3OD7A

Haemophilus influenzae ferric binding protein a -iron loaded
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
308
structure length
308
Chain Sequence
DITVYNGQHKEAATAVAKAFEQETGIKVTLNSGKSEQLAGQLKEEGDKTPADVFYTEQTATFADLSEAGLLAPISEQTIQQTAQKGVPLAPKKDWIALSGRSRVVVYDHTKLSEKDMEKSVLDYATPKWKGKIGYVSTSGAFLEQVVALSKMKGDKVALNWLKGLKENGKLYAKNSVALQAVENGEVPAALINNYYWYNLAKEKGVENLKSRLYFVRHQDPGALVSYSGAAVLKASKNQAEAQKFVDFLASKKGQEALVAARAEYPLRADVVSPFNLEPYEKLEAPVVSATTAQDKEHAIKLIEEAGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Iron-utilization periplasmic protein
publication title The role of vicinal tyrosine residues in the function of Haemophilus influenzae ferric binding protein A.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Metal binding protein
total genus 116
structure length 308
sequence length 308
ec nomenclature
pdb deposition date 2010-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3od7A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3od7A02
2ZNUA 1CE2A 2Y7WA 4KPTA 2DVZA 4Q8RA 4YKPA 1FQDA 3OXNA 1TWYA 3RTFB 4OEVA 2VD2A 4KI0E 1N76A 2O7UA 3K00A 5EYFA 3MP6A 3MC2A 4ZDMA 1QVSA 1IXGA 2ESNA 4FEDA 2HQ0A 1MXVA 1NKXA 4F1YA 1B3EA 1PC3A 3OO7A 1SDXA 2F78A 1B0LA 4Q0CA 3RGYA 1H3DA 3A3CA 3EHSA 3SEWA 1OMPA 5ITOA 1WDNA 4LZ5A 2F7CA 2ANJA 2XHDA 4ZEIA 4H6DA 5IKBA 3TMGA 4GFRA 1QULA 5AA4B 4PFWA 2DWHA 4C0RA 4ZEKA 3TEPA 5DTBA 3OO9A 4GXAA 1MQIA 4JDFA 4POWA 5H8FB 3CG3A 4GL0A 2F35A 4G4PA 3TZAA 1B5IA 1LAGE 1Z7ME 4I8CA 3K2DA 1O64A 3IR1A 4ZEFA 2A5SA 5I56A 3FD3A 3B7DA 4F3SA 2DYXA 1MH4A 3MZ9A 4F2OA 1OQGA 4G68B 3VVDA 4MLQA 5A5XB 1FTMA 1OQHA 3QYTA 4OVJA 3HN0A 4RNSA 3IK6B 1HSJA 2RC8A 3U92A 3MW0A 2XXHA 4NF4B 2YPNA 1OVTA 2F34A 4GLIA 5H8NB 2NOOA 1JNFA 2F36A 4DZ1A 2RCBA 4R75A 2Q89A 3JZJA 1B40A 1LAHE 2UXAA 1OIBA 2DXRA 1JW5A 2Y7KA 3EPEA 3USDA 2G93A 4N6PA 4AB5A 3MWBA 2ZYKA 4ZZEA 1P1OA 4GL8A 3GXAA 3PPRA 3KOTA 3TELA 4I1DA 5IAIA 2Y84A 3T96B 4OFOA 4GVOA 1SW1A 4NF4A 3N26A 2HEUA 1ZBMA 1B52A 4H8IA 4ZZAA 3OEKA 1R9LA 2Y7IA 3RTWB 3R7XA 4QF9A 2HCAA 4UACA 3I6VA 1FQCA 1B9JA 3PMVA 1A8FA 2V84A 1MY4A 1S9TA 1OLAA 1USYE 3PPQA 4R72A 5FHMA 3IJOB 1GTKA 3MZBA 4YAHX 2QS4A 3TCHA 3UA8A 3RQTA 3FUZA 1XC1A 4Z7EA 1N0TA 4DCYA 4PETA 2D3IA 4U22A 3PUVE 3SEYA 4FJPA 2ZYMA 3VDFA 5ISUA 4G8MA 1B4ZA 1MQHA 4LATA 4MFIA 4GRKA 4QFPA 5I59B 2FYIA 3G3GA 4QFOA 1A54A 1ZMGA 1UTHB 1FQEA 4RPOA 2E0SA 3CSGA 4IY6A 4H65A 1R1NA 4LUBA 1IITA 1AMFA 1HSLA 1PB8A 5CMKA 2B65A 4F18A 2DE3A 1SVXB 3H6TA 4KR5A 3SEVA 4YKKA 4FIMA 4YKJA 3OOAA 4OZ9A 2UVJA 1URDA 4OYVA 5CMMA 1R9QA 2B3FA 5ELVA 4ESWA 4K3FA 4C1UA 1YCJA 1QW0A 4EUOA 3MAMA 5JTYB 2RC7A 3PD8A 4Q30B 3IB2A 4M4GA 4R74A 1TT1A 2UVHA 2FA7A 3EF7A 3VVEA 1LAFE 2NVUB 1MY0A 4H67A 3QXMA 3K0VA 1MH3A 2RINA 1ZLQA 5CI5A 3KJ7A 5HPQA 2DSFA 1I69A 5TP9A 4KHZE 3B6QA 4BDMA 5BWJA 3S9EA 2O84X 3G3IA 2Z22A 5FHOA 1SI0A 2ZMBA 3LSXA 5J1DA 2OLBA 1Y3NA 3V8XB 2B3BA 2Q8JA 1FQFA 4X1DA 3H06B 4GF8A 2D5WA 3PMWA 4GOTA 1SW2A 3C31A 2BJJX 1XT8A 3EHTA 3T66A 2I0CA 1B7HA 2F6GA 4OHNA 3V83A 1B1XA 1M5DA 1DPEA 2YLNA 1JW4A 4DDDA 1XS5A 2Z8DA 1LAXA 5H8HA 2NWJA 4ZECA 2XXYA 2RCAA 4U1ZA 4IO4A 1B46A 4QSDA 1A7LA 3PUWE 1NNTA 4U2RA 4DXBA 3OO6A 3I5OA 2P2AA 2I49A 2R6GE 2XXRA 4NF5A 1B0HA 1B3HA 3G7WA 3IL1B 4IY5A 4NWDA 4OFJA 2Q9TA 4EQ9A 1POTA 4ECFA 1FCKA 3Q27A 1A8EA 3EN3A 3IO4A 3UK4A 2XXQA 1N7XA 4XKPA 4RJZA 3B6TA 2DP8A 3ILTB 3MZ1A 4QSCA 1NNFA 1M5FA 3FXRA 4R2BA 1P1NA 4OETA 2O7IA 1LLSA 3VV5A 3IORA 1QKBA 4U21A 1NL5A 4XKRA 3IAZA 2I0BA 3IO6A 4HS7A 1QJMA 3OO8A 1EZOA 4ND9A 5KDTB 4F22A 5AA2D 2GHBA 2F8DA 1ANFA 3OSQA 1T0KA 2DQVA 3R26A 1Y4CA 2REGA 3GLBA 3FJGA 1XVYA 4FECA 5K2XA 3CFZA 4MH5A 2I6EA 3L6GA 4ELPA 1GV8A 5LOMA 2ONRA 3Q26A 3RT8A 2XD3A 3E13X 2GFEA 2QMWA 1LB9A 3RY3A 1EH3A 1MXZA 1S7YA 4JXIA 3VFJA 3H6UA 3K01A 5B7DA 4O3AA 2P1SA 4NF8A 2DE2A 2DWAA 5KDTA 5F7VA 1JQFA 1ZIUA 2GHAA 3CIJA 4Q5TA 5CC2A 3HV1A 1BKAA 4EQ7A 1BP5A 1ATGA 4RK9A 2DWIA 4XKQA 3LSLA 4JSDA 5CRYA 5I56B 1HSEA 5AA3A 1US4A 5HBCA 4HCWA 3CVGA 2ZNSA 4F19A 1PDAA 1L5TA 3O66A 3WAEA 2XX8A 3ILUB 1A40A 1B3FA 2XX9A 1D9YA 1O63A 2VOZA 4YMBA 4M1VA 3T22A 3FGSA 1B32A 2XXPA 3TUSA 2UVIA 1MQJA 1D3KA 1NH7A 3QSLA 5JK4A 1US5A 3K1NA 4ISUA 1AH5A 4GD5A 2AL4A 4YB6A 4AB6A 1SW5A 4ELQA 4F39A 3CFLA 1B2HA 4DIGA 2X7PA 5CBRA 2W7YA 1B5HA 3K6VA 1XOCA 3W15C 2HAUA 5I58B 3VXCA 3V5AA 2GH9A 5EHSA 4I9DA 1B6HA 1UIVA 4YZZA 2ZXTA 4PFUA 3C9HA 2UYEA 2VGQA 4G68C 3SKPA 1AIVA 2ONSA 3KSJA 3MVYA 4WEDA 4KFQA 4TQUQ 4PP0A 3UN6A 3LR1A 1Y3PA 4LQ2A 2PMSA 3CG1A 2X7QA 3MBPA 1MRPA 1MPCA 1B5JA 4RA1A 2V93A 1DOTA 4TOZA 4IB2A 3H6WA 3EHUA 1BTJA 1LFGA 1PB9A 1YPNA 1QUKA 3E4RA 3HHFA 3LSFB 5I58A 3RUMA 2O68A 2PBWA 3L6HA 3C35A 4JWXA 1NNKA 2YJPA 4IO5A 1FW0A 4XIGQ 1EZPA 3ZKKA 3R6UA 3FIRA 5M2VA 3T9HB 3PPOA 1MQDA 2A5TB 1F9BA 2QS2A 4DLDA 2QPQA 3HO7A 4LP2B 4POXA 4C1TA 4G2ZA 3K4UA 4NWCA 2REJA 4JSOA 5CM6A 4IGRA 4QFNA 3LUYA 1JETA 4ELOA 1URGA 3H3GA 2RC9A 1LBBA 5AA2A 3ZSFA 1DTGA 1SBPA 3KN3A 2XXTA 5H8QA 1ZJLA 4JWOA 4KQPA 3TAJA 2ALUA 4KYSA 3OD7A 3LSWA 2XXXA 5KZTA 4P0GA 3K6XA 4NE4A 3T9VA 1R6ZA 3JV9A 3UORA 1OVBA 1FQBA 2A5TA 5TU0A 4GWOA 3H4ZA 1B7UA 3KSXA 4JB7A 3RPWA 4BDNA 1H43A 3Q25A 3GBAA 1B05A 4OEUA 3G3KA 1FQAA 4EF1A 3QIMA 3SERA 2QRYA 1TXFA 3GBBA 3QUFA 5B70A 1CB6A 3HCQA 1M5BA 1FTOA 3TODA 1MQGA 4WEPA 3O2AA 3DP4A 1ZKBA 4PE5B 2M8CA 1QUIA 1VR5A 1WVJA 2Q2AA 1J1NA 3BFUA 1SI1A 1MPDA 2I4CA 4OMBA 5TP9B 5I2NB 3E9XA 2HZKA 2NXOA 2H99A 1LGBC 2OWSA 2I4BA 3FATA 4NF6A 3MPKA 3PUYE 3W9WA 1PEBA 4IO2A 4XKNA 2Q2CA 4RK2A 3MP1A 4ZS9A 5L9SA 3H6VA 4AQ4A 1B4HA 3S4UA 3OENA 4YU0A 3RN8A 1H45A 3FV1A 2HZLA 4ZE9A 4TLMB 4DXCA 3D4CA 3FJMA 4BDRA 1B51A 3KFMA 4R6KA 4FORA 1SD3A 4EDPA 3S9NC 4PFYA 5H8HB 3B6WA 3VXBA 2ZYOA 2OWTA 3U72A 2HFBA 3FVNA 2KLFA 3DP6A 4KCDA 4XXUA 2OBGA 5L9OA 3TTNA 3UGWA 5I2NA 3TCFA 4H8JA 1P1UA 1H76A 4G8HA 4NF5B 3E3KA 1POY1 2Y7PA 3BBRA 5AA1A 4G8NA 1UTBB 2AYSA 3G3HA 1B3LA 5ICTA 1MDQA 2V3TA 1KWHA 5KCJB 3PD9A 1Y1MA 4OENA 4JBZA 2F7BA 1N7WA 2QL3A 4KD5A 3H7MA 4IO3A 1EU8A 2P0SA 4FATA 3HSTA 3G3JA 4QFLA 3PU5A 3C34A 5AE4A 3PMXA 3N5LA 3MVXA 1MS7A 1PB7A 3KG2A 3U94A 4F29A 5TPAA 1O7TA 3CSBA 1H44A 4BDLA 3N6TA 5ITPA 1M5CA 1ELJA 1UTBA 4NTLA 3T9UA 5HM4B 1MXWA 4GXSB 1FTJA 4IGTA 3SESA 5DEXA 2Z23A 3HPIA 2UVGA 1B7ZA 5KCJA 4P11A 2DVCA 3TYHA 4ONYA 1MG1A 3MJNA 4NEDA 3A3UA 3LBSA 2XXUA 1SYHA 2PYYA 1AOVA 2VD3A 4E0WA 1ZTYA 2F6PA 3TCGA 5EHMA 3THIA 3ECRA 3IOWA 4H5GA 4YKIA 3DM0A 1B3GA 2F7AA 5I2KB 2E1SA 3RT6B 3WAFA 2THIA 1B58A 3SDFA 4NF8B 2O1LA 3TTLA 4EXKA 2Y7RA 4X9TA 3W9VA 2R71A 2O69A 3K02A 1YAEA 1MXUA 3O6HA 3TQLA 2XD2A 1TFAA 1GR2A 3IOVA 2I3WA 4EF2A 3GZGA 3CR9A 3C4MA 5DYHA 2ZNTA 1AL3A 4F31B 4NMYA 2I58A 3S9MC 4HCYA 3TTMA 4GQOA 1FTKA 2HXWA 2X26A 1XHYA 5I2KA 2WKYA 3KN7A 2QS3A 1QKAA 3VLVA 3CI8A 3T93B 3ONMA 4L17A 4LZ7A 3O9PA 2QS1A 4XTCQ 3M3KA 2OZZA 2H98A 1VE4A 5FTHA 3VLUA 1MPBA 1DMBA 2V25A 2PT1A 3HHGA 3PV0E 1N04A 1IXCA 3PPNA 4PQJA 1IXIA 2O51A 4DCXA 3C36A 4E0XA 2RF1A 3TTKA 4N13A 1LB8A 3U1OA 1IEJA 3UIFA 2GRVA 3MQ9A 1A99A 3N94A 4DXUA 4KCCA 4MF3A 1Q35A 1N84A 3K6WA 4LVQA 3VE1B 2F97A 3QK6A 4H5FA 4OXVA 2R9JA 3TFLA 3O29A 4R6HA 2LAOA 1JW1A 1BIYA 3O6IA 3DP8A 3U93A 4WKMA 3ZS6A 1SYIA 3S9LC 3FJ7A 2G29A 4BDOA 3FVKA 2DOJA 3I3VA 1MXXA 2Q88A 4JWYA 4MLVA 2IA4A 1D4NA 3TTRA 2V3QA 2OCUA 3ODBA 3C32A 1LBCA 2AIXA 3FXUA 1Y20A 4IO6A 4U23A 1P99A 3O28A 2HAVA 5AA4A 1IXHA 1YTVA 4R9GA 5BUUA 2XXVA 2I3VA 3PUZE 5H8FA 4OQOA 5H8SA 4G77A 2O1MA 3FZVA 1LCFA 3N6UA 3P7IA 5AA2B 2DS9A 3FXQA 1WODA 1LFHA 3O6GA 5H8QB 2OJTA 3KBRA 1GGGA 4WXJA 3F11A 4F3BA 1A55A 2H25A 2ZYNA 5DVJA 3FV2A 3TPAA 2F5XA 4G68A 3IB0A 3RLFE 5A5XA 3AXFA 4QHQA 2PX1A 3M3LA 4QRZA 1IIWA 4N07A 5I84A 4O3BA 1MDP1 4DE8A 1NNPA 1VFDA 4R2FA 2QSXA 5JEIA 1P1WA 5H8NA 4ZEBA 3IB1A 3KGCA 3U8QA 1LFIA 3ZKLA 3OSRA 1MY3A 3IX1A 4KYDA 3DLNA 1UIUA 2PT2A 4EQBA 3PPPA 1I6BA 5L8DA 3IOTA 1Z7NE 3Q29A 3VLWA 4F1VA 1XVXA 1II5A 5FHNA 3CFXA 4NF6B 3KEIA 1Y3QA 4Z0IA 2OK2A 1Y9UA 3JYRA 4KYEA 1IUDA 5I57B 3SEXA 2CMOA 3S2VA 5K2YA 3FVGA 2XXWA 1I6QA 3MVZA 1N3XA 2Z8FA 1ZU0A 4IO7A 4FAJA 1DSNA 4OFLA 4EXLA 3V89B 4YB7A 4ZEDA 4U4XA 2IEEA 3OELA 1PBQA 4R73A 3UP9A 4TLLB 1JVXA 1MY1A 2O6AA 4QFKA 4YB5A 3SETA 2ABHA 3D4GA 4R6YA 1JEVA 1DTZA 3K1MA 4OWDA 5I57A 1EZ9A 4LA9A 1MM7A 1LCTA 3EQ1A 2AL5A 3LC8A 3A09A 2H9BA 1M5EA 1VFEA 1UQWA 1D9VA 3MPLA 5I59A 2D21A 1Y4TA 5DVFA 3MUQA 3OMBA 1UTHA 1GVCA 4RYAA 1N3WA 1LSTA 3BFTA 4RY1A 2FNCA 1SQYA 3TDJA 4HTGA 1JVYA 3SEUA 3QUJA 1TFDA 2XXIA 3TKDA 1VSOA 1MM6A 4H0WA 1B1HA 1JEUA 1IQ7A 1Q1KA 5TPAB 3M8UA 2QJEA 2QMXA 3OEMA 1MY2A 3PUXE 4FE8A 4F1UA 4R9FA 4U1OA 2NUVA 4ELRA 4GIZA 1RYOA 5DEXB 1NH8A 4X1BA 1RKMA 5DVIA 3K1PA 4F2QA 4F3PA 2I48A 4BDQA 2VP1A 4LZ8A 3C33A 5JTYA 1BLFA 4F3GA 3VVFA 2CZLA 3Q28A 3IJXB 1DPPA 4H1XA 2H4IA 1NMUA 3H03A 1PBPA 1MXYA 4ZE8A 3KJTA 3KZGA 2Z8EA 4MBPA 3K6UA 4OERA 3M3FA 4UA8A 1QUJA 3MVWA 5FTIA 3FVOA 1Y1ZA 5CMBA 4LQ5A 1RYXA 4P0IA 4OESA 4THIA 5L9MA 4QSEA 2VHAA 3MP8A 5CBSA 4I62A 1SW4A 4LONB 4U4SA 3FASA 2UYFA 3CRBA 4FEBA 3IOUA 4BLAA 1P1QA 3RNNA 4ESXA 2V3UA 2ONKE 1USYH 3KOSA 5ICQA 1IZ1A 4YMAA 1URSA 1I6AA 4O3CA 1S50A 1FTLA 3QAXA 3PGFA 1OLCA 4RPNA 4X48A 4OTEA 3DELB 2H5YA 5F1QA 3KN8A 3BKIB 3O97A 4RXLA 5DT6A 3T9XB 5CMCA 4PFTA 4YICA 2DXYA 2RKMA 4HW8A 2DWJA 1NFTA 3TQWA 3G3FA 2PVUA 2DE4A 2XX7A
chains in the Genus database with same CATH superfamily
2ZNUA 4P1EA 1DCUA 1CE2A 2Y7WA 4KPTA 2DVZA 4Q8RA 4YKPA 1FQDA 3OXNA 1TWYA 3RTFB 4OEVA 2VD2A 4KI0E 1N76A 2O7UA 3K00A 5EYFA 3MP6A 3MC2A 5IZZA 4ZDMA 1QVSA 1IXGA 2ESNA 4FEDA 2HQ0A 1MXVA 1NKXA 4F1YA 1B3EA 1LBWA 1PC3A 3OO7A 1SDXA 2F78A 2XWKA 1B0LA 4Q0CA 3RGYA 1H3DA 3A3CA 4H46A 3EHSA 4HE2A 3SEWA 1OMPA 5ITOA 1WDNA 4PFRA 4LZ5A 2F7CA 2ANJA 2XHDA 4ZEIA 4H6DA 4GBWA 5IKBA 4N8YA 3QMFA 3TMGA 2KQZA 4GFRA 1QULA 2XWOA 5AA4B 2QFLA 4PFWA 2DWHA 4C0RA 4ZEKA 3TEPA 5DTBA 2XWVA 3OO9A 4GXAA 1MQIA 4JVDA 4JDFA 4POWA 5H8FB 3CG3A 4GL0A 4N6KA 2F35A 4G4PA 3TZAA 1B5IA 1LAGE 1Z7ME 4I8CA 2ZZVA 3K2DA 1O64A 3IR1A 4ZEFA 2A5SA 5I56A 5EQAA 3FD3A 3B7DA 4F3SA 5ET8A 2DYXA 4GX4A 1MH4A 3MZ9A 4F2OA 4DI3D 1OQGA 4G68B 3VVDA 4H45A 4MLQA 5A5XB 1FTMA 3D1RA 2WX9A 1OQHA 3QYTA 4OVJA 4RNSA 3HN0A 3LUZA 1FPJA 3IK6B 5IZ3B 1HSJA 2RC8A 3U92A 4OVQA 3BIHA 3MW0A 2XXHA 4NF4B 2YPNA 2F3BA 1OVTA 2F34A 4GLIA 5H8NB 2NOOA 1NV6A 2MKZA 1JNFA 2F36A 4DZ1A 2RCBA 4R75A 2Q89A 3JZJA 1B40A 1LAHE 2UXAA 1OIBA 2DXRA 1JW5A 2Y7KA 3EPEA 3USDA 4PAIA 2G93A 4N6PA 4AB5A 2R8TA 3MWBA 2ZYKA 4ZZEA 1P1OA 4GL8A 3GXAA 3PPRA 4P3LA 5F24A 4NG7A 3KOTA 3TELA 4I1DA 5IAIA 1FBEA 2Y84A 3T96B 4OFOA 4GVOA 1SW1A 4NF4A 3N26A 2HEUA 1ZBMA 1B52A 4H8IA 4I3YA 4ZZAA 3OEKA 3T1BA 1R9LA 2Y7IA 3RTWB 3R7XA 4QF9A 2HCAA 4UACA 3I6VA 1FQCA 1B9JA 3PMVA 1A8FA 2V84A 1MY4A 1S9TA 1OLAA 1USYE 4MAGA 3E78A 3PPQA 4R72A 1D9QA 5FHMA 3IJOB 1GTKA 3MZBA 4YAHX 2QS4A 3TCHA 3UA8A 3RQTA 3FUZA 1XC1A 4Z7EA 1N0TA 4DCYA 4OVSA 4PETA 2D3IA 4U22A 3PUVE 3SEYA 4FJPA 2ZYMA 3VDFA 5ISUA 4G8MA 1B4ZA 1MQHA 2Y5KA 1FBHA 4LATA 4MFIA 4GRKA 4GX6A 4QFPA 5I59B 4AS5A 2FYIA 3G3GA 4QFOA 1A54A 1ZMGA 1UTHB 4GBVA 1FQEA 4NQ8A 4RPOA 2E0SA 3CSGA 4IY6A 2WEFA 4H65A 1R1NA 4LUBA 1IITA 1AMFA 1HSLA 1PB8A 5CMKA 2B65A 4F18A 2DE3A 1SVXB 3H6TA 4PCDA 4KR5A 3SEVA 4YKKA 2XXKA 4FIMA 4YKJA 1FPBA 3ROJA 2VPOA 3OOAA 4OZ9A 2UVJA 1URDA 4OYVA 5CMMA 1R9QA 2B3FA 5ELVA 4ESWA 4K3FA 4C1UA 1YCJA 1QW0A 4EUOA 3MAMA 5JTYB 5ESYA 2RC7A 3PD8A 4Q30B 3IB2A 4M4GA 4R74A 1TT1A 2UVHA 2FA7A 4PGPA 1IMBA 1NUXA 3EF7A 3VVEA 1K9ZA 1LAFE 2NVUB 4O7MA 1MY0A 4H67A 3QXMA 3K0VA 1MH3A 2RINA 1ZLQA 5CI5A 3KJ7A 5EQ8A 5HPQA 2DSFA 1I69A 5TP9A 4KHZE 1G0HA 3B6QA 4BDMA 5BWJA 3S9EA 2O84X 3G3IA 2Z22A 5FHOA 1SI0A 2ZMBA 3LSXA 5J1DA 1FRPA 2OLBA 1Y3NA 3V8XB 2B3BA 2Q8JA 1FQFA 4X1DA 3H06B 4GF8A 2D5WA 3PMWA 2GQ1A 4GOTA 1SW2A 4I40A 3C31A 2BJJX 1XT8A 3EHTA 3T66A 4O8MA 2I0CA 1B7HA 2F6GA 4OHNA 4P8BA 3V83A 1B1XA 1M5DA 1DPEA 2YLNA 5EQ7A 1JW4A 4DDDA 1YXIA 1XS5A 2Z8DA 1LAXA 5H8HA 2NWJA 4ZECA 2XXYA 2RCAA 4U1ZA 4IO4A 1B46A 4QSDA 1A7LA 3PUWE 1NNTA 4U2RA 4DXBA 1DK4A 3OO6A 3I5OA 2P2AA 2I49A 2R6GE 2XXRA 4NF5A 1B0HA 1B3HA 3G7WA 1FJ9A 2DDKA 2WYPA 3IL1B 4IY5A 4NWDA 4OFJA 2Q9TA 4EQ9A 1POTA 1FPGA 4ECFA 1FCKA 3Q27A 1A8EA 4DI4B 3EN3A 3IO4A 3UK4A 4N6DA 2XXQA 1N7XA 4XKPA 5DW8A 4PE3A 4RJZA 3B6TA 2DP8A 3ILTB 1Q9DA 3MZ1A 4QSCA 1NNFA 1M5FA 4N15A 3FXRA 4R2BA 4JVIA 1P1NA 4FBPA 4OETA 3MYUA 2O7IA 5ET7A 1LLSA 3VV5A 3IORA 1QKBA 4U21A 1NL5A 4XKRA 1NV2A 3IAZA 2I0BA 2JJKA 3IO6A 4HS7A 1QJMA 3OO8A 1EZOA 4ND9A 5KDTB 4F22A 5AA2D 2GHBA 2F8DA 4GWUA 1ANFA 3OSQA 1T0KA 2DQVA 3SZPA 3R26A 1NV3A 1Y4CA 2REGA 3GLBA 3FJGA 1RDZA 1XVYA 2BJIA 4FECA 5K2XA 3B50A 3CFZA 4MH5A 2I6EA 3L6GA 3U65A 4ELPA 1FBFA 1GV8A 5LOMA 2ONRA 3Q26A 3RT8A 2XD3A 3E13X 2GFEA 1SPIA 2QMWA 1LB9A 3RY3A 1EH3A 1MXZA 1S7YA 4JXIA 3VFJA 1FSAA 3H6UA 3K01A 2Y5LA 5B7DA 4O3AA 2P1SA 4NF8A 2DE2A 2DWAA 5KDTA 5F7VA 1JQFA 1ZIUA 2GHAA 3CIJA 3EKIA 4Q5TA 1YZ0A 5CC2A 3HV1A 1BKAA 4EQ7A 1BP5A 1ATGA 4RK9A 2DWIA 4XKQA 3LSLA 4JSDA 5CRYA 5I56B 3RYDA 1HSEA 5AA3A 1US4A 5HBCA 4HCWA 3CVGA 2ZNSA 4F19A 1NUWA 1PDAA 1L5TA 3O66A 3WAEA 2XX8A 3ILUB 3ISPA 1A40A 1B3FA 2QVUA 2XX9A 2CZIA 1D9YA 1O63A 2VOZA 4YMBA 4M1VA 3T22A 3FGSA 1B32A 2XXPA 3TUSA 2UVIA 1MQJA 1D3KA 1NH7A 3QSLA 5JK4A 5EYGA 1RDYA 1US5A 3K1NA 4ISUA 1AH5A 4GD5A 2AL4A 4YB6A 4AB6A 1SW5A 4ELQA 4MEVA 3RPLB 4P1LA 4F39A 2VPNA 3CFLA 3KBZA 1B2HA 4I3EA 4DIGA 2X7PA 5CBRA 2W7YA 1B5HA 3K6VA 1RDXA 4PC9A 2CEYA 1XOCA 3W15C 2HAUA 1IMCA 5I58B 3VXCA 3V5AA 1NV4A 2GH9A 5EHSA 2FHYA 4I9DA 1B6HA 1UIVA 4YZZA 2ZXTA 4PFUA 3C9HA 2UYEA 2VGQA 4O94A 4G68C 3SKPA 1AIVA 2ONSA 3KSJA 3MVYA 1NI9A 4WEDA 4KFQA 4TQUQ 4PP0A 3LR1A 3UN6A 1Y3PA 4LQ2A 2PMSA 3CG1A 2PCRA 2X7QA 3MBPA 3RPLA 1LBXA 1MRPA 1MPCA 2XA5A 1B5JA 4RA1A 2CZKA 2V93A 1DOTA 4MJOA 4TOZA 4IB2A 3H6WA 3EHUA 1BTJA 4OVTA 1LFGA 1PB9A 2PFZA 1YPNA 1QUKA 4MIJA 3E4RA 4MX6A 2ZZXA 5I3SA 3HHFA 3LSFB 4HXVA 5I58A 3RUMA 2O68A 4N4UA 2PBWA 3L6HA 1FBPA 3C35A 1VDWA 4JWXA 1NNKA 2YJPA 4IO5A 1FW0A 4XIGQ 4P56A 1EZPA 4PFBA 3ZKKA 3R6UA 3FIRA 5M2VA 3T9HB 3PPOA 3BIGA 1MQDA 2A5TB 1F9BA 1NUYA 2QS2A 4DLDA 2QPQA 3HO7A 4LP2B 4POXA 4P9KA 4C1TA 4G2ZA 3K4UA 4NWCA 2REJA 4JSOA 4X8RA 5CM6A 4IGRA 4QFNA 3LUYA 1JETA 4ELOA 1URGA 3H3GA 2RC9A 1LBBA 5AA2A 3ZSFA 1DTGA 1SBPA 4PBQA 3KN3A 2XXTA 5H8QA 1ZJLA 4JWOA 4KQPA 3TAJA 2ALUA 4KYSA 5LDZA 3OD7A 3LSWA 2XXXA 2OWZA 5KZTA 3T0JA 4P0GA 4NHBA 3K6XA 4NE4A 3T9VA 1R6ZA 3JV9A 3UORA 1OVBA 1FQBA 2A5TA 5TU0A 4GWOA 3H4ZA 1B7UA 3KSXA 4JB7A 3A29A 3RPWA 4BDNA 1H43A 3Q25A 3GBAA 1B05A 4OEUA 3G3KA 4XF5A 1FQAA 4EF1A 4UABA 3QIMA 3SERA 2QRYA 1TXFA 3GBBA 3QUFA 5B70A 1CB6A 3HCQA 1M5BA 1FTOA 3TODA 1MQGA 4WEPA 3O2AA 3DP4A 1ZKBA 4PE5B 2M8CA 3MSTA 1LBVA 1QUIA 1VR5A 1WVJA 2Q2AA 1J1NA 4G61A 3BFUA 1SI1A 1MPDA 2I4CA 4GWWA 5ET6A 4OMBA 5TP9B 5I2NB 3E9XA 1FPDA 2HZKA 2NXOA 2H99A 1LGBC 2OWSA 2I4BA 3FATA 1XI6A 4NF6A 3MPKA 3PUYE 3W9WA 1PEBA 4IO2A 4XKNA 2Q2CA 4RK2A 3MP1A 4ZS9A 5L9SA 3H6VA 4AQ4A 2QVVA 1B4HA 3S4UA 3OENA 4YU0A 4N8GA 3RN8A 1H45A 3FV1A 4N81A 2HZLA 4ZE9A 4TLMB 4DXCA 3D4CA 3FJMA 4BDRA 1B51A 3KFMA 4R6KA 4FORA 1SD3A 4EDPA 3S9NC 1FPFA 4PFYA 1NV7A 5H8HB 3B6WA 2V4CA 2XWIA 3VXBA 4IR8A 2ZYOA 2OWTA 3U72A 4OA4A 2HFBA 2P3VA 3FVNA 2KLFA 3DP6A 4KCDA 4XXUA 2OBGA 1FTAA 5L9OA 1FBDA 3TTNA 3UGWA 5I2NA 3TCFA 4H8JA 1P1UA 1H76A 4G8HA 4NF5B 3E3KA 1POY1 2Y7PA 3BBRA 5AA1A 4G8NA 1UTBB 2AYSA 3G3HA 1B3LA 5ICTA 1MDQA 1EYKA 2V3TA 1KWHA 5KCJB 3PD9A 4OVPA 2HHMA 1Y1MA 4OENA 4JBZA 3E79A 2F7BA 4PGNA 1INPA 1N7WA 2QL3A 4KD5A 3H7MA 4IO3A 1EU8A 2P0SA 1NUZA 3GYYA 4FATA 1FPKA 3HSTA 3G3JA 4QFLA 1IMAA 3PU5A 2QVRA 3C34A 5AE4A 3PMXA 3N5LA 3MVXA 1MS7A 1PB7A 3KG2A 3U94A 4F29A 5TPAA 1O7TA 3CSBA 1H44A 4BDLA 3N6TA 1DBZA 5ITPA 1M5CA 1ELJA 1UTBA 4NTLA 2KR0A 3T9UA 5HM4B 1MXWA 4GXSB 1FTJA 4IGTA 3SESA 5DEXA 2Z23A 3HPIA 2UVGA 1B7ZA 5KCJA 4P11A 5I7IA 2DVCA 3TYHA 4ONYA 1MG1A 3MJNA 4NEDA 1FBCA 1BK4A 2WBDA 3A3UA 4MCOA 3LBSA 2XXUA 1SYHA 1FJ6A 2PYYA 1AOVA 2VD3A 4E0WA 4NX1A 1ZTYA 2F6PA 3TCGA 5EHMA 3THIA 3ECRA 3IOWA 4H5GA 4YKIA 3DM0A 3CHGA 1B3GA 2F7AA 5I2KB 2E1SA 3RT6B 3WAFA 3IFCA 2THIA 1B58A 3SDFA 4X04A 4NF8B 3HFUA 4PF6A 2O1LA 3TTLA 4EXKA 2Y7RA 4X9TA 4MMPA 3W9VA 2R71A 2O69A 3K02A 1YAEA 1MXUA 3O6HA 4GWYA 3TQLA 2XD2A 1TFAA 1GR2A 4LN5A 3IOVA 2I3WA 4EF2A 3GZGA 3CR9A 3C4MA 5DYHA 2Q8MA 2ZNTA 1AL3A 4F31B 4KXPA 2CZHA 4NMYA 2I58A 3S9MC 4HCYA 3TTMA 4GQOA 1FTKA 2FVZA 2HXWA 2X26A 1XHYA 4OVRA 5I2KA 2WKYA 3KN7A 2QS3A 1QKAA 3VLVA 4QBAA 3CI8A 3T93B 3ONMA 4L17A 2P3NA 3O9PA 4LZ7A 2QS1A 4XTCQ 2VT5A 3M3KA 4O7IA 2OZZA 2H98A 1VE4A 5FTHA 3VLUA 1MPBA 1DMBA 2V25A 2PT1A 3HHGA 3PV0E 1N04A 1IXCA 3PPNA 4PQJA 1NV0A 1IXIA 3PTYA 3KC0A 2O51A 4DCXA 2ZZWA 3C36A 4E0XA 2RF1A 3TTKA 4HE0A 4PF8A 4N13A 2F3DA 1LB8A 3U1OA 1IEJA 3UIFA 2PFYA 1G0IA 3NOHA 5FBPA 2GRVA 3MQ9A 1A99A 3N94A 4DXUA 4KCCA 4MF3A 1Q35A 5IZ1A 1N84A 3K6WA 4LVQA 3VE1B 2F97A 3QK6A 1KA0A 4H5FA 4OXVA 2R9JA 3LV0A 3TFLA 3O29A 5IGAA 4R6HA 3FBPA 2LAOA 1JW1A 1BIYA 3O6IA 3DP8A 3U93A 4WKMA 3ZS6A 1SYIA 1NV5A 3S9LC 3FJ7A 2G29A 4NGUA 4BDOA 3FVKA 2DOJA 3I3VA 1MXXA 2Q88A 4JWYA 2WBBA 4MLVA 2IA4A 1D4NA 3TTRA 2V3QA 2OCUA 3ODBA 3FXBA 3C32A 1LBCA 2AIXA 3FXUA 2HPGA 1Y20A 4IO6A 4U23A 1P99A 3O28A 2HAVA 5AA4A 1IXHA 1YTVA 1EYJA 4R9GA 5BUUA 2XXVA 2FIEA 2I3VA 3PUZE 5I5PA 5H8FA 4OQOA 5H8SA 4G77A 2O1MA 4QXDA 3FZVA 1LCFA 1FPEA 3N6UA 3P7IA 5AA2B 2DS9A 3FXQA 1WODA 1LFHA 3O6GA 1FPIA 5H8QB 2OJTA 3KBRA 1GGGA 2B4MA 4WXJA 4P47A 3F11A 2HXRA 4F3BA 4MNCA 1A55A 2H25A 2ZYNA 5DVJA 3FV2A 3TPAA 1LBYA 2F5XA 4G68A 3IB0A 5IM2A 3RLFE 5A5XA 3AXFA 4QHQA 2PX1A 3M3LA 4QRZA 2FBPA 5IZ3A 1IIWA 4N07A 5I84A 4O3BA 4NF0A 1MDP1 4DE8A 1NNPA 4MNIA 1VFDA 4R2FA 2QSXA 5JEIA 1P1WA 5H8NA 4ZEBA 3IB1A 3KGCA 3U8QA 4GWSA 2Q74A 1LFIA 4OANA 3ZKLA 3OSRA 1LBZA 1MY3A 3IX1A 4KYDA 3DLNA 1UIUA 2PT2A 4EQBA 3PPPA 1I6BA 5L8DA 3IOTA 1Z7NE 2WYKA 3Q29A 5LTCA 3B8BA 3VLWA 4F1VA 1XVXA 1YYZA 1II5A 5FHNA 3CFXA 4NF6B 3KEIA 5ET5A 1Y3QA 4Z0IA 2OK2A 1LEVA 4XFEA 1Y9UA 3JYRA 4KYEA 1IUDA 5I57B 3SEXA 2CMOA 4PDHA 1KA1A 3S2VA 5K2YA 3FVGA 2XXWA 1I6QA 3MVZA 1N3XA 2Z8FA 1ZU0A 4IO7A 4FAJA 1DSNA 4OFLA 4EXLA 3V89B 4YB7A 4ZEDA 4U4XA 5J16A 2IEEA 3OELA 1PBQA 4R73A 4PBHA 5EYHA 4TLLB 3UP9A 1JVXA 1MY1A 2O6AA 4QFKA 4YB5A 3SETA 4PFIA 2ABHA 1NV1A 3D4GA 4R6YA 1JEVA 1DTZA 3K1MA 4OWDA 5I57A 1EZ9A 4LA9A 1MM7A 1LCTA 3EQ1A 2AL5A 3LC8A 3A09A 2H9BA 1M5EA 1VFEA 1UQWA 2L5VA 1D9VA 3MPLA 5I59A 2D21A 1Y4TA 5DVFA 3MUQA 3OMBA 1UTHA 1GVCA 4RYAA 1N3WA 1LSTA 3BFTA 4RY1A 2FNCA 1SQYA 3TDJA 4NN3A 4HTGA 1JVYA 3SEUA 3QUJA 2CEXA 1TFDA 2XXIA 3TKDA 1VSOA 1MM6A 5A5LA 4H0WA 1B1HA 1JEUA 1IQ7A 1Q1KA 5TPAB 3M8UA 2QJEA 2QMXA 3OEMA 4JVCA 1MY2A 3PUXE 4FE8A 4F1UA 4R9FA 4U1OA 2NUVA 1EYIA 4ELRA 4GIZA 1IMEA 1RYOA 5DEXB 1NH8A 4X1BA 1IMFA 4PAKA 1RKMA 5DVIA 3K1PA 4F2QA 4F3PA 2I48A 4BDQA 2VP1A 4LZ8A 3C33A 5JTYA 4PDDA 4GWZA 1BLFA 2FIXA 4F3GA 3VVFA 2CZLA 3Q28A 3IJXB 1DPPA 4H1XA 2H4IA 1NMUA 3H03A 4HE1A 1PBPA 1MXYA 4ZE8A 3KJTA 3IFAA 3KZGA 2Z8EA 5EQ9A 4MBPA 2B4LA 3K6UA 4OERA 1K9YA 3M3FA 4UA8A 1QUJA 1JP4A 3MVWA 5FTIA 3FVOA 4PAFA 1Y1ZA 3KC1A 5CMBA 1FPLA 4LQ5A 1RYXA 4N17A 4P0IA 1QGXA 1FBGA 4OESA 1IMDA 4THIA 5L9MA 5T3JA 4QSEA 2VHAA 4GWXA 4N91A 3MP8A 5CBSA 4I62A 1SW4A 4LONB 4U4SA 3FASA 2UYFA 1KZ8A 3CRBA 1AWBA 4FEBA 3IOUA 2OX3A 4BLAA 4GX3A 1P1QA 3RNNA 4ESXA 2V3UA 2ONKE 1USYH 3KOSA 4PTKA 5ICQA 1IZ1A 4YMAA 1URSA 1I6AA 4O3CA 1S50A 1FTLA 3QAXA 1CNQA 4AS4A 3PGFA 4MHFA 4NAPA 1OLCA 4RPNA 4X48A 4OTEA 3DELB 2H5YA 5F1QA 3KN8A 3BKIB 3O97A 4RXLA 5DT6A 3T9XB 5CMCA 4PFTA 4YICA 2DXYA 2RKMA 4HW8A 2DWJA 1NFTA 3TQWA 4MNPA 3G3FA 4XEQA 2PVUA 2DE4A 2XX7A
chains in the Genus database with same CATH topology
2ZNUA 1CE2A 2Y7WA 4KPTA 2DVZA 4Q8RA 4YKPA 1FQDA 3OXNA 1TWYA 3RTFB 4OEVA 2VD2A 4KI0E 1N76A 2O7UA 3K00A 5EYFA 3MP6A 3MC2A 4ZDMA 1QVSA 1IXGA 2ESNA 4FEDA 2HQ0A 1MXVA 1NKXA 4F1YA 1B3EA 1PC3A 3OO7A 1SDXA 2F78A 1B0LA 4Q0CA 3RGYA 1H3DA 3A3CA 3EHSA 3SEWA 1OMPA 5ITOA 1WDNA 4LZ5A 2F7CA 2ANJA 2XHDA 4ZEIA 4H6DA 5IKBA 3TMGA 4GFRA 1QULA 5AA4B 4PFWA 2DWHA 4C0RA 4ZEKA 3TEPA 5DTBA 3OO9A 4GXAA 1MQIA 4JDFA 4POWA 5H8FB 3CG3A 4GL0A 2F35A 4G4PA 3TZAA 1B5IA 1LAGE 1Z7ME 4I8CA 3K2DA 1O64A 3IR1A 4ZEFA 2A5SA 5I56A 3FD3A 3B7DA 4F3SA 2DYXA 1MH4A 3MZ9A 4F2OA 1OQGA 4G68B 3VVDA 4MLQA 5A5XB 1FTMA 1OQHA 3QYTA 4OVJA 3HN0A 4RNSA 3IK6B 1HSJA 2RC8A 3U92A 3MW0A 2XXHA 4NF4B 2YPNA 1OVTA 2F34A 4GLIA 5H8NB 2NOOA 1JNFA 2F36A 4DZ1A 2RCBA 4R75A 2Q89A 3JZJA 1B40A 1LAHE 2UXAA 1OIBA 2DXRA 1JW5A 2Y7KA 3EPEA 3USDA 2G93A 4N6PA 4AB5A 3MWBA 2ZYKA 4ZZEA 1P1OA 4GL8A 3GXAA 3PPRA 3KOTA 3TELA 4I1DA 5IAIA 2Y84A 3T96B 4OFOA 4GVOA 1SW1A 4NF4A 3N26A 2HEUA 1ZBMA 1B52A 4H8IA 4ZZAA 3OEKA 1R9LA 2Y7IA 3RTWB 3R7XA 4QF9A 2HCAA 4UACA 3I6VA 1FQCA 1B9JA 3PMVA 1A8FA 2V84A 1MY4A 1S9TA 1OLAA 1USYE 3PPQA 4R72A 5FHMA 3IJOB 1GTKA 3MZBA 4YAHX 2QS4A 3TCHA 3UA8A 3RQTA 3FUZA 1XC1A 4Z7EA 1N0TA 4DCYA 4PETA 2D3IA 4U22A 3PUVE 3SEYA 4FJPA 2ZYMA 3VDFA 5ISUA 4G8MA 1B4ZA 1MQHA 4LATA 4MFIA 4GRKA 4QFPA 5I59B 2FYIA 3G3GA 4QFOA 1A54A 1ZMGA 1UTHB 1FQEA 4RPOA 2E0SA 3CSGA 4IY6A 4H65A 1R1NA 4LUBA 1IITA 1AMFA 1HSLA 1PB8A 5CMKA 2B65A 4F18A 2DE3A 1SVXB 3H6TA 4KR5A 3SEVA 4YKKA 4FIMA 4YKJA 3OOAA 4OZ9A 2UVJA 1URDA 4OYVA 5CMMA 1R9QA 2B3FA 5ELVA 4ESWA 4K3FA 4C1UA 1YCJA 1QW0A 4EUOA 3MAMA 5JTYB 2RC7A 3PD8A 4Q30B 3IB2A 4M4GA 4R74A 1TT1A 2UVHA 2FA7A 3EF7A 3VVEA 1LAFE 2NVUB 1MY0A 4H67A 3QXMA 3K0VA 1MH3A 2RINA 1ZLQA 5CI5A 3KJ7A 5HPQA 2DSFA 1I69A 5TP9A 4KHZE 3B6QA 4BDMA 5BWJA 3S9EA 2O84X 3G3IA 2Z22A 5FHOA 1SI0A 2ZMBA 3LSXA 5J1DA 2OLBA 1Y3NA 3V8XB 2B3BA 2Q8JA 1FQFA 4X1DA 3H06B 4GF8A 2D5WA 3PMWA 4GOTA 1SW2A 3C31A 2BJJX 1XT8A 3EHTA 3T66A 2I0CA 1B7HA 2F6GA 4OHNA 3V83A 1B1XA 1M5DA 1DPEA 2YLNA 1JW4A 4DDDA 1XS5A 2Z8DA 1LAXA 5H8HA 2NWJA 4ZECA 2XXYA 2RCAA 4U1ZA 4IO4A 1B46A 4QSDA 1A7LA 3PUWE 1NNTA 4U2RA 4DXBA 3OO6A 3I5OA 2P2AA 2I49A 2R6GE 2XXRA 4NF5A 1B0HA 1B3HA 3G7WA 3IL1B 4IY5A 4NWDA 4OFJA 2Q9TA 4EQ9A 1POTA 4ECFA 1FCKA 3Q27A 1A8EA 3EN3A 3IO4A 3UK4A 2XXQA 1N7XA 4XKPA 4RJZA 3B6TA 2DP8A 3ILTB 3MZ1A 4QSCA 1NNFA 1M5FA 3FXRA 4R2BA 1P1NA 4OETA 2O7IA 1LLSA 3VV5A 3IORA 1QKBA 4U21A 1NL5A 4XKRA 3IAZA 2I0BA 3IO6A 4HS7A 1QJMA 3OO8A 1EZOA 4ND9A 5KDTB 4F22A 5AA2D 2GHBA 2F8DA 1ANFA 3OSQA 1T0KA 2DQVA 3R26A 1Y4CA 2REGA 3GLBA 3FJGA 1XVYA 4FECA 5K2XA 3CFZA 4MH5A 2I6EA 3L6GA 4ELPA 1GV8A 5LOMA 2ONRA 3Q26A 3RT8A 2XD3A 3E13X 2GFEA 2QMWA 1LB9A 3RY3A 1EH3A 1MXZA 1S7YA 4JXIA 3VFJA 3H6UA 3K01A 5B7DA 4O3AA 2P1SA 4NF8A 2DE2A 2DWAA 5KDTA 5F7VA 1JQFA 1ZIUA 2GHAA 3CIJA 4Q5TA 5CC2A 3HV1A 1BKAA 4EQ7A 1BP5A 1ATGA 4RK9A 2DWIA 4XKQA 3LSLA 4JSDA 5CRYA 5I56B 1HSEA 5AA3A 1US4A 5HBCA 4HCWA 3CVGA 2ZNSA 4F19A 1PDAA 1L5TA 3O66A 3WAEA 2XX8A 3ILUB 1A40A 1B3FA 2XX9A 1D9YA 1O63A 2VOZA 4YMBA 4M1VA 3T22A 3FGSA 1B32A 2XXPA 3TUSA 2UVIA 1MQJA 1D3KA 1NH7A 3QSLA 5JK4A 1US5A 3K1NA 4ISUA 1AH5A 4GD5A 2AL4A 4YB6A 4AB6A 1SW5A 4ELQA 4F39A 3CFLA 1B2HA 4DIGA 2X7PA 5CBRA 2W7YA 1B5HA 3K6VA 1XOCA 3W15C 2HAUA 5I58B 3VXCA 3V5AA 2GH9A 5EHSA 4I9DA 1B6HA 1UIVA 4YZZA 2ZXTA 4PFUA 3C9HA 2UYEA 2VGQA 4G68C 3SKPA 1AIVA 2ONSA 3KSJA 3MVYA 4WEDA 4KFQA 4TQUQ 4PP0A 3UN6A 3LR1A 1Y3PA 4LQ2A 2PMSA 3CG1A 2X7QA 3MBPA 1MRPA 1MPCA 1B5JA 4RA1A 2V93A 1DOTA 4TOZA 4IB2A 3H6WA 3EHUA 1BTJA 1LFGA 1PB9A 1YPNA 1QUKA 3E4RA 3HHFA 3LSFB 5I58A 3RUMA 2O68A 2PBWA 3L6HA 3C35A 4JWXA 1NNKA 2YJPA 4IO5A 1FW0A 4XIGQ 1EZPA 3ZKKA 3R6UA 3FIRA 5M2VA 3T9HB 3PPOA 1MQDA 2A5TB 1F9BA 2QS2A 4DLDA 2QPQA 3HO7A 4LP2B 4POXA 4C1TA 4G2ZA 3K4UA 4NWCA 2REJA 4JSOA 5CM6A 4IGRA 4QFNA 3LUYA 1JETA 4ELOA 1URGA 3H3GA 2RC9A 1LBBA 5AA2A 3ZSFA 1DTGA 1SBPA 3KN3A 2XXTA 5H8QA 1ZJLA 4JWOA 4KQPA 3TAJA 2ALUA 4KYSA 3OD7A 3LSWA 2XXXA 5KZTA 4P0GA 3K6XA 4NE4A 3T9VA 1R6ZA 3JV9A 3UORA 1OVBA 1FQBA 2A5TA 5TU0A 4GWOA 3H4ZA 1B7UA 3KSXA 4JB7A 3RPWA 4BDNA 1H43A 3Q25A 3GBAA 1B05A 4OEUA 3G3KA 1FQAA 4EF1A 3QIMA 3SERA 2QRYA 1TXFA 3GBBA 3QUFA 5B70A 1CB6A 3HCQA 1M5BA 1FTOA 3TODA 1MQGA 4WEPA 3O2AA 3DP4A 1ZKBA 4PE5B 2M8CA 1QUIA 1VR5A 1WVJA 2Q2AA 1J1NA 3BFUA 1SI1A 1MPDA 2I4CA 4OMBA 5TP9B 5I2NB 3E9XA 2HZKA 2NXOA 2H99A 1LGBC 2OWSA 2I4BA 3FATA 4NF6A 3MPKA 3PUYE 3W9WA 1PEBA 4IO2A 4XKNA 2Q2CA 4RK2A 3MP1A 4ZS9A 5L9SA 3H6VA 4AQ4A 1B4HA 3S4UA 3OENA 4YU0A 3RN8A 1H45A 3FV1A 2HZLA 4ZE9A 4TLMB 4DXCA 3D4CA 3FJMA 4BDRA 1B51A 3KFMA 4R6KA 4FORA 1SD3A 4EDPA 3S9NC 4PFYA 5H8HB 3B6WA 3VXBA 2ZYOA 2OWTA 3U72A 2HFBA 3FVNA 2KLFA 3DP6A 4KCDA 4XXUA 2OBGA 5L9OA 3TTNA 3UGWA 5I2NA 3TCFA 4H8JA 1P1UA 1H76A 4G8HA 4NF5B 3E3KA 1POY1 2Y7PA 3BBRA 5AA1A 4G8NA 1UTBB 2AYSA 3G3HA 1B3LA 5ICTA 1MDQA 2V3TA 1KWHA 5KCJB 3PD9A 1Y1MA 4OENA 4JBZA 2F7BA 1N7WA 2QL3A 4KD5A 3H7MA 4IO3A 1EU8A 2P0SA 4FATA 3HSTA 3G3JA 4QFLA 3PU5A 3C34A 5AE4A 3PMXA 3N5LA 3MVXA 1MS7A 1PB7A 3KG2A 3U94A 4F29A 5TPAA 1O7TA 3CSBA 1H44A 4BDLA 3N6TA 5ITPA 1M5CA 1ELJA 1UTBA 4NTLA 3T9UA 5HM4B 1MXWA 4GXSB 1FTJA 4IGTA 3SESA 5DEXA 2Z23A 3HPIA 2UVGA 1B7ZA 5KCJA 4P11A 2DVCA 3TYHA 4ONYA 1MG1A 3MJNA 4NEDA 3A3UA 3LBSA 2XXUA 1SYHA 2PYYA 1AOVA 2VD3A 4E0WA 1ZTYA 2F6PA 3TCGA 5EHMA 3THIA 3ECRA 3IOWA 4H5GA 4YKIA 3DM0A 1B3GA 2F7AA 5I2KB 2E1SA 3RT6B 3WAFA 2THIA 1B58A 3SDFA 4NF8B 2O1LA 3TTLA 4EXKA 2Y7RA 4X9TA 3W9VA 2R71A 2O69A 3K02A 1YAEA 1MXUA 3O6HA 3TQLA 2XD2A 1TFAA 1GR2A 3IOVA 2I3WA 4EF2A 3GZGA 3CR9A 3C4MA 5DYHA 2ZNTA 1AL3A 4F31B 4NMYA 2I58A 3S9MC 4HCYA 3TTMA 4GQOA 1FTKA 2HXWA 2X26A 1XHYA 5I2KA 2WKYA 3KN7A 2QS3A 1QKAA 3VLVA 3CI8A 3T93B 3ONMA 4L17A 4LZ7A 3O9PA 2QS1A 4XTCQ 3M3KA 2OZZA 2H98A 1VE4A 5FTHA 3VLUA 1MPBA 1DMBA 2V25A 2PT1A 3HHGA 3PV0E 1N04A 1IXCA 3PPNA 4PQJA 1IXIA 2O51A 4DCXA 3C36A 4E0XA 2RF1A 3TTKA 4N13A 1LB8A 3U1OA 1IEJA 3UIFA 2GRVA 3MQ9A 1A99A 3N94A 4DXUA 4KCCA 4MF3A 1Q35A 1N84A 3K6WA 4LVQA 3VE1B 2F97A 3QK6A 4H5FA 4OXVA 2R9JA 3TFLA 3O29A 4R6HA 2LAOA 1JW1A 1BIYA 3O6IA 3DP8A 3U93A 4WKMA 3ZS6A 1SYIA 3S9LC 3FJ7A 2G29A 4BDOA 3FVKA 2DOJA 3I3VA 1MXXA 2Q88A 4JWYA 4MLVA 2IA4A 1D4NA 3TTRA 2V3QA 2OCUA 3ODBA 3C32A 1LBCA 2AIXA 3FXUA 1Y20A 4IO6A 4U23A 1P99A 3O28A 2HAVA 5AA4A 1IXHA 1YTVA 4R9GA 5BUUA 2XXVA 2I3VA 3PUZE 5H8FA 4OQOA 5H8SA 4G77A 2O1MA 3FZVA 1LCFA 3N6UA 3P7IA 5AA2B 2DS9A 3FXQA 1WODA 1LFHA 3O6GA 5H8QB 2OJTA 3KBRA 1GGGA 4WXJA 3F11A 4F3BA 1A55A 2H25A 2ZYNA 5DVJA 3FV2A 3TPAA 2F5XA 4G68A 3IB0A 3RLFE 5A5XA 3AXFA 4QHQA 2PX1A 3M3LA 4QRZA 1IIWA 4N07A 5I84A 4O3BA 1MDP1 4DE8A 1NNPA 1VFDA 4R2FA 2QSXA 5JEIA 1P1WA 5H8NA 4ZEBA 3IB1A 3KGCA 3U8QA 1LFIA 3ZKLA 3OSRA 1MY3A 3IX1A 4KYDA 3DLNA 1UIUA 2PT2A 4EQBA 3PPPA 1I6BA 5L8DA 3IOTA 1Z7NE 3Q29A 3VLWA 4F1VA 1XVXA 1II5A 5FHNA 3CFXA 4NF6B 3KEIA 1Y3QA 4Z0IA 2OK2A 1Y9UA 3JYRA 4KYEA 1IUDA 5I57B 3SEXA 2CMOA 3S2VA 5K2YA 3FVGA 2XXWA 1I6QA 3MVZA 1N3XA 2Z8FA 1ZU0A 4IO7A 4FAJA 1DSNA 4OFLA 4EXLA 3V89B 4YB7A 4ZEDA 4U4XA 2IEEA 3OELA 1PBQA 4R73A 3UP9A 4TLLB 1JVXA 1MY1A 2O6AA 4QFKA 4YB5A 3SETA 2ABHA 3D4GA 4R6YA 1JEVA 1DTZA 3K1MA 4OWDA 5I57A 1EZ9A 4LA9A 1MM7A 1LCTA 3EQ1A 2AL5A 3LC8A 3A09A 2H9BA 1M5EA 1VFEA 1UQWA 1D9VA 3MPLA 5I59A 2D21A 1Y4TA 5DVFA 3MUQA 3OMBA 1UTHA 1GVCA 4RYAA 1N3WA 1LSTA 3BFTA 4RY1A 2FNCA 1SQYA 3TDJA 4HTGA 1JVYA 3SEUA 3QUJA 1TFDA 2XXIA 3TKDA 1VSOA 1MM6A 4H0WA 1B1HA 1JEUA 1IQ7A 1Q1KA 5TPAB 3M8UA 2QJEA 2QMXA 3OEMA 1MY2A 3PUXE 4FE8A 4F1UA 4R9FA 4U1OA 2NUVA 4ELRA 4GIZA 1RYOA 5DEXB 1NH8A 4X1BA 1RKMA 5DVIA 3K1PA 4F2QA 4F3PA 2I48A 4BDQA 2VP1A 4LZ8A 3C33A 5JTYA 1BLFA 4F3GA 3VVFA 2CZLA 3Q28A 3IJXB 1DPPA 4H1XA 2H4IA 1NMUA 3H03A 1PBPA 1MXYA 4ZE8A 3KJTA 3KZGA 2Z8EA 4MBPA 3K6UA 4OERA 3M3FA 4UA8A 1QUJA 3MVWA 5FTIA 3FVOA 1Y1ZA 5CMBA 4LQ5A 1RYXA 4P0IA 4OESA 4THIA 5L9MA 4QSEA 2VHAA 3MP8A 5CBSA 4I62A 1SW4A 4LONB 4U4SA 3FASA 2UYFA 3CRBA 4FEBA 3IOUA 4BLAA 1P1QA 3RNNA 4ESXA 2V3UA 2ONKE 1USYH 3KOSA 5ICQA 1IZ1A 4YMAA 1URSA 1I6AA 4O3CA 1S50A 1FTLA 3QAXA 3PGFA 1OLCA 4RPNA 4X48A 4OTEA 3DELB 2H5YA 5F1QA 3KN8A 3BKIB 3O97A 4RXLA 5DT6A 3T9XB 5CMCA 4PFTA 4YICA 2DXYA 2RKMA 4HW8A 2DWJA 1NFTA 3TQWA 3G3FA 2PVUA 2DE4A 2XX7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZNU A;  1CE2 A;  2Y7W A;  4KPT A;  2DVZ A;  4Q8R A;  4YKP A;  1FQD A;  3OXN A;  1TWY A;  3RTF B;  4OEV A;  2VD2 A;  4KI0 E;  1N76 A;  2O7U A;  3K00 A;  5EYF A;  3MP6 A;  3MC2 A;  4ZDM A;  1QVS A;  1IXG A;  2ESN A;  4FED A;  2HQ0 A;  1MXV A;  1NKX A;  4F1Y A;  1B3E A;  1PC3 A;  3OO7 A;  1SDX A;  2F78 A;  1B0L A;  4Q0C A;  3RGY A;  1H3D A;  3A3C A;  3EHS A;  3SEW A;  1OMP A;  5ITO A;  1WDN A;  4LZ5 A;  2F7C A;  2ANJ A;  2XHD A;  4ZEI A;  4H6D A;  5IKB A;  3TMG A;  4GFR A;  1QUL A;  5AA4 B;  4PFW A;  2DWH A;  4C0R A;  4ZEK A;  3TEP A;  5DTB A;  3OO9 A;  4GXA A;  1MQI A;  4JDF A;  4POW A;  5H8F B;  3CG3 A;  4GL0 A;  2F35 A;  4G4P A;  3TZA A;  1B5I A;  1LAG E;  1Z7M E;  4I8C A;  3K2D A;  1O64 A;  3IR1 A;  4ZEF A;  2A5S A;  5I56 A;  3FD3 A;  3B7D A;  4F3S A;  2DYX A;  1MH4 A;  3MZ9 A;  4F2O A;  1OQG A;  4G68 B;  3VVD A;  4MLQ A;  5A5X B;  1FTM A;  1OQH A;  3QYT A;  4OVJ A;  3HN0 A;  4RNS A;  3IK6 B;  1HSJ A;  2RC8 A;  3U92 A;  3MW0 A;  2XXH A;  4NF4 B;  2YPN A;  1OVT A;  2F34 A;  4GLI A;  5H8N B;  2NOO A;  1JNF A;  2F36 A;  4DZ1 A;  2RCB A;  4R75 A;  2Q89 A;  3JZJ A;  1B40 A;  1LAH E;  2UXA A;  1OIB A;  2DXR A;  1JW5 A;  2Y7K A;  3EPE A;  3USD A;  2G93 A;  4N6P A;  4AB5 A;  3MWB A;  2ZYK A;  4ZZE A;  1P1O A;  4GL8 A;  3GXA A;  3PPR A;  3KOT A;  3TEL A;  4I1D A;  5IAI A;  2Y84 A;  3T96 B;  4OFO A;  4GVO A;  1SW1 A;  4NF4 A;  3N26 A;  2HEU A;  1ZBM A;  1B52 A;  4H8I A;  4ZZA A;  3OEK A;  1R9L A;  2Y7I A;  3RTW B;  3R7X A;  4QF9 A;  2HCA A;  4UAC A;  3I6V A;  1FQC A;  1B9J A;  3PMV A;  1A8F A;  2V84 A;  1MY4 A;  1S9T A;  1OLA A;  1USY E;  3PPQ A;  4R72 A;  5FHM A;  3IJO B;  1GTK A;  3MZB A;  4YAH X;  2QS4 A;  3TCH A;  3UA8 A;  3RQT A;  3FUZ A;  1XC1 A;  4Z7E A;  1N0T A;  4DCY A;  4PET A;  2D3I A;  4U22 A;  3PUV E;  3SEY A;  4FJP A;  2ZYM A;  3VDF A;  5ISU A;  4G8M A;  1B4Z A;  1MQH A;  4LAT A;  4MFI A;  4GRK A;  4QFP A;  5I59 B;  2FYI A;  3G3G A;  4QFO A;  1A54 A;  1ZMG A;  1UTH B;  1FQE A;  4RPO A;  2E0S A;  3CSG A;  4IY6 A;  4H65 A;  1R1N A;  4LUB A;  1IIT A;  1AMF A;  1HSL A;  1PB8 A;  5CMK A;  2B65 A;  4F18 A;  2DE3 A;  1SVX B;  3H6T A;  4KR5 A;  3SEV A;  4YKK A;  4FIM A;  4YKJ A;  3OOA A;  4OZ9 A;  2UVJ A;  1URD A;  4OYV A;  5CMM A;  1R9Q A;  2B3F A;  5ELV A;  4ESW A;  4K3F A;  4C1U A;  1YCJ A;  1QW0 A;  4EUO A;  3MAM A;  5JTY B;  2RC7 A;  3PD8 A;  4Q30 B;  3IB2 A;  4M4G A;  4R74 A;  1TT1 A;  2UVH A;  2FA7 A;  3EF7 A;  3VVE A;  1LAF E;  2NVU B;  1MY0 A;  4H67 A;  3QXM A;  3K0V A;  1MH3 A;  2RIN A;  1ZLQ A;  5CI5 A;  3KJ7 A;  5HPQ A;  2DSF A;  1I69 A;  5TP9 A;  4KHZ E;  3B6Q A;  4BDM A;  5BWJ A;  3S9E A;  2O84 X;  3G3I A;  2Z22 A;  5FHO A;  1SI0 A;  2ZMB A;  3LSX A;  5J1D A;  2OLB A;  1Y3N A;  3V8X B;  2B3B A;  2Q8J A;  1FQF A;  4X1D A;  3H06 B;  4GF8 A;  2D5W A;  3PMW A;  4GOT A;  1SW2 A;  3C31 A;  2BJJ X;  1XT8 A;  3EHT A;  3T66 A;  2I0C A;  1B7H A;  2F6G A;  4OHN A;  3V83 A;  1B1X A;  1M5D A;  1DPE A;  2YLN A;  1JW4 A;  4DDD A;  1XS5 A;  2Z8D A;  1LAX A;  5H8H A;  2NWJ A;  4ZEC A;  2XXY A;  2RCA A;  4U1Z A;  4IO4 A;  1B46 A;  4QSD A;  1A7L A;  3PUW E;  1NNT A;  4U2R A;  4DXB A;  3OO6 A;  3I5O A;  2P2A A;  2I49 A;  2R6G E;  2XXR A;  4NF5 A;  1B0H A;  1B3H A;  3G7W A;  3IL1 B;  4IY5 A;  4NWD A;  4OFJ A;  2Q9T A;  4EQ9 A;  1POT A;  4ECF A;  1FCK A;  3Q27 A;  1A8E A;  3EN3 A;  3IO4 A;  3UK4 A;  2XXQ A;  1N7X A;  4XKP A;  4RJZ A;  3B6T A;  2DP8 A;  3ILT B;  3MZ1 A;  4QSC A;  1NNF A;  1M5F A;  3FXR A;  4R2B A;  1P1N A;  4OET A;  2O7I A;  1LLS A;  3VV5 A;  3IOR A;  1QKB A;  4U21 A;  1NL5 A;  4XKR A;  3IAZ A;  2I0B A;  3IO6 A;  4HS7 A;  1QJM A;  3OO8 A;  1EZO A;  4ND9 A;  5KDT B;  4F22 A;  5AA2 D;  2GHB A;  2F8D A;  1ANF A;  3OSQ A;  1T0K A;  2DQV A;  3R26 A;  1Y4C A;  2REG A;  3GLB A;  3FJG A;  1XVY A;  4FEC A;  5K2X A;  3CFZ A;  4MH5 A;  2I6E A;  3L6G A;  4ELP A;  1GV8 A;  5LOM A;  2ONR A;  3Q26 A;  3RT8 A;  2XD3 A;  3E13 X;  2GFE A;  2QMW A;  1LB9 A;  3RY3 A;  1EH3 A;  1MXZ A;  1S7Y A;  4JXI A;  3VFJ A;  3H6U A;  3K01 A;  5B7D A;  4O3A A;  2P1S A;  4NF8 A;  2DE2 A;  2DWA A;  5KDT A;  5F7V A;  1JQF A;  1ZIU A;  2GHA A;  3CIJ A;  4Q5T A;  5CC2 A;  3HV1 A;  1BKA A;  4EQ7 A;  1BP5 A;  1ATG A;  4RK9 A;  2DWI A;  4XKQ A;  3LSL A;  4JSD A;  5CRY A;  5I56 B;  1HSE A;  5AA3 A;  1US4 A;  5HBC A;  4HCW A;  3CVG A;  2ZNS A;  4F19 A;  1PDA A;  1L5T A;  3O66 A;  3WAE A;  2XX8 A;  3ILU B;  1A40 A;  1B3F A;  2XX9 A;  1D9Y A;  1O63 A;  2VOZ A;  4YMB A;  4M1V A;  3T22 A;  3FGS A;  1B32 A;  2XXP A;  3TUS A;  2UVI A;  1MQJ A;  1D3K A;  1NH7 A;  3QSL A;  5JK4 A;  1US5 A;  3K1N A;  4ISU A;  1AH5 A;  4GD5 A;  2AL4 A;  4YB6 A;  4AB6 A;  1SW5 A;  4ELQ A;  4F39 A;  3CFL A;  1B2H A;  4DIG A;  2X7P A;  5CBR A;  2W7Y A;  1B5H A;  3K6V A;  1XOC A;  3W15 C;  2HAU A;  5I58 B;  3VXC A;  3V5A A;  2GH9 A;  5EHS A;  4I9D A;  1B6H A;  1UIV A;  4YZZ A;  2ZXT A;  4PFU A;  3C9H A;  2UYE A;  2VGQ A;  4G68 C;  3SKP A;  1AIV A;  2ONS A;  3KSJ A;  3MVY A;  4WED A;  4KFQ A;  4TQU Q;  4PP0 A;  3UN6 A;  3LR1 A;  1Y3P A;  4LQ2 A;  2PMS A;  3CG1 A;  2X7Q A;  3MBP A;  1MRP A;  1MPC A;  1B5J A;  4RA1 A;  2V93 A;  1DOT A;  4TOZ A;  4IB2 A;  3H6W A;  3EHU A;  1BTJ A;  1LFG A;  1PB9 A;  1YPN A;  1QUK A;  3E4R A;  3HHF A;  3LSF B;  5I58 A;  3RUM A;  2O68 A;  2PBW A;  3L6H A;  3C35 A;  4JWX A;  1NNK A;  2YJP A;  4IO5 A;  1FW0 A;  4XIG Q;  1EZP A;  3ZKK A;  3R6U A;  3FIR A;  5M2V A;  3T9H B;  3PPO A;  1MQD A;  2A5T B;  1F9B A;  2QS2 A;  4DLD A;  2QPQ A;  3HO7 A;  4LP2 B;  4POX A;  4C1T A;  4G2Z A;  3K4U A;  4NWC A;  2REJ A;  4JSO A;  5CM6 A;  4IGR A;  4QFN A;  3LUY A;  1JET A;  4ELO A;  1URG A;  3H3G A;  2RC9 A;  1LBB A;  5AA2 A;  3ZSF A;  1DTG A;  1SBP A;  3KN3 A;  2XXT A;  5H8Q A;  1ZJL A;  4JWO A;  4KQP A;  3TAJ A;  2ALU A;  4KYS A;  3OD7 A;  3LSW A;  2XXX A;  5KZT A;  4P0G A;  3K6X A;  4NE4 A;  3T9V A;  1R6Z A;  3JV9 A;  3UOR A;  1OVB A;  1FQB A;  2A5T A;  5TU0 A;  4GWO A;  3H4Z A;  1B7U A;  3KSX A;  4JB7 A;  3RPW A;  4BDN A;  1H43 A;  3Q25 A;  3GBA A;  1B05 A;  4OEU A;  3G3K A;  1FQA A;  4EF1 A;  3QIM A;  3SER A;  2QRY A;  1TXF A;  3GBB A;  3QUF A;  5B70 A;  1CB6 A;  3HCQ A;  1M5B A;  1FTO A;  3TOD A;  1MQG A;  4WEP A;  3O2A A;  3DP4 A;  1ZKB A;  4PE5 B;  2M8C A;  1QUI A;  1VR5 A;  1WVJ A;  2Q2A A;  1J1N A;  3BFU A;  1SI1 A;  1MPD A;  2I4C A;  4OMB A;  5TP9 B;  5I2N B;  3E9X A;  2HZK A;  2NXO A;  2H99 A;  1LGB C;  2OWS A;  2I4B A;  3FAT A;  4NF6 A;  3MPK A;  3PUY E;  3W9W A;  1PEB A;  4IO2 A;  4XKN A;  2Q2C A;  4RK2 A;  3MP1 A;  4ZS9 A;  5L9S A;  3H6V A;  4AQ4 A;  1B4H A;  3S4U A;  3OEN A;  4YU0 A;  3RN8 A;  1H45 A;  3FV1 A;  2HZL A;  4ZE9 A;  4TLM B;  4DXC A;  3D4C A;  3FJM A;  4BDR A;  1B51 A;  3KFM A;  4R6K A;  4FOR A;  1SD3 A;  4EDP A;  3S9N C;  4PFY A;  5H8H B;  3B6W A;  3VXB A;  2ZYO A;  2OWT A;  3U72 A;  2HFB A;  3FVN A;  2KLF A;  3DP6 A;  4KCD A;  4XXU A;  2OBG A;  5L9O A;  3TTN A;  3UGW A;  5I2N A;  3TCF A;  4H8J A;  1P1U A;  1H76 A;  4G8H A;  4NF5 B;  3E3K A;  1POY 1;  2Y7P A;  3BBR A;  5AA1 A;  4G8N A;  1UTB B;  2AYS A;  3G3H A;  1B3L A;  5ICT A;  1MDQ A;  2V3T A;  1KWH A;  5KCJ B;  3PD9 A;  1Y1M A;  4OEN A;  4JBZ A;  2F7B A;  1N7W A;  2QL3 A;  4KD5 A;  3H7M A;  4IO3 A;  1EU8 A;  2P0S A;  4FAT A;  3HST A;  3G3J A;  4QFL A;  3PU5 A;  3C34 A;  5AE4 A;  3PMX A;  3N5L A;  3MVX A;  1MS7 A;  1PB7 A;  3KG2 A;  3U94 A;  4F29 A;  5TPA A;  1O7T A;  3CSB A;  1H44 A;  4BDL A;  3N6T A;  5ITP A;  1M5C A;  1ELJ A;  1UTB A;  4NTL A;  3T9U A;  5HM4 B;  1MXW A;  4GXS B;  1FTJ A;  4IGT A;  3SES A;  5DEX A;  2Z23 A;  3HPI A;  2UVG A;  1B7Z A;  5KCJ A;  4P11 A;  2DVC A;  3TYH A;  4ONY A;  1MG1 A;  3MJN A;  4NED A;  3A3U A;  3LBS A;  2XXU A;  1SYH A;  2PYY A;  1AOV A;  2VD3 A;  4E0W A;  1ZTY A;  2F6P A;  3TCG A;  5EHM A;  3THI A;  3ECR A;  3IOW A;  4H5G A;  4YKI A;  3DM0 A;  1B3G A;  2F7A A;  5I2K B;  2E1S A;  3RT6 B;  3WAF A;  2THI A;  1B58 A;  3SDF A;  4NF8 B;  2O1L A;  3TTL A;  4EXK A;  2Y7R A;  4X9T A;  3W9V A;  2R71 A;  2O69 A;  3K02 A;  1YAE A;  1MXU A;  3O6H A;  3TQL A;  2XD2 A;  1TFA A;  1GR2 A;  3IOV A;  2I3W A;  4EF2 A;  3GZG A;  3CR9 A;  3C4M A;  5DYH A;  2ZNT A;  1AL3 A;  4F31 B;  4NMY A;  2I58 A;  3S9M C;  4HCY A;  3TTM A;  4GQO A;  1FTK A;  2HXW A;  2X26 A;  1XHY A;  5I2K A;  2WKY A;  3KN7 A;  2QS3 A;  1QKA A;  3VLV A;  3CI8 A;  3T93 B;  3ONM A;  4L17 A;  4LZ7 A;  3O9P A;  2QS1 A;  4XTC Q;  3M3K A;  2OZZ A;  2H98 A;  1VE4 A;  5FTH A;  3VLU A;  1MPB A;  1DMB A;  2V25 A;  2PT1 A;  3HHG A;  3PV0 E;  1N04 A;  1IXC A;  3PPN A;  4PQJ A;  1IXI A;  2O51 A;  4DCX A;  3C36 A;  4E0X A;  2RF1 A;  3TTK A;  4N13 A;  1LB8 A;  3U1O A;  1IEJ A;  3UIF A;  2GRV A;  3MQ9 A;  1A99 A;  3N94 A;  4DXU A;  4KCC A;  4MF3 A;  1Q35 A;  1N84 A;  3K6W A;  4LVQ A;  3VE1 B;  2F97 A;  3QK6 A;  4H5F A;  4OXV A;  2R9J A;  3TFL A;  3O29 A;  4R6H A;  2LAO A;  1JW1 A;  1BIY A;  3O6I A;  3DP8 A;  3U93 A;  4WKM A;  3ZS6 A;  1SYI A;  3S9L C;  3FJ7 A;  2G29 A;  4BDO A;  3FVK A;  2DOJ A;  3I3V A;  1MXX A;  2Q88 A;  4JWY A;  4MLV A;  2IA4 A;  1D4N A;  3TTR A;  2V3Q A;  2OCU A;  3ODB A;  3C32 A;  1LBC A;  2AIX A;  3FXU A;  1Y20 A;  4IO6 A;  4U23 A;  1P99 A;  3O28 A;  2HAV A;  5AA4 A;  1IXH A;  1YTV A;  4R9G A;  5BUU A;  2XXV A;  2I3V A;  3PUZ E;  5H8F A;  4OQO A;  5H8S A;  4G77 A;  2O1M A;  3FZV A;  1LCF A;  3N6U A;  3P7I A;  5AA2 B;  2DS9 A;  3FXQ A;  1WOD A;  1LFH A;  3O6G A;  5H8Q B;  2OJT A;  3KBR A;  1GGG A;  4WXJ A;  3F11 A;  4F3B A;  1A55 A;  2H25 A;  2ZYN A;  5DVJ A;  3FV2 A;  3TPA A;  2F5X A;  4G68 A;  3IB0 A;  3RLF E;  5A5X A;  3AXF A;  4QHQ A;  2PX1 A;  3M3L A;  4QRZ A;  1IIW A;  4N07 A;  5I84 A;  4O3B A;  1MDP 1;  4DE8 A;  1NNP A;  1VFD A;  4R2F A;  2QSX A;  5JEI A;  1P1W A;  5H8N A;  4ZEB A;  3IB1 A;  3KGC A;  3U8Q A;  1LFI A;  3ZKL A;  3OSR A;  1MY3 A;  3IX1 A;  4KYD A;  3DLN A;  1UIU A;  2PT2 A;  4EQB A;  3PPP A;  1I6B A;  5L8D A;  3IOT A;  1Z7N E;  3Q29 A;  3VLW A;  4F1V A;  1XVX A;  1II5 A;  5FHN A;  3CFX A;  4NF6 B;  3KEI A;  1Y3Q A;  4Z0I A;  2OK2 A;  1Y9U A;  3JYR A;  4KYE A;  1IUD A;  5I57 B;  3SEX A;  2CMO A;  3S2V A;  5K2Y A;  3FVG A;  2XXW A;  1I6Q A;  3MVZ A;  1N3X A;  2Z8F A;  1ZU0 A;  4IO7 A;  4FAJ A;  1DSN A;  4OFL A;  4EXL A;  3V89 B;  4YB7 A;  4ZED A;  4U4X A;  2IEE A;  3OEL A;  1PBQ A;  4R73 A;  3UP9 A;  4TLL B;  1JVX A;  1MY1 A;  2O6A A;  4QFK A;  4YB5 A;  3SET A;  2ABH A;  3D4G A;  4R6Y A;  1JEV A;  1DTZ A;  3K1M A;  4OWD A;  5I57 A;  1EZ9 A;  4LA9 A;  1MM7 A;  1LCT A;  3EQ1 A;  2AL5 A;  3LC8 A;  3A09 A;  2H9B A;  1M5E A;  1VFE A;  1UQW A;  1D9V A;  3MPL A;  5I59 A;  2D21 A;  1Y4T A;  5DVF A;  3MUQ A;  3OMB A;  1UTH A;  1GVC A;  4RYA A;  1N3W A;  1LST A;  3BFT A;  4RY1 A;  2FNC A;  1SQY A;  3TDJ A;  4HTG A;  1JVY A;  3SEU A;  3QUJ A;  1TFD A;  2XXI A;  3TKD A;  1VSO A;  1MM6 A;  4H0W A;  1B1H A;  1JEU A;  1IQ7 A;  1Q1K A;  5TPA B;  3M8U A;  2QJE A;  2QMX A;  3OEM A;  1MY2 A;  3PUX E;  4FE8 A;  4F1U A;  4R9F A;  4U1O A;  2NUV A;  4ELR A;  4GIZ A;  1RYO A;  5DEX B;  1NH8 A;  4X1B A;  1RKM A;  5DVI A;  3K1P A;  4F2Q A;  4F3P A;  2I48 A;  4BDQ A;  2VP1 A;  4LZ8 A;  3C33 A;  5JTY A;  1BLF A;  4F3G A;  3VVF A;  2CZL A;  3Q28 A;  3IJX B;  1DPP A;  4H1X A;  2H4I A;  1NMU A;  3H03 A;  1PBP A;  1MXY A;  4ZE8 A;  3KJT A;  3KZG A;  2Z8E A;  4MBP A;  3K6U A;  4OER A;  3M3F A;  4UA8 A;  1QUJ A;  3MVW A;  5FTI A;  3FVO A;  1Y1Z A;  5CMB A;  4LQ5 A;  1RYX A;  4P0I A;  4OES A;  4THI A;  5L9M A;  4QSE A;  2VHA A;  3MP8 A;  5CBS A;  4I62 A;  1SW4 A;  4LON B;  4U4S A;  3FAS A;  2UYF A;  3CRB A;  4FEB A;  3IOU A;  4BLA A;  1P1Q A;  3RNN A;  4ESX A;  2V3U A;  2ONK E;  1USY H;  3KOS A;  5ICQ A;  1IZ1 A;  4YMA A;  1URS A;  1I6A A;  4O3C A;  1S50 A;  1FTL A;  3QAX A;  3PGF A;  1OLC A;  4RPN A;  4X48 A;  4OTE A;  3DEL B;  2H5Y A;  5F1Q A;  3KN8 A;  3BKI B;  3O97 A;  4RXL A;  5DT6 A;  3T9X B;  5CMC A;  4PFT A;  4YIC A;  2DXY A;  2RKM A;  4HW8 A;  2DWJ A;  1NFT A;  3TQW A;  3G3F A;  2PVU A;  2DE4 A;  2XX7 A; 
#chains in the Genus database with same CATH topology
 2ZNU A;  4P1E A;  1DCU A;  1CE2 A;  2Y7W A;  4KPT A;  2DVZ A;  4Q8R A;  4YKP A;  1FQD A;  3OXN A;  1TWY A;  3RTF B;  4OEV A;  2VD2 A;  4KI0 E;  1N76 A;  2O7U A;  3K00 A;  5EYF A;  3MP6 A;  3MC2 A;  5IZZ A;  4ZDM A;  1QVS A;  1IXG A;  2ESN A;  4FED A;  2HQ0 A;  1MXV A;  1NKX A;  4F1Y A;  1B3E A;  1LBW A;  1PC3 A;  3OO7 A;  1SDX A;  2F78 A;  2XWK A;  1B0L A;  4Q0C A;  3RGY A;  1H3D A;  3A3C A;  4H46 A;  3EHS A;  4HE2 A;  3SEW A;  1OMP A;  5ITO A;  1WDN A;  4PFR A;  4LZ5 A;  2F7C A;  2ANJ A;  2XHD A;  4ZEI A;  4H6D A;  4GBW A;  5IKB A;  4N8Y A;  3QMF A;  3TMG A;  2KQZ A;  4GFR A;  1QUL A;  2XWO A;  5AA4 B;  2QFL A;  4PFW A;  2DWH A;  4C0R A;  4ZEK A;  3TEP A;  5DTB A;  2XWV A;  3OO9 A;  4GXA A;  1MQI A;  4JVD A;  4JDF A;  4POW A;  5H8F B;  3CG3 A;  4GL0 A;  4N6K A;  2F35 A;  4G4P A;  3TZA A;  1B5I A;  1LAG E;  1Z7M E;  4I8C A;  2ZZV A;  3K2D A;  1O64 A;  3IR1 A;  4ZEF A;  2A5S A;  5I56 A;  5EQA A;  3FD3 A;  3B7D A;  4F3S A;  5ET8 A;  2DYX A;  4GX4 A;  1MH4 A;  3MZ9 A;  4F2O A;  4DI3 D;  1OQG A;  4G68 B;  3VVD A;  4H45 A;  4MLQ A;  5A5X B;  1FTM A;  3D1R A;  2WX9 A;  1OQH A;  3QYT A;  4OVJ A;  4RNS A;  3HN0 A;  3LUZ A;  1FPJ A;  3IK6 B;  5IZ3 B;  1HSJ A;  2RC8 A;  3U92 A;  4OVQ A;  3BIH A;  3MW0 A;  2XXH A;  4NF4 B;  2YPN A;  2F3B A;  1OVT A;  2F34 A;  4GLI A;  5H8N B;  2NOO A;  1NV6 A;  2MKZ A;  1JNF A;  2F36 A;  4DZ1 A;  2RCB A;  4R75 A;  2Q89 A;  3JZJ A;  1B40 A;  1LAH E;  2UXA A;  1OIB A;  2DXR A;  1JW5 A;  2Y7K A;  3EPE A;  3USD A;  4PAI A;  2G93 A;  4N6P A;  4AB5 A;  2R8T A;  3MWB A;  2ZYK A;  4ZZE A;  1P1O A;  4GL8 A;  3GXA A;  3PPR A;  4P3L A;  5F24 A;  4NG7 A;  3KOT A;  3TEL A;  4I1D A;  5IAI A;  1FBE A;  2Y84 A;  3T96 B;  4OFO A;  4GVO A;  1SW1 A;  4NF4 A;  3N26 A;  2HEU A;  1ZBM A;  1B52 A;  4H8I A;  4I3Y A;  4ZZA A;  3OEK A;  3T1B A;  1R9L A;  2Y7I A;  3RTW B;  3R7X A;  4QF9 A;  2HCA A;  4UAC A;  3I6V A;  1FQC A;  1B9J A;  3PMV A;  1A8F A;  2V84 A;  1MY4 A;  1S9T A;  1OLA A;  1USY E;  4MAG A;  3E78 A;  3PPQ A;  4R72 A;  1D9Q A;  5FHM A;  3IJO B;  1GTK A;  3MZB A;  4YAH X;  2QS4 A;  3TCH A;  3UA8 A;  3RQT A;  3FUZ A;  1XC1 A;  4Z7E A;  1N0T A;  4DCY A;  4OVS A;  4PET A;  2D3I A;  4U22 A;  3PUV E;  3SEY A;  4FJP A;  2ZYM A;  3VDF A;  5ISU A;  4G8M A;  1B4Z A;  1MQH A;  2Y5K A;  1FBH A;  4LAT A;  4MFI A;  4GRK A;  4GX6 A;  4QFP A;  5I59 B;  4AS5 A;  2FYI A;  3G3G A;  4QFO A;  1A54 A;  1ZMG A;  1UTH B;  4GBV A;  1FQE A;  4NQ8 A;  4RPO A;  2E0S A;  3CSG A;  4IY6 A;  2WEF A;  4H65 A;  1R1N A;  4LUB A;  1IIT A;  1AMF A;  1HSL A;  1PB8 A;  5CMK A;  2B65 A;  4F18 A;  2DE3 A;  1SVX B;  3H6T A;  4PCD A;  4KR5 A;  3SEV A;  4YKK A;  2XXK A;  4FIM A;  4YKJ A;  1FPB A;  3ROJ A;  2VPO A;  3OOA A;  4OZ9 A;  2UVJ A;  1URD A;  4OYV A;  5CMM A;  1R9Q A;  2B3F A;  5ELV A;  4ESW A;  4K3F A;  4C1U A;  1YCJ A;  1QW0 A;  4EUO A;  3MAM A;  5JTY B;  5ESY A;  2RC7 A;  3PD8 A;  4Q30 B;  3IB2 A;  4M4G A;  4R74 A;  1TT1 A;  2UVH A;  2FA7 A;  4PGP A;  1IMB A;  1NUX A;  3EF7 A;  3VVE A;  1K9Z A;  1LAF E;  2NVU B;  4O7M A;  1MY0 A;  4H67 A;  3QXM A;  3K0V A;  1MH3 A;  2RIN A;  1ZLQ A;  5CI5 A;  3KJ7 A;  5EQ8 A;  5HPQ A;  2DSF A;  1I69 A;  5TP9 A;  4KHZ E;  1G0H A;  3B6Q A;  4BDM A;  5BWJ A;  3S9E A;  2O84 X;  3G3I A;  2Z22 A;  5FHO A;  1SI0 A;  2ZMB A;  3LSX A;  5J1D A;  1FRP A;  2OLB A;  1Y3N A;  3V8X B;  2B3B A;  2Q8J A;  1FQF A;  4X1D A;  3H06 B;  4GF8 A;  2D5W A;  3PMW A;  2GQ1 A;  4GOT A;  1SW2 A;  4I40 A;  3C31 A;  2BJJ X;  1XT8 A;  3EHT A;  3T66 A;  4O8M A;  2I0C A;  1B7H A;  2F6G A;  4OHN A;  4P8B A;  3V83 A;  1B1X A;  1M5D A;  1DPE A;  2YLN A;  5EQ7 A;  1JW4 A;  4DDD A;  1YXI A;  1XS5 A;  2Z8D A;  1LAX A;  5H8H A;  2NWJ A;  4ZEC A;  2XXY A;  2RCA A;  4U1Z A;  4IO4 A;  1B46 A;  4QSD A;  1A7L A;  3PUW E;  1NNT A;  4U2R A;  4DXB A;  1DK4 A;  3OO6 A;  3I5O A;  2P2A A;  2I49 A;  2R6G E;  2XXR A;  4NF5 A;  1B0H A;  1B3H A;  3G7W A;  1FJ9 A;  2DDK A;  2WYP A;  3IL1 B;  4IY5 A;  4NWD A;  4OFJ A;  2Q9T A;  4EQ9 A;  1POT A;  1FPG A;  4ECF A;  1FCK A;  3Q27 A;  1A8E A;  4DI4 B;  3EN3 A;  3IO4 A;  3UK4 A;  4N6D A;  2XXQ A;  1N7X A;  4XKP A;  5DW8 A;  4PE3 A;  4RJZ A;  3B6T A;  2DP8 A;  3ILT B;  1Q9D A;  3MZ1 A;  4QSC A;  1NNF A;  1M5F A;  4N15 A;  3FXR A;  4R2B A;  4JVI A;  1P1N A;  4FBP A;  4OET A;  3MYU A;  2O7I A;  5ET7 A;  1LLS A;  3VV5 A;  3IOR A;  1QKB A;  4U21 A;  1NL5 A;  4XKR A;  1NV2 A;  3IAZ A;  2I0B A;  2JJK A;  3IO6 A;  4HS7 A;  1QJM A;  3OO8 A;  1EZO A;  4ND9 A;  5KDT B;  4F22 A;  5AA2 D;  2GHB A;  2F8D A;  4GWU A;  1ANF A;  3OSQ A;  1T0K A;  2DQV A;  3SZP A;  3R26 A;  1NV3 A;  1Y4C A;  2REG A;  3GLB A;  3FJG A;  1RDZ A;  1XVY A;  2BJI A;  4FEC A;  5K2X A;  3B50 A;  3CFZ A;  4MH5 A;  2I6E A;  3L6G A;  3U65 A;  4ELP A;  1FBF A;  1GV8 A;  5LOM A;  2ONR A;  3Q26 A;  3RT8 A;  2XD3 A;  3E13 X;  2GFE A;  1SPI A;  2QMW A;  1LB9 A;  3RY3 A;  1EH3 A;  1MXZ A;  1S7Y A;  4JXI A;  3VFJ A;  1FSA A;  3H6U A;  3K01 A;  2Y5L A;  5B7D A;  4O3A A;  2P1S A;  4NF8 A;  2DE2 A;  2DWA A;  5KDT A;  5F7V A;  1JQF A;  1ZIU A;  2GHA A;  3CIJ A;  3EKI A;  4Q5T A;  1YZ0 A;  5CC2 A;  3HV1 A;  1BKA A;  4EQ7 A;  1BP5 A;  1ATG A;  4RK9 A;  2DWI A;  4XKQ A;  3LSL A;  4JSD A;  5CRY A;  5I56 B;  3RYD A;  1HSE A;  5AA3 A;  1US4 A;  5HBC A;  4HCW A;  3CVG A;  2ZNS A;  4F19 A;  1NUW A;  1PDA A;  1L5T A;  3O66 A;  3WAE A;  2XX8 A;  3ILU B;  3ISP A;  1A40 A;  1B3F A;  2QVU A;  2XX9 A;  2CZI A;  1D9Y A;  1O63 A;  2VOZ A;  4YMB A;  4M1V A;  3T22 A;  3FGS A;  1B32 A;  2XXP A;  3TUS A;  2UVI A;  1MQJ A;  1D3K A;  1NH7 A;  3QSL A;  5JK4 A;  5EYG A;  1RDY A;  1US5 A;  3K1N A;  4ISU A;  1AH5 A;  4GD5 A;  2AL4 A;  4YB6 A;  4AB6 A;  1SW5 A;  4ELQ A;  4MEV A;  3RPL B;  4P1L A;  4F39 A;  2VPN A;  3CFL A;  3KBZ A;  1B2H A;  4I3E A;  4DIG A;  2X7P A;  5CBR A;  2W7Y A;  1B5H A;  3K6V A;  1RDX A;  4PC9 A;  2CEY A;  1XOC A;  3W15 C;  2HAU A;  1IMC A;  5I58 B;  3VXC A;  3V5A A;  1NV4 A;  2GH9 A;  5EHS A;  2FHY A;  4I9D A;  1B6H A;  1UIV A;  4YZZ A;  2ZXT A;  4PFU A;  3C9H A;  2UYE A;  2VGQ A;  4O94 A;  4G68 C;  3SKP A;  1AIV A;  2ONS A;  3KSJ A;  3MVY A;  1NI9 A;  4WED A;  4KFQ A;  4TQU Q;  4PP0 A;  3LR1 A;  3UN6 A;  1Y3P A;  4LQ2 A;  2PMS A;  3CG1 A;  2PCR A;  2X7Q A;  3MBP A;  3RPL A;  1LBX A;  1MRP A;  1MPC A;  2XA5 A;  1B5J A;  4RA1 A;  2CZK A;  2V93 A;  1DOT A;  4MJO A;  4TOZ A;  4IB2 A;  3H6W A;  3EHU A;  1BTJ A;  4OVT A;  1LFG A;  1PB9 A;  2PFZ A;  1YPN A;  1QUK A;  4MIJ A;  3E4R A;  4MX6 A;  2ZZX A;  5I3S A;  3HHF A;  3LSF B;  4HXV A;  5I58 A;  3RUM A;  2O68 A;  4N4U A;  2PBW A;  3L6H A;  1FBP A;  3C35 A;  1VDW A;  4JWX A;  1NNK A;  2YJP A;  4IO5 A;  1FW0 A;  4XIG Q;  4P56 A;  1EZP A;  4PFB A;  3ZKK A;  3R6U A;  3FIR A;  5M2V A;  3T9H B;  3PPO A;  3BIG A;  1MQD A;  2A5T B;  1F9B A;  1NUY A;  2QS2 A;  4DLD A;  2QPQ A;  3HO7 A;  4LP2 B;  4POX A;  4P9K A;  4C1T A;  4G2Z A;  3K4U A;  4NWC A;  2REJ A;  4JSO A;  4X8R A;  5CM6 A;  4IGR A;  4QFN A;  3LUY A;  1JET A;  4ELO A;  1URG A;  3H3G A;  2RC9 A;  1LBB A;  5AA2 A;  3ZSF A;  1DTG A;  1SBP A;  4PBQ A;  3KN3 A;  2XXT A;  5H8Q A;  1ZJL A;  4JWO A;  4KQP A;  3TAJ A;  2ALU A;  4KYS A;  5LDZ A;  3OD7 A;  3LSW A;  2XXX A;  2OWZ A;  5KZT A;  3T0J A;  4P0G A;  4NHB A;  3K6X A;  4NE4 A;  3T9V A;  1R6Z A;  3JV9 A;  3UOR A;  1OVB A;  1FQB A;  2A5T A;  5TU0 A;  4GWO A;  3H4Z A;  1B7U A;  3KSX A;  4JB7 A;  3A29 A;  3RPW A;  4BDN A;  1H43 A;  3Q25 A;  3GBA A;  1B05 A;  4OEU A;  3G3K A;  4XF5 A;  1FQA A;  4EF1 A;  4UAB A;  3QIM A;  3SER A;  2QRY A;  1TXF A;  3GBB A;  3QUF A;  5B70 A;  1CB6 A;  3HCQ A;  1M5B A;  1FTO A;  3TOD A;  1MQG A;  4WEP A;  3O2A A;  3DP4 A;  1ZKB A;  4PE5 B;  2M8C A;  3MST A;  1LBV A;  1QUI A;  1VR5 A;  1WVJ A;  2Q2A A;  1J1N A;  4G61 A;  3BFU A;  1SI1 A;  1MPD A;  2I4C A;  4GWW A;  5ET6 A;  4OMB A;  5TP9 B;  5I2N B;  3E9X A;  1FPD A;  2HZK A;  2NXO A;  2H99 A;  1LGB C;  2OWS A;  2I4B A;  3FAT A;  1XI6 A;  4NF6 A;  3MPK A;  3PUY E;  3W9W A;  1PEB A;  4IO2 A;  4XKN A;  2Q2C A;  4RK2 A;  3MP1 A;  4ZS9 A;  5L9S A;  3H6V A;  4AQ4 A;  2QVV A;  1B4H A;  3S4U A;  3OEN A;  4YU0 A;  4N8G A;  3RN8 A;  1H45 A;  3FV1 A;  4N81 A;  2HZL A;  4ZE9 A;  4TLM B;  4DXC A;  3D4C A;  3FJM A;  4BDR A;  1B51 A;  3KFM A;  4R6K A;  4FOR A;  1SD3 A;  4EDP A;  3S9N C;  1FPF A;  4PFY A;  1NV7 A;  5H8H B;  3B6W A;  2V4C A;  2XWI A;  3VXB A;  4IR8 A;  2ZYO A;  2OWT A;  3U72 A;  4OA4 A;  2HFB A;  2P3V A;  3FVN A;  2KLF A;  3DP6 A;  4KCD A;  4XXU A;  2OBG A;  1FTA A;  5L9O A;  1FBD A;  3TTN A;  3UGW A;  5I2N A;  3TCF A;  4H8J A;  1P1U A;  1H76 A;  4G8H A;  4NF5 B;  3E3K A;  1POY 1;  2Y7P A;  3BBR A;  5AA1 A;  4G8N A;  1UTB B;  2AYS A;  3G3H A;  1B3L A;  5ICT A;  1MDQ A;  1EYK A;  2V3T A;  1KWH A;  5KCJ B;  3PD9 A;  4OVP A;  2HHM A;  1Y1M A;  4OEN A;  4JBZ A;  3E79 A;  2F7B A;  4PGN A;  1INP A;  1N7W A;  2QL3 A;  4KD5 A;  3H7M A;  4IO3 A;  1EU8 A;  2P0S A;  1NUZ A;  3GYY A;  4FAT A;  1FPK A;  3HST A;  3G3J A;  4QFL A;  1IMA A;  3PU5 A;  2QVR A;  3C34 A;  5AE4 A;  3PMX A;  3N5L A;  3MVX A;  1MS7 A;  1PB7 A;  3KG2 A;  3U94 A;  4F29 A;  5TPA A;  1O7T A;  3CSB A;  1H44 A;  4BDL A;  3N6T A;  1DBZ A;  5ITP A;  1M5C A;  1ELJ A;  1UTB A;  4NTL A;  2KR0 A;  3T9U A;  5HM4 B;  1MXW A;  4GXS B;  1FTJ A;  4IGT A;  3SES A;  5DEX A;  2Z23 A;  3HPI A;  2UVG A;  1B7Z A;  5KCJ A;  4P11 A;  5I7I A;  2DVC A;  3TYH A;  4ONY A;  1MG1 A;  3MJN A;  4NED A;  1FBC A;  1BK4 A;  2WBD A;  3A3U A;  4MCO A;  3LBS A;  2XXU A;  1SYH A;  1FJ6 A;  2PYY A;  1AOV A;  2VD3 A;  4E0W A;  4NX1 A;  1ZTY A;  2F6P A;  3TCG A;  5EHM A;  3THI A;  3ECR A;  3IOW A;  4H5G A;  4YKI A;  3DM0 A;  3CHG A;  1B3G A;  2F7A A;  5I2K B;  2E1S A;  3RT6 B;  3WAF A;  3IFC A;  2THI A;  1B58 A;  3SDF A;  4X04 A;  4NF8 B;  3HFU A;  4PF6 A;  2O1L A;  3TTL A;  4EXK A;  2Y7R A;  4X9T A;  4MMP A;  3W9V A;  2R71 A;  2O69 A;  3K02 A;  1YAE A;  1MXU A;  3O6H A;  4GWY A;  3TQL A;  2XD2 A;  1TFA A;  1GR2 A;  4LN5 A;  3IOV A;  2I3W A;  4EF2 A;  3GZG A;  3CR9 A;  3C4M A;  5DYH A;  2Q8M A;  2ZNT A;  1AL3 A;  4F31 B;  4KXP A;  2CZH A;  4NMY A;  2I58 A;  3S9M C;  4HCY A;  3TTM A;  4GQO A;  1FTK A;  2FVZ A;  2HXW A;  2X26 A;  1XHY A;  4OVR A;  5I2K A;  2WKY A;  3KN7 A;  2QS3 A;  1QKA A;  3VLV A;  4QBA A;  3CI8 A;  3T93 B;  3ONM A;  4L17 A;  2P3N A;  3O9P A;  4LZ7 A;  2QS1 A;  4XTC Q;  2VT5 A;  3M3K A;  4O7I A;  2OZZ A;  2H98 A;  1VE4 A;  5FTH A;  3VLU A;  1MPB A;  1DMB A;  2V25 A;  2PT1 A;  3HHG A;  3PV0 E;  1N04 A;  1IXC A;  3PPN A;  4PQJ A;  1NV0 A;  1IXI A;  3PTY A;  3KC0 A;  2O51 A;  4DCX A;  2ZZW A;  3C36 A;  4E0X A;  2RF1 A;  3TTK A;  4HE0 A;  4PF8 A;  4N13 A;  2F3D A;  1LB8 A;  3U1O A;  1IEJ A;  3UIF A;  2PFY A;  1G0I A;  3NOH A;  5FBP A;  2GRV A;  3MQ9 A;  1A99 A;  3N94 A;  4DXU A;  4KCC A;  4MF3 A;  1Q35 A;  5IZ1 A;  1N84 A;  3K6W A;  4LVQ A;  3VE1 B;  2F97 A;  3QK6 A;  1KA0 A;  4H5F A;  4OXV A;  2R9J A;  3LV0 A;  3TFL A;  3O29 A;  5IGA A;  4R6H A;  3FBP A;  2LAO A;  1JW1 A;  1BIY A;  3O6I A;  3DP8 A;  3U93 A;  4WKM A;  3ZS6 A;  1SYI A;  1NV5 A;  3S9L C;  3FJ7 A;  2G29 A;  4NGU A;  4BDO A;  3FVK A;  2DOJ A;  3I3V A;  1MXX A;  2Q88 A;  4JWY A;  2WBB A;  4MLV A;  2IA4 A;  1D4N A;  3TTR A;  2V3Q A;  2OCU A;  3ODB A;  3FXB A;  3C32 A;  1LBC A;  2AIX A;  3FXU A;  2HPG A;  1Y20 A;  4IO6 A;  4U23 A;  1P99 A;  3O28 A;  2HAV A;  5AA4 A;  1IXH A;  1YTV A;  1EYJ A;  4R9G A;  5BUU A;  2XXV A;  2FIE A;  2I3V A;  3PUZ E;  5I5P A;  5H8F A;  4OQO A;  5H8S A;  4G77 A;  2O1M A;  4QXD A;  3FZV A;  1LCF A;  1FPE A;  3N6U A;  3P7I A;  5AA2 B;  2DS9 A;  3FXQ A;  1WOD A;  1LFH A;  3O6G A;  1FPI A;  5H8Q B;  2OJT A;  3KBR A;  1GGG A;  2B4M A;  4WXJ A;  4P47 A;  3F11 A;  2HXR A;  4F3B A;  4MNC A;  1A55 A;  2H25 A;  2ZYN A;  5DVJ A;  3FV2 A;  3TPA A;  1LBY A;  2F5X A;  4G68 A;  3IB0 A;  5IM2 A;  3RLF E;  5A5X A;  3AXF A;  4QHQ A;  2PX1 A;  3M3L A;  4QRZ A;  2FBP A;  5IZ3 A;  1IIW A;  4N07 A;  5I84 A;  4O3B A;  4NF0 A;  1MDP 1;  4DE8 A;  1NNP A;  4MNI A;  1VFD A;  4R2F A;  2QSX A;  5JEI A;  1P1W A;  5H8N A;  4ZEB A;  3IB1 A;  3KGC A;  3U8Q A;  4GWS A;  2Q74 A;  1LFI A;  4OAN A;  3ZKL A;  3OSR A;  1LBZ A;  1MY3 A;  3IX1 A;  4KYD A;  3DLN A;  1UIU A;  2PT2 A;  4EQB A;  3PPP A;  1I6B A;  5L8D A;  3IOT A;  1Z7N E;  2WYK A;  3Q29 A;  5LTC A;  3B8B A;  3VLW A;  4F1V A;  1XVX A;  1YYZ A;  1II5 A;  5FHN A;  3CFX A;  4NF6 B;  3KEI A;  5ET5 A;  1Y3Q A;  4Z0I A;  2OK2 A;  1LEV A;  4XFE A;  1Y9U A;  3JYR A;  4KYE A;  1IUD A;  5I57 B;  3SEX A;  2CMO A;  4PDH A;  1KA1 A;  3S2V A;  5K2Y A;  3FVG A;  2XXW A;  1I6Q A;  3MVZ A;  1N3X A;  2Z8F A;  1ZU0 A;  4IO7 A;  4FAJ A;  1DSN A;  4OFL A;  4EXL A;  3V89 B;  4YB7 A;  4ZED A;  4U4X A;  5J16 A;  2IEE A;  3OEL A;  1PBQ A;  4R73 A;  4PBH A;  5EYH A;  4TLL B;  3UP9 A;  1JVX A;  1MY1 A;  2O6A A;  4QFK A;  4YB5 A;  3SET A;  4PFI A;  2ABH A;  1NV1 A;  3D4G A;  4R6Y A;  1JEV A;  1DTZ A;  3K1M A;  4OWD A;  5I57 A;  1EZ9 A;  4LA9 A;  1MM7 A;  1LCT A;  3EQ1 A;  2AL5 A;  3LC8 A;  3A09 A;  2H9B A;  1M5E A;  1VFE A;  1UQW A;  2L5V A;  1D9V A;  3MPL A;  5I59 A;  2D21 A;  1Y4T A;  5DVF A;  3MUQ A;  3OMB A;  1UTH A;  1GVC A;  4RYA A;  1N3W A;  1LST A;  3BFT A;  4RY1 A;  2FNC A;  1SQY A;  3TDJ A;  4NN3 A;  4HTG A;  1JVY A;  3SEU A;  3QUJ A;  2CEX A;  1TFD A;  2XXI A;  3TKD A;  1VSO A;  1MM6 A;  5A5L A;  4H0W A;  1B1H A;  1JEU A;  1IQ7 A;  1Q1K A;  5TPA B;  3M8U A;  2QJE A;  2QMX A;  3OEM A;  4JVC A;  1MY2 A;  3PUX E;  4FE8 A;  4F1U A;  4R9F A;  4U1O A;  2NUV A;  1EYI A;  4ELR A;  4GIZ A;  1IME A;  1RYO A;  5DEX B;  1NH8 A;  4X1B A;  1IMF A;  4PAK A;  1RKM A;  5DVI A;  3K1P A;  4F2Q A;  4F3P A;  2I48 A;  4BDQ A;  2VP1 A;  4LZ8 A;  3C33 A;  5JTY A;  4PDD A;  4GWZ A;  1BLF A;  2FIX A;  4F3G A;  3VVF A;  2CZL A;  3Q28 A;  3IJX B;  1DPP A;  4H1X A;  2H4I A;  1NMU A;  3H03 A;  4HE1 A;  1PBP A;  1MXY A;  4ZE8 A;  3KJT A;  3IFA A;  3KZG A;  2Z8E A;  5EQ9 A;  4MBP A;  2B4L A;  3K6U A;  4OER A;  1K9Y A;  3M3F A;  4UA8 A;  1QUJ A;  1JP4 A;  3MVW A;  5FTI A;  3FVO A;  4PAF A;  1Y1Z A;  3KC1 A;  5CMB A;  1FPL A;  4LQ5 A;  1RYX A;  4N17 A;  4P0I A;  1QGX A;  1FBG A;  4OES A;  1IMD A;  4THI A;  5L9M A;  5T3J A;  4QSE A;  2VHA A;  4GWX A;  4N91 A;  3MP8 A;  5CBS A;  4I62 A;  1SW4 A;  4LON B;  4U4S A;  3FAS A;  2UYF A;  1KZ8 A;  3CRB A;  1AWB A;  4FEB A;  3IOU A;  2OX3 A;  4BLA A;  4GX3 A;  1P1Q A;  3RNN A;  4ESX A;  2V3U A;  2ONK E;  1USY H;  3KOS A;  4PTK A;  5ICQ A;  1IZ1 A;  4YMA A;  1URS A;  1I6A A;  4O3C A;  1S50 A;  1FTL A;  3QAX A;  1CNQ A;  4AS4 A;  3PGF A;  4MHF A;  4NAP A;  1OLC A;  4RPN A;  4X48 A;  4OTE A;  3DEL B;  2H5Y A;  5F1Q A;  3KN8 A;  3BKI B;  3O97 A;  4RXL A;  5DT6 A;  3T9X B;  5CMC A;  4PFT A;  4YIC A;  2DXY A;  2RKM A;  4HW8 A;  2DWJ A;  1NFT A;  3TQW A;  4MNP A;  3G3F A;  4XEQ A;  2PVU A;  2DE4 A;  2XX7 A; 
#chains in the Genus database with same CATH homology
 2ZNU A;  1CE2 A;  2Y7W A;  4KPT A;  2DVZ A;  4Q8R A;  4YKP A;  1FQD A;  3OXN A;  1TWY A;  3RTF B;  4OEV A;  2VD2 A;  4KI0 E;  1N76 A;  2O7U A;  3K00 A;  5EYF A;  3MP6 A;  3MC2 A;  4ZDM A;  1QVS A;  1IXG A;  2ESN A;  4FED A;  2HQ0 A;  1MXV A;  1NKX A;  4F1Y A;  1B3E A;  1PC3 A;  3OO7 A;  1SDX A;  2F78 A;  1B0L A;  4Q0C A;  3RGY A;  1H3D A;  3A3C A;  3EHS A;  3SEW A;  1OMP A;  5ITO A;  1WDN A;  4LZ5 A;  2F7C A;  2ANJ A;  2XHD A;  4ZEI A;  4H6D A;  5IKB A;  3TMG A;  4GFR A;  1QUL A;  5AA4 B;  4PFW A;  2DWH A;  4C0R A;  4ZEK A;  3TEP A;  5DTB A;  3OO9 A;  4GXA A;  1MQI A;  4JDF A;  4POW A;  5H8F B;  3CG3 A;  4GL0 A;  2F35 A;  4G4P A;  3TZA A;  1B5I A;  1LAG E;  1Z7M E;  4I8C A;  3K2D A;  1O64 A;  3IR1 A;  4ZEF A;  2A5S A;  5I56 A;  3FD3 A;  3B7D A;  4F3S A;  2DYX A;  1MH4 A;  3MZ9 A;  4F2O A;  1OQG A;  4G68 B;  3VVD A;  4MLQ A;  5A5X B;  1FTM A;  1OQH A;  3QYT A;  4OVJ A;  3HN0 A;  4RNS A;  3IK6 B;  1HSJ A;  2RC8 A;  3U92 A;  3MW0 A;  2XXH A;  4NF4 B;  2YPN A;  1OVT A;  2F34 A;  4GLI A;  5H8N B;  2NOO A;  1JNF A;  2F36 A;  4DZ1 A;  2RCB A;  4R75 A;  2Q89 A;  3JZJ A;  1B40 A;  1LAH E;  2UXA A;  1OIB A;  2DXR A;  1JW5 A;  2Y7K A;  3EPE A;  3USD A;  2G93 A;  4N6P A;  4AB5 A;  3MWB A;  2ZYK A;  4ZZE A;  1P1O A;  4GL8 A;  3GXA A;  3PPR A;  3KOT A;  3TEL A;  4I1D A;  5IAI A;  2Y84 A;  3T96 B;  4OFO A;  4GVO A;  1SW1 A;  4NF4 A;  3N26 A;  2HEU A;  1ZBM A;  1B52 A;  4H8I A;  4ZZA A;  3OEK A;  1R9L A;  2Y7I A;  3RTW B;  3R7X A;  4QF9 A;  2HCA A;  4UAC A;  3I6V A;  1FQC A;  1B9J A;  3PMV A;  1A8F A;  2V84 A;  1MY4 A;  1S9T A;  1OLA A;  1USY E;  3PPQ A;  4R72 A;  5FHM A;  3IJO B;  1GTK A;  3MZB A;  4YAH X;  2QS4 A;  3TCH A;  3UA8 A;  3RQT A;  3FUZ A;  1XC1 A;  4Z7E A;  1N0T A;  4DCY A;  4PET A;  2D3I A;  4U22 A;  3PUV E;  3SEY A;  4FJP A;  2ZYM A;  3VDF A;  5ISU A;  4G8M A;  1B4Z A;  1MQH A;  4LAT A;  4MFI A;  4GRK A;  4QFP A;  5I59 B;  2FYI A;  3G3G A;  4QFO A;  1A54 A;  1ZMG A;  1UTH B;  1FQE A;  4RPO A;  2E0S A;  3CSG A;  4IY6 A;  4H65 A;  1R1N A;  4LUB A;  1IIT A;  1AMF A;  1HSL A;  1PB8 A;  5CMK A;  2B65 A;  4F18 A;  2DE3 A;  1SVX B;  3H6T A;  4KR5 A;  3SEV A;  4YKK A;  4FIM A;  4YKJ A;  3OOA A;  4OZ9 A;  2UVJ A;  1URD A;  4OYV A;  5CMM A;  1R9Q A;  2B3F A;  5ELV A;  4ESW A;  4K3F A;  4C1U A;  1YCJ A;  1QW0 A;  4EUO A;  3MAM A;  5JTY B;  2RC7 A;  3PD8 A;  4Q30 B;  3IB2 A;  4M4G A;  4R74 A;  1TT1 A;  2UVH A;  2FA7 A;  3EF7 A;  3VVE A;  1LAF E;  2NVU B;  1MY0 A;  4H67 A;  3QXM A;  3K0V A;  1MH3 A;  2RIN A;  1ZLQ A;  5CI5 A;  3KJ7 A;  5HPQ A;  2DSF A;  1I69 A;  5TP9 A;  4KHZ E;  3B6Q A;  4BDM A;  5BWJ A;  3S9E A;  2O84 X;  3G3I A;  2Z22 A;  5FHO A;  1SI0 A;  2ZMB A;  3LSX A;  5J1D A;  2OLB A;  1Y3N A;  3V8X B;  2B3B A;  2Q8J A;  1FQF A;  4X1D A;  3H06 B;  4GF8 A;  2D5W A;  3PMW A;  4GOT A;  1SW2 A;  3C31 A;  2BJJ X;  1XT8 A;  3EHT A;  3T66 A;  2I0C A;  1B7H A;  2F6G A;  4OHN A;  3V83 A;  1B1X A;  1M5D A;  1DPE A;  2YLN A;  1JW4 A;  4DDD A;  1XS5 A;  2Z8D A;  1LAX A;  5H8H A;  2NWJ A;  4ZEC A;  2XXY A;  2RCA A;  4U1Z A;  4IO4 A;  1B46 A;  4QSD A;  1A7L A;  3PUW E;  1NNT A;  4U2R A;  4DXB A;  3OO6 A;  3I5O A;  2P2A A;  2I49 A;  2R6G E;  2XXR A;  4NF5 A;  1B0H A;  1B3H A;  3G7W A;  3IL1 B;  4IY5 A;  4NWD A;  4OFJ A;  2Q9T A;  4EQ9 A;  1POT A;  4ECF A;  1FCK A;  3Q27 A;  1A8E A;  3EN3 A;  3IO4 A;  3UK4 A;  2XXQ A;  1N7X A;  4XKP A;  4RJZ A;  3B6T A;  2DP8 A;  3ILT B;  3MZ1 A;  4QSC A;  1NNF A;  1M5F A;  3FXR A;  4R2B A;  1P1N A;  4OET A;  2O7I A;  1LLS A;  3VV5 A;  3IOR A;  1QKB A;  4U21 A;  1NL5 A;  4XKR A;  3IAZ A;  2I0B A;  3IO6 A;  4HS7 A;  1QJM A;  3OO8 A;  1EZO A;  4ND9 A;  5KDT B;  4F22 A;  5AA2 D;  2GHB A;  2F8D A;  1ANF A;  3OSQ A;  1T0K A;  2DQV A;  3R26 A;  1Y4C A;  2REG A;  3GLB A;  3FJG A;  1XVY A;  4FEC A;  5K2X A;  3CFZ A;  4MH5 A;  2I6E A;  3L6G A;  4ELP A;  1GV8 A;  5LOM A;  2ONR A;  3Q26 A;  3RT8 A;  2XD3 A;  3E13 X;  2GFE A;  2QMW A;  1LB9 A;  3RY3 A;  1EH3 A;  1MXZ A;  1S7Y A;  4JXI A;  3VFJ A;  3H6U A;  3K01 A;  5B7D A;  4O3A A;  2P1S A;  4NF8 A;  2DE2 A;  2DWA A;  5KDT A;  5F7V A;  1JQF A;  1ZIU A;  2GHA A;  3CIJ A;  4Q5T A;  5CC2 A;  3HV1 A;  1BKA A;  4EQ7 A;  1BP5 A;  1ATG A;  4RK9 A;  2DWI A;  4XKQ A;  3LSL A;  4JSD A;  5CRY A;  5I56 B;  1HSE A;  5AA3 A;  1US4 A;  5HBC A;  4HCW A;  3CVG A;  2ZNS A;  4F19 A;  1PDA A;  1L5T A;  3O66 A;  3WAE A;  2XX8 A;  3ILU B;  1A40 A;  1B3F A;  2XX9 A;  1D9Y A;  1O63 A;  2VOZ A;  4YMB A;  4M1V A;  3T22 A;  3FGS A;  1B32 A;  2XXP A;  3TUS A;  2UVI A;  1MQJ A;  1D3K A;  1NH7 A;  3QSL A;  5JK4 A;  1US5 A;  3K1N A;  4ISU A;  1AH5 A;  4GD5 A;  2AL4 A;  4YB6 A;  4AB6 A;  1SW5 A;  4ELQ A;  4F39 A;  3CFL A;  1B2H A;  4DIG A;  2X7P A;  5CBR A;  2W7Y A;  1B5H A;  3K6V A;  1XOC A;  3W15 C;  2HAU A;  5I58 B;  3VXC A;  3V5A A;  2GH9 A;  5EHS A;  4I9D A;  1B6H A;  1UIV A;  4YZZ A;  2ZXT A;  4PFU A;  3C9H A;  2UYE A;  2VGQ A;  4G68 C;  3SKP A;  1AIV A;  2ONS A;  3KSJ A;  3MVY A;  4WED A;  4KFQ A;  4TQU Q;  4PP0 A;  3UN6 A;  3LR1 A;  1Y3P A;  4LQ2 A;  2PMS A;  3CG1 A;  2X7Q A;  3MBP A;  1MRP A;  1MPC A;  1B5J A;  4RA1 A;  2V93 A;  1DOT A;  4TOZ A;  4IB2 A;  3H6W A;  3EHU A;  1BTJ A;  1LFG A;  1PB9 A;  1YPN A;  1QUK A;  3E4R A;  3HHF A;  3LSF B;  5I58 A;  3RUM A;  2O68 A;  2PBW A;  3L6H A;  3C35 A;  4JWX A;  1NNK A;  2YJP A;  4IO5 A;  1FW0 A;  4XIG Q;  1EZP A;  3ZKK A;  3R6U A;  3FIR A;  5M2V A;  3T9H B;  3PPO A;  1MQD A;  2A5T B;  1F9B A;  2QS2 A;  4DLD A;  2QPQ A;  3HO7 A;  4LP2 B;  4POX A;  4C1T A;  4G2Z A;  3K4U A;  4NWC A;  2REJ A;  4JSO A;  5CM6 A;  4IGR A;  4QFN A;  3LUY A;  1JET A;  4ELO A;  1URG A;  3H3G A;  2RC9 A;  1LBB A;  5AA2 A;  3ZSF A;  1DTG A;  1SBP A;  3KN3 A;  2XXT A;  5H8Q A;  1ZJL A;  4JWO A;  4KQP A;  3TAJ A;  2ALU A;  4KYS A;  3OD7 A;  3LSW A;  2XXX A;  5KZT A;  4P0G A;  3K6X A;  4NE4 A;  3T9V A;  1R6Z A;  3JV9 A;  3UOR A;  1OVB A;  1FQB A;  2A5T A;  5TU0 A;  4GWO A;  3H4Z A;  1B7U A;  3KSX A;  4JB7 A;  3RPW A;  4BDN A;  1H43 A;  3Q25 A;  3GBA A;  1B05 A;  4OEU A;  3G3K A;  1FQA A;  4EF1 A;  3QIM A;  3SER A;  2QRY A;  1TXF A;  3GBB A;  3QUF A;  5B70 A;  1CB6 A;  3HCQ A;  1M5B A;  1FTO A;  3TOD A;  1MQG A;  4WEP A;  3O2A A;  3DP4 A;  1ZKB A;  4PE5 B;  2M8C A;  1QUI A;  1VR5 A;  1WVJ A;  2Q2A A;  1J1N A;  3BFU A;  1SI1 A;  1MPD A;  2I4C A;  4OMB A;  5TP9 B;  5I2N B;  3E9X A;  2HZK A;  2NXO A;  2H99 A;  1LGB C;  2OWS A;  2I4B A;  3FAT A;  4NF6 A;  3MPK A;  3PUY E;  3W9W A;  1PEB A;  4IO2 A;  4XKN A;  2Q2C A;  4RK2 A;  3MP1 A;  4ZS9 A;  5L9S A;  3H6V A;  4AQ4 A;  1B4H A;  3S4U A;  3OEN A;  4YU0 A;  3RN8 A;  1H45 A;  3FV1 A;  2HZL A;  4ZE9 A;  4TLM B;  4DXC A;  3D4C A;  3FJM A;  4BDR A;  1B51 A;  3KFM A;  4R6K A;  4FOR A;  1SD3 A;  4EDP A;  3S9N C;  4PFY A;  5H8H B;  3B6W A;  3VXB A;  2ZYO A;  2OWT A;  3U72 A;  2HFB A;  3FVN A;  2KLF A;  3DP6 A;  4KCD A;  4XXU A;  2OBG A;  5L9O A;  3TTN A;  3UGW A;  5I2N A;  3TCF A;  4H8J A;  1P1U A;  1H76 A;  4G8H A;  4NF5 B;  3E3K A;  1POY 1;  2Y7P A;  3BBR A;  5AA1 A;  4G8N A;  1UTB B;  2AYS A;  3G3H A;  1B3L A;  5ICT A;  1MDQ A;  2V3T A;  1KWH A;  5KCJ B;  3PD9 A;  1Y1M A;  4OEN A;  4JBZ A;  2F7B A;  1N7W A;  2QL3 A;  4KD5 A;  3H7M A;  4IO3 A;  1EU8 A;  2P0S A;  4FAT A;  3HST A;  3G3J A;  4QFL A;  3PU5 A;  3C34 A;  5AE4 A;  3PMX A;  3N5L A;  3MVX A;  1MS7 A;  1PB7 A;  3KG2 A;  3U94 A;  4F29 A;  5TPA A;  1O7T A;  3CSB A;  1H44 A;  4BDL A;  3N6T A;  5ITP A;  1M5C A;  1ELJ A;  1UTB A;  4NTL A;  3T9U A;  5HM4 B;  1MXW A;  4GXS B;  1FTJ A;  4IGT A;  3SES A;  5DEX A;  2Z23 A;  3HPI A;  2UVG A;  1B7Z A;  5KCJ A;  4P11 A;  2DVC A;  3TYH A;  4ONY A;  1MG1 A;  3MJN A;  4NED A;  3A3U A;  3LBS A;  2XXU A;  1SYH A;  2PYY A;  1AOV A;  2VD3 A;  4E0W A;  1ZTY A;  2F6P A;  3TCG A;  5EHM A;  3THI A;  3ECR A;  3IOW A;  4H5G A;  4YKI A;  3DM0 A;  1B3G A;  2F7A A;  5I2K B;  2E1S A;  3RT6 B;  3WAF A;  2THI A;  1B58 A;  3SDF A;  4NF8 B;  2O1L A;  3TTL A;  4EXK A;  2Y7R A;  4X9T A;  3W9V A;  2R71 A;  2O69 A;  3K02 A;  1YAE A;  1MXU A;  3O6H A;  3TQL A;  2XD2 A;  1TFA A;  1GR2 A;  3IOV A;  2I3W A;  4EF2 A;  3GZG A;  3CR9 A;  3C4M A;  5DYH A;  2ZNT A;  1AL3 A;  4F31 B;  4NMY A;  2I58 A;  3S9M C;  4HCY A;  3TTM A;  4GQO A;  1FTK A;  2HXW A;  2X26 A;  1XHY A;  5I2K A;  2WKY A;  3KN7 A;  2QS3 A;  1QKA A;  3VLV A;  3CI8 A;  3T93 B;  3ONM A;  4L17 A;  4LZ7 A;  3O9P A;  2QS1 A;  4XTC Q;  3M3K A;  2OZZ A;  2H98 A;  1VE4 A;  5FTH A;  3VLU A;  1MPB A;  1DMB A;  2V25 A;  2PT1 A;  3HHG A;  3PV0 E;  1N04 A;  1IXC A;  3PPN A;  4PQJ A;  1IXI A;  2O51 A;  4DCX A;  3C36 A;  4E0X A;  2RF1 A;  3TTK A;  4N13 A;  1LB8 A;  3U1O A;  1IEJ A;  3UIF A;  2GRV A;  3MQ9 A;  1A99 A;  3N94 A;  4DXU A;  4KCC A;  4MF3 A;  1Q35 A;  1N84 A;  3K6W A;  4LVQ A;  3VE1 B;  2F97 A;  3QK6 A;  4H5F A;  4OXV A;  2R9J A;  3TFL A;  3O29 A;  4R6H A;  2LAO A;  1JW1 A;  1BIY A;  3O6I A;  3DP8 A;  3U93 A;  4WKM A;  3ZS6 A;  1SYI A;  3S9L C;  3FJ7 A;  2G29 A;  4BDO A;  3FVK A;  2DOJ A;  3I3V A;  1MXX A;  2Q88 A;  4JWY A;  4MLV A;  2IA4 A;  1D4N A;  3TTR A;  2V3Q A;  2OCU A;  3ODB A;  3C32 A;  1LBC A;  2AIX A;  3FXU A;  1Y20 A;  4IO6 A;  4U23 A;  1P99 A;  3O28 A;  2HAV A;  5AA4 A;  1IXH A;  1YTV A;  4R9G A;  5BUU A;  2XXV A;  2I3V A;  3PUZ E;  5H8F A;  4OQO A;  5H8S A;  4G77 A;  2O1M A;  3FZV A;  1LCF A;  3N6U A;  3P7I A;  5AA2 B;  2DS9 A;  3FXQ A;  1WOD A;  1LFH A;  3O6G A;  5H8Q B;  2OJT A;  3KBR A;  1GGG A;  4WXJ A;  3F11 A;  4F3B A;  1A55 A;  2H25 A;  2ZYN A;  5DVJ A;  3FV2 A;  3TPA A;  2F5X A;  4G68 A;  3IB0 A;  3RLF E;  5A5X A;  3AXF A;  4QHQ A;  2PX1 A;  3M3L A;  4QRZ A;  1IIW A;  4N07 A;  5I84 A;  4O3B A;  1MDP 1;  4DE8 A;  1NNP A;  1VFD A;  4R2F A;  2QSX A;  5JEI A;  1P1W A;  5H8N A;  4ZEB A;  3IB1 A;  3KGC A;  3U8Q A;  1LFI A;  3ZKL A;  3OSR A;  1MY3 A;  3IX1 A;  4KYD A;  3DLN A;  1UIU A;  2PT2 A;  4EQB A;  3PPP A;  1I6B A;  5L8D A;  3IOT A;  1Z7N E;  3Q29 A;  3VLW A;  4F1V A;  1XVX A;  1II5 A;  5FHN A;  3CFX A;  4NF6 B;  3KEI A;  1Y3Q A;  4Z0I A;  2OK2 A;  1Y9U A;  3JYR A;  4KYE A;  1IUD A;  5I57 B;  3SEX A;  2CMO A;  3S2V A;  5K2Y A;  3FVG A;  2XXW A;  1I6Q A;  3MVZ A;  1N3X A;  2Z8F A;  1ZU0 A;  4IO7 A;  4FAJ A;  1DSN A;  4OFL A;  4EXL A;  3V89 B;  4YB7 A;  4ZED A;  4U4X A;  2IEE A;  3OEL A;  1PBQ A;  4R73 A;  3UP9 A;  4TLL B;  1JVX A;  1MY1 A;  2O6A A;  4QFK A;  4YB5 A;  3SET A;  2ABH A;  3D4G A;  4R6Y A;  1JEV A;  1DTZ A;  3K1M A;  4OWD A;  5I57 A;  1EZ9 A;  4LA9 A;  1MM7 A;  1LCT A;  3EQ1 A;  2AL5 A;  3LC8 A;  3A09 A;  2H9B A;  1M5E A;  1VFE A;  1UQW A;  1D9V A;  3MPL A;  5I59 A;  2D21 A;  1Y4T A;  5DVF A;  3MUQ A;  3OMB A;  1UTH A;  1GVC A;  4RYA A;  1N3W A;  1LST A;  3BFT A;  4RY1 A;  2FNC A;  1SQY A;  3TDJ A;  4HTG A;  1JVY A;  3SEU A;  3QUJ A;  1TFD A;  2XXI A;  3TKD A;  1VSO A;  1MM6 A;  4H0W A;  1B1H A;  1JEU A;  1IQ7 A;  1Q1K A;  5TPA B;  3M8U A;  2QJE A;  2QMX A;  3OEM A;  1MY2 A;  3PUX E;  4FE8 A;  4F1U A;  4R9F A;  4U1O A;  2NUV A;  4ELR A;  4GIZ A;  1RYO A;  5DEX B;  1NH8 A;  4X1B A;  1RKM A;  5DVI A;  3K1P A;  4F2Q A;  4F3P A;  2I48 A;  4BDQ A;  2VP1 A;  4LZ8 A;  3C33 A;  5JTY A;  1BLF A;  4F3G A;  3VVF A;  2CZL A;  3Q28 A;  3IJX B;  1DPP A;  4H1X A;  2H4I A;  1NMU A;  3H03 A;  1PBP A;  1MXY A;  4ZE8 A;  3KJT A;  3KZG A;  2Z8E A;  4MBP A;  3K6U A;  4OER A;  3M3F A;  4UA8 A;  1QUJ A;  3MVW A;  5FTI A;  3FVO A;  1Y1Z A;  5CMB A;  4LQ5 A;  1RYX A;  4P0I A;  4OES A;  4THI A;  5L9M A;  4QSE A;  2VHA A;  3MP8 A;  5CBS A;  4I62 A;  1SW4 A;  4LON B;  4U4S A;  3FAS A;  2UYF A;  3CRB A;  4FEB A;  3IOU A;  4BLA A;  1P1Q A;  3RNN A;  4ESX A;  2V3U A;  2ONK E;  1USY H;  3KOS A;  5ICQ A;  1IZ1 A;  4YMA A;  1URS A;  1I6A A;  4O3C A;  1S50 A;  1FTL A;  3QAX A;  3PGF A;  1OLC A;  4RPN A;  4X48 A;  4OTE A;  3DEL B;  2H5Y A;  5F1Q A;  3KN8 A;  3BKI B;  3O97 A;  4RXL A;  5DT6 A;  3T9X B;  5CMC A;  4PFT A;  4YIC A;  2DXY A;  2RKM A;  4HW8 A;  2DWJ A;  1NFT A;  3TQW A;  3G3F A;  2PVU A;  2DE4 A;  2XX7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...