3E13X

Iron reconstituted ferric binding protein from campylobacter jejuni
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
317
structure length
317
Chain Sequence
SELNIYSARHYNADFEIIKKFEEKTGIKVNHTQAKASELIKRLSLEGSNSPADIFITADISNLTEAKNLGLLSPVSSKYLEEFIPAHLRDKDKEWFAITKRARIIAYNKNTNIDISKMKNYEDLAKAEFKGEIVMRSATAPYSKTLLASIIANDGNKEAKAWAKGVLENLATNPKGGDRDQARQVFAGEAKFAVMNTYYIGLLKNSKNPKDVEVGNSLGIIFPNQDNRGTHINISGIAMTKSSKNQDAAKKFMEFMLSPEIQKILTDSNYEFPIRNDVELSQTVKDFGTFKEDQIPVSKIAENIKEAVKIYDEVGFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Putative iron-uptake ABC transport system,periplasmic iron-b
publication title Small hinge motion by the anion-independent ferric binding protein from Campylobacter jejuni
rcsb
source organism Campylobacter jejuni
total genus 122
structure length 317
sequence length 317
ec nomenclature
pdb deposition date 2008-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF13343 SBP_bac_6 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3e13X01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3e13X02
3CVGA 4LQ5A 1N3XA 4QF9A 4QRZA 1IXHA 3C9HA 1H3DA 1MQIA 5HBCA 1F9BA 2XXUA 4R6HA 3MBPA 3IX1A 3ILTB 4NF4A 2Q2AA 1POY1 1ELJA 1M5BA 3RQTA 2HQ0A 2IA4A 3MPLA 3TTMA 3K02A 3TEPA 2RC8A 5AA2D 1TFAA 3W9VA 2XXVA 3TDJA 3O29A 3E13X 1NNTA 1GV8A 2HXWA 2A5SA 3FVNA 2F78A 3PPOA 4LZ5A 4THIA 2D21A 2ZNUA 1DSNA 4M1VA 1POTA 5I56A 4R9GA 1BIYA 4RA1A 1AH5A 3MW0A 3GLBA 1OVTA 2HFBA 2Q89A 4R73A 3K6UA 3SESA 4U21A 2G29A 2I49A 3IJOB 1MDQA 4OMBA 4OFLA 1MQDA 3OSRA 3RPWA 1SI0A 3RLFE 2HAUA 1USYE 5CMMA 3U8QA 4ZE8A 1Y4TA 2DYXA 2X26A 3TFLA 5F1QA 4F18A 3ZS6A 4C1TA 4OESA 4ELPA 2UYEA 4JXIA 3OD7A 3VV5A 4G4PA 4IY6A 1B7ZA 3R26A 3IB0A 5AE4A 5BWJA 1QUJA 1LLSA 5AA3A 4MF3A 3T9UA 3JYRA 1MPCA 1JEVA 3O6HA 1MXWA 1SW5A 2ONSA 2PX1A 5AA4A 1MY4A 3N26A 1J1NA 2P0SA 2Q8JA 1FQFA 1B46A 1ZLQA 1R9QA 2QRYA 1SYHA 3EQ1A 4ZS9A 1GTKA 3MZ9A 2H98A 2UYFA 1AOVA 1R9LA 3K1PA 3V83A 2Q2CA 3PUXE 5J1DA 4G8HA 4KCCA 1H76A 4ELRA 1OLCA 4ZEBA 2XXRA 4DXCA 4O3BA 3KFMA 5B7DA 3VXBA 3T93B 2DWIA 4NF6A 1O63A 3E4RA 3JZJA 3T66A 2H9BA 3I5OA 1NNFA 1IIWA 1VE4A 3PD9A 3CSBA 3RTFB 4NMYA 5I59A 1MQJA 1MXVA 1LCTA 4ZZEA 4U4SA 5EHMA 3DP4A 1SVXB 3TAJA 2QMXA 4GRKA 4YZZA 1ZJLA 4IO5A 1M5CA 4R6KA 1NKXA 4GF8A 1Y20A 5LOMA 3VLVA 1A7LA 3ODBA 3EN3A 3QAXA 3TPAA 4OVJA 4DCYA 1B1HA 1VSOA 2I4CA 5DT6A 4ZEIA 4ESWA 1FTMA 1UTHA 4YKKA 3LSWA 1MXZA 3Q26A 2NUVA 4ND9A 2F5XA 3E9XA 3PMVA 3MZ1A 1MQHA 3IR1A 4IB2A 4OFOA 5HPQA 2QS2A 3RGYA 4OYVA 2DXYA 3ILUB 3SEYA 2I0BA 4GFRA 2B65A 3AXFA 3L6HA 4NWCA 3UORA 4QHQA 4N07A 3PV0E 3IOWA 2YLNA 2VGQA 3RT6B 3QIMA 1WODA 1IXGA 5M2VA 4G68A 4OFJA 4X48A 3QYTA 3S9NC 3K00A 1VFDA 2I48A 1LAHE 5ICTA 4JDFA 4EXLA 5F7VA 3HN0A 4KCDA 4ECFA 1A99A 2ZYKA 5ISUA 3IB2A 2I3VA 4LA9A 2XXHA 3BFUA 2Y7RA 5CMKA 2ZMBA 4YKJA 5KDTB 5KCJA 2QMWA 2Z8DA 2O1LA 1H45A 3KOTA 3MUQA 4ZE9A 1IZ1A 1MM6A 1DTGA 4MLQA 4YICA 1P1QA 1NMUA 1MG1A 2V25A 3H03A 2QJEA 1Z7ME 5AA1A 3I6VA 1B4HA 4PFWA 1YAEA 4BLAA 1B52A 5TPAB 1O7TA 4JSDA 3TODA 1FQEA 3OMBA 2F7AA 4O3AA 1R6ZA 4M4GA 2XD3A 5DVFA 3K4UA 4JWXA 2DVCA 3VDFA 5DVJA 1YPNA 4KFQA 5K2YA 1A8FA 3K6XA 3H06B 4Q30B 4NF8B 1TFDA 4GXAA 1UIUA 4OHNA 4FJPA 1P1WA 4QFNA 2AL4A 1RYXA 1D4NA 1MXYA 4TLMB 3TKDA 2DXRA 1B0LA 4H8JA 3C36A 3CR9A 4K3FA 3S9LC 4NF5A 4HCYA 3OO8A 1LSTA 3C35A 1L5TA 4HS7A 5DVIA 1ZTYA 3O28A 3BKIB 5CI5A 4IO4A 3LBSA 4AB6A 3UA8A 3G3IA 5H8NA 3FGSA 4KD5A 3TELA 2R71A 3KGCA 3H6VA 1D3KA 5FHOA 1GGGA 3Q27A 3TQLA 3OO6A 3EF7A 3TUSA 4MFIA 4QSDA 1A40A 1SBPA 4ZEDA 4GVOA 4ELQA 4OQOA 4FECA 4R2BA 5I2NB 3O2AA 3PPNA 1XT8A 2DP8A 2I3WA 4R75A 4JWYA 3C4MA 5DEXB 3K1MA 3CSGA 5DTBA 2NXOA 3O9PA 5KZTA 3OEMA 2QSXA 3RY3A 1BP5A 4ESXA 3FUZA 5JK4A 4H1XA 3VLUA 3K01A 4XKQA 1M5EA 3A3UA 1M5DA 3C33A 2O6AA 4DE8A 3EHUA 3R7XA 4DDDA 2NOOA 3KN3A 3OSQA 4NTLA 5I58B 4LQ2A 4F1YA 3QUJA 2V3UA 3G3FA 4H8IA 4Z0IA 2O1MA 4YKPA 3W9WA 4YB7A 5A5XA 1DPEA 3U72A 3K1NA 5JTYA 1Y3PA 4F1UA 3FJGA 1USYH 4F39A 1SDXA 3H3GA 2Y7IA 2XHDA 4KPTA 1ANFA 2XXQA 4F1VA 2DSFA 5ITPA 4UACA 1XC1A 3OENA 3TCHA 4N6PA 4RY1A 3VE1B 4HCWA 1NH7A 1IEJA 3DM0A 3D4GA 4G8MA 2ONKE 3MZBA 4PFUA 3M3FA 4EQ7A 2RINA 1MY2A 3SEUA 1I6AA 3JV9A 2XX9A 4DXUA 1MY0A 2DQVA 3FV1A 2NVUB 2ESNA 3OO7A 3RUMA 1D9VA 1Y9UA 5BUUA 1GVCA 1MXUA 2W7YA 5I2KA 4ONYA 1SD3A 2X7PA 1JW4A 3CFLA 3VFJA 2H99A 1LB8A 2D5WA 1LGBC 3FXQA 3VVDA 4OEVA 2H4IA 2FNCA 1B3GA 3VLWA 4OTEA 4Z7EA 2AL5A 3UP9A 4XKNA 5I57A 5L9SA 1UTHB 2FA7A 2RC9A 3C34A 2GH9A 4GIZA 2LAOA 1JVYA 2Z8EA 4ZZAA 5H8HA 3FVOA 2AIXA 4QFOA 1MPBA 1DTZA 3FJMA 1NH8A 4X9TA 5H8SA 2F8DA 3D4CA 4QSEA 1JNFA 2OZZA 1DMBA 2I6EA 4G77A 3OXNA 3K0VA 5H8FA 2V3QA 3DLNA 3G3HA 5K2XA 2Y84A 3MQ9A 2XXPA 3GBAA 5FTHA 5TP9B 1B5IA 3FJ7A 5FHMA 1MH3A 1ZU0A 3Q28A 1Q1KA 4IO2A 4TOZA 4FORA 3KSJA 1B9JA 2QS3A 2ZYMA 3B6QA 1XOCA 2HAVA 1NL5A 3HCQA 4EF2A 3LR1A 2GHBA 3LSFB 2UVJA 1FQAA 3IB1A 1PDAA 1SW1A 4BDNA 3S9EA 5CRYA 3FV2A 3PUVE 2B3FA 4XKPA 1B40A 5ICQA 1B5JA 2GHAA 4YAHX 2O69A 4WXJA 2O7IA 5H8QB 3IO4A 2ZNSA 1ATGA 1OIBA 3K2DA 1IUDA 2ABHA 4I9DA 4LUBA 1WDNA 4X1BA 1KWHA 5CMBA 1Q35A 3CI8A 2Z22A 2Z23A 1N0TA 5I84A 3MPKA 1PB8A 4KYEA 4XTCQ 1P1UA 4WKMA 4JWOA 3OO9A 4H5GA 4XIGQ 4YMBA 4FE8A 4UA8A 1QVSA 3FD3A 3N6TA 4F3PA 3GXAA 2F35A 4RK2A 5CMCA 1AIVA 4GQOA 1URDA 3FXRA 2OCUA 3LSXA 2PT1A 4GLIA 4LVQA 3B7DA 5EHSA 3KN7A 4YKIA 4OWDA 2FYIA 5AA2B 3T96B 1B3HA 2VHAA 3HHGA 1XS5A 4GOTA 4EQBA 3EPEA 5H8NB 2GFEA 2DE4A 4F2OA 3N94A 2VD2A 3PPQA 2XXTA 3CFZA 1DOTA 1FCKA 1UTBB 4PFTA 2ALUA 2I58A 3HO7A 4HTGA 2DOJA 5TU0A 2F97A 2A5TA 4EQ9A 2OBGA 1B6HA 5ELVA 3IOUA 1JW1A 3PMWA 4OETA 3H6UA 3HPIA 4FEDA 1NFTA 2V84A 1ZIUA 4ZEFA 4YMAA 1B3EA 4KYSA 1FQCA 3MP8A 3OEKA 1B3LA 4BDLA 1QKAA 1B5HA 2CZLA 2RCAA 4GD5A 2UXAA 1II5A 3I3VA 3KJTA 3HSTA 2DS9A 4BDRA 1ZKBA 1XHYA 2PMSA 1TWYA 1EZ9A 3HHFA 3V8XB 1SYIA 2XXWA 3H6TA 4EDPA 2X7QA 2QS4A 3B6WA 1IQ7A 4QSCA 5ITOA 2DE2A 3SERA 2Y7KA 3KBRA 4DCXA 4LONB 2RKMA 3EHTA 1EZOA 1FTLA 1HSLA 4PETA 1Z7NE 5L9OA 1CE2A 4NE4A 3ZKKA 1N7WA 3K6VA 2I4BA 3QSLA 3IO6A 3S2VA 1P99A 2ANJA 4QFPA 3U93A 5A5XB 4FEBA 3BFTA 3LSLA 1B51A 4E0XA 1Y1MA 1N76A 1US5A 2PT2A 5DYHA 5FTIA 1GR2A 1BLFA 3QK6A 4Q5TA 1BKAA 4RJZA 3T9HB 1B58A 3ONMA 2O84X 1OQHA 4NF4B 3TMGA 2XX8A 1QUIA 4Q8RA 1LAXA 1SQYA 4I1DA 2UVGA 2E1SA 3UGWA 3E3KA 1FQDA 4G68C 4MLVA 2V93A 4X1DA 5I56B 5KDTA 3PUYE 3HV1A 2OLBA 2O68A 1S50A 3T9XB 2DWJA 4RK9A 4BDOA 4JB7A 3RT8A 2DE3A 1HSJA 2ONRA 2RCBA 3C32A 2R6GE 1LBBA 3IOTA 4FIMA 3H7MA 5IAIA 2OWSA 5CBRA 1LCFA 2ZNTA 4GL8A 4YU0A 1MXXA 2QL3A 3UN6A 4TLLB 3MP1A 4IO7A 5I57B 2ZXTA 1WVJA 3CG3A 5L9MA 1S9TA 1B05A 4R9FA 4OERA 3GBBA 4H67A 1XVXA 4G8NA 3ZSFA 1B4ZA 4F29A 2R9JA 4KQPA 4NF8A 4O3CA 1VR5A 2VD3A 4AB5A 1OQGA 5AA4B 2P2AA 4P0IA 2M8CA 2AYSA 4RXLA 4U1OA 4ZEKA 1JEUA 3SEXA 1OLAA 3MWBA 3CIJA 4RPOA 2O7UA 2DVZA 5L8DA 3N5LA 1US4A 1D9YA 2WKYA 4BDMA 4IGTA 2THIA 3OOAA 3LUYA 3G3JA 2PBWA 3VVEA 2Q9TA 2QPQA 1LAGE 4LP2B 4H5FA 1B32A 4WEDA 2OK2A 4ISUA 2D3IA 4NF6B 3UK4A 4R74A 3N6UA 3V5AA 2VP1A 1QUKA 1EH3A 4ZDMA 4GWOA 3GZGA 3ECRA 3SEWA 1XVYA 3RTWB 3T9VA 3PUWE 5I59B 3G3GA 5CBSA 1MH4A 5I2NA 1O64A 3LC8A 3C31A 3S4UA 1TXFA 5DEXA 1B1XA 1N7XA 3B6TA 1SW2A 1OVBA 4U1ZA 2O51A 3KEIA 2I0CA 4XKRA 4LZ7A 5B70A 2F6PA 4TQUQ 3VXCA 3FVGA 4IO3A 5CM6A 3PGFA 1B0HA 3QXMA 2XXYA 3PU5A 1RYOA 4NWDA 3MVYA 3PPRA 1MPDA 1IITA 4C0RA 1PC3A 1PB9A 1B7UA 3DP6A 1JVXA 1M5FA 5I58A 1NNKA 1EZPA 3DELB 4MH5A 3M3LA 2CMOA 4F31B 3FXUA 3MVWA 1JETA 4G68B 3IAZA 2XXXA 4U4XA 3CRBA 4JBZA 1JW5A 4ELOA 1B3FA 1FQBA 3CG1A 5KCJB 1Y1ZA 1FTOA 2F6GA 2A5TB 1HSEA 5EYFA 4DZ1A 4EF1A 3PMXA 3KZGA 3TTKA 4F3SA 2KLFA 1MDP1 3KOSA 4I62A 3TZAA 3MJNA 2F7BA 4H0WA 2PVUA 4KHZE 1Y4CA 3R6UA 4U2RA 4KR5A 3VVFA 4RYAA 2OWTA 4AQ4A 3WAFA 3M3KA 5IKBA 1AMFA 4R72A 2NWJA 3G3KA 4Q0CA 3TYHA 3QUFA 2XXIA 2REGA 3O66A 1SI1A 4F3BA 1S7YA 3FZVA 3A3CA 3SETA 1N3WA 2Y7WA 4R6YA 4R2FA 4F22A 3IJXB 2YJPA 1I6BA 3G7WA 1N84A 4RNSA 2DWHA 3KN8A 5FHNA 2UVHA 2VOZA 1PB7A 4NEDA 1QW0A 2YPNA 2DWAA 1LFGA 4KI0E 4IO6A 1IXIA 4NF5B 4QFLA 4LZ8A 1YTVA 3MC2A 3Q29A 4BDQA 3RNNA 4IY5A 3KSXA 1QKBA 1A55A 3SEVA 4P11A 4ZECA 1UQWA 1ZMGA 2B3BA 3OELA 1BTJA 2IEEA 4E0WA 4F3GA 3MP6A 1URGA 4EUOA 2G93A 3FATA 4F19A 2Y7PA 4C1UA 1PBQA 2HZKA 1NNPA 3PD8A 2ZYNA 5TP9A 3H6WA 1QJMA 4IGRA 3K6WA 1LFIA 4PE5B 2OJTA 1MY1A 4G2ZA 1I6QA 3MVZA 4WEPA 2RC7A 2RF1A 3PPPA 3FVKA 3P7IA 2V3TA 3MVXA 1SW4A 1MQGA 1MY3A 4DLDA 1URSA 1LB9A 4PP0A 2QS1A 3U94A 1P1NA 4XXUA 3TCFA 4H65A 1I69A 5H8QA 4HW8A 1A54A 3W15C 1P1OA 3UIFA 2Q88A 3KJ7A 3MAMA 4I8CA 2Z8FA 1B7HA 1FW0A 4U22A 4RPNA 1FTKA 2BJJX 4FAJA 3IORA 1TT1A 5HM4B 1PBPA 2F7CA 2XX7A 1CB6A 3V89B 4POXA 1UIVA 3KG2A 3T22A 2H25A 5JTYB 3TTLA 4H6DA 4P0GA 5JEIA 1FTJA 3TCGA 3U1OA 5AA2A 1Y3QA 3RN8A 3L6GA 1H43A 3O97A 2HZLA 3FIRA 1MS7A 1QULA 4OEUA 4LATA 1DPPA 2GRVA 1JQFA 3SDFA 4PQJA 3H4ZA 2HCAA 1Y3NA 1ZBMA 4DXBA 1UTBA 2P1SA 3A09A 4QFKA 1T0KA 3TTNA 5CC2A 4OENA 1MM7A 4L17A 4MBPA 1MRPA 4OZ9A 1OMPA 3THIA 1LAFE 3O6IA 4GXSB 5I2KB 4GL0A 1IXCA 4U23A 3FASA 1H44A 1EU8A 1LBCA 4F2QA 1LFHA 2H5YA 4N13A 4OXVA 5TPAA 3EHSA 3Q25A 1PEBA 3U92A 1N04A 3TQWA 4POWA 1R1NA 2XD2A 4JSOA 1B2HA 3IK6B 1RKMA 3TTRA 5H8HB 4FATA 2PYYA 3ZKLA 3SKPA 3F11A 2UVIA 2ZYOA 3WAEA 3USDA 2F36A 4PFYA 4EXKA 3O6GA 4YB5A 3BBRA 1A8EA 2E0SA 3S9MC 4YB6A 3IOVA 3M8UA 3PUZE 5H8FB 2F34A 3CFXA 3DP8A 2REJA 2HEUA 1YCJA 4KYDA 4DIGA 1AL3A 3IL1B 1VFEA
chains in the Genus database with same CATH superfamily
3CVGA 4LQ5A 1N3XA 4QF9A 4QRZA 1IXHA 3C9HA 1H3DA 1MQIA 5HBCA 1F9BA 4NN3A 2XXUA 4R6HA 3MBPA 3IX1A 1K9ZA 3KC0A 3ILTB 4NF4A 2Q2AA 1POY1 1ELJA 1M5BA 3RQTA 2HQ0A 2IA4A 3MPLA 3TTMA 3K02A 3TEPA 2RC8A 5AA2D 1TFAA 3W9VA 2XXVA 3TDJA 3O29A 3E13X 1NNTA 1GV8A 2HXWA 2A5SA 3FVNA 2F78A 3PPOA 4LZ5A 4THIA 2D21A 2ZNUA 1DSNA 4M1VA 1POTA 5I56A 4R9GA 1BIYA 4RA1A 4NX1A 4P8BA 1AH5A 3MW0A 3GLBA 1OVTA 1RDXA 2GQ1A 2HFBA 2Q89A 4GWWA 4R73A 1CNQA 3K6UA 3SESA 4U21A 2G29A 2I49A 3IJOB 1MDQA 4OMBA 4OFLA 1FPLA 1MQDA 3OSRA 3RPWA 1SI0A 3RLFE 5ET5A 2CZKA 2HAUA 1USYE 5CMMA 3U8QA 4ZE8A 1Y4TA 2DYXA 2X26A 3TFLA 5F1QA 4F18A 3ZS6A 3B50A 4C1TA 4OESA 4ELPA 2UYEA 1QGXA 4JXIA 4OANA 3OD7A 3VV5A 4G4PA 4IY6A 1B7ZA 3R26A 3IB0A 5AE4A 5BWJA 1QUJA 1LLSA 5AA3A 4X8RA 4MF3A 3T9UA 3JYRA 1MPCA 2HPGA 5T3JA 1NV6A 1JEVA 3O6HA 1MXWA 1SW5A 2Q8MA 2ONSA 2PX1A 5AA4A 1MY4A 3N26A 1J1NA 2P0SA 2Q8JA 1BK4A 1FQFA 1B46A 3U65A 1ZLQA 1R9QA 2QRYA 1SYHA 3EQ1A 4ZS9A 1GTKA 3MZ9A 2H98A 4N8GA 2UYFA 1AOVA 1R9LA 3K1PA 3V83A 1YYZA 3IFAA 2Q2CA 3PUXE 5J1DA 5A5LA 4G8HA 4KCCA 1H76A 4ELRA 1OLCA 4ZEBA 2XXRA 4DXCA 1FPJA 4O3BA 3KFMA 5B7DA 3VXBA 3T93B 2DWIA 4NF6A 1O63A 3E4RA 3JZJA 3T66A 2H9BA 3QMFA 3I5OA 1NNFA 2QFLA 1IIWA 4JVDA 1VE4A 3PD9A 3CSBA 3RTFB 4NMYA 4PDHA 5I59A 3FBPA 4HE0A 1MQJA 1MXVA 1LCTA 4ZZEA 4U4SA 5EHMA 2FBPA 3DP4A 1SVXB 3TAJA 2QMXA 4GRKA 4YZZA 1ZJLA 4IO5A 1M5CA 4R6KA 1NKXA 4GF8A 3D1RA 1Y20A 5LOMA 3VLVA 1A7LA 3ODBA 3EN3A 4NAPA 3QAXA 3TPAA 4OVJA 4DCYA 4MHFA 1B1HA 4XFEA 1VSOA 2I4CA 2JJKA 5DT6A 4ZEIA 4ESWA 1FTMA 1UTHA 5LTCA 4YKKA 3LSWA 2XWKA 1MXZA 3Q26A 2NUVA 4ND9A 2F5XA 3E9XA 3PMVA 4PFIA 3MZ1A 1MQHA 3IR1A 4IB2A 4OFOA 5HPQA 2QS2A 3RGYA 4GX4A 4OYVA 2DXYA 3ILUB 3SEYA 2KR0A 2I0BA 4GFRA 3IFCA 2B65A 3AXFA 3L6HA 1FBPA 4NWCA 1FBDA 3UORA 4QHQA 4N07A 3PV0E 3IOWA 2YLNA 2CZIA 5IZ3B 2VGQA 3RT6B 3QIMA 1WODA 1IXGA 5M2VA 4G68A 4OFJA 4X48A 3QYTA 3S9NC 3K00A 1VFDA 2I48A 1LAHE 2Y5KA 5ICTA 4JDFA 2P3NA 4EXLA 5F7VA 1NV1A 3HN0A 4KCDA 4LN5A 4ECFA 1A99A 2ZYKA 5ISUA 4N8YA 3IB2A 2I3VA 4LA9A 2FIEA 4OA4A 2XXHA 3BFUA 4DIGA 2Y7RA 5CMKA 2ZMBA 4YKJA 5KDTB 5KCJA 2QMWA 2Z8DA 4P56A 2O1LA 1H45A 3A29A 3KOTA 3MUQA 4ZE9A 1IMCA 1IZ1A 1MM6A 1DTGA 4MLQA 4YICA 1P1QA 1NMUA 1MG1A 2V25A 3H03A 4GWXA 2QJEA 1Z7ME 5AA1A 2PFYA 4OVSA 3I6VA 1B4HA 4N4UA 4PFWA 1YAEA 4BLAA 1B52A 5TPAB 1O7TA 4JSDA 1FPKA 3TODA 1FQEA 3OMBA 2F7AA 4O3AA 1R6ZA 2XD3A 5DVFA 3K4UA 1SPIA 4JWXA 4MX6A 2B4LA 2DVCA 3VDFA 4G61A 5DVJA 1YPNA 4KFQA 5K2YA 1A8FA 3B8BA 3K6XA 3H06B 4Q30B 4NF8B 1TFDA 4GXAA 1UIUA 4PGPA 4OHNA 5IGAA 4FJPA 4QFNA 1P1WA 2AL4A 1RYXA 1D4NA 1NV2A 1MXYA 4TLMB 3TKDA 2DXRA 1B0LA 4N6KA 4H8JA 3C36A 3CR9A 4O7MA 2QVRA 4K3FA 3S9LC 4MIJA 4NF5A 4HCYA 3OO8A 1LSTA 3C35A 2HXRA 4HS7A 1L5TA 5DVIA 1ZTYA 2WX9A 3O28A 3BKIB 5CI5A 4IO4A 3LBSA 4AB6A 3UA8A 3G3IA 5H8NA 3FGSA 1Q9DA 4KD5A 3TELA 2R71A 3KGCA 4PE3A 3H6VA 1NUXA 1D3KA 5FHOA 1GGGA 1VDWA 3Q27A 3TQLA 2Q74A 3OO6A 3EF7A 3TUSA 4MFIA 4QSDA 1A40A 1FPBA 4O94A 2OX3A 1SBPA 4ZEDA 4GVOA 4H46A 4ELQA 4OQOA 4FECA 4R2BA 5I2NB 1NI9A 3O2AA 3PPNA 1XT8A 4MNIA 2DP8A 2I3WA 4R75A 4JWYA 4JVIA 3C4MA 5DEXB 4PAIA 3K1MA 3CSGA 5DTBA 1FBEA 2NXOA 3O9PA 4MNCA 5KZTA 3OEMA 2QSXA 3RY3A 4UABA 1BP5A 4ESXA 2PFZA 3FUZA 5JK4A 4PFBA 4GBWA 4H1XA 3VLUA 3K01A 4XKQA 1M5EA 3A3UA 1M5DA 3C33A 2O6AA 4DE8A 3EHUA 3R7XA 4GWZA 4DDDA 5EYHA 1FRPA 2NOOA 3KN3A 3OSQA 4GWYA 4NTLA 3RYDA 5I58B 4LQ2A 4F1YA 3QUJA 2V3UA 3G3FA 5EQ8A 3E79A 2PCRA 4H8IA 4Z0IA 2O1MA 4YKPA 3W9WA 4YB7A 5A5XA 1DPEA 3U72A 3K1NA 5JTYA 1Y3PA 4F1UA 3EKIA 4AS4A 3FJGA 1USYH 4F39A 1SDXA 3H3GA 2FVZA 1NV4A 2Y7IA 2XHDA 4KPTA 1ANFA 2XXQA 4F1VA 4AS5A 2DSFA 5ITPA 4UACA 1XC1A 3OENA 3TCHA 4N6PA 4RY1A 3VE1B 4HCWA 4HE2A 1NH7A 1IEJA 3DM0A 4NF0A 3D4GA 4G8MA 2ONKE 3MZBA 4PFUA 1RDZA 3M3FA 4EQ7A 2RINA 1IMBA 1MY2A 4N17A 3SEUA 1I6AA 3JV9A 2XX9A 4DXUA 1KA0A 2V4CA 1MY0A 2DQVA 3FV1A 2NVUB 2ESNA 3OO7A 3RUMA 1D9VA 1Y9UA 5BUUA 1GVCA 1MXUA 4MMPA 2W7YA 4O8MA 5I2KA 4ONYA 1SD3A 2X7PA 1LBXA 1JW4A 3CFLA 3VFJA 2H99A 2WEFA 1LB8A 2D5WA 1NV5A 1LGBC 3FXQA 3VVDA 4OEVA 2DDKA 2H4IA 2FNCA 1B3GA 3VLWA 4OTEA 4Z7EA 2AL5A 3UP9A 4XKNA 4N91A 5I57A 5L9SA 1UTHB 2FA7A 2RC9A 3C34A 1FPIA 2GH9A 4GIZA 2LAOA 1JVYA 2Z8EA 4ZZAA 5H8HA 5ESYA 3FVOA 2AIXA 4QFOA 1MPBA 1DTZA 3FJMA 4NQ8A 1NH8A 4X9TA 5H8SA 2F8DA 3D4CA 4QSEA 1RDYA 1JNFA 2OZZA 1DMBA 2I6EA 4OVTA 4G77A 3OXNA 3K0VA 5H8FA 2VPNA 2V3QA 3DLNA 3G3HA 5K2XA 2Y84A 3MQ9A 2XXPA 3GBAA 5FTHA 5TP9B 1B5IA 3FJ7A 5FHMA 1MH3A 1ZU0A 3Q28A 1Q1KA 1LEVA 4IO2A 4TOZA 4FORA 3KSJA 1B9JA 2QS3A 2ZYMA 3B6QA 4NHBA 1XOCA 2HAVA 1NL5A 3HCQA 4EF2A 3LR1A 1KA1A 3SZPA 2GHBA 4MNPA 3LSFB 2UVJA 1FQAA 3IB1A 1PDAA 1SW1A 4BDNA 3S9EA 1NUWA 4PFRA 5CRYA 3FV2A 3PUVE 2B3FA 4XKPA 1B40A 5ICQA 1B5JA 2GHAA 4YAHX 1JP4A 2O69A 4QXDA 4WXJA 2O7IA 5H8QB 3IO4A 2ZNSA 1IMEA 1ATGA 1OIBA 3K2DA 1IUDA 2ABHA 4I9DA 4LUBA 1WDNA 4X1BA 2WBDA 1KWHA 5CMBA 1INPA 3RPLB 1Q35A 3CI8A 1DBZA 2Z22A 2Z23A 1N0TA 5I84A 3MPKA 4NG7A 1PB8A 4KYEA 4XTCQ 1P1UA 4FBPA 4WKMA 4JWOA 3PTYA 3OO9A 4H5GA 4XIGQ 4YMBA 4FE8A 4UA8A 1QVSA 3FD3A 3N6TA 4X04A 4PAKA 3GXAA 4F3PA 2F35A 4RK2A 5CMCA 1AIVA 4GQOA 1URDA 3FXRA 2OCUA 3LSXA 2PT1A 4GLIA 4LVQA 3B7DA 5EHSA 3KN7A 5IZ1A 4YKIA 4OWDA 2FYIA 5AA2B 1EYIA 3T96B 3BIGA 1B3HA 2VHAA 3HHGA 1XS5A 4GOTA 4EQBA 3EPEA 1KZ8A 5H8NB 2GFEA 2DE4A 4F2OA 3N94A 2VD2A 3PPQA 2XXTA 3CFZA 1DOTA 4OVPA 1FCKA 1UTBB 4PFTA 2ALUA 2I58A 3HO7A 4HTGA 2DOJA 2B4MA 4GWUA 5TU0A 2F97A 2A5TA 4EQ9A 2OBGA 1B6HA 5ELVA 3IOUA 1JW1A 3PMWA 4OETA 3H6UA 1FPFA 3HPIA 5F24A 4FEDA 1NFTA 2V84A 1ZIUA 4ZEFA 1DK4A 4YMAA 1B3EA 4KYSA 1FQCA 3MP8A 3OEKA 1B3LA 4BDLA 1QKAA 1B5HA 2CZLA 2RCAA 4GD5A 1FBCA 2UXAA 5LDZA 3T0JA 1II5A 3I3VA 3KJTA 3HSTA 5EQ7A 4QBAA 2DS9A 4OVQA 4BDRA 1ZKBA 1XHYA 2PMSA 1TWYA 4OVRA 1EZ9A 3HHFA 3V8XB 1SYIA 2XXWA 4P3LA 3H6TA 4EDPA 2X7QA 2QS4A 4HE1A 3B6WA 1IQ7A 4QSCA 5ITOA 2DE2A 3SERA 2Y7KA 3KBRA 4DCXA 4LONB 4XEQA 2RKMA 3EHTA 1EZOA 1FTLA 1HSLA 4PETA 1Z7NE 5L9OA 1CE2A 4NE4A 3ZKKA 1N7WA 3K6VA 2I4BA 1LBWA 3LV0A 5FBPA 3QSLA 3IO6A 4IR8A 3S2VA 1P99A 2ANJA 1FPEA 4QFPA 3U93A 5A5XB 4FEBA 3BFTA 3LSLA 1G0IA 1B51A 4E0XA 1Y1MA 1N76A 1US5A 2PT2A 5DYHA 5FTIA 1GR2A 1BLFA 3QK6A 4Q5TA 1BKAA 2ZZVA 4RJZA 3T9HB 1B58A 3ONMA 4PGNA 2O84X 1OQHA 4NF4B 3TMGA 2XX8A 1QUIA 4Q8RA 1LAXA 2F3BA 1SQYA 4I1DA 5IZ3A 2UVGA 2E1SA 3UGWA 2FIXA 3E3KA 1FQDA 4G68C 4MLVA 2WYPA 2V93A 4X1DA 5I56B 5KDTA 3PUYE 5I3SA 3HV1A 2OLBA 2O68A 4PF6A 1S50A 5EYGA 3T9XB 2DWJA 4RK9A 4BDOA 4JB7A 2L5VA 3RT8A 2DE3A 1HSJA 2ONRA 2RCBA 3C32A 2QVVA 2R6GE 1LBBA 3IOTA 4FIMA 3H7MA 5IAIA 4GX3A 2OWSA 5CBRA 1NV3A 1LCFA 2ZNTA 4GL8A 4YU0A 1NUYA 1MXXA 2QL3A 4MJOA 3UN6A 4TLLB 3MP1A 4IO7A 5I57B 2ZXTA 1WVJA 3CG3A 5L9MA 1S9TA 1B05A 2HHMA 4R9FA 1D9QA 4OERA 3GBBA 4H67A 1XVXA 4G8NA 3ZSFA 2QVUA 1B4ZA 4F29A 4HXVA 2R9JA 4PTKA 4KQPA 4KXPA 1LBYA 4NF8A 4O3CA 1K9YA 4PDDA 1VR5A 2VD3A 4AB5A 1OQGA 4NGUA 5AA4B 2P2AA 4P0IA 2M8CA 2AYSA 4RXLA 4U1OA 4GBVA 4ZEKA 1JEUA 3SEXA 1OLAA 3MWBA 3CIJA 4RPOA 2O7UA 2DVZA 5L8DA 3N5LA 1US4A 1D9YA 2WKYA 2WBBA 4BDMA 3GYYA 4IGTA 2XWVA 2THIA 3OOAA 3LUYA 3G3JA 2PBWA 4N81A 3VVEA 2Q9TA 2QPQA 1LAGE 4LP2B 4H5FA 1B32A 4WEDA 2OK2A 4ISUA 2D3IA 2WYKA 4NF6B 3UK4A 4R74A 3N6UA 3V5AA 2VP1A 1QUKA 1EH3A 4ZDMA 4GWOA 3GZGA 3MYUA 3ECRA 3NOHA 1XVYA 3SEWA 3RTWB 3T9VA 3PUWE 5I59B 3G3GA 5CBSA 1MH4A 2F3DA 5I2NA 4GX6A 1O64A 5J16A 3LC8A 3C31A 3S4UA 1TXFA 5DEXA 1B1XA 1IMFA 1N7XA 3B6TA 2FHYA 1SW2A 1OVBA 4U1ZA 2O51A 3KEIA 2I0CA 4XKRA 4LZ7A 5B70A 2F6PA 4TQUQ 3VXCA 2BJIA 2CEYA 3FVGA 4IO3A 5CM6A 3PGFA 1B0HA 3QXMA 2XXYA 3PU5A 1RYOA 4NWDA 3MVYA 3PPRA 1FBHA 1MPDA 4DI4B 1IITA 4P9KA 4C0RA 1PC3A 1PB9A 1B7UA 5ET6A 3DP6A 1JVXA 1M5FA 5I58A 3MSTA 1NNKA 1EZPA 3DELB 4MH5A 3M3LA 2CMOA 4F31B 3FXUA 3MVWA 1JETA 4G68B 3IAZA 2XXXA 4U4XA 4PCDA 3CRBA 4JBZA 1JW5A 4ELOA 1B3FA 1FQBA 1YXIA 1AWBA 3CG1A 3HFUA 5KCJB 1Y1ZA 1FBGA 1FTOA 2F6GA 2A5TB 1HSEA 5EYFA 4DZ1A 4EF1A 3PMXA 3KZGA 3TTKA 4F3SA 4MCOA 2Y5LA 2KLFA 1MDP1 3KOSA 4I62A 3TZAA 3MJNA 2F7BA 4H0WA 2PVUA 4KHZE 4H45A 4P47A 1Y4CA 3R6UA 4U2RA 4DI3D 4KR5A 3VVFA 4RYAA 2OWTA 4AQ4A 3WAFA 3M3KA 2ZZXA 5IKBA 1AMFA 4R72A 2NWJA 3G3KA 4Q0CA 4PBQA 3KBZA 3TYHA 3QUFA 2XXIA 2REGA 1FJ9A 3O66A 1NV0A 5ET7A 1SI1A 4F3BA 5I5PA 1S7YA 3FZVA 2P3VA 3A3CA 3SETA 1N3WA 2Y7WA 4R6YA 4R2FA 4F22A 3IJXB 2YJPA 1I6BA 1FTAA 3G7WA 1N84A 4RNSA 2DWHA 3KN8A 5FHNA 2UVHA 2VOZA 1PB7A 4XF5A 4NEDA 4PF8A 2VPOA 1QW0A 2YPNA 2DWAA 1LFGA 4KI0E 1EYKA 4IO6A 1IXIA 4NF5B 4QFLA 4I3EA 4LZ8A 1YTVA 3MC2A 3Q29A 4BDQA 3RNNA 4IY5A 3KSXA 4P1LA 1QKBA 1A55A 3SEVA 4P11A 4ZECA 1UQWA 1ZMGA 1EYJA 3T1BA 5ET8A 2B3BA 3OELA 1NV7A 1BTJA 4P1EA 2IEEA 4E0WA 4F3GA 3MP6A 1URGA 4EUOA 2G93A 3FATA 4F19A 2Y7PA 4C1UA 1PBQA 2HZKA 4JVCA 4GWSA 1NNPA 3PD8A 1FSAA 5IZZA 2ZYNA 5TP9A 3H6WA 1QJMA 4IGRA 3K6WA 1LFIA 4PE5B 2OJTA 1MY1A 4G2ZA 1I6QA 3MVZA 4WEPA 2RC7A 1NUZA 2RF1A 4N6DA 5EQ9A 3PPPA 1LBZA 3FVKA 3P7IA 2V3TA 3MVXA 1SW4A 1MQGA 1MY3A 4DLDA 1URSA 1LB9A 4PP0A 2QS1A 3U94A 1P1NA 4XXUA 3TCFA 4H65A 1I69A 5H8QA 4HW8A 1A54A 3W15C 1P1OA 1DCUA 3UIFA 2Q88A 3KJ7A 3MAMA 3CHGA 5IM2A 4I8CA 1YZ0A 5DW8A 2Z8FA 3RPLA 1B7HA 1FW0A 4U22A 4RPNA 1FTKA 3BIHA 2BJJX 4FAJA 3IORA 2CEXA 1TT1A 5HM4B 1PBPA 2F7CA 2XX7A 1CB6A 3V89B 4POXA 1UIVA 3KG2A 3T22A 2H25A 2VT5A 5JTYB 1FPDA 4O7IA 3TTLA 4H6DA 4P0GA 5JEIA 1FTJA 3TCGA 3U1OA 5AA2A 2ZZWA 1Y3QA 3RN8A 3L6GA 1H43A 3ISPA 3O97A 1IMDA 2HZLA 3FIRA 1MS7A 1QULA 2MKZA 4OEUA 4LATA 2CZHA 1DPPA 2GRVA 1JQFA 3SDFA 4PQJA 2OWZA 3H4ZA 2HCAA 2R8TA 1Y3NA 1ZBMA 4DXBA 4I3YA 1LBVA 1UTBA 3LUZA 2P1SA 3A09A 4QFKA 2KQZA 1T0KA 3TTNA 3KC1A 5CC2A 3FXBA 4OENA 1MM7A 4L17A 4MBPA 5EQAA 1MRPA 4OZ9A 1OMPA 3ROJA 3THIA 4MEVA 1LAFE 5I7IA 3O6IA 4GXSB 5I2KB 4GL0A 1IXCA 2XWOA 4U23A 3FASA 3E78A 1IMAA 1H44A 1EU8A 1LBCA 4F2QA 1LFHA 2H5YA 4N13A 4OXVA 5TPAA 3EHSA 3Q25A 2XA5A 1PEBA 3U92A 1N04A 3TQWA 4I40A 4POWA 1R1NA 2XD2A 4JSOA 1B2HA 1FJ6A 3IK6B 1RKMA 1FBFA 3TTRA 5H8HB 4FATA 2PYYA 3ZKLA 3SKPA 3F11A 2UVIA 2ZYOA 2XXKA 3WAEA 3USDA 2F36A 1G0HA 4PFYA 4EXKA 3O6GA 4YB5A 3BBRA 1A8EA 2E0SA 3S9MC 4N15A 4YB6A 2XWIA 4PBHA 3IOVA 3M8UA 3PUZE 5H8FB 1XI6A 4PAFA 1FPGA 2F34A 4MAGA 3CFXA 3DP8A 2REJA 4PC9A 2HEUA 1YCJA 4KYDA 4M4GA 1AL3A 3IL1B 1VFEA
chains in the Genus database with same CATH topology
3CVGA 4LQ5A 1N3XA 4QF9A 4QRZA 1IXHA 3C9HA 1H3DA 1MQIA 5HBCA 1F9BA 2XXUA 4R6HA 3MBPA 3IX1A 3ILTB 4NF4A 2Q2AA 1POY1 1ELJA 1M5BA 3RQTA 2HQ0A 2IA4A 3MPLA 3TTMA 3K02A 3TEPA 2RC8A 5AA2D 1TFAA 3W9VA 2XXVA 3TDJA 3O29A 3E13X 1NNTA 1GV8A 2HXWA 2A5SA 3FVNA 2F78A 3PPOA 4LZ5A 4THIA 2D21A 2ZNUA 1DSNA 4M1VA 1POTA 5I56A 4R9GA 1BIYA 4RA1A 1AH5A 3MW0A 3GLBA 1OVTA 2HFBA 2Q89A 4R73A 3K6UA 3SESA 4U21A 2G29A 2I49A 3IJOB 1MDQA 4OMBA 4OFLA 1MQDA 3OSRA 3RPWA 1SI0A 3RLFE 2HAUA 1USYE 5CMMA 3U8QA 4ZE8A 1Y4TA 2DYXA 2X26A 3TFLA 5F1QA 4F18A 3ZS6A 4C1TA 4OESA 4ELPA 2UYEA 4JXIA 3OD7A 3VV5A 4G4PA 4IY6A 1B7ZA 3R26A 3IB0A 5AE4A 5BWJA 1QUJA 1LLSA 5AA3A 4MF3A 3T9UA 3JYRA 1MPCA 1JEVA 3O6HA 1MXWA 1SW5A 2ONSA 2PX1A 5AA4A 1MY4A 3N26A 1J1NA 2P0SA 2Q8JA 1FQFA 1B46A 1ZLQA 1R9QA 2QRYA 1SYHA 3EQ1A 4ZS9A 1GTKA 3MZ9A 2H98A 2UYFA 1AOVA 1R9LA 3K1PA 3V83A 2Q2CA 3PUXE 5J1DA 4G8HA 4KCCA 1H76A 4ELRA 1OLCA 4ZEBA 2XXRA 4DXCA 4O3BA 3KFMA 5B7DA 3VXBA 3T93B 2DWIA 4NF6A 1O63A 3E4RA 3JZJA 3T66A 2H9BA 3I5OA 1NNFA 1IIWA 1VE4A 3PD9A 3CSBA 3RTFB 4NMYA 5I59A 1MQJA 1MXVA 1LCTA 4ZZEA 4U4SA 5EHMA 3DP4A 1SVXB 3TAJA 2QMXA 4GRKA 4YZZA 1ZJLA 4IO5A 1M5CA 4R6KA 1NKXA 4GF8A 1Y20A 5LOMA 3VLVA 1A7LA 3ODBA 3EN3A 3QAXA 3TPAA 4OVJA 4DCYA 1B1HA 1VSOA 2I4CA 5DT6A 4ZEIA 4ESWA 1FTMA 1UTHA 4YKKA 3LSWA 1MXZA 3Q26A 2NUVA 4ND9A 2F5XA 3E9XA 3PMVA 3MZ1A 1MQHA 3IR1A 4IB2A 4OFOA 5HPQA 2QS2A 3RGYA 4OYVA 2DXYA 3ILUB 3SEYA 2I0BA 4GFRA 2B65A 3AXFA 3L6HA 4NWCA 3UORA 4QHQA 4N07A 3PV0E 3IOWA 2YLNA 2VGQA 3RT6B 3QIMA 1WODA 1IXGA 5M2VA 4G68A 4OFJA 4X48A 3QYTA 3S9NC 3K00A 1VFDA 2I48A 1LAHE 5ICTA 4JDFA 4EXLA 5F7VA 3HN0A 4KCDA 4ECFA 1A99A 2ZYKA 5ISUA 3IB2A 2I3VA 4LA9A 2XXHA 3BFUA 2Y7RA 5CMKA 2ZMBA 4YKJA 5KDTB 5KCJA 2QMWA 2Z8DA 2O1LA 1H45A 3KOTA 3MUQA 4ZE9A 1IZ1A 1MM6A 1DTGA 4MLQA 4YICA 1P1QA 1NMUA 1MG1A 2V25A 3H03A 2QJEA 1Z7ME 5AA1A 3I6VA 1B4HA 4PFWA 1YAEA 4BLAA 1B52A 5TPAB 1O7TA 4JSDA 3TODA 1FQEA 3OMBA 2F7AA 4O3AA 1R6ZA 4M4GA 2XD3A 5DVFA 3K4UA 4JWXA 2DVCA 3VDFA 5DVJA 1YPNA 4KFQA 5K2YA 1A8FA 3K6XA 3H06B 4Q30B 4NF8B 1TFDA 4GXAA 1UIUA 4OHNA 4FJPA 1P1WA 4QFNA 2AL4A 1RYXA 1D4NA 1MXYA 4TLMB 3TKDA 2DXRA 1B0LA 4H8JA 3C36A 3CR9A 4K3FA 3S9LC 4NF5A 4HCYA 3OO8A 1LSTA 3C35A 1L5TA 4HS7A 5DVIA 1ZTYA 3O28A 3BKIB 5CI5A 4IO4A 3LBSA 4AB6A 3UA8A 3G3IA 5H8NA 3FGSA 4KD5A 3TELA 2R71A 3KGCA 3H6VA 1D3KA 5FHOA 1GGGA 3Q27A 3TQLA 3OO6A 3EF7A 3TUSA 4MFIA 4QSDA 1A40A 1SBPA 4ZEDA 4GVOA 4ELQA 4OQOA 4FECA 4R2BA 5I2NB 3O2AA 3PPNA 1XT8A 2DP8A 2I3WA 4R75A 4JWYA 3C4MA 5DEXB 3K1MA 3CSGA 5DTBA 2NXOA 3O9PA 5KZTA 3OEMA 2QSXA 3RY3A 1BP5A 4ESXA 3FUZA 5JK4A 4H1XA 3VLUA 3K01A 4XKQA 1M5EA 3A3UA 1M5DA 3C33A 2O6AA 4DE8A 3EHUA 3R7XA 4DDDA 2NOOA 3KN3A 3OSQA 4NTLA 5I58B 4LQ2A 4F1YA 3QUJA 2V3UA 3G3FA 4H8IA 4Z0IA 2O1MA 4YKPA 3W9WA 4YB7A 5A5XA 1DPEA 3U72A 3K1NA 5JTYA 1Y3PA 4F1UA 3FJGA 1USYH 4F39A 1SDXA 3H3GA 2Y7IA 2XHDA 4KPTA 1ANFA 2XXQA 4F1VA 2DSFA 5ITPA 4UACA 1XC1A 3OENA 3TCHA 4N6PA 4RY1A 3VE1B 4HCWA 1NH7A 1IEJA 3DM0A 3D4GA 4G8MA 2ONKE 3MZBA 4PFUA 3M3FA 4EQ7A 2RINA 1MY2A 3SEUA 1I6AA 3JV9A 2XX9A 4DXUA 1MY0A 2DQVA 3FV1A 2NVUB 2ESNA 3OO7A 3RUMA 1D9VA 1Y9UA 5BUUA 1GVCA 1MXUA 2W7YA 5I2KA 4ONYA 1SD3A 2X7PA 1JW4A 3CFLA 3VFJA 2H99A 1LB8A 2D5WA 1LGBC 3FXQA 3VVDA 4OEVA 2H4IA 2FNCA 1B3GA 3VLWA 4OTEA 4Z7EA 2AL5A 3UP9A 4XKNA 5I57A 5L9SA 1UTHB 2FA7A 2RC9A 3C34A 2GH9A 4GIZA 2LAOA 1JVYA 2Z8EA 4ZZAA 5H8HA 3FVOA 2AIXA 4QFOA 1MPBA 1DTZA 3FJMA 1NH8A 4X9TA 5H8SA 2F8DA 3D4CA 4QSEA 1JNFA 2OZZA 1DMBA 2I6EA 4G77A 3OXNA 3K0VA 5H8FA 2V3QA 3DLNA 3G3HA 5K2XA 2Y84A 3MQ9A 2XXPA 3GBAA 5FTHA 5TP9B 1B5IA 3FJ7A 5FHMA 1MH3A 1ZU0A 3Q28A 1Q1KA 4IO2A 4TOZA 4FORA 3KSJA 1B9JA 2QS3A 2ZYMA 3B6QA 1XOCA 2HAVA 1NL5A 3HCQA 4EF2A 3LR1A 2GHBA 3LSFB 2UVJA 1FQAA 3IB1A 1PDAA 1SW1A 4BDNA 3S9EA 5CRYA 3FV2A 3PUVE 2B3FA 4XKPA 1B40A 5ICQA 1B5JA 2GHAA 4YAHX 2O69A 4WXJA 2O7IA 5H8QB 3IO4A 2ZNSA 1ATGA 1OIBA 3K2DA 1IUDA 2ABHA 4I9DA 4LUBA 1WDNA 4X1BA 1KWHA 5CMBA 1Q35A 3CI8A 2Z22A 2Z23A 1N0TA 5I84A 3MPKA 1PB8A 4KYEA 4XTCQ 1P1UA 4WKMA 4JWOA 3OO9A 4H5GA 4XIGQ 4YMBA 4FE8A 4UA8A 1QVSA 3FD3A 3N6TA 4F3PA 3GXAA 2F35A 4RK2A 5CMCA 1AIVA 4GQOA 1URDA 3FXRA 2OCUA 3LSXA 2PT1A 4GLIA 4LVQA 3B7DA 5EHSA 3KN7A 4YKIA 4OWDA 2FYIA 5AA2B 3T96B 1B3HA 2VHAA 3HHGA 1XS5A 4GOTA 4EQBA 3EPEA 5H8NB 2GFEA 2DE4A 4F2OA 3N94A 2VD2A 3PPQA 2XXTA 3CFZA 1DOTA 1FCKA 1UTBB 4PFTA 2ALUA 2I58A 3HO7A 4HTGA 2DOJA 5TU0A 2F97A 2A5TA 4EQ9A 2OBGA 1B6HA 5ELVA 3IOUA 1JW1A 3PMWA 4OETA 3H6UA 3HPIA 4FEDA 1NFTA 2V84A 1ZIUA 4ZEFA 4YMAA 1B3EA 4KYSA 1FQCA 3MP8A 3OEKA 1B3LA 4BDLA 1QKAA 1B5HA 2CZLA 2RCAA 4GD5A 2UXAA 1II5A 3I3VA 3KJTA 3HSTA 2DS9A 4BDRA 1ZKBA 1XHYA 2PMSA 1TWYA 1EZ9A 3HHFA 3V8XB 1SYIA 2XXWA 3H6TA 4EDPA 2X7QA 2QS4A 3B6WA 1IQ7A 4QSCA 5ITOA 2DE2A 3SERA 2Y7KA 3KBRA 4DCXA 4LONB 2RKMA 3EHTA 1EZOA 1FTLA 1HSLA 4PETA 1Z7NE 5L9OA 1CE2A 4NE4A 3ZKKA 1N7WA 3K6VA 2I4BA 3QSLA 3IO6A 3S2VA 1P99A 2ANJA 4QFPA 3U93A 5A5XB 4FEBA 3BFTA 3LSLA 1B51A 4E0XA 1Y1MA 1N76A 1US5A 2PT2A 5DYHA 5FTIA 1GR2A 1BLFA 3QK6A 4Q5TA 1BKAA 4RJZA 3T9HB 1B58A 3ONMA 2O84X 1OQHA 4NF4B 3TMGA 2XX8A 1QUIA 4Q8RA 1LAXA 1SQYA 4I1DA 2UVGA 2E1SA 3UGWA 3E3KA 1FQDA 4G68C 4MLVA 2V93A 4X1DA 5I56B 5KDTA 3PUYE 3HV1A 2OLBA 2O68A 1S50A 3T9XB 2DWJA 4RK9A 4BDOA 4JB7A 3RT8A 2DE3A 1HSJA 2ONRA 2RCBA 3C32A 2R6GE 1LBBA 3IOTA 4FIMA 3H7MA 5IAIA 2OWSA 5CBRA 1LCFA 2ZNTA 4GL8A 4YU0A 1MXXA 2QL3A 3UN6A 4TLLB 3MP1A 4IO7A 5I57B 2ZXTA 1WVJA 3CG3A 5L9MA 1S9TA 1B05A 4R9FA 4OERA 3GBBA 4H67A 1XVXA 4G8NA 3ZSFA 1B4ZA 4F29A 2R9JA 4KQPA 4NF8A 4O3CA 1VR5A 2VD3A 4AB5A 1OQGA 5AA4B 2P2AA 4P0IA 2M8CA 2AYSA 4RXLA 4U1OA 4ZEKA 1JEUA 3SEXA 1OLAA 3MWBA 3CIJA 4RPOA 2O7UA 2DVZA 5L8DA 3N5LA 1US4A 1D9YA 2WKYA 4BDMA 4IGTA 2THIA 3OOAA 3LUYA 3G3JA 2PBWA 3VVEA 2Q9TA 2QPQA 1LAGE 4LP2B 4H5FA 1B32A 4WEDA 2OK2A 4ISUA 2D3IA 4NF6B 3UK4A 4R74A 3N6UA 3V5AA 2VP1A 1QUKA 1EH3A 4ZDMA 4GWOA 3GZGA 3ECRA 3SEWA 1XVYA 3RTWB 3T9VA 3PUWE 5I59B 3G3GA 5CBSA 1MH4A 5I2NA 1O64A 3LC8A 3C31A 3S4UA 1TXFA 5DEXA 1B1XA 1N7XA 3B6TA 1SW2A 1OVBA 4U1ZA 2O51A 3KEIA 2I0CA 4XKRA 4LZ7A 5B70A 2F6PA 4TQUQ 3VXCA 3FVGA 4IO3A 5CM6A 3PGFA 1B0HA 3QXMA 2XXYA 3PU5A 1RYOA 4NWDA 3MVYA 3PPRA 1MPDA 1IITA 4C0RA 1PC3A 1PB9A 1B7UA 3DP6A 1JVXA 1M5FA 5I58A 1NNKA 1EZPA 3DELB 4MH5A 3M3LA 2CMOA 4F31B 3FXUA 3MVWA 1JETA 4G68B 3IAZA 2XXXA 4U4XA 3CRBA 4JBZA 1JW5A 4ELOA 1B3FA 1FQBA 3CG1A 5KCJB 1Y1ZA 1FTOA 2F6GA 2A5TB 1HSEA 5EYFA 4DZ1A 4EF1A 3PMXA 3KZGA 3TTKA 4F3SA 2KLFA 1MDP1 3KOSA 4I62A 3TZAA 3MJNA 2F7BA 4H0WA 2PVUA 4KHZE 1Y4CA 3R6UA 4U2RA 4KR5A 3VVFA 4RYAA 2OWTA 4AQ4A 3WAFA 3M3KA 5IKBA 1AMFA 4R72A 2NWJA 3G3KA 4Q0CA 3TYHA 3QUFA 2XXIA 2REGA 3O66A 1SI1A 4F3BA 1S7YA 3FZVA 3A3CA 3SETA 1N3WA 2Y7WA 4R6YA 4R2FA 4F22A 3IJXB 2YJPA 1I6BA 3G7WA 1N84A 4RNSA 2DWHA 3KN8A 5FHNA 2UVHA 2VOZA 1PB7A 4NEDA 1QW0A 2YPNA 2DWAA 1LFGA 4KI0E 4IO6A 1IXIA 4NF5B 4QFLA 4LZ8A 1YTVA 3MC2A 3Q29A 4BDQA 3RNNA 4IY5A 3KSXA 1QKBA 1A55A 3SEVA 4P11A 4ZECA 1UQWA 1ZMGA 2B3BA 3OELA 1BTJA 2IEEA 4E0WA 4F3GA 3MP6A 1URGA 4EUOA 2G93A 3FATA 4F19A 2Y7PA 4C1UA 1PBQA 2HZKA 1NNPA 3PD8A 2ZYNA 5TP9A 3H6WA 1QJMA 4IGRA 3K6WA 1LFIA 4PE5B 2OJTA 1MY1A 4G2ZA 1I6QA 3MVZA 4WEPA 2RC7A 2RF1A 3PPPA 3FVKA 3P7IA 2V3TA 3MVXA 1SW4A 1MQGA 1MY3A 4DLDA 1URSA 1LB9A 4PP0A 2QS1A 3U94A 1P1NA 4XXUA 3TCFA 4H65A 1I69A 5H8QA 4HW8A 1A54A 3W15C 1P1OA 3UIFA 2Q88A 3KJ7A 3MAMA 4I8CA 2Z8FA 1B7HA 1FW0A 4U22A 4RPNA 1FTKA 2BJJX 4FAJA 3IORA 1TT1A 5HM4B 1PBPA 2F7CA 2XX7A 1CB6A 3V89B 4POXA 1UIVA 3KG2A 3T22A 2H25A 5JTYB 3TTLA 4H6DA 4P0GA 5JEIA 1FTJA 3TCGA 3U1OA 5AA2A 1Y3QA 3RN8A 3L6GA 1H43A 3O97A 2HZLA 3FIRA 1MS7A 1QULA 4OEUA 4LATA 1DPPA 2GRVA 1JQFA 3SDFA 4PQJA 3H4ZA 2HCAA 1Y3NA 1ZBMA 4DXBA 1UTBA 2P1SA 3A09A 4QFKA 1T0KA 3TTNA 5CC2A 4OENA 1MM7A 4L17A 4MBPA 1MRPA 4OZ9A 1OMPA 3THIA 1LAFE 3O6IA 4GXSB 5I2KB 4GL0A 1IXCA 4U23A 3FASA 1H44A 1EU8A 1LBCA 4F2QA 1LFHA 2H5YA 4N13A 4OXVA 5TPAA 3EHSA 3Q25A 1PEBA 3U92A 1N04A 3TQWA 4POWA 1R1NA 2XD2A 4JSOA 1B2HA 3IK6B 1RKMA 3TTRA 5H8HB 4FATA 2PYYA 3ZKLA 3SKPA 3F11A 2UVIA 2ZYOA 3WAEA 3USDA 2F36A 4PFYA 4EXKA 3O6GA 4YB5A 3BBRA 1A8EA 2E0SA 3S9MC 4YB6A 3IOVA 3M8UA 3PUZE 5H8FB 2F34A 3CFXA 3DP8A 2REJA 2HEUA 1YCJA 4KYDA 4DIGA 1AL3A 3IL1B 1VFEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CVG A;  4LQ5 A;  1N3X A;  4QF9 A;  4QRZ A;  1IXH A;  3C9H A;  1H3D A;  1MQI A;  5HBC A;  1F9B A;  2XXU A;  4R6H A;  3MBP A;  3IX1 A;  3ILT B;  4NF4 A;  2Q2A A;  1POY 1;  1ELJ A;  1M5B A;  3RQT A;  2HQ0 A;  2IA4 A;  3MPL A;  3TTM A;  3K02 A;  3TEP A;  2RC8 A;  5AA2 D;  1TFA A;  3W9V A;  2XXV A;  3TDJ A;  3O29 A;  3E13 X;  1NNT A;  1GV8 A;  2HXW A;  2A5S A;  3FVN A;  2F78 A;  3PPO A;  4LZ5 A;  4THI A;  2D21 A;  2ZNU A;  1DSN A;  4M1V A;  1POT A;  5I56 A;  4R9G A;  1BIY A;  4RA1 A;  1AH5 A;  3MW0 A;  3GLB A;  1OVT A;  2HFB A;  2Q89 A;  4R73 A;  3K6U A;  3SES A;  4U21 A;  2G29 A;  2I49 A;  3IJO B;  1MDQ A;  4OMB A;  4OFL A;  1MQD A;  3OSR A;  3RPW A;  1SI0 A;  3RLF E;  2HAU A;  1USY E;  5CMM A;  3U8Q A;  4ZE8 A;  1Y4T A;  2DYX A;  2X26 A;  3TFL A;  5F1Q A;  4F18 A;  3ZS6 A;  4C1T A;  4OES A;  4ELP A;  2UYE A;  4JXI A;  3OD7 A;  3VV5 A;  4G4P A;  4IY6 A;  1B7Z A;  3R26 A;  3IB0 A;  5AE4 A;  5BWJ A;  1QUJ A;  1LLS A;  5AA3 A;  4MF3 A;  3T9U A;  3JYR A;  1MPC A;  1JEV A;  3O6H A;  1MXW A;  1SW5 A;  2ONS A;  2PX1 A;  5AA4 A;  1MY4 A;  3N26 A;  1J1N A;  2P0S A;  2Q8J A;  1FQF A;  1B46 A;  1ZLQ A;  1R9Q A;  2QRY A;  1SYH A;  3EQ1 A;  4ZS9 A;  1GTK A;  3MZ9 A;  2H98 A;  2UYF A;  1AOV A;  1R9L A;  3K1P A;  3V83 A;  2Q2C A;  3PUX E;  5J1D A;  4G8H A;  4KCC A;  1H76 A;  4ELR A;  1OLC A;  4ZEB A;  2XXR A;  4DXC A;  4O3B A;  3KFM A;  5B7D A;  3VXB A;  3T93 B;  2DWI A;  4NF6 A;  1O63 A;  3E4R A;  3JZJ A;  3T66 A;  2H9B A;  3I5O A;  1NNF A;  1IIW A;  1VE4 A;  3PD9 A;  3CSB A;  3RTF B;  4NMY A;  5I59 A;  1MQJ A;  1MXV A;  1LCT A;  4ZZE A;  4U4S A;  5EHM A;  3DP4 A;  1SVX B;  3TAJ A;  2QMX A;  4GRK A;  4YZZ A;  1ZJL A;  4IO5 A;  1M5C A;  4R6K A;  1NKX A;  4GF8 A;  1Y20 A;  5LOM A;  3VLV A;  1A7L A;  3ODB A;  3EN3 A;  3QAX A;  3TPA A;  4OVJ A;  4DCY A;  1B1H A;  1VSO A;  2I4C A;  5DT6 A;  4ZEI A;  4ESW A;  1FTM A;  1UTH A;  4YKK A;  3LSW A;  1MXZ A;  3Q26 A;  2NUV A;  4ND9 A;  2F5X A;  3E9X A;  3PMV A;  3MZ1 A;  1MQH A;  3IR1 A;  4IB2 A;  4OFO A;  5HPQ A;  2QS2 A;  3RGY A;  4OYV A;  2DXY A;  3ILU B;  3SEY A;  2I0B A;  4GFR A;  2B65 A;  3AXF A;  3L6H A;  4NWC A;  3UOR A;  4QHQ A;  4N07 A;  3PV0 E;  3IOW A;  2YLN A;  2VGQ A;  3RT6 B;  3QIM A;  1WOD A;  1IXG A;  5M2V A;  4G68 A;  4OFJ A;  4X48 A;  3QYT A;  3S9N C;  3K00 A;  1VFD A;  2I48 A;  1LAH E;  5ICT A;  4JDF A;  4EXL A;  5F7V A;  3HN0 A;  4KCD A;  4ECF A;  1A99 A;  2ZYK A;  5ISU A;  3IB2 A;  2I3V A;  4LA9 A;  2XXH A;  3BFU A;  2Y7R A;  5CMK A;  2ZMB A;  4YKJ A;  5KDT B;  5KCJ A;  2QMW A;  2Z8D A;  2O1L A;  1H45 A;  3KOT A;  3MUQ A;  4ZE9 A;  1IZ1 A;  1MM6 A;  1DTG A;  4MLQ A;  4YIC A;  1P1Q A;  1NMU A;  1MG1 A;  2V25 A;  3H03 A;  2QJE A;  1Z7M E;  5AA1 A;  3I6V A;  1B4H A;  4PFW A;  1YAE A;  4BLA A;  1B52 A;  5TPA B;  1O7T A;  4JSD A;  3TOD A;  1FQE A;  3OMB A;  2F7A A;  4O3A A;  1R6Z A;  4M4G A;  2XD3 A;  5DVF A;  3K4U A;  4JWX A;  2DVC A;  3VDF A;  5DVJ A;  1YPN A;  4KFQ A;  5K2Y A;  1A8F A;  3K6X A;  3H06 B;  4Q30 B;  4NF8 B;  1TFD A;  4GXA A;  1UIU A;  4OHN A;  4FJP A;  1P1W A;  4QFN A;  2AL4 A;  1RYX A;  1D4N A;  1MXY A;  4TLM B;  3TKD A;  2DXR A;  1B0L A;  4H8J A;  3C36 A;  3CR9 A;  4K3F A;  3S9L C;  4NF5 A;  4HCY A;  3OO8 A;  1LST A;  3C35 A;  1L5T A;  4HS7 A;  5DVI A;  1ZTY A;  3O28 A;  3BKI B;  5CI5 A;  4IO4 A;  3LBS A;  4AB6 A;  3UA8 A;  3G3I A;  5H8N A;  3FGS A;  4KD5 A;  3TEL A;  2R71 A;  3KGC A;  3H6V A;  1D3K A;  5FHO A;  1GGG A;  3Q27 A;  3TQL A;  3OO6 A;  3EF7 A;  3TUS A;  4MFI A;  4QSD A;  1A40 A;  1SBP A;  4ZED A;  4GVO A;  4ELQ A;  4OQO A;  4FEC A;  4R2B A;  5I2N B;  3O2A A;  3PPN A;  1XT8 A;  2DP8 A;  2I3W A;  4R75 A;  4JWY A;  3C4M A;  5DEX B;  3K1M A;  3CSG A;  5DTB A;  2NXO A;  3O9P A;  5KZT A;  3OEM A;  2QSX A;  3RY3 A;  1BP5 A;  4ESX A;  3FUZ A;  5JK4 A;  4H1X A;  3VLU A;  3K01 A;  4XKQ A;  1M5E A;  3A3U A;  1M5D A;  3C33 A;  2O6A A;  4DE8 A;  3EHU A;  3R7X A;  4DDD A;  2NOO A;  3KN3 A;  3OSQ A;  4NTL A;  5I58 B;  4LQ2 A;  4F1Y A;  3QUJ A;  2V3U A;  3G3F A;  4H8I A;  4Z0I A;  2O1M A;  4YKP A;  3W9W A;  4YB7 A;  5A5X A;  1DPE A;  3U72 A;  3K1N A;  5JTY A;  1Y3P A;  4F1U A;  3FJG A;  1USY H;  4F39 A;  1SDX A;  3H3G A;  2Y7I A;  2XHD A;  4KPT A;  1ANF A;  2XXQ A;  4F1V A;  2DSF A;  5ITP A;  4UAC A;  1XC1 A;  3OEN A;  3TCH A;  4N6P A;  4RY1 A;  3VE1 B;  4HCW A;  1NH7 A;  1IEJ A;  3DM0 A;  3D4G A;  4G8M A;  2ONK E;  3MZB A;  4PFU A;  3M3F A;  4EQ7 A;  2RIN A;  1MY2 A;  3SEU A;  1I6A A;  3JV9 A;  2XX9 A;  4DXU A;  1MY0 A;  2DQV A;  3FV1 A;  2NVU B;  2ESN A;  3OO7 A;  3RUM A;  1D9V A;  1Y9U A;  5BUU A;  1GVC A;  1MXU A;  2W7Y A;  5I2K A;  4ONY A;  1SD3 A;  2X7P A;  1JW4 A;  3CFL A;  3VFJ A;  2H99 A;  1LB8 A;  2D5W A;  1LGB C;  3FXQ A;  3VVD A;  4OEV A;  2H4I A;  2FNC A;  1B3G A;  3VLW A;  4OTE A;  4Z7E A;  2AL5 A;  3UP9 A;  4XKN A;  5I57 A;  5L9S A;  1UTH B;  2FA7 A;  2RC9 A;  3C34 A;  2GH9 A;  4GIZ A;  2LAO A;  1JVY A;  2Z8E A;  4ZZA A;  5H8H A;  3FVO A;  2AIX A;  4QFO A;  1MPB A;  1DTZ A;  3FJM A;  1NH8 A;  4X9T A;  5H8S A;  2F8D A;  3D4C A;  4QSE A;  1JNF A;  2OZZ A;  1DMB A;  2I6E A;  4G77 A;  3OXN A;  3K0V A;  5H8F A;  2V3Q A;  3DLN A;  3G3H A;  5K2X A;  2Y84 A;  3MQ9 A;  2XXP A;  3GBA A;  5FTH A;  5TP9 B;  1B5I A;  3FJ7 A;  5FHM A;  1MH3 A;  1ZU0 A;  3Q28 A;  1Q1K A;  4IO2 A;  4TOZ A;  4FOR A;  3KSJ A;  1B9J A;  2QS3 A;  2ZYM A;  3B6Q A;  1XOC A;  2HAV A;  1NL5 A;  3HCQ A;  4EF2 A;  3LR1 A;  2GHB A;  3LSF B;  2UVJ A;  1FQA A;  3IB1 A;  1PDA A;  1SW1 A;  4BDN A;  3S9E A;  5CRY A;  3FV2 A;  3PUV E;  2B3F A;  4XKP A;  1B40 A;  5ICQ A;  1B5J A;  2GHA A;  4YAH X;  2O69 A;  4WXJ A;  2O7I A;  5H8Q B;  3IO4 A;  2ZNS A;  1ATG A;  1OIB A;  3K2D A;  1IUD A;  2ABH A;  4I9D A;  4LUB A;  1WDN A;  4X1B A;  1KWH A;  5CMB A;  1Q35 A;  3CI8 A;  2Z22 A;  2Z23 A;  1N0T A;  5I84 A;  3MPK A;  1PB8 A;  4KYE A;  4XTC Q;  1P1U A;  4WKM A;  4JWO A;  3OO9 A;  4H5G A;  4XIG Q;  4YMB A;  4FE8 A;  4UA8 A;  1QVS A;  3FD3 A;  3N6T A;  4F3P A;  3GXA A;  2F35 A;  4RK2 A;  5CMC A;  1AIV A;  4GQO A;  1URD A;  3FXR A;  2OCU A;  3LSX A;  2PT1 A;  4GLI A;  4LVQ A;  3B7D A;  5EHS A;  3KN7 A;  4YKI A;  4OWD A;  2FYI A;  5AA2 B;  3T96 B;  1B3H A;  2VHA A;  3HHG A;  1XS5 A;  4GOT A;  4EQB A;  3EPE A;  5H8N B;  2GFE A;  2DE4 A;  4F2O A;  3N94 A;  2VD2 A;  3PPQ A;  2XXT A;  3CFZ A;  1DOT A;  1FCK A;  1UTB B;  4PFT A;  2ALU A;  2I58 A;  3HO7 A;  4HTG A;  2DOJ A;  5TU0 A;  2F97 A;  2A5T A;  4EQ9 A;  2OBG A;  1B6H A;  5ELV A;  3IOU A;  1JW1 A;  3PMW A;  4OET A;  3H6U A;  3HPI A;  4FED A;  1NFT A;  2V84 A;  1ZIU A;  4ZEF A;  4YMA A;  1B3E A;  4KYS A;  1FQC A;  3MP8 A;  3OEK A;  1B3L A;  4BDL A;  1QKA A;  1B5H A;  2CZL A;  2RCA A;  4GD5 A;  2UXA A;  1II5 A;  3I3V A;  3KJT A;  3HST A;  2DS9 A;  4BDR A;  1ZKB A;  1XHY A;  2PMS A;  1TWY A;  1EZ9 A;  3HHF A;  3V8X B;  1SYI A;  2XXW A;  3H6T A;  4EDP A;  2X7Q A;  2QS4 A;  3B6W A;  1IQ7 A;  4QSC A;  5ITO A;  2DE2 A;  3SER A;  2Y7K A;  3KBR A;  4DCX A;  4LON B;  2RKM A;  3EHT A;  1EZO A;  1FTL A;  1HSL A;  4PET A;  1Z7N E;  5L9O A;  1CE2 A;  4NE4 A;  3ZKK A;  1N7W A;  3K6V A;  2I4B A;  3QSL A;  3IO6 A;  3S2V A;  1P99 A;  2ANJ A;  4QFP A;  3U93 A;  5A5X B;  4FEB A;  3BFT A;  3LSL A;  1B51 A;  4E0X A;  1Y1M A;  1N76 A;  1US5 A;  2PT2 A;  5DYH A;  5FTI A;  1GR2 A;  1BLF A;  3QK6 A;  4Q5T A;  1BKA A;  4RJZ A;  3T9H B;  1B58 A;  3ONM A;  2O84 X;  1OQH A;  4NF4 B;  3TMG A;  2XX8 A;  1QUI A;  4Q8R A;  1LAX A;  1SQY A;  4I1D A;  2UVG A;  2E1S A;  3UGW A;  3E3K A;  1FQD A;  4G68 C;  4MLV A;  2V93 A;  4X1D A;  5I56 B;  5KDT A;  3PUY E;  3HV1 A;  2OLB A;  2O68 A;  1S50 A;  3T9X B;  2DWJ A;  4RK9 A;  4BDO A;  4JB7 A;  3RT8 A;  2DE3 A;  1HSJ A;  2ONR A;  2RCB A;  3C32 A;  2R6G E;  1LBB A;  3IOT A;  4FIM A;  3H7M A;  5IAI A;  2OWS A;  5CBR A;  1LCF A;  2ZNT A;  4GL8 A;  4YU0 A;  1MXX A;  2QL3 A;  3UN6 A;  4TLL B;  3MP1 A;  4IO7 A;  5I57 B;  2ZXT A;  1WVJ A;  3CG3 A;  5L9M A;  1S9T A;  1B05 A;  4R9F A;  4OER A;  3GBB A;  4H67 A;  1XVX A;  4G8N A;  3ZSF A;  1B4Z A;  4F29 A;  2R9J A;  4KQP A;  4NF8 A;  4O3C A;  1VR5 A;  2VD3 A;  4AB5 A;  1OQG A;  5AA4 B;  2P2A A;  4P0I A;  2M8C A;  2AYS A;  4RXL A;  4U1O A;  4ZEK A;  1JEU A;  3SEX A;  1OLA A;  3MWB A;  3CIJ A;  4RPO A;  2O7U A;  2DVZ A;  5L8D A;  3N5L A;  1US4 A;  1D9Y A;  2WKY A;  4BDM A;  4IGT A;  2THI A;  3OOA A;  3LUY A;  3G3J A;  2PBW A;  3VVE A;  2Q9T A;  2QPQ A;  1LAG E;  4LP2 B;  4H5F A;  1B32 A;  4WED A;  2OK2 A;  4ISU A;  2D3I A;  4NF6 B;  3UK4 A;  4R74 A;  3N6U A;  3V5A A;  2VP1 A;  1QUK A;  1EH3 A;  4ZDM A;  4GWO A;  3GZG A;  3ECR A;  3SEW A;  1XVY A;  3RTW B;  3T9V A;  3PUW E;  5I59 B;  3G3G A;  5CBS A;  1MH4 A;  5I2N A;  1O64 A;  3LC8 A;  3C31 A;  3S4U A;  1TXF A;  5DEX A;  1B1X A;  1N7X A;  3B6T A;  1SW2 A;  1OVB A;  4U1Z A;  2O51 A;  3KEI A;  2I0C A;  4XKR A;  4LZ7 A;  5B70 A;  2F6P A;  4TQU Q;  3VXC A;  3FVG A;  4IO3 A;  5CM6 A;  3PGF A;  1B0H A;  3QXM A;  2XXY A;  3PU5 A;  1RYO A;  4NWD A;  3MVY A;  3PPR A;  1MPD A;  1IIT A;  4C0R A;  1PC3 A;  1PB9 A;  1B7U A;  3DP6 A;  1JVX A;  1M5F A;  5I58 A;  1NNK A;  1EZP A;  3DEL B;  4MH5 A;  3M3L A;  2CMO A;  4F31 B;  3FXU A;  3MVW A;  1JET A;  4G68 B;  3IAZ A;  2XXX A;  4U4X A;  3CRB A;  4JBZ A;  1JW5 A;  4ELO A;  1B3F A;  1FQB A;  3CG1 A;  5KCJ B;  1Y1Z A;  1FTO A;  2F6G A;  2A5T B;  1HSE A;  5EYF A;  4DZ1 A;  4EF1 A;  3PMX A;  3KZG A;  3TTK A;  4F3S A;  2KLF A;  1MDP 1;  3KOS A;  4I62 A;  3TZA A;  3MJN A;  2F7B A;  4H0W A;  2PVU A;  4KHZ E;  1Y4C A;  3R6U A;  4U2R A;  4KR5 A;  3VVF A;  4RYA A;  2OWT A;  4AQ4 A;  3WAF A;  3M3K A;  5IKB A;  1AMF A;  4R72 A;  2NWJ A;  3G3K A;  4Q0C A;  3TYH A;  3QUF A;  2XXI A;  2REG A;  3O66 A;  1SI1 A;  4F3B A;  1S7Y A;  3FZV A;  3A3C A;  3SET A;  1N3W A;  2Y7W A;  4R6Y A;  4R2F A;  4F22 A;  3IJX B;  2YJP A;  1I6B A;  3G7W A;  1N84 A;  4RNS A;  2DWH A;  3KN8 A;  5FHN A;  2UVH A;  2VOZ A;  1PB7 A;  4NED A;  1QW0 A;  2YPN A;  2DWA A;  1LFG A;  4KI0 E;  4IO6 A;  1IXI A;  4NF5 B;  4QFL A;  4LZ8 A;  1YTV A;  3MC2 A;  3Q29 A;  4BDQ A;  3RNN A;  4IY5 A;  3KSX A;  1QKB A;  1A55 A;  3SEV A;  4P11 A;  4ZEC A;  1UQW A;  1ZMG A;  2B3B A;  3OEL A;  1BTJ A;  2IEE A;  4E0W A;  4F3G A;  3MP6 A;  1URG A;  4EUO A;  2G93 A;  3FAT A;  4F19 A;  2Y7P A;  4C1U A;  1PBQ A;  2HZK A;  1NNP A;  3PD8 A;  2ZYN A;  5TP9 A;  3H6W A;  1QJM A;  4IGR A;  3K6W A;  1LFI A;  4PE5 B;  2OJT A;  1MY1 A;  4G2Z A;  1I6Q A;  3MVZ A;  4WEP A;  2RC7 A;  2RF1 A;  3PPP A;  3FVK A;  3P7I A;  2V3T A;  3MVX A;  1SW4 A;  1MQG A;  1MY3 A;  4DLD A;  1URS A;  1LB9 A;  4PP0 A;  2QS1 A;  3U94 A;  1P1N A;  4XXU A;  3TCF A;  4H65 A;  1I69 A;  5H8Q A;  4HW8 A;  1A54 A;  3W15 C;  1P1O A;  3UIF A;  2Q88 A;  3KJ7 A;  3MAM A;  4I8C A;  2Z8F A;  1B7H A;  1FW0 A;  4U22 A;  4RPN A;  1FTK A;  2BJJ X;  4FAJ A;  3IOR A;  1TT1 A;  5HM4 B;  1PBP A;  2F7C A;  2XX7 A;  1CB6 A;  3V89 B;  4POX A;  1UIV A;  3KG2 A;  3T22 A;  2H25 A;  5JTY B;  3TTL A;  4H6D A;  4P0G A;  5JEI A;  1FTJ A;  3TCG A;  3U1O A;  5AA2 A;  1Y3Q A;  3RN8 A;  3L6G A;  1H43 A;  3O97 A;  2HZL A;  3FIR A;  1MS7 A;  1QUL A;  4OEU A;  4LAT A;  1DPP A;  2GRV A;  1JQF A;  3SDF A;  4PQJ A;  3H4Z A;  2HCA A;  1Y3N A;  1ZBM A;  4DXB A;  1UTB A;  2P1S A;  3A09 A;  4QFK A;  1T0K A;  3TTN A;  5CC2 A;  4OEN A;  1MM7 A;  4L17 A;  4MBP A;  1MRP A;  4OZ9 A;  1OMP A;  3THI A;  1LAF E;  3O6I A;  4GXS B;  5I2K B;  4GL0 A;  1IXC A;  4U23 A;  3FAS A;  1H44 A;  1EU8 A;  1LBC A;  4F2Q A;  1LFH A;  2H5Y A;  4N13 A;  4OXV A;  5TPA A;  3EHS A;  3Q25 A;  1PEB A;  3U92 A;  1N04 A;  3TQW A;  4POW A;  1R1N A;  2XD2 A;  4JSO A;  1B2H A;  3IK6 B;  1RKM A;  3TTR A;  5H8H B;  4FAT A;  2PYY A;  3ZKL A;  3SKP A;  3F11 A;  2UVI A;  2ZYO A;  3WAE A;  3USD A;  2F36 A;  4PFY A;  4EXK A;  3O6G A;  4YB5 A;  3BBR A;  1A8E A;  2E0S A;  3S9M C;  4YB6 A;  3IOV A;  3M8U A;  3PUZ E;  5H8F B;  2F34 A;  3CFX A;  3DP8 A;  2REJ A;  2HEU A;  1YCJ A;  4KYD A;  4DIG A;  1AL3 A;  3IL1 B;  1VFE A; 
#chains in the Genus database with same CATH topology
 3CVG A;  4LQ5 A;  1N3X A;  4QF9 A;  4QRZ A;  1IXH A;  3C9H A;  1H3D A;  1MQI A;  5HBC A;  1F9B A;  4NN3 A;  2XXU A;  4R6H A;  3MBP A;  3IX1 A;  1K9Z A;  3KC0 A;  3ILT B;  4NF4 A;  2Q2A A;  1POY 1;  1ELJ A;  1M5B A;  3RQT A;  2HQ0 A;  2IA4 A;  3MPL A;  3TTM A;  3K02 A;  3TEP A;  2RC8 A;  5AA2 D;  1TFA A;  3W9V A;  2XXV A;  3TDJ A;  3O29 A;  3E13 X;  1NNT A;  1GV8 A;  2HXW A;  2A5S A;  3FVN A;  2F78 A;  3PPO A;  4LZ5 A;  4THI A;  2D21 A;  2ZNU A;  1DSN A;  4M1V A;  1POT A;  5I56 A;  4R9G A;  1BIY A;  4RA1 A;  4NX1 A;  4P8B A;  1AH5 A;  3MW0 A;  3GLB A;  1OVT A;  1RDX A;  2GQ1 A;  2HFB A;  2Q89 A;  4GWW A;  4R73 A;  1CNQ A;  3K6U A;  3SES A;  4U21 A;  2G29 A;  2I49 A;  3IJO B;  1MDQ A;  4OMB A;  4OFL A;  1FPL A;  1MQD A;  3OSR A;  3RPW A;  1SI0 A;  3RLF E;  5ET5 A;  2CZK A;  2HAU A;  1USY E;  5CMM A;  3U8Q A;  4ZE8 A;  1Y4T A;  2DYX A;  2X26 A;  3TFL A;  5F1Q A;  4F18 A;  3ZS6 A;  3B50 A;  4C1T A;  4OES A;  4ELP A;  2UYE A;  1QGX A;  4JXI A;  4OAN A;  3OD7 A;  3VV5 A;  4G4P A;  4IY6 A;  1B7Z A;  3R26 A;  3IB0 A;  5AE4 A;  5BWJ A;  1QUJ A;  1LLS A;  5AA3 A;  4X8R A;  4MF3 A;  3T9U A;  3JYR A;  1MPC A;  2HPG A;  5T3J A;  1NV6 A;  1JEV A;  3O6H A;  1MXW A;  1SW5 A;  2Q8M A;  2ONS A;  2PX1 A;  5AA4 A;  1MY4 A;  3N26 A;  1J1N A;  2P0S A;  2Q8J A;  1BK4 A;  1FQF A;  1B46 A;  3U65 A;  1ZLQ A;  1R9Q A;  2QRY A;  1SYH A;  3EQ1 A;  4ZS9 A;  1GTK A;  3MZ9 A;  2H98 A;  4N8G A;  2UYF A;  1AOV A;  1R9L A;  3K1P A;  3V83 A;  1YYZ A;  3IFA A;  2Q2C A;  3PUX E;  5J1D A;  5A5L A;  4G8H A;  4KCC A;  1H76 A;  4ELR A;  1OLC A;  4ZEB A;  2XXR A;  4DXC A;  1FPJ A;  4O3B A;  3KFM A;  5B7D A;  3VXB A;  3T93 B;  2DWI A;  4NF6 A;  1O63 A;  3E4R A;  3JZJ A;  3T66 A;  2H9B A;  3QMF A;  3I5O A;  1NNF A;  2QFL A;  1IIW A;  4JVD A;  1VE4 A;  3PD9 A;  3CSB A;  3RTF B;  4NMY A;  4PDH A;  5I59 A;  3FBP A;  4HE0 A;  1MQJ A;  1MXV A;  1LCT A;  4ZZE A;  4U4S A;  5EHM A;  2FBP A;  3DP4 A;  1SVX B;  3TAJ A;  2QMX A;  4GRK A;  4YZZ A;  1ZJL A;  4IO5 A;  1M5C A;  4R6K A;  1NKX A;  4GF8 A;  3D1R A;  1Y20 A;  5LOM A;  3VLV A;  1A7L A;  3ODB A;  3EN3 A;  4NAP A;  3QAX A;  3TPA A;  4OVJ A;  4DCY A;  4MHF A;  1B1H A;  4XFE A;  1VSO A;  2I4C A;  2JJK A;  5DT6 A;  4ZEI A;  4ESW A;  1FTM A;  1UTH A;  5LTC A;  4YKK A;  3LSW A;  2XWK A;  1MXZ A;  3Q26 A;  2NUV A;  4ND9 A;  2F5X A;  3E9X A;  3PMV A;  4PFI A;  3MZ1 A;  1MQH A;  3IR1 A;  4IB2 A;  4OFO A;  5HPQ A;  2QS2 A;  3RGY A;  4GX4 A;  4OYV A;  2DXY A;  3ILU B;  3SEY A;  2KR0 A;  2I0B A;  4GFR A;  3IFC A;  2B65 A;  3AXF A;  3L6H A;  1FBP A;  4NWC A;  1FBD A;  3UOR A;  4QHQ A;  4N07 A;  3PV0 E;  3IOW A;  2YLN A;  2CZI A;  5IZ3 B;  2VGQ A;  3RT6 B;  3QIM A;  1WOD A;  1IXG A;  5M2V A;  4G68 A;  4OFJ A;  4X48 A;  3QYT A;  3S9N C;  3K00 A;  1VFD A;  2I48 A;  1LAH E;  2Y5K A;  5ICT A;  4JDF A;  2P3N A;  4EXL A;  5F7V A;  1NV1 A;  3HN0 A;  4KCD A;  4LN5 A;  4ECF A;  1A99 A;  2ZYK A;  5ISU A;  4N8Y A;  3IB2 A;  2I3V A;  4LA9 A;  2FIE A;  4OA4 A;  2XXH A;  3BFU A;  4DIG A;  2Y7R A;  5CMK A;  2ZMB A;  4YKJ A;  5KDT B;  5KCJ A;  2QMW A;  2Z8D A;  4P56 A;  2O1L A;  1H45 A;  3A29 A;  3KOT A;  3MUQ A;  4ZE9 A;  1IMC A;  1IZ1 A;  1MM6 A;  1DTG A;  4MLQ A;  4YIC A;  1P1Q A;  1NMU A;  1MG1 A;  2V25 A;  3H03 A;  4GWX A;  2QJE A;  1Z7M E;  5AA1 A;  2PFY A;  4OVS A;  3I6V A;  1B4H A;  4N4U A;  4PFW A;  1YAE A;  4BLA A;  1B52 A;  5TPA B;  1O7T A;  4JSD A;  1FPK A;  3TOD A;  1FQE A;  3OMB A;  2F7A A;  4O3A A;  1R6Z A;  2XD3 A;  5DVF A;  3K4U A;  1SPI A;  4JWX A;  4MX6 A;  2B4L A;  2DVC A;  3VDF A;  4G61 A;  5DVJ A;  1YPN A;  4KFQ A;  5K2Y A;  1A8F A;  3B8B A;  3K6X A;  3H06 B;  4Q30 B;  4NF8 B;  1TFD A;  4GXA A;  1UIU A;  4PGP A;  4OHN A;  5IGA A;  4FJP A;  4QFN A;  1P1W A;  2AL4 A;  1RYX A;  1D4N A;  1NV2 A;  1MXY A;  4TLM B;  3TKD A;  2DXR A;  1B0L A;  4N6K A;  4H8J A;  3C36 A;  3CR9 A;  4O7M A;  2QVR A;  4K3F A;  3S9L C;  4MIJ A;  4NF5 A;  4HCY A;  3OO8 A;  1LST A;  3C35 A;  2HXR A;  4HS7 A;  1L5T A;  5DVI A;  1ZTY A;  2WX9 A;  3O28 A;  3BKI B;  5CI5 A;  4IO4 A;  3LBS A;  4AB6 A;  3UA8 A;  3G3I A;  5H8N A;  3FGS A;  1Q9D A;  4KD5 A;  3TEL A;  2R71 A;  3KGC A;  4PE3 A;  3H6V A;  1NUX A;  1D3K A;  5FHO A;  1GGG A;  1VDW A;  3Q27 A;  3TQL A;  2Q74 A;  3OO6 A;  3EF7 A;  3TUS A;  4MFI A;  4QSD A;  1A40 A;  1FPB A;  4O94 A;  2OX3 A;  1SBP A;  4ZED A;  4GVO A;  4H46 A;  4ELQ A;  4OQO A;  4FEC A;  4R2B A;  5I2N B;  1NI9 A;  3O2A A;  3PPN A;  1XT8 A;  4MNI A;  2DP8 A;  2I3W A;  4R75 A;  4JWY A;  4JVI A;  3C4M A;  5DEX B;  4PAI A;  3K1M A;  3CSG A;  5DTB A;  1FBE A;  2NXO A;  3O9P A;  4MNC A;  5KZT A;  3OEM A;  2QSX A;  3RY3 A;  4UAB A;  1BP5 A;  4ESX A;  2PFZ A;  3FUZ A;  5JK4 A;  4PFB A;  4GBW A;  4H1X A;  3VLU A;  3K01 A;  4XKQ A;  1M5E A;  3A3U A;  1M5D A;  3C33 A;  2O6A A;  4DE8 A;  3EHU A;  3R7X A;  4GWZ A;  4DDD A;  5EYH A;  1FRP A;  2NOO A;  3KN3 A;  3OSQ A;  4GWY A;  4NTL A;  3RYD A;  5I58 B;  4LQ2 A;  4F1Y A;  3QUJ A;  2V3U A;  3G3F A;  5EQ8 A;  3E79 A;  2PCR A;  4H8I A;  4Z0I A;  2O1M A;  4YKP A;  3W9W A;  4YB7 A;  5A5X A;  1DPE A;  3U72 A;  3K1N A;  5JTY A;  1Y3P A;  4F1U A;  3EKI A;  4AS4 A;  3FJG A;  1USY H;  4F39 A;  1SDX A;  3H3G A;  2FVZ A;  1NV4 A;  2Y7I A;  2XHD A;  4KPT A;  1ANF A;  2XXQ A;  4F1V A;  4AS5 A;  2DSF A;  5ITP A;  4UAC A;  1XC1 A;  3OEN A;  3TCH A;  4N6P A;  4RY1 A;  3VE1 B;  4HCW A;  4HE2 A;  1NH7 A;  1IEJ A;  3DM0 A;  4NF0 A;  3D4G A;  4G8M A;  2ONK E;  3MZB A;  4PFU A;  1RDZ A;  3M3F A;  4EQ7 A;  2RIN A;  1IMB A;  1MY2 A;  4N17 A;  3SEU A;  1I6A A;  3JV9 A;  2XX9 A;  4DXU A;  1KA0 A;  2V4C A;  1MY0 A;  2DQV A;  3FV1 A;  2NVU B;  2ESN A;  3OO7 A;  3RUM A;  1D9V A;  1Y9U A;  5BUU A;  1GVC A;  1MXU A;  4MMP A;  2W7Y A;  4O8M A;  5I2K A;  4ONY A;  1SD3 A;  2X7P A;  1LBX A;  1JW4 A;  3CFL A;  3VFJ A;  2H99 A;  2WEF A;  1LB8 A;  2D5W A;  1NV5 A;  1LGB C;  3FXQ A;  3VVD A;  4OEV A;  2DDK A;  2H4I A;  2FNC A;  1B3G A;  3VLW A;  4OTE A;  4Z7E A;  2AL5 A;  3UP9 A;  4XKN A;  4N91 A;  5I57 A;  5L9S A;  1UTH B;  2FA7 A;  2RC9 A;  3C34 A;  1FPI A;  2GH9 A;  4GIZ A;  2LAO A;  1JVY A;  2Z8E A;  4ZZA A;  5H8H A;  5ESY A;  3FVO A;  2AIX A;  4QFO A;  1MPB A;  1DTZ A;  3FJM A;  4NQ8 A;  1NH8 A;  4X9T A;  5H8S A;  2F8D A;  3D4C A;  4QSE A;  1RDY A;  1JNF A;  2OZZ A;  1DMB A;  2I6E A;  4OVT A;  4G77 A;  3OXN A;  3K0V A;  5H8F A;  2VPN A;  2V3Q A;  3DLN A;  3G3H A;  5K2X A;  2Y84 A;  3MQ9 A;  2XXP A;  3GBA A;  5FTH A;  5TP9 B;  1B5I A;  3FJ7 A;  5FHM A;  1MH3 A;  1ZU0 A;  3Q28 A;  1Q1K A;  1LEV A;  4IO2 A;  4TOZ A;  4FOR A;  3KSJ A;  1B9J A;  2QS3 A;  2ZYM A;  3B6Q A;  4NHB A;  1XOC A;  2HAV A;  1NL5 A;  3HCQ A;  4EF2 A;  3LR1 A;  1KA1 A;  3SZP A;  2GHB A;  4MNP A;  3LSF B;  2UVJ A;  1FQA A;  3IB1 A;  1PDA A;  1SW1 A;  4BDN A;  3S9E A;  1NUW A;  4PFR A;  5CRY A;  3FV2 A;  3PUV E;  2B3F A;  4XKP A;  1B40 A;  5ICQ A;  1B5J A;  2GHA A;  4YAH X;  1JP4 A;  2O69 A;  4QXD A;  4WXJ A;  2O7I A;  5H8Q B;  3IO4 A;  2ZNS A;  1IME A;  1ATG A;  1OIB A;  3K2D A;  1IUD A;  2ABH A;  4I9D A;  4LUB A;  1WDN A;  4X1B A;  2WBD A;  1KWH A;  5CMB A;  1INP A;  3RPL B;  1Q35 A;  3CI8 A;  1DBZ A;  2Z22 A;  2Z23 A;  1N0T A;  5I84 A;  3MPK A;  4NG7 A;  1PB8 A;  4KYE A;  4XTC Q;  1P1U A;  4FBP A;  4WKM A;  4JWO A;  3PTY A;  3OO9 A;  4H5G A;  4XIG Q;  4YMB A;  4FE8 A;  4UA8 A;  1QVS A;  3FD3 A;  3N6T A;  4X04 A;  4PAK A;  3GXA A;  4F3P A;  2F35 A;  4RK2 A;  5CMC A;  1AIV A;  4GQO A;  1URD A;  3FXR A;  2OCU A;  3LSX A;  2PT1 A;  4GLI A;  4LVQ A;  3B7D A;  5EHS A;  3KN7 A;  5IZ1 A;  4YKI A;  4OWD A;  2FYI A;  5AA2 B;  1EYI A;  3T96 B;  3BIG A;  1B3H A;  2VHA A;  3HHG A;  1XS5 A;  4GOT A;  4EQB A;  3EPE A;  1KZ8 A;  5H8N B;  2GFE A;  2DE4 A;  4F2O A;  3N94 A;  2VD2 A;  3PPQ A;  2XXT A;  3CFZ A;  1DOT A;  4OVP A;  1FCK A;  1UTB B;  4PFT A;  2ALU A;  2I58 A;  3HO7 A;  4HTG A;  2DOJ A;  2B4M A;  4GWU A;  5TU0 A;  2F97 A;  2A5T A;  4EQ9 A;  2OBG A;  1B6H A;  5ELV A;  3IOU A;  1JW1 A;  3PMW A;  4OET A;  3H6U A;  1FPF A;  3HPI A;  5F24 A;  4FED A;  1NFT A;  2V84 A;  1ZIU A;  4ZEF A;  1DK4 A;  4YMA A;  1B3E A;  4KYS A;  1FQC A;  3MP8 A;  3OEK A;  1B3L A;  4BDL A;  1QKA A;  1B5H A;  2CZL A;  2RCA A;  4GD5 A;  1FBC A;  2UXA A;  5LDZ A;  3T0J A;  1II5 A;  3I3V A;  3KJT A;  3HST A;  5EQ7 A;  4QBA A;  2DS9 A;  4OVQ A;  4BDR A;  1ZKB A;  1XHY A;  2PMS A;  1TWY A;  4OVR A;  1EZ9 A;  3HHF A;  3V8X B;  1SYI A;  2XXW A;  4P3L A;  3H6T A;  4EDP A;  2X7Q A;  2QS4 A;  4HE1 A;  3B6W A;  1IQ7 A;  4QSC A;  5ITO A;  2DE2 A;  3SER A;  2Y7K A;  3KBR A;  4DCX A;  4LON B;  4XEQ A;  2RKM A;  3EHT A;  1EZO A;  1FTL A;  1HSL A;  4PET A;  1Z7N E;  5L9O A;  1CE2 A;  4NE4 A;  3ZKK A;  1N7W A;  3K6V A;  2I4B A;  1LBW A;  3LV0 A;  5FBP A;  3QSL A;  3IO6 A;  4IR8 A;  3S2V A;  1P99 A;  2ANJ A;  1FPE A;  4QFP A;  3U93 A;  5A5X B;  4FEB A;  3BFT A;  3LSL A;  1G0I A;  1B51 A;  4E0X A;  1Y1M A;  1N76 A;  1US5 A;  2PT2 A;  5DYH A;  5FTI A;  1GR2 A;  1BLF A;  3QK6 A;  4Q5T A;  1BKA A;  2ZZV A;  4RJZ A;  3T9H B;  1B58 A;  3ONM A;  4PGN A;  2O84 X;  1OQH A;  4NF4 B;  3TMG A;  2XX8 A;  1QUI A;  4Q8R A;  1LAX A;  2F3B A;  1SQY A;  4I1D A;  5IZ3 A;  2UVG A;  2E1S A;  3UGW A;  2FIX A;  3E3K A;  1FQD A;  4G68 C;  4MLV A;  2WYP A;  2V93 A;  4X1D A;  5I56 B;  5KDT A;  3PUY E;  5I3S A;  3HV1 A;  2OLB A;  2O68 A;  4PF6 A;  1S50 A;  5EYG A;  3T9X B;  2DWJ A;  4RK9 A;  4BDO A;  4JB7 A;  2L5V A;  3RT8 A;  2DE3 A;  1HSJ A;  2ONR A;  2RCB A;  3C32 A;  2QVV A;  2R6G E;  1LBB A;  3IOT A;  4FIM A;  3H7M A;  5IAI A;  4GX3 A;  2OWS A;  5CBR A;  1NV3 A;  1LCF A;  2ZNT A;  4GL8 A;  4YU0 A;  1NUY A;  1MXX A;  2QL3 A;  4MJO A;  3UN6 A;  4TLL B;  3MP1 A;  4IO7 A;  5I57 B;  2ZXT A;  1WVJ A;  3CG3 A;  5L9M A;  1S9T A;  1B05 A;  2HHM A;  4R9F A;  1D9Q A;  4OER A;  3GBB A;  4H67 A;  1XVX A;  4G8N A;  3ZSF A;  2QVU A;  1B4Z A;  4F29 A;  4HXV A;  2R9J A;  4PTK A;  4KQP A;  4KXP A;  1LBY A;  4NF8 A;  4O3C A;  1K9Y A;  4PDD A;  1VR5 A;  2VD3 A;  4AB5 A;  1OQG A;  4NGU A;  5AA4 B;  2P2A A;  4P0I A;  2M8C A;  2AYS A;  4RXL A;  4U1O A;  4GBV A;  4ZEK A;  1JEU A;  3SEX A;  1OLA A;  3MWB A;  3CIJ A;  4RPO A;  2O7U A;  2DVZ A;  5L8D A;  3N5L A;  1US4 A;  1D9Y A;  2WKY A;  2WBB A;  4BDM A;  3GYY A;  4IGT A;  2XWV A;  2THI A;  3OOA A;  3LUY A;  3G3J A;  2PBW A;  4N81 A;  3VVE A;  2Q9T A;  2QPQ A;  1LAG E;  4LP2 B;  4H5F A;  1B32 A;  4WED A;  2OK2 A;  4ISU A;  2D3I A;  2WYK A;  4NF6 B;  3UK4 A;  4R74 A;  3N6U A;  3V5A A;  2VP1 A;  1QUK A;  1EH3 A;  4ZDM A;  4GWO A;  3GZG A;  3MYU A;  3ECR A;  3NOH A;  1XVY A;  3SEW A;  3RTW B;  3T9V A;  3PUW E;  5I59 B;  3G3G A;  5CBS A;  1MH4 A;  2F3D A;  5I2N A;  4GX6 A;  1O64 A;  5J16 A;  3LC8 A;  3C31 A;  3S4U A;  1TXF A;  5DEX A;  1B1X A;  1IMF A;  1N7X A;  3B6T A;  2FHY A;  1SW2 A;  1OVB A;  4U1Z A;  2O51 A;  3KEI A;  2I0C A;  4XKR A;  4LZ7 A;  5B70 A;  2F6P A;  4TQU Q;  3VXC A;  2BJI A;  2CEY A;  3FVG A;  4IO3 A;  5CM6 A;  3PGF A;  1B0H A;  3QXM A;  2XXY A;  3PU5 A;  1RYO A;  4NWD A;  3MVY A;  3PPR A;  1FBH A;  1MPD A;  4DI4 B;  1IIT A;  4P9K A;  4C0R A;  1PC3 A;  1PB9 A;  1B7U A;  5ET6 A;  3DP6 A;  1JVX A;  1M5F A;  5I58 A;  3MST A;  1NNK A;  1EZP A;  3DEL B;  4MH5 A;  3M3L A;  2CMO A;  4F31 B;  3FXU A;  3MVW A;  1JET A;  4G68 B;  3IAZ A;  2XXX A;  4U4X A;  4PCD A;  3CRB A;  4JBZ A;  1JW5 A;  4ELO A;  1B3F A;  1FQB A;  1YXI A;  1AWB A;  3CG1 A;  3HFU A;  5KCJ B;  1Y1Z A;  1FBG A;  1FTO A;  2F6G A;  2A5T B;  1HSE A;  5EYF A;  4DZ1 A;  4EF1 A;  3PMX A;  3KZG A;  3TTK A;  4F3S A;  4MCO A;  2Y5L A;  2KLF A;  1MDP 1;  3KOS A;  4I62 A;  3TZA A;  3MJN A;  2F7B A;  4H0W A;  2PVU A;  4KHZ E;  4H45 A;  4P47 A;  1Y4C A;  3R6U A;  4U2R A;  4DI3 D;  4KR5 A;  3VVF A;  4RYA A;  2OWT A;  4AQ4 A;  3WAF A;  3M3K A;  2ZZX A;  5IKB A;  1AMF A;  4R72 A;  2NWJ A;  3G3K A;  4Q0C A;  4PBQ A;  3KBZ A;  3TYH A;  3QUF A;  2XXI A;  2REG A;  1FJ9 A;  3O66 A;  1NV0 A;  5ET7 A;  1SI1 A;  4F3B A;  5I5P A;  1S7Y A;  3FZV A;  2P3V A;  3A3C A;  3SET A;  1N3W A;  2Y7W A;  4R6Y A;  4R2F A;  4F22 A;  3IJX B;  2YJP A;  1I6B A;  1FTA A;  3G7W A;  1N84 A;  4RNS A;  2DWH A;  3KN8 A;  5FHN A;  2UVH A;  2VOZ A;  1PB7 A;  4XF5 A;  4NED A;  4PF8 A;  2VPO A;  1QW0 A;  2YPN A;  2DWA A;  1LFG A;  4KI0 E;  1EYK A;  4IO6 A;  1IXI A;  4NF5 B;  4QFL A;  4I3E A;  4LZ8 A;  1YTV A;  3MC2 A;  3Q29 A;  4BDQ A;  3RNN A;  4IY5 A;  3KSX A;  4P1L A;  1QKB A;  1A55 A;  3SEV A;  4P11 A;  4ZEC A;  1UQW A;  1ZMG A;  1EYJ A;  3T1B A;  5ET8 A;  2B3B A;  3OEL A;  1NV7 A;  1BTJ A;  4P1E A;  2IEE A;  4E0W A;  4F3G A;  3MP6 A;  1URG A;  4EUO A;  2G93 A;  3FAT A;  4F19 A;  2Y7P A;  4C1U A;  1PBQ A;  2HZK A;  4JVC A;  4GWS A;  1NNP A;  3PD8 A;  1FSA A;  5IZZ A;  2ZYN A;  5TP9 A;  3H6W A;  1QJM A;  4IGR A;  3K6W A;  1LFI A;  4PE5 B;  2OJT A;  1MY1 A;  4G2Z A;  1I6Q A;  3MVZ A;  4WEP A;  2RC7 A;  1NUZ A;  2RF1 A;  4N6D A;  5EQ9 A;  3PPP A;  1LBZ A;  3FVK A;  3P7I A;  2V3T A;  3MVX A;  1SW4 A;  1MQG A;  1MY3 A;  4DLD A;  1URS A;  1LB9 A;  4PP0 A;  2QS1 A;  3U94 A;  1P1N A;  4XXU A;  3TCF A;  4H65 A;  1I69 A;  5H8Q A;  4HW8 A;  1A54 A;  3W15 C;  1P1O A;  1DCU A;  3UIF A;  2Q88 A;  3KJ7 A;  3MAM A;  3CHG A;  5IM2 A;  4I8C A;  1YZ0 A;  5DW8 A;  2Z8F A;  3RPL A;  1B7H A;  1FW0 A;  4U22 A;  4RPN A;  1FTK A;  3BIH A;  2BJJ X;  4FAJ A;  3IOR A;  2CEX A;  1TT1 A;  5HM4 B;  1PBP A;  2F7C A;  2XX7 A;  1CB6 A;  3V89 B;  4POX A;  1UIV A;  3KG2 A;  3T22 A;  2H25 A;  2VT5 A;  5JTY B;  1FPD A;  4O7I A;  3TTL A;  4H6D A;  4P0G A;  5JEI A;  1FTJ A;  3TCG A;  3U1O A;  5AA2 A;  2ZZW A;  1Y3Q A;  3RN8 A;  3L6G A;  1H43 A;  3ISP A;  3O97 A;  1IMD A;  2HZL A;  3FIR A;  1MS7 A;  1QUL A;  2MKZ A;  4OEU A;  4LAT A;  2CZH A;  1DPP A;  2GRV A;  1JQF A;  3SDF A;  4PQJ A;  2OWZ A;  3H4Z A;  2HCA A;  2R8T A;  1Y3N A;  1ZBM A;  4DXB A;  4I3Y A;  1LBV A;  1UTB A;  3LUZ A;  2P1S A;  3A09 A;  4QFK A;  2KQZ A;  1T0K A;  3TTN A;  3KC1 A;  5CC2 A;  3FXB A;  4OEN A;  1MM7 A;  4L17 A;  4MBP A;  5EQA A;  1MRP A;  4OZ9 A;  1OMP A;  3ROJ A;  3THI A;  4MEV A;  1LAF E;  5I7I A;  3O6I A;  4GXS B;  5I2K B;  4GL0 A;  1IXC A;  2XWO A;  4U23 A;  3FAS A;  3E78 A;  1IMA A;  1H44 A;  1EU8 A;  1LBC A;  4F2Q A;  1LFH A;  2H5Y A;  4N13 A;  4OXV A;  5TPA A;  3EHS A;  3Q25 A;  2XA5 A;  1PEB A;  3U92 A;  1N04 A;  3TQW A;  4I40 A;  4POW A;  1R1N A;  2XD2 A;  4JSO A;  1B2H A;  1FJ6 A;  3IK6 B;  1RKM A;  1FBF A;  3TTR A;  5H8H B;  4FAT A;  2PYY A;  3ZKL A;  3SKP A;  3F11 A;  2UVI A;  2ZYO A;  2XXK A;  3WAE A;  3USD A;  2F36 A;  1G0H A;  4PFY A;  4EXK A;  3O6G A;  4YB5 A;  3BBR A;  1A8E A;  2E0S A;  3S9M C;  4N15 A;  4YB6 A;  2XWI A;  4PBH A;  3IOV A;  3M8U A;  3PUZ E;  5H8F B;  1XI6 A;  4PAF A;  1FPG A;  2F34 A;  4MAG A;  3CFX A;  3DP8 A;  2REJ A;  4PC9 A;  2HEU A;  1YCJ A;  4KYD A;  4M4G A;  1AL3 A;  3IL1 B;  1VFE A; 
#chains in the Genus database with same CATH homology
 3CVG A;  4LQ5 A;  1N3X A;  4QF9 A;  4QRZ A;  1IXH A;  3C9H A;  1H3D A;  1MQI A;  5HBC A;  1F9B A;  2XXU A;  4R6H A;  3MBP A;  3IX1 A;  3ILT B;  4NF4 A;  2Q2A A;  1POY 1;  1ELJ A;  1M5B A;  3RQT A;  2HQ0 A;  2IA4 A;  3MPL A;  3TTM A;  3K02 A;  3TEP A;  2RC8 A;  5AA2 D;  1TFA A;  3W9V A;  2XXV A;  3TDJ A;  3O29 A;  3E13 X;  1NNT A;  1GV8 A;  2HXW A;  2A5S A;  3FVN A;  2F78 A;  3PPO A;  4LZ5 A;  4THI A;  2D21 A;  2ZNU A;  1DSN A;  4M1V A;  1POT A;  5I56 A;  4R9G A;  1BIY A;  4RA1 A;  1AH5 A;  3MW0 A;  3GLB A;  1OVT A;  2HFB A;  2Q89 A;  4R73 A;  3K6U A;  3SES A;  4U21 A;  2G29 A;  2I49 A;  3IJO B;  1MDQ A;  4OMB A;  4OFL A;  1MQD A;  3OSR A;  3RPW A;  1SI0 A;  3RLF E;  2HAU A;  1USY E;  5CMM A;  3U8Q A;  4ZE8 A;  1Y4T A;  2DYX A;  2X26 A;  3TFL A;  5F1Q A;  4F18 A;  3ZS6 A;  4C1T A;  4OES A;  4ELP A;  2UYE A;  4JXI A;  3OD7 A;  3VV5 A;  4G4P A;  4IY6 A;  1B7Z A;  3R26 A;  3IB0 A;  5AE4 A;  5BWJ A;  1QUJ A;  1LLS A;  5AA3 A;  4MF3 A;  3T9U A;  3JYR A;  1MPC A;  1JEV A;  3O6H A;  1MXW A;  1SW5 A;  2ONS A;  2PX1 A;  5AA4 A;  1MY4 A;  3N26 A;  1J1N A;  2P0S A;  2Q8J A;  1FQF A;  1B46 A;  1ZLQ A;  1R9Q A;  2QRY A;  1SYH A;  3EQ1 A;  4ZS9 A;  1GTK A;  3MZ9 A;  2H98 A;  2UYF A;  1AOV A;  1R9L A;  3K1P A;  3V83 A;  2Q2C A;  3PUX E;  5J1D A;  4G8H A;  4KCC A;  1H76 A;  4ELR A;  1OLC A;  4ZEB A;  2XXR A;  4DXC A;  4O3B A;  3KFM A;  5B7D A;  3VXB A;  3T93 B;  2DWI A;  4NF6 A;  1O63 A;  3E4R A;  3JZJ A;  3T66 A;  2H9B A;  3I5O A;  1NNF A;  1IIW A;  1VE4 A;  3PD9 A;  3CSB A;  3RTF B;  4NMY A;  5I59 A;  1MQJ A;  1MXV A;  1LCT A;  4ZZE A;  4U4S A;  5EHM A;  3DP4 A;  1SVX B;  3TAJ A;  2QMX A;  4GRK A;  4YZZ A;  1ZJL A;  4IO5 A;  1M5C A;  4R6K A;  1NKX A;  4GF8 A;  1Y20 A;  5LOM A;  3VLV A;  1A7L A;  3ODB A;  3EN3 A;  3QAX A;  3TPA A;  4OVJ A;  4DCY A;  1B1H A;  1VSO A;  2I4C A;  5DT6 A;  4ZEI A;  4ESW A;  1FTM A;  1UTH A;  4YKK A;  3LSW A;  1MXZ A;  3Q26 A;  2NUV A;  4ND9 A;  2F5X A;  3E9X A;  3PMV A;  3MZ1 A;  1MQH A;  3IR1 A;  4IB2 A;  4OFO A;  5HPQ A;  2QS2 A;  3RGY A;  4OYV A;  2DXY A;  3ILU B;  3SEY A;  2I0B A;  4GFR A;  2B65 A;  3AXF A;  3L6H A;  4NWC A;  3UOR A;  4QHQ A;  4N07 A;  3PV0 E;  3IOW A;  2YLN A;  2VGQ A;  3RT6 B;  3QIM A;  1WOD A;  1IXG A;  5M2V A;  4G68 A;  4OFJ A;  4X48 A;  3QYT A;  3S9N C;  3K00 A;  1VFD A;  2I48 A;  1LAH E;  5ICT A;  4JDF A;  4EXL A;  5F7V A;  3HN0 A;  4KCD A;  4ECF A;  1A99 A;  2ZYK A;  5ISU A;  3IB2 A;  2I3V A;  4LA9 A;  2XXH A;  3BFU A;  2Y7R A;  5CMK A;  2ZMB A;  4YKJ A;  5KDT B;  5KCJ A;  2QMW A;  2Z8D A;  2O1L A;  1H45 A;  3KOT A;  3MUQ A;  4ZE9 A;  1IZ1 A;  1MM6 A;  1DTG A;  4MLQ A;  4YIC A;  1P1Q A;  1NMU A;  1MG1 A;  2V25 A;  3H03 A;  2QJE A;  1Z7M E;  5AA1 A;  3I6V A;  1B4H A;  4PFW A;  1YAE A;  4BLA A;  1B52 A;  5TPA B;  1O7T A;  4JSD A;  3TOD A;  1FQE A;  3OMB A;  2F7A A;  4O3A A;  1R6Z A;  4M4G A;  2XD3 A;  5DVF A;  3K4U A;  4JWX A;  2DVC A;  3VDF A;  5DVJ A;  1YPN A;  4KFQ A;  5K2Y A;  1A8F A;  3K6X A;  3H06 B;  4Q30 B;  4NF8 B;  1TFD A;  4GXA A;  1UIU A;  4OHN A;  4FJP A;  1P1W A;  4QFN A;  2AL4 A;  1RYX A;  1D4N A;  1MXY A;  4TLM B;  3TKD A;  2DXR A;  1B0L A;  4H8J A;  3C36 A;  3CR9 A;  4K3F A;  3S9L C;  4NF5 A;  4HCY A;  3OO8 A;  1LST A;  3C35 A;  1L5T A;  4HS7 A;  5DVI A;  1ZTY A;  3O28 A;  3BKI B;  5CI5 A;  4IO4 A;  3LBS A;  4AB6 A;  3UA8 A;  3G3I A;  5H8N A;  3FGS A;  4KD5 A;  3TEL A;  2R71 A;  3KGC A;  3H6V A;  1D3K A;  5FHO A;  1GGG A;  3Q27 A;  3TQL A;  3OO6 A;  3EF7 A;  3TUS A;  4MFI A;  4QSD A;  1A40 A;  1SBP A;  4ZED A;  4GVO A;  4ELQ A;  4OQO A;  4FEC A;  4R2B A;  5I2N B;  3O2A A;  3PPN A;  1XT8 A;  2DP8 A;  2I3W A;  4R75 A;  4JWY A;  3C4M A;  5DEX B;  3K1M A;  3CSG A;  5DTB A;  2NXO A;  3O9P A;  5KZT A;  3OEM A;  2QSX A;  3RY3 A;  1BP5 A;  4ESX A;  3FUZ A;  5JK4 A;  4H1X A;  3VLU A;  3K01 A;  4XKQ A;  1M5E A;  3A3U A;  1M5D A;  3C33 A;  2O6A A;  4DE8 A;  3EHU A;  3R7X A;  4DDD A;  2NOO A;  3KN3 A;  3OSQ A;  4NTL A;  5I58 B;  4LQ2 A;  4F1Y A;  3QUJ A;  2V3U A;  3G3F A;  4H8I A;  4Z0I A;  2O1M A;  4YKP A;  3W9W A;  4YB7 A;  5A5X A;  1DPE A;  3U72 A;  3K1N A;  5JTY A;  1Y3P A;  4F1U A;  3FJG A;  1USY H;  4F39 A;  1SDX A;  3H3G A;  2Y7I A;  2XHD A;  4KPT A;  1ANF A;  2XXQ A;  4F1V A;  2DSF A;  5ITP A;  4UAC A;  1XC1 A;  3OEN A;  3TCH A;  4N6P A;  4RY1 A;  3VE1 B;  4HCW A;  1NH7 A;  1IEJ A;  3DM0 A;  3D4G A;  4G8M A;  2ONK E;  3MZB A;  4PFU A;  3M3F A;  4EQ7 A;  2RIN A;  1MY2 A;  3SEU A;  1I6A A;  3JV9 A;  2XX9 A;  4DXU A;  1MY0 A;  2DQV A;  3FV1 A;  2NVU B;  2ESN A;  3OO7 A;  3RUM A;  1D9V A;  1Y9U A;  5BUU A;  1GVC A;  1MXU A;  2W7Y A;  5I2K A;  4ONY A;  1SD3 A;  2X7P A;  1JW4 A;  3CFL A;  3VFJ A;  2H99 A;  1LB8 A;  2D5W A;  1LGB C;  3FXQ A;  3VVD A;  4OEV A;  2H4I A;  2FNC A;  1B3G A;  3VLW A;  4OTE A;  4Z7E A;  2AL5 A;  3UP9 A;  4XKN A;  5I57 A;  5L9S A;  1UTH B;  2FA7 A;  2RC9 A;  3C34 A;  2GH9 A;  4GIZ A;  2LAO A;  1JVY A;  2Z8E A;  4ZZA A;  5H8H A;  3FVO A;  2AIX A;  4QFO A;  1MPB A;  1DTZ A;  3FJM A;  1NH8 A;  4X9T A;  5H8S A;  2F8D A;  3D4C A;  4QSE A;  1JNF A;  2OZZ A;  1DMB A;  2I6E A;  4G77 A;  3OXN A;  3K0V A;  5H8F A;  2V3Q A;  3DLN A;  3G3H A;  5K2X A;  2Y84 A;  3MQ9 A;  2XXP A;  3GBA A;  5FTH A;  5TP9 B;  1B5I A;  3FJ7 A;  5FHM A;  1MH3 A;  1ZU0 A;  3Q28 A;  1Q1K A;  4IO2 A;  4TOZ A;  4FOR A;  3KSJ A;  1B9J A;  2QS3 A;  2ZYM A;  3B6Q A;  1XOC A;  2HAV A;  1NL5 A;  3HCQ A;  4EF2 A;  3LR1 A;  2GHB A;  3LSF B;  2UVJ A;  1FQA A;  3IB1 A;  1PDA A;  1SW1 A;  4BDN A;  3S9E A;  5CRY A;  3FV2 A;  3PUV E;  2B3F A;  4XKP A;  1B40 A;  5ICQ A;  1B5J A;  2GHA A;  4YAH X;  2O69 A;  4WXJ A;  2O7I A;  5H8Q B;  3IO4 A;  2ZNS A;  1ATG A;  1OIB A;  3K2D A;  1IUD A;  2ABH A;  4I9D A;  4LUB A;  1WDN A;  4X1B A;  1KWH A;  5CMB A;  1Q35 A;  3CI8 A;  2Z22 A;  2Z23 A;  1N0T A;  5I84 A;  3MPK A;  1PB8 A;  4KYE A;  4XTC Q;  1P1U A;  4WKM A;  4JWO A;  3OO9 A;  4H5G A;  4XIG Q;  4YMB A;  4FE8 A;  4UA8 A;  1QVS A;  3FD3 A;  3N6T A;  4F3P A;  3GXA A;  2F35 A;  4RK2 A;  5CMC A;  1AIV A;  4GQO A;  1URD A;  3FXR A;  2OCU A;  3LSX A;  2PT1 A;  4GLI A;  4LVQ A;  3B7D A;  5EHS A;  3KN7 A;  4YKI A;  4OWD A;  2FYI A;  5AA2 B;  3T96 B;  1B3H A;  2VHA A;  3HHG A;  1XS5 A;  4GOT A;  4EQB A;  3EPE A;  5H8N B;  2GFE A;  2DE4 A;  4F2O A;  3N94 A;  2VD2 A;  3PPQ A;  2XXT A;  3CFZ A;  1DOT A;  1FCK A;  1UTB B;  4PFT A;  2ALU A;  2I58 A;  3HO7 A;  4HTG A;  2DOJ A;  5TU0 A;  2F97 A;  2A5T A;  4EQ9 A;  2OBG A;  1B6H A;  5ELV A;  3IOU A;  1JW1 A;  3PMW A;  4OET A;  3H6U A;  3HPI A;  4FED A;  1NFT A;  2V84 A;  1ZIU A;  4ZEF A;  4YMA A;  1B3E A;  4KYS A;  1FQC A;  3MP8 A;  3OEK A;  1B3L A;  4BDL A;  1QKA A;  1B5H A;  2CZL A;  2RCA A;  4GD5 A;  2UXA A;  1II5 A;  3I3V A;  3KJT A;  3HST A;  2DS9 A;  4BDR A;  1ZKB A;  1XHY A;  2PMS A;  1TWY A;  1EZ9 A;  3HHF A;  3V8X B;  1SYI A;  2XXW A;  3H6T A;  4EDP A;  2X7Q A;  2QS4 A;  3B6W A;  1IQ7 A;  4QSC A;  5ITO A;  2DE2 A;  3SER A;  2Y7K A;  3KBR A;  4DCX A;  4LON B;  2RKM A;  3EHT A;  1EZO A;  1FTL A;  1HSL A;  4PET A;  1Z7N E;  5L9O A;  1CE2 A;  4NE4 A;  3ZKK A;  1N7W A;  3K6V A;  2I4B A;  3QSL A;  3IO6 A;  3S2V A;  1P99 A;  2ANJ A;  4QFP A;  3U93 A;  5A5X B;  4FEB A;  3BFT A;  3LSL A;  1B51 A;  4E0X A;  1Y1M A;  1N76 A;  1US5 A;  2PT2 A;  5DYH A;  5FTI A;  1GR2 A;  1BLF A;  3QK6 A;  4Q5T A;  1BKA A;  4RJZ A;  3T9H B;  1B58 A;  3ONM A;  2O84 X;  1OQH A;  4NF4 B;  3TMG A;  2XX8 A;  1QUI A;  4Q8R A;  1LAX A;  1SQY A;  4I1D A;  2UVG A;  2E1S A;  3UGW A;  3E3K A;  1FQD A;  4G68 C;  4MLV A;  2V93 A;  4X1D A;  5I56 B;  5KDT A;  3PUY E;  3HV1 A;  2OLB A;  2O68 A;  1S50 A;  3T9X B;  2DWJ A;  4RK9 A;  4BDO A;  4JB7 A;  3RT8 A;  2DE3 A;  1HSJ A;  2ONR A;  2RCB A;  3C32 A;  2R6G E;  1LBB A;  3IOT A;  4FIM A;  3H7M A;  5IAI A;  2OWS A;  5CBR A;  1LCF A;  2ZNT A;  4GL8 A;  4YU0 A;  1MXX A;  2QL3 A;  3UN6 A;  4TLL B;  3MP1 A;  4IO7 A;  5I57 B;  2ZXT A;  1WVJ A;  3CG3 A;  5L9M A;  1S9T A;  1B05 A;  4R9F A;  4OER A;  3GBB A;  4H67 A;  1XVX A;  4G8N A;  3ZSF A;  1B4Z A;  4F29 A;  2R9J A;  4KQP A;  4NF8 A;  4O3C A;  1VR5 A;  2VD3 A;  4AB5 A;  1OQG A;  5AA4 B;  2P2A A;  4P0I A;  2M8C A;  2AYS A;  4RXL A;  4U1O A;  4ZEK A;  1JEU A;  3SEX A;  1OLA A;  3MWB A;  3CIJ A;  4RPO A;  2O7U A;  2DVZ A;  5L8D A;  3N5L A;  1US4 A;  1D9Y A;  2WKY A;  4BDM A;  4IGT A;  2THI A;  3OOA A;  3LUY A;  3G3J A;  2PBW A;  3VVE A;  2Q9T A;  2QPQ A;  1LAG E;  4LP2 B;  4H5F A;  1B32 A;  4WED A;  2OK2 A;  4ISU A;  2D3I A;  4NF6 B;  3UK4 A;  4R74 A;  3N6U A;  3V5A A;  2VP1 A;  1QUK A;  1EH3 A;  4ZDM A;  4GWO A;  3GZG A;  3ECR A;  3SEW A;  1XVY A;  3RTW B;  3T9V A;  3PUW E;  5I59 B;  3G3G A;  5CBS A;  1MH4 A;  5I2N A;  1O64 A;  3LC8 A;  3C31 A;  3S4U A;  1TXF A;  5DEX A;  1B1X A;  1N7X A;  3B6T A;  1SW2 A;  1OVB A;  4U1Z A;  2O51 A;  3KEI A;  2I0C A;  4XKR A;  4LZ7 A;  5B70 A;  2F6P A;  4TQU Q;  3VXC A;  3FVG A;  4IO3 A;  5CM6 A;  3PGF A;  1B0H A;  3QXM A;  2XXY A;  3PU5 A;  1RYO A;  4NWD A;  3MVY A;  3PPR A;  1MPD A;  1IIT A;  4C0R A;  1PC3 A;  1PB9 A;  1B7U A;  3DP6 A;  1JVX A;  1M5F A;  5I58 A;  1NNK A;  1EZP A;  3DEL B;  4MH5 A;  3M3L A;  2CMO A;  4F31 B;  3FXU A;  3MVW A;  1JET A;  4G68 B;  3IAZ A;  2XXX A;  4U4X A;  3CRB A;  4JBZ A;  1JW5 A;  4ELO A;  1B3F A;  1FQB A;  3CG1 A;  5KCJ B;  1Y1Z A;  1FTO A;  2F6G A;  2A5T B;  1HSE A;  5EYF A;  4DZ1 A;  4EF1 A;  3PMX A;  3KZG A;  3TTK A;  4F3S A;  2KLF A;  1MDP 1;  3KOS A;  4I62 A;  3TZA A;  3MJN A;  2F7B A;  4H0W A;  2PVU A;  4KHZ E;  1Y4C A;  3R6U A;  4U2R A;  4KR5 A;  3VVF A;  4RYA A;  2OWT A;  4AQ4 A;  3WAF A;  3M3K A;  5IKB A;  1AMF A;  4R72 A;  2NWJ A;  3G3K A;  4Q0C A;  3TYH A;  3QUF A;  2XXI A;  2REG A;  3O66 A;  1SI1 A;  4F3B A;  1S7Y A;  3FZV A;  3A3C A;  3SET A;  1N3W A;  2Y7W A;  4R6Y A;  4R2F A;  4F22 A;  3IJX B;  2YJP A;  1I6B A;  3G7W A;  1N84 A;  4RNS A;  2DWH A;  3KN8 A;  5FHN A;  2UVH A;  2VOZ A;  1PB7 A;  4NED A;  1QW0 A;  2YPN A;  2DWA A;  1LFG A;  4KI0 E;  4IO6 A;  1IXI A;  4NF5 B;  4QFL A;  4LZ8 A;  1YTV A;  3MC2 A;  3Q29 A;  4BDQ A;  3RNN A;  4IY5 A;  3KSX A;  1QKB A;  1A55 A;  3SEV A;  4P11 A;  4ZEC A;  1UQW A;  1ZMG A;  2B3B A;  3OEL A;  1BTJ A;  2IEE A;  4E0W A;  4F3G A;  3MP6 A;  1URG A;  4EUO A;  2G93 A;  3FAT A;  4F19 A;  2Y7P A;  4C1U A;  1PBQ A;  2HZK A;  1NNP A;  3PD8 A;  2ZYN A;  5TP9 A;  3H6W A;  1QJM A;  4IGR A;  3K6W A;  1LFI A;  4PE5 B;  2OJT A;  1MY1 A;  4G2Z A;  1I6Q A;  3MVZ A;  4WEP A;  2RC7 A;  2RF1 A;  3PPP A;  3FVK A;  3P7I A;  2V3T A;  3MVX A;  1SW4 A;  1MQG A;  1MY3 A;  4DLD A;  1URS A;  1LB9 A;  4PP0 A;  2QS1 A;  3U94 A;  1P1N A;  4XXU A;  3TCF A;  4H65 A;  1I69 A;  5H8Q A;  4HW8 A;  1A54 A;  3W15 C;  1P1O A;  3UIF A;  2Q88 A;  3KJ7 A;  3MAM A;  4I8C A;  2Z8F A;  1B7H A;  1FW0 A;  4U22 A;  4RPN A;  1FTK A;  2BJJ X;  4FAJ A;  3IOR A;  1TT1 A;  5HM4 B;  1PBP A;  2F7C A;  2XX7 A;  1CB6 A;  3V89 B;  4POX A;  1UIV A;  3KG2 A;  3T22 A;  2H25 A;  5JTY B;  3TTL A;  4H6D A;  4P0G A;  5JEI A;  1FTJ A;  3TCG A;  3U1O A;  5AA2 A;  1Y3Q A;  3RN8 A;  3L6G A;  1H43 A;  3O97 A;  2HZL A;  3FIR A;  1MS7 A;  1QUL A;  4OEU A;  4LAT A;  1DPP A;  2GRV A;  1JQF A;  3SDF A;  4PQJ A;  3H4Z A;  2HCA A;  1Y3N A;  1ZBM A;  4DXB A;  1UTB A;  2P1S A;  3A09 A;  4QFK A;  1T0K A;  3TTN A;  5CC2 A;  4OEN A;  1MM7 A;  4L17 A;  4MBP A;  1MRP A;  4OZ9 A;  1OMP A;  3THI A;  1LAF E;  3O6I A;  4GXS B;  5I2K B;  4GL0 A;  1IXC A;  4U23 A;  3FAS A;  1H44 A;  1EU8 A;  1LBC A;  4F2Q A;  1LFH A;  2H5Y A;  4N13 A;  4OXV A;  5TPA A;  3EHS A;  3Q25 A;  1PEB A;  3U92 A;  1N04 A;  3TQW A;  4POW A;  1R1N A;  2XD2 A;  4JSO A;  1B2H A;  3IK6 B;  1RKM A;  3TTR A;  5H8H B;  4FAT A;  2PYY A;  3ZKL A;  3SKP A;  3F11 A;  2UVI A;  2ZYO A;  3WAE A;  3USD A;  2F36 A;  4PFY A;  4EXK A;  3O6G A;  4YB5 A;  3BBR A;  1A8E A;  2E0S A;  3S9M C;  4YB6 A;  3IOV A;  3M8U A;  3PUZ E;  5H8F B;  2F34 A;  3CFX A;  3DP8 A;  2REJ A;  2HEU A;  1YCJ A;  4KYD A;  4DIG A;  1AL3 A;  3IL1 B;  1VFE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...