3OD7A

Haemophilus influenzae ferric binding protein a -iron loaded
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
308
structure length
308
Chain Sequence
DITVYNGQHKEAATAVAKAFEQETGIKVTLNSGKSEQLAGQLKEEGDKTPADVFYTEQTATFADLSEAGLLAPISEQTIQQTAQKGVPLAPKKDWIALSGRSRVVVYDHTKLSEKDMEKSVLDYATPKWKGKIGYVSTSGAFLEQVVALSKMKGDKVALNWLKGLKENGKLYAKNSVALQAVENGEVPAALINNYYWYNLAKEKGVENLKSRLYFVRHQDPGALVSYSGAAVLKASKNQAEAQKFVDFLASKKGQEALVAARAEYPLRADVVSPFNLEPYEKLEAPVVSATTAQDKEHAIKLIEEAGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The role of vicinal tyrosine residues in the function of Haemophilus influenzae ferric binding protein A.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Metal binding protein
molecule keywords Iron-utilization periplasmic protein
total genus 116
structure length 308
sequence length 308
ec nomenclature
pdb deposition date 2010-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3od7A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3od7A02
1B32A 1MQGA 5H8QA 1MH4A 3T93B 3IB1A 1NKXA 3B7DA 5I56A 2Q9TA 2DWAA 2VOZA 4NTLA 4R75A 1UTHB 1T0KA 2Y84A 3QXMA 5M2VA 2CMOA 1DOTA 2DE3A 1DTGA 1QJMA 3PPOA 3V83A 1IXHA 1FQAA 4EXKA 4G77A 2HZLA 5EYFA 1D3KA 4N6PA 1N0TA 2AL5A 4QFLA 3MUQA 2REJA 5AA2D 2DVZA 5I58A 3DP6A 4GF8A 3RT6B 4EQ9A 3FVOA 4O3AA 3MQ9A 3QAXA 3HHGA 1MM7A 5L9OA 4OETA 5TPAB 2V93A 3Q25A 3VXBA 4R2FA 4ELRA 2H98A 4P0GA 2AIXA 1IITA 2I0BA 4U2RA 4XTCQ 3MP8A 5I2KB 1EH3A 1ZKBA 3O9PA 4HS7A 5K2YA 5I2KA 2HCAA 2DWHA 3M3FA 3PGFA 4U22A 1Y1MA 1R1NA 3IK6B 4WKMA 1N04A 3FJ7A 5CBSA 1LB9A 5H8NB 4G4PA 1UIVA 1MS7A 2OWSA 5CMMA 1DPEA 1JETA 3JV9A 3TQWA 4ZEFA 4PFYA 1B3FA 3O6IA 1A8EA 2V25A 4YKJA 1NH8A 1AMFA 5I58B 3TQLA 3SEWA 4GRKA 4OFOA 2A5TA 1B2HA 2HQ0A 3MZ9A 1SQYA 1VFDA 1GV8A 4R6KA 4HTGA 2F6PA 3RTFB 2Y7IA 1GGGA 5A5XB 4MLQA 3A3CA 3A09A 1JW5A 4LVQA 2UVGA 3BFUA 1ZMGA 3E9XA 4NMYA 4THIA 4ELOA 5A5XA 1Y3QA 2QL3A 2AYSA 1Y3PA 3CSGA 2XXQA 1OQGA 4P0IA 1QKAA 1NMUA 3KN8A 3OO8A 4UACA 3FVGA 3RQTA 4R6HA 3EQ1A 2H4IA 3ZKLA 2ZNSA 4KCCA 2NVUB 1EU8A 3JYRA 4POXA 3S4UA 3PPPA 1PC3A 2H9BA 3DP8A 4I9DA 4Q8RA 2Y7PA 3TUSA 3RY3A 5L8DA 3N5LA 1IXCA 3G3KA 3MW0A 3KGCA 3N26A 4FECA 1SBPA 2THIA 4MF3A 4JWYA 3G3JA 4FIMA 1POY1 4F3GA 3GBBA 2HAUA 3K6XA 3CG1A 3N6TA 3I5OA 4TLMB 3T66A 1O7TA 2W7YA 3O2AA 3SKPA 4Q5TA 3T9HB 4ECFA 2DYXA 5AA4A 2XXPA 1TWYA 5JTYA 1B5IA 2XXTA 4ZS9A 2XD2A 4OEUA 1FQBA 1I69A 2ABHA 4LP2B 2HZKA 3SERA 3VLWA 1OVTA 3KEIA 3PUWE 4IY5A 2GFEA 3MP1A 1JEVA 1FTLA 3WAEA 1SI1A 3N94A 2PX1A 4RA1A 4F19A 1NNFA 3K6WA 3O6HA 1LAFE 4TOZA 4QFPA 4DXUA 1H45A 1OLAA 3AXFA 4FEDA 1I6BA 1UTHA 3E4RA 3K1PA 3MVXA 1LFGA 4U21A 4U1OA 3IOUA 1A54A 1ELJA 4I8CA 1UTBB 2I3VA 1S50A 2OLBA 1TFDA 1SI0A 3FXUA 4OTEA 5H8QB 3T9XB 1NFTA 5DEXB 4F3BA 1PB9A 2ZYKA 3KOSA 1LLSA 1VR5A 3SEYA 1IUDA 3FV2A 1MDQA 2OJTA 4GIZA 5ISUA 4H8IA 4Q0CA 4NWDA 5L9SA 4FE8A 3WAFA 2CZLA 2ZNUA 4RY1A 3G3GA 4EXLA 4BDNA 4H65A 3O97A 2UVJA 3H7MA 4ZDMA 3VLUA 1QKBA 2YJPA 4MBPA 1S9TA 4G8HA 2RCBA 4OERA 3OXNA 3TPAA 2RC9A 3FASA 1PDAA 4ZEKA 1GTKA 1FQDA 2VD2A 3BKIB 2GHAA 1BTJA 2Q2CA 2KLFA 3LC8A 4JSOA 5DVFA 4BDRA 4OWDA 4C1UA 1B7UA 2UVHA 2X7QA 2YPNA 1URGA 3MJNA 3O66A 1P1OA 3QK6A 3FVKA 3DM0A 4LQ2A 5FHMA 4DXCA 3SEXA 5KDTA 2P1SA 2ZYOA 5ITOA 3M3LA 3THIA 4EF1A 5HM4B 1OIBA 4QRZA 5JK4A 2Q89A 3S9NC 1WODA 3VFJA 1AL3A 1ATGA 1RKMA 4NF5A 3QUJA 1QW0A 3UORA 3T96B 3KG2A 2O84X 2O68A 3IB2A 2Q2AA 4BDLA 1J1NA 4GXAA 4YB5A 5DVJA 3K0VA 2Z8FA 1OVBA 3EPEA 3FJGA 4DIGA 5FHNA 4GL0A 4OHNA 1Y4TA 2P0SA 1B3EA 3KZGA 1B5JA 1FTJA 3K4UA 1I6AA 1MY0A 5DEXA 3Q28A 1URDA 1O63A 1IXIA 1TFAA 2DWJA 4U1ZA 3TELA 3PU5A 3FIRA 5TPAA 1B7ZA 4JWXA 3PUXE 4QHQA 2ZMBA 3PD9A 2D3IA 3IJOB 3PV0E 4Q30B 1NNKA 3ECRA 2ZNTA 3GBAA 3O28A 1MY4A 2VHAA 1UQWA 3MZ1A 4N13A 4NWCA 4QFKA 4ESWA 1S7YA 3DP4A 1RYOA 1R6ZA 4RNSA 5FTIA 5H8FB 1O64A 1HSLA 3MBPA 2PT2A 4FJPA 4FAJA 1FW0A 4KYEA 2XXWA 1B0LA 4LONB 3FXQA 3W9VA 4F31B 3OEMA 5K2XA 3M8UA 3S9LC 1SW5A 1IZ1A 2YLNA 3LSLA 3MC2A 3TMGA 3V89B 4YKPA 5TP9B 4E0WA 2XXIA 2BJJX 3C35A 3HV1A 4POWA 4L17A 2XX7A 1SW4A 4LQ5A 4LZ7A 1A7LA 1N7WA 1I6QA 2R71A 4G8MA 4G2ZA 3RNNA 4TLLB 4RPOA 2OBGA 4R9FA 1B52A 1DMBA 4YZZA 4LZ8A 3OSQA 1B05A 2NUVA 1USYH 1A40A 2B65A 1LGBC 3IO6A 1JW1A 3T9UA 2I3WA 3CVGA 3PPRA 4X9TA 1GVCA 1B4HA 2Z22A 4E0XA 4F39A 4PE5B 1B46A 1ZIUA 3O6GA 5FTHA 5TU0A 2UYEA 2ESNA 4DDDA 1Y1ZA 4KYSA 1LSTA 4OMBA 4EUOA 4F29A 5LOMA 3I3VA 4GL8A 3LSXA 2DSFA 2UYFA 2F7AA 3VE1B 2H99A 4JSDA 4OESA 1VSOA 3H3GA 1SYIA 1QVSA 2OWTA 4F2OA 1LBCA 1NH7A 2A5TB 1USYE 4ND9A 1H43A 4G68C 4OXVA 5ELVA 3TTRA 3MZBA 3OSRA 4DLDA 3FGSA 3DELB 4GVOA 2O7UA 2XXYA 3LBSA 1DSNA 3RGYA 3C4MA 4GOTA 4H0WA 3U94A 4DXBA 2ONKE 3KOTA 2F7BA 3MWBA 1Y4CA 1US5A 3LSFB 3L6GA 5B70A 4KPTA 3ODBA 4DCXA 2RCAA 3USDA 2ONRA 1IXGA 3H6UA 3TTLA 3UN6A 2HAVA 3G3HA 4NE4A 5IKBA 1BKAA 5H8HB 3ZS6A 4UA8A 2XX9A 2DE4A 1UTBA 5CI5A 4DZ1A 4GLIA 5FHOA 3H6WA 1CB6A 1OQHA 1NNTA 5TP9A 1D4NA 1B0HA 3OO9A 3TAJA 1EZ9A 1WDNA 4G68A 3KJTA 3RPWA 2B3BA 3E3KA 2D21A 2F34A 4Z7EA 4KYDA 5HPQA 1B4ZA 2I49A 2NOOA 3U92A 2QMWA 4ZEBA 4KD5A 1B51A 4BDOA 2F8DA 3EN3A 1PBPA 1YAEA 2DP8A 4X48A 1TT1A 1BIYA 2R9JA 5I59B 3MVWA 1P99A 4YB6A 5EHMA 4QSEA 2REGA 1II5A 2QS2A 3FXRA 3LR1A 4PETA 3UP9A 1IEJA 4C0RA 3OEKA 5HBCA 5KCJB 4PFUA 1H3DA 1N3XA 3V8XB 1EZPA 3B6QA 1FTMA 4NF4B 5ICTA 1LCFA 1MXXA 1FTKA 4M1VA 4OVJA 5DT6A 4ZE8A 2G29A 5I57B 5J1DA 5H8HA 1FCKA 5CBRA 1PBQA 3PD8A 4ZZAA 2GH9A 1A55A 1M5BA 2RINA 2FYIA 1JVXA 2O69A 2X7PA 2F97A 5AE4A 3H4ZA 1Y9UA 4LZ5A 4EF2A 1POTA 1MY2A 1XC1A 1IIWA 2DE2A 3SESA 4ELPA 3S9EA 1PB7A 1SW2A 2OCUA 2Q8JA 1H44A 2GHBA 4OZ9A 4IO7A 4PFWA 4H5GA 2IA4A 2NXOA 4JWOA 4K3FA 4PQJA 4EQBA 4F22A 2M8CA 3K6UA 4YB7A 3W15C 4YMAA 1B1HA 4XXUA 2ZYNA 4IO5A 1ZU0A 2B3FA 3R6UA 4JBZA 1FQFA 2A5SA 4IO6A 3TZAA 2PBWA 1URSA 3QSLA 1QULA 2F78A 1YTVA 1B7HA 3CFXA 4FORA 2ZYMA 3RT8A 4N07A 1XS5A 3TKDA 3C33A 3MPLA 4C1TA 1SVXB 4MFIA 1ZLQA 3HO7A 4QFOA 3UK4A 2PYYA 4BLAA 4KI0E 4RXLA 3C31A 3SDFA 3U72A 2VP1A 1B3GA 2Q88A 2XHDA 3FJMA 4H6DA 4P11A 5H8NA 3ONMA 4IGRA 4G8NA 2VD3A 1MH3A 2PT1A 4IO2A 3UA8A 5KZTA 3CFZA 3VVDA 2QPQA 2WKYA 2FNCA 3H6VA 2F35A 3VLVA 1NL5A 3VV5A 3CIJA 4Z0IA 1OMPA 3M3KA 1VFEA 5KCJA 1H76A 5CMBA 2DS9A 2F7CA 5AA3A 4RJZA 3ZKKA 1HSEA 4WEDA 2XXUA 4I1DA 4IB2A 1FQEA 4NF8B 5CMCA 1N3WA 4F2QA 3L6HA 2H5YA 3SETA 2UXAA 1JEUA 4QSCA 2DOJA 1B3HA 3F11A 4OEVA 5IAIA 2HXWA 2DQVA 3TYHA 5JTYB 1B5HA 1MRPA 1UIUA 5CRYA 3EHTA 2XXVA 1YCJA 4R73A 5AA4B 3OO6A 3OELA 1N7XA 4TQUQ 3UGWA 2F6GA 3KJ7A 4OENA 3K1MA 1ZBMA 3RTWB 1YPNA 1LAGE 3QYTA 3KN3A 4ZEIA 3D4CA 1P1NA 1ZTYA 3IO4A 4WXJA 3ZSFA 2Z23A 4U23A 2OZZA 1BP5A 1LAXA 1HSJA 3EHSA 3G3IA 3G3FA 3LUYA 1TXFA 4JB7A 4JDFA 4H1XA 1SDXA 1R9QA 5ICQA 3PPQA 3MPKA 1JQFA 1JW4A 2XXXA 5AA1A 2F5XA 3D4GA 4LUBA 2QSXA 1AIVA 1M5FA 2XXRA 2Z8DA 1MXVA 1AOVA 5I57A 1ANFA 2O51A 4NEDA 1MPDA 3R7XA 1B40A 1FQCA 2UVIA 4KFQA 3B6TA 3RLFE 2I6EA 4ESXA 5KDTB 3K01A 1Q1KA 3CRBA 3IOVA 4YMBA 1QUIA 1KWHA 4HW8A 2F36A 3MP6A 4O3BA 2DWIA 5I59A 3T22A 3OENA 4QSDA 5B7DA 1P1WA 3IJXB 4NF6A 3GLBA 4OQOA 3TDJA 3W9WA 5EHSA 3PPNA 4H5FA 3PMWA 3SEVA 2DXYA 1FTOA 1DTZA 3FD3A 4H67A 4DE8A 1PB8A 2X26A 3H06B 4G68B 4F1YA 4F1UA 5JEIA 1ZJLA 1MXZA 4HCWA 2RKMA 2RC7A 4JXIA 1F9BA 2QJEA 3IOTA 3KBRA 4OFLA 1LBBA 2QRYA 1L5TA 3HSTA 1MQJA 3CSBA 4X1BA 3TCHA 1MY3A 3CFLA 2Y7RA 1B3LA 4ZE9A 4R74A 4ONYA 3K6VA 4KCDA 1MQIA 2R6GE 3K1NA 3DLNA 3R26A 1LAHE 3G7WA 3U93A 5ITPA 4IO3A 1Z7NE 2NWJA 4YU0A 3UIFA 2Y7WA 5DYHA 4GD5A 2PVUA 2QS3A 3RUMA 3HPIA 3CR9A 3IOWA 4AQ4A 4F18A 3ILUB 3S9MC 2I4CA 3MVYA 3CG3A 1N76A 4YAHX 1CE2A 2ZXTA 3E13X 3OD7A 2E1SA 3Q26A 1N84A 1SW1A 2PMSA 4NF6B 4OFJA 4RK2A 1SYHA 2VGQA 3PMVA 1MY1A 1IQ7A 3A3UA 4GQOA 3TCGA 5I2NB 1EZOA 4OYVA 3I6VA 1VE4A 3OO7A 3TTKA 4YICA 4KQPA 3FV1A 1AH5A 1MXUA 1Z7ME 3TFLA 5CM6A 2XD3A 1P1UA 1MPCA 2Z8EA 1M5EA 4XIGQ 4MLVA 2LAOA 2IEEA 2O1MA 2QS4A 3GZGA 4HCYA 4QF9A 3VDFA 3IAZA 4FEBA 3IL1B 4R6YA 3EF7A 3N6UA 3O29A 3C32A 1B58A 3PUYE 4XKNA 1M5DA 3OMBA 4ZEDA 2V3TA 4MH5A 4BDQA 1D9VA 2HFBA 2DXRA 4YKKA 3PMXA 3HCQA 4NF5B 5F7VA 1GR2A 1MG1A 5AA2A 3VVEA 1R9LA 4DCYA 3JZJA 1XHYA 4U4SA 5H8SA 5CC2A 2DVCA 4NF4A 5I84A 4XKQA 4GWOA 4AB6A 1MDP1 3LSWA 1QUJA 2I48A 1M5CA 4O3CA 3HN0A 3TEPA 4ZECA 4IY6A 2D5WA 1NNPA 1XOCA 2I4BA 4RK9A 5H8FA 2OK2A 1MXWA 4RPNA 3VVFA 1DPPA 2H25A 2Y7KA 3C36A 4R9GA 2V3UA 4KHZE 5F1QA 3P7IA 2ALUA 5I2NA 3IX1A 1PEBA 1Y20A 2RC8A 4KR5A 5DTBA 3GXAA 3QIMA 3KN7A 2QMXA 4H8JA 4NF8A 4M4GA 2HEUA 2QS1A 1P1QA 3FUZA 1US4A 4QFNA 2V3QA 2XXHA 3C9HA 3PUVE 4YKIA 3RN8A 4FATA 5CMKA 4RYAA 3Q27A 3KFMA 3OOAA 1RYXA 3S2VA 3C34A 1WVJA 3KSJA 1B9JA 4LA9A 1MXYA 1Q35A 4AB5A 4ELQA 2XX8A 4F3PA 1B6HA 3VXCA 3KSXA 2O6AA 3FATA 1LFHA 1JVYA 4ISUA 2ANJA 2G93A 3QUFA 4LATA 3V5AA 1LFIA 5BWJA 2AL4A 3BFTA 1MQHA 4IO4A 3SEUA 2I0CA 3TTNA 3CI8A 3EHUA 4BDMA 3U1OA 5DVIA 3Q29A 4F1VA 2RF1A 3TCFA 1LB8A 1XVXA 1Y3NA 1A8FA 2P2AA 3ILTB 4WEPA 4U4XA 2O1LA 3U8QA 1MM6A 1A99A 3MVZA 3PUZE 3BBRA 3IB0A 3IR1A 2GRVA 4X1DA 4XKPA 4IGTA 1XT8A 1MPBA 1XVYA 3HHFA 3B6WA 4GXSB 5BUUA 1QUKA 4XKRA 3H03A 5I56B 3FVNA 3K02A 3K00A 3TTMA 2O7IA 1MQDA 3IORA 1OLCA 4ZZEA 5AA2B 3K2DA 2E0SA 4F3SA 1LCTA 2FA7A 4PP0A 4I62A 4EQ7A 1D9YA 3T9VA 4R72A 1JNFA 1SD3A 4EDPA 2V84A 3MAMA 4PFTA 5L9MA 1B1XA 1BLFA 4R2BA 2I58A 3FZVA 3H6TA 4GFRA 3TODA 2ONSA
chains in the Genus database with same CATH superfamily
4GBWA 1BK4A 1NKXA 1UTHB 1DOTA 2DE3A 1QJMA 3V83A 1AWBA 4G77A 2HZLA 5EYFA 2WEFA 4PF6A 3RT6B 4P8BA 1MM7A 1NV6A 2V93A 4ELRA 2H98A 1IITA 4U2RA 4XTCQ 1EH3A 4HS7A 3IK6B 5CBSA 3FJ7A 1LB9A 4G4PA 1MS7A 2OWSA 3TQWA 2V25A 3IFCA 1AMFA 2QVVA 3TQLA 1B2HA 1VFDA 4R6KA 3RTFB 2GQ1A 2Y7IA 3A09A 1JW5A 5A5XA 1FPIA 4AS5A 1QKAA 1NMUA 3EKIA 3ZKLA 2ZNSA 3PPPA 1PC3A 2H9BA 4I9DA 3RY3A 2THIA 3G3JA 2P3VA 1POY1 3I5OA 3T9HB 4ECFA 2DYXA 4OEUA 2HZKA 3VLWA 1JEVA 1FTLA 4RA1A 4N15A 1LAFE 1H45A 3AXFA 3E4RA 1LFGA 3IOUA 3T9XB 1S50A 4F3BA 5H8QB 1NFTA 1PB9A 2ZYKA 3SEYA 1VR5A 3FV2A 1MDQA 4GWZA 2OJTA 4H8IA 4FE8A 4RY1A 2ZNUA 4NAPA 4BDNA 2YJPA 3OXNA 2RC9A 4ZEKA 3E79A 2KLFA 4LQ2A 5KDTA 3DM0A 2ZYOA 5HM4B 4GWSA 1NV2A 1RKMA 4NF5A 3UORA 2O68A 2Q2AA 4GXAA 5DVJA 1OVBA 5FHNA 4GL0A 1B3EA 1FTJA 2CEYA 5DEXA 1I6AA 1MY0A 3TELA 5TPAA 4Q30B 4QFKA 1MY4A 2VHAA 3MZ1A 4ESWA 4RNSA 5FTIA 1O64A 4FJPA 3FXQA 1FPFA 4YKPA 5TP9B 1FBCA 2XXIA 4QBAA 4LZ7A 1A7LA 2DDKA 4G2ZA 1A40A 2B65A 3T9UA 1VDWA 2I3WA 3CVGA 4F39A 3O6GA 4KYSA 1LSTA 3I3VA 3LSXA 4JSDA 4OESA 1VSOA 3H3GA 1SYIA 1QVSA 4MNCA 1NH7A 5ELVA 2XXYA 2ONKE 3LSFB 4DCXA 2ONRA 3UN6A 2HAVA 2BJIA 3G3HA 4NE4A 5H8HB 4DZ1A 5TP9A 3H6WA 3OO9A 2Q8MA 3TAJA 1FJ9A 3KJTA 3E3KA 2D21A 2NOOA 2QMWA 2DP8A 4X48A 1TT1A 1BIYA 2R9JA 3MVWA 4YB6A 5EHMA 3LR1A 3OEKA 4ZE8A 4OVJA 1NUXA 2FYIA 4N81A 1RDZA 4LZ5A 2HHMA 3S9EA 5EYHA 4H5GA 4JWOA 1IMBA 1B1HA 2ZYNA 3QSLA 3RT8A 1B7HA 3TKDA 1XS5A 1SVXB 3HO7A 3FJMA 4G8NA 4N6KA 2FNCA 2F35A 1NL5A 3CIJA 4Z0IA 1OMPA 1FRPA 1HSEA 4WEDA 4IB2A 1N3WA 4F2QA 4P56A 4OEVA 1B5HA 5CRYA 2XXVA 5AA4B 3OO6A 1NV5A 1LAGE 2V4CA 3KN3A 2FBPA 3D4CA 1P1NA 1LAXA 1HSJA 1TXFA 4N8YA 2QFLA 1SDXA 1R9QA 1LBZA 1JQFA 3D4GA 2XXRA 1JP4A 1ANFA 4NEDA 1MPDA 1B40A 2UVIA 3RLFE 3B6TA 2L5VA 3IOVA 4YMBA 1KWHA 4MHFA 3MSTA 3IJXB 5EHSA 3PPNA 4H5FA 3SEVA 1DTZA 2CEXA 3H06B 2RKMA 4JXIA 2QJEA 4F29A 4DI4B 3HSTA 1MQJA 3TCHA 4X1BA 1MY3A 4ONYA 5ITPA 1LAHE 3U93A 4YU0A 3T0JA 4PFBA 3HPIA 3MVYA 3OD7A 4ZZEA 1SW1A 2PMSA 4NF6B 4GQOA 2WYPA 3TCGA 3OO7A 1VE4A 1MXUA 4MNIA 2XD3A 2LAOA 2CZKA 3EF7A 3N6UA 3PUYE 2V3TA 3HCQA 1XHYA 2DVCA 4PFRA 4NF4A 2I48A 1XOCA 4RK9A 1MXWA 1EZOA 4KR5A 5DTBA 5ISUA 2HEUA 2XXHA 3RN8A 4FATA 4LA9A 4AB5A 1MXYA 4F3PA 3VXCA 3KSXA 2O6AA 4HE2A 3QUFA 2I0CA 1FBPA 3EHUA 2B4LA 5DVIA 4F1VA 3TCFA 1LB8A 4P3LA 1A8FA 2FHYA 1MM6A 4X1DA 3BBRA 3IR1A 2GRVA 5BUUA 4GXSB 4XKRA 5I56B 5ESYA 3K02A 4PP0A 1D9YA 4R72A 5L9MA 4R2BA 1MQGA 3B7DA 2VOZA 4NTLA 2Y84A 3QXMA 3CHGA 1DTGA 4EXKA 4N6PA 5EQ8A 3IFAA 2AL5A 5AA2D 2REJA 2DVZA 5I58A 3DP6A 4EQ9A 3FVOA 1FJ6A 4O3AA 3HHGA 4NF0A 4OETA 5F24A 4R2FA 4P0GA 2I0BA 5I2KB 3KC1A 3PGFA 1N04A 5I7IA 1UIVA 5CMMA 5J16A 4ZEFA 1A8EA 4YKJA 2MKZA 4GRKA 4OFOA 2A5TA 3MZ9A 1SQYA 3T96B 5A5XB 3A29A 4MLQA 4ELOA 4LVQA 3E9XA 2FIXA 4GX4A 2QL3A 4O7MA 4P0IA 3RQTA 3OO8A 4UACA 4R6HA 4KCCA 3JYRA 3DP8A 3TUSA 2Y7PA 5L8DA 4JWYA 4F3GA 3K6XA 3T66A 4P1LA 3O2AA 3SKPA 5AA4A 2XXPA 1TWYA 2XXTA 2HPGA 1FQBA 4IY5A 5EQ9A 1LBVA 2PX1A 4F19A 4N4UA 3O6HA 5LOMA 4FEDA 4U1OA 4U21A 4OTEA 1SI0A 3KOSA 4Q0CA 4NWDA 3WAFA 3G3GA 3VLUA 3H7MA 5ET7A 4N17A 1S9TA 2RCBA 1PDAA 4UABA 1FQDA 2GHAA 1BTJA 2Q2CA 3LC8A 4JSOA 4C1UA 1B7UA 2UVHA 2X7QA 2YPNA 1URGA 3O66A 4LONB 1P1OA 4DXCA 5ITOA 4EF1A 3ROJA 2Q89A 3VFJA 3KG2A 3IB2A 4BDLA 3EPEA 1CNQA 1Y4TA 1EYJA 1URDA 1O63A 2DWJA 3PU5A 4JWXA 3PD9A 3PV0E 1NNKA 3GBAA 3O28A 1RYOA 1R6ZA 2XXKA 1FW0A 2XXWA 1B0LA 4F31B 2YLNA 3HV1A 2BJJX 1SW4A 4PF8A 1N7WA 4G8MA 4TLLB 1B05A 1LGBC 3IO6A 1JW1A 1GVCA 4X9TA 1B4HA 5FBPA 1ZIUA 4DDDA 3KC0A 1FBEA 3VE1B 1LBCA 4OVPA 4ND9A 3TTRA 3MZBA 2O7UA 3RGYA 4DXBA 3C4MA 4H0WA 3U94A 3KOTA 2F7BA 1Y4CA 2RCAA 3USDA 3H6UA 1FPEA 4I3YA 5IKBA 2XWVA 1UTBA 1B0HA 4G68A 4Z7EA 5HPQA 1B4ZA 2I49A 4ZEBA 1NUZA 4KD5A 4PTKA 1YAEA 1IMCA 2ZZXA 4QSEA 3UP9A 1IEJA 4NHBA 3V8XB 1H3DA 1EZPA 3B6QA 4AS4A 1MXXA 5J1DA 5DT6A 5H8HA 1PBQA 2GH9A 5ET6A 2O69A 2F97A 2XWKA 3H4ZA 4EF2A 1POTA 2DE2A 3SESA 1PB7A 4O8MA 2GHBA 4IO7A 4F22A 2IA4A 4K3FA 1LBWA 2M8CA 4JBZA 2B3FA 3R6UA 2A5SA 2PBWA 4PGPA 1URSA 2F78A 4FORA 4C1TA 4MFIA 1ZLQA 4QFOA 4NX1A 4RXLA 3U72A 4PC9A 1B3GA 2XHDA 4P11A 5H8NA 4NN3A 4IGRA 2VD3A 1MH3A 3UA8A 3VVDA 2QPQA 2WKYA 3H6VA 3D1RA 1VFEA 4HXVA 5KCJA 4RJZA 4NF8B 1NV4A 5CMCA 2H5YA 2UXAA 1JEUA 3F11A 5IAIA 4R73A 3OELA 1N7XA 4TQUQ 3UGWA 2F6GA 3KJ7A 4N6DA 5A5LA 5ET8A 3EHSA 3LUYA 5EYGA 4JB7A 2XXXA 4LUBA 2O51A 5KDTB 3CRBA 2XWOA 3BIGA 2P3NA 4HW8A 3RPLA 2DWIA 3OENA 4QSDA 1P1WA 4OQOA 1NUYA 1FPKA 1FTOA 3FD3A 2HXRA 4H67A 1ZJLA 4HCWA 1F9BA 3IOTA 3KBRA 4OFLA 3CSBA 1MQIA 2R6GE 3R26A 3UIFA 1YYZA 5DYHA 4GD5A 2PVUA 3ILUB 3S9MC 2I4CA 5IM2A 3CG3A 3E13X 4OFJA 1SYHA 3A3UA 2KR0A 4PAFA 3TFLA 3FV1A 1AH5A 1M5EA 4XIGQ 2IEEA 3IL1B 3O29A 4OANA 4XEQA 3FBPA 1M5DA 4PBQA 1D9VA 2DXRA 4YKKA 3PMXA 5F7VA 1MG1A 4GWOA 1M5CA 4ZECA 2D5WA 1NNPA 2I4BA 3VVFA 1DPPA 4R9GA 3P7IA 4H8JA 1US4A 4OA4A 3GYYA 3PUVE 4YKIA 4RYAA 3Q27A 5T3JA 2XX8A 4ISUA 1LFIA 3B8BA 4BDMA 2RF1A 1Y3NA 2P2AA 2ZZVA 2O1LA 3MVZA 1A99A 4H46A 4XKPA 1XT8A 1MPBA 3B6WA 4MNPA 3TTMA 3K00A 2O7IA 3IORA 3K2DA 2E0SA 2FA7A 4PCDA 4I62A 2ONSA 1EYIA 5H8QA 5I56A 2DWAA 1T0KA 3PPOA 1IXHA 1FQAA 1D3KA 1N0TA 3MUQA 4HE0A 4PBHA 3MQ9A 3QAXA 5TPAB 3Q25A 3MP8A 1ZKBA 5K2YA 1FBFA 4WKMA 1Y1MA 1R1NA 5H8NB 1LEVA 1FPJA 3O6IA 1INPA 5I58B 2HQ0A 2KQZA 1GGGA 3A3CA 3BFUA 1ZMGA 1Y3PA 3CSGA 2XXQA 1FTAA 2CZIA 2H4IA 4MJOA 3S4UA 1IXCA 5IZ3A 3N26A 4MF3A 1SBPA 3GBBA 2HAUA 2W7YA 4Q5TA 1IMAA 5JTYA 4OVRA 2XD2A 1I69A 3SERA 1IMDA 1OVTA 3PUWE 4JVDA 1SI1A 3N94A 1NNFA 4TOZA 1OLAA 1UTHA 3K1PA 3MVXA 1ELJA 5L9SA 1UTBB 1TFDA 3FXUA 1IUDA 4GIZA 2CZLA 4EXLA 2UVJA 1QKBA 1IMEA 4O7IA 4OERA 3TPAA 2VD2A 5DVFA 4BDRA 4OWDA 3MJNA 3QK6A 3FVKA 5FHMA 2P1SA 4I3EA 1AL3A 1ATGA 4YB5A 3FJGA 3BIHA 3K4UA 1IXIA 1TFAA 2R8TA 4U1ZA 3FIRA 3PUXE 3IJOB 2F3DA 1NI9A 1UQWA 1S7YA 3DP4A 5H8FB 1HSLA 3MBPA 4FAJA 2WBBA 2FVZA 3W9VA 3OEMA 3M8UA 3S9LC 3TMGA 1IZ1A 3MC2A 4E0WA 3C35A 2CZHA 4L17A 4PAKA 4R9FA 1B52A 4LZ8A 3OSQA 1XI6A 1USYH 2VPNA 3PPRA 1G0HA 4E0XA 2F3BA 4PE5B 5TU0A 4N91A 4EUOA 4OMBA 2WX9A 4GL8A 4C0RA 2F7AA 2H99A 5LTCA 4F2OA 1USYE 5LDZA 1NV0A 4OXVA 3OSRA 3FGSA 3DELB 4MMPA 3LBSA 1DSNA 4GOTA 3SZPA 3MWBA 1US5A 5B70A 4KPTA 3ODBA 1IXGA 5CI5A 2XX9A 4GLIA 5FHOA 1LBYA 1WDNA 2F34A 2FIEA 4KYDA 1FBHA 4PFIA 4BDOA 4P1EA 4PAIA 2REGA 2QS2A 5HBCA 5KCJB 4MAGA 4MIJA 4PFUA 4NF4B 5ICTA 1LCFA 4M1VA 5I57B 1FCKA 3RYDA 3PD8A 4ZZAA 1M5BA 3FXBA 4KXPA 2RINA 1Q9DA 1K9ZA 1JVXA 5AE4A 1Y9UA 1XC1A 1IIWA 2OCUA 1SW2A 4PDHA 2Q8JA 1H44A 4OZ9A 4PQJA 4EQBA 4XXUA 1FQFA 3TZAA 4JVCA 1QULA 1YTVA 4FBPA 4N07A 3MPLA 4KI0E 3C31A 2VP1A 3ONMA 5KZTA 1KZ8A 3VV5A 1H76A 4I1DA 3L6HA 3SETA 1B3HA 2HXWA 3TYHA 3QMFA 5JTYB 1MRPA 4GX3A 4OENA 3T1BA 4PE3A 3QYTA 4ZEIA 3ZSFA 3IO4A 4WXJA 4U23A 2OZZA 2QVUA 4H1XA 5ICQA 3MPKA 5AA1A 1JW4A 3U65A 2F5XA 1M5FA 2Z8DA 1AOVA 5I57A 3R7XA 4KFQA 2I6EA 1Q1KA 1QUIA 3MP6A 5I59A 5B7DA 5EQ7A 3TDJA 4F1UA 4I40A 1PB8A 4F1YA 1FPDA 5JEIA 5EQAA 1MXZA 2QRYA 3CFLA 1B3LA 3G7WA 4IO3A 2NWJA 5IZ1A 2Y7WA 2QS3A 3RUMA 3CR9A 3IOWA 4AQ4A 4F18A 2ZXTA 4RK2A 3Q26A 4OVQA 5I2NB 1MY1A 1IQ7A 3I6VA 3TTKA 4YICA 3MYUA 1NV1A 1P1UA 2QS4A 4QF9A 4FEBA 4R6YA 3C32A 1B58A 4OVSA 3OMBA 2HFBA 4NF5B 5AA2A 1GR2A 1R9LA 4DCYA 3JZJA 5H8SA 5CC2A 5I84A 4XKQA 3HN0A 3TEPA 4IY6A 5H8FA 4RPNA 2H25A 5I2NA 1RDXA 5F1QA 2V3UA 4KHZE 2ALUA 2WBDA 1Y20A 3QIMA 2QMXA 4NF8A 2QS1A 1P1QA 3FUZA 2V3QA 5CMKA 3B50A 4NGUA 3OOAA 1RYXA 3C34A 1WVJA 3KSJA 5I5PA 1B6HA 3FATA 2VT5A 1JVYA 4LATA 3BFTA 1MQHA 4MEVA 1EYKA 4P9KA 3U1OA 2XA5A 3RPLB 3ILTB 4WEPA 3U8QA 3PUZE 3IB0A 1QUKA 3FVNA 1OLCA 5AA2B 4F3SA 1LCTA 4EQ7A 1JNFA 4EDPA 3MAMA 4PFTA 1BLFA 3TODA 2I58A 3FZVA 4PGNA 3SDFA 1B32A 1MH4A 3T93B 3IB1A 2Q9TA 4R75A 5M2VA 2CMOA 1KA1A 4OVTA 4QFLA 4GF8A 4GBVA 5L9OA 3VXBA 2AIXA 5I2KA 3O9PA 2HCAA 2DWHA 3M3FA 4U22A 1DPEA 1JETA 3JV9A 1YZ0A 4PFYA 1B3FA 1NH8A 3SEWA 1SPIA 1GV8A 4HTGA 2F6PA 4NMYA 2UVGA 1NV7A 4G61A 4THIA 1Y3QA 2AYSA 1OQGA 3KN8A 1FBDA 3FVGA 3EQ1A 2NVUB 1EU8A 4POXA 4X04A 4Q8RA 3N5LA 3G3KA 3MW0A 3KGCA 4FECA 4H45A 4FIMA 1DCUA 3CG1A 3N6TA 4TLMB 1O7TA 1FPBA 1B5IA 4QXDA 4ZS9A 4LP2B 2ABHA 3KEIA 2GFEA 3MP1A 3WAEA 3K6WA 1FPGA 4QFPA 4DXUA 1I6BA 1A54A 4I8CA 2I3VA 2OLBA 5DEXB 1LLSA 2QVRA 3LV0A 4PDDA 1D9QA 4H65A 3O97A 4ZDMA 4NQ8A 4MBPA 5IZZA 4G8HA 3FASA 1GTKA 5ET5A 4X8RA 3BKIB 3ISPA 3NOHA 4LN5A 3SEXA 3M3LA 3THIA 1OIBA 1YXIA 4QRZA 5JK4A 1IMFA 3S9NC 1WODA 3QUJA 1QW0A 4GWUA 2O84X 2PFZA 1J1NA 2JJKA 3K0VA 2Z8FA 4DIGA 4OHNA 2P0SA 3KZGA 1B5JA 2ZZWA 3Q28A 3E78A 1B7ZA 4QHQA 2ZMBA 2D3IA 3ECRA 2ZNTA 4N13A 4NWCA 2PT2A 2XWIA 4KYEA 5K2XA 5IGAA 1SW5A 3LSLA 3V89B 2WYKA 4POWA 2XX7A 2PCRA 4LQ5A 1I6QA 2R71A 3RNNA 4RPOA 2OBGA 1DMBA 4YZZA 2NUVA 2Z22A 1B46A 5FTHA 2UYEA 2ESNA 1Y1ZA 2DSFA 1KA0A 2UYFA 2OWTA 2A5TB 1H43A 4G68C 4DLDA 4GVOA 4O94A 4MCOA 3L6GA 1FPLA 3TTLA 1BKAA 3ZS6A 4UA8A 2DE4A 1CB6A 1OQHA 1NNTA 1D4NA 1EZ9A 3RPWA 2B3BA 2Q74A 3U92A 1FBGA 1B51A 2F8DA 3EN3A 1PBPA 2OWZA 5I59B 1P99A 3FXRA 1II5A 4PETA 1N3XA 1FTMA 1FTKA 2G29A 5CBRA 1A55A 2X7PA 1NV3A 1MY2A 4ELPA 4IR8A 4PFWA 2NXOA 3K6UA 4YB7A 3W15C 4YMAA 4IO5A 1ZU0A 4IO6A 3CFXA 1DK4A 4N8GA 2ZYMA 3C33A 2B4MA 3UK4A 2PYYA 4BLAA 1QGXA 2Q88A 4H6DA 3PTYA 1RDYA 4IO2A 2PT1A 3CFZA 3VLVA 3M3KA 5CMBA 2DS9A 2F7CA 5AA3A 3ZKKA 2XXUA 1FQEA 2Y5KA 4QSCA 2DOJA 2DQVA 1UIUA 4JVIA 3EHTA 1YCJA 1K9YA 3K1MA 1ZBMA 3RTWB 1YPNA 1ZTYA 2Z23A 1LBXA 1BP5A 3G3IA 3G3FA 4JDFA 3PPQA 4P47A 2QSXA 1AIVA 1MXVA 1FQCA 4ESXA 3K01A 2F36A 3KBZA 4GWWA 4O3BA 3T22A 4NF6A 3GLBA 3W9WA 3PMWA 2DXYA 4DE8A 2X26A 4G68B 2RC7A 1L5TA 1LBBA 3LUZA 3HFUA 2Y7RA 4ZE9A 4R74A 3K6VA 4KCDA 3K1NA 3DLNA 1Z7NE 1NUWA 4YAHX 1N76A 1CE2A 2E1SA 1N84A 5I3SA 2VGQA 3PMVA 4OYVA 4KQPA 1Z7ME 5CM6A 2Z8EA 1MPCA 4MLVA 2O1MA 3VDFA 3GZGA 4HCYA 3IAZA 2VPOA 5IZ3B 4XKNA 4ZEDA 4BDQA 4MH5A 1G0IA 2OX3A 3VVEA 4U4SA 4NG7A 4AB6A 1MDP1 3LSWA 1QUJA 4O3CA 2PFYA 2Y5LA 2OK2A 4DI3D 2Y7KA 3C36A 4XFEA 3IX1A 1PEBA 2RC8A 3GXAA 1DBZA 3KN7A 4M4GA 4QFNA 3C9HA 3KFMA 3S2VA 1B9JA 1Q35A 4ELQA 1FSAA 1LFHA 4HE1A 2ANJA 2G93A 3V5AA 5BWJA 2AL4A 3SEUA 4IO4A 3TTNA 3CI8A 5DW8A 3Q29A 1XVXA 4GX6A 4GWYA 4U4XA 4IGTA 3HHFA 1XVYA 3H03A 4MX6A 1MQDA 3T9VA 1SD3A 4XF5A 2V84A 1B1XA 3H6TA 4GFRA 4GWXA
chains in the Genus database with same CATH topology
1B32A 1MQGA 5H8QA 1MH4A 3T93B 3IB1A 1NKXA 3B7DA 5I56A 2Q9TA 2DWAA 2VOZA 4NTLA 4R75A 1UTHB 1T0KA 2Y84A 3QXMA 5M2VA 2CMOA 1DOTA 2DE3A 1DTGA 1QJMA 3PPOA 3V83A 1IXHA 1FQAA 4EXKA 4G77A 2HZLA 5EYFA 1D3KA 4N6PA 1N0TA 2AL5A 4QFLA 3MUQA 2REJA 5AA2D 2DVZA 5I58A 3DP6A 4GF8A 3RT6B 4EQ9A 3FVOA 4O3AA 3MQ9A 3QAXA 3HHGA 1MM7A 5L9OA 4OETA 5TPAB 2V93A 3Q25A 3VXBA 4R2FA 4ELRA 2H98A 4P0GA 2AIXA 1IITA 2I0BA 4U2RA 4XTCQ 3MP8A 5I2KB 1EH3A 1ZKBA 3O9PA 4HS7A 5K2YA 5I2KA 2HCAA 2DWHA 3M3FA 3PGFA 4U22A 1Y1MA 1R1NA 3IK6B 4WKMA 1N04A 3FJ7A 5CBSA 1LB9A 5H8NB 4G4PA 1UIVA 1MS7A 2OWSA 5CMMA 1DPEA 1JETA 3JV9A 3TQWA 4ZEFA 4PFYA 1B3FA 3O6IA 1A8EA 2V25A 4YKJA 1NH8A 1AMFA 5I58B 3TQLA 3SEWA 4GRKA 4OFOA 2A5TA 1B2HA 2HQ0A 3MZ9A 1SQYA 1VFDA 1GV8A 4R6KA 4HTGA 2F6PA 3RTFB 2Y7IA 1GGGA 5A5XB 4MLQA 3A3CA 3A09A 1JW5A 4LVQA 2UVGA 3BFUA 1ZMGA 3E9XA 4NMYA 4THIA 4ELOA 5A5XA 1Y3QA 2QL3A 2AYSA 1Y3PA 3CSGA 2XXQA 1OQGA 4P0IA 1QKAA 1NMUA 3KN8A 3OO8A 4UACA 3FVGA 3RQTA 4R6HA 3EQ1A 2H4IA 3ZKLA 2ZNSA 4KCCA 2NVUB 1EU8A 3JYRA 4POXA 3S4UA 3PPPA 1PC3A 2H9BA 3DP8A 4I9DA 4Q8RA 2Y7PA 3TUSA 3RY3A 5L8DA 3N5LA 1IXCA 3G3KA 3MW0A 3KGCA 3N26A 4FECA 1SBPA 2THIA 4MF3A 4JWYA 3G3JA 4FIMA 1POY1 4F3GA 3GBBA 2HAUA 3K6XA 3CG1A 3N6TA 3I5OA 4TLMB 3T66A 1O7TA 2W7YA 3O2AA 3SKPA 4Q5TA 3T9HB 4ECFA 2DYXA 5AA4A 2XXPA 1TWYA 5JTYA 1B5IA 2XXTA 4ZS9A 2XD2A 4OEUA 1FQBA 1I69A 2ABHA 4LP2B 2HZKA 3SERA 3VLWA 1OVTA 3KEIA 3PUWE 4IY5A 2GFEA 3MP1A 1JEVA 1FTLA 3WAEA 1SI1A 3N94A 2PX1A 4RA1A 4F19A 1NNFA 3K6WA 3O6HA 1LAFE 4TOZA 4QFPA 4DXUA 1H45A 1OLAA 3AXFA 4FEDA 1I6BA 1UTHA 3E4RA 3K1PA 3MVXA 1LFGA 4U21A 4U1OA 3IOUA 1A54A 1ELJA 4I8CA 1UTBB 2I3VA 1S50A 2OLBA 1TFDA 1SI0A 3FXUA 4OTEA 5H8QB 3T9XB 1NFTA 5DEXB 4F3BA 1PB9A 2ZYKA 3KOSA 1LLSA 1VR5A 3SEYA 1IUDA 3FV2A 1MDQA 2OJTA 4GIZA 5ISUA 4H8IA 4Q0CA 4NWDA 5L9SA 4FE8A 3WAFA 2CZLA 2ZNUA 4RY1A 3G3GA 4EXLA 4BDNA 4H65A 3O97A 2UVJA 3H7MA 4ZDMA 3VLUA 1QKBA 2YJPA 4MBPA 1S9TA 4G8HA 2RCBA 4OERA 3OXNA 3TPAA 2RC9A 3FASA 1PDAA 4ZEKA 1GTKA 1FQDA 2VD2A 3BKIB 2GHAA 1BTJA 2Q2CA 2KLFA 3LC8A 4JSOA 5DVFA 4BDRA 4OWDA 4C1UA 1B7UA 2UVHA 2X7QA 2YPNA 1URGA 3MJNA 3O66A 1P1OA 3QK6A 3FVKA 3DM0A 4LQ2A 5FHMA 4DXCA 3SEXA 5KDTA 2P1SA 2ZYOA 5ITOA 3M3LA 3THIA 4EF1A 5HM4B 1OIBA 4QRZA 5JK4A 2Q89A 3S9NC 1WODA 3VFJA 1AL3A 1ATGA 1RKMA 4NF5A 3QUJA 1QW0A 3UORA 3T96B 3KG2A 2O84X 2O68A 3IB2A 2Q2AA 4BDLA 1J1NA 4GXAA 4YB5A 5DVJA 3K0VA 2Z8FA 1OVBA 3EPEA 3FJGA 4DIGA 5FHNA 4GL0A 4OHNA 1Y4TA 2P0SA 1B3EA 3KZGA 1B5JA 1FTJA 3K4UA 1I6AA 1MY0A 5DEXA 3Q28A 1URDA 1O63A 1IXIA 1TFAA 2DWJA 4U1ZA 3TELA 3PU5A 3FIRA 5TPAA 1B7ZA 4JWXA 3PUXE 4QHQA 2ZMBA 3PD9A 2D3IA 3IJOB 3PV0E 4Q30B 1NNKA 3ECRA 2ZNTA 3GBAA 3O28A 1MY4A 2VHAA 1UQWA 3MZ1A 4N13A 4NWCA 4QFKA 4ESWA 1S7YA 3DP4A 1RYOA 1R6ZA 4RNSA 5FTIA 5H8FB 1O64A 1HSLA 3MBPA 2PT2A 4FJPA 4FAJA 1FW0A 4KYEA 2XXWA 1B0LA 4LONB 3FXQA 3W9VA 4F31B 3OEMA 5K2XA 3M8UA 3S9LC 1SW5A 1IZ1A 2YLNA 3LSLA 3MC2A 3TMGA 3V89B 4YKPA 5TP9B 4E0WA 2XXIA 2BJJX 3C35A 3HV1A 4POWA 4L17A 2XX7A 1SW4A 4LQ5A 4LZ7A 1A7LA 1N7WA 1I6QA 2R71A 4G8MA 4G2ZA 3RNNA 4TLLB 4RPOA 2OBGA 4R9FA 1B52A 1DMBA 4YZZA 4LZ8A 3OSQA 1B05A 2NUVA 1USYH 1A40A 2B65A 1LGBC 3IO6A 1JW1A 3T9UA 2I3WA 3CVGA 3PPRA 4X9TA 1GVCA 1B4HA 2Z22A 4E0XA 4F39A 4PE5B 1B46A 1ZIUA 3O6GA 5FTHA 5TU0A 2UYEA 2ESNA 4DDDA 1Y1ZA 4KYSA 1LSTA 4OMBA 4EUOA 4F29A 5LOMA 3I3VA 4GL8A 3LSXA 2DSFA 2UYFA 2F7AA 3VE1B 2H99A 4JSDA 4OESA 1VSOA 3H3GA 1SYIA 1QVSA 2OWTA 4F2OA 1LBCA 1NH7A 2A5TB 1USYE 4ND9A 1H43A 4G68C 4OXVA 5ELVA 3TTRA 3MZBA 3OSRA 4DLDA 3FGSA 3DELB 4GVOA 2O7UA 2XXYA 3LBSA 1DSNA 3RGYA 3C4MA 4GOTA 4H0WA 3U94A 4DXBA 2ONKE 3KOTA 2F7BA 3MWBA 1Y4CA 1US5A 3LSFB 3L6GA 5B70A 4KPTA 3ODBA 4DCXA 2RCAA 3USDA 2ONRA 1IXGA 3H6UA 3TTLA 3UN6A 2HAVA 3G3HA 4NE4A 5IKBA 1BKAA 5H8HB 3ZS6A 4UA8A 2XX9A 2DE4A 1UTBA 5CI5A 4DZ1A 4GLIA 5FHOA 3H6WA 1CB6A 1OQHA 1NNTA 5TP9A 1D4NA 1B0HA 3OO9A 3TAJA 1EZ9A 1WDNA 4G68A 3KJTA 3RPWA 2B3BA 3E3KA 2D21A 2F34A 4Z7EA 4KYDA 5HPQA 1B4ZA 2I49A 2NOOA 3U92A 2QMWA 4ZEBA 4KD5A 1B51A 4BDOA 2F8DA 3EN3A 1PBPA 1YAEA 2DP8A 4X48A 1TT1A 1BIYA 2R9JA 5I59B 3MVWA 1P99A 4YB6A 5EHMA 4QSEA 2REGA 1II5A 2QS2A 3FXRA 3LR1A 4PETA 3UP9A 1IEJA 4C0RA 3OEKA 5HBCA 5KCJB 4PFUA 1H3DA 1N3XA 3V8XB 1EZPA 3B6QA 1FTMA 4NF4B 5ICTA 1LCFA 1MXXA 1FTKA 4M1VA 4OVJA 5DT6A 4ZE8A 2G29A 5I57B 5J1DA 5H8HA 1FCKA 5CBRA 1PBQA 3PD8A 4ZZAA 2GH9A 1A55A 1M5BA 2RINA 2FYIA 1JVXA 2O69A 2X7PA 2F97A 5AE4A 3H4ZA 1Y9UA 4LZ5A 4EF2A 1POTA 1MY2A 1XC1A 1IIWA 2DE2A 3SESA 4ELPA 3S9EA 1PB7A 1SW2A 2OCUA 2Q8JA 1H44A 2GHBA 4OZ9A 4IO7A 4PFWA 4H5GA 2IA4A 2NXOA 4JWOA 4K3FA 4PQJA 4EQBA 4F22A 2M8CA 3K6UA 4YB7A 3W15C 4YMAA 1B1HA 4XXUA 2ZYNA 4IO5A 1ZU0A 2B3FA 3R6UA 4JBZA 1FQFA 2A5SA 4IO6A 3TZAA 2PBWA 1URSA 3QSLA 1QULA 2F78A 1YTVA 1B7HA 3CFXA 4FORA 2ZYMA 3RT8A 4N07A 1XS5A 3TKDA 3C33A 3MPLA 4C1TA 1SVXB 4MFIA 1ZLQA 3HO7A 4QFOA 3UK4A 2PYYA 4BLAA 4KI0E 4RXLA 3C31A 3SDFA 3U72A 2VP1A 1B3GA 2Q88A 2XHDA 3FJMA 4H6DA 4P11A 5H8NA 3ONMA 4IGRA 4G8NA 2VD3A 1MH3A 2PT1A 4IO2A 3UA8A 5KZTA 3CFZA 3VVDA 2QPQA 2WKYA 2FNCA 3H6VA 2F35A 3VLVA 1NL5A 3VV5A 3CIJA 4Z0IA 1OMPA 3M3KA 1VFEA 5KCJA 1H76A 5CMBA 2DS9A 2F7CA 5AA3A 4RJZA 3ZKKA 1HSEA 4WEDA 2XXUA 4I1DA 4IB2A 1FQEA 4NF8B 5CMCA 1N3WA 4F2QA 3L6HA 2H5YA 3SETA 2UXAA 1JEUA 4QSCA 2DOJA 1B3HA 3F11A 4OEVA 5IAIA 2HXWA 2DQVA 3TYHA 5JTYB 1B5HA 1MRPA 1UIUA 5CRYA 3EHTA 2XXVA 1YCJA 4R73A 5AA4B 3OO6A 3OELA 1N7XA 4TQUQ 3UGWA 2F6GA 3KJ7A 4OENA 3K1MA 1ZBMA 3RTWB 1YPNA 1LAGE 3QYTA 3KN3A 4ZEIA 3D4CA 1P1NA 1ZTYA 3IO4A 4WXJA 3ZSFA 2Z23A 4U23A 2OZZA 1BP5A 1LAXA 1HSJA 3EHSA 3G3IA 3G3FA 3LUYA 1TXFA 4JB7A 4JDFA 4H1XA 1SDXA 1R9QA 5ICQA 3PPQA 3MPKA 1JQFA 1JW4A 2XXXA 5AA1A 2F5XA 3D4GA 4LUBA 2QSXA 1AIVA 1M5FA 2XXRA 2Z8DA 1MXVA 1AOVA 5I57A 1ANFA 2O51A 4NEDA 1MPDA 3R7XA 1B40A 1FQCA 2UVIA 4KFQA 3B6TA 3RLFE 2I6EA 4ESXA 5KDTB 3K01A 1Q1KA 3CRBA 3IOVA 4YMBA 1QUIA 1KWHA 4HW8A 2F36A 3MP6A 4O3BA 2DWIA 5I59A 3T22A 3OENA 4QSDA 5B7DA 1P1WA 3IJXB 4NF6A 3GLBA 4OQOA 3TDJA 3W9WA 5EHSA 3PPNA 4H5FA 3PMWA 3SEVA 2DXYA 1FTOA 1DTZA 3FD3A 4H67A 4DE8A 1PB8A 2X26A 3H06B 4G68B 4F1YA 4F1UA 5JEIA 1ZJLA 1MXZA 4HCWA 2RKMA 2RC7A 4JXIA 1F9BA 2QJEA 3IOTA 3KBRA 4OFLA 1LBBA 2QRYA 1L5TA 3HSTA 1MQJA 3CSBA 4X1BA 3TCHA 1MY3A 3CFLA 2Y7RA 1B3LA 4ZE9A 4R74A 4ONYA 3K6VA 4KCDA 1MQIA 2R6GE 3K1NA 3DLNA 3R26A 1LAHE 3G7WA 3U93A 5ITPA 4IO3A 1Z7NE 2NWJA 4YU0A 3UIFA 2Y7WA 5DYHA 4GD5A 2PVUA 2QS3A 3RUMA 3HPIA 3CR9A 3IOWA 4AQ4A 4F18A 3ILUB 3S9MC 2I4CA 3MVYA 3CG3A 1N76A 4YAHX 1CE2A 2ZXTA 3E13X 3OD7A 2E1SA 3Q26A 1N84A 1SW1A 2PMSA 4NF6B 4OFJA 4RK2A 1SYHA 2VGQA 3PMVA 1MY1A 1IQ7A 3A3UA 4GQOA 3TCGA 5I2NB 1EZOA 4OYVA 3I6VA 1VE4A 3OO7A 3TTKA 4YICA 4KQPA 3FV1A 1AH5A 1MXUA 1Z7ME 3TFLA 5CM6A 2XD3A 1P1UA 1MPCA 2Z8EA 1M5EA 4XIGQ 4MLVA 2LAOA 2IEEA 2O1MA 2QS4A 3GZGA 4HCYA 4QF9A 3VDFA 3IAZA 4FEBA 3IL1B 4R6YA 3EF7A 3N6UA 3O29A 3C32A 1B58A 3PUYE 4XKNA 1M5DA 3OMBA 4ZEDA 2V3TA 4MH5A 4BDQA 1D9VA 2HFBA 2DXRA 4YKKA 3PMXA 3HCQA 4NF5B 5F7VA 1GR2A 1MG1A 5AA2A 3VVEA 1R9LA 4DCYA 3JZJA 1XHYA 4U4SA 5H8SA 5CC2A 2DVCA 4NF4A 5I84A 4XKQA 4GWOA 4AB6A 1MDP1 3LSWA 1QUJA 2I48A 1M5CA 4O3CA 3HN0A 3TEPA 4ZECA 4IY6A 2D5WA 1NNPA 1XOCA 2I4BA 4RK9A 5H8FA 2OK2A 1MXWA 4RPNA 3VVFA 1DPPA 2H25A 2Y7KA 3C36A 4R9GA 2V3UA 4KHZE 5F1QA 3P7IA 2ALUA 5I2NA 3IX1A 1PEBA 1Y20A 2RC8A 4KR5A 5DTBA 3GXAA 3QIMA 3KN7A 2QMXA 4H8JA 4NF8A 4M4GA 2HEUA 2QS1A 1P1QA 3FUZA 1US4A 4QFNA 2V3QA 2XXHA 3C9HA 3PUVE 4YKIA 3RN8A 4FATA 5CMKA 4RYAA 3Q27A 3KFMA 3OOAA 1RYXA 3S2VA 3C34A 1WVJA 3KSJA 1B9JA 4LA9A 1MXYA 1Q35A 4AB5A 4ELQA 2XX8A 4F3PA 1B6HA 3VXCA 3KSXA 2O6AA 3FATA 1LFHA 1JVYA 4ISUA 2ANJA 2G93A 3QUFA 4LATA 3V5AA 1LFIA 5BWJA 2AL4A 3BFTA 1MQHA 4IO4A 3SEUA 2I0CA 3TTNA 3CI8A 3EHUA 4BDMA 3U1OA 5DVIA 3Q29A 4F1VA 2RF1A 3TCFA 1LB8A 1XVXA 1Y3NA 1A8FA 2P2AA 3ILTB 4WEPA 4U4XA 2O1LA 3U8QA 1MM6A 1A99A 3MVZA 3PUZE 3BBRA 3IB0A 3IR1A 2GRVA 4X1DA 4XKPA 4IGTA 1XT8A 1MPBA 1XVYA 3HHFA 3B6WA 4GXSB 5BUUA 1QUKA 4XKRA 3H03A 5I56B 3FVNA 3K02A 3K00A 3TTMA 2O7IA 1MQDA 3IORA 1OLCA 4ZZEA 5AA2B 3K2DA 2E0SA 4F3SA 1LCTA 2FA7A 4PP0A 4I62A 4EQ7A 1D9YA 3T9VA 4R72A 1JNFA 1SD3A 4EDPA 2V84A 3MAMA 4PFTA 5L9MA 1B1XA 1BLFA 4R2BA 2I58A 3FZVA 3H6TA 4GFRA 3TODA 2ONSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B32 A;  1MQG A;  5H8Q A;  1MH4 A;  3T93 B;  3IB1 A;  1NKX A;  3B7D A;  5I56 A;  2Q9T A;  2DWA A;  2VOZ A;  4NTL A;  4R75 A;  1UTH B;  1T0K A;  2Y84 A;  3QXM A;  5M2V A;  2CMO A;  1DOT A;  2DE3 A;  1DTG A;  1QJM A;  3PPO A;  3V83 A;  1IXH A;  1FQA A;  4EXK A;  4G77 A;  2HZL A;  5EYF A;  1D3K A;  4N6P A;  1N0T A;  2AL5 A;  4QFL A;  3MUQ A;  2REJ A;  5AA2 D;  2DVZ A;  5I58 A;  3DP6 A;  4GF8 A;  3RT6 B;  4EQ9 A;  3FVO A;  4O3A A;  3MQ9 A;  3QAX A;  3HHG A;  1MM7 A;  5L9O A;  4OET A;  5TPA B;  2V93 A;  3Q25 A;  3VXB A;  4R2F A;  4ELR A;  2H98 A;  4P0G A;  2AIX A;  1IIT A;  2I0B A;  4U2R A;  4XTC Q;  3MP8 A;  5I2K B;  1EH3 A;  1ZKB A;  3O9P A;  4HS7 A;  5K2Y A;  5I2K A;  2HCA A;  2DWH A;  3M3F A;  3PGF A;  4U22 A;  1Y1M A;  1R1N A;  3IK6 B;  4WKM A;  1N04 A;  3FJ7 A;  5CBS A;  1LB9 A;  5H8N B;  4G4P A;  1UIV A;  1MS7 A;  2OWS A;  5CMM A;  1DPE A;  1JET A;  3JV9 A;  3TQW A;  4ZEF A;  4PFY A;  1B3F A;  3O6I A;  1A8E A;  2V25 A;  4YKJ A;  1NH8 A;  1AMF A;  5I58 B;  3TQL A;  3SEW A;  4GRK A;  4OFO A;  2A5T A;  1B2H A;  2HQ0 A;  3MZ9 A;  1SQY A;  1VFD A;  1GV8 A;  4R6K A;  4HTG A;  2F6P A;  3RTF B;  2Y7I A;  1GGG A;  5A5X B;  4MLQ A;  3A3C A;  3A09 A;  1JW5 A;  4LVQ A;  2UVG A;  3BFU A;  1ZMG A;  3E9X A;  4NMY A;  4THI A;  4ELO A;  5A5X A;  1Y3Q A;  2QL3 A;  2AYS A;  1Y3P A;  3CSG A;  2XXQ A;  1OQG A;  4P0I A;  1QKA A;  1NMU A;  3KN8 A;  3OO8 A;  4UAC A;  3FVG A;  3RQT A;  4R6H A;  3EQ1 A;  2H4I A;  3ZKL A;  2ZNS A;  4KCC A;  2NVU B;  1EU8 A;  3JYR A;  4POX A;  3S4U A;  3PPP A;  1PC3 A;  2H9B A;  3DP8 A;  4I9D A;  4Q8R A;  2Y7P A;  3TUS A;  3RY3 A;  5L8D A;  3N5L A;  1IXC A;  3G3K A;  3MW0 A;  3KGC A;  3N26 A;  4FEC A;  1SBP A;  2THI A;  4MF3 A;  4JWY A;  3G3J A;  4FIM A;  1POY 1;  4F3G A;  3GBB A;  2HAU A;  3K6X A;  3CG1 A;  3N6T A;  3I5O A;  4TLM B;  3T66 A;  1O7T A;  2W7Y A;  3O2A A;  3SKP A;  4Q5T A;  3T9H B;  4ECF A;  2DYX A;  5AA4 A;  2XXP A;  1TWY A;  5JTY A;  1B5I A;  2XXT A;  4ZS9 A;  2XD2 A;  4OEU A;  1FQB A;  1I69 A;  2ABH A;  4LP2 B;  2HZK A;  3SER A;  3VLW A;  1OVT A;  3KEI A;  3PUW E;  4IY5 A;  2GFE A;  3MP1 A;  1JEV A;  1FTL A;  3WAE A;  1SI1 A;  3N94 A;  2PX1 A;  4RA1 A;  4F19 A;  1NNF A;  3K6W A;  3O6H A;  1LAF E;  4TOZ A;  4QFP A;  4DXU A;  1H45 A;  1OLA A;  3AXF A;  4FED A;  1I6B A;  1UTH A;  3E4R A;  3K1P A;  3MVX A;  1LFG A;  4U21 A;  4U1O A;  3IOU A;  1A54 A;  1ELJ A;  4I8C A;  1UTB B;  2I3V A;  1S50 A;  2OLB A;  1TFD A;  1SI0 A;  3FXU A;  4OTE A;  5H8Q B;  3T9X B;  1NFT A;  5DEX B;  4F3B A;  1PB9 A;  2ZYK A;  3KOS A;  1LLS A;  1VR5 A;  3SEY A;  1IUD A;  3FV2 A;  1MDQ A;  2OJT A;  4GIZ A;  5ISU A;  4H8I A;  4Q0C A;  4NWD A;  5L9S A;  4FE8 A;  3WAF A;  2CZL A;  2ZNU A;  4RY1 A;  3G3G A;  4EXL A;  4BDN A;  4H65 A;  3O97 A;  2UVJ A;  3H7M A;  4ZDM A;  3VLU A;  1QKB A;  2YJP A;  4MBP A;  1S9T A;  4G8H A;  2RCB A;  4OER A;  3OXN A;  3TPA A;  2RC9 A;  3FAS A;  1PDA A;  4ZEK A;  1GTK A;  1FQD A;  2VD2 A;  3BKI B;  2GHA A;  1BTJ A;  2Q2C A;  2KLF A;  3LC8 A;  4JSO A;  5DVF A;  4BDR A;  4OWD A;  4C1U A;  1B7U A;  2UVH A;  2X7Q A;  2YPN A;  1URG A;  3MJN A;  3O66 A;  1P1O A;  3QK6 A;  3FVK A;  3DM0 A;  4LQ2 A;  5FHM A;  4DXC A;  3SEX A;  5KDT A;  2P1S A;  2ZYO A;  5ITO A;  3M3L A;  3THI A;  4EF1 A;  5HM4 B;  1OIB A;  4QRZ A;  5JK4 A;  2Q89 A;  3S9N C;  1WOD A;  3VFJ A;  1AL3 A;  1ATG A;  1RKM A;  4NF5 A;  3QUJ A;  1QW0 A;  3UOR A;  3T96 B;  3KG2 A;  2O84 X;  2O68 A;  3IB2 A;  2Q2A A;  4BDL A;  1J1N A;  4GXA A;  4YB5 A;  5DVJ A;  3K0V A;  2Z8F A;  1OVB A;  3EPE A;  3FJG A;  4DIG A;  5FHN A;  4GL0 A;  4OHN A;  1Y4T A;  2P0S A;  1B3E A;  3KZG A;  1B5J A;  1FTJ A;  3K4U A;  1I6A A;  1MY0 A;  5DEX A;  3Q28 A;  1URD A;  1O63 A;  1IXI A;  1TFA A;  2DWJ A;  4U1Z A;  3TEL A;  3PU5 A;  3FIR A;  5TPA A;  1B7Z A;  4JWX A;  3PUX E;  4QHQ A;  2ZMB A;  3PD9 A;  2D3I A;  3IJO B;  3PV0 E;  4Q30 B;  1NNK A;  3ECR A;  2ZNT A;  3GBA A;  3O28 A;  1MY4 A;  2VHA A;  1UQW A;  3MZ1 A;  4N13 A;  4NWC A;  4QFK A;  4ESW A;  1S7Y A;  3DP4 A;  1RYO A;  1R6Z A;  4RNS A;  5FTI A;  5H8F B;  1O64 A;  1HSL A;  3MBP A;  2PT2 A;  4FJP A;  4FAJ A;  1FW0 A;  4KYE A;  2XXW A;  1B0L A;  4LON B;  3FXQ A;  3W9V A;  4F31 B;  3OEM A;  5K2X A;  3M8U A;  3S9L C;  1SW5 A;  1IZ1 A;  2YLN A;  3LSL A;  3MC2 A;  3TMG A;  3V89 B;  4YKP A;  5TP9 B;  4E0W A;  2XXI A;  2BJJ X;  3C35 A;  3HV1 A;  4POW A;  4L17 A;  2XX7 A;  1SW4 A;  4LQ5 A;  4LZ7 A;  1A7L A;  1N7W A;  1I6Q A;  2R71 A;  4G8M A;  4G2Z A;  3RNN A;  4TLL B;  4RPO A;  2OBG A;  4R9F A;  1B52 A;  1DMB A;  4YZZ A;  4LZ8 A;  3OSQ A;  1B05 A;  2NUV A;  1USY H;  1A40 A;  2B65 A;  1LGB C;  3IO6 A;  1JW1 A;  3T9U A;  2I3W A;  3CVG A;  3PPR A;  4X9T A;  1GVC A;  1B4H A;  2Z22 A;  4E0X A;  4F39 A;  4PE5 B;  1B46 A;  1ZIU A;  3O6G A;  5FTH A;  5TU0 A;  2UYE A;  2ESN A;  4DDD A;  1Y1Z A;  4KYS A;  1LST A;  4OMB A;  4EUO A;  4F29 A;  5LOM A;  3I3V A;  4GL8 A;  3LSX A;  2DSF A;  2UYF A;  2F7A A;  3VE1 B;  2H99 A;  4JSD A;  4OES A;  1VSO A;  3H3G A;  1SYI A;  1QVS A;  2OWT A;  4F2O A;  1LBC A;  1NH7 A;  2A5T B;  1USY E;  4ND9 A;  1H43 A;  4G68 C;  4OXV A;  5ELV A;  3TTR A;  3MZB A;  3OSR A;  4DLD A;  3FGS A;  3DEL B;  4GVO A;  2O7U A;  2XXY A;  3LBS A;  1DSN A;  3RGY A;  3C4M A;  4GOT A;  4H0W A;  3U94 A;  4DXB A;  2ONK E;  3KOT A;  2F7B A;  3MWB A;  1Y4C A;  1US5 A;  3LSF B;  3L6G A;  5B70 A;  4KPT A;  3ODB A;  4DCX A;  2RCA A;  3USD A;  2ONR A;  1IXG A;  3H6U A;  3TTL A;  3UN6 A;  2HAV A;  3G3H A;  4NE4 A;  5IKB A;  1BKA A;  5H8H B;  3ZS6 A;  4UA8 A;  2XX9 A;  2DE4 A;  1UTB A;  5CI5 A;  4DZ1 A;  4GLI A;  5FHO A;  3H6W A;  1CB6 A;  1OQH A;  1NNT A;  5TP9 A;  1D4N A;  1B0H A;  3OO9 A;  3TAJ A;  1EZ9 A;  1WDN A;  4G68 A;  3KJT A;  3RPW A;  2B3B A;  3E3K A;  2D21 A;  2F34 A;  4Z7E A;  4KYD A;  5HPQ A;  1B4Z A;  2I49 A;  2NOO A;  3U92 A;  2QMW A;  4ZEB A;  4KD5 A;  1B51 A;  4BDO A;  2F8D A;  3EN3 A;  1PBP A;  1YAE A;  2DP8 A;  4X48 A;  1TT1 A;  1BIY A;  2R9J A;  5I59 B;  3MVW A;  1P99 A;  4YB6 A;  5EHM A;  4QSE A;  2REG A;  1II5 A;  2QS2 A;  3FXR A;  3LR1 A;  4PET A;  3UP9 A;  1IEJ A;  4C0R A;  3OEK A;  5HBC A;  5KCJ B;  4PFU A;  1H3D A;  1N3X A;  3V8X B;  1EZP A;  3B6Q A;  1FTM A;  4NF4 B;  5ICT A;  1LCF A;  1MXX A;  1FTK A;  4M1V A;  4OVJ A;  5DT6 A;  4ZE8 A;  2G29 A;  5I57 B;  5J1D A;  5H8H A;  1FCK A;  5CBR A;  1PBQ A;  3PD8 A;  4ZZA A;  2GH9 A;  1A55 A;  1M5B A;  2RIN A;  2FYI A;  1JVX A;  2O69 A;  2X7P A;  2F97 A;  5AE4 A;  3H4Z A;  1Y9U A;  4LZ5 A;  4EF2 A;  1POT A;  1MY2 A;  1XC1 A;  1IIW A;  2DE2 A;  3SES A;  4ELP A;  3S9E A;  1PB7 A;  1SW2 A;  2OCU A;  2Q8J A;  1H44 A;  2GHB A;  4OZ9 A;  4IO7 A;  4PFW A;  4H5G A;  2IA4 A;  2NXO A;  4JWO A;  4K3F A;  4PQJ A;  4EQB A;  4F22 A;  2M8C A;  3K6U A;  4YB7 A;  3W15 C;  4YMA A;  1B1H A;  4XXU A;  2ZYN A;  4IO5 A;  1ZU0 A;  2B3F A;  3R6U A;  4JBZ A;  1FQF A;  2A5S A;  4IO6 A;  3TZA A;  2PBW A;  1URS A;  3QSL A;  1QUL A;  2F78 A;  1YTV A;  1B7H A;  3CFX A;  4FOR A;  2ZYM A;  3RT8 A;  4N07 A;  1XS5 A;  3TKD A;  3C33 A;  3MPL A;  4C1T A;  1SVX B;  4MFI A;  1ZLQ A;  3HO7 A;  4QFO A;  3UK4 A;  2PYY A;  4BLA A;  4KI0 E;  4RXL A;  3C31 A;  3SDF A;  3U72 A;  2VP1 A;  1B3G A;  2Q88 A;  2XHD A;  3FJM A;  4H6D A;  4P11 A;  5H8N A;  3ONM A;  4IGR A;  4G8N A;  2VD3 A;  1MH3 A;  2PT1 A;  4IO2 A;  3UA8 A;  5KZT A;  3CFZ A;  3VVD A;  2QPQ A;  2WKY A;  2FNC A;  3H6V A;  2F35 A;  3VLV A;  1NL5 A;  3VV5 A;  3CIJ A;  4Z0I A;  1OMP A;  3M3K A;  1VFE A;  5KCJ A;  1H76 A;  5CMB A;  2DS9 A;  2F7C A;  5AA3 A;  4RJZ A;  3ZKK A;  1HSE A;  4WED A;  2XXU A;  4I1D A;  4IB2 A;  1FQE A;  4NF8 B;  5CMC A;  1N3W A;  4F2Q A;  3L6H A;  2H5Y A;  3SET A;  2UXA A;  1JEU A;  4QSC A;  2DOJ A;  1B3H A;  3F11 A;  4OEV A;  5IAI A;  2HXW A;  2DQV A;  3TYH A;  5JTY B;  1B5H A;  1MRP A;  1UIU A;  5CRY A;  3EHT A;  2XXV A;  1YCJ A;  4R73 A;  5AA4 B;  3OO6 A;  3OEL A;  1N7X A;  4TQU Q;  3UGW A;  2F6G A;  3KJ7 A;  4OEN A;  3K1M A;  1ZBM A;  3RTW B;  1YPN A;  1LAG E;  3QYT A;  3KN3 A;  4ZEI A;  3D4C A;  1P1N A;  1ZTY A;  3IO4 A;  4WXJ A;  3ZSF A;  2Z23 A;  4U23 A;  2OZZ A;  1BP5 A;  1LAX A;  1HSJ A;  3EHS A;  3G3I A;  3G3F A;  3LUY A;  1TXF A;  4JB7 A;  4JDF A;  4H1X A;  1SDX A;  1R9Q A;  5ICQ A;  3PPQ A;  3MPK A;  1JQF A;  1JW4 A;  2XXX A;  5AA1 A;  2F5X A;  3D4G A;  4LUB A;  2QSX A;  1AIV A;  1M5F A;  2XXR A;  2Z8D A;  1MXV A;  1AOV A;  5I57 A;  1ANF A;  2O51 A;  4NED A;  1MPD A;  3R7X A;  1B40 A;  1FQC A;  2UVI A;  4KFQ A;  3B6T A;  3RLF E;  2I6E A;  4ESX A;  5KDT B;  3K01 A;  1Q1K A;  3CRB A;  3IOV A;  4YMB A;  1QUI A;  1KWH A;  4HW8 A;  2F36 A;  3MP6 A;  4O3B A;  2DWI A;  5I59 A;  3T22 A;  3OEN A;  4QSD A;  5B7D A;  1P1W A;  3IJX B;  4NF6 A;  3GLB A;  4OQO A;  3TDJ A;  3W9W A;  5EHS A;  3PPN A;  4H5F A;  3PMW A;  3SEV A;  2DXY A;  1FTO A;  1DTZ A;  3FD3 A;  4H67 A;  4DE8 A;  1PB8 A;  2X26 A;  3H06 B;  4G68 B;  4F1Y A;  4F1U A;  5JEI A;  1ZJL A;  1MXZ A;  4HCW A;  2RKM A;  2RC7 A;  4JXI A;  1F9B A;  2QJE A;  3IOT A;  3KBR A;  4OFL A;  1LBB A;  2QRY A;  1L5T A;  3HST A;  1MQJ A;  3CSB A;  4X1B A;  3TCH A;  1MY3 A;  3CFL A;  2Y7R A;  1B3L A;  4ZE9 A;  4R74 A;  4ONY A;  3K6V A;  4KCD A;  1MQI A;  2R6G E;  3K1N A;  3DLN A;  3R26 A;  1LAH E;  3G7W A;  3U93 A;  5ITP A;  4IO3 A;  1Z7N E;  2NWJ A;  4YU0 A;  3UIF A;  2Y7W A;  5DYH A;  4GD5 A;  2PVU A;  2QS3 A;  3RUM A;  3HPI A;  3CR9 A;  3IOW A;  4AQ4 A;  4F18 A;  3ILU B;  3S9M C;  2I4C A;  3MVY A;  3CG3 A;  1N76 A;  4YAH X;  1CE2 A;  2ZXT A;  3E13 X;  3OD7 A;  2E1S A;  3Q26 A;  1N84 A;  1SW1 A;  2PMS A;  4NF6 B;  4OFJ A;  4RK2 A;  1SYH A;  2VGQ A;  3PMV A;  1MY1 A;  1IQ7 A;  3A3U A;  4GQO A;  3TCG A;  5I2N B;  1EZO A;  4OYV A;  3I6V A;  1VE4 A;  3OO7 A;  3TTK A;  4YIC A;  4KQP A;  3FV1 A;  1AH5 A;  1MXU A;  1Z7M E;  3TFL A;  5CM6 A;  2XD3 A;  1P1U A;  1MPC A;  2Z8E A;  1M5E A;  4XIG Q;  4MLV A;  2LAO A;  2IEE A;  2O1M A;  2QS4 A;  3GZG A;  4HCY A;  4QF9 A;  3VDF A;  3IAZ A;  4FEB A;  3IL1 B;  4R6Y A;  3EF7 A;  3N6U A;  3O29 A;  3C32 A;  1B58 A;  3PUY E;  4XKN A;  1M5D A;  3OMB A;  4ZED A;  2V3T A;  4MH5 A;  4BDQ A;  1D9V A;  2HFB A;  2DXR A;  4YKK A;  3PMX A;  3HCQ A;  4NF5 B;  5F7V A;  1GR2 A;  1MG1 A;  5AA2 A;  3VVE A;  1R9L A;  4DCY A;  3JZJ A;  1XHY A;  4U4S A;  5H8S A;  5CC2 A;  2DVC A;  4NF4 A;  5I84 A;  4XKQ A;  4GWO A;  4AB6 A;  1MDP 1;  3LSW A;  1QUJ A;  2I48 A;  1M5C A;  4O3C A;  3HN0 A;  3TEP A;  4ZEC A;  4IY6 A;  2D5W A;  1NNP A;  1XOC A;  2I4B A;  4RK9 A;  5H8F A;  2OK2 A;  1MXW A;  4RPN A;  3VVF A;  1DPP A;  2H25 A;  2Y7K A;  3C36 A;  4R9G A;  2V3U A;  4KHZ E;  5F1Q A;  3P7I A;  2ALU A;  5I2N A;  3IX1 A;  1PEB A;  1Y20 A;  2RC8 A;  4KR5 A;  5DTB A;  3GXA A;  3QIM A;  3KN7 A;  2QMX A;  4H8J A;  4NF8 A;  4M4G A;  2HEU A;  2QS1 A;  1P1Q A;  3FUZ A;  1US4 A;  4QFN A;  2V3Q A;  2XXH A;  3C9H A;  3PUV E;  4YKI A;  3RN8 A;  4FAT A;  5CMK A;  4RYA A;  3Q27 A;  3KFM A;  3OOA A;  1RYX A;  3S2V A;  3C34 A;  1WVJ A;  3KSJ A;  1B9J A;  4LA9 A;  1MXY A;  1Q35 A;  4AB5 A;  4ELQ A;  2XX8 A;  4F3P A;  1B6H A;  3VXC A;  3KSX A;  2O6A A;  3FAT A;  1LFH A;  1JVY A;  4ISU A;  2ANJ A;  2G93 A;  3QUF A;  4LAT A;  3V5A A;  1LFI A;  5BWJ A;  2AL4 A;  3BFT A;  1MQH A;  4IO4 A;  3SEU A;  2I0C A;  3TTN A;  3CI8 A;  3EHU A;  4BDM A;  3U1O A;  5DVI A;  3Q29 A;  4F1V A;  2RF1 A;  3TCF A;  1LB8 A;  1XVX A;  1Y3N A;  1A8F A;  2P2A A;  3ILT B;  4WEP A;  4U4X A;  2O1L A;  3U8Q A;  1MM6 A;  1A99 A;  3MVZ A;  3PUZ E;  3BBR A;  3IB0 A;  3IR1 A;  2GRV A;  4X1D A;  4XKP A;  4IGT A;  1XT8 A;  1MPB A;  1XVY A;  3HHF A;  3B6W A;  4GXS B;  5BUU A;  1QUK A;  4XKR A;  3H03 A;  5I56 B;  3FVN A;  3K02 A;  3K00 A;  3TTM A;  2O7I A;  1MQD A;  3IOR A;  1OLC A;  4ZZE A;  5AA2 B;  3K2D A;  2E0S A;  4F3S A;  1LCT A;  2FA7 A;  4PP0 A;  4I62 A;  4EQ7 A;  1D9Y A;  3T9V A;  4R72 A;  1JNF A;  1SD3 A;  4EDP A;  2V84 A;  3MAM A;  4PFT A;  5L9M A;  1B1X A;  1BLF A;  4R2B A;  2I58 A;  3FZV A;  3H6T A;  4GFR A;  3TOD A;  2ONS A; 
#chains in the Genus database with same CATH topology
 4GBW A;  1BK4 A;  1NKX A;  1UTH B;  1DOT A;  2DE3 A;  1QJM A;  3V83 A;  1AWB A;  4G77 A;  2HZL A;  5EYF A;  2WEF A;  4PF6 A;  3RT6 B;  4P8B A;  1MM7 A;  1NV6 A;  2V93 A;  4ELR A;  2H98 A;  1IIT A;  4U2R A;  4XTC Q;  1EH3 A;  4HS7 A;  3IK6 B;  5CBS A;  3FJ7 A;  1LB9 A;  4G4P A;  1MS7 A;  2OWS A;  3TQW A;  2V25 A;  3IFC A;  1AMF A;  2QVV A;  3TQL A;  1B2H A;  1VFD A;  4R6K A;  3RTF B;  2GQ1 A;  2Y7I A;  3A09 A;  1JW5 A;  5A5X A;  1FPI A;  4AS5 A;  1QKA A;  1NMU A;  3EKI A;  3ZKL A;  2ZNS A;  3PPP A;  1PC3 A;  2H9B A;  4I9D A;  3RY3 A;  2THI A;  3G3J A;  2P3V A;  1POY 1;  3I5O A;  3T9H B;  4ECF A;  2DYX A;  4OEU A;  2HZK A;  3VLW A;  1JEV A;  1FTL A;  4RA1 A;  4N15 A;  1LAF E;  1H45 A;  3AXF A;  3E4R A;  1LFG A;  3IOU A;  3T9X B;  1S50 A;  4F3B A;  5H8Q B;  1NFT A;  1PB9 A;  2ZYK A;  3SEY A;  1VR5 A;  3FV2 A;  1MDQ A;  4GWZ A;  2OJT A;  4H8I A;  4FE8 A;  4RY1 A;  2ZNU A;  4NAP A;  4BDN A;  2YJP A;  3OXN A;  2RC9 A;  4ZEK A;  3E79 A;  2KLF A;  4LQ2 A;  5KDT A;  3DM0 A;  2ZYO A;  5HM4 B;  4GWS A;  1NV2 A;  1RKM A;  4NF5 A;  3UOR A;  2O68 A;  2Q2A A;  4GXA A;  5DVJ A;  1OVB A;  5FHN A;  4GL0 A;  1B3E A;  1FTJ A;  2CEY A;  5DEX A;  1I6A A;  1MY0 A;  3TEL A;  5TPA A;  4Q30 B;  4QFK A;  1MY4 A;  2VHA A;  3MZ1 A;  4ESW A;  4RNS A;  5FTI A;  1O64 A;  4FJP A;  3FXQ A;  1FPF A;  4YKP A;  5TP9 B;  1FBC A;  2XXI A;  4QBA A;  4LZ7 A;  1A7L A;  2DDK A;  4G2Z A;  1A40 A;  2B65 A;  3T9U A;  1VDW A;  2I3W A;  3CVG A;  4F39 A;  3O6G A;  4KYS A;  1LST A;  3I3V A;  3LSX A;  4JSD A;  4OES A;  1VSO A;  3H3G A;  1SYI A;  1QVS A;  4MNC A;  1NH7 A;  5ELV A;  2XXY A;  2ONK E;  3LSF B;  4DCX A;  2ONR A;  3UN6 A;  2HAV A;  2BJI A;  3G3H A;  4NE4 A;  5H8H B;  4DZ1 A;  5TP9 A;  3H6W A;  3OO9 A;  2Q8M A;  3TAJ A;  1FJ9 A;  3KJT A;  3E3K A;  2D21 A;  2NOO A;  2QMW A;  2DP8 A;  4X48 A;  1TT1 A;  1BIY A;  2R9J A;  3MVW A;  4YB6 A;  5EHM A;  3LR1 A;  3OEK A;  4ZE8 A;  4OVJ A;  1NUX A;  2FYI A;  4N81 A;  1RDZ A;  4LZ5 A;  2HHM A;  3S9E A;  5EYH A;  4H5G A;  4JWO A;  1IMB A;  1B1H A;  2ZYN A;  3QSL A;  3RT8 A;  1B7H A;  3TKD A;  1XS5 A;  1SVX B;  3HO7 A;  3FJM A;  4G8N A;  4N6K A;  2FNC A;  2F35 A;  1NL5 A;  3CIJ A;  4Z0I A;  1OMP A;  1FRP A;  1HSE A;  4WED A;  4IB2 A;  1N3W A;  4F2Q A;  4P56 A;  4OEV A;  1B5H A;  5CRY A;  2XXV A;  5AA4 B;  3OO6 A;  1NV5 A;  1LAG E;  2V4C A;  3KN3 A;  2FBP A;  3D4C A;  1P1N A;  1LAX A;  1HSJ A;  1TXF A;  4N8Y A;  2QFL A;  1SDX A;  1R9Q A;  1LBZ A;  1JQF A;  3D4G A;  2XXR A;  1JP4 A;  1ANF A;  4NED A;  1MPD A;  1B40 A;  2UVI A;  3RLF E;  3B6T A;  2L5V A;  3IOV A;  4YMB A;  1KWH A;  4MHF A;  3MST A;  3IJX B;  5EHS A;  3PPN A;  4H5F A;  3SEV A;  1DTZ A;  2CEX A;  3H06 B;  2RKM A;  4JXI A;  2QJE A;  4F29 A;  4DI4 B;  3HST A;  1MQJ A;  3TCH A;  4X1B A;  1MY3 A;  4ONY A;  5ITP A;  1LAH E;  3U93 A;  4YU0 A;  3T0J A;  4PFB A;  3HPI A;  3MVY A;  3OD7 A;  4ZZE A;  1SW1 A;  2PMS A;  4NF6 B;  4GQO A;  2WYP A;  3TCG A;  3OO7 A;  1VE4 A;  1MXU A;  4MNI A;  2XD3 A;  2LAO A;  2CZK A;  3EF7 A;  3N6U A;  3PUY E;  2V3T A;  3HCQ A;  1XHY A;  2DVC A;  4PFR A;  4NF4 A;  2I48 A;  1XOC A;  4RK9 A;  1MXW A;  1EZO A;  4KR5 A;  5DTB A;  5ISU A;  2HEU A;  2XXH A;  3RN8 A;  4FAT A;  4LA9 A;  4AB5 A;  1MXY A;  4F3P A;  3VXC A;  3KSX A;  2O6A A;  4HE2 A;  3QUF A;  2I0C A;  1FBP A;  3EHU A;  2B4L A;  5DVI A;  4F1V A;  3TCF A;  1LB8 A;  4P3L A;  1A8F A;  2FHY A;  1MM6 A;  4X1D A;  3BBR A;  3IR1 A;  2GRV A;  5BUU A;  4GXS B;  4XKR A;  5I56 B;  5ESY A;  3K02 A;  4PP0 A;  1D9Y A;  4R72 A;  5L9M A;  4R2B A;  1MQG A;  3B7D A;  2VOZ A;  4NTL A;  2Y84 A;  3QXM A;  3CHG A;  1DTG A;  4EXK A;  4N6P A;  5EQ8 A;  3IFA A;  2AL5 A;  5AA2 D;  2REJ A;  2DVZ A;  5I58 A;  3DP6 A;  4EQ9 A;  3FVO A;  1FJ6 A;  4O3A A;  3HHG A;  4NF0 A;  4OET A;  5F24 A;  4R2F A;  4P0G A;  2I0B A;  5I2K B;  3KC1 A;  3PGF A;  1N04 A;  5I7I A;  1UIV A;  5CMM A;  5J16 A;  4ZEF A;  1A8E A;  4YKJ A;  2MKZ A;  4GRK A;  4OFO A;  2A5T A;  3MZ9 A;  1SQY A;  3T96 B;  5A5X B;  3A29 A;  4MLQ A;  4ELO A;  4LVQ A;  3E9X A;  2FIX A;  4GX4 A;  2QL3 A;  4O7M A;  4P0I A;  3RQT A;  3OO8 A;  4UAC A;  4R6H A;  4KCC A;  3JYR A;  3DP8 A;  3TUS A;  2Y7P A;  5L8D A;  4JWY A;  4F3G A;  3K6X A;  3T66 A;  4P1L A;  3O2A A;  3SKP A;  5AA4 A;  2XXP A;  1TWY A;  2XXT A;  2HPG A;  1FQB A;  4IY5 A;  5EQ9 A;  1LBV A;  2PX1 A;  4F19 A;  4N4U A;  3O6H A;  5LOM A;  4FED A;  4U1O A;  4U21 A;  4OTE A;  1SI0 A;  3KOS A;  4Q0C A;  4NWD A;  3WAF A;  3G3G A;  3VLU A;  3H7M A;  5ET7 A;  4N17 A;  1S9T A;  2RCB A;  1PDA A;  4UAB A;  1FQD A;  2GHA A;  1BTJ A;  2Q2C A;  3LC8 A;  4JSO A;  4C1U A;  1B7U A;  2UVH A;  2X7Q A;  2YPN A;  1URG A;  3O66 A;  4LON B;  1P1O A;  4DXC A;  5ITO A;  4EF1 A;  3ROJ A;  2Q89 A;  3VFJ A;  3KG2 A;  3IB2 A;  4BDL A;  3EPE A;  1CNQ A;  1Y4T A;  1EYJ A;  1URD A;  1O63 A;  2DWJ A;  3PU5 A;  4JWX A;  3PD9 A;  3PV0 E;  1NNK A;  3GBA A;  3O28 A;  1RYO A;  1R6Z A;  2XXK A;  1FW0 A;  2XXW A;  1B0L A;  4F31 B;  2YLN A;  3HV1 A;  2BJJ X;  1SW4 A;  4PF8 A;  1N7W A;  4G8M A;  4TLL B;  1B05 A;  1LGB C;  3IO6 A;  1JW1 A;  1GVC A;  4X9T A;  1B4H A;  5FBP A;  1ZIU A;  4DDD A;  3KC0 A;  1FBE A;  3VE1 B;  1LBC A;  4OVP A;  4ND9 A;  3TTR A;  3MZB A;  2O7U A;  3RGY A;  4DXB A;  3C4M A;  4H0W A;  3U94 A;  3KOT A;  2F7B A;  1Y4C A;  2RCA A;  3USD A;  3H6U A;  1FPE A;  4I3Y A;  5IKB A;  2XWV A;  1UTB A;  1B0H A;  4G68 A;  4Z7E A;  5HPQ A;  1B4Z A;  2I49 A;  4ZEB A;  1NUZ A;  4KD5 A;  4PTK A;  1YAE A;  1IMC A;  2ZZX A;  4QSE A;  3UP9 A;  1IEJ A;  4NHB A;  3V8X B;  1H3D A;  1EZP A;  3B6Q A;  4AS4 A;  1MXX A;  5J1D A;  5DT6 A;  5H8H A;  1PBQ A;  2GH9 A;  5ET6 A;  2O69 A;  2F97 A;  2XWK A;  3H4Z A;  4EF2 A;  1POT A;  2DE2 A;  3SES A;  1PB7 A;  4O8M A;  2GHB A;  4IO7 A;  4F22 A;  2IA4 A;  4K3F A;  1LBW A;  2M8C A;  4JBZ A;  2B3F A;  3R6U A;  2A5S A;  2PBW A;  4PGP A;  1URS A;  2F78 A;  4FOR A;  4C1T A;  4MFI A;  1ZLQ A;  4QFO A;  4NX1 A;  4RXL A;  3U72 A;  4PC9 A;  1B3G A;  2XHD A;  4P11 A;  5H8N A;  4NN3 A;  4IGR A;  2VD3 A;  1MH3 A;  3UA8 A;  3VVD A;  2QPQ A;  2WKY A;  3H6V A;  3D1R A;  1VFE A;  4HXV A;  5KCJ A;  4RJZ A;  4NF8 B;  1NV4 A;  5CMC A;  2H5Y A;  2UXA A;  1JEU A;  3F11 A;  5IAI A;  4R73 A;  3OEL A;  1N7X A;  4TQU Q;  3UGW A;  2F6G A;  3KJ7 A;  4N6D A;  5A5L A;  5ET8 A;  3EHS A;  3LUY A;  5EYG A;  4JB7 A;  2XXX A;  4LUB A;  2O51 A;  5KDT B;  3CRB A;  2XWO A;  3BIG A;  2P3N A;  4HW8 A;  3RPL A;  2DWI A;  3OEN A;  4QSD A;  1P1W A;  4OQO A;  1NUY A;  1FPK A;  1FTO A;  3FD3 A;  2HXR A;  4H67 A;  1ZJL A;  4HCW A;  1F9B A;  3IOT A;  3KBR A;  4OFL A;  3CSB A;  1MQI A;  2R6G E;  3R26 A;  3UIF A;  1YYZ A;  5DYH A;  4GD5 A;  2PVU A;  3ILU B;  3S9M C;  2I4C A;  5IM2 A;  3CG3 A;  3E13 X;  4OFJ A;  1SYH A;  3A3U A;  2KR0 A;  4PAF A;  3TFL A;  3FV1 A;  1AH5 A;  1M5E A;  4XIG Q;  2IEE A;  3IL1 B;  3O29 A;  4OAN A;  4XEQ A;  3FBP A;  1M5D A;  4PBQ A;  1D9V A;  2DXR A;  4YKK A;  3PMX A;  5F7V A;  1MG1 A;  4GWO A;  1M5C A;  4ZEC A;  2D5W A;  1NNP A;  2I4B A;  3VVF A;  1DPP A;  4R9G A;  3P7I A;  4H8J A;  1US4 A;  4OA4 A;  3GYY A;  3PUV E;  4YKI A;  4RYA A;  3Q27 A;  5T3J A;  2XX8 A;  4ISU A;  1LFI A;  3B8B A;  4BDM A;  2RF1 A;  1Y3N A;  2P2A A;  2ZZV A;  2O1L A;  3MVZ A;  1A99 A;  4H46 A;  4XKP A;  1XT8 A;  1MPB A;  3B6W A;  4MNP A;  3TTM A;  3K00 A;  2O7I A;  3IOR A;  3K2D A;  2E0S A;  2FA7 A;  4PCD A;  4I62 A;  2ONS A;  1EYI A;  5H8Q A;  5I56 A;  2DWA A;  1T0K A;  3PPO A;  1IXH A;  1FQA A;  1D3K A;  1N0T A;  3MUQ A;  4HE0 A;  4PBH A;  3MQ9 A;  3QAX A;  5TPA B;  3Q25 A;  3MP8 A;  1ZKB A;  5K2Y A;  1FBF A;  4WKM A;  1Y1M A;  1R1N A;  5H8N B;  1LEV A;  1FPJ A;  3O6I A;  1INP A;  5I58 B;  2HQ0 A;  2KQZ A;  1GGG A;  3A3C A;  3BFU A;  1ZMG A;  1Y3P A;  3CSG A;  2XXQ A;  1FTA A;  2CZI A;  2H4I A;  4MJO A;  3S4U A;  1IXC A;  5IZ3 A;  3N26 A;  4MF3 A;  1SBP A;  3GBB A;  2HAU A;  2W7Y A;  4Q5T A;  1IMA A;  5JTY A;  4OVR A;  2XD2 A;  1I69 A;  3SER A;  1IMD A;  1OVT A;  3PUW E;  4JVD A;  1SI1 A;  3N94 A;  1NNF A;  4TOZ A;  1OLA A;  1UTH A;  3K1P A;  3MVX A;  1ELJ A;  5L9S A;  1UTB B;  1TFD A;  3FXU A;  1IUD A;  4GIZ A;  2CZL A;  4EXL A;  2UVJ A;  1QKB A;  1IME A;  4O7I A;  4OER A;  3TPA A;  2VD2 A;  5DVF A;  4BDR A;  4OWD A;  3MJN A;  3QK6 A;  3FVK A;  5FHM A;  2P1S A;  4I3E A;  1AL3 A;  1ATG A;  4YB5 A;  3FJG A;  3BIH A;  3K4U A;  1IXI A;  1TFA A;  2R8T A;  4U1Z A;  3FIR A;  3PUX E;  3IJO B;  2F3D A;  1NI9 A;  1UQW A;  1S7Y A;  3DP4 A;  5H8F B;  1HSL A;  3MBP A;  4FAJ A;  2WBB A;  2FVZ A;  3W9V A;  3OEM A;  3M8U A;  3S9L C;  3TMG A;  1IZ1 A;  3MC2 A;  4E0W A;  3C35 A;  2CZH A;  4L17 A;  4PAK A;  4R9F A;  1B52 A;  4LZ8 A;  3OSQ A;  1XI6 A;  1USY H;  2VPN A;  3PPR A;  1G0H A;  4E0X A;  2F3B A;  4PE5 B;  5TU0 A;  4N91 A;  4EUO A;  4OMB A;  2WX9 A;  4GL8 A;  4C0R A;  2F7A A;  2H99 A;  5LTC A;  4F2O A;  1USY E;  5LDZ A;  1NV0 A;  4OXV A;  3OSR A;  3FGS A;  3DEL B;  4MMP A;  3LBS A;  1DSN A;  4GOT A;  3SZP A;  3MWB A;  1US5 A;  5B70 A;  4KPT A;  3ODB A;  1IXG A;  5CI5 A;  2XX9 A;  4GLI A;  5FHO A;  1LBY A;  1WDN A;  2F34 A;  2FIE A;  4KYD A;  1FBH A;  4PFI A;  4BDO A;  4P1E A;  4PAI A;  2REG A;  2QS2 A;  5HBC A;  5KCJ B;  4MAG A;  4MIJ A;  4PFU A;  4NF4 B;  5ICT A;  1LCF A;  4M1V A;  5I57 B;  1FCK A;  3RYD A;  3PD8 A;  4ZZA A;  1M5B A;  3FXB A;  4KXP A;  2RIN A;  1Q9D A;  1K9Z A;  1JVX A;  5AE4 A;  1Y9U A;  1XC1 A;  1IIW A;  2OCU A;  1SW2 A;  4PDH A;  2Q8J A;  1H44 A;  4OZ9 A;  4PQJ A;  4EQB A;  4XXU A;  1FQF A;  3TZA A;  4JVC A;  1QUL A;  1YTV A;  4FBP A;  4N07 A;  3MPL A;  4KI0 E;  3C31 A;  2VP1 A;  3ONM A;  5KZT A;  1KZ8 A;  3VV5 A;  1H76 A;  4I1D A;  3L6H A;  3SET A;  1B3H A;  2HXW A;  3TYH A;  3QMF A;  5JTY B;  1MRP A;  4GX3 A;  4OEN A;  3T1B A;  4PE3 A;  3QYT A;  4ZEI A;  3ZSF A;  3IO4 A;  4WXJ A;  4U23 A;  2OZZ A;  2QVU A;  4H1X A;  5ICQ A;  3MPK A;  5AA1 A;  1JW4 A;  3U65 A;  2F5X A;  1M5F A;  2Z8D A;  1AOV A;  5I57 A;  3R7X A;  4KFQ A;  2I6E A;  1Q1K A;  1QUI A;  3MP6 A;  5I59 A;  5B7D A;  5EQ7 A;  3TDJ A;  4F1U A;  4I40 A;  1PB8 A;  4F1Y A;  1FPD A;  5JEI A;  5EQA A;  1MXZ A;  2QRY A;  3CFL A;  1B3L A;  3G7W A;  4IO3 A;  2NWJ A;  5IZ1 A;  2Y7W A;  2QS3 A;  3RUM A;  3CR9 A;  3IOW A;  4AQ4 A;  4F18 A;  2ZXT A;  4RK2 A;  3Q26 A;  4OVQ A;  5I2N B;  1MY1 A;  1IQ7 A;  3I6V A;  3TTK A;  4YIC A;  3MYU A;  1NV1 A;  1P1U A;  2QS4 A;  4QF9 A;  4FEB A;  4R6Y A;  3C32 A;  1B58 A;  4OVS A;  3OMB A;  2HFB A;  4NF5 B;  5AA2 A;  1GR2 A;  1R9L A;  4DCY A;  3JZJ A;  5H8S A;  5CC2 A;  5I84 A;  4XKQ A;  3HN0 A;  3TEP A;  4IY6 A;  5H8F A;  4RPN A;  2H25 A;  5I2N A;  1RDX A;  5F1Q A;  2V3U A;  4KHZ E;  2ALU A;  2WBD A;  1Y20 A;  3QIM A;  2QMX A;  4NF8 A;  2QS1 A;  1P1Q A;  3FUZ A;  2V3Q A;  5CMK A;  3B50 A;  4NGU A;  3OOA A;  1RYX A;  3C34 A;  1WVJ A;  3KSJ A;  5I5P A;  1B6H A;  3FAT A;  2VT5 A;  1JVY A;  4LAT A;  3BFT A;  1MQH A;  4MEV A;  1EYK A;  4P9K A;  3U1O A;  2XA5 A;  3RPL B;  3ILT B;  4WEP A;  3U8Q A;  3PUZ E;  3IB0 A;  1QUK A;  3FVN A;  1OLC A;  5AA2 B;  4F3S A;  1LCT A;  4EQ7 A;  1JNF A;  4EDP A;  3MAM A;  4PFT A;  1BLF A;  3TOD A;  2I58 A;  3FZV A;  4PGN A;  3SDF A;  1B32 A;  1MH4 A;  3T93 B;  3IB1 A;  2Q9T A;  4R75 A;  5M2V A;  2CMO A;  1KA1 A;  4OVT A;  4QFL A;  4GF8 A;  4GBV A;  5L9O A;  3VXB A;  2AIX A;  5I2K A;  3O9P A;  2HCA A;  2DWH A;  3M3F A;  4U22 A;  1DPE A;  1JET A;  3JV9 A;  1YZ0 A;  4PFY A;  1B3F A;  1NH8 A;  3SEW A;  1SPI A;  1GV8 A;  4HTG A;  2F6P A;  4NMY A;  2UVG A;  1NV7 A;  4G61 A;  4THI A;  1Y3Q A;  2AYS A;  1OQG A;  3KN8 A;  1FBD A;  3FVG A;  3EQ1 A;  2NVU B;  1EU8 A;  4POX A;  4X04 A;  4Q8R A;  3N5L A;  3G3K A;  3MW0 A;  3KGC A;  4FEC A;  4H45 A;  4FIM A;  1DCU A;  3CG1 A;  3N6T A;  4TLM B;  1O7T A;  1FPB A;  1B5I A;  4QXD A;  4ZS9 A;  4LP2 B;  2ABH A;  3KEI A;  2GFE A;  3MP1 A;  3WAE A;  3K6W A;  1FPG A;  4QFP A;  4DXU A;  1I6B A;  1A54 A;  4I8C A;  2I3V A;  2OLB A;  5DEX B;  1LLS A;  2QVR A;  3LV0 A;  4PDD A;  1D9Q A;  4H65 A;  3O97 A;  4ZDM A;  4NQ8 A;  4MBP A;  5IZZ A;  4G8H A;  3FAS A;  1GTK A;  5ET5 A;  4X8R A;  3BKI B;  3ISP A;  3NOH A;  4LN5 A;  3SEX A;  3M3L A;  3THI A;  1OIB A;  1YXI A;  4QRZ A;  5JK4 A;  1IMF A;  3S9N C;  1WOD A;  3QUJ A;  1QW0 A;  4GWU A;  2O84 X;  2PFZ A;  1J1N A;  2JJK A;  3K0V A;  2Z8F A;  4DIG A;  4OHN A;  2P0S A;  3KZG A;  1B5J A;  2ZZW A;  3Q28 A;  3E78 A;  1B7Z A;  4QHQ A;  2ZMB A;  2D3I A;  3ECR A;  2ZNT A;  4N13 A;  4NWC A;  2PT2 A;  2XWI A;  4KYE A;  5K2X A;  5IGA A;  1SW5 A;  3LSL A;  3V89 B;  2WYK A;  4POW A;  2XX7 A;  2PCR A;  4LQ5 A;  1I6Q A;  2R71 A;  3RNN A;  4RPO A;  2OBG A;  1DMB A;  4YZZ A;  2NUV A;  2Z22 A;  1B46 A;  5FTH A;  2UYE A;  2ESN A;  1Y1Z A;  2DSF A;  1KA0 A;  2UYF A;  2OWT A;  2A5T B;  1H43 A;  4G68 C;  4DLD A;  4GVO A;  4O94 A;  4MCO A;  3L6G A;  1FPL A;  3TTL A;  1BKA A;  3ZS6 A;  4UA8 A;  2DE4 A;  1CB6 A;  1OQH A;  1NNT A;  1D4N A;  1EZ9 A;  3RPW A;  2B3B A;  2Q74 A;  3U92 A;  1FBG A;  1B51 A;  2F8D A;  3EN3 A;  1PBP A;  2OWZ A;  5I59 B;  1P99 A;  3FXR A;  1II5 A;  4PET A;  1N3X A;  1FTM A;  1FTK A;  2G29 A;  5CBR A;  1A55 A;  2X7P A;  1NV3 A;  1MY2 A;  4ELP A;  4IR8 A;  4PFW A;  2NXO A;  3K6U A;  4YB7 A;  3W15 C;  4YMA A;  4IO5 A;  1ZU0 A;  4IO6 A;  3CFX A;  1DK4 A;  4N8G A;  2ZYM A;  3C33 A;  2B4M A;  3UK4 A;  2PYY A;  4BLA A;  1QGX A;  2Q88 A;  4H6D A;  3PTY A;  1RDY A;  4IO2 A;  2PT1 A;  3CFZ A;  3VLV A;  3M3K A;  5CMB A;  2DS9 A;  2F7C A;  5AA3 A;  3ZKK A;  2XXU A;  1FQE A;  2Y5K A;  4QSC A;  2DOJ A;  2DQV A;  1UIU A;  4JVI A;  3EHT A;  1YCJ A;  1K9Y A;  3K1M A;  1ZBM A;  3RTW B;  1YPN A;  1ZTY A;  2Z23 A;  1LBX A;  1BP5 A;  3G3I A;  3G3F A;  4JDF A;  3PPQ A;  4P47 A;  2QSX A;  1AIV A;  1MXV A;  1FQC A;  4ESX A;  3K01 A;  2F36 A;  3KBZ A;  4GWW A;  4O3B A;  3T22 A;  4NF6 A;  3GLB A;  3W9W A;  3PMW A;  2DXY A;  4DE8 A;  2X26 A;  4G68 B;  2RC7 A;  1L5T A;  1LBB A;  3LUZ A;  3HFU A;  2Y7R A;  4ZE9 A;  4R74 A;  3K6V A;  4KCD A;  3K1N A;  3DLN A;  1Z7N E;  1NUW A;  4YAH X;  1N76 A;  1CE2 A;  2E1S A;  1N84 A;  5I3S A;  2VGQ A;  3PMV A;  4OYV A;  4KQP A;  1Z7M E;  5CM6 A;  2Z8E A;  1MPC A;  4MLV A;  2O1M A;  3VDF A;  3GZG A;  4HCY A;  3IAZ A;  2VPO A;  5IZ3 B;  4XKN A;  4ZED A;  4BDQ A;  4MH5 A;  1G0I A;  2OX3 A;  3VVE A;  4U4S A;  4NG7 A;  4AB6 A;  1MDP 1;  3LSW A;  1QUJ A;  4O3C A;  2PFY A;  2Y5L A;  2OK2 A;  4DI3 D;  2Y7K A;  3C36 A;  4XFE A;  3IX1 A;  1PEB A;  2RC8 A;  3GXA A;  1DBZ A;  3KN7 A;  4M4G A;  4QFN A;  3C9H A;  3KFM A;  3S2V A;  1B9J A;  1Q35 A;  4ELQ A;  1FSA A;  1LFH A;  4HE1 A;  2ANJ A;  2G93 A;  3V5A A;  5BWJ A;  2AL4 A;  3SEU A;  4IO4 A;  3TTN A;  3CI8 A;  5DW8 A;  3Q29 A;  1XVX A;  4GX6 A;  4GWY A;  4U4X A;  4IGT A;  3HHF A;  1XVY A;  3H03 A;  4MX6 A;  1MQD A;  3T9V A;  1SD3 A;  4XF5 A;  2V84 A;  1B1X A;  3H6T A;  4GFR A;  4GWX A; 
#chains in the Genus database with same CATH homology
 1B32 A;  1MQG A;  5H8Q A;  1MH4 A;  3T93 B;  3IB1 A;  1NKX A;  3B7D A;  5I56 A;  2Q9T A;  2DWA A;  2VOZ A;  4NTL A;  4R75 A;  1UTH B;  1T0K A;  2Y84 A;  3QXM A;  5M2V A;  2CMO A;  1DOT A;  2DE3 A;  1DTG A;  1QJM A;  3PPO A;  3V83 A;  1IXH A;  1FQA A;  4EXK A;  4G77 A;  2HZL A;  5EYF A;  1D3K A;  4N6P A;  1N0T A;  2AL5 A;  4QFL A;  3MUQ A;  2REJ A;  5AA2 D;  2DVZ A;  5I58 A;  3DP6 A;  4GF8 A;  3RT6 B;  4EQ9 A;  3FVO A;  4O3A A;  3MQ9 A;  3QAX A;  3HHG A;  1MM7 A;  5L9O A;  4OET A;  5TPA B;  2V93 A;  3Q25 A;  3VXB A;  4R2F A;  4ELR A;  2H98 A;  4P0G A;  2AIX A;  1IIT A;  2I0B A;  4U2R A;  4XTC Q;  3MP8 A;  5I2K B;  1EH3 A;  1ZKB A;  3O9P A;  4HS7 A;  5K2Y A;  5I2K A;  2HCA A;  2DWH A;  3M3F A;  3PGF A;  4U22 A;  1Y1M A;  1R1N A;  3IK6 B;  4WKM A;  1N04 A;  3FJ7 A;  5CBS A;  1LB9 A;  5H8N B;  4G4P A;  1UIV A;  1MS7 A;  2OWS A;  5CMM A;  1DPE A;  1JET A;  3JV9 A;  3TQW A;  4ZEF A;  4PFY A;  1B3F A;  3O6I A;  1A8E A;  2V25 A;  4YKJ A;  1NH8 A;  1AMF A;  5I58 B;  3TQL A;  3SEW A;  4GRK A;  4OFO A;  2A5T A;  1B2H A;  2HQ0 A;  3MZ9 A;  1SQY A;  1VFD A;  1GV8 A;  4R6K A;  4HTG A;  2F6P A;  3RTF B;  2Y7I A;  1GGG A;  5A5X B;  4MLQ A;  3A3C A;  3A09 A;  1JW5 A;  4LVQ A;  2UVG A;  3BFU A;  1ZMG A;  3E9X A;  4NMY A;  4THI A;  4ELO A;  5A5X A;  1Y3Q A;  2QL3 A;  2AYS A;  1Y3P A;  3CSG A;  2XXQ A;  1OQG A;  4P0I A;  1QKA A;  1NMU A;  3KN8 A;  3OO8 A;  4UAC A;  3FVG A;  3RQT A;  4R6H A;  3EQ1 A;  2H4I A;  3ZKL A;  2ZNS A;  4KCC A;  2NVU B;  1EU8 A;  3JYR A;  4POX A;  3S4U A;  3PPP A;  1PC3 A;  2H9B A;  3DP8 A;  4I9D A;  4Q8R A;  2Y7P A;  3TUS A;  3RY3 A;  5L8D A;  3N5L A;  1IXC A;  3G3K A;  3MW0 A;  3KGC A;  3N26 A;  4FEC A;  1SBP A;  2THI A;  4MF3 A;  4JWY A;  3G3J A;  4FIM A;  1POY 1;  4F3G A;  3GBB A;  2HAU A;  3K6X A;  3CG1 A;  3N6T A;  3I5O A;  4TLM B;  3T66 A;  1O7T A;  2W7Y A;  3O2A A;  3SKP A;  4Q5T A;  3T9H B;  4ECF A;  2DYX A;  5AA4 A;  2XXP A;  1TWY A;  5JTY A;  1B5I A;  2XXT A;  4ZS9 A;  2XD2 A;  4OEU A;  1FQB A;  1I69 A;  2ABH A;  4LP2 B;  2HZK A;  3SER A;  3VLW A;  1OVT A;  3KEI A;  3PUW E;  4IY5 A;  2GFE A;  3MP1 A;  1JEV A;  1FTL A;  3WAE A;  1SI1 A;  3N94 A;  2PX1 A;  4RA1 A;  4F19 A;  1NNF A;  3K6W A;  3O6H A;  1LAF E;  4TOZ A;  4QFP A;  4DXU A;  1H45 A;  1OLA A;  3AXF A;  4FED A;  1I6B A;  1UTH A;  3E4R A;  3K1P A;  3MVX A;  1LFG A;  4U21 A;  4U1O A;  3IOU A;  1A54 A;  1ELJ A;  4I8C A;  1UTB B;  2I3V A;  1S50 A;  2OLB A;  1TFD A;  1SI0 A;  3FXU A;  4OTE A;  5H8Q B;  3T9X B;  1NFT A;  5DEX B;  4F3B A;  1PB9 A;  2ZYK A;  3KOS A;  1LLS A;  1VR5 A;  3SEY A;  1IUD A;  3FV2 A;  1MDQ A;  2OJT A;  4GIZ A;  5ISU A;  4H8I A;  4Q0C A;  4NWD A;  5L9S A;  4FE8 A;  3WAF A;  2CZL A;  2ZNU A;  4RY1 A;  3G3G A;  4EXL A;  4BDN A;  4H65 A;  3O97 A;  2UVJ A;  3H7M A;  4ZDM A;  3VLU A;  1QKB A;  2YJP A;  4MBP A;  1S9T A;  4G8H A;  2RCB A;  4OER A;  3OXN A;  3TPA A;  2RC9 A;  3FAS A;  1PDA A;  4ZEK A;  1GTK A;  1FQD A;  2VD2 A;  3BKI B;  2GHA A;  1BTJ A;  2Q2C A;  2KLF A;  3LC8 A;  4JSO A;  5DVF A;  4BDR A;  4OWD A;  4C1U A;  1B7U A;  2UVH A;  2X7Q A;  2YPN A;  1URG A;  3MJN A;  3O66 A;  1P1O A;  3QK6 A;  3FVK A;  3DM0 A;  4LQ2 A;  5FHM A;  4DXC A;  3SEX A;  5KDT A;  2P1S A;  2ZYO A;  5ITO A;  3M3L A;  3THI A;  4EF1 A;  5HM4 B;  1OIB A;  4QRZ A;  5JK4 A;  2Q89 A;  3S9N C;  1WOD A;  3VFJ A;  1AL3 A;  1ATG A;  1RKM A;  4NF5 A;  3QUJ A;  1QW0 A;  3UOR A;  3T96 B;  3KG2 A;  2O84 X;  2O68 A;  3IB2 A;  2Q2A A;  4BDL A;  1J1N A;  4GXA A;  4YB5 A;  5DVJ A;  3K0V A;  2Z8F A;  1OVB A;  3EPE A;  3FJG A;  4DIG A;  5FHN A;  4GL0 A;  4OHN A;  1Y4T A;  2P0S A;  1B3E A;  3KZG A;  1B5J A;  1FTJ A;  3K4U A;  1I6A A;  1MY0 A;  5DEX A;  3Q28 A;  1URD A;  1O63 A;  1IXI A;  1TFA A;  2DWJ A;  4U1Z A;  3TEL A;  3PU5 A;  3FIR A;  5TPA A;  1B7Z A;  4JWX A;  3PUX E;  4QHQ A;  2ZMB A;  3PD9 A;  2D3I A;  3IJO B;  3PV0 E;  4Q30 B;  1NNK A;  3ECR A;  2ZNT A;  3GBA A;  3O28 A;  1MY4 A;  2VHA A;  1UQW A;  3MZ1 A;  4N13 A;  4NWC A;  4QFK A;  4ESW A;  1S7Y A;  3DP4 A;  1RYO A;  1R6Z A;  4RNS A;  5FTI A;  5H8F B;  1O64 A;  1HSL A;  3MBP A;  2PT2 A;  4FJP A;  4FAJ A;  1FW0 A;  4KYE A;  2XXW A;  1B0L A;  4LON B;  3FXQ A;  3W9V A;  4F31 B;  3OEM A;  5K2X A;  3M8U A;  3S9L C;  1SW5 A;  1IZ1 A;  2YLN A;  3LSL A;  3MC2 A;  3TMG A;  3V89 B;  4YKP A;  5TP9 B;  4E0W A;  2XXI A;  2BJJ X;  3C35 A;  3HV1 A;  4POW A;  4L17 A;  2XX7 A;  1SW4 A;  4LQ5 A;  4LZ7 A;  1A7L A;  1N7W A;  1I6Q A;  2R71 A;  4G8M A;  4G2Z A;  3RNN A;  4TLL B;  4RPO A;  2OBG A;  4R9F A;  1B52 A;  1DMB A;  4YZZ A;  4LZ8 A;  3OSQ A;  1B05 A;  2NUV A;  1USY H;  1A40 A;  2B65 A;  1LGB C;  3IO6 A;  1JW1 A;  3T9U A;  2I3W A;  3CVG A;  3PPR A;  4X9T A;  1GVC A;  1B4H A;  2Z22 A;  4E0X A;  4F39 A;  4PE5 B;  1B46 A;  1ZIU A;  3O6G A;  5FTH A;  5TU0 A;  2UYE A;  2ESN A;  4DDD A;  1Y1Z A;  4KYS A;  1LST A;  4OMB A;  4EUO A;  4F29 A;  5LOM A;  3I3V A;  4GL8 A;  3LSX A;  2DSF A;  2UYF A;  2F7A A;  3VE1 B;  2H99 A;  4JSD A;  4OES A;  1VSO A;  3H3G A;  1SYI A;  1QVS A;  2OWT A;  4F2O A;  1LBC A;  1NH7 A;  2A5T B;  1USY E;  4ND9 A;  1H43 A;  4G68 C;  4OXV A;  5ELV A;  3TTR A;  3MZB A;  3OSR A;  4DLD A;  3FGS A;  3DEL B;  4GVO A;  2O7U A;  2XXY A;  3LBS A;  1DSN A;  3RGY A;  3C4M A;  4GOT A;  4H0W A;  3U94 A;  4DXB A;  2ONK E;  3KOT A;  2F7B A;  3MWB A;  1Y4C A;  1US5 A;  3LSF B;  3L6G A;  5B70 A;  4KPT A;  3ODB A;  4DCX A;  2RCA A;  3USD A;  2ONR A;  1IXG A;  3H6U A;  3TTL A;  3UN6 A;  2HAV A;  3G3H A;  4NE4 A;  5IKB A;  1BKA A;  5H8H B;  3ZS6 A;  4UA8 A;  2XX9 A;  2DE4 A;  1UTB A;  5CI5 A;  4DZ1 A;  4GLI A;  5FHO A;  3H6W A;  1CB6 A;  1OQH A;  1NNT A;  5TP9 A;  1D4N A;  1B0H A;  3OO9 A;  3TAJ A;  1EZ9 A;  1WDN A;  4G68 A;  3KJT A;  3RPW A;  2B3B A;  3E3K A;  2D21 A;  2F34 A;  4Z7E A;  4KYD A;  5HPQ A;  1B4Z A;  2I49 A;  2NOO A;  3U92 A;  2QMW A;  4ZEB A;  4KD5 A;  1B51 A;  4BDO A;  2F8D A;  3EN3 A;  1PBP A;  1YAE A;  2DP8 A;  4X48 A;  1TT1 A;  1BIY A;  2R9J A;  5I59 B;  3MVW A;  1P99 A;  4YB6 A;  5EHM A;  4QSE A;  2REG A;  1II5 A;  2QS2 A;  3FXR A;  3LR1 A;  4PET A;  3UP9 A;  1IEJ A;  4C0R A;  3OEK A;  5HBC A;  5KCJ B;  4PFU A;  1H3D A;  1N3X A;  3V8X B;  1EZP A;  3B6Q A;  1FTM A;  4NF4 B;  5ICT A;  1LCF A;  1MXX A;  1FTK A;  4M1V A;  4OVJ A;  5DT6 A;  4ZE8 A;  2G29 A;  5I57 B;  5J1D A;  5H8H A;  1FCK A;  5CBR A;  1PBQ A;  3PD8 A;  4ZZA A;  2GH9 A;  1A55 A;  1M5B A;  2RIN A;  2FYI A;  1JVX A;  2O69 A;  2X7P A;  2F97 A;  5AE4 A;  3H4Z A;  1Y9U A;  4LZ5 A;  4EF2 A;  1POT A;  1MY2 A;  1XC1 A;  1IIW A;  2DE2 A;  3SES A;  4ELP A;  3S9E A;  1PB7 A;  1SW2 A;  2OCU A;  2Q8J A;  1H44 A;  2GHB A;  4OZ9 A;  4IO7 A;  4PFW A;  4H5G A;  2IA4 A;  2NXO A;  4JWO A;  4K3F A;  4PQJ A;  4EQB A;  4F22 A;  2M8C A;  3K6U A;  4YB7 A;  3W15 C;  4YMA A;  1B1H A;  4XXU A;  2ZYN A;  4IO5 A;  1ZU0 A;  2B3F A;  3R6U A;  4JBZ A;  1FQF A;  2A5S A;  4IO6 A;  3TZA A;  2PBW A;  1URS A;  3QSL A;  1QUL A;  2F78 A;  1YTV A;  1B7H A;  3CFX A;  4FOR A;  2ZYM A;  3RT8 A;  4N07 A;  1XS5 A;  3TKD A;  3C33 A;  3MPL A;  4C1T A;  1SVX B;  4MFI A;  1ZLQ A;  3HO7 A;  4QFO A;  3UK4 A;  2PYY A;  4BLA A;  4KI0 E;  4RXL A;  3C31 A;  3SDF A;  3U72 A;  2VP1 A;  1B3G A;  2Q88 A;  2XHD A;  3FJM A;  4H6D A;  4P11 A;  5H8N A;  3ONM A;  4IGR A;  4G8N A;  2VD3 A;  1MH3 A;  2PT1 A;  4IO2 A;  3UA8 A;  5KZT A;  3CFZ A;  3VVD A;  2QPQ A;  2WKY A;  2FNC A;  3H6V A;  2F35 A;  3VLV A;  1NL5 A;  3VV5 A;  3CIJ A;  4Z0I A;  1OMP A;  3M3K A;  1VFE A;  5KCJ A;  1H76 A;  5CMB A;  2DS9 A;  2F7C A;  5AA3 A;  4RJZ A;  3ZKK A;  1HSE A;  4WED A;  2XXU A;  4I1D A;  4IB2 A;  1FQE A;  4NF8 B;  5CMC A;  1N3W A;  4F2Q A;  3L6H A;  2H5Y A;  3SET A;  2UXA A;  1JEU A;  4QSC A;  2DOJ A;  1B3H A;  3F11 A;  4OEV A;  5IAI A;  2HXW A;  2DQV A;  3TYH A;  5JTY B;  1B5H A;  1MRP A;  1UIU A;  5CRY A;  3EHT A;  2XXV A;  1YCJ A;  4R73 A;  5AA4 B;  3OO6 A;  3OEL A;  1N7X A;  4TQU Q;  3UGW A;  2F6G A;  3KJ7 A;  4OEN A;  3K1M A;  1ZBM A;  3RTW B;  1YPN A;  1LAG E;  3QYT A;  3KN3 A;  4ZEI A;  3D4C A;  1P1N A;  1ZTY A;  3IO4 A;  4WXJ A;  3ZSF A;  2Z23 A;  4U23 A;  2OZZ A;  1BP5 A;  1LAX A;  1HSJ A;  3EHS A;  3G3I A;  3G3F A;  3LUY A;  1TXF A;  4JB7 A;  4JDF A;  4H1X A;  1SDX A;  1R9Q A;  5ICQ A;  3PPQ A;  3MPK A;  1JQF A;  1JW4 A;  2XXX A;  5AA1 A;  2F5X A;  3D4G A;  4LUB A;  2QSX A;  1AIV A;  1M5F A;  2XXR A;  2Z8D A;  1MXV A;  1AOV A;  5I57 A;  1ANF A;  2O51 A;  4NED A;  1MPD A;  3R7X A;  1B40 A;  1FQC A;  2UVI A;  4KFQ A;  3B6T A;  3RLF E;  2I6E A;  4ESX A;  5KDT B;  3K01 A;  1Q1K A;  3CRB A;  3IOV A;  4YMB A;  1QUI A;  1KWH A;  4HW8 A;  2F36 A;  3MP6 A;  4O3B A;  2DWI A;  5I59 A;  3T22 A;  3OEN A;  4QSD A;  5B7D A;  1P1W A;  3IJX B;  4NF6 A;  3GLB A;  4OQO A;  3TDJ A;  3W9W A;  5EHS A;  3PPN A;  4H5F A;  3PMW A;  3SEV A;  2DXY A;  1FTO A;  1DTZ A;  3FD3 A;  4H67 A;  4DE8 A;  1PB8 A;  2X26 A;  3H06 B;  4G68 B;  4F1Y A;  4F1U A;  5JEI A;  1ZJL A;  1MXZ A;  4HCW A;  2RKM A;  2RC7 A;  4JXI A;  1F9B A;  2QJE A;  3IOT A;  3KBR A;  4OFL A;  1LBB A;  2QRY A;  1L5T A;  3HST A;  1MQJ A;  3CSB A;  4X1B A;  3TCH A;  1MY3 A;  3CFL A;  2Y7R A;  1B3L A;  4ZE9 A;  4R74 A;  4ONY A;  3K6V A;  4KCD A;  1MQI A;  2R6G E;  3K1N A;  3DLN A;  3R26 A;  1LAH E;  3G7W A;  3U93 A;  5ITP A;  4IO3 A;  1Z7N E;  2NWJ A;  4YU0 A;  3UIF A;  2Y7W A;  5DYH A;  4GD5 A;  2PVU A;  2QS3 A;  3RUM A;  3HPI A;  3CR9 A;  3IOW A;  4AQ4 A;  4F18 A;  3ILU B;  3S9M C;  2I4C A;  3MVY A;  3CG3 A;  1N76 A;  4YAH X;  1CE2 A;  2ZXT A;  3E13 X;  3OD7 A;  2E1S A;  3Q26 A;  1N84 A;  1SW1 A;  2PMS A;  4NF6 B;  4OFJ A;  4RK2 A;  1SYH A;  2VGQ A;  3PMV A;  1MY1 A;  1IQ7 A;  3A3U A;  4GQO A;  3TCG A;  5I2N B;  1EZO A;  4OYV A;  3I6V A;  1VE4 A;  3OO7 A;  3TTK A;  4YIC A;  4KQP A;  3FV1 A;  1AH5 A;  1MXU A;  1Z7M E;  3TFL A;  5CM6 A;  2XD3 A;  1P1U A;  1MPC A;  2Z8E A;  1M5E A;  4XIG Q;  4MLV A;  2LAO A;  2IEE A;  2O1M A;  2QS4 A;  3GZG A;  4HCY A;  4QF9 A;  3VDF A;  3IAZ A;  4FEB A;  3IL1 B;  4R6Y A;  3EF7 A;  3N6U A;  3O29 A;  3C32 A;  1B58 A;  3PUY E;  4XKN A;  1M5D A;  3OMB A;  4ZED A;  2V3T A;  4MH5 A;  4BDQ A;  1D9V A;  2HFB A;  2DXR A;  4YKK A;  3PMX A;  3HCQ A;  4NF5 B;  5F7V A;  1GR2 A;  1MG1 A;  5AA2 A;  3VVE A;  1R9L A;  4DCY A;  3JZJ A;  1XHY A;  4U4S A;  5H8S A;  5CC2 A;  2DVC A;  4NF4 A;  5I84 A;  4XKQ A;  4GWO A;  4AB6 A;  1MDP 1;  3LSW A;  1QUJ A;  2I48 A;  1M5C A;  4O3C A;  3HN0 A;  3TEP A;  4ZEC A;  4IY6 A;  2D5W A;  1NNP A;  1XOC A;  2I4B A;  4RK9 A;  5H8F A;  2OK2 A;  1MXW A;  4RPN A;  3VVF A;  1DPP A;  2H25 A;  2Y7K A;  3C36 A;  4R9G A;  2V3U A;  4KHZ E;  5F1Q A;  3P7I A;  2ALU A;  5I2N A;  3IX1 A;  1PEB A;  1Y20 A;  2RC8 A;  4KR5 A;  5DTB A;  3GXA A;  3QIM A;  3KN7 A;  2QMX A;  4H8J A;  4NF8 A;  4M4G A;  2HEU A;  2QS1 A;  1P1Q A;  3FUZ A;  1US4 A;  4QFN A;  2V3Q A;  2XXH A;  3C9H A;  3PUV E;  4YKI A;  3RN8 A;  4FAT A;  5CMK A;  4RYA A;  3Q27 A;  3KFM A;  3OOA A;  1RYX A;  3S2V A;  3C34 A;  1WVJ A;  3KSJ A;  1B9J A;  4LA9 A;  1MXY A;  1Q35 A;  4AB5 A;  4ELQ A;  2XX8 A;  4F3P A;  1B6H A;  3VXC A;  3KSX A;  2O6A A;  3FAT A;  1LFH A;  1JVY A;  4ISU A;  2ANJ A;  2G93 A;  3QUF A;  4LAT A;  3V5A A;  1LFI A;  5BWJ A;  2AL4 A;  3BFT A;  1MQH A;  4IO4 A;  3SEU A;  2I0C A;  3TTN A;  3CI8 A;  3EHU A;  4BDM A;  3U1O A;  5DVI A;  3Q29 A;  4F1V A;  2RF1 A;  3TCF A;  1LB8 A;  1XVX A;  1Y3N A;  1A8F A;  2P2A A;  3ILT B;  4WEP A;  4U4X A;  2O1L A;  3U8Q A;  1MM6 A;  1A99 A;  3MVZ A;  3PUZ E;  3BBR A;  3IB0 A;  3IR1 A;  2GRV A;  4X1D A;  4XKP A;  4IGT A;  1XT8 A;  1MPB A;  1XVY A;  3HHF A;  3B6W A;  4GXS B;  5BUU A;  1QUK A;  4XKR A;  3H03 A;  5I56 B;  3FVN A;  3K02 A;  3K00 A;  3TTM A;  2O7I A;  1MQD A;  3IOR A;  1OLC A;  4ZZE A;  5AA2 B;  3K2D A;  2E0S A;  4F3S A;  1LCT A;  2FA7 A;  4PP0 A;  4I62 A;  4EQ7 A;  1D9Y A;  3T9V A;  4R72 A;  1JNF A;  1SD3 A;  4EDP A;  2V84 A;  3MAM A;  4PFT A;  5L9M A;  1B1X A;  1BLF A;  4R2B A;  2I58 A;  3FZV A;  3H6T A;  4GFR A;  3TOD A;  2ONS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...