENA 4KI0E 4R74A 4NGUA 4QFLA 3MVXA 4F18A 2Q8MA 3GBBA 3MSTA 5ITOA 5CM6A 1A7LA 1QKAA 1RDZA 5I59B 1SYIA 4FBPA 5ET6A 3W15C 1O63A 4ZEIA 2HPGA 2F34A 1NMUA 2V3TA 1Y1MA 3KEIA 1PC3A 4QFNA 1MQIA 4NF8A 4THIA 3FJMA 4F1VA 4F2QA 2R9JA 2P3NA 3RN8A 3IX1A 4I3EA 2GHBA 4LN5A 3TCHA 4N91A 3SEWA 2FIXA 1B7HA 1ZLQA 1EYKA 1AMFA 4GWWA 2NVUB 2F78A 2PX1A 2OWZA 1B46A 3PV0E 2B3FA 2LAOA 1JEVA 4KD5A 2VD2A 4PFIA 4DXBA 3H06B 3PPQA 3HN0A 4N4UA 4F22A 1FBPA 3O29A 4GWUA 1MH3A 4YICA 1IQ7A 1JNFA 3A09A 2ESNA 3LSFB 4X04A 4PDDA 2OX3A 2OBGA 3TTMA 4X48A 4IY5A 4PP0A 4BDLA 3TELA 5BUUA 3CFXA 5CC2A 3RTFB 5H8FB 4GWYA 1VE4A 2I58A 3K4UA 4N13A 1UQWA 1LBZA 4ZE8A 2OJTA 4GWXA
chains in the Genus database with same CATH topology
1SDXA 2VD3A 3JZJA 4POWA 4MLVA 4OEUA 4YMBA 2V93A 3GLBA 4Z0IA 3ZS6A 3HHGA 2XXQA 4PFYA 1B5JA 3KFMA 1SYHA 3K02A 4U21A 2I6EA 2D5WA 3MZ1A 1US4A 4EQ7A 2A5TA 3TDJA 2OCUA 3FV1A 3QSLA 1MQGA 2RCBA 2QMXA 1UTHA 3Q28A 1YPNA 3G3FA 4U1OA 1QW0A 2XX9A 3EF7A 3IO4A 1OLCA 3U94A 4C1TA 2FNCA 4N07A 1MY0A 3F11A 2WKYA 5CMMA 1IXIA 3K6UA 3KG2A 1SW5A 4P0IA 3U92A 4R6KA 4DIGA 3O2AA 4K3FA 3IB1A 1D9YA 2OZZA 4EDPA 3SESA 1OIBA 4YKPA 2ZYMA 5EHSA 4Q30B 1B52A 4DZ1A 2F5XA 2XX7A 3SETA 3KGCA 2DWJA 3PPPA 1JW5A 4ZZAA 2Q8JA 1D3KA 1FQEA 4FORA 4ONYA 2XXRA 4PETA 3U93A 1VR5A 4MLQA 2ZNTA 3S9NC 4ZEKA 1I69A 2DYXA 2GFEA 3UIFA 2XXTA 2H4IA 5CRYA 3V89B 5LOMA 2F7CA 1HSJA 3EQ1A 4PFUA 1IUDA 1JW4A 1B40A 1LB8A 2NOOA 1MXXA 3UORA 1UTBA 3BFTA 4X1DA 4YMAA 3RTWB 4RNSA 3MP1A 1Z7ME 3MZBA 3TEPA 3RLFE 2E1SA 1XHYA 3RT8A 4F39A 3FVKA 1M5EA 2DXYA 3U1OA 4BLAA 3W9WA 5AE4A 5H8HA 3ZSFA 5TPAB 2PMSA 3TTLA 4NWDA 2F97A 3KZGA 5CBSA 1B32A 2UYFA 3T66A 3D4GA 4JWXA 4XKPA 3KN7A 1VSOA 5J1DA 4ND9A 1N04A 2O84X 3LBSA 5ICQA 4P0GA 1OMPA 4R2FA 3IJOB 3DLNA 1I6BA 1YTVA 2I48A 1NL5A 3K1PA 1GVCA 3IO6A 4WKMA 2F36A 1N84A 2RC8A 5F1QA 2ZNUA 2I4BA 1IEJA 3IAZA 3IB2A 4OYVA 4QSEA 1B1XA 4RY1A 2XXXA 3DP6A 4ECFA 2REGA 4O3AA 2YLNA 3VVFA 1LBCA 4F2OA 3MPKA 3N26A 1UIVA 1L5TA 3K2DA 4RXLA 3KOTA 4RK9A 5I57A 3IORA 1IITA 3OXNA 5I2KB 3O97A 1FTMA 4F3PA 2DSFA 4YKIA 1A99A 3HO7A 1TXFA 3QUJA 1MY3A 5EYFA 2QS2A 2Z8DA 1A8EA 2DE2A 5DVJA 2Y7KA 2QSXA 4NF4B 1B3FA 4G8MA 1OLAA 2Z8EA 2QL3A 2F6PA 1MRPA 4RA1A 2HEUA 3R26A 1RYOA 3EHUA 3T93B 3T9HB 2G93A 4RPNA 1EZPA 1YCJA 4NMYA 3TPAA 3I3VA 3ILTB 4LONB 5AA1A 1RKMA 4FECA 2Q89A 1N76A 4IGTA 4ZEFA 4GQOA 2RF1A 2B3BA 2DE4A 4DCYA 4OWDA 4WEPA 3PPRA 1ZBMA 3TYHA 1MPBA 1ZTYA 3IR1A 5CI5A 4KYDA 3VXBA 4F31B 3HSTA 4OEVA 3TAJA 1POY1 1MS7A 4FAJA 4YZZA 1PB8A 4O3BA 3A3CA 1SW4A 2X7QA 4OXVA 1B0HA 5CMCA 3G3KA 3IOVA 3Q29A 2ABHA 3TMGA 1D4NA 3H6UA 4AB5A 3MQ9A 3VLUA 1T0KA 5AA4A 4KQPA 5H8SA 2I0CA 4ZDMA 3I6VA 4DXCA 2QS3A 2HAUA 4F19A 3RPWA 4LVQA 1DMBA 1B7UA 4DE8A 4MH5A 5JTYA 3IB0A 2RKMA 2V25A 3M3FA 1FQDA 5HPQA 1POTA 5A5XA 3SEVA 4ISUA 2V3QA 4I62A 5FHOA 1URSA 2PYYA 3U72A 3UA8A 3C35A 4HTGA 4Z7EA 1FCKA 4X9TA 3N6TA 4L17A 4Q5TA 4G2ZA 2DS9A 3KJ7A 5IKBA 1VFDA 2ZYKA 4GFRA 4GWOA 3MAMA 3FZVA 1UIUA 4R75A 1RYXA 4QRZA 4G68C 2XXWA 1EU8A 3H6WA 4U1ZA 4I9DA 1SQYA 4IO5A 4H8JA 4H8IA 3WAFA 1GV8A 1MDQA 3MVWA 3OEKA 1JVXA 3G7WA 4NE4A 2UVIA 1NNTA 2QJEA 1N3XA 3S2VA 4G68A 1ZU0A 2NWJA 4H65A 4XKRA 4NF5B 4KR5A 3H03A 1NNKA 4GRKA 2Y7PA 1MDP1 3U8QA 1LLSA 4GXSB 3G3HA 1IXHA 1DTZA 3K6VA 3TKDA 1B3EA 1MY2A 1ANFA 1N7XA 2F35A 4H0WA 1A54A 2R6GE 2RC7A 1HSEA 4R73A 1MXUA 3K00A 1BKAA 4IGRA 4FEDA 2F7BA 4JB7A 5H8QB 1PBQA 4ZEBA 3VLWA 4AB6A 3PUWE 1LAHE 5I56A 3DP8A 1FQBA 2XXYA 3V83A 4LATA 3N5LA 1QKBA 2AL5A 5B7DA 2THIA 1GTKA 1P1WA 1B2HA 1MM6A 2ZYOA 5I59A 3B6WA 3IK6B 5F7VA 3S9MC 4LZ8A 3MZ9A 4KCDA 2O7UA 1ZJLA 3FVOA 2VHAA 1TFDA 1OQGA 4YB7A 5FTHA 2F8DA 3BBRA 1I6QA 4JSOA 3OOAA 4EXKA 5DEXB 1OVTA 1URGA 3MW0A 3O6HA 2I0BA 2H9BA 2PT2A 1D9VA 1ZMGA 2O1LA 3CSBA 1VFEA 3G3IA 5TP9B 1S7YA 1USYH 3OMBA 1QULA 1Y3PA 3PPNA 1GGGA 3IOTA 1LAXA 5K2YA 1NFTA 3OO7A 1NH8A 4X1BA 3K6WA 3PMVA 4QFOA 4P11A 3CI8A 1XVYA 1IXGA 4QSDA 3RQTA 1SI1A 1JVYA 1EZ9A 1LAGE 3JYRA 4LP2B 2REJA 1WDNA 4N6PA 5FHMA 3S4UA 4YB6A 4F29A 1MY4A 1WODA 1PB7A 3CR9A 1B9JA 4GOTA 5DVIA 2OK2A 3OO8A 4G8HA 1DSNA 4PFTA 5KCJB 3FJGA 1S50A 1Y3QA 2AL4A 4QSCA 3MWBA 3C4MA 2QS4A 3B6TA 1IIWA 3ZKLA 2RC9A 3RT6B 3E4RA 2ZNSA 1QUIA 4EXLA 3SEUA 2DOJA 2RCAA 5I57B 4QHQA 4R9FA 2VP1A 1B4ZA 1NNPA 3VXCA 3IJXB 5DTBA 1USYE 5I58B 4F3GA 4HW8A 3QIMA 4OFLA 1Y3NA 5IAIA 3FXRA 3KN3A 4NWCA 1ELJA 4YB5A 3ONMA 5FTIA 1SW1A 4EF2A 4H5GA 1H45A 3T22A 3C32A 4NEDA 5JK4A 1TWYA 1SI0A 5ELVA 4AQ4A 1DTGA 2NXOA 3T9VA 2HFBA 4C0RA 4F3BA 3FIRA 3Q27A 3TTRA 4Q8RA 1MXYA 3T96B 4LQ5A 5AA2B 1N3WA 2CZLA 3R7XA 5H8NA 4HS7A 2VOZA 1B05A 3G3GA 1P1OA 5KDTB 3MVZA 5I2NA 4BDRA 1A55A 2XD2A 3SDFA 4BDNA 1MPDA 5L9MA 1Z7NE 1O64A 4NF6A 5DVFA 4M1VA 4XTCQ 2YPNA 2Z23A 4EQ9A 2DVZA 4UA8A 1B7ZA 1SD3A 4OESA 2G29A 4JWYA 3T9UA 2A5SA 3ILUB 3M3LA 2XXPA 5AA4B 1Y1ZA 4KFQA 2I3WA 1R9QA 5AA2D 5DT6A 5HBCA 2Y7WA 5L9OA 4LZ7A 3VVEA 3KBRA 4H5FA 1NH7A 2AIXA 2DWIA 3D4CA 1YAEA 4H6DA 2XXUA 2ALUA 3B6QA 4RJZA 5JTYB 3TZAA 3C9HA 3C34A 4KYEA 4XKQA 5A5XB 4JWOA 3TUSA 4ELQA 3OSRA 4OFOA 3WAEA 3HPIA 2X7PA 5ISUA 1H44A 1FQCA 2P0SA 3JV9A 2KLFA 4M4GA 1H3DA 1URDA 2M8CA 3SEYA 3TCGA 4RYAA 2HXWA 3K6XA 2UYEA 4U4XA 2H98A 4ESWA 4C1UA 4NF8B 4DLDA 4QF9A 4GIZA 3S9LC 1Q1KA 2XXHA 4BDQA 4I8CA 3E13X 4EUOA 4ELPA 3PUVE 5JEIA 3MP6A 2OWTA 4YKJA 4ELOA 3QXMA 1MXZA 3S9EA 1JETA 1ATGA 3FD3A 2PT1A 3M8UA 4JXIA 4E0WA 3V5AA 1P1UA 4R9GA 4FE8A 4TLMB 1B3GA 3CFZA 4R6YA 1FTJA 2O7IA 2QMWA 1P99A 3PUXE 3A3UA 1F9BA 2HAVA 3FASA 2CMOA 2RINA 1LFHA 2DQVA 4R6HA 3HCQA 1KWHA 4GL0A 5ICTA 1B4HA 3C31A 2DP8A 4OHNA 3QK6A 3PMWA 4LA9A 3QYTA 1M5DA 1XS5A 4GD5A 4NF4A 3PPOA 4IB2A 2QPQA 1AIVA 1DOTA 2Z8FA 4R72A 1JQFA 1ZIUA 4XIGQ 3DM0A 3UGWA 2PVUA 1SVXB 2GRVA 1MQHA 1BIYA 3OSQA 5CBRA 4DDDA 4H67A 3O66A 2A5TB 3FJ7A 3T9XB 1UTHB 4YU0A 1LFIA 3FXUA 1CB6A 3OD7A 3Q25A 3KJTA 2O1MA 1H76A 3L6GA 1P1QA 3O6IA 1XVXA 4H1XA 1QJMA 3LSXA 4BDMA 3CVGA 3FVGA 1R6ZA 1R1NA 4OERA 3TTKA 2R71A 5CMBA 4Q0CA 2IEEA 4OVJA 1MY1A 3UK4A 2XXIA 1MQDA 2DWHA 1MXVA 2XXVA 3IL1B 4JSDA 3LR1A 2Q9TA 1PB9A 1A40A 4XXUA 3TCFA 3UN6A 5M2VA 1M5CA 1QUKA 1MXWA 4ZS9A 2DVCA 1GR2A 3CRBA 3CFLA 2OWSA 3MUQA 2FA7A 3RGYA 2ONKE 3K1MA 4WEDA 3R6UA 4RPOA 3K1NA 4FATA 5FHNA 5BWJA 2DE3A 2E0SA 3ECRA 1US5A 4ZZEA 4PE5B 1UTBB 4KYSA 4TOZA 3VLVA 1B51A 3MVYA 1AH5A 3B7DA 2DXRA 1EZOA 5K2XA 4OQOA 2DWAA 4HCYA 3VV5A 4YKKA 1N0TA 3H4ZA 4G4PA 1EH3A 4FEBA 5H8HB 2Q88A 2O6AA 2Q2AA 1TFAA 2ONRA 1LFGA 3W9VA 2HZLA 1NKXA 3TQLA 3OO6A 3GZGA 1M5BA 4F3SA 1A8FA 1S9TA 1OQHA 1B0LA 4NF5A 3Q26A 5H8NB 4JDFA 3H7MA 3CIJA 3IOUA 3UP9A 3LSWA 4MBPA 2Q2CA 3ODBA 5I2NB 3M3KA 2ZXTA 3PU5A 4TQUQ 1B5HA 4U23A 3CG3A 1AL3A 1IXCA 4NF6B 4UACA 2B65A 2BJJX 5H8FA 3N94A 4R2BA 3ZKKA 3FV2A 4PFWA 4EQBA 2UVGA 3H6TA 4ZECA 3TODA 5H8QA 3I5OA 3THIA 4F1YA 3PMXA 1MPCA 2UXAA 1O7TA 1M5FA 3E3KA 4LQ2A 3RUMA 4G77A 2HQ0A 3PD8A 1Y4CA 4ESXA 1ZKBA 4LZ5A 4EF1A 4NTLA 2P2AA 3H6VA 3KSXA 1TT1A 4G8NA 1J1NA 3O28A 4FJPA 2Y84A 3V8XB 3TTNA 3TQWA 1Y9UA 1QUJA 3KOSA 4KHZE 1AOVA 2ANJA 4IO6A 4BDOA 1PBPA 1CE2A 4GVOA 4WXJA 3MC2A 5DEXA 1R9LA 1QVSA 2NUVA 3VVDA 1LGBC 4IO3A 2ZMBA 3O6GA 3MP8A 4KCCA 4OTEA 3EPEA 4HCWA 3GBAA 3EHTA 2AYSA 5TP9A 3FATA 3CSGA 4E0XA 3QAXA 3RY3A 3HHFA 1P1NA 3CG1A 1JW1A 2V84A 3TFLA 2F7AA 1SBPA 1B3LA 2OLBA 1LCTA 3QUFA 1MQJA 2O68A 3PD9A 4OZ9A 5KZTA 1MG1A 1DPEA 2FYIA 1B5IA 2P1SA 3MBPA 3BKIB 3OO9A 1XOCA 3LUYA 1II5A 3P7IA 1DPPA 3G3JA 2XD3A 3K01A 3C36A 1FW0A 3K0VA 2V3UA 2D3IA 1PDAA 1Q35A 5KCJA 5L8DA 1NNFA 3OELA 2O51A 4GXAA 1H43A 3GXAA 1B1HA 3PUYE 3E9XA 1I6AA 1BLFA 4IO4A 2ONSA 3USDA 3FUZA 3FVNA 4U2RA 1FTOA 3VE1B 3H3GA 4GLIA 4OMBA 2F6GA 2H99A 3EHSA 4XKNA 4RK2A 4U4SA 1LBBA 5I58A 3N6UA 1XT8A 2D21A 2W7YA 3VDFA 3HV1A 1LAFE 3RNNA 4KPTA 4QFPA 5TPAA 4F1UA 2Y7IA 3OEMA 3VFJA 4GF8A 2X26A 1FQAA 3SERA 4ZEDA 4MF3A 1Y20A 2QS1A 3SEXA 2GHAA 4DXUA 2VGQA 1WVJA 1MM7A 4I1DA 1XC1A 1JEUA 4POXA 1SW2A 2PBWA 2H5YA 5AA2A 1FTKA 4MFIA 5I84A 3KSJA 5KDTA 4OETA 4YAHX 3C33A 2I4CA 4TLLB 5ITPA 1LB9A 4DCXA 1PEBA 3IOWA 2GH9A 3MJNA 2YJPA 1HSLA 2Z22A 4OENA 5TU0A 4GL8A 1LSTA 4FIMA 2QRYA 4G68B 4LUBA 5AA3A 5HM4B 4ELRA 4IY6A 1FQFA 2I49A 1LCFA 5B70A 3LC8A 5CMKA 5I2KA 2XX8A 3O9PA 5DYHA 4QFKA 4ZE9A 1FTLA 5L9SA 3DP4A 4OFJA 1OVBA 3SKPA 2UVJA 2HZKA 2Y7RA 1Y4TA 2IA4A 2XHDA 3EN3A 3FXQA 2HCAA 3MPLA 1MH4A 4JBZA 2UVHA 1BTJA 4IO2A 3PGFA 3LSLA 1N7WA 3PUZE 1B3HA 4IO7A 5EHMA 4U22A 1B58A 5I56B 4PQJA 3DELB 2O69A 1BP5A 3L6HA 3FGSA 3BFUA 1IZ1A 2H25A 3AXFA 1B6HA 3KN8A 4O3CA 2ZYNA 2I3VA 3OENA 4KI0E 4R74A 4QFLA 3MVXA 4F18A 3GBBA 5ITOA 5CM6A 1A7LA 1QKAA 5I59B 1SYIA 3W15C 1O63A 4ZEIA 2F34A 1NMUA 2V3TA 1Y1MA 3KEIA 1PC3A 4QFNA 1MQIA 4NF8A 4THIA 3FJMA 4F1VA 4F2QA 2R9JA 3RN8A 3IX1A 2GHBA 3TCHA 3SEWA 1B7HA 1ZLQA 1AMFA 2NVUB 2F78A 2PX1A 1B46A 3PV0E 2B3FA 2LAOA 1JEVA 4KD5A 2VD2A 4DXBA 3H06B 3PPQA 3HN0A 4F22A 3O29A 1MH3A 4YICA 1IQ7A 1JNFA 3A09A 2ESNA 3LSFB 2OBGA 3TTMA 4X48A 4IY5A 4PP0A 4BDLA 3TELA 5BUUA 3CFXA 5CC2A 3RTFB 5H8FB 1VE4A 2I58A 3K4UA 4N13A 1UQWA 4ZE8A 2OJTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SDX A;  2VD3 A;  3JZJ A;  4POW A;  4MLV A;  4OEU A;  4YMB A;  2V93 A;  3GLB A;  4Z0I A;  3ZS6 A;  3HHG A;  2XXQ A;  4PFY A;  1B5J A;  3KFM A;  1SYH A;  3K02 A;  4U21 A;  2I6E A;  2D5W A;  3MZ1 A;  1US4 A;  4EQ7 A;  2A5T A;  3TDJ A;  2OCU A;  3FV1 A;  3QSL A;  1MQG A;  2RCB A;  2QMX A;  1UTH A;  3Q28 A;  1YPN A;  3G3F A;  4U1O A;  1QW0 A;  2XX9 A;  3EF7 A;  3IO4 A;  1OLC A;  3U94 A;  4C1T A;  2FNC A;  4N07 A;  1MY0 A;  3F11 A;  2WKY A;  5CMM A;  1IXI A;  3K6U A;  3KG2 A;  1SW5 A;  4P0I A;  3U92 A;  4R6K A;  4DIG A;  3O2A A;  4K3F A;  3IB1 A;  1D9Y A;  2OZZ A;  4EDP A;  3SES A;  1OIB A;  4YKP A;  2ZYM A;  5EHS A;  4Q30 B;  1B52 A;  4DZ1 A;  2F5X A;  2XX7 A;  3SET A;  3KGC A;  2DWJ A;  3PPP A;  1JW5 A;  4ZZA A;  2Q8J A;  1D3K A;  1FQE A;  4FOR A;  4ONY A;  2XXR A;  4PET A;  3U93 A;  1VR5 A;  4MLQ A;  2ZNT A;  3S9N C;  4ZEK A;  1I69 A;  2DYX A;  2GFE A;  3UIF A;  2XXT A;  2H4I A;  5CRY A;  3V89 B;  5LOM A;  2F7C A;  1HSJ A;  3EQ1 A;  4PFU A;  1IUD A;  1JW4 A;  1B40 A;  1LB8 A;  2NOO A;  1MXX A;  3UOR A;  1UTB A;  3BFT A;  4X1D A;  4YMA A;  3RTW B;  4RNS A;  3MP1 A;  1Z7M E;  3MZB A;  3TEP A;  3RLF E;  2E1S A;  1XHY A;  3RT8 A;  4F39 A;  3FVK A;  1M5E A;  2DXY A;  3U1O A;  4BLA A;  3W9W A;  5AE4 A;  5H8H A;  3ZSF A;  5TPA B;  2PMS A;  3TTL A;  4NWD A;  2F97 A;  3KZG A;  5CBS A;  1B32 A;  2UYF A;  3T66 A;  3D4G A;  4JWX A;  4XKP A;  3KN7 A;  1VSO A;  5J1D A;  4ND9 A;  1N04 A;  2O84 X;  3LBS A;  5ICQ A;  4P0G A;  1OMP A;  4R2F A;  3IJO B;  3DLN A;  1I6B A;  1YTV A;  2I48 A;  1NL5 A;  3K1P A;  1GVC A;  3IO6 A;  4WKM A;  2F36 A;  1N84 A;  2RC8 A;  5F1Q A;  2ZNU A;  2I4B A;  1IEJ A;  3IAZ A;  3IB2 A;  4OYV A;  4QSE A;  1B1X A;  4RY1 A;  2XXX A;  3DP6 A;  4ECF A;  2REG A;  4O3A A;  2YLN A;  3VVF A;  1LBC A;  4F2O A;  3MPK A;  3N26 A;  1UIV A;  1L5T A;  3K2D A;  4RXL A;  3KOT A;  4RK9 A;  5I57 A;  3IOR A;  1IIT A;  3OXN A;  5I2K B;  3O97 A;  1FTM A;  4F3P A;  2DSF A;  4YKI A;  1A99 A;  3HO7 A;  1TXF A;  3QUJ A;  1MY3 A;  5EYF A;  2QS2 A;  2Z8D A;  1A8E A;  2DE2 A;  5DVJ A;  2Y7K A;  2QSX A;  4NF4 B;  1B3F A;  4G8M A;  1OLA A;  2Z8E A;  2QL3 A;  2F6P A;  1MRP A;  4RA1 A;  2HEU A;  3R26 A;  1RYO A;  3EHU A;  3T93 B;  3T9H B;  2G93 A;  4RPN A;  1EZP A;  1YCJ A;  4NMY A;  3TPA A;  3I3V A;  3ILT B;  4LON B;  5AA1 A;  1RKM A;  4FEC A;  2Q89 A;  1N76 A;  4IGT A;  4ZEF A;  4GQO A;  2RF1 A;  2B3B A;  2DE4 A;  4DCY A;  4OWD A;  4WEP A;  3PPR A;  1ZBM A;  3TYH A;  1MPB A;  1ZTY A;  3IR1 A;  5CI5 A;  4KYD A;  3VXB A;  4F31 B;  3HST A;  4OEV A;  3TAJ A;  1POY 1;  1MS7 A;  4FAJ A;  4YZZ A;  1PB8 A;  4O3B A;  3A3C A;  1SW4 A;  2X7Q A;  4OXV A;  1B0H A;  5CMC A;  3G3K A;  3IOV A;  3Q29 A;  2ABH A;  3TMG A;  1D4N A;  3H6U A;  4AB5 A;  3MQ9 A;  3VLU A;  1T0K A;  5AA4 A;  4KQP A;  5H8S A;  2I0C A;  4ZDM A;  3I6V A;  4DXC A;  2QS3 A;  2HAU A;  4F19 A;  3RPW A;  4LVQ A;  1DMB A;  1B7U A;  4DE8 A;  4MH5 A;  5JTY A;  3IB0 A;  2RKM A;  2V25 A;  3M3F A;  1FQD A;  5HPQ A;  1POT A;  5A5X A;  3SEV A;  4ISU A;  2V3Q A;  4I62 A;  5FHO A;  1URS A;  2PYY A;  3U72 A;  3UA8 A;  3C35 A;  4HTG A;  4Z7E A;  1FCK A;  4X9T A;  3N6T A;  4L17 A;  4Q5T A;  4G2Z A;  2DS9 A;  3KJ7 A;  5IKB A;  1VFD A;  2ZYK A;  4GFR A;  4GWO A;  3MAM A;  3FZV A;  1UIU A;  4R75 A;  1RYX A;  4QRZ A;  4G68 C;  2XXW A;  1EU8 A;  3H6W A;  4U1Z A;  4I9D A;  1SQY A;  4IO5 A;  4H8J A;  4H8I A;  3WAF A;  1GV8 A;  1MDQ A;  3MVW A;  3OEK A;  1JVX A;  3G7W A;  4NE4 A;  2UVI A;  1NNT A;  2QJE A;  1N3X A;  3S2V A;  4G68 A;  1ZU0 A;  2NWJ A;  4H65 A;  4XKR A;  4NF5 B;  4KR5 A;  3H03 A;  1NNK A;  4GRK A;  2Y7P A;  1MDP 1;  3U8Q A;  1LLS A;  4GXS B;  3G3H A;  1IXH A;  1DTZ A;  3K6V A;  3TKD A;  1B3E A;  1MY2 A;  1ANF A;  1N7X A;  2F35 A;  4H0W A;  1A54 A;  2R6G E;  2RC7 A;  1HSE A;  4R73 A;  1MXU A;  3K00 A;  1BKA A;  4IGR A;  4FED A;  2F7B A;  4JB7 A;  5H8Q B;  1PBQ A;  4ZEB A;  3VLW A;  4AB6 A;  3PUW E;  1LAH E;  5I56 A;  3DP8 A;  1FQB A;  2XXY A;  3V83 A;  4LAT A;  3N5L A;  1QKB A;  2AL5 A;  5B7D A;  2THI A;  1GTK A;  1P1W A;  1B2H A;  1MM6 A;  2ZYO A;  5I59 A;  3B6W A;  3IK6 B;  5F7V A;  3S9M C;  4LZ8 A;  3MZ9 A;  4KCD A;  2O7U A;  1ZJL A;  3FVO A;  2VHA A;  1TFD A;  1OQG A;  4YB7 A;  5FTH A;  2F8D A;  3BBR A;  1I6Q A;  4JSO A;  3OOA A;  4EXK A;  5DEX B;  1OVT A;  1URG A;  3MW0 A;  3O6H A;  2I0B A;  2H9B A;  2PT2 A;  1D9V A;  1ZMG A;  2O1L A;  3CSB A;  1VFE A;  3G3I A;  5TP9 B;  1S7Y A;  1USY H;  3OMB A;  1QUL A;  1Y3P A;  3PPN A;  1GGG A;  3IOT A;  1LAX A;  5K2Y A;  1NFT A;  3OO7 A;  1NH8 A;  4X1B A;  3K6W A;  3PMV A;  4QFO A;  4P11 A;  3CI8 A;  1XVY A;  1IXG A;  4QSD A;  3RQT A;  1SI1 A;  1JVY A;  1EZ9 A;  1LAG E;  3JYR A;  4LP2 B;  2REJ A;  1WDN A;  4N6P A;  5FHM A;  3S4U A;  4YB6 A;  4F29 A;  1MY4 A;  1WOD A;  1PB7 A;  3CR9 A;  1B9J A;  4GOT A;  5DVI A;  2OK2 A;  3OO8 A;  4G8H A;  1DSN A;  4PFT A;  5KCJ B;  3FJG A;  1S50 A;  1Y3Q A;  2AL4 A;  4QSC A;  3MWB A;  3C4M A;  2QS4 A;  3B6T A;  1IIW A;  3ZKL A;  2RC9 A;  3RT6 B;  3E4R A;  2ZNS A;  1QUI A;  4EXL A;  3SEU A;  2DOJ A;  2RCA A;  5I57 B;  4QHQ A;  4R9F A;  2VP1 A;  1B4Z A;  1NNP A;  3VXC A;  3IJX B;  5DTB A;  1USY E;  5I58 B;  4F3G A;  4HW8 A;  3QIM A;  4OFL A;  1Y3N A;  5IAI A;  3FXR A;  3KN3 A;  4NWC A;  1ELJ A;  4YB5 A;  3ONM A;  5FTI A;  1SW1 A;  4EF2 A;  4H5G A;  1H45 A;  3T22 A;  3C32 A;  4NED A;  5JK4 A;  1TWY A;  1SI0 A;  5ELV A;  4AQ4 A;  1DTG A;  2NXO A;  3T9V A;  2HFB A;  4C0R A;  4F3B A;  3FIR A;  3Q27 A;  3TTR A;  4Q8R A;  1MXY A;  3T96 B;  4LQ5 A;  5AA2 B;  1N3W A;  2CZL A;  3R7X A;  5H8N A;  4HS7 A;  2VOZ A;  1B05 A;  3G3G A;  1P1O A;  5KDT B;  3MVZ A;  5I2N A;  4BDR A;  1A55 A;  2XD2 A;  3SDF A;  4BDN A;  1MPD A;  5L9M A;  1Z7N E;  1O64 A;  4NF6 A;  5DVF A;  4M1V A;  4XTC Q;  2YPN A;  2Z23 A;  4EQ9 A;  2DVZ A;  4UA8 A;  1B7Z A;  1SD3 A;  4OES A;  2G29 A;  4JWY A;  3T9U A;  2A5S A;  3ILU B;  3M3L A;  2XXP A;  5AA4 B;  1Y1Z A;  4KFQ A;  2I3W A;  1R9Q A;  5AA2 D;  5DT6 A;  5HBC A;  2Y7W A;  5L9O A;  4LZ7 A;  3VVE A;  3KBR A;  4H5F A;  1NH7 A;  2AIX A;  2DWI A;  3D4C A;  1YAE A;  4H6D A;  2XXU A;  2ALU A;  3B6Q A;  4RJZ A;  5JTY B;  3TZA A;  3C9H A;  3C34 A;  4KYE A;  4XKQ A;  5A5X B;  4JWO A;  3TUS A;  4ELQ A;  3OSR A;  4OFO A;  3WAE A;  3HPI A;  2X7P A;  5ISU A;  1H44 A;  1FQC A;  2P0S A;  3JV9 A;  2KLF A;  4M4G A;  1H3D A;  1URD A;  2M8C A;  3SEY A;  3TCG A;  4RYA A;  2HXW A;  3K6X A;  2UYE A;  4U4X A;  2H98 A;  4ESW A;  4C1U A;  4NF8 B;  4DLD A;  4QF9 A;  4GIZ A;  3S9L C;  1Q1K A;  2XXH A;  4BDQ A;  4I8C A;  3E13 X;  4EUO A;  4ELP A;  3PUV E;  5JEI A;  3MP6 A;  2OWT A;  4YKJ A;  4ELO A;  3QXM A;  1MXZ A;  3S9E A;  1JET A;  1ATG A;  3FD3 A;  2PT1 A;  3M8U A;  4JXI A;  4E0W A;  3V5A A;  1P1U A;  4R9G A;  4FE8 A;  4TLM B;  1B3G A;  3CFZ A;  4R6Y A;  1FTJ A;  2O7I A;  2QMW A;  1P99 A;  3PUX E;  3A3U A;  1F9B A;  2HAV A;  3FAS A;  2CMO A;  2RIN A;  1LFH A;  2DQV A;  4R6H A;  3HCQ A;  1KWH A;  4GL0 A;  5ICT A;  1B4H A;  3C31 A;  2DP8 A;  4OHN A;  3QK6 A;  3PMW A;  4LA9 A;  3QYT A;  1M5D A;  1XS5 A;  4GD5 A;  4NF4 A;  3PPO A;  4IB2 A;  2QPQ A;  1AIV A;  1DOT A;  2Z8F A;  4R72 A;  1JQF A;  1ZIU A;  4XIG Q;  3DM0 A;  3UGW A;  2PVU A;  1SVX B;  2GRV A;  1MQH A;  1BIY A;  3OSQ A;  5CBR A;  4DDD A;  4H67 A;  3O66 A;  2A5T B;  3FJ7 A;  3T9X B;  1UTH B;  4YU0 A;  1LFI A;  3FXU A;  1CB6 A;  3OD7 A;  3Q25 A;  3KJT A;  2O1M A;  1H76 A;  3L6G A;  1P1Q A;  3O6I A;  1XVX A;  4H1X A;  1QJM A;  3LSX A;  4BDM A;  3CVG A;  3FVG A;  1R6Z A;  1R1N A;  4OER A;  3TTK A;  2R71 A;  5CMB A;  4Q0C A;  2IEE A;  4OVJ A;  1MY1 A;  3UK4 A;  2XXI A;  1MQD A;  2DWH A;  1MXV A;  2XXV A;  3IL1 B;  4JSD A;  3LR1 A;  2Q9T A;  1PB9 A;  1A40 A;  4XXU A;  3TCF A;  3UN6 A;  5M2V A;  1M5C A;  1QUK A;  1MXW A;  4ZS9 A;  2DVC A;  1GR2 A;  3CRB A;  3CFL A;  2OWS A;  3MUQ A;  2FA7 A;  3RGY A;  2ONK E;  3K1M A;  4WED A;  3R6U A;  4RPO A;  3K1N A;  4FAT A;  5FHN A;  5BWJ A;  2DE3 A;  2E0S A;  3ECR A;  1US5 A;  4ZZE A;  4PE5 B;  1UTB B;  4KYS A;  4TOZ A;  3VLV A;  1B51 A;  3MVY A;  1AH5 A;  3B7D A;  2DXR A;  1EZO A;  5K2X A;  4OQO A;  2DWA A;  4HCY A;  3VV5 A;  4YKK A;  1N0T A;  3H4Z A;  4G4P A;  1EH3 A;  4FEB A;  5H8H B;  2Q88 A;  2O6A A;  2Q2A A;  1TFA A;  2ONR A;  1LFG A;  3W9V A;  2HZL A;  1NKX A;  3TQL A;  3OO6 A;  3GZG A;  1M5B A;  4F3S A;  1A8F A;  1S9T A;  1OQH A;  1B0L A;  4NF5 A;  3Q26 A;  5H8N B;  4JDF A;  3H7M A;  3CIJ A;  3IOU A;  3UP9 A;  3LSW A;  4MBP A;  2Q2C A;  3ODB A;  5I2N B;  3M3K A;  2ZXT A;  3PU5 A;  4TQU Q;  1B5H A;  4U23 A;  3CG3 A;  1AL3 A;  1IXC A;  4NF6 B;  4UAC A;  2B65 A;  2BJJ X;  5H8F A;  3N94 A;  4R2B A;  3ZKK A;  3FV2 A;  4PFW A;  4EQB A;  2UVG A;  3H6T A;  4ZEC A;  3TOD A;  5H8Q A;  3I5O A;  3THI A;  4F1Y A;  3PMX A;  1MPC A;  2UXA A;  1O7T A;  1M5F A;  3E3K A;  4LQ2 A;  3RUM A;  4G77 A;  2HQ0 A;  3PD8 A;  1Y4C A;  4ESX A;  1ZKB A;  4LZ5 A;  4EF1 A;  4NTL A;  2P2A A;  3H6V A;  3KSX A;  1TT1 A;  4G8N A;  1J1N A;  3O28 A;  4FJP A;  2Y84 A;  3V8X B;  3TTN A;  3TQW A;  1Y9U A;  1QUJ A;  3KOS A;  4KHZ E;  1AOV A;  2ANJ A;  4IO6 A;  4BDO A;  1PBP A;  1CE2 A;  4GVO A;  4WXJ A;  3MC2 A;  5DEX A;  1R9L A;  1QVS A;  2NUV A;  3VVD A;  1LGB C;  4IO3 A;  2ZMB A;  3O6G A;  3MP8 A;  4KCC A;  4OTE A;  3EPE A;  4HCW A;  3GBA A;  3EHT A;  2AYS A;  5TP9 A;  3FAT A;  3CSG A;  4E0X A;  3QAX A;  3RY3 A;  3HHF A;  1P1N A;  3CG1 A;  1JW1 A;  2V84 A;  3TFL A;  2F7A A;  1SBP A;  1B3L A;  2OLB A;  1LCT A;  3QUF A;  1MQJ A;  2O68 A;  3PD9 A;  4OZ9 A;  5KZT A;  1MG1 A;  1DPE A;  2FYI A;  1B5I A;  2P1S A;  3MBP A;  3BKI B;  3OO9 A;  1XOC A;  3LUY A;  1II5 A;  3P7I A;  1DPP A;  3G3J A;  2XD3 A;  3K01 A;  3C36 A;  1FW0 A;  3K0V A;  2V3U A;  2D3I A;  1PDA A;  1Q35 A;  5KCJ A;  5L8D A;  1NNF A;  3OEL A;  2O51 A;  4GXA A;  1H43 A;  3GXA A;  1B1H A;  3PUY E;  3E9X A;  1I6A A;  1BLF A;  4IO4 A;  2ONS A;  3USD A;  3FUZ A;  3FVN A;  4U2R A;  1FTO A;  3VE1 B;  3H3G A;  4GLI A;  4OMB A;  2F6G A;  2H99 A;  3EHS A;  4XKN A;  4RK2 A;  4U4S A;  1LBB A;  5I58 A;  3N6U A;  1XT8 A;  2D21 A;  2W7Y A;  3VDF A;  3HV1 A;  1LAF E;  3RNN A;  4KPT A;  4QFP A;  5TPA A;  4F1U A;  2Y7I A;  3OEM A;  3VFJ A;  4GF8 A;  2X26 A;  1FQA A;  3SER A;  4ZED A;  4MF3 A;  1Y20 A;  2QS1 A;  3SEX A;  2GHA A;  4DXU A;  2VGQ A;  1WVJ A;  1MM7 A;  4I1D A;  1XC1 A;  1JEU A;  4POX A;  1SW2 A;  2PBW A;  2H5Y A;  5AA2 A;  1FTK A;  4MFI A;  5I84 A;  3KSJ A;  5KDT A;  4OET A;  4YAH X;  3C33 A;  2I4C A;  4TLL B;  5ITP A;  1LB9 A;  4DCX A;  1PEB A;  3IOW A;  2GH9 A;  3MJN A;  2YJP A;  1HSL A;  2Z22 A;  4OEN A;  5TU0 A;  4GL8 A;  1LST A;  4FIM A;  2QRY A;  4G68 B;  4LUB A;  5AA3 A;  5HM4 B;  4ELR A;  4IY6 A;  1FQF A;  2I49 A;  1LCF A;  5B70 A;  3LC8 A;  5CMK A;  5I2K A;  2XX8 A;  3O9P A;  5DYH A;  4QFK A;  4ZE9 A;  1FTL A;  5L9S A;  3DP4 A;  4OFJ A;  1OVB A;  3SKP A;  2UVJ A;  2HZK A;  2Y7R A;  1Y4T A;  2IA4 A;  2XHD A;  3EN3 A;  3FXQ A;  2HCA A;  3MPL A;  1MH4 A;  4JBZ A;  2UVH A;  1BTJ A;  4IO2 A;  3PGF A;  3LSL A;  1N7W A;  3PUZ E;  1B3H A;  4IO7 A;  5EHM A;  4U22 A;  1B58 A;  5I56 B;  4PQJ A;  3DEL B;  2O69 A;  1BP5 A;  3L6H A;  3FGS A;  3BFU A;  1IZ1 A;  2H25 A;  3AXF A;  1B6H A;  3KN8 A;  4O3C A;  2ZYN A;  2I3V A;  3OEN A;  4KI0 E;  4R74 A;  4QFL A;  3MVX A;  4F18 A;  3GBB A;  5ITO A;  5CM6 A;  1A7L A;  1QKA A;  5I59 B;  1SYI A;  3W15 C;  1O63 A;  4ZEI A;  2F34 A;  1NMU A;  2V3T A;  1Y1M A;  3KEI A;  1PC3 A;  4QFN A;  1MQI A;  4NF8 A;  4THI A;  3FJM A;  4F1V A;  4F2Q A;  2R9J A;  3RN8 A;  3IX1 A;  2GHB A;  3TCH A;  3SEW A;  1B7H A;  1ZLQ A;  1AMF A;  2NVU B;  2F78 A;  2PX1 A;  1B46 A;  3PV0 E;  2B3F A;  2LAO A;  1JEV A;  4KD5 A;  2VD2 A;  4DXB A;  3H06 B;  3PPQ A;  3HN0 A;  4F22 A;  3O29 A;  1MH3 A;  4YIC A;  1IQ7 A;  1JNF A;  3A09 A;  2ESN A;  3LSF B;  2OBG A;  3TTM A;  4X48 A;  4IY5 A;  4PP0 A;  4BDL A;  3TEL A;  5BUU A;  3CFX A;  5CC2 A;  3RTF B;  5H8F B;  1VE4 A;  2I58 A;  3K4U A;  4N13 A;  1UQW A;  4ZE8 A;  2OJT A; 
#chains in the Genus database with same CATH topology
 4GWZ A;  1SDX A;  2VD3 A;  3JZJ A;  4POW A;  4MLV A;  4OEU A;  4PDH A;  3IFA A;  4YMB A;  2V93 A;  3GLB A;  4Z0I A;  3ZS6 A;  3HHG A;  2XXQ A;  4PFY A;  1B5J A;  3KFM A;  1SYH A;  2CZI A;  3K02 A;  4U21 A;  2I6E A;  2D5W A;  1NV0 A;  3MZ1 A;  1US4 A;  4EQ7 A;  2A5T A;  3TDJ A;  2OCU A;  3FV1 A;  3QSL A;  1MQG A;  2RCB A;  2QMX A;  1UTH A;  2L5V A;  3Q28 A;  4MIJ A;  1YPN A;  3G3F A;  4U1O A;  1QW0 A;  1DK4 A;  2XX9 A;  3EF7 A;  3IO4 A;  1OLC A;  3U94 A;  4C1T A;  2FNC A;  2F3B A;  4PAI A;  4N07 A;  1KA0 A;  1MY0 A;  3F11 A;  2WKY A;  5CMM A;  1IXI A;  3K6U A;  4HE2 A;  3KG2 A;  1SW5 A;  4P0I A;  4MCO A;  3U92 A;  2P3V A;  4R6K A;  4DIG A;  3O2A A;  4K3F A;  3IB1 A;  1D9Y A;  2OZZ A;  4EDP A;  3SES A;  4OAN A;  1OIB A;  4YKP A;  2ZYM A;  5EHS A;  4Q30 B;  1B52 A;  4P1L A;  4XFE A;  4DZ1 A;  2F5X A;  2XX7 A;  3SET A;  3KGC A;  2DWJ A;  4XEQ A;  3PPP A;  1JW5 A;  4ZZA A;  4OVQ A;  4MX6 A;  2Q8J A;  1D3K A;  1FQE A;  4FOR A;  4JVD A;  4ONY A;  2XXR A;  4PET A;  4OVS A;  3U93 A;  1VR5 A;  4MLQ A;  2ZNT A;  3S9N C;  4ZEK A;  1I69 A;  2DYX A;  2GFE A;  3UIF A;  2XXT A;  2H4I A;  5CRY A;  3V89 B;  3E78 A;  5LOM A;  2F7C A;  2WYK A;  1HSJ A;  3EQ1 A;  4PFU A;  1IUD A;  1JW4 A;  1B40 A;  1LB8 A;  2NOO A;  2ZZV A;  1MXX A;  3UOR A;  1UTB A;  2V4C A;  5LTC A;  3BFT A;  4X1D A;  4YMA A;  3RTW B;  1NUZ A;  4RNS A;  3MP1 A;  1Z7M E;  3MZB A;  3TEP A;  3RLF E;  2E1S A;  5IZ3 B;  1XHY A;  3RT8 A;  4F39 A;  4GX6 A;  3FVK A;  3CHG A;  1M5E A;  2DXY A;  3U1O A;  4BLA A;  2Q74 A;  3W9W A;  5AE4 A;  5H8H A;  3ZSF A;  5TPA B;  2PMS A;  3TTL A;  4NWD A;  2F97 A;  3KZG A;  5CBS A;  1B32 A;  2UYF A;  3T66 A;  4DI4 B;  1FBC A;  3D4G A;  4JWX A;  4XKP A;  3KN7 A;  1VSO A;  5J1D A;  4ND9 A;  1N04 A;  2O84 X;  3LBS A;  5ICQ A;  4P0G A;  1OMP A;  4R2F A;  3IJO B;  2VPN A;  3DLN A;  1I6B A;  1FBH A;  1YTV A;  2I48 A;  1NL5 A;  1FJ9 A;  3K1P A;  1GVC A;  3IO6 A;  4WKM A;  2F36 A;  1N84 A;  2RC8 A;  5F1Q A;  2ZNU A;  2I4B A;  1IEJ A;  3IAZ A;  3IB2 A;  4OYV A;  4QSE A;  1B1X A;  4RY1 A;  2XXX A;  3DP6 A;  4ECF A;  1AWB A;  2REG A;  4O3A A;  2YLN A;  3VVF A;  1LBC A;  4F2O A;  3MPK A;  4N6K A;  3N26 A;  1UIV A;  1L5T A;  3K2D A;  4RXL A;  3KOT A;  4RK9 A;  5I57 A;  3IOR A;  1IIT A;  3OXN A;  5I2K B;  3O97 A;  1FTM A;  4F3P A;  2PFY A;  2DSF A;  4YKI A;  1A99 A;  3HO7 A;  1TXF A;  1LEV A;  3QUJ A;  1MY3 A;  5EYF A;  2VT5 A;  2QS2 A;  2Z8D A;  1A8E A;  4GBW A;  2DE2 A;  5DVJ A;  2Y7K A;  2QSX A;  1XI6 A;  4NF4 B;  1B3F A;  4OVR A;  4G8M A;  1OLA A;  1IME A;  2Z8E A;  4NAP A;  2QL3 A;  2F6P A;  1MRP A;  4RA1 A;  2HEU A;  4AS5 A;  3R26 A;  1RYO A;  3EHU A;  3T93 B;  3T9H B;  2G93 A;  4RPN A;  1EZP A;  1YCJ A;  4NMY A;  3TPA A;  1NV7 A;  3I3V A;  3ILT B;  4LON B;  2QFL A;  5AA1 A;  1RKM A;  4FEC A;  4GWS A;  2Q89 A;  1N76 A;  4IGT A;  4ZEF A;  4GQO A;  2WYP A;  2RF1 A;  2PCR A;  2B3B A;  2DE4 A;  4DCY A;  4OWD A;  4WEP A;  3PPR A;  1ZBM A;  3TYH A;  1MPB A;  1ZTY A;  3IR1 A;  5CI5 A;  5EQ9 A;  4KYD A;  3VXB A;  4F31 B;  3HST A;  4OEV A;  3TAJ A;  1POY 1;  1MS7 A;  4FAJ A;  4YZZ A;  4MNC A;  1PB8 A;  4O3B A;  3A3C A;  1SW4 A;  2X7Q A;  4OXV A;  1B0H A;  5CMC A;  3G3K A;  3IOV A;  3Q29 A;  2ABH A;  3TMG A;  1D4N A;  3H6U A;  4AB5 A;  3MQ9 A;  3VLU A;  1T0K A;  5AA4 A;  4KQP A;  4PFB A;  2CEY A;  5H8S A;  2I0C A;  1NV2 A;  4ZDM A;  3I6V A;  4DXC A;  2QS3 A;  2HAU A;  5ESY A;  4F19 A;  3RPW A;  4LVQ A;  1DMB A;  1B7U A;  4DE8 A;  4MH5 A;  5JTY A;  3IB0 A;  2RKM A;  2V25 A;  5DW8 A;  3M3F A;  1FQD A;  1KZ8 A;  5HPQ A;  1POT A;  3D1R A;  5A5X A;  3SEV A;  4ISU A;  4GX3 A;  2V3Q A;  4I62 A;  5FHO A;  1URS A;  4G61 A;  2PYY A;  3U72 A;  3UA8 A;  3C35 A;  4HTG A;  4Z7E A;  1FCK A;  2B4M A;  4MEV A;  4X9T A;  3N6T A;  4L17 A;  4PTK A;  2FBP A;  4PAF A;  4G2Z A;  1YZ0 A;  4Q5T A;  2DS9 A;  3KJ7 A;  5IKB A;  5J16 A;  1VFD A;  1DCU A;  2ZYK A;  4GFR A;  4GWO A;  3MAM A;  2XA5 A;  3FZV A;  4N6D A;  1UIU A;  4R75 A;  1RYX A;  4QRZ A;  4G68 C;  2XXW A;  1EU8 A;  3H6W A;  4U1Z A;  4I9D A;  1SQY A;  4IO5 A;  1NI9 A;  4H8J A;  4H8I A;  3WAF A;  1GV8 A;  1MDQ A;  3MVW A;  3OEK A;  1JVX A;  3G7W A;  4NE4 A;  2UVI A;  1NNT A;  2QJE A;  1N3X A;  1CNQ A;  3S2V A;  4G68 A;  1FJ6 A;  1LBX A;  1ZU0 A;  2NWJ A;  4H65 A;  4XKR A;  4NF5 B;  4KR5 A;  1QGX A;  3H03 A;  1NNK A;  4GRK A;  2Y7P A;  1MDP 1;  4QXD A;  3U8Q A;  1LLS A;  4GXS B;  3G3H A;  1IXH A;  2KQZ A;  3FBP A;  1DTZ A;  3K6V A;  3TKD A;  1B3E A;  1LBW A;  1MY2 A;  1ANF A;  1N7X A;  2F35 A;  4H0W A;  2FHY A;  1A54 A;  2R6G E;  2RC7 A;  1IMD A;  4N8Y A;  1FTA A;  4MHF A;  1HSE A;  4R73 A;  1MXU A;  4P1E A;  3K00 A;  1BKA A;  2JJK A;  3SZP A;  4IGR A;  4FED A;  2F7B A;  4JB7 A;  5H8Q B;  1PBQ A;  4ZEB A;  3VLW A;  4AB6 A;  3PUW E;  1IMF A;  4PAK A;  1LAH E;  5I56 A;  3DP8 A;  1FQB A;  2XXY A;  3V83 A;  4LAT A;  3N5L A;  1QKB A;  1YXI A;  2AL5 A;  4GX4 A;  5IM2 A;  4PBH A;  5B7D A;  2THI A;  1GTK A;  1P1W A;  1B2H A;  4DI3 D;  4XF5 A;  1MM6 A;  2ZYO A;  5I59 A;  3B6W A;  3IK6 B;  5F7V A;  3S9M C;  5ET5 A;  4LZ8 A;  3B50 A;  3MZ9 A;  4KCD A;  2O7U A;  1ZJL A;  3FVO A;  4N8G A;  2VHA A;  1TFD A;  1OQG A;  3IFC A;  4YB7 A;  5FTH A;  2F8D A;  3BBR A;  4MNI A;  1I6Q A;  4JSO A;  1K9Z A;  3OOA A;  2QVR A;  4EXK A;  5DEX B;  1OVT A;  1URG A;  3MW0 A;  3O6H A;  3B8B A;  2I0B A;  2H9B A;  2PT2 A;  1D9V A;  3ISP A;  1ZMG A;  2O1L A;  3CSB A;  1D9Q A;  1VFE A;  3G3I A;  5TP9 B;  1S7Y A;  1USY H;  3OMB A;  1QUL A;  1Y3P A;  3PPN A;  1GGG A;  3IOT A;  1LAX A;  5K2Y A;  1NFT A;  3OO7 A;  5EQA A;  1NH8 A;  3T0J A;  4X1B A;  3K6W A;  3PMV A;  1FPG A;  2BJI A;  4QFO A;  4P11 A;  3CI8 A;  1XVY A;  1IXG A;  4QSD A;  3RQT A;  1SI1 A;  1JVY A;  1EZ9 A;  1LAG E;  3JYR A;  4LP2 B;  2REJ A;  1WDN A;  4N6P A;  4P47 A;  5FHM A;  3S4U A;  4YB6 A;  1JP4 A;  4F29 A;  1MY4 A;  1WOD A;  1NUY A;  1PB7 A;  3CR9 A;  1B9J A;  1KA1 A;  4GOT A;  5DVI A;  2OK2 A;  5I7I A;  3OO8 A;  4G8H A;  1DSN A;  4P56 A;  4PFT A;  5KCJ B;  3FJG A;  1S50 A;  2F3D A;  1DBZ A;  1Y3Q A;  2AL4 A;  4QSC A;  3MWB A;  3C4M A;  3PTY A;  2QS4 A;  3B6T A;  1IIW A;  3ZKL A;  2RC9 A;  3RT6 B;  3E4R A;  2ZNS A;  1QUI A;  1Q9D A;  4EXL A;  3SEU A;  2DOJ A;  5FBP A;  2RCA A;  5I57 B;  1FPI A;  4QHQ A;  4R9F A;  2VP1 A;  2WBB A;  1B4Z A;  1NNP A;  3VXC A;  3IJX B;  5DTB A;  1USY E;  5I58 B;  4F3G A;  4HW8 A;  3QIM A;  2CZH A;  4OFL A;  1Y3N A;  5IAI A;  3FXR A;  3KN3 A;  4NWC A;  1ELJ A;  2MKZ A;  4YB5 A;  1NV1 A;  3ONM A;  5FTI A;  1SW1 A;  3GYY A;  4JVI A;  4EF2 A;  4H5G A;  1H45 A;  2B4L A;  3T22 A;  3C32 A;  4NED A;  5JK4 A;  1TWY A;  1SI0 A;  5ELV A;  4AQ4 A;  1DTG A;  2NXO A;  3T9V A;  2HFB A;  4C0R A;  4F3B A;  3FIR A;  3Q27 A;  3TTR A;  4Q8R A;  1MXY A;  3T96 B;  2XWO A;  4LQ5 A;  5AA2 B;  1N3W A;  2CZL A;  2WX9 A;  3R7X A;  5H8N A;  4HS7 A;  2VOZ A;  1B05 A;  3G3G A;  1P1O A;  5KDT B;  1YYZ A;  3MVZ A;  5I2N A;  4BDR A;  1A55 A;  2XD2 A;  3SDF A;  4BDN A;  1MPD A;  5L9M A;  1Z7N E;  5IZ1 A;  3LUZ A;  1O64 A;  4NF6 A;  5DVF A;  4M1V A;  1FPF A;  4XTC Q;  2YPN A;  5IZZ A;  2Z23 A;  4EQ9 A;  2DVZ A;  3BIH A;  4N15 A;  1RDX A;  4UA8 A;  1B7Z A;  4PF8 A;  1SD3 A;  4OES A;  2G29 A;  2HXR A;  4JWY A;  1EYJ A;  3T9U A;  2A5S A;  3ILU B;  3M3L A;  1FSA A;  4NQ8 A;  2XXP A;  5AA4 B;  1Y1Z A;  4KFQ A;  2I3W A;  1R9Q A;  5AA2 D;  1FBE A;  5DT6 A;  5HBC A;  2Y7W A;  5L9O A;  4LZ7 A;  5EYG A;  3VVE A;  3KBR A;  4H5F A;  1NH7 A;  2AIX A;  2DWI A;  3D4C A;  4NX1 A;  1YAE A;  5IZ3 A;  4H6D A;  2XXU A;  2ALU A;  3B6Q A;  4RJZ A;  5JTY B;  3TZA A;  3C9H A;  3C34 A;  2CEX A;  4KYE A;  4XKQ A;  3NOH A;  5A5X B;  4JWO A;  2QVV A;  3TUS A;  4ELQ A;  3OSR A;  4OFO A;  3WAE A;  3HPI A;  2X7P A;  5ISU A;  1H44 A;  1FQC A;  2P0S A;  3JV9 A;  2KLF A;  4M4G A;  4P3L A;  1H3D A;  1URD A;  1FPE A;  2M8C A;  3SEY A;  3TCG A;  4RYA A;  2HXW A;  3K6X A;  2UYE A;  4U4X A;  2H98 A;  4ESW A;  4C1U A;  1NV3 A;  2XXK A;  4NF8 B;  4DLD A;  4QF9 A;  4GIZ A;  4N81 A;  3QMF A;  3S9L C;  1Q1K A;  2XXH A;  4BDQ A;  4I8C A;  3E13 X;  4EUO A;  1NV4 A;  4ELP A;  3PUV E;  5JEI A;  3MP6 A;  2OWT A;  4YKJ A;  4ELO A;  3QXM A;  2Y5L A;  1MXZ A;  3S9E A;  5EQ7 A;  1JET A;  1ATG A;  3FD3 A;  2PT1 A;  3M8U A;  4JXI A;  4E0W A;  1NUW A;  3V5A A;  1P1U A;  4R9G A;  4FE8 A;  4TLM B;  1B3G A;  3CFZ A;  4R6Y A;  1FTJ A;  2O7I A;  2KR0 A;  3FXB A;  2QMW A;  1P99 A;  3PUX E;  3A3U A;  1F9B A;  2HAV A;  3FAS A;  2CMO A;  2RIN A;  1LFH A;  4P9K A;  2DQV A;  2FIE A;  4R6H A;  1EYI A;  3HCQ A;  4O7I A;  1KWH A;  4NF0 A;  4N17 A;  4GL0 A;  5ICT A;  1B4H A;  3C31 A;  2DP8 A;  4IR8 A;  4OHN A;  3QK6 A;  3PMW A;  4LA9 A;  4MMP A;  3QYT A;  1M5D A;  1IMA A;  1K9Y A;  1XS5 A;  4GBV A;  4GD5 A;  1RDY A;  4NF4 A;  3PPO A;  4IB2 A;  2QPQ A;  4NN3 A;  1AIV A;  1DOT A;  2Z8F A;  4R72 A;  1JQF A;  1ZIU A;  4XIG Q;  3DM0 A;  3UGW A;  2PVU A;  3HFU A;  3A29 A;  1SVX B;  2GRV A;  1MQH A;  1BIY A;  3OSQ A;  5CBR A;  4DDD A;  4H67 A;  2DDK A;  3O66 A;  2A5T B;  4O94 A;  2PFZ A;  3FJ7 A;  3T9X B;  1UTH B;  4YU0 A;  1LFI A;  3FXU A;  1CB6 A;  3OD7 A;  3Q25 A;  3KJT A;  2O1M A;  1H76 A;  3L6G A;  5T3J A;  1P1Q A;  3O6I A;  1XVX A;  4H1X A;  1QJM A;  3LSX A;  4BDM A;  3CVG A;  4JVC A;  2GQ1 A;  3FVG A;  1R6Z A;  1R1N A;  4OER A;  4OA4 A;  2R71 A;  5CMB A;  3TTK A;  4Q0C A;  2XWV A;  1BK4 A;  2IEE A;  4OVJ A;  1FPJ A;  1MY1 A;  5LDZ A;  3UK4 A;  3BIG A;  2FVZ A;  2XXI A;  1MQD A;  2DWH A;  1MXV A;  2XXV A;  3IL1 B;  4JSD A;  3LR1 A;  2Q9T A;  1PB9 A;  3RPL A;  1A40 A;  4XXU A;  3TCF A;  3UN6 A;  5M2V A;  1M5C A;  4HXV A;  1QUK A;  2ZZX A;  5ET7 A;  1MXW A;  4ZS9 A;  2DVC A;  3E79 A;  4PGP A;  1GR2 A;  3CRB A;  3CFL A;  2OWS A;  4NHB A;  3MUQ A;  2FA7 A;  3RGY A;  4HE1 A;  2ONK E;  3K1M A;  4WED A;  3R6U A;  4RPO A;  3K1N A;  4FAT A;  5FHN A;  5BWJ A;  2DE3 A;  4MNP A;  2E0S A;  3ECR A;  4P8B A;  1US5 A;  4ZZE A;  4PE5 B;  2CZK A;  1UTB B;  4KYS A;  4TOZ A;  3VLV A;  1B51 A;  3MVY A;  1AH5 A;  3B7D A;  2DXR A;  1FPD A;  1EZO A;  5K2X A;  1INP A;  4OQO A;  5ET8 A;  2DWA A;  4HCY A;  3VV5 A;  4YKK A;  1N0T A;  4KXP A;  3H4Z A;  4G4P A;  4I40 A;  3MYU A;  1EH3 A;  4FEB A;  5H8H B;  5A5L A;  2Q88 A;  2O6A A;  2Q2A A;  1G0H A;  1TFA A;  2ONR A;  3LV0 A;  1LFG A;  3W9V A;  5I3S A;  4PCD A;  2HZL A;  1NKX A;  3TQL A;  3KC1 A;  3OO6 A;  3GZG A;  3KC0 A;  1M5B A;  1LBY A;  1A8F A;  4F3S A;  1S9T A;  1OQH A;  1B0L A;  4NF5 A;  3Q26 A;  5H8N B;  4JDF A;  3H7M A;  3CIJ A;  3IOU A;  3UP9 A;  3LSW A;  4MBP A;  2Q2C A;  3ODB A;  5I2N B;  3M3K A;  3T1B A;  2ZXT A;  3PU5 A;  4TQU Q;  1B5H A;  4U23 A;  2XWK A;  3CG3 A;  1AL3 A;  1IXC A;  4O7M A;  4NF6 B;  4UAC A;  2B65 A;  2BJJ X;  5H8F A;  3N94 A;  4R2B A;  3ZKK A;  3FV2 A;  4OVP A;  4PFW A;  4EQB A;  2UVG A;  3H6T A;  4ZEC A;  5I5P A;  3TOD A;  5H8Q A;  4PBQ A;  4H45 A;  3I5O A;  3THI A;  4F1Y A;  3PMX A;  1IMC A;  1MPC A;  2UXA A;  1O7T A;  1M5F A;  2WEF A;  3ROJ A;  3E3K A;  4LQ2 A;  3RUM A;  4G77 A;  2HQ0 A;  3PD8 A;  1Y4C A;  4ESX A;  1ZKB A;  4LZ5 A;  4EF1 A;  4NTL A;  2P2A A;  3H6V A;  3KSX A;  1TT1 A;  4QBA A;  4G8N A;  1J1N A;  2WBD A;  3O28 A;  4FJP A;  1FPK A;  2Y84 A;  3V8X B;  3TTN A;  3TQW A;  4PE3 A;  4O8M A;  2Y5K A;  1FPL A;  1Y9U A;  1QUJ A;  3KOS A;  4KHZ E;  1AOV A;  2ANJ A;  4IO6 A;  4BDO A;  1PBP A;  1G0I A;  1CE2 A;  4GVO A;  4WXJ A;  3MC2 A;  5DEX A;  1R9L A;  1QVS A;  2NUV A;  3VVD A;  1LGB C;  4IO3 A;  2ZMB A;  3O6G A;  3MP8 A;  4KCC A;  4OTE A;  3EPE A;  4HCW A;  3GBA A;  3EHT A;  2AYS A;  5TP9 A;  4PC9 A;  3FAT A;  3CSG A;  4E0X A;  3QAX A;  3RY3 A;  3HHF A;  1P1N A;  3CG1 A;  1JW1 A;  2V84 A;  3TFL A;  2F7A A;  1SBP A;  1B3L A;  2OLB A;  1LCT A;  4H46 A;  3QUF A;  1MQJ A;  2O68 A;  3PD9 A;  4OZ9 A;  5KZT A;  1MG1 A;  1NUX A;  1DPE A;  2FYI A;  4HE0 A;  1B5I A;  2P1S A;  3MBP A;  3BKI B;  3OO9 A;  1XOC A;  3LUY A;  1II5 A;  4NG7 A;  1SPI A;  3P7I A;  4AS4 A;  1DPP A;  3G3J A;  2XD3 A;  3K01 A;  3C36 A;  3EKI A;  1FW0 A;  3K0V A;  2V3U A;  2D3I A;  1PDA A;  1Q35 A;  5KCJ A;  5L8D A;  1NNF A;  3OEL A;  4X8R A;  2O51 A;  5EYH A;  4GXA A;  1H43 A;  3RYD A;  4I3Y A;  3GXA A;  1B1H A;  3PUY E;  3E9X A;  1I6A A;  1BLF A;  4IO4 A;  2ONS A;  3USD A;  3FUZ A;  3FVN A;  4U2R A;  1FTO A;  3VE1 B;  3H3G A;  4GLI A;  4OMB A;  2F6G A;  1FBG A;  1FBF A;  2H99 A;  3EHS A;  4XKN A;  4RK2 A;  4U4S A;  1LBB A;  5I58 A;  3N6U A;  1XT8 A;  2D21 A;  2W7Y A;  3VDF A;  3HV1 A;  1LAF E;  3RNN A;  4KPT A;  3KBZ A;  4MAG A;  4QFP A;  5IGA A;  5TPA A;  4F1U A;  2Y7I A;  3OEM A;  3VFJ A;  4GF8 A;  2X26 A;  1FQA A;  3SER A;  4ZED A;  2R8T A;  4MF3 A;  1Y20 A;  2QS1 A;  3SEX A;  2GHA A;  4DXU A;  4OVT A;  2VGQ A;  1WVJ A;  2XWI A;  1MM7 A;  4I1D A;  1XC1 A;  2ZZW A;  1JEU A;  4POX A;  1SW2 A;  2PBW A;  2H5Y A;  5AA2 A;  1FTK A;  5F24 A;  4MFI A;  5I84 A;  3KSJ A;  5KDT A;  4OET A;  4YAH X;  3C33 A;  4PGN A;  2I4C A;  2QVU A;  1IMB A;  4TLL B;  5ITP A;  1LB9 A;  4DCX A;  1PEB A;  3IOW A;  1LBV A;  2GH9 A;  3MJN A;  2YJP A;  1HSL A;  2Z22 A;  4OEN A;  5TU0 A;  4GL8 A;  1LST A;  4FIM A;  2QRY A;  4G68 B;  4LUB A;  5AA3 A;  5HM4 B;  4ELR A;  1FRP A;  4IY6 A;  1FQF A;  2I49 A;  4PFR A;  1LCF A;  5B70 A;  3LC8 A;  5CMK A;  3U65 A;  1NV5 A;  5I2K A;  2VPO A;  2XX8 A;  3O9P A;  1VDW A;  4MJO A;  3RPL B;  5DYH A;  4QFK A;  4ZE9 A;  4PF6 A;  1FTL A;  2HHM A;  5L9S A;  3DP4 A;  4OFJ A;  1OVB A;  3SKP A;  2UVJ A;  2HZK A;  2Y7R A;  1Y4T A;  2IA4 A;  2XHD A;  3EN3 A;  3FXQ A;  2HCA A;  3MPL A;  1MH4 A;  4JBZ A;  2UVH A;  1BTJ A;  4IO2 A;  1NV6 A;  3PGF A;  1FBD A;  3LSL A;  1N7W A;  3PUZ E;  1B3H A;  4IO7 A;  5EQ8 A;  5EHM A;  1FPB A;  4U22 A;  1B58 A;  5I56 B;  4PQJ A;  3DEL B;  2O69 A;  1BP5 A;  3L6H A;  3FGS A;  3BFU A;  1IZ1 A;  2H25 A;  3AXF A;  1B6H A;  4UAB A;  3KN8 A;  4O3C A;  2ZYN A;  2I3V A;  3OEN A;  4KI0 E;  4R74 A;  4NGU A;  4QFL A;  3MVX A;  4F18 A;  2Q8M A;  3GBB A;  3MST A;  5ITO A;  5CM6 A;  1A7L A;  1QKA A;  1RDZ A;  5I59 B;  1SYI A;  4FBP A;  5ET6 A;  3W15 C;  1O63 A;  4ZEI A;  2HPG A;  2F34 A;  1NMU A;  2V3T A;  1Y1M A;  3KEI A;  1PC3 A;  4QFN A;  1MQI A;  4NF8 A;  4THI A;  3FJM A;  4F1V A;  4F2Q A;  2R9J A;  2P3N A;  3RN8 A;  3IX1 A;  4I3E A;  2GHB A;  4LN5 A;  3TCH A;  4N91 A;  3SEW A;  2FIX A;  1B7H A;  1ZLQ A;  1EYK A;  1AMF A;  4GWW A;  2NVU B;  2F78 A;  2PX1 A;  2OWZ A;  1B46 A;  3PV0 E;  2B3F A;  2LAO A;  1JEV A;  4KD5 A;  2VD2 A;  4PFI A;  4DXB A;  3H06 B;  3PPQ A;  3HN0 A;  4N4U A;  4F22 A;  1FBP A;  3O29 A;  4GWU A;  1MH3 A;  4YIC A;  1IQ7 A;  1JNF A;  3A09 A;  2ESN A;  3LSF B;  4X04 A;  4PDD A;  2OX3 A;  2OBG A;  3TTM A;  4X48 A;  4IY5 A;  4PP0 A;  4BDL A;  3TEL A;  5BUU A;  3CFX A;  5CC2 A;  3RTF B;  5H8F B;  4GWY A;  1VE4 A;  2I58 A;  3K4U A;  4N13 A;  1UQW A;  1LBZ A;  4ZE8 A;  2OJT A;  4GWX A; 
#chains in the Genus database with same CATH homology
 1SDX A;  2VD3 A;  3JZJ A;  4POW A;  4MLV A;  4OEU A;  4YMB A;  2V93 A;  3GLB A;  4Z0I A;  3ZS6 A;  3HHG A;  2XXQ A;  4PFY A;  1B5J A;  3KFM A;  1SYH A;  3K02 A;  4U21 A;  2I6E A;  2D5W A;  3MZ1 A;  1US4 A;  4EQ7 A;  2A5T A;  3TDJ A;  2OCU A;  3FV1 A;  3QSL A;  1MQG A;  2RCB A;  2QMX A;  1UTH A;  3Q28 A;  1YPN A;  3G3F A;  4U1O A;  1QW0 A;  2XX9 A;  3EF7 A;  3IO4 A;  1OLC A;  3U94 A;  4C1T A;  2FNC A;  4N07 A;  1MY0 A;  3F11 A;  2WKY A;  5CMM A;  1IXI A;  3K6U A;  3KG2 A;  1SW5 A;  4P0I A;  3U92 A;  4R6K A;  4DIG A;  3O2A A;  4K3F A;  3IB1 A;  1D9Y A;  2OZZ A;  4EDP A;  3SES A;  1OIB A;  4YKP A;  2ZYM A;  5EHS A;  4Q30 B;  1B52 A;  4DZ1 A;  2F5X A;  2XX7 A;  3SET A;  3KGC A;  2DWJ A;  3PPP A;  1JW5 A;  4ZZA A;  2Q8J A;  1D3K A;  1FQE A;  4FOR A;  4ONY A;  2XXR A;  4PET A;  3U93 A;  1VR5 A;  4MLQ A;  2ZNT A;  3S9N C;  4ZEK A;  1I69 A;  2DYX A;  2GFE A;  3UIF A;  2XXT A;  2H4I A;  5CRY A;  3V89 B;  5LOM A;  2F7C A;  1HSJ A;  3EQ1 A;  4PFU A;  1IUD A;  1JW4 A;  1B40 A;  1LB8 A;  2NOO A;  1MXX A;  3UOR A;  1UTB A;  3BFT A;  4X1D A;  4YMA A;  3RTW B;  4RNS A;  3MP1 A;  1Z7M E;  3MZB A;  3TEP A;  3RLF E;  2E1S A;  1XHY A;  3RT8 A;  4F39 A;  3FVK A;  1M5E A;  2DXY A;  3U1O A;  4BLA A;  3W9W A;  5AE4 A;  5H8H A;  3ZSF A;  5TPA B;  2PMS A;  3TTL A;  4NWD A;  2F97 A;  3KZG A;  5CBS A;  1B32 A;  2UYF A;  3T66 A;  3D4G A;  4JWX A;  4XKP A;  3KN7 A;  1VSO A;  5J1D A;  4ND9 A;  1N04 A;  2O84 X;  3LBS A;  5ICQ A;  4P0G A;  1OMP A;  4R2F A;  3IJO B;  3DLN A;  1I6B A;  1YTV A;  2I48 A;  1NL5 A;  3K1P A;  1GVC A;  3IO6 A;  4WKM A;  2F36 A;  1N84 A;  2RC8 A;  5F1Q A;  2ZNU A;  2I4B A;  1IEJ A;  3IAZ A;  3IB2 A;  4OYV A;  4QSE A;  1B1X A;  4RY1 A;  2XXX A;  3DP6 A;  4ECF A;  2REG A;  4O3A A;  2YLN A;  3VVF A;  1LBC A;  4F2O A;  3MPK A;  3N26 A;  1UIV A;  1L5T A;  3K2D A;  4RXL A;  3KOT A;  4RK9 A;  5I57 A;  3IOR A;  1IIT A;  3OXN A;  5I2K B;  3O97 A;  1FTM A;  4F3P A;  2DSF A;  4YKI A;  1A99 A;  3HO7 A;  1TXF A;  3QUJ A;  1MY3 A;  5EYF A;  2QS2 A;  2Z8D A;  1A8E A;  2DE2 A;  5DVJ A;  2Y7K A;  2QSX A;  4NF4 B;  1B3F A;  4G8M A;  1OLA A;  2Z8E A;  2QL3 A;  2F6P A;  1MRP A;  4RA1 A;  2HEU A;  3R26 A;  1RYO A;  3EHU A;  3T93 B;  3T9H B;  2G93 A;  4RPN A;  1EZP A;  1YCJ A;  4NMY A;  3TPA A;  3I3V A;  3ILT B;  4LON B;  5AA1 A;  1RKM A;  4FEC A;  2Q89 A;  1N76 A;  4IGT A;  4ZEF A;  4GQO A;  2RF1 A;  2B3B A;  2DE4 A;  4DCY A;  4OWD A;  4WEP A;  3PPR A;  1ZBM A;  3TYH A;  1MPB A;  1ZTY A;  3IR1 A;  5CI5 A;  4KYD A;  3VXB A;  4F31 B;  3HST A;  4OEV A;  3TAJ A;  1POY 1;  1MS7 A;  4FAJ A;  4YZZ A;  1PB8 A;  4O3B A;  3A3C A;  1SW4 A;  2X7Q A;  4OXV A;  1B0H A;  5CMC A;  3G3K A;  3IOV A;  3Q29 A;  2ABH A;  3TMG A;  1D4N A;  3H6U A;  4AB5 A;  3MQ9 A;  3VLU A;  1T0K A;  5AA4 A;  4KQP A;  5H8S A;  2I0C A;  4ZDM A;  3I6V A;  4DXC A;  2QS3 A;  2HAU A;  4F19 A;  3RPW A;  4LVQ A;  1DMB A;  1B7U A;  4DE8 A;  4MH5 A;  5JTY A;  3IB0 A;  2RKM A;  2V25 A;  3M3F A;  1FQD A;  5HPQ A;  1POT A;  5A5X A;  3SEV A;  4ISU A;  2V3Q A;  4I62 A;  5FHO A;  1URS A;  2PYY A;  3U72 A;  3UA8 A;  3C35 A;  4HTG A;  4Z7E A;  1FCK A;  4X9T A;  3N6T A;  4L17 A;  4Q5T A;  4G2Z A;  2DS9 A;  3KJ7 A;  5IKB A;  1VFD A;  2ZYK A;  4GFR A;  4GWO A;  3MAM A;  3FZV A;  1UIU A;  4R75 A;  1RYX A;  4QRZ A;  4G68 C;  2XXW A;  1EU8 A;  3H6W A;  4U1Z A;  4I9D A;  1SQY A;  4IO5 A;  4H8J A;  4H8I A;  3WAF A;  1GV8 A;  1MDQ A;  3MVW A;  3OEK A;  1JVX A;  3G7W A;  4NE4 A;  2UVI A;  1NNT A;  2QJE A;  1N3X A;  3S2V A;  4G68 A;  1ZU0 A;  2NWJ A;  4H65 A;  4XKR A;  4NF5 B;  4KR5 A;  3H03 A;  1NNK A;  4GRK A;  2Y7P A;  1MDP 1;  3U8Q A;  1LLS A;  4GXS B;  3G3H A;  1IXH A;  1DTZ A;  3K6V A;  3TKD A;  1B3E A;  1MY2 A;  1ANF A;  1N7X A;  2F35 A;  4H0W A;  1A54 A;  2R6G E;  2RC7 A;  1HSE A;  4R73 A;  1MXU A;  3K00 A;  1BKA A;  4IGR A;  4FED A;  2F7B A;  4JB7 A;  5H8Q B;  1PBQ A;  4ZEB A;  3VLW A;  4AB6 A;  3PUW E;  1LAH E;  5I56 A;  3DP8 A;  1FQB A;  2XXY A;  3V83 A;  4LAT A;  3N5L A;  1QKB A;  2AL5 A;  5B7D A;  2THI A;  1GTK A;  1P1W A;  1B2H A;  1MM6 A;  2ZYO A;  5I59 A;  3B6W A;  3IK6 B;  5F7V A;  3S9M C;  4LZ8 A;  3MZ9 A;  4KCD A;  2O7U A;  1ZJL A;  3FVO A;  2VHA A;  1TFD A;  1OQG A;  4YB7 A;  5FTH A;  2F8D A;  3BBR A;  1I6Q A;  4JSO A;  3OOA A;  4EXK A;  5DEX B;  1OVT A;  1URG A;  3MW0 A;  3O6H A;  2I0B A;  2H9B A;  2PT2 A;  1D9V A;  1ZMG A;  2O1L A;  3CSB A;  1VFE A;  3G3I A;  5TP9 B;  1S7Y A;  1USY H;  3OMB A;  1QUL A;  1Y3P A;  3PPN A;  1GGG A;  3IOT A;  1LAX A;  5K2Y A;  1NFT A;  3OO7 A;  1NH8 A;  4X1B A;  3K6W A;  3PMV A;  4QFO A;  4P11 A;  3CI8 A;  1XVY A;  1IXG A;  4QSD A;  3RQT A;  1SI1 A;  1JVY A;  1EZ9 A;  1LAG E;  3JYR A;  4LP2 B;  2REJ A;  1WDN A;  4N6P A;  5FHM A;  3S4U A;  4YB6 A;  4F29 A;  1MY4 A;  1WOD A;  1PB7 A;  3CR9 A;  1B9J A;  4GOT A;  5DVI A;  2OK2 A;  3OO8 A;  4G8H A;  1DSN A;  4PFT A;  5KCJ B;  3FJG A;  1S50 A;  1Y3Q A;  2AL4 A;  4QSC A;  3MWB A;  3C4M A;  2QS4 A;  3B6T A;  1IIW A;  3ZKL A;  2RC9 A;  3RT6 B;  3E4R A;  2ZNS A;  1QUI A;  4EXL A;  3SEU A;  2DOJ A;  2RCA A;  5I57 B;  4QHQ A;  4R9F A;  2VP1 A;  1B4Z A;  1NNP A;  3VXC A;  3IJX B;  5DTB A;  1USY E;  5I58 B;  4F3G A;  4HW8 A;  3QIM A;  4OFL A;  1Y3N A;  5IAI A;  3FXR A;  3KN3 A;  4NWC A;  1ELJ A;  4YB5 A;  3ONM A;  5FTI A;  1SW1 A;  4EF2 A;  4H5G A;  1H45 A;  3T22 A;  3C32 A;  4NED A;  5JK4 A;  1TWY A;  1SI0 A;  5ELV A;  4AQ4 A;  1DTG A;  2NXO A;  3T9V A;  2HFB A;  4C0R A;  4F3B A;  3FIR A;  3Q27 A;  3TTR A;  4Q8R A;  1MXY A;  3T96 B;  4LQ5 A;  5AA2 B;  1N3W A;  2CZL A;  3R7X A;  5H8N A;  4HS7 A;  2VOZ A;  1B05 A;  3G3G A;  1P1O A;  5KDT B;  3MVZ A;  5I2N A;  4BDR A;  1A55 A;  2XD2 A;  3SDF A;  4BDN A;  1MPD A;  5L9M A;  1Z7N E;  1O64 A;  4NF6 A;  5DVF A;  4M1V A;  4XTC Q;  2YPN A;  2Z23 A;  4EQ9 A;  2DVZ A;  4UA8 A;  1B7Z A;  1SD3 A;  4OES A;  2G29 A;  4JWY A;  3T9U A;  2A5S A;  3ILU B;  3M3L A;  2XXP A;  5AA4 B;  1Y1Z A;  4KFQ A;  2I3W A;  1R9Q A;  5AA2 D;  5DT6 A;  5HBC A;  2Y7W A;  5L9O A;  4LZ7 A;  3VVE A;  3KBR A;  4H5F A;  1NH7 A;  2AIX A;  2DWI A;  3D4C A;  1YAE A;  4H6D A;  2XXU A;  2ALU A;  3B6Q A;  4RJZ A;  5JTY B;  3TZA A;  3C9H A;  3C34 A;  4KYE A;  4XKQ A;  5A5X B;  4JWO A;  3TUS A;  4ELQ A;  3OSR A;  4OFO A;  3WAE A;  3HPI A;  2X7P A;  5ISU A;  1H44 A;  1FQC A;  2P0S A;  3JV9 A;  2KLF A;  4M4G A;  1H3D A;  1URD A;  2M8C A;  3SEY A;  3TCG A;  4RYA A;  2HXW A;  3K6X A;  2UYE A;  4U4X A;  2H98 A;  4ESW A;  4C1U A;  4NF8 B;  4DLD A;  4QF9 A;  4GIZ A;  3S9L C;  1Q1K A;  2XXH A;  4BDQ A;  4I8C A;  3E13 X;  4EUO A;  4ELP A;  3PUV E;  5JEI A;  3MP6 A;  2OWT A;  4YKJ A;  4ELO A;  3QXM A;  1MXZ A;  3S9E A;  1JET A;  1ATG A;  3FD3 A;  2PT1 A;  3M8U A;  4JXI A;  4E0W A;  3V5A A;  1P1U A;  4R9G A;  4FE8 A;  4TLM B;  1B3G A;  3CFZ A;  4R6Y A;  1FTJ A;  2O7I A;  2QMW A;  1P99 A;  3PUX E;  3A3U A;  1F9B A;  2HAV A;  3FAS A;  2CMO A;  2RIN A;  1LFH A;  2DQV A;  4R6H A;  3HCQ A;  1KWH A;  4GL0 A;  5ICT A;  1B4H A;  3C31 A;  2DP8 A;  4OHN A;  3QK6 A;  3PMW A;  4LA9 A;  3QYT A;  1M5D A;  1XS5 A;  4GD5 A;  4NF4 A;  3PPO A;  4IB2 A;  2QPQ A;  1AIV A;  1DOT A;  2Z8F A;  4R72 A;  1JQF A;  1ZIU A;  4XIG Q;  3DM0 A;  3UGW A;  2PVU A;  1SVX B;  2GRV A;  1MQH A;  1BIY A;  3OSQ A;  5CBR A;  4DDD A;  4H67 A;  3O66 A;  2A5T B;  3FJ7 A;  3T9X B;  1UTH B;  4YU0 A;  1LFI A;  3FXU A;  1CB6 A;  3OD7 A;  3Q25 A;  3KJT A;  2O1M A;  1H76 A;  3L6G A;  1P1Q A;  3O6I A;  1XVX A;  4H1X A;  1QJM A;  3LSX A;  4BDM A;  3CVG A;  3FVG A;  1R6Z A;  1R1N A;  4OER A;  3TTK A;  2R71 A;  5CMB A;  4Q0C A;  2IEE A;  4OVJ A;  1MY1 A;  3UK4 A;  2XXI A;  1MQD A;  2DWH A;  1MXV A;  2XXV A;  3IL1 B;  4JSD A;  3LR1 A;  2Q9T A;  1PB9 A;  1A40 A;  4XXU A;  3TCF A;  3UN6 A;  5M2V A;  1M5C A;  1QUK A;  1MXW A;  4ZS9 A;  2DVC A;  1GR2 A;  3CRB A;  3CFL A;  2OWS A;  3MUQ A;  2FA7 A;  3RGY A;  2ONK E;  3K1M A;  4WED A;  3R6U A;  4RPO A;  3K1N A;  4FAT A;  5FHN A;  5BWJ A;  2DE3 A;  2E0S A;  3ECR A;  1US5 A;  4ZZE A;  4PE5 B;  1UTB B;  4KYS A;  4TOZ A;  3VLV A;  1B51 A;  3MVY A;  1AH5 A;  3B7D A;  2DXR A;  1EZO A;  5K2X A;  4OQO A;  2DWA A;  4HCY A;  3VV5 A;  4YKK A;  1N0T A;  3H4Z A;  4G4P A;  1EH3 A;  4FEB A;  5H8H B;  2Q88 A;  2O6A A;  2Q2A A;  1TFA A;  2ONR A;  1LFG A;  3W9V A;  2HZL A;  1NKX A;  3TQL A;  3OO6 A;  3GZG A;  1M5B A;  4F3S A;  1A8F A;  1S9T A;  1OQH A;  1B0L A;  4NF5 A;  3Q26 A;  5H8N B;  4JDF A;  3H7M A;  3CIJ A;  3IOU A;  3UP9 A;  3LSW A;  4MBP A;  2Q2C A;  3ODB A;  5I2N B;  3M3K A;  2ZXT A;  3PU5 A;  4TQU Q;  1B5H A;  4U23 A;  3CG3 A;  1AL3 A;  1IXC A;  4NF6 B;  4UAC A;  2B65 A;  2BJJ X;  5H8F A;  3N94 A;  4R2B A;  3ZKK A;  3FV2 A;  4PFW A;  4EQB A;  2UVG A;  3H6T A;  4ZEC A;  3TOD A;  5H8Q A;  3I5O A;  3THI A;  4F1Y A;  3PMX A;  1MPC A;  2UXA A;  1O7T A;  1M5F A;  3E3K A;  4LQ2 A;  3RUM A;  4G77 A;  2HQ0 A;  3PD8 A;  1Y4C A;  4ESX A;  1ZKB A;  4LZ5 A;  4EF1 A;  4NTL A;  2P2A A;  3H6V A;  3KSX A;  1TT1 A;  4G8N A;  1J1N A;  3O28 A;  4FJP A;  2Y84 A;  3V8X B;  3TTN A;  3TQW A;  1Y9U A;  1QUJ A;  3KOS A;  4KHZ E;  1AOV A;  2ANJ A;  4IO6 A;  4BDO A;  1PBP A;  1CE2 A;  4GVO A;  4WXJ A;  3MC2 A;  5DEX A;  1R9L A;  1QVS A;  2NUV A;  3VVD A;  1LGB C;  4IO3 A;  2ZMB A;  3O6G A;  3MP8 A;  4KCC A;  4OTE A;  3EPE A;  4HCW A;  3GBA A;  3EHT A;  2AYS A;  5TP9 A;  3FAT A;  3CSG A;  4E0X A;  3QAX A;  3RY3 A;  3HHF A;  1P1N A;  3CG1 A;  1JW1 A;  2V84 A;  3TFL A;  2F7A A;  1SBP A;  1B3L A;  2OLB A;  1LCT A;  3QUF A;  1MQJ A;  2O68 A;  3PD9 A;  4OZ9 A;  5KZT A;  1MG1 A;  1DPE A;  2FYI A;  1B5I A;  2P1S A;  3MBP A;  3BKI B;  3OO9 A;  1XOC A;  3LUY A;  1II5 A;  3P7I A;  1DPP A;  3G3J A;  2XD3 A;  3K01 A;  3C36 A;  1FW0 A;  3K0V A;  2V3U A;  2D3I A;  1PDA A;  1Q35 A;  5KCJ A;  5L8D A;  1NNF A;  3OEL A;  2O51 A;  4GXA A;  1H43 A;  3GXA A;  1B1H A;  3PUY E;  3E9X A;  1I6A A;  1BLF A;  4IO4 A;  2ONS A;  3USD A;  3FUZ A;  3FVN A;  4U2R A;  1FTO A;  3VE1 B;  3H3G A;  4GLI A;  4OMB A;  2F6G A;  2H99 A;  3EHS A;  4XKN A;  4RK2 A;  4U4S A;  1LBB A;  5I58 A;  3N6U A;  1XT8 A;  2D21 A;  2W7Y A;  3VDF A;  3HV1 A;  1LAF E;  3RNN A;  4KPT A;  4QFP A;  5TPA A;  4F1U A;  2Y7I A;  3OEM A;  3VFJ A;  4GF8 A;  2X26 A;  1FQA A;  3SER A;  4ZED A;  4MF3 A;  1Y20 A;  2QS1 A;  3SEX A;  2GHA A;  4DXU A;  2VGQ A;  1WVJ A;  1MM7 A;  4I1D A;  1XC1 A;  1JEU A;  4POX A;  1SW2 A;  2PBW A;  2H5Y A;  5AA2 A;  1FTK A;  4MFI A;  5I84 A;  3KSJ A;  5KDT A;  4OET A;  4YAH X;  3C33 A;  2I4C A;  4TLL B;  5ITP A;  1LB9 A;  4DCX A;  1PEB A;  3IOW A;  2GH9 A;  3MJN A;  2YJP A;  1HSL A;  2Z22 A;  4OEN A;  5TU0 A;  4GL8 A;  1LST A;  4FIM A;  2QRY A;  4G68 B;  4LUB A;  5AA3 A;  5HM4 B;  4ELR A;  4IY6 A;  1FQF A;  2I49 A;  1LCF A;  5B70 A;  3LC8 A;  5CMK A;  5I2K A;  2XX8 A;  3O9P A;  5DYH A;  4QFK A;  4ZE9 A;  1FTL A;  5L9S A;  3DP4 A;  4OFJ A;  1OVB A;  3SKP A;  2UVJ A;  2HZK A;  2Y7R A;  1Y4T A;  2IA4 A;  2XHD A;  3EN3 A;  3FXQ A;  2HCA A;  3MPL A;  1MH4 A;  4JBZ A;  2UVH A;  1BTJ A;  4IO2 A;  3PGF A;  3LSL A;  1N7W A;  3PUZ E;  1B3H A;  4IO7 A;  5EHM A;  4U22 A;  1B58 A;  5I56 B;  4PQJ A;  3DEL B;  2O69 A;  1BP5 A;  3L6H A;  3FGS A;  3BFU A;  1IZ1 A;  2H25 A;  3AXF A;  1B6H A;  3KN8 A;  4O3C A;  2ZYN A;  2I3V A;  3OEN A;  4KI0 E;  4R74 A;  4QFL A;  3MVX A;  4F18 A;  3GBB A;  5ITO A;  5CM6 A;  1A7L A;  1QKA A;  5I59 B;  1SYI A;  3W15 C;  1O63 A;  4ZEI A;  2F34 A;  1NMU A;  2V3T A;  1Y1M A;  3KEI A;  1PC3 A;  4QFN A;  1MQI A;  4NF8 A;  4THI A;  3FJM A;  4F1V A;  4F2Q A;  2R9J A;  3RN8 A;  3IX1 A;  2GHB A;  3TCH A;  3SEW A;  1B7H A;  1ZLQ A;  1AMF A;  2NVU B;  2F78 A;  2PX1 A;  1B46 A;  3PV0 E;  2B3F A;  2LAO A;  1JEV A;  4KD5 A;  2VD2 A;  4DXB A;  3H06 B;  3PPQ A;  3HN0 A;  4F22 A;  3O29 A;  1MH3 A;  4YIC A;  1IQ7 A;  1JNF A;  3A09 A;  2ESN A;  3LSF B;  2OBG A;  3TTM A;  4X48 A;  4IY5 A;  4PP0 A;  4BDL A;  3TEL A;  5BUU A;  3CFX A;  5CC2 A;  3RTF B;  5H8F B;  1VE4 A;  2I58 A;  3K4U A;  4N13 A;  1UQW A;  4ZE8 A;  2OJT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...