3OD7A

Haemophilus influenzae ferric binding protein a -iron loaded
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
308
structure length
308
Chain Sequence
DITVYNGQHKEAATAVAKAFEQETGIKVTLNSGKSEQLAGQLKEEGDKTPADVFYTEQTATFADLSEAGLLAPISEQTIQQTAQKGVPLAPKKDWIALSGRSRVVVYDHTKLSEKDMEKSVLDYATPKWKGKIGYVSTSGAFLEQVVALSKMKGDKVALNWLKGLKENGKLYAKNSVALQAVENGEVPAALINNYYWYNLAKEKGVENLKSRLYFVRHQDPGALVSYSGAAVLKASKNQAEAQKFVDFLASKKGQEALVAARAEYPLRADVVSPFNLEPYEKLEAPVVSATTAQDKEHAIKLIEEAGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Iron-utilization periplasmic protein
publication title The role of vicinal tyrosine residues in the function of Haemophilus influenzae ferric binding protein A.
pubmed doi rcsb
source organism Haemophilus influenzae
total genus 116
structure length 308
sequence length 308
ec nomenclature
pdb deposition date 2010-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3od7A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3od7A02
5AE4A 2PX1A 3N6TA 2B3FA 4ZDMA 4IO5A 3G3IA 4R6HA 3MW0A 5CMCA 3UP9A 2NWJA 1GR2A 4YKKA 3C9HA 1PC3A 1R6ZA 2DXRA 1JEVA 1Y20A 1HSJA 1EU8A 3A3CA 2D21A 4E0XA 1ZBMA 2DXYA 4F3BA 4F3PA 3RY3A 3OO6A 3EHTA 3CG3A 2RF1A 3C32A 3GXAA 3KGCA 3A3UA 1TT1A 3TPAA 1Y3PA 4M4GA 2ONKE 3H6TA 1OQGA 3R6UA 3OO9A 1ZMGA 5TU0A 5ITPA 3KN3A 2QJEA 4KD5A 2O1LA 3IORA 4GL0A 4Z0IA 3MUQA 3O6GA 3U93A 3FV2A 2QPQA 2XXIA 3LSFB 4R6YA 1PBPA 1IIWA 3KG2A 3TTMA 3G7WA 1LAFE 1BKAA 1MM7A 2AIXA 3HO7A 3T9VA 5FHOA 3Q26A 4G2ZA 2OLBA 3MPLA 1JNFA 3V83A 2PYYA 2UXAA 1N7XA 5KDTA 3W9VA 1KWHA 1LGBC 3MP1A 3SEWA 2QMWA 4HCWA 3HCQA 4G8NA 1MQHA 1LAXA 2XXWA 2DWIA 3IOVA 3DELB 1LFGA 3T22A 1L5TA 1S50A 1FQDA 1CE2A 4OFLA 4DCXA 3OXNA 2HFBA 3Q29A 1UTBA 4IO2A 5KCJB 4LA9A 2DSFA 3TYHA 2R9JA 4H1XA 1DMBA 5BUUA 4YKPA 4GF8A 2YPNA 2ZYOA 2FA7A 3PUWE 1NNKA 5I58A 1QULA 3TTRA 1OLAA 4OQOA 1LB9A 1SBPA 4LP2B 3MVXA 3QIMA 4GOTA 1ZTYA 3CIJA 3PPOA 3V5AA 3BBRA 4EXLA 3K02A 2IEEA 3PPRA 3ZKKA 1B6HA 4X1BA 4G68B 1MQJA 4PFYA 1B46A 1R9QA 4O3AA 5I59A 4PFUA 4YMAA 3G3FA 1B3LA 2H9BA 4R74A 4QHQA 3SEXA 2YLNA 5CC2A 5A5XA 1MQGA 4ZZAA 4EXKA 3ZKLA 1XS5A 3S2VA 2XXHA 2KLFA 3OO7A 3LBSA 1NNFA 1QKAA 1O64A 4QSCA 1VR5A 1UQWA 3M3FA 3D4GA 3PPNA 4KR5A 2P2AA 3F11A 2Q2CA 3IX1A 3CFLA 5ISUA 3I5OA 1M5BA 3FXRA 3KSXA 1NFTA 2B3BA 1EZOA 1B3HA 4OHNA 3Q28A 3E3KA 3VXBA 3V8XB 3H03A 1HSEA 3U1OA 5EHSA 2DE3A 2HZKA 3U8QA 4FAJA 2H5YA 5B7DA 4QRZA 4OENA 4XIGQ 4Q0CA 4G8MA 2Y7PA 1MPDA 4IO6A 1Z7NE 1US4A 2FYIA 2RCAA 1LCFA 1ATGA 3K6WA 3C33A 3MJNA 1SW5A 3H3GA 4YU0A 1P1OA 4NWDA 4ELPA 1B52A 3ONMA 1TXFA 1IXIA 2YJPA 2XXUA 4FIMA 4ZEDA 5FTIA 1M5DA 4EUOA 4EF2A 1M5EA 4H5GA 4G8HA 1URGA 1QUIA 2Y7RA 5CI5A 1P99A 1UTHB 3IR1A 2W7YA 2QS2A 3KEIA 2Y84A 3PMWA 2HEUA 2OK2A 5CMMA 1IQ7A 3MAMA 5DVJA 1TFAA 4F1YA 1IUDA 4ND9A 4QFKA 4I62A 4BDLA 2ONRA 1A8FA 4HW8A 2BJJX 4F1VA 4PQJA 3THIA 1SYIA 4MF3A 1Q35A 2O51A 1SW1A 4OEVA 4F1UA 3GBAA 1QW0A 5CRYA 1LBBA 4ZE9A 5KCJA 2H99A 2ZMBA 2A5TA 1QVSA 2XXTA 5L9SA 4OYVA 4GLIA 1MH3A 3CSBA 4YICA 3IO6A 1Q1KA 2XD3A 4U23A 5DYHA 1Y3NA 3IOWA 1IITA 3TAJA 3A09A 1YPNA 1B40A 2X7QA 3B6QA 1EH3A 4H8JA 2XXPA 3KFMA 3TCHA 1LCTA 2HXWA 1QKBA 4G68A 3H6VA 2F97A 4YMBA 4F3SA 3K0VA 4R9FA 1RYOA 4U1OA 5JK4A 3K1MA 1ZLQA 4XKPA 4ESWA 1P1WA 3SEYA 4JWXA 1H45A 4G68C 3O6HA 3OEMA 1JVYA 2GH9A 3FVOA 1B4HA 4OESA 3ECRA 1FTOA 1N04A 4TLMB 2ZNTA 3DP4A 3FJMA 3OSQA 1A55A 3FVNA 4PFTA 2G93A 1B7ZA 4ECFA 1D9YA 2R6GE 5IAIA 3PUYE 2HZLA 4FORA 3KJ7A 4ZS9A 1NKXA 2LAOA 3HN0A 5F7VA 2V93A 4M1VA 3DLNA 4F22A 1VSOA 4N13A 2H4IA 3QSLA 3TTLA 3VLWA 1NL5A 2O69A 4TQUQ 2VOZA 4QFNA 4GXAA 4AQ4A 3EF7A 2DWAA 2O68A 3RTFB 3HHFA 3RN8A 1SYHA 1USYE 2XXYA 1UTHA 1PB9A 1Y9UA 1AOVA 4K3FA 3TEPA 4YAHX 3FXQA 3PUVE 1ZJLA 4JWOA 2RC9A 4YB6A 4NWCA 5M2VA 4IGRA 4XKRA 3IJOB 4N07A 2DWJA 1URSA 1LFIA 2X26A 3RNNA 4OFOA 4GRKA 5I59B 4LZ7A 4ZEFA 3T9HB 2F6GA 2QS4A 1MY3A 4L17A 2I3VA 4OFJA 2O6AA 2V3TA 3QAXA 3RTWB 3U72A 4YKJA 3IB1A 4POXA 4EQ9A 4OVJA 5H8QA 4JB7A 2DE2A 1LAHE 3TCFA 3EHUA 2ESNA 1S9TA 3T9XB 3C35A 1PDAA 5J1DA 3CI8A 2I4BA 1Y4CA 3SEVA 4RY1A 2VHAA 3EHSA 1HSLA 1USYH 4RK2A 1IEJA 4QSEA 3TQLA 3FIRA 5HM4B 4ZEBA 1MY1A 1YCJA 3IL1B 3KSJA 3PUXE 2UVHA 4DE8A 4BDMA 3SERA 4KYDA 1BLFA 2B65A 2M8CA 4IY6A 2HAVA 1AIVA 3ZSFA 3KN8A 5K2YA 3CG1A 2Z22A 1I6AA 3MZBA 1EZPA 3I6VA 5I57B 1LFHA 3IAZA 2HCAA 1B05A 2DVCA 3WAFA 1MXWA 5H8HB 4IY5A 4I8CA 3H6UA 3K2DA 2XD2A 3K01A 3PUZE 4WEPA 1FQEA 1WDNA 5IKBA 1MRPA 3K6XA 2NOOA 2GFEA 1N76A 1POTA 4GL8A 2VD2A 3P7IA 3VVEA 3TDJA 4EF1A 1B3FA 4YZZA 2A5TB 4HCYA 3MBPA 1B7HA 1FTJA 3FVGA 4Q8RA 1N3XA 2VP1A 4MLQA 4FE8A 2E1SA 3G3HA 2OCUA 1DPPA 3I3VA 5FHMA 4Z7EA 3JYRA 1IXCA 2P0SA 2OWSA 1DOTA 3G3KA 3PGFA 3GLBA 2ANJA 1II5A 1LBCA 3O97A 3S9MC 2XXVA 4OERA 3FV1A 1O63A 3Q27A 1MPCA 5DVIA 2PBWA 3GBBA 1B3GA 1D9VA 1MDP1 1H76A 5I2KB 1RKMA 3QXMA 4I9DA 4OWDA 4KFQA 2H98A 3RUMA 3HSTA 2Q89A 4KHZE 3RT8A 3PD8A 1MY0A 3FJ7A 4FECA 3O28A 1O7TA 5CM6A 2Y7IA 4DCYA 3PU5A 4XKNA 5AA3A 2IA4A 4ESXA 3OOAA 3MWBA 4JSOA 3B7DA 4F39A 4U21A 2I0BA 2Q9TA 3FASA 3RT6B 3O66A 2H25A 2DWHA 2V3QA 3QYTA 3ODBA 2RC8A 2DQVA 2GHAA 3QK6A 1XT8A 4H65A 4QFOA 3TMGA 5CMBA 2O7UA 3B6TA 4RNSA 4ONYA 1FTLA 3L6GA 4NF6B 1B51A 1N84A 4ISUA 3U94A 1ELJA 2FNCA 3IJXB 3B6WA 4G4PA 4OXVA 2ZNSA 3MZ1A 4R2FA 4WXJA 2ZYKA 5KZTA 5ITOA 2D3IA 3UIFA 5I57A 2O84X 2V3UA 4THIA 1FTKA 4E0WA 2CMOA 5JTYA 1B5JA 2QL3A 4P11A 3VVFA 5H8HA 4PETA 4KYEA 3N26A 1NH8A 2AYSA 4ZECA 1B9JA 4DXBA 5AA2B 2QRYA 2DYXA 1MQDA 3T9UA 2F78A 2REJA 4GWOA 4F2OA 4LUBA 4MBPA 1UIVA 4LVQA 1B0LA 4H0WA 4IGTA 2UVIA 2VGQA 3L6HA 3KOSA 1F9BA 3UN6A 1FCKA 5LOMA 3SESA 5HBCA 5H8QB 2RKMA 5EYFA 3E9XA 3VLUA 4LQ5A 2E0SA 2XX9A 1B32A 2Q88A 3N6UA 1FQCA 4P0GA 5FTHA 1A54A 1RYXA 1H3DA 2I49A 3MQ9A 1OIBA 5AA1A 4H67A 3H06B 3VV5A 4UACA 3MC2A 2P1SA 3BKIB 4NE4A 3PPQA 4AB6A 4FEDA 3UGWA 1XHYA 3HPIA 3VLVA 2F35A 3O9PA 5I2KA 4QF9A 2WKYA 5F1QA 1J1NA 1P1QA 2ZYNA 4DXUA 3OEKA 5ICTA 4NF4B 2UVJA 3R7XA 4POWA 2Z8EA 3RGYA 1OVBA 3CR9A 3TTKA 2HAUA 3MVWA 3MPKA 3ILUB 5AA2D 2XXXA 3FJGA 5H8SA 1SW4A 3UA8A 1MXYA 1BTJA 3K6VA 4R72A 1Z7ME 4NF5B 4NEDA 1B3EA 4U4SA 5EHMA 4TOZA 4C1TA 3TELA 3TKDA 4WKMA 2PT2A 3KOTA 1UIUA 5H8NB 2GHBA 2V84A 3EPEA 1JW4A 1SI1A 4H6DA 3D4CA 1PB7A 4Q30B 3K1PA 4H8IA 4N6PA 4NF6A 4O3CA 4KQPA 2RINA 2F34A 4KCCA 5H8FB 4OETA 4PFWA 2G29A 1OVTA 1LAGE 1N0TA 2XXQA 2ABHA 2OWTA 4QFPA 4LQ2A 1MM6A 5L9MA 1D4NA 4YB7A 3PMVA 1MH4A 1AMFA 4QSDA 1FQBA 4XXUA 5AA2A 4U1ZA 1Y1ZA 1OMPA 5BWJA 4R75A 4NF8B 4HS7A 1A7LA 2Q8JA 2VD3A 5I84A 3BFTA 2QMXA 1AL3A 1PB8A 3MZ9A 4GVOA 3C31A 1XC1A 4GQOA 1H44A 1SVXB 4GXSB 4RXLA 3VXCA 4HTGA 2DP8A 3RQTA 3TCGA 4X1DA 1Y4TA 3LC8A 1ZU0A 4R73A 2F8DA 2AL4A 4MH5A 3IB0A 3KJTA 3KN7A 1PEBA 4BDRA 3IOUA 3DP8A 4FATA 2A5SA 3TUSA 4PE5B 1MY4A 3IB2A 3CFZA 1AH5A 3OELA 4NF4A 4IB2A 3M8UA 5FHNA 3CSGA 1GTKA 4MFIA 5DT6A 4MLVA 2HQ0A 4DZ1A 1D3KA 5JTYB 4G77A 3TFLA 3E4RA 4F31B 2XX8A 5DEXB 1LSTA 2ZXTA 1CB6A 4ZZEA 3E13X 5CMKA 4NF5A 4KPTA 4DDDA 1R1NA 1ZIUA 4F19A 1I6QA 4GFRA 1H43A 1B4ZA 1P1UA 1GVCA 3M3KA 3U92A 4RJZA 5H8NA 2Z8FA 4YB5A 4TLLB 4DIGA 1JW5A 4ZEKA 2OJTA 4F3GA 2NXOA 1QUKA 3LSWA 3DP6A 3KZGA 4KYSA 4RPOA 1M5CA 5B70A 1EZ9A 3FVKA 5H8FA 3SDFA 1MXZA 2F7BA 3JZJA 1XOCA 4OEUA 1MXUA 3MVYA 4R9GA 4LZ5A 1T0KA 5I56B 3CRBA 1YAEA 2PT1A 1FTMA 4OZ9A 5K2XA 4UA8A 2I3WA 4WEDA 3EN3A 5TP9B 2QS1A 3HV1A 3MP6A 3T66A 1S7YA 3RLFE 4ELRA 2DVZA 4RYAA 1IZ1A 1XVXA 4NMYA 4NF8A 1SQYA 1MDQA 1JVXA 3LR1A 4RA1A 4BLAA 1B1XA 1DTGA 3K6UA 1B5IA 4O3BA 2F5XA 5TPAB 1VFDA 2O7IA 3N5LA 1IXHA 5JEIA 1SD3A 3TZAA 4BDQA 4ELQA 4NTLA 1B2HA 3Q25A 3H6WA 3VVDA 4EQ7A 3OD7A 1US5A 2RCBA 1IXGA 2QS3A 4DXCA 4BDOA 4AB5A 4IO7A 4C1UA 2Y7WA 1MG1A 2Z23A 3O6IA 1A99A 2PVUA 3KBRA 2D5WA 1B1HA 1WODA 3W15C 2I0CA 2QSXA 3QUJA 1URDA 1POY1 1Y1MA 3ILTB 3TQWA 3HHGA 3PMXA 3GZGA 4GIZA 1BP5A 3DM0A 3SEUA 1NMUA 1JQFA 1N3WA 3CFXA 1MY2A 3MP8A 3LSXA 1JEUA 5I2NB 2XXRA 1B7UA 2GRVA 2X7PA 3FXUA 3BFUA 3O2AA 2OZZA 4RPNA 1DSNA 1VFEA 1Y3QA 3IOTA 5DEXA 3M3LA 4BDNA 1MXVA 1VE4A 2F7AA 4F18A 4RK9A 1LB8A 3RPWA 1MXXA 1I6BA 4F2QA 4LONB 3K00A 2DOJA 5AA4B 4JDFA 1NH7A 3S9NC 3FZVA 3TODA 3LUYA 1JETA 1A8EA 4ELOA 1GGGA 2XHDA 3AXFA 3SKPA 1B0HA 1FQAA 1DPEA 4H5FA 2F36A 3QUFA 4X48A 4EQBA 4U2RA 4JWYA 3EQ1A 2Q2AA 3SETA 3N94A 3W9WA 1R9LA 3S9EA 5L9OA 3UORA 2I48A 1PBQA 2ZYMA 3S4UA 1MPBA 4XKQA 5I56A 5CBSA 2I58A 4F29A 1TWYA 1N7WA 1MQIA 1DTZA 3FD3A 3OMBA 4LZ8A 1A40A 4OTEA 1MS7A 5TP9A 3VE1B 4FEBA 2O1MA 1SDXA 2DE4A 5L8DA 2UYFA 2Z8DA 4ZE8A 4ZEIA 1YTVA 4QFLA 3T96B 4KCDA 4KI0E 1B58A 2AL5A 1OLCA 4LATA 2XX7A 4U22A 5ELVA 3H4ZA 4FJPA 1TFDA 4C0RA 3T93B 3VFJA 1SI0A 2F7CA 3JV9A 4P0IA 2I4CA 2I6EA 2UYEA 5TPAA 4Q5TA 3CVGA 4XTCQ 1QJMA 2NUVA 2ALUA 5CBRA 5KDTB 2RC7A 3C34A 1M5FA 3OSRA 1FW0A 3S9LC 3VDFA 1SW2A 3UK4A 3K1NA 5DVFA 4YKIA 1NNTA 2Y7KA 1OQHA 4PP0A 4U4XA 2PMSA 3PPPA 3PD9A 4JXIA 1B5HA 2OBGA 2ZNUA 5HPQA 2DS9A 1UTBB 4I1DA 2NVUB 2V25A 3G3JA 3FUZA 4EDPA 1WVJA 3OO8A 3R26A 5I2NA 5I58B 1LLSA 3PV0E 1GV8A 4GD5A 2REGA 1FQFA 1ZKBA 3K4UA 2R71A 3WAEA 3V89B 4OMBA 2ONSA 1I69A 3H7MA 2CZLA 4JSDA 3IO4A 4X9TA 4DLDA 3OENA 3MVZA 3FATA 4IO4A 3O29A 3LSLA 3C4MA 3FGSA 3G3GA 5AA4A 4R2BA 2THIA 2UVGA 5ICQA 1P1NA 1BIYA 3C36A 5DTBA 3IK6B 3ZS6A 5A5XB 1ANFA 4JBZA 2F6PA 3TTNA 1NNPA 1QUJA 1JW1A 3USDA 4IO3A 4R6KA 1XVYA
chains in the Genus database with same CATH superfamily
5AE4A 2PX1A 3N6TA 2B3FA 4ZDMA 4IO5A 3G3IA 4R6HA 3MW0A 5CMCA 3UP9A 2NWJA 1GR2A 2KR0A 1IMBA 4YKKA 4QBAA 3C9HA 1PC3A 1R6ZA 2DXRA 1JEVA 1FBPA 1Y20A 1HSJA 4N6DA 1EU8A 3A3CA 2D21A 4E0XA 1ZBMA 5FBPA 3PTYA 2DXYA 4F3BA 4I3YA 4F3PA 2Y5LA 3RY3A 3GYYA 3OO6A 3EHTA 2B4LA 3CG3A 2RF1A 3C32A 3GXAA 2XXKA 3A3UA 3KGCA 1TT1A 3TPAA 3NOHA 1Y3PA 4M4GA 4PFIA 2ONKE 4OVPA 5IGAA 3H6TA 4PFBA 1OQGA 3R6UA 3OO9A 1ZMGA 3QMFA 5TU0A 5ITPA 3KN3A 2QJEA 4KD5A 2O1LA 3IORA 4GL0A 4Z0IA 3MUQA 3O6GA 4OANA 3U93A 3KBZA 3FV2A 2QPQA 2XXIA 3LSFB 4R6YA 1PBPA 1IIWA 3KG2A 5EQAA 3TTMA 2HHMA 3G7WA 1LAFE 1SPIA 1BKAA 1MM7A 2AIXA 3HO7A 2Y5KA 3T9VA 5FHOA 3Q26A 4G2ZA 2OLBA 3MPLA 1JNFA 3V83A 2PYYA 2UXAA 1FTAA 1N7XA 5KDTA 3W9VA 1K9ZA 4JVDA 1KWHA 3IFCA 1LGBC 1FPJA 3MP1A 3SEWA 2QMWA 4HCWA 2ZZXA 3HCQA 4G8NA 1MQHA 1LAXA 2XXWA 2DWIA 3IOVA 3DELB 1LFGA 2BJIA 3T22A 1L5TA 1S50A 1FQDA 1CE2A 4OFLA 2F3DA 4DCXA 3OXNA 2HFBA 3Q29A 1UTBA 4IO2A 5KCJB 2VPNA 4LA9A 2XWVA 2DSFA 4O94A 3TYHA 2R9JA 4H1XA 1DMBA 1DBZA 5BUUA 4YKPA 4GF8A 2YPNA 2ZYOA 5EQ7A 2FA7A 3PUWE 1NNKA 5I58A 2QVRA 1QULA 3TTRA 1RDXA 1OLAA 4OQOA 1LB9A 1SBPA 4LP2B 3MVXA 3QIMA 2FBPA 4GOTA 1ZTYA 3CIJA 3PPOA 4NHBA 3V5AA 3BBRA 4EXLA 3K02A 2IEEA 3PPRA 3ZKKA 2VT5A 5J16A 1B6HA 4X1BA 4G68B 1MQJA 4PFYA 1B46A 1R9QA 4O3AA 5I59A 4PFUA 4YMAA 3G3FA 1B3LA 2H9BA 4R74A 3FBPA 4QHQA 3SEXA 2YLNA 3CHGA 3RPLB 5CC2A 5A5XA 4H46A 1MQGA 4ZZAA 4EXKA 3ZKLA 1XS5A 3S2VA 2XXHA 2CEXA 2KLFA 3OO7A 3LBSA 1NNFA 1QKAA 1O64A 4QSCA 1VR5A 1NI9A 1UQWA 3M3FA 3D4GA 1FRPA 3PPNA 4KR5A 2P2AA 3F11A 5ESYA 4P3LA 2Q2CA 3IX1A 3CFLA 5ISUA 3I5OA 5IM2A 1M5BA 3FXRA 3KSXA 1NFTA 2B3BA 1EZOA 1B3HA 1INPA 4OHNA 3Q28A 3E3KA 4PAIA 3VXBA 3V8XB 3H03A 1HSEA 3U1OA 5EHSA 2DE3A 2HZKA 3U8QA 4FAJA 2H5YA 5B7DA 4QRZA 4OENA 4XIGQ 4Q0CA 4PCDA 1FPDA 4G8MA 2Y7PA 1MPDA 4IO6A 1Z7NE 1RDZA 1US4A 2FYIA 2RCAA 1LCFA 1ATGA 3K6WA 3C33A 3MJNA 1SW5A 2WEFA 3H3GA 4YU0A 1P1OA 4NWDA 4MCOA 4ELPA 1B52A 3ONMA 1TXFA 1IXIA 2YJPA 1LBWA 2XXUA 4FIMA 4ZEDA 5FTIA 1M5DA 4EUOA 4EF2A 1M5EA 1NV4A 4H5GA 4G8HA 1URGA 1QUIA 2Y7RA 5CI5A 1P99A 4MMPA 1UTHB 1DCUA 3IR1A 2W7YA 4NQ8A 2QS2A 3KEIA 3ROJA 2Y84A 3PMWA 2HEUA 2OK2A 5CMMA 1IQ7A 2XA5A 3MAMA 5DVJA 1TFAA 4GX4A 4F1YA 1IUDA 4ND9A 4QFKA 4I62A 4BDLA 2ONRA 1A8FA 4HW8A 2BJJX 4F1VA 4PQJA 3THIA 1SYIA 4MF3A 1Q35A 2O51A 1SW1A 4OEVA 4F1UA 3GBAA 1QW0A 5CRYA 1LBBA 4ZE9A 5KCJA 2H99A 2ZMBA 2A5TA 1QVSA 2XXTA 5I5PA 5L9SA 4OYVA 1NUXA 4GLIA 3KC1A 1MH3A 3CSBA 4YICA 3IO6A 1Q1KA 2ZZVA 2XD3A 1KA1A 4U23A 5DYHA 1Y3NA 2OX3A 3IOWA 1NV3A 1IITA 4QXDA 5A5LA 4PAKA 3TAJA 3A09A 1YPNA 1B40A 4LN5A 3LUZA 2X7QA 3B6QA 1EH3A 4H8JA 4HXVA 2XXPA 3KFMA 3TCHA 1LCTA 2HXWA 1QKBA 4G68A 3H6VA 2F97A 4PF8A 5F24A 4YMBA 2WBDA 4F3SA 1BK4A 3K0VA 4R9FA 2ZZWA 1RYOA 3RPLA 4U1OA 5JK4A 3K1MA 1ZLQA 4XKPA 4ESWA 1P1WA 3SEYA 4JWXA 1H45A 4G68C 3O6HA 3OEMA 2GQ1A 1JVYA 2GH9A 3FVOA 1B4HA 4OESA 3ECRA 5ET5A 1FTOA 1N04A 1IMAA 4TLMB 2ZNTA 2QVUA 3DP4A 3FJMA 3OSQA 1A55A 3FVNA 4PFTA 2G93A 1B7ZA 4ECFA 1D9YA 2R6GE 5IAIA 1FBHA 4O8MA 3PUYE 2HZLA 4FORA 3KJ7A 4ZS9A 1NKXA 2LAOA 1NV2A 3HN0A 5F7VA 4XF5A 4M1VA 2V93A 3DLNA 4F22A 1VSOA 4N13A 2H4IA 3QSLA 3TTLA 3VLWA 1NL5A 2O69A 4TQUQ 2VOZA 4QFNA 4GXAA 4AQ4A 2QFLA 3EF7A 4PGPA 2DWAA 2O68A 3RTFB 3HHFA 3RN8A 1SYHA 1USYE 2XXYA 2HXRA 1UTHA 1PB9A 1Y9UA 1AOVA 4K3FA 3TEPA 4YAHX 3FXQA 3PUVE 4NX1A 1Q9DA 1ZJLA 4JWOA 2RC9A 4YB6A 4NWCA 5M2VA 4IGRA 4XKRA 3IJOB 4N07A 2DWJA 1URSA 4FBPA 1LFIA 2X26A 3RNNA 4OFOA 4GRKA 5I59B 4LZ7A 4ZEFA 3T9HB 2F6GA 2QS4A 4JVCA 1MY3A 4L17A 2I3VA 4OFJA 2O6AA 2V3TA 3QAXA 3RTWB 1NV6A 2CZIA 3U72A 4YKJA 3IB1A 4POXA 4EQ9A 4OVJA 5H8QA 4JB7A 2DE2A 1LAHE 3TCFA 3EHUA 2ESNA 1S9TA 4UABA 3T9XB 1FJ9A 3C35A 1PDAA 5J1DA 3CI8A 2I4BA 1Y4CA 3SEVA 4GWYA 4RY1A 2VHAA 3EHSA 1HSLA 2PCRA 1FBCA 1USYH 4RK2A 1IEJA 4QSEA 3TQLA 3FIRA 5HM4B 4ZEBA 1MY1A 1YCJA 4O7MA 3IL1B 3KSJA 3PUXE 2UVHA 4DE8A 4BDMA 3SERA 1RDYA 4KYDA 1BLFA 2B65A 2M8CA 4IY6A 2HAVA 5EQ9A 5I3SA 1AIVA 3ZSFA 4N15A 3KN8A 5K2YA 3CG1A 1IMFA 4MNCA 2Z22A 1I6AA 3MZBA 1EZPA 1JP4A 3I6VA 5I57B 1LFHA 3IAZA 2HCAA 1B05A 2DVCA 3WAFA 1MXWA 5H8HB 4IY5A 4I8CA 3H6UA 3K2DA 2XD2A 3K01A 3PUZE 4WEPA 1FQEA 1WDNA 4NN3A 5IKBA 1EYIA 1MRPA 3K6XA 2NOOA 2GFEA 1N76A 1POTA 4GL8A 2VD2A 3P7IA 3VVEA 3TDJA 4EF1A 2PFZA 1B3FA 4YZZA 2MKZA 2A5TB 3E79A 4HCYA 3MBPA 1B7HA 1FTJA 3FVGA 4Q8RA 1N3XA 4P9KA 2VP1A 4MLQA 4FE8A 2E1SA 3G3HA 2OCUA 1DPPA 3I3VA 4N17A 5FHMA 4Z7EA 3JYRA 1IXCA 2P0SA 2OWSA 1DOTA 3G3KA 5EQ8A 3PGFA 3GLBA 2ANJA 1II5A 1LBCA 3O97A 3S9MC 2P3NA 2XXVA 4OERA 1NV1A 1O63A 3FV1A 1FPEA 3Q27A 2WYKA 3LV0A 1MPCA 5DVIA 4JVIA 2PBWA 3GBBA 1B3GA 1D9VA 1CNQA 1MDP1 1H76A 5I2KB 1RKMA 3QXMA 4I9DA 3HFUA 4OWDA 4KFQA 2H98A 3IFAA 3RUMA 3HSTA 2Q89A 4KHZE 1FPFA 4GWWA 2QVVA 1FPKA 3RT8A 3PD8A 1MY0A 3FJ7A 4FECA 3O28A 1O7TA 5CM6A 2Y7IA 4DCYA 3PU5A 4XKNA 2F3BA 5AA3A 2IA4A 4ESXA 3OOAA 3MWBA 4JSOA 3B7DA 4F39A 3BIGA 4U21A 2I0BA 2Q9TA 3FASA 3RT6B 3O66A 1LBZA 2H25A 2DWHA 2V3QA 3QYTA 5ET7A 4X04A 3ODBA 2RC8A 2DQVA 2GHAA 3QK6A 4PGNA 1XT8A 4H65A 4QFOA 3TMGA 5CMBA 2O7UA 3B6TA 4RNSA 4ONYA 1FTLA 3L6GA 4NF6B 1B51A 5IZ3B 1N84A 4ISUA 3U94A 1ELJA 2FNCA 3IJXB 3B6WA 4G4PA 4OXVA 2ZNSA 3MZ1A 4R2FA 4WXJA 2ZYKA 5KZTA 5ITOA 2D3IA 3UIFA 5I57A 2O84X 2V3UA 4THIA 1FTKA 4E0WA 2CMOA 1AWBA 5JTYA 1B5JA 2QL3A 3A29A 2HPGA 4P11A 3VVFA 5H8HA 4PETA 4HE0A 4KYEA 3N26A 1NH8A 2AYSA 1FBGA 4ZECA 1B9JA 4DXBA 5AA2B 2QRYA 2DYXA 1MQDA 1IMCA 3T9UA 2F78A 2REJA 4GWOA 4F2OA 4LUBA 4MBPA 1UIVA 4LVQA 4NG7A 1B0LA 4H0WA 4IGTA 2UVIA 2VGQA 3L6HA 4P47A 3KOSA 4XFEA 1F9BA 3UN6A 1FCKA 4AS4A 1FBDA 3SESA 5LOMA 5HBCA 5H8QB 2RKMA 5EYFA 3E9XA 3VLUA 4LQ5A 2E0SA 2XX9A 4P8BA 1B32A 2Q88A 3N6UA 1FQCA 4P0GA 2V4CA 5FTHA 4MEVA 4N4UA 1A54A 1RYXA 1H3DA 1FPLA 2I49A 3MQ9A 1OIBA 5AA1A 4H67A 3H06B 3VV5A 4UACA 3MC2A 2P1SA 3BKIB 4NE4A 4DI3D 3PPQA 4AB6A 1G0HA 4FEDA 3UGWA 1XHYA 3HPIA 3VLVA 2F35A 3O9PA 2PFYA 5I2KA 4QF9A 1FPBA 2WKYA 5F1QA 1J1NA 1P1QA 2ZYNA 4DXUA 2XWKA 3OEKA 5ICTA 4NF4B 2UVJA 1DK4A 3R7XA 4POWA 2Z8EA 3RGYA 1OVBA 3CR9A 3TTKA 2HAUA 3MVWA 3MPKA 3ILUB 5AA2D 2XXXA 3FJGA 5H8SA 1SW4A 3UA8A 1MXYA 2WX9A 1BTJA 3K6VA 3T0JA 5I7IA 4R72A 1Z7ME 4NF5B 4NEDA 1B3EA 4U4SA 5EHMA 4TOZA 2CZKA 4C1TA 4G61A 3TELA 3TKDA 4WKMA 2PT2A 3KOTA 1UIUA 5H8NB 2GHBA 2V84A 3EPEA 1JW4A 1SI1A 4H6DA 3D4CA 1PB7A 4Q30B 3K1PA 4H8IA 1FPIA 4N6PA 4NF6A 5T3JA 5IZ3A 1G0IA 4O3CA 4KQPA 2RINA 4N91A 2F34A 4KCCA 4NF0A 3D1RA 4OVSA 5H8FB 4OETA 4PFWA 2L5VA 2XWOA 3MSTA 2G29A 4GWUA 1NV0A 1OVTA 4GX6A 1LAGE 4H45A 1N0TA 4O7IA 2XXQA 2ABHA 2OWTA 4QFPA 4LQ2A 1MM6A 5IZ1A 1D4NA 4YB7A 5L9MA 3PMVA 1MH4A 1AMFA 4QSDA 1FQBA 4XXUA 3SZPA 5AA2A 4U1ZA 1Y1ZA 1OMPA 5BWJA 4R75A 4NF8B 3B50A 4HS7A 1A7LA 2Q8JA 2VD3A 4MAGA 5I84A 1K9YA 3BFTA 5LTCA 2QMXA 1AL3A 1PB8A 3MZ9A 4GVOA 3C31A 1XC1A 4GQOA 1H44A 1SVXB 4GXSB 4RXLA 4MHFA 4N6KA 3VXCA 4HTGA 5EYHA 2DP8A 2VPOA 3RQTA 3TCGA 4PDDA 4N8YA 4X1DA 4OVQA 1Y4TA 3LC8A 1ZU0A 4R73A 2F8DA 2AL4A 5ET6A 4N81A 4MH5A 3IB0A 3KJTA 3KN7A 5EYGA 1PEBA 4BDRA 3IOUA 2FIXA 3DP8A 4FATA 2A5SA 3TUSA 4GWSA 4PE5B 1MY4A 3IB2A 3CFZA 1AH5A 3OELA 4NF4A 4IB2A 3M8UA 5FHNA 4XEQA 2KQZA 3CSGA 1GTKA 4MFIA 5DT6A 4MLVA 2HQ0A 4DZ1A 1D3KA 4P56A 5JTYB 4G77A 3TFLA 3E4RA 2R8TA 4F31B 2XX8A 5DEXB 1LSTA 2ZXTA 1CB6A 4ZZEA 1LEVA 3E13X 5CMKA 4NF5A 4KPTA 3E78A 4DDDA 1R1NA 1ZIUA 4F19A 1I6QA 4GFRA 1H43A 1B4ZA 1P1UA 2CZHA 1EYKA 1GVCA 3M3KA 3U92A 4RJZA 5ET8A 1FBFA 5H8NA 2Z8FA 4YB5A 4KXPA 4TLLB 4DIGA 1JW5A 2XWIA 4ZEKA 1LBXA 2OJTA 4F3GA 2NXOA 1QUKA 3LSWA 4PF6A 3DP6A 3KZGA 4KYSA 4RPOA 1M5CA 5B70A 1EZ9A 3FVKA 5H8FA 3SDFA 1MXZA 2F7BA 3JZJA 1NUWA 1XOCA 2CEYA 4OEUA 1MXUA 4PTKA 3MVYA 4R9GA 4LZ5A 1T0KA 5I56B 3CRBA 1YAEA 2PT1A 1FTMA 4PFRA 3RYDA 4OZ9A 5K2XA 4UA8A 2I3WA 4WEDA 3EN3A 5TP9B 2QS1A 4X8RA 3HV1A 3MP6A 4IR8A 1YYZA 2Q74A 3T66A 1S7YA 3RLFE 4GWZA 4ELRA 2DVZA 4RYAA 1IZ1A 1XVXA 4PAFA 4NMYA 4NF8A 4AS5A 1SQYA 3ISPA 1MDQA 1JVXA 3LR1A 1FBEA 4PE3A 3FXBA 4RA1A 4BLAA 1B1XA 1DTGA 1VDWA 3K6UA 1B5IA 4O3BA 2F5XA 5TPAB 1FPGA 1VFDA 4MNPA 2O7IA 2FVZA 4DI4B 3N5LA 1IXHA 5JEIA 1SD3A 4GX3A 3TZAA 4BDQA 4ELQA 4NTLA 1B2HA 3B8BA 3Q25A 3H6WA 3VVDA 4EQ7A 3OD7A 1US5A 2RCBA 1IXGA 2QS3A 4DXCA 4I3EA 4BDOA 4AB5A 4IO7A 4C1UA 2Y7WA 1MG1A 2Z23A 3O6IA 1A99A 2PVUA 3KBRA 3T1BA 2D5WA 1YZ0A 4HE2A 1NV5A 1B1HA 1WODA 3W15C 2I0CA 2QSXA 3QUJA 1URDA 1POY1 1Y1MA 3ILTB 3TQWA 3HHGA 3PMXA 3GZGA 4GIZA 1BP5A 3DM0A 3SEUA 1IMDA 1NMUA 1EYJA 1JQFA 1N3WA 3CFXA 1MY2A 3MP8A 3LSXA 1JEUA 5I2NB 2XXRA 1B7UA 2GRVA 2X7PA 3FXUA 3BFUA 3BIHA 3O2AA 4OVRA 2OZZA 4RPNA 1DSNA 4PBHA 1VFEA 1Y3QA 3IOTA 5DEXA 3M3LA 4BDNA 1MXVA 1VE4A 2F7AA 4F18A 4RK9A 1LB8A 4HE1A 3RPWA 1MXXA 1I6BA 2Q8MA 4MNIA 4F2QA 4LONB 3K00A 2DOJA 5AA4B 4JDFA 1NH7A 3S9NC 2WYPA 3KC0A 3FZVA 3TODA 3LUYA 1JETA 1A8EA 4ELOA 1NUYA 1GGGA 2XHDA 3AXFA 3SKPA 1B0HA 1FQAA 1DPEA 4H5FA 2F36A 3QUFA 4N8GA 4X48A 4EQBA 4U2RA 4JWYA 2JJKA 3EQ1A 1FJ6A 2Q2AA 4PDHA 1NUZA 3SETA 3N94A 4MIJA 3W9WA 1R9LA 3S9EA 5L9OA 4I40A 3UORA 2I48A 1PBQA 2ZYMA 4MJOA 3S4UA 1MPBA 4XKQA 5I56A 5CBSA 2I58A 4F29A 1TWYA 1N7WA 2P3VA 1KA0A 1MQIA 1DTZA 3FD3A 3OMBA 4LZ8A 1A40A 4OTEA 1MS7A 3EKIA 1XI6A 5TP9A 3VE1B 4FEBA 2O1MA 1SDXA 2DE4A 5L8DA 4P1LA 2UYFA 2Z8DA 4ZE8A 4ZEIA 1YTVA 4QFLA 3T96B 4GWXA 4KCDA 4KI0E 1B58A 2AL5A 1OLCA 4LATA 2XX7A 4U22A 1QGXA 5ELVA 3H4ZA 4FJPA 1TFDA 4C0RA 3T93B 3VFJA 1SI0A 2F7CA 3JV9A 5IZZA 4P0IA 2I4CA 2I6EA 2UYEA 5TPAA 4Q5TA 3CVGA 4XTCQ 1QJMA 2NUVA 2ALUA 5CBRA 1LBVA 5KDTB 1FSAA 3U65A 4P1EA 2RC7A 3C34A 1M5FA 3OSRA 1FW0A 4PBQA 3S9LC 3VDFA 4MX6A 1SW2A 3UK4A 3K1NA 5DVFA 4YKIA 1NNTA 2Y7KA 3MYUA 1OQHA 4PP0A 2DDKA 4U4XA 2PMSA 1NV7A 3PPPA 3PD9A 2OWZA 4JXIA 1B5HA 2OBGA 2ZNUA 5HPQA 2DS9A 1UTBB 4I1DA 2NVUB 2V25A 3G3JA 4PC9A 3FUZA 4EDPA 1WVJA 4GBVA 1IMEA 3OO8A 3R26A 5I2NA 5I58B 1LLSA 3PV0E 1GV8A 4GD5A 4OVTA 2REGA 2B4MA 1FQFA 4NAPA 1ZKBA 3K4UA 2R71A 3WAEA 3V89B 4OMBA 2ONSA 1I69A 3H7MA 2CZLA 4JSDA 3IO4A 4X9TA 4DLDA 3OENA 3MVZA 3FATA 4IO4A 3O29A 3LSLA 3C4MA 1YXIA 2WBBA 3FGSA 3G3GA 5AA4A 4R2BA 2THIA 2UVGA 4GBWA 5ICQA 5LDZA 1P1NA 1BIYA 1KZ8A 3C36A 1D9QA 4OA4A 5DTBA 3IK6B 3ZS6A 5A5XB 4NGUA 1ANFA 4JBZA 2F6PA 3TTNA 1NNPA 1QUJA 1JW1A 3USDA 4IO3A 1LBYA 2FIEA 4R6KA 5DW8A 1XVYA 2FHYA
chains in the Genus database with same CATH topology
5AE4A 2PX1A 3N6TA 2B3FA 4ZDMA 4IO5A 3G3IA 4R6HA 3MW0A 5CMCA 3UP9A 2NWJA 1GR2A 4YKKA 3C9HA 1PC3A 1R6ZA 2DXRA 1JEVA 1Y20A 1HSJA 1EU8A 3A3CA 2D21A 4E0XA 1ZBMA 2DXYA 4F3BA 4F3PA 3RY3A 3OO6A 3EHTA 3CG3A 2RF1A 3C32A 3GXAA 3KGCA 3A3UA 1TT1A 3TPAA 1Y3PA 4M4GA 2ONKE 3H6TA 1OQGA 3R6UA 3OO9A 1ZMGA 5TU0A 5ITPA 3KN3A 2QJEA 4KD5A 2O1LA 3IORA 4GL0A 4Z0IA 3MUQA 3O6GA 3U93A 3FV2A 2QPQA 2XXIA 3LSFB 4R6YA 1PBPA 1IIWA 3KG2A 3TTMA 3G7WA 1LAFE 1BKAA 1MM7A 2AIXA 3HO7A 3T9VA 5FHOA 3Q26A 4G2ZA 2OLBA 3MPLA 1JNFA 3V83A 2PYYA 2UXAA 1N7XA 5KDTA 3W9VA 1KWHA 1LGBC 3MP1A 3SEWA 2QMWA 4HCWA 3HCQA 4G8NA 1MQHA 1LAXA 2XXWA 2DWIA 3IOVA 3DELB 1LFGA 3T22A 1L5TA 1S50A 1FQDA 1CE2A 4OFLA 4DCXA 3OXNA 2HFBA 3Q29A 1UTBA 4IO2A 5KCJB 4LA9A 2DSFA 3TYHA 2R9JA 4H1XA 1DMBA 5BUUA 4YKPA 4GF8A 2YPNA 2ZYOA 2FA7A 3PUWE 1NNKA 5I58A 1QULA 3TTRA 1OLAA 4OQOA 1LB9A 1SBPA 4LP2B 3MVXA 3QIMA 4GOTA 1ZTYA 3CIJA 3PPOA 3V5AA 3BBRA 4EXLA 3K02A 2IEEA 3PPRA 3ZKKA 1B6HA 4X1BA 4G68B 1MQJA 4PFYA 1B46A 1R9QA 4O3AA 5I59A 4PFUA 4YMAA 3G3FA 1B3LA 2H9BA 4R74A 4QHQA 3SEXA 2YLNA 5CC2A 5A5XA 1MQGA 4ZZAA 4EXKA 3ZKLA 1XS5A 3S2VA 2XXHA 2KLFA 3OO7A 3LBSA 1NNFA 1QKAA 1O64A 4QSCA 1VR5A 1UQWA 3M3FA 3D4GA 3PPNA 4KR5A 2P2AA 3F11A 2Q2CA 3IX1A 3CFLA 5ISUA 3I5OA 1M5BA 3FXRA 3KSXA 1NFTA 2B3BA 1EZOA 1B3HA 4OHNA 3Q28A 3E3KA 3VXBA 3V8XB 3H03A 1HSEA 3U1OA 5EHSA 2DE3A 2HZKA 3U8QA 4FAJA 2H5YA 5B7DA 4QRZA 4OENA 4XIGQ 4Q0CA 4G8MA 2Y7PA 1MPDA 4IO6A 1Z7NE 1US4A 2FYIA 2RCAA 1LCFA 1ATGA 3K6WA 3C33A 3MJNA 1SW5A 3H3GA 4YU0A 1P1OA 4NWDA 4ELPA 1B52A 3ONMA 1TXFA 1IXIA 2YJPA 2XXUA 4FIMA 4ZEDA 5FTIA 1M5DA 4EUOA 4EF2A 1M5EA 4H5GA 4G8HA 1URGA 1QUIA 2Y7RA 5CI5A 1P99A 1UTHB 3IR1A 2W7YA 2QS2A 3KEIA 2Y84A 3PMWA 2HEUA 2OK2A 5CMMA 1IQ7A 3MAMA 5DVJA 1TFAA 4F1YA 1IUDA 4ND9A 4QFKA 4I62A 4BDLA 2ONRA 1A8FA 4HW8A 2BJJX 4F1VA 4PQJA 3THIA 1SYIA 4MF3A 1Q35A 2O51A 1SW1A 4OEVA 4F1UA 3GBAA 1QW0A 5CRYA 1LBBA 4ZE9A 5KCJA 2H99A 2ZMBA 2A5TA 1QVSA 2XXTA 5L9SA 4OYVA 4GLIA 1MH3A 3CSBA 4YICA 3IO6A 1Q1KA 2XD3A 4U23A 5DYHA 1Y3NA 3IOWA 1IITA 3TAJA 3A09A 1YPNA 1B40A 2X7QA 3B6QA 1EH3A 4H8JA 2XXPA 3KFMA 3TCHA 1LCTA 2HXWA 1QKBA 4G68A 3H6VA 2F97A 4YMBA 4F3SA 3K0VA 4R9FA 1RYOA 4U1OA 5JK4A 3K1MA 1ZLQA 4XKPA 4ESWA 1P1WA 3SEYA 4JWXA 1H45A 4G68C 3O6HA 3OEMA 1JVYA 2GH9A 3FVOA 1B4HA 4OESA 3ECRA 1FTOA 1N04A 4TLMB 2ZNTA 3DP4A 3FJMA 3OSQA 1A55A 3FVNA 4PFTA 2G93A 1B7ZA 4ECFA 1D9YA 2R6GE 5IAIA 3PUYE 2HZLA 4FORA 3KJ7A 4ZS9A 1NKXA 2LAOA 3HN0A 5F7VA 2V93A 4M1VA 3DLNA 4F22A 1VSOA 4N13A 2H4IA 3QSLA 3TTLA 3VLWA 1NL5A 2O69A 4TQUQ 2VOZA 4QFNA 4GXAA 4AQ4A 3EF7A 2DWAA 2O68A 3RTFB 3HHFA 3RN8A 1SYHA 1USYE 2XXYA 1UTHA 1PB9A 1Y9UA 1AOVA 4K3FA 3TEPA 4YAHX 3FXQA 3PUVE 1ZJLA 4JWOA 2RC9A 4YB6A 4NWCA 5M2VA 4IGRA 4XKRA 3IJOB 4N07A 2DWJA 1URSA 1LFIA 2X26A 3RNNA 4OFOA 4GRKA 5I59B 4LZ7A 4ZEFA 3T9HB 2F6GA 2QS4A 1MY3A 4L17A 2I3VA 4OFJA 2O6AA 2V3TA 3QAXA 3RTWB 3U72A 4YKJA 3IB1A 4POXA 4EQ9A 4OVJA 5H8QA 4JB7A 2DE2A 1LAHE 3TCFA 3EHUA 2ESNA 1S9TA 3T9XB 3C35A 1PDAA 5J1DA 3CI8A 2I4BA 1Y4CA 3SEVA 4RY1A 2VHAA 3EHSA 1HSLA 1USYH 4RK2A 1IEJA 4QSEA 3TQLA 3FIRA 5HM4B 4ZEBA 1MY1A 1YCJA 3IL1B 3KSJA 3PUXE 2UVHA 4DE8A 4BDMA 3SERA 4KYDA 1BLFA 2B65A 2M8CA 4IY6A 2HAVA 1AIVA 3ZSFA 3KN8A 5K2YA 3CG1A 2Z22A 1I6AA 3MZBA 1EZPA 3I6VA 5I57B 1LFHA 3IAZA 2HCAA 1B05A 2DVCA 3WAFA 1MXWA 5H8HB 4IY5A 4I8CA 3H6UA 3K2DA 2XD2A 3K01A 3PUZE 4WEPA 1FQEA 1WDNA 5IKBA 1MRPA 3K6XA 2NOOA 2GFEA 1N76A 1POTA 4GL8A 2VD2A 3P7IA 3VVEA 3TDJA 4EF1A 1B3FA 4YZZA 2A5TB 4HCYA 3MBPA 1B7HA 1FTJA 3FVGA 4Q8RA 1N3XA 2VP1A 4MLQA 4FE8A 2E1SA 3G3HA 2OCUA 1DPPA 3I3VA 5FHMA 4Z7EA 3JYRA 1IXCA 2P0SA 2OWSA 1DOTA 3G3KA 3PGFA 3GLBA 2ANJA 1II5A 1LBCA 3O97A 3S9MC 2XXVA 4OERA 3FV1A 1O63A 3Q27A 1MPCA 5DVIA 2PBWA 3GBBA 1B3GA 1D9VA 1MDP1 1H76A 5I2KB 1RKMA 3QXMA 4I9DA 4OWDA 4KFQA 2H98A 3RUMA 3HSTA 2Q89A 4KHZE 3RT8A 3PD8A 1MY0A 3FJ7A 4FECA 3O28A 1O7TA 5CM6A 2Y7IA 4DCYA 3PU5A 4XKNA 5AA3A 2IA4A 4ESXA 3OOAA 3MWBA 4JSOA 3B7DA 4F39A 4U21A 2I0BA 2Q9TA 3FASA 3RT6B 3O66A 2H25A 2DWHA 2V3QA 3QYTA 3ODBA 2RC8A 2DQVA 2GHAA 3QK6A 1XT8A 4H65A 4QFOA 3TMGA 5CMBA 2O7UA 3B6TA 4RNSA 4ONYA 1FTLA 3L6GA 4NF6B 1B51A 1N84A 4ISUA 3U94A 1ELJA 2FNCA 3IJXB 3B6WA 4G4PA 4OXVA 2ZNSA 3MZ1A 4R2FA 4WXJA 2ZYKA 5KZTA 5ITOA 2D3IA 3UIFA 5I57A 2O84X 2V3UA 4THIA 1FTKA 4E0WA 2CMOA 5JTYA 1B5JA 2QL3A 4P11A 3VVFA 5H8HA 4PETA 4KYEA 3N26A 1NH8A 2AYSA 4ZECA 1B9JA 4DXBA 5AA2B 2QRYA 2DYXA 1MQDA 3T9UA 2F78A 2REJA 4GWOA 4F2OA 4LUBA 4MBPA 1UIVA 4LVQA 1B0LA 4H0WA 4IGTA 2UVIA 2VGQA 3L6HA 3KOSA 1F9BA 3UN6A 1FCKA 5LOMA 3SESA 5HBCA 5H8QB 2RKMA 5EYFA 3E9XA 3VLUA 4LQ5A 2E0SA 2XX9A 1B32A 2Q88A 3N6UA 1FQCA 4P0GA 5FTHA 1A54A 1RYXA 1H3DA 2I49A 3MQ9A 1OIBA 5AA1A 4H67A 3H06B 3VV5A 4UACA 3MC2A 2P1SA 3BKIB 4NE4A 3PPQA 4AB6A 4FEDA 3UGWA 1XHYA 3HPIA 3VLVA 2F35A 3O9PA 5I2KA 4QF9A 2WKYA 5F1QA 1J1NA 1P1QA 2ZYNA 4DXUA 3OEKA 5ICTA 4NF4B 2UVJA 3R7XA 4POWA 2Z8EA 3RGYA 1OVBA 3CR9A 3TTKA 2HAUA 3MVWA 3MPKA 3ILUB 5AA2D 2XXXA 3FJGA 5H8SA 1SW4A 3UA8A 1MXYA 1BTJA 3K6VA 4R72A 1Z7ME 4NF5B 4NEDA 1B3EA 4U4SA 5EHMA 4TOZA 4C1TA 3TELA 3TKDA 4WKMA 2PT2A 3KOTA 1UIUA 5H8NB 2GHBA 2V84A 3EPEA 1JW4A 1SI1A 4H6DA 3D4CA 1PB7A 4Q30B 3K1PA 4H8IA 4N6PA 4NF6A 4O3CA 4KQPA 2RINA 2F34A 4KCCA 5H8FB 4OETA 4PFWA 2G29A 1OVTA 1LAGE 1N0TA 2XXQA 2ABHA 2OWTA 4QFPA 4LQ2A 1MM6A 5L9MA 1D4NA 4YB7A 3PMVA 1MH4A 1AMFA 4QSDA 1FQBA 4XXUA 5AA2A 4U1ZA 1Y1ZA 1OMPA 5BWJA 4R75A 4NF8B 4HS7A 1A7LA 2Q8JA 2VD3A 5I84A 3BFTA 2QMXA 1AL3A 1PB8A 3MZ9A 4GVOA 3C31A 1XC1A 4GQOA 1H44A 1SVXB 4GXSB 4RXLA 3VXCA 4HTGA 2DP8A 3RQTA 3TCGA 4X1DA 1Y4TA 3LC8A 1ZU0A 4R73A 2F8DA 2AL4A 4MH5A 3IB0A 3KJTA 3KN7A 1PEBA 4BDRA 3IOUA 3DP8A 4FATA 2A5SA 3TUSA 4PE5B 1MY4A 3IB2A 3CFZA 1AH5A 3OELA 4NF4A 4IB2A 3M8UA 5FHNA 3CSGA 1GTKA 4MFIA 5DT6A 4MLVA 2HQ0A 4DZ1A 1D3KA 5JTYB 4G77A 3TFLA 3E4RA 4F31B 2XX8A 5DEXB 1LSTA 2ZXTA 1CB6A 4ZZEA 3E13X 5CMKA 4NF5A 4KPTA 4DDDA 1R1NA 1ZIUA 4F19A 1I6QA 4GFRA 1H43A 1B4ZA 1P1UA 1GVCA 3M3KA 3U92A 4RJZA 5H8NA 2Z8FA 4YB5A 4TLLB 4DIGA 1JW5A 4ZEKA 2OJTA 4F3GA 2NXOA 1QUKA 3LSWA 3DP6A 3KZGA 4KYSA 4RPOA 1M5CA 5B70A 1EZ9A 3FVKA 5H8FA 3SDFA 1MXZA 2F7BA 3JZJA 1XOCA 4OEUA 1MXUA 3MVYA 4R9GA 4LZ5A 1T0KA 5I56B 3CRBA 1YAEA 2PT1A 1FTMA 4OZ9A 5K2XA 4UA8A 2I3WA 4WEDA 3EN3A 5TP9B 2QS1A 3HV1A 3MP6A 3T66A 1S7YA 3RLFE 4ELRA 2DVZA 4RYAA 1IZ1A 1XVXA 4NMYA 4NF8A 1SQYA 1MDQA 1JVXA 3LR1A 4RA1A 4BLAA 1B1XA 1DTGA 3K6UA 1B5IA 4O3BA 2F5XA 5TPAB 1VFDA 2O7IA 3N5LA 1IXHA 5JEIA 1SD3A 3TZAA 4BDQA 4ELQA 4NTLA 1B2HA 3Q25A 3H6WA 3VVDA 4EQ7A 3OD7A 1US5A 2RCBA 1IXGA 2QS3A 4DXCA 4BDOA 4AB5A 4IO7A 4C1UA 2Y7WA 1MG1A 2Z23A 3O6IA 1A99A 2PVUA 3KBRA 2D5WA 1B1HA 1WODA 3W15C 2I0CA 2QSXA 3QUJA 1URDA 1POY1 1Y1MA 3ILTB 3TQWA 3HHGA 3PMXA 3GZGA 4GIZA 1BP5A 3DM0A 3SEUA 1NMUA 1JQFA 1N3WA 3CFXA 1MY2A 3MP8A 3LSXA 1JEUA 5I2NB 2XXRA 1B7UA 2GRVA 2X7PA 3FXUA 3BFUA 3O2AA 2OZZA 4RPNA 1DSNA 1VFEA 1Y3QA 3IOTA 5DEXA 3M3LA 4BDNA 1MXVA 1VE4A 2F7AA 4F18A 4RK9A 1LB8A 3RPWA 1MXXA 1I6BA 4F2QA 4LONB 3K00A 2DOJA 5AA4B 4JDFA 1NH7A 3S9NC 3FZVA 3TODA 3LUYA 1JETA 1A8EA 4ELOA 1GGGA 2XHDA 3AXFA 3SKPA 1B0HA 1FQAA 1DPEA 4H5FA 2F36A 3QUFA 4X48A 4EQBA 4U2RA 4JWYA 3EQ1A 2Q2AA 3SETA 3N94A 3W9WA 1R9LA 3S9EA 5L9OA 3UORA 2I48A 1PBQA 2ZYMA 3S4UA 1MPBA 4XKQA 5I56A 5CBSA 2I58A 4F29A 1TWYA 1N7WA 1MQIA 1DTZA 3FD3A 3OMBA 4LZ8A 1A40A 4OTEA 1MS7A 5TP9A 3VE1B 4FEBA 2O1MA 1SDXA 2DE4A 5L8DA 2UYFA 2Z8DA 4ZE8A 4ZEIA 1YTVA 4QFLA 3T96B 4KCDA 4KI0E 1B58A 2AL5A 1OLCA 4LATA 2XX7A 4U22A 5ELVA 3H4ZA 4FJPA 1TFDA 4C0RA 3T93B 3VFJA 1SI0A 2F7CA 3JV9A 4P0IA 2I4CA 2I6EA 2UYEA 5TPAA 4Q5TA 3CVGA 4XTCQ 1QJMA 2NUVA 2ALUA 5CBRA 5KDTB 2RC7A 3C34A 1M5FA 3OSRA 1FW0A 3S9LC 3VDFA 1SW2A 3UK4A 3K1NA 5DVFA 4YKIA 1NNTA 2Y7KA 1OQHA 4PP0A 4U4XA 2PMSA 3PPPA 3PD9A 4JXIA 1B5HA 2OBGA 2ZNUA 5HPQA 2DS9A 1UTBB 4I1DA 2NVUB 2V25A 3G3JA 3FUZA 4EDPA 1WVJA 3OO8A 3R26A 5I2NA 5I58B 1LLSA 3PV0E 1GV8A 4GD5A 2REGA 1FQFA 1ZKBA 3K4UA 2R71A 3WAEA 3V89B 4OMBA 2ONSA 1I69A 3H7MA 2CZLA 4JSDA 3IO4A 4X9TA 4DLDA 3OENA 3MVZA 3FATA 4IO4A 3O29A 3LSLA 3C4MA 3FGSA 3G3GA 5AA4A 4R2BA 2THIA 2UVGA 5ICQA 1P1NA 1BIYA 3C36A 5DTBA 3IK6B 3ZS6A 5A5XB 1ANFA 4JBZA 2F6PA 3TTNA 1NNPA 1QUJA 1JW1A 3USDA 4IO3A 4R6KA 1XVYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AE4 A;  2PX1 A;  3N6T A;  2B3F A;  4ZDM A;  4IO5 A;  3G3I A;  4R6H A;  3MW0 A;  5CMC A;  3UP9 A;  2NWJ A;  1GR2 A;  4YKK A;  3C9H A;  1PC3 A;  1R6Z A;  2DXR A;  1JEV A;  1Y20 A;  1HSJ A;  1EU8 A;  3A3C A;  2D21 A;  4E0X A;  1ZBM A;  2DXY A;  4F3B A;  4F3P A;  3RY3 A;  3OO6 A;  3EHT A;  3CG3 A;  2RF1 A;  3C32 A;  3GXA A;  3KGC A;  3A3U A;  1TT1 A;  3TPA A;  1Y3P A;  4M4G A;  2ONK E;  3H6T A;  1OQG A;  3R6U A;  3OO9 A;  1ZMG A;  5TU0 A;  5ITP A;  3KN3 A;  2QJE A;  4KD5 A;  2O1L A;  3IOR A;  4GL0 A;  4Z0I A;  3MUQ A;  3O6G A;  3U93 A;  3FV2 A;  2QPQ A;  2XXI A;  3LSF B;  4R6Y A;  1PBP A;  1IIW A;  3KG2 A;  3TTM A;  3G7W A;  1LAF E;  1BKA A;  1MM7 A;  2AIX A;  3HO7 A;  3T9V A;  5FHO A;  3Q26 A;  4G2Z A;  2OLB A;  3MPL A;  1JNF A;  3V83 A;  2PYY A;  2UXA A;  1N7X A;  5KDT A;  3W9V A;  1KWH A;  1LGB C;  3MP1 A;  3SEW A;  2QMW A;  4HCW A;  3HCQ A;  4G8N A;  1MQH A;  1LAX A;  2XXW A;  2DWI A;  3IOV A;  3DEL B;  1LFG A;  3T22 A;  1L5T A;  1S50 A;  1FQD A;  1CE2 A;  4OFL A;  4DCX A;  3OXN A;  2HFB A;  3Q29 A;  1UTB A;  4IO2 A;  5KCJ B;  4LA9 A;  2DSF A;  3TYH A;  2R9J A;  4H1X A;  1DMB A;  5BUU A;  4YKP A;  4GF8 A;  2YPN A;  2ZYO A;  2FA7 A;  3PUW E;  1NNK A;  5I58 A;  1QUL A;  3TTR A;  1OLA A;  4OQO A;  1LB9 A;  1SBP A;  4LP2 B;  3MVX A;  3QIM A;  4GOT A;  1ZTY A;  3CIJ A;  3PPO A;  3V5A A;  3BBR A;  4EXL A;  3K02 A;  2IEE A;  3PPR A;  3ZKK A;  1B6H A;  4X1B A;  4G68 B;  1MQJ A;  4PFY A;  1B46 A;  1R9Q A;  4O3A A;  5I59 A;  4PFU A;  4YMA A;  3G3F A;  1B3L A;  2H9B A;  4R74 A;  4QHQ A;  3SEX A;  2YLN A;  5CC2 A;  5A5X A;  1MQG A;  4ZZA A;  4EXK A;  3ZKL A;  1XS5 A;  3S2V A;  2XXH A;  2KLF A;  3OO7 A;  3LBS A;  1NNF A;  1QKA A;  1O64 A;  4QSC A;  1VR5 A;  1UQW A;  3M3F A;  3D4G A;  3PPN A;  4KR5 A;  2P2A A;  3F11 A;  2Q2C A;  3IX1 A;  3CFL A;  5ISU A;  3I5O A;  1M5B A;  3FXR A;  3KSX A;  1NFT A;  2B3B A;  1EZO A;  1B3H A;  4OHN A;  3Q28 A;  3E3K A;  3VXB A;  3V8X B;  3H03 A;  1HSE A;  3U1O A;  5EHS A;  2DE3 A;  2HZK A;  3U8Q A;  4FAJ A;  2H5Y A;  5B7D A;  4QRZ A;  4OEN A;  4XIG Q;  4Q0C A;  4G8M A;  2Y7P A;  1MPD A;  4IO6 A;  1Z7N E;  1US4 A;  2FYI A;  2RCA A;  1LCF A;  1ATG A;  3K6W A;  3C33 A;  3MJN A;  1SW5 A;  3H3G A;  4YU0 A;  1P1O A;  4NWD A;  4ELP A;  1B52 A;  3ONM A;  1TXF A;  1IXI A;  2YJP A;  2XXU A;  4FIM A;  4ZED A;  5FTI A;  1M5D A;  4EUO A;  4EF2 A;  1M5E A;  4H5G A;  4G8H A;  1URG A;  1QUI A;  2Y7R A;  5CI5 A;  1P99 A;  1UTH B;  3IR1 A;  2W7Y A;  2QS2 A;  3KEI A;  2Y84 A;  3PMW A;  2HEU A;  2OK2 A;  5CMM A;  1IQ7 A;  3MAM A;  5DVJ A;  1TFA A;  4F1Y A;  1IUD A;  4ND9 A;  4QFK A;  4I62 A;  4BDL A;  2ONR A;  1A8F A;  4HW8 A;  2BJJ X;  4F1V A;  4PQJ A;  3THI A;  1SYI A;  4MF3 A;  1Q35 A;  2O51 A;  1SW1 A;  4OEV A;  4F1U A;  3GBA A;  1QW0 A;  5CRY A;  1LBB A;  4ZE9 A;  5KCJ A;  2H99 A;  2ZMB A;  2A5T A;  1QVS A;  2XXT A;  5L9S A;  4OYV A;  4GLI A;  1MH3 A;  3CSB A;  4YIC A;  3IO6 A;  1Q1K A;  2XD3 A;  4U23 A;  5DYH A;  1Y3N A;  3IOW A;  1IIT A;  3TAJ A;  3A09 A;  1YPN A;  1B40 A;  2X7Q A;  3B6Q A;  1EH3 A;  4H8J A;  2XXP A;  3KFM A;  3TCH A;  1LCT A;  2HXW A;  1QKB A;  4G68 A;  3H6V A;  2F97 A;  4YMB A;  4F3S A;  3K0V A;  4R9F A;  1RYO A;  4U1O A;  5JK4 A;  3K1M A;  1ZLQ A;  4XKP A;  4ESW A;  1P1W A;  3SEY A;  4JWX A;  1H45 A;  4G68 C;  3O6H A;  3OEM A;  1JVY A;  2GH9 A;  3FVO A;  1B4H A;  4OES A;  3ECR A;  1FTO A;  1N04 A;  4TLM B;  2ZNT A;  3DP4 A;  3FJM A;  3OSQ A;  1A55 A;  3FVN A;  4PFT A;  2G93 A;  1B7Z A;  4ECF A;  1D9Y A;  2R6G E;  5IAI A;  3PUY E;  2HZL A;  4FOR A;  3KJ7 A;  4ZS9 A;  1NKX A;  2LAO A;  3HN0 A;  5F7V A;  2V93 A;  4M1V A;  3DLN A;  4F22 A;  1VSO A;  4N13 A;  2H4I A;  3QSL A;  3TTL A;  3VLW A;  1NL5 A;  2O69 A;  4TQU Q;  2VOZ A;  4QFN A;  4GXA A;  4AQ4 A;  3EF7 A;  2DWA A;  2O68 A;  3RTF B;  3HHF A;  3RN8 A;  1SYH A;  1USY E;  2XXY A;  1UTH A;  1PB9 A;  1Y9U A;  1AOV A;  4K3F A;  3TEP A;  4YAH X;  3FXQ A;  3PUV E;  1ZJL A;  4JWO A;  2RC9 A;  4YB6 A;  4NWC A;  5M2V A;  4IGR A;  4XKR A;  3IJO B;  4N07 A;  2DWJ A;  1URS A;  1LFI A;  2X26 A;  3RNN A;  4OFO A;  4GRK A;  5I59 B;  4LZ7 A;  4ZEF A;  3T9H B;  2F6G A;  2QS4 A;  1MY3 A;  4L17 A;  2I3V A;  4OFJ A;  2O6A A;  2V3T A;  3QAX A;  3RTW B;  3U72 A;  4YKJ A;  3IB1 A;  4POX A;  4EQ9 A;  4OVJ A;  5H8Q A;  4JB7 A;  2DE2 A;  1LAH E;  3TCF A;  3EHU A;  2ESN A;  1S9T A;  3T9X B;  3C35 A;  1PDA A;  5J1D A;  3CI8 A;  2I4B A;  1Y4C A;  3SEV A;  4RY1 A;  2VHA A;  3EHS A;  1HSL A;  1USY H;  4RK2 A;  1IEJ A;  4QSE A;  3TQL A;  3FIR A;  5HM4 B;  4ZEB A;  1MY1 A;  1YCJ A;  3IL1 B;  3KSJ A;  3PUX E;  2UVH A;  4DE8 A;  4BDM A;  3SER A;  4KYD A;  1BLF A;  2B65 A;  2M8C A;  4IY6 A;  2HAV A;  1AIV A;  3ZSF A;  3KN8 A;  5K2Y A;  3CG1 A;  2Z22 A;  1I6A A;  3MZB A;  1EZP A;  3I6V A;  5I57 B;  1LFH A;  3IAZ A;  2HCA A;  1B05 A;  2DVC A;  3WAF A;  1MXW A;  5H8H B;  4IY5 A;  4I8C A;  3H6U A;  3K2D A;  2XD2 A;  3K01 A;  3PUZ E;  4WEP A;  1FQE A;  1WDN A;  5IKB A;  1MRP A;  3K6X A;  2NOO A;  2GFE A;  1N76 A;  1POT A;  4GL8 A;  2VD2 A;  3P7I A;  3VVE A;  3TDJ A;  4EF1 A;  1B3F A;  4YZZ A;  2A5T B;  4HCY A;  3MBP A;  1B7H A;  1FTJ A;  3FVG A;  4Q8R A;  1N3X A;  2VP1 A;  4MLQ A;  4FE8 A;  2E1S A;  3G3H A;  2OCU A;  1DPP A;  3I3V A;  5FHM A;  4Z7E A;  3JYR A;  1IXC A;  2P0S A;  2OWS A;  1DOT A;  3G3K A;  3PGF A;  3GLB A;  2ANJ A;  1II5 A;  1LBC A;  3O97 A;  3S9M C;  2XXV A;  4OER A;  3FV1 A;  1O63 A;  3Q27 A;  1MPC A;  5DVI A;  2PBW A;  3GBB A;  1B3G A;  1D9V A;  1MDP 1;  1H76 A;  5I2K B;  1RKM A;  3QXM A;  4I9D A;  4OWD A;  4KFQ A;  2H98 A;  3RUM A;  3HST A;  2Q89 A;  4KHZ E;  3RT8 A;  3PD8 A;  1MY0 A;  3FJ7 A;  4FEC A;  3O28 A;  1O7T A;  5CM6 A;  2Y7I A;  4DCY A;  3PU5 A;  4XKN A;  5AA3 A;  2IA4 A;  4ESX A;  3OOA A;  3MWB A;  4JSO A;  3B7D A;  4F39 A;  4U21 A;  2I0B A;  2Q9T A;  3FAS A;  3RT6 B;  3O66 A;  2H25 A;  2DWH A;  2V3Q A;  3QYT A;  3ODB A;  2RC8 A;  2DQV A;  2GHA A;  3QK6 A;  1XT8 A;  4H65 A;  4QFO A;  3TMG A;  5CMB A;  2O7U A;  3B6T A;  4RNS A;  4ONY A;  1FTL A;  3L6G A;  4NF6 B;  1B51 A;  1N84 A;  4ISU A;  3U94 A;  1ELJ A;  2FNC A;  3IJX B;  3B6W A;  4G4P A;  4OXV A;  2ZNS A;  3MZ1 A;  4R2F A;  4WXJ A;  2ZYK A;  5KZT A;  5ITO A;  2D3I A;  3UIF A;  5I57 A;  2O84 X;  2V3U A;  4THI A;  1FTK A;  4E0W A;  2CMO A;  5JTY A;  1B5J A;  2QL3 A;  4P11 A;  3VVF A;  5H8H A;  4PET A;  4KYE A;  3N26 A;  1NH8 A;  2AYS A;  4ZEC A;  1B9J A;  4DXB A;  5AA2 B;  2QRY A;  2DYX A;  1MQD A;  3T9U A;  2F78 A;  2REJ A;  4GWO A;  4F2O A;  4LUB A;  4MBP A;  1UIV A;  4LVQ A;  1B0L A;  4H0W A;  4IGT A;  2UVI A;  2VGQ A;  3L6H A;  3KOS A;  1F9B A;  3UN6 A;  1FCK A;  5LOM A;  3SES A;  5HBC A;  5H8Q B;  2RKM A;  5EYF A;  3E9X A;  3VLU A;  4LQ5 A;  2E0S A;  2XX9 A;  1B32 A;  2Q88 A;  3N6U A;  1FQC A;  4P0G A;  5FTH A;  1A54 A;  1RYX A;  1H3D A;  2I49 A;  3MQ9 A;  1OIB A;  5AA1 A;  4H67 A;  3H06 B;  3VV5 A;  4UAC A;  3MC2 A;  2P1S A;  3BKI B;  4NE4 A;  3PPQ A;  4AB6 A;  4FED A;  3UGW A;  1XHY A;  3HPI A;  3VLV A;  2F35 A;  3O9P A;  5I2K A;  4QF9 A;  2WKY A;  5F1Q A;  1J1N A;  1P1Q A;  2ZYN A;  4DXU A;  3OEK A;  5ICT A;  4NF4 B;  2UVJ A;  3R7X A;  4POW A;  2Z8E A;  3RGY A;  1OVB A;  3CR9 A;  3TTK A;  2HAU A;  3MVW A;  3MPK A;  3ILU B;  5AA2 D;  2XXX A;  3FJG A;  5H8S A;  1SW4 A;  3UA8 A;  1MXY A;  1BTJ A;  3K6V A;  4R72 A;  1Z7M E;  4NF5 B;  4NED A;  1B3E A;  4U4S A;  5EHM A;  4TOZ A;  4C1T A;  3TEL A;  3TKD A;  4WKM A;  2PT2 A;  3KOT A;  1UIU A;  5H8N B;  2GHB A;  2V84 A;  3EPE A;  1JW4 A;  1SI1 A;  4H6D A;  3D4C A;  1PB7 A;  4Q30 B;  3K1P A;  4H8I A;  4N6P A;  4NF6 A;  4O3C A;  4KQP A;  2RIN A;  2F34 A;  4KCC A;  5H8F B;  4OET A;  4PFW A;  2G29 A;  1OVT A;  1LAG E;  1N0T A;  2XXQ A;  2ABH A;  2OWT A;  4QFP A;  4LQ2 A;  1MM6 A;  5L9M A;  1D4N A;  4YB7 A;  3PMV A;  1MH4 A;  1AMF A;  4QSD A;  1FQB A;  4XXU A;  5AA2 A;  4U1Z A;  1Y1Z A;  1OMP A;  5BWJ A;  4R75 A;  4NF8 B;  4HS7 A;  1A7L A;  2Q8J A;  2VD3 A;  5I84 A;  3BFT A;  2QMX A;  1AL3 A;  1PB8 A;  3MZ9 A;  4GVO A;  3C31 A;  1XC1 A;  4GQO A;  1H44 A;  1SVX B;  4GXS B;  4RXL A;  3VXC A;  4HTG A;  2DP8 A;  3RQT A;  3TCG A;  4X1D A;  1Y4T A;  3LC8 A;  1ZU0 A;  4R73 A;  2F8D A;  2AL4 A;  4MH5 A;  3IB0 A;  3KJT A;  3KN7 A;  1PEB A;  4BDR A;  3IOU A;  3DP8 A;  4FAT A;  2A5S A;  3TUS A;  4PE5 B;  1MY4 A;  3IB2 A;  3CFZ A;  1AH5 A;  3OEL A;  4NF4 A;  4IB2 A;  3M8U A;  5FHN A;  3CSG A;  1GTK A;  4MFI A;  5DT6 A;  4MLV A;  2HQ0 A;  4DZ1 A;  1D3K A;  5JTY B;  4G77 A;  3TFL A;  3E4R A;  4F31 B;  2XX8 A;  5DEX B;  1LST A;  2ZXT A;  1CB6 A;  4ZZE A;  3E13 X;  5CMK A;  4NF5 A;  4KPT A;  4DDD A;  1R1N A;  1ZIU A;  4F19 A;  1I6Q A;  4GFR A;  1H43 A;  1B4Z A;  1P1U A;  1GVC A;  3M3K A;  3U92 A;  4RJZ A;  5H8N A;  2Z8F A;  4YB5 A;  4TLL B;  4DIG A;  1JW5 A;  4ZEK A;  2OJT A;  4F3G A;  2NXO A;  1QUK A;  3LSW A;  3DP6 A;  3KZG A;  4KYS A;  4RPO A;  1M5C A;  5B70 A;  1EZ9 A;  3FVK A;  5H8F A;  3SDF A;  1MXZ A;  2F7B A;  3JZJ A;  1XOC A;  4OEU A;  1MXU A;  3MVY A;  4R9G A;  4LZ5 A;  1T0K A;  5I56 B;  3CRB A;  1YAE A;  2PT1 A;  1FTM A;  4OZ9 A;  5K2X A;  4UA8 A;  2I3W A;  4WED A;  3EN3 A;  5TP9 B;  2QS1 A;  3HV1 A;  3MP6 A;  3T66 A;  1S7Y A;  3RLF E;  4ELR A;  2DVZ A;  4RYA A;  1IZ1 A;  1XVX A;  4NMY A;  4NF8 A;  1SQY A;  1MDQ A;  1JVX A;  3LR1 A;  4RA1 A;  4BLA A;  1B1X A;  1DTG A;  3K6U A;  1B5I A;  4O3B A;  2F5X A;  5TPA B;  1VFD A;  2O7I A;  3N5L A;  1IXH A;  5JEI A;  1SD3 A;  3TZA A;  4BDQ A;  4ELQ A;  4NTL A;  1B2H A;  3Q25 A;  3H6W A;  3VVD A;  4EQ7 A;  3OD7 A;  1US5 A;  2RCB A;  1IXG A;  2QS3 A;  4DXC A;  4BDO A;  4AB5 A;  4IO7 A;  4C1U A;  2Y7W A;  1MG1 A;  2Z23 A;  3O6I A;  1A99 A;  2PVU A;  3KBR A;  2D5W A;  1B1H A;  1WOD A;  3W15 C;  2I0C A;  2QSX A;  3QUJ A;  1URD A;  1POY 1;  1Y1M A;  3ILT B;  3TQW A;  3HHG A;  3PMX A;  3GZG A;  4GIZ A;  1BP5 A;  3DM0 A;  3SEU A;  1NMU A;  1JQF A;  1N3W A;  3CFX A;  1MY2 A;  3MP8 A;  3LSX A;  1JEU A;  5I2N B;  2XXR A;  1B7U A;  2GRV A;  2X7P A;  3FXU A;  3BFU A;  3O2A A;  2OZZ A;  4RPN A;  1DSN A;  1VFE A;  1Y3Q A;  3IOT A;  5DEX A;  3M3L A;  4BDN A;  1MXV A;  1VE4 A;  2F7A A;  4F18 A;  4RK9 A;  1LB8 A;  3RPW A;  1MXX A;  1I6B A;  4F2Q A;  4LON B;  3K00 A;  2DOJ A;  5AA4 B;  4JDF A;  1NH7 A;  3S9N C;  3FZV A;  3TOD A;  3LUY A;  1JET A;  1A8E A;  4ELO A;  1GGG A;  2XHD A;  3AXF A;  3SKP A;  1B0H A;  1FQA A;  1DPE A;  4H5F A;  2F36 A;  3QUF A;  4X48 A;  4EQB A;  4U2R A;  4JWY A;  3EQ1 A;  2Q2A A;  3SET A;  3N94 A;  3W9W A;  1R9L A;  3S9E A;  5L9O A;  3UOR A;  2I48 A;  1PBQ A;  2ZYM A;  3S4U A;  1MPB A;  4XKQ A;  5I56 A;  5CBS A;  2I58 A;  4F29 A;  1TWY A;  1N7W A;  1MQI A;  1DTZ A;  3FD3 A;  3OMB A;  4LZ8 A;  1A40 A;  4OTE A;  1MS7 A;  5TP9 A;  3VE1 B;  4FEB A;  2O1M A;  1SDX A;  2DE4 A;  5L8D A;  2UYF A;  2Z8D A;  4ZE8 A;  4ZEI A;  1YTV A;  4QFL A;  3T96 B;  4KCD A;  4KI0 E;  1B58 A;  2AL5 A;  1OLC A;  4LAT A;  2XX7 A;  4U22 A;  5ELV A;  3H4Z A;  4FJP A;  1TFD A;  4C0R A;  3T93 B;  3VFJ A;  1SI0 A;  2F7C A;  3JV9 A;  4P0I A;  2I4C A;  2I6E A;  2UYE A;  5TPA A;  4Q5T A;  3CVG A;  4XTC Q;  1QJM A;  2NUV A;  2ALU A;  5CBR A;  5KDT B;  2RC7 A;  3C34 A;  1M5F A;  3OSR A;  1FW0 A;  3S9L C;  3VDF A;  1SW2 A;  3UK4 A;  3K1N A;  5DVF A;  4YKI A;  1NNT A;  2Y7K A;  1OQH A;  4PP0 A;  4U4X A;  2PMS A;  3PPP A;  3PD9 A;  4JXI A;  1B5H A;  2OBG A;  2ZNU A;  5HPQ A;  2DS9 A;  1UTB B;  4I1D A;  2NVU B;  2V25 A;  3G3J A;  3FUZ A;  4EDP A;  1WVJ A;  3OO8 A;  3R26 A;  5I2N A;  5I58 B;  1LLS A;  3PV0 E;  1GV8 A;  4GD5 A;  2REG A;  1FQF A;  1ZKB A;  3K4U A;  2R71 A;  3WAE A;  3V89 B;  4OMB A;  2ONS A;  1I69 A;  3H7M A;  2CZL A;  4JSD A;  3IO4 A;  4X9T A;  4DLD A;  3OEN A;  3MVZ A;  3FAT A;  4IO4 A;  3O29 A;  3LSL A;  3C4M A;  3FGS A;  3G3G A;  5AA4 A;  4R2B A;  2THI A;  2UVG A;  5ICQ A;  1P1N A;  1BIY A;  3C36 A;  5DTB A;  3IK6 B;  3ZS6 A;  5A5X B;  1ANF A;  4JBZ A;  2F6P A;  3TTN A;  1NNP A;  1QUJ A;  1JW1 A;  3USD A;  4IO3 A;  4R6K A;  1XVY A; 
#chains in the Genus database with same CATH topology
 5AE4 A;  2PX1 A;  3N6T A;  2B3F A;  4ZDM A;  4IO5 A;  3G3I A;  4R6H A;  3MW0 A;  5CMC A;  3UP9 A;  2NWJ A;  1GR2 A;  2KR0 A;  1IMB A;  4YKK A;  4QBA A;  3C9H A;  1PC3 A;  1R6Z A;  2DXR A;  1JEV A;  1FBP A;  1Y20 A;  1HSJ A;  4N6D A;  1EU8 A;  3A3C A;  2D21 A;  4E0X A;  1ZBM A;  5FBP A;  3PTY A;  2DXY A;  4F3B A;  4I3Y A;  4F3P A;  2Y5L A;  3RY3 A;  3GYY A;  3OO6 A;  3EHT A;  2B4L A;  3CG3 A;  2RF1 A;  3C32 A;  3GXA A;  2XXK A;  3A3U A;  3KGC A;  1TT1 A;  3TPA A;  3NOH A;  1Y3P A;  4M4G A;  4PFI A;  2ONK E;  4OVP A;  5IGA A;  3H6T A;  4PFB A;  1OQG A;  3R6U A;  3OO9 A;  1ZMG A;  3QMF A;  5TU0 A;  5ITP A;  3KN3 A;  2QJE A;  4KD5 A;  2O1L A;  3IOR A;  4GL0 A;  4Z0I A;  3MUQ A;  3O6G A;  4OAN A;  3U93 A;  3KBZ A;  3FV2 A;  2QPQ A;  2XXI A;  3LSF B;  4R6Y A;  1PBP A;  1IIW A;  3KG2 A;  5EQA A;  3TTM A;  2HHM A;  3G7W A;  1LAF E;  1SPI A;  1BKA A;  1MM7 A;  2AIX A;  3HO7 A;  2Y5K A;  3T9V A;  5FHO A;  3Q26 A;  4G2Z A;  2OLB A;  3MPL A;  1JNF A;  3V83 A;  2PYY A;  2UXA A;  1FTA A;  1N7X A;  5KDT A;  3W9V A;  1K9Z A;  4JVD A;  1KWH A;  3IFC A;  1LGB C;  1FPJ A;  3MP1 A;  3SEW A;  2QMW A;  4HCW A;  2ZZX A;  3HCQ A;  4G8N A;  1MQH A;  1LAX A;  2XXW A;  2DWI A;  3IOV A;  3DEL B;  1LFG A;  2BJI A;  3T22 A;  1L5T A;  1S50 A;  1FQD A;  1CE2 A;  4OFL A;  2F3D A;  4DCX A;  3OXN A;  2HFB A;  3Q29 A;  1UTB A;  4IO2 A;  5KCJ B;  2VPN A;  4LA9 A;  2XWV A;  2DSF A;  4O94 A;  3TYH A;  2R9J A;  4H1X A;  1DMB A;  1DBZ A;  5BUU A;  4YKP A;  4GF8 A;  2YPN A;  2ZYO A;  5EQ7 A;  2FA7 A;  3PUW E;  1NNK A;  5I58 A;  2QVR A;  1QUL A;  3TTR A;  1RDX A;  1OLA A;  4OQO A;  1LB9 A;  1SBP A;  4LP2 B;  3MVX A;  3QIM A;  2FBP A;  4GOT A;  1ZTY A;  3CIJ A;  3PPO A;  4NHB A;  3V5A A;  3BBR A;  4EXL A;  3K02 A;  2IEE A;  3PPR A;  3ZKK A;  2VT5 A;  5J16 A;  1B6H A;  4X1B A;  4G68 B;  1MQJ A;  4PFY A;  1B46 A;  1R9Q A;  4O3A A;  5I59 A;  4PFU A;  4YMA A;  3G3F A;  1B3L A;  2H9B A;  4R74 A;  3FBP A;  4QHQ A;  3SEX A;  2YLN A;  3CHG A;  3RPL B;  5CC2 A;  5A5X A;  4H46 A;  1MQG A;  4ZZA A;  4EXK A;  3ZKL A;  1XS5 A;  3S2V A;  2XXH A;  2CEX A;  2KLF A;  3OO7 A;  3LBS A;  1NNF A;  1QKA A;  1O64 A;  4QSC A;  1VR5 A;  1NI9 A;  1UQW A;  3M3F A;  3D4G A;  1FRP A;  3PPN A;  4KR5 A;  2P2A A;  3F11 A;  5ESY A;  4P3L A;  2Q2C A;  3IX1 A;  3CFL A;  5ISU A;  3I5O A;  5IM2 A;  1M5B A;  3FXR A;  3KSX A;  1NFT A;  2B3B A;  1EZO A;  1B3H A;  1INP A;  4OHN A;  3Q28 A;  3E3K A;  4PAI A;  3VXB A;  3V8X B;  3H03 A;  1HSE A;  3U1O A;  5EHS A;  2DE3 A;  2HZK A;  3U8Q A;  4FAJ A;  2H5Y A;  5B7D A;  4QRZ A;  4OEN A;  4XIG Q;  4Q0C A;  4PCD A;  1FPD A;  4G8M A;  2Y7P A;  1MPD A;  4IO6 A;  1Z7N E;  1RDZ A;  1US4 A;  2FYI A;  2RCA A;  1LCF A;  1ATG A;  3K6W A;  3C33 A;  3MJN A;  1SW5 A;  2WEF A;  3H3G A;  4YU0 A;  1P1O A;  4NWD A;  4MCO A;  4ELP A;  1B52 A;  3ONM A;  1TXF A;  1IXI A;  2YJP A;  1LBW A;  2XXU A;  4FIM A;  4ZED A;  5FTI A;  1M5D A;  4EUO A;  4EF2 A;  1M5E A;  1NV4 A;  4H5G A;  4G8H A;  1URG A;  1QUI A;  2Y7R A;  5CI5 A;  1P99 A;  4MMP A;  1UTH B;  1DCU A;  3IR1 A;  2W7Y A;  4NQ8 A;  2QS2 A;  3KEI A;  3ROJ A;  2Y84 A;  3PMW A;  2HEU A;  2OK2 A;  5CMM A;  1IQ7 A;  2XA5 A;  3MAM A;  5DVJ A;  1TFA A;  4GX4 A;  4F1Y A;  1IUD A;  4ND9 A;  4QFK A;  4I62 A;  4BDL A;  2ONR A;  1A8F A;  4HW8 A;  2BJJ X;  4F1V A;  4PQJ A;  3THI A;  1SYI A;  4MF3 A;  1Q35 A;  2O51 A;  1SW1 A;  4OEV A;  4F1U A;  3GBA A;  1QW0 A;  5CRY A;  1LBB A;  4ZE9 A;  5KCJ A;  2H99 A;  2ZMB A;  2A5T A;  1QVS A;  2XXT A;  5I5P A;  5L9S A;  4OYV A;  1NUX A;  4GLI A;  3KC1 A;  1MH3 A;  3CSB A;  4YIC A;  3IO6 A;  1Q1K A;  2ZZV A;  2XD3 A;  1KA1 A;  4U23 A;  5DYH A;  1Y3N A;  2OX3 A;  3IOW A;  1NV3 A;  1IIT A;  4QXD A;  5A5L A;  4PAK A;  3TAJ A;  3A09 A;  1YPN A;  1B40 A;  4LN5 A;  3LUZ A;  2X7Q A;  3B6Q A;  1EH3 A;  4H8J A;  4HXV A;  2XXP A;  3KFM A;  3TCH A;  1LCT A;  2HXW A;  1QKB A;  4G68 A;  3H6V A;  2F97 A;  4PF8 A;  5F24 A;  4YMB A;  2WBD A;  4F3S A;  1BK4 A;  3K0V A;  4R9F A;  2ZZW A;  1RYO A;  3RPL A;  4U1O A;  5JK4 A;  3K1M A;  1ZLQ A;  4XKP A;  4ESW A;  1P1W A;  3SEY A;  4JWX A;  1H45 A;  4G68 C;  3O6H A;  3OEM A;  2GQ1 A;  1JVY A;  2GH9 A;  3FVO A;  1B4H A;  4OES A;  3ECR A;  5ET5 A;  1FTO A;  1N04 A;  1IMA A;  4TLM B;  2ZNT A;  2QVU A;  3DP4 A;  3FJM A;  3OSQ A;  1A55 A;  3FVN A;  4PFT A;  2G93 A;  1B7Z A;  4ECF A;  1D9Y A;  2R6G E;  5IAI A;  1FBH A;  4O8M A;  3PUY E;  2HZL A;  4FOR A;  3KJ7 A;  4ZS9 A;  1NKX A;  2LAO A;  1NV2 A;  3HN0 A;  5F7V A;  4XF5 A;  4M1V A;  2V93 A;  3DLN A;  4F22 A;  1VSO A;  4N13 A;  2H4I A;  3QSL A;  3TTL A;  3VLW A;  1NL5 A;  2O69 A;  4TQU Q;  2VOZ A;  4QFN A;  4GXA A;  4AQ4 A;  2QFL A;  3EF7 A;  4PGP A;  2DWA A;  2O68 A;  3RTF B;  3HHF A;  3RN8 A;  1SYH A;  1USY E;  2XXY A;  2HXR A;  1UTH A;  1PB9 A;  1Y9U A;  1AOV A;  4K3F A;  3TEP A;  4YAH X;  3FXQ A;  3PUV E;  4NX1 A;  1Q9D A;  1ZJL A;  4JWO A;  2RC9 A;  4YB6 A;  4NWC A;  5M2V A;  4IGR A;  4XKR A;  3IJO B;  4N07 A;  2DWJ A;  1URS A;  4FBP A;  1LFI A;  2X26 A;  3RNN A;  4OFO A;  4GRK A;  5I59 B;  4LZ7 A;  4ZEF A;  3T9H B;  2F6G A;  2QS4 A;  4JVC A;  1MY3 A;  4L17 A;  2I3V A;  4OFJ A;  2O6A A;  2V3T A;  3QAX A;  3RTW B;  1NV6 A;  2CZI A;  3U72 A;  4YKJ A;  3IB1 A;  4POX A;  4EQ9 A;  4OVJ A;  5H8Q A;  4JB7 A;  2DE2 A;  1LAH E;  3TCF A;  3EHU A;  2ESN A;  1S9T A;  4UAB A;  3T9X B;  1FJ9 A;  3C35 A;  1PDA A;  5J1D A;  3CI8 A;  2I4B A;  1Y4C A;  3SEV A;  4GWY A;  4RY1 A;  2VHA A;  3EHS A;  1HSL A;  2PCR A;  1FBC A;  1USY H;  4RK2 A;  1IEJ A;  4QSE A;  3TQL A;  3FIR A;  5HM4 B;  4ZEB A;  1MY1 A;  1YCJ A;  4O7M A;  3IL1 B;  3KSJ A;  3PUX E;  2UVH A;  4DE8 A;  4BDM A;  3SER A;  1RDY A;  4KYD A;  1BLF A;  2B65 A;  2M8C A;  4IY6 A;  2HAV A;  5EQ9 A;  5I3S A;  1AIV A;  3ZSF A;  4N15 A;  3KN8 A;  5K2Y A;  3CG1 A;  1IMF A;  4MNC A;  2Z22 A;  1I6A A;  3MZB A;  1EZP A;  1JP4 A;  3I6V A;  5I57 B;  1LFH A;  3IAZ A;  2HCA A;  1B05 A;  2DVC A;  3WAF A;  1MXW A;  5H8H B;  4IY5 A;  4I8C A;  3H6U A;  3K2D A;  2XD2 A;  3K01 A;  3PUZ E;  4WEP A;  1FQE A;  1WDN A;  4NN3 A;  5IKB A;  1EYI A;  1MRP A;  3K6X A;  2NOO A;  2GFE A;  1N76 A;  1POT A;  4GL8 A;  2VD2 A;  3P7I A;  3VVE A;  3TDJ A;  4EF1 A;  2PFZ A;  1B3F A;  4YZZ A;  2MKZ A;  2A5T B;  3E79 A;  4HCY A;  3MBP A;  1B7H A;  1FTJ A;  3FVG A;  4Q8R A;  1N3X A;  4P9K A;  2VP1 A;  4MLQ A;  4FE8 A;  2E1S A;  3G3H A;  2OCU A;  1DPP A;  3I3V A;  4N17 A;  5FHM A;  4Z7E A;  3JYR A;  1IXC A;  2P0S A;  2OWS A;  1DOT A;  3G3K A;  5EQ8 A;  3PGF A;  3GLB A;  2ANJ A;  1II5 A;  1LBC A;  3O97 A;  3S9M C;  2P3N A;  2XXV A;  4OER A;  1NV1 A;  1O63 A;  3FV1 A;  1FPE A;  3Q27 A;  2WYK A;  3LV0 A;  1MPC A;  5DVI A;  4JVI A;  2PBW A;  3GBB A;  1B3G A;  1D9V A;  1CNQ A;  1MDP 1;  1H76 A;  5I2K B;  1RKM A;  3QXM A;  4I9D A;  3HFU A;  4OWD A;  4KFQ A;  2H98 A;  3IFA A;  3RUM A;  3HST A;  2Q89 A;  4KHZ E;  1FPF A;  4GWW A;  2QVV A;  1FPK A;  3RT8 A;  3PD8 A;  1MY0 A;  3FJ7 A;  4FEC A;  3O28 A;  1O7T A;  5CM6 A;  2Y7I A;  4DCY A;  3PU5 A;  4XKN A;  2F3B A;  5AA3 A;  2IA4 A;  4ESX A;  3OOA A;  3MWB A;  4JSO A;  3B7D A;  4F39 A;  3BIG A;  4U21 A;  2I0B A;  2Q9T A;  3FAS A;  3RT6 B;  3O66 A;  1LBZ A;  2H25 A;  2DWH A;  2V3Q A;  3QYT A;  5ET7 A;  4X04 A;  3ODB A;  2RC8 A;  2DQV A;  2GHA A;  3QK6 A;  4PGN A;  1XT8 A;  4H65 A;  4QFO A;  3TMG A;  5CMB A;  2O7U A;  3B6T A;  4RNS A;  4ONY A;  1FTL A;  3L6G A;  4NF6 B;  1B51 A;  5IZ3 B;  1N84 A;  4ISU A;  3U94 A;  1ELJ A;  2FNC A;  3IJX B;  3B6W A;  4G4P A;  4OXV A;  2ZNS A;  3MZ1 A;  4R2F A;  4WXJ A;  2ZYK A;  5KZT A;  5ITO A;  2D3I A;  3UIF A;  5I57 A;  2O84 X;  2V3U A;  4THI A;  1FTK A;  4E0W A;  2CMO A;  1AWB A;  5JTY A;  1B5J A;  2QL3 A;  3A29 A;  2HPG A;  4P11 A;  3VVF A;  5H8H A;  4PET A;  4HE0 A;  4KYE A;  3N26 A;  1NH8 A;  2AYS A;  1FBG A;  4ZEC A;  1B9J A;  4DXB A;  5AA2 B;  2QRY A;  2DYX A;  1MQD A;  1IMC A;  3T9U A;  2F78 A;  2REJ A;  4GWO A;  4F2O A;  4LUB A;  4MBP A;  1UIV A;  4LVQ A;  4NG7 A;  1B0L A;  4H0W A;  4IGT A;  2UVI A;  2VGQ A;  3L6H A;  4P47 A;  3KOS A;  4XFE A;  1F9B A;  3UN6 A;  1FCK A;  4AS4 A;  1FBD A;  3SES A;  5LOM A;  5HBC A;  5H8Q B;  2RKM A;  5EYF A;  3E9X A;  3VLU A;  4LQ5 A;  2E0S A;  2XX9 A;  4P8B A;  1B32 A;  2Q88 A;  3N6U A;  1FQC A;  4P0G A;  2V4C A;  5FTH A;  4MEV A;  4N4U A;  1A54 A;  1RYX A;  1H3D A;  1FPL A;  2I49 A;  3MQ9 A;  1OIB A;  5AA1 A;  4H67 A;  3H06 B;  3VV5 A;  4UAC A;  3MC2 A;  2P1S A;  3BKI B;  4NE4 A;  4DI3 D;  3PPQ A;  4AB6 A;  1G0H A;  4FED A;  3UGW A;  1XHY A;  3HPI A;  3VLV A;  2F35 A;  3O9P A;  2PFY A;  5I2K A;  4QF9 A;  1FPB A;  2WKY A;  5F1Q A;  1J1N A;  1P1Q A;  2ZYN A;  4DXU A;  2XWK A;  3OEK A;  5ICT A;  4NF4 B;  2UVJ A;  1DK4 A;  3R7X A;  4POW A;  2Z8E A;  3RGY A;  1OVB A;  3CR9 A;  3TTK A;  2HAU A;  3MVW A;  3MPK A;  3ILU B;  5AA2 D;  2XXX A;  3FJG A;  5H8S A;  1SW4 A;  3UA8 A;  1MXY A;  2WX9 A;  1BTJ A;  3K6V A;  3T0J A;  5I7I A;  4R72 A;  1Z7M E;  4NF5 B;  4NED A;  1B3E A;  4U4S A;  5EHM A;  4TOZ A;  2CZK A;  4C1T A;  4G61 A;  3TEL A;  3TKD A;  4WKM A;  2PT2 A;  3KOT A;  1UIU A;  5H8N B;  2GHB A;  2V84 A;  3EPE A;  1JW4 A;  1SI1 A;  4H6D A;  3D4C A;  1PB7 A;  4Q30 B;  3K1P A;  4H8I A;  1FPI A;  4N6P A;  4NF6 A;  5T3J A;  5IZ3 A;  1G0I A;  4O3C A;  4KQP A;  2RIN A;  4N91 A;  2F34 A;  4KCC A;  4NF0 A;  3D1R A;  4OVS A;  5H8F B;  4OET A;  4PFW A;  2L5V A;  2XWO A;  3MST A;  2G29 A;  4GWU A;  1NV0 A;  1OVT A;  4GX6 A;  1LAG E;  4H45 A;  1N0T A;  4O7I A;  2XXQ A;  2ABH A;  2OWT A;  4QFP A;  4LQ2 A;  1MM6 A;  5IZ1 A;  1D4N A;  4YB7 A;  5L9M A;  3PMV A;  1MH4 A;  1AMF A;  4QSD A;  1FQB A;  4XXU A;  3SZP A;  5AA2 A;  4U1Z A;  1Y1Z A;  1OMP A;  5BWJ A;  4R75 A;  4NF8 B;  3B50 A;  4HS7 A;  1A7L A;  2Q8J A;  2VD3 A;  4MAG A;  5I84 A;  1K9Y A;  3BFT A;  5LTC A;  2QMX A;  1AL3 A;  1PB8 A;  3MZ9 A;  4GVO A;  3C31 A;  1XC1 A;  4GQO A;  1H44 A;  1SVX B;  4GXS B;  4RXL A;  4MHF A;  4N6K A;  3VXC A;  4HTG A;  5EYH A;  2DP8 A;  2VPO A;  3RQT A;  3TCG A;  4PDD A;  4N8Y A;  4X1D A;  4OVQ A;  1Y4T A;  3LC8 A;  1ZU0 A;  4R73 A;  2F8D A;  2AL4 A;  5ET6 A;  4N81 A;  4MH5 A;  3IB0 A;  3KJT A;  3KN7 A;  5EYG A;  1PEB A;  4BDR A;  3IOU A;  2FIX A;  3DP8 A;  4FAT A;  2A5S A;  3TUS A;  4GWS A;  4PE5 B;  1MY4 A;  3IB2 A;  3CFZ A;  1AH5 A;  3OEL A;  4NF4 A;  4IB2 A;  3M8U A;  5FHN A;  4XEQ A;  2KQZ A;  3CSG A;  1GTK A;  4MFI A;  5DT6 A;  4MLV A;  2HQ0 A;  4DZ1 A;  1D3K A;  4P56 A;  5JTY B;  4G77 A;  3TFL A;  3E4R A;  2R8T A;  4F31 B;  2XX8 A;  5DEX B;  1LST A;  2ZXT A;  1CB6 A;  4ZZE A;  1LEV A;  3E13 X;  5CMK A;  4NF5 A;  4KPT A;  3E78 A;  4DDD A;  1R1N A;  1ZIU A;  4F19 A;  1I6Q A;  4GFR A;  1H43 A;  1B4Z A;  1P1U A;  2CZH A;  1EYK A;  1GVC A;  3M3K A;  3U92 A;  4RJZ A;  5ET8 A;  1FBF A;  5H8N A;  2Z8F A;  4YB5 A;  4KXP A;  4TLL B;  4DIG A;  1JW5 A;  2XWI A;  4ZEK A;  1LBX A;  2OJT A;  4F3G A;  2NXO A;  1QUK A;  3LSW A;  4PF6 A;  3DP6 A;  3KZG A;  4KYS A;  4RPO A;  1M5C A;  5B70 A;  1EZ9 A;  3FVK A;  5H8F A;  3SDF A;  1MXZ A;  2F7B A;  3JZJ A;  1NUW A;  1XOC A;  2CEY A;  4OEU A;  1MXU A;  4PTK A;  3MVY A;  4R9G A;  4LZ5 A;  1T0K A;  5I56 B;  3CRB A;  1YAE A;  2PT1 A;  1FTM A;  4PFR A;  3RYD A;  4OZ9 A;  5K2X A;  4UA8 A;  2I3W A;  4WED A;  3EN3 A;  5TP9 B;  2QS1 A;  4X8R A;  3HV1 A;  3MP6 A;  4IR8 A;  1YYZ A;  2Q74 A;  3T66 A;  1S7Y A;  3RLF E;  4GWZ A;  4ELR A;  2DVZ A;  4RYA A;  1IZ1 A;  1XVX A;  4PAF A;  4NMY A;  4NF8 A;  4AS5 A;  1SQY A;  3ISP A;  1MDQ A;  1JVX A;  3LR1 A;  1FBE A;  4PE3 A;  3FXB A;  4RA1 A;  4BLA A;  1B1X A;  1DTG A;  1VDW A;  3K6U A;  1B5I A;  4O3B A;  2F5X A;  5TPA B;  1FPG A;  1VFD A;  4MNP A;  2O7I A;  2FVZ A;  4DI4 B;  3N5L A;  1IXH A;  5JEI A;  1SD3 A;  4GX3 A;  3TZA A;  4BDQ A;  4ELQ A;  4NTL A;  1B2H A;  3B8B A;  3Q25 A;  3H6W A;  3VVD A;  4EQ7 A;  3OD7 A;  1US5 A;  2RCB A;  1IXG A;  2QS3 A;  4DXC A;  4I3E A;  4BDO A;  4AB5 A;  4IO7 A;  4C1U A;  2Y7W A;  1MG1 A;  2Z23 A;  3O6I A;  1A99 A;  2PVU A;  3KBR A;  3T1B A;  2D5W A;  1YZ0 A;  4HE2 A;  1NV5 A;  1B1H A;  1WOD A;  3W15 C;  2I0C A;  2QSX A;  3QUJ A;  1URD A;  1POY 1;  1Y1M A;  3ILT B;  3TQW A;  3HHG A;  3PMX A;  3GZG A;  4GIZ A;  1BP5 A;  3DM0 A;  3SEU A;  1IMD A;  1NMU A;  1EYJ A;  1JQF A;  1N3W A;  3CFX A;  1MY2 A;  3MP8 A;  3LSX A;  1JEU A;  5I2N B;  2XXR A;  1B7U A;  2GRV A;  2X7P A;  3FXU A;  3BFU A;  3BIH A;  3O2A A;  4OVR A;  2OZZ A;  4RPN A;  1DSN A;  4PBH A;  1VFE A;  1Y3Q A;  3IOT A;  5DEX A;  3M3L A;  4BDN A;  1MXV A;  1VE4 A;  2F7A A;  4F18 A;  4RK9 A;  1LB8 A;  4HE1 A;  3RPW A;  1MXX A;  1I6B A;  2Q8M A;  4MNI A;  4F2Q A;  4LON B;  3K00 A;  2DOJ A;  5AA4 B;  4JDF A;  1NH7 A;  3S9N C;  2WYP A;  3KC0 A;  3FZV A;  3TOD A;  3LUY A;  1JET A;  1A8E A;  4ELO A;  1NUY A;  1GGG A;  2XHD A;  3AXF A;  3SKP A;  1B0H A;  1FQA A;  1DPE A;  4H5F A;  2F36 A;  3QUF A;  4N8G A;  4X48 A;  4EQB A;  4U2R A;  4JWY A;  2JJK A;  3EQ1 A;  1FJ6 A;  2Q2A A;  4PDH A;  1NUZ A;  3SET A;  3N94 A;  4MIJ A;  3W9W A;  1R9L A;  3S9E A;  5L9O A;  4I40 A;  3UOR A;  2I48 A;  1PBQ A;  2ZYM A;  4MJO A;  3S4U A;  1MPB A;  4XKQ A;  5I56 A;  5CBS A;  2I58 A;  4F29 A;  1TWY A;  1N7W A;  2P3V A;  1KA0 A;  1MQI A;  1DTZ A;  3FD3 A;  3OMB A;  4LZ8 A;  1A40 A;  4OTE A;  1MS7 A;  3EKI A;  1XI6 A;  5TP9 A;  3VE1 B;  4FEB A;  2O1M A;  1SDX A;  2DE4 A;  5L8D A;  4P1L A;  2UYF A;  2Z8D A;  4ZE8 A;  4ZEI A;  1YTV A;  4QFL A;  3T96 B;  4GWX A;  4KCD A;  4KI0 E;  1B58 A;  2AL5 A;  1OLC A;  4LAT A;  2XX7 A;  4U22 A;  1QGX A;  5ELV A;  3H4Z A;  4FJP A;  1TFD A;  4C0R A;  3T93 B;  3VFJ A;  1SI0 A;  2F7C A;  3JV9 A;  5IZZ A;  4P0I A;  2I4C A;  2I6E A;  2UYE A;  5TPA A;  4Q5T A;  3CVG A;  4XTC Q;  1QJM A;  2NUV A;  2ALU A;  5CBR A;  1LBV A;  5KDT B;  1FSA A;  3U65 A;  4P1E A;  2RC7 A;  3C34 A;  1M5F A;  3OSR A;  1FW0 A;  4PBQ A;  3S9L C;  3VDF A;  4MX6 A;  1SW2 A;  3UK4 A;  3K1N A;  5DVF A;  4YKI A;  1NNT A;  2Y7K A;  3MYU A;  1OQH A;  4PP0 A;  2DDK A;  4U4X A;  2PMS A;  1NV7 A;  3PPP A;  3PD9 A;  2OWZ A;  4JXI A;  1B5H A;  2OBG A;  2ZNU A;  5HPQ A;  2DS9 A;  1UTB B;  4I1D A;  2NVU B;  2V25 A;  3G3J A;  4PC9 A;  3FUZ A;  4EDP A;  1WVJ A;  4GBV A;  1IME A;  3OO8 A;  3R26 A;  5I2N A;  5I58 B;  1LLS A;  3PV0 E;  1GV8 A;  4GD5 A;  4OVT A;  2REG A;  2B4M A;  1FQF A;  4NAP A;  1ZKB A;  3K4U A;  2R71 A;  3WAE A;  3V89 B;  4OMB A;  2ONS A;  1I69 A;  3H7M A;  2CZL A;  4JSD A;  3IO4 A;  4X9T A;  4DLD A;  3OEN A;  3MVZ A;  3FAT A;  4IO4 A;  3O29 A;  3LSL A;  3C4M A;  1YXI A;  2WBB A;  3FGS A;  3G3G A;  5AA4 A;  4R2B A;  2THI A;  2UVG A;  4GBW A;  5ICQ A;  5LDZ A;  1P1N A;  1BIY A;  1KZ8 A;  3C36 A;  1D9Q A;  4OA4 A;  5DTB A;  3IK6 B;  3ZS6 A;  5A5X B;  4NGU A;  1ANF A;  4JBZ A;  2F6P A;  3TTN A;  1NNP A;  1QUJ A;  1JW1 A;  3USD A;  4IO3 A;  1LBY A;  2FIE A;  4R6K A;  5DW8 A;  1XVY A;  2FHY A; 
#chains in the Genus database with same CATH homology
 5AE4 A;  2PX1 A;  3N6T A;  2B3F A;  4ZDM A;  4IO5 A;  3G3I A;  4R6H A;  3MW0 A;  5CMC A;  3UP9 A;  2NWJ A;  1GR2 A;  4YKK A;  3C9H A;  1PC3 A;  1R6Z A;  2DXR A;  1JEV A;  1Y20 A;  1HSJ A;  1EU8 A;  3A3C A;  2D21 A;  4E0X A;  1ZBM A;  2DXY A;  4F3B A;  4F3P A;  3RY3 A;  3OO6 A;  3EHT A;  3CG3 A;  2RF1 A;  3C32 A;  3GXA A;  3KGC A;  3A3U A;  1TT1 A;  3TPA A;  1Y3P A;  4M4G A;  2ONK E;  3H6T A;  1OQG A;  3R6U A;  3OO9 A;  1ZMG A;  5TU0 A;  5ITP A;  3KN3 A;  2QJE A;  4KD5 A;  2O1L A;  3IOR A;  4GL0 A;  4Z0I A;  3MUQ A;  3O6G A;  3U93 A;  3FV2 A;  2QPQ A;  2XXI A;  3LSF B;  4R6Y A;  1PBP A;  1IIW A;  3KG2 A;  3TTM A;  3G7W A;  1LAF E;  1BKA A;  1MM7 A;  2AIX A;  3HO7 A;  3T9V A;  5FHO A;  3Q26 A;  4G2Z A;  2OLB A;  3MPL A;  1JNF A;  3V83 A;  2PYY A;  2UXA A;  1N7X A;  5KDT A;  3W9V A;  1KWH A;  1LGB C;  3MP1 A;  3SEW A;  2QMW A;  4HCW A;  3HCQ A;  4G8N A;  1MQH A;  1LAX A;  2XXW A;  2DWI A;  3IOV A;  3DEL B;  1LFG A;  3T22 A;  1L5T A;  1S50 A;  1FQD A;  1CE2 A;  4OFL A;  4DCX A;  3OXN A;  2HFB A;  3Q29 A;  1UTB A;  4IO2 A;  5KCJ B;  4LA9 A;  2DSF A;  3TYH A;  2R9J A;  4H1X A;  1DMB A;  5BUU A;  4YKP A;  4GF8 A;  2YPN A;  2ZYO A;  2FA7 A;  3PUW E;  1NNK A;  5I58 A;  1QUL A;  3TTR A;  1OLA A;  4OQO A;  1LB9 A;  1SBP A;  4LP2 B;  3MVX A;  3QIM A;  4GOT A;  1ZTY A;  3CIJ A;  3PPO A;  3V5A A;  3BBR A;  4EXL A;  3K02 A;  2IEE A;  3PPR A;  3ZKK A;  1B6H A;  4X1B A;  4G68 B;  1MQJ A;  4PFY A;  1B46 A;  1R9Q A;  4O3A A;  5I59 A;  4PFU A;  4YMA A;  3G3F A;  1B3L A;  2H9B A;  4R74 A;  4QHQ A;  3SEX A;  2YLN A;  5CC2 A;  5A5X A;  1MQG A;  4ZZA A;  4EXK A;  3ZKL A;  1XS5 A;  3S2V A;  2XXH A;  2KLF A;  3OO7 A;  3LBS A;  1NNF A;  1QKA A;  1O64 A;  4QSC A;  1VR5 A;  1UQW A;  3M3F A;  3D4G A;  3PPN A;  4KR5 A;  2P2A A;  3F11 A;  2Q2C A;  3IX1 A;  3CFL A;  5ISU A;  3I5O A;  1M5B A;  3FXR A;  3KSX A;  1NFT A;  2B3B A;  1EZO A;  1B3H A;  4OHN A;  3Q28 A;  3E3K A;  3VXB A;  3V8X B;  3H03 A;  1HSE A;  3U1O A;  5EHS A;  2DE3 A;  2HZK A;  3U8Q A;  4FAJ A;  2H5Y A;  5B7D A;  4QRZ A;  4OEN A;  4XIG Q;  4Q0C A;  4G8M A;  2Y7P A;  1MPD A;  4IO6 A;  1Z7N E;  1US4 A;  2FYI A;  2RCA A;  1LCF A;  1ATG A;  3K6W A;  3C33 A;  3MJN A;  1SW5 A;  3H3G A;  4YU0 A;  1P1O A;  4NWD A;  4ELP A;  1B52 A;  3ONM A;  1TXF A;  1IXI A;  2YJP A;  2XXU A;  4FIM A;  4ZED A;  5FTI A;  1M5D A;  4EUO A;  4EF2 A;  1M5E A;  4H5G A;  4G8H A;  1URG A;  1QUI A;  2Y7R A;  5CI5 A;  1P99 A;  1UTH B;  3IR1 A;  2W7Y A;  2QS2 A;  3KEI A;  2Y84 A;  3PMW A;  2HEU A;  2OK2 A;  5CMM A;  1IQ7 A;  3MAM A;  5DVJ A;  1TFA A;  4F1Y A;  1IUD A;  4ND9 A;  4QFK A;  4I62 A;  4BDL A;  2ONR A;  1A8F A;  4HW8 A;  2BJJ X;  4F1V A;  4PQJ A;  3THI A;  1SYI A;  4MF3 A;  1Q35 A;  2O51 A;  1SW1 A;  4OEV A;  4F1U A;  3GBA A;  1QW0 A;  5CRY A;  1LBB A;  4ZE9 A;  5KCJ A;  2H99 A;  2ZMB A;  2A5T A;  1QVS A;  2XXT A;  5L9S A;  4OYV A;  4GLI A;  1MH3 A;  3CSB A;  4YIC A;  3IO6 A;  1Q1K A;  2XD3 A;  4U23 A;  5DYH A;  1Y3N A;  3IOW A;  1IIT A;  3TAJ A;  3A09 A;  1YPN A;  1B40 A;  2X7Q A;  3B6Q A;  1EH3 A;  4H8J A;  2XXP A;  3KFM A;  3TCH A;  1LCT A;  2HXW A;  1QKB A;  4G68 A;  3H6V A;  2F97 A;  4YMB A;  4F3S A;  3K0V A;  4R9F A;  1RYO A;  4U1O A;  5JK4 A;  3K1M A;  1ZLQ A;  4XKP A;  4ESW A;  1P1W A;  3SEY A;  4JWX A;  1H45 A;  4G68 C;  3O6H A;  3OEM A;  1JVY A;  2GH9 A;  3FVO A;  1B4H A;  4OES A;  3ECR A;  1FTO A;  1N04 A;  4TLM B;  2ZNT A;  3DP4 A;  3FJM A;  3OSQ A;  1A55 A;  3FVN A;  4PFT A;  2G93 A;  1B7Z A;  4ECF A;  1D9Y A;  2R6G E;  5IAI A;  3PUY E;  2HZL A;  4FOR A;  3KJ7 A;  4ZS9 A;  1NKX A;  2LAO A;  3HN0 A;  5F7V A;  2V93 A;  4M1V A;  3DLN A;  4F22 A;  1VSO A;  4N13 A;  2H4I A;  3QSL A;  3TTL A;  3VLW A;  1NL5 A;  2O69 A;  4TQU Q;  2VOZ A;  4QFN A;  4GXA A;  4AQ4 A;  3EF7 A;  2DWA A;  2O68 A;  3RTF B;  3HHF A;  3RN8 A;  1SYH A;  1USY E;  2XXY A;  1UTH A;  1PB9 A;  1Y9U A;  1AOV A;  4K3F A;  3TEP A;  4YAH X;  3FXQ A;  3PUV E;  1ZJL A;  4JWO A;  2RC9 A;  4YB6 A;  4NWC A;  5M2V A;  4IGR A;  4XKR A;  3IJO B;  4N07 A;  2DWJ A;  1URS A;  1LFI A;  2X26 A;  3RNN A;  4OFO A;  4GRK A;  5I59 B;  4LZ7 A;  4ZEF A;  3T9H B;  2F6G A;  2QS4 A;  1MY3 A;  4L17 A;  2I3V A;  4OFJ A;  2O6A A;  2V3T A;  3QAX A;  3RTW B;  3U72 A;  4YKJ A;  3IB1 A;  4POX A;  4EQ9 A;  4OVJ A;  5H8Q A;  4JB7 A;  2DE2 A;  1LAH E;  3TCF A;  3EHU A;  2ESN A;  1S9T A;  3T9X B;  3C35 A;  1PDA A;  5J1D A;  3CI8 A;  2I4B A;  1Y4C A;  3SEV A;  4RY1 A;  2VHA A;  3EHS A;  1HSL A;  1USY H;  4RK2 A;  1IEJ A;  4QSE A;  3TQL A;  3FIR A;  5HM4 B;  4ZEB A;  1MY1 A;  1YCJ A;  3IL1 B;  3KSJ A;  3PUX E;  2UVH A;  4DE8 A;  4BDM A;  3SER A;  4KYD A;  1BLF A;  2B65 A;  2M8C A;  4IY6 A;  2HAV A;  1AIV A;  3ZSF A;  3KN8 A;  5K2Y A;  3CG1 A;  2Z22 A;  1I6A A;  3MZB A;  1EZP A;  3I6V A;  5I57 B;  1LFH A;  3IAZ A;  2HCA A;  1B05 A;  2DVC A;  3WAF A;  1MXW A;  5H8H B;  4IY5 A;  4I8C A;  3H6U A;  3K2D A;  2XD2 A;  3K01 A;  3PUZ E;  4WEP A;  1FQE A;  1WDN A;  5IKB A;  1MRP A;  3K6X A;  2NOO A;  2GFE A;  1N76 A;  1POT A;  4GL8 A;  2VD2 A;  3P7I A;  3VVE A;  3TDJ A;  4EF1 A;  1B3F A;  4YZZ A;  2A5T B;  4HCY A;  3MBP A;  1B7H A;  1FTJ A;  3FVG A;  4Q8R A;  1N3X A;  2VP1 A;  4MLQ A;  4FE8 A;  2E1S A;  3G3H A;  2OCU A;  1DPP A;  3I3V A;  5FHM A;  4Z7E A;  3JYR A;  1IXC A;  2P0S A;  2OWS A;  1DOT A;  3G3K A;  3PGF A;  3GLB A;  2ANJ A;  1II5 A;  1LBC A;  3O97 A;  3S9M C;  2XXV A;  4OER A;  3FV1 A;  1O63 A;  3Q27 A;  1MPC A;  5DVI A;  2PBW A;  3GBB A;  1B3G A;  1D9V A;  1MDP 1;  1H76 A;  5I2K B;  1RKM A;  3QXM A;  4I9D A;  4OWD A;  4KFQ A;  2H98 A;  3RUM A;  3HST A;  2Q89 A;  4KHZ E;  3RT8 A;  3PD8 A;  1MY0 A;  3FJ7 A;  4FEC A;  3O28 A;  1O7T A;  5CM6 A;  2Y7I A;  4DCY A;  3PU5 A;  4XKN A;  5AA3 A;  2IA4 A;  4ESX A;  3OOA A;  3MWB A;  4JSO A;  3B7D A;  4F39 A;  4U21 A;  2I0B A;  2Q9T A;  3FAS A;  3RT6 B;  3O66 A;  2H25 A;  2DWH A;  2V3Q A;  3QYT A;  3ODB A;  2RC8 A;  2DQV A;  2GHA A;  3QK6 A;  1XT8 A;  4H65 A;  4QFO A;  3TMG A;  5CMB A;  2O7U A;  3B6T A;  4RNS A;  4ONY A;  1FTL A;  3L6G A;  4NF6 B;  1B51 A;  1N84 A;  4ISU A;  3U94 A;  1ELJ A;  2FNC A;  3IJX B;  3B6W A;  4G4P A;  4OXV A;  2ZNS A;  3MZ1 A;  4R2F A;  4WXJ A;  2ZYK A;  5KZT A;  5ITO A;  2D3I A;  3UIF A;  5I57 A;  2O84 X;  2V3U A;  4THI A;  1FTK A;  4E0W A;  2CMO A;  5JTY A;  1B5J A;  2QL3 A;  4P11 A;  3VVF A;  5H8H A;  4PET A;  4KYE A;  3N26 A;  1NH8 A;  2AYS A;  4ZEC A;  1B9J A;  4DXB A;  5AA2 B;  2QRY A;  2DYX A;  1MQD A;  3T9U A;  2F78 A;  2REJ A;  4GWO A;  4F2O A;  4LUB A;  4MBP A;  1UIV A;  4LVQ A;  1B0L A;  4H0W A;  4IGT A;  2UVI A;  2VGQ A;  3L6H A;  3KOS A;  1F9B A;  3UN6 A;  1FCK A;  5LOM A;  3SES A;  5HBC A;  5H8Q B;  2RKM A;  5EYF A;  3E9X A;  3VLU A;  4LQ5 A;  2E0S A;  2XX9 A;  1B32 A;  2Q88 A;  3N6U A;  1FQC A;  4P0G A;  5FTH A;  1A54 A;  1RYX A;  1H3D A;  2I49 A;  3MQ9 A;  1OIB A;  5AA1 A;  4H67 A;  3H06 B;  3VV5 A;  4UAC A;  3MC2 A;  2P1S A;  3BKI B;  4NE4 A;  3PPQ A;  4AB6 A;  4FED A;  3UGW A;  1XHY A;  3HPI A;  3VLV A;  2F35 A;  3O9P A;  5I2K A;  4QF9 A;  2WKY A;  5F1Q A;  1J1N A;  1P1Q A;  2ZYN A;  4DXU A;  3OEK A;  5ICT A;  4NF4 B;  2UVJ A;  3R7X A;  4POW A;  2Z8E A;  3RGY A;  1OVB A;  3CR9 A;  3TTK A;  2HAU A;  3MVW A;  3MPK A;  3ILU B;  5AA2 D;  2XXX A;  3FJG A;  5H8S A;  1SW4 A;  3UA8 A;  1MXY A;  1BTJ A;  3K6V A;  4R72 A;  1Z7M E;  4NF5 B;  4NED A;  1B3E A;  4U4S A;  5EHM A;  4TOZ A;  4C1T A;  3TEL A;  3TKD A;  4WKM A;  2PT2 A;  3KOT A;  1UIU A;  5H8N B;  2GHB A;  2V84 A;  3EPE A;  1JW4 A;  1SI1 A;  4H6D A;  3D4C A;  1PB7 A;  4Q30 B;  3K1P A;  4H8I A;  4N6P A;  4NF6 A;  4O3C A;  4KQP A;  2RIN A;  2F34 A;  4KCC A;  5H8F B;  4OET A;  4PFW A;  2G29 A;  1OVT A;  1LAG E;  1N0T A;  2XXQ A;  2ABH A;  2OWT A;  4QFP A;  4LQ2 A;  1MM6 A;  5L9M A;  1D4N A;  4YB7 A;  3PMV A;  1MH4 A;  1AMF A;  4QSD A;  1FQB A;  4XXU A;  5AA2 A;  4U1Z A;  1Y1Z A;  1OMP A;  5BWJ A;  4R75 A;  4NF8 B;  4HS7 A;  1A7L A;  2Q8J A;  2VD3 A;  5I84 A;  3BFT A;  2QMX A;  1AL3 A;  1PB8 A;  3MZ9 A;  4GVO A;  3C31 A;  1XC1 A;  4GQO A;  1H44 A;  1SVX B;  4GXS B;  4RXL A;  3VXC A;  4HTG A;  2DP8 A;  3RQT A;  3TCG A;  4X1D A;  1Y4T A;  3LC8 A;  1ZU0 A;  4R73 A;  2F8D A;  2AL4 A;  4MH5 A;  3IB0 A;  3KJT A;  3KN7 A;  1PEB A;  4BDR A;  3IOU A;  3DP8 A;  4FAT A;  2A5S A;  3TUS A;  4PE5 B;  1MY4 A;  3IB2 A;  3CFZ A;  1AH5 A;  3OEL A;  4NF4 A;  4IB2 A;  3M8U A;  5FHN A;  3CSG A;  1GTK A;  4MFI A;  5DT6 A;  4MLV A;  2HQ0 A;  4DZ1 A;  1D3K A;  5JTY B;  4G77 A;  3TFL A;  3E4R A;  4F31 B;  2XX8 A;  5DEX B;  1LST A;  2ZXT A;  1CB6 A;  4ZZE A;  3E13 X;  5CMK A;  4NF5 A;  4KPT A;  4DDD A;  1R1N A;  1ZIU A;  4F19 A;  1I6Q A;  4GFR A;  1H43 A;  1B4Z A;  1P1U A;  1GVC A;  3M3K A;  3U92 A;  4RJZ A;  5H8N A;  2Z8F A;  4YB5 A;  4TLL B;  4DIG A;  1JW5 A;  4ZEK A;  2OJT A;  4F3G A;  2NXO A;  1QUK A;  3LSW A;  3DP6 A;  3KZG A;  4KYS A;  4RPO A;  1M5C A;  5B70 A;  1EZ9 A;  3FVK A;  5H8F A;  3SDF A;  1MXZ A;  2F7B A;  3JZJ A;  1XOC A;  4OEU A;  1MXU A;  3MVY A;  4R9G A;  4LZ5 A;  1T0K A;  5I56 B;  3CRB A;  1YAE A;  2PT1 A;  1FTM A;  4OZ9 A;  5K2X A;  4UA8 A;  2I3W A;  4WED A;  3EN3 A;  5TP9 B;  2QS1 A;  3HV1 A;  3MP6 A;  3T66 A;  1S7Y A;  3RLF E;  4ELR A;  2DVZ A;  4RYA A;  1IZ1 A;  1XVX A;  4NMY A;  4NF8 A;  1SQY A;  1MDQ A;  1JVX A;  3LR1 A;  4RA1 A;  4BLA A;  1B1X A;  1DTG A;  3K6U A;  1B5I A;  4O3B A;  2F5X A;  5TPA B;  1VFD A;  2O7I A;  3N5L A;  1IXH A;  5JEI A;  1SD3 A;  3TZA A;  4BDQ A;  4ELQ A;  4NTL A;  1B2H A;  3Q25 A;  3H6W A;  3VVD A;  4EQ7 A;  3OD7 A;  1US5 A;  2RCB A;  1IXG A;  2QS3 A;  4DXC A;  4BDO A;  4AB5 A;  4IO7 A;  4C1U A;  2Y7W A;  1MG1 A;  2Z23 A;  3O6I A;  1A99 A;  2PVU A;  3KBR A;  2D5W A;  1B1H A;  1WOD A;  3W15 C;  2I0C A;  2QSX A;  3QUJ A;  1URD A;  1POY 1;  1Y1M A;  3ILT B;  3TQW A;  3HHG A;  3PMX A;  3GZG A;  4GIZ A;  1BP5 A;  3DM0 A;  3SEU A;  1NMU A;  1JQF A;  1N3W A;  3CFX A;  1MY2 A;  3MP8 A;  3LSX A;  1JEU A;  5I2N B;  2XXR A;  1B7U A;  2GRV A;  2X7P A;  3FXU A;  3BFU A;  3O2A A;  2OZZ A;  4RPN A;  1DSN A;  1VFE A;  1Y3Q A;  3IOT A;  5DEX A;  3M3L A;  4BDN A;  1MXV A;  1VE4 A;  2F7A A;  4F18 A;  4RK9 A;  1LB8 A;  3RPW A;  1MXX A;  1I6B A;  4F2Q A;  4LON B;  3K00 A;  2DOJ A;  5AA4 B;  4JDF A;  1NH7 A;  3S9N C;  3FZV A;  3TOD A;  3LUY A;  1JET A;  1A8E A;  4ELO A;  1GGG A;  2XHD A;  3AXF A;  3SKP A;  1B0H A;  1FQA A;  1DPE A;  4H5F A;  2F36 A;  3QUF A;  4X48 A;  4EQB A;  4U2R A;  4JWY A;  3EQ1 A;  2Q2A A;  3SET A;  3N94 A;  3W9W A;  1R9L A;  3S9E A;  5L9O A;  3UOR A;  2I48 A;  1PBQ A;  2ZYM A;  3S4U A;  1MPB A;  4XKQ A;  5I56 A;  5CBS A;  2I58 A;  4F29 A;  1TWY A;  1N7W A;  1MQI A;  1DTZ A;  3FD3 A;  3OMB A;  4LZ8 A;  1A40 A;  4OTE A;  1MS7 A;  5TP9 A;  3VE1 B;  4FEB A;  2O1M A;  1SDX A;  2DE4 A;  5L8D A;  2UYF A;  2Z8D A;  4ZE8 A;  4ZEI A;  1YTV A;  4QFL A;  3T96 B;  4KCD A;  4KI0 E;  1B58 A;  2AL5 A;  1OLC A;  4LAT A;  2XX7 A;  4U22 A;  5ELV A;  3H4Z A;  4FJP A;  1TFD A;  4C0R A;  3T93 B;  3VFJ A;  1SI0 A;  2F7C A;  3JV9 A;  4P0I A;  2I4C A;  2I6E A;  2UYE A;  5TPA A;  4Q5T A;  3CVG A;  4XTC Q;  1QJM A;  2NUV A;  2ALU A;  5CBR A;  5KDT B;  2RC7 A;  3C34 A;  1M5F A;  3OSR A;  1FW0 A;  3S9L C;  3VDF A;  1SW2 A;  3UK4 A;  3K1N A;  5DVF A;  4YKI A;  1NNT A;  2Y7K A;  1OQH A;  4PP0 A;  4U4X A;  2PMS A;  3PPP A;  3PD9 A;  4JXI A;  1B5H A;  2OBG A;  2ZNU A;  5HPQ A;  2DS9 A;  1UTB B;  4I1D A;  2NVU B;  2V25 A;  3G3J A;  3FUZ A;  4EDP A;  1WVJ A;  3OO8 A;  3R26 A;  5I2N A;  5I58 B;  1LLS A;  3PV0 E;  1GV8 A;  4GD5 A;  2REG A;  1FQF A;  1ZKB A;  3K4U A;  2R71 A;  3WAE A;  3V89 B;  4OMB A;  2ONS A;  1I69 A;  3H7M A;  2CZL A;  4JSD A;  3IO4 A;  4X9T A;  4DLD A;  3OEN A;  3MVZ A;  3FAT A;  4IO4 A;  3O29 A;  3LSL A;  3C4M A;  3FGS A;  3G3G A;  5AA4 A;  4R2B A;  2THI A;  2UVG A;  5ICQ A;  1P1N A;  1BIY A;  3C36 A;  5DTB A;  3IK6 B;  3ZS6 A;  5A5X B;  1ANF A;  4JBZ A;  2F6P A;  3TTN A;  1NNP A;  1QUJ A;  1JW1 A;  3USD A;  4IO3 A;  4R6K A;  1XVY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...