3E13X

Iron reconstituted ferric binding protein from campylobacter jejuni
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
317
structure length
317
Chain Sequence
SELNIYSARHYNADFEIIKKFEEKTGIKVNHTQAKASELIKRLSLEGSNSPADIFITADISNLTEAKNLGLLSPVSSKYLEEFIPAHLRDKDKEWFAITKRARIIAYNKNTNIDISKMKNYEDLAKAEFKGEIVMRSATAPYSKTLLASIIANDGNKEAKAWAKGVLENLATNPKGGDRDQARQVFAGEAKFAVMNTYYIGLLKNSKNPKDVEVGNSLGIIFPNQDNRGTHINISGIAMTKSSKNQDAAKKFMEFMLSPEIQKILTDSNYEFPIRNDVELSQTVKDFGTFKEDQIPVSKIAENIKEAVKIYDEVGFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative iron-uptake ABC transport system,periplasmic iron-b
publication title Small hinge motion by the anion-independent ferric binding protein from Campylobacter jejuni
rcsb
source organism Campylobacter jejuni
molecule tags Metal binding protein
total genus 122
structure length 317
sequence length 317
ec nomenclature
pdb deposition date 2008-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF13343 SBP_bac_6 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3e13X01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3e13X02
2ZYNA 1MQGA 2O51A 3T96B 1OMPA 4JSOA 3OO8A 3S9MC 1MY2A 1MXYA 3RLFE 5I59A 4PE5B 1DPPA 4C1UA 2YPNA 3H7MA 4LZ5A 3W9VA 2F97A 1MPCA 1XC1A 1B51A 4P0IA 4O3CA 3PPNA 4TQUQ 1ZKBA 2I4BA 1MXXA 4AB6A 2IEEA 3B6WA 1Y1MA 5I2NA 2F8DA 3L6GA 3EPEA 4OWDA 5ISUA 1BLFA 4XKNA 1SW5A 4AB5A 1MY4A 1Q35A 3TAJA 3C9HA 1XOCA 1MPDA 3FGSA 1QW0A 1Y1ZA 2ANJA 4LQ2A 3SEXA 4RJZA 3SDFA 4DXBA 4U23A 4ESWA 3KN7A 4BDQA 3RY3A 2V25A 5HM4B 1VFEA 1AIVA 1N84A 2Y7RA 3MZBA 1JETA 3EHTA 2O6AA 4KCDA 3KGCA 3IOVA 4IO7A 2NUVA 3BFTA 3S9LC 1LSTA 3K6WA 4NF8B 3IO4A 3C31A 1LBCA 3A09A 3FXRA 1SW4A 1EZPA 5EHMA 3SEWA 3MUQA 3BBRA 2XX9A 2DWAA 3AXFA 4QF9A 1M5DA 3MBPA 4PFTA 4LQ5A 4F1YA 3DP6A 2NWJA 4F3PA 2GH9A 1CB6A 5H8HB 4GFRA 3UN6A 3PPOA 1ZU0A 2G29A 1MS7A 1Z7NE 3KJ7A 1FQBA 1N7WA 3FJGA 2F5XA 4XKRA 1B40A 2O1LA 3K6UA 4X48A 1FQDA 4R73A 1JEUA 4C1TA 1IITA 3Q26A 1NL5A 4KPTA 3B6TA 1LCTA 3IAZA 1FQAA 3GLBA 3IORA 2ALUA 1YPNA 4HS7A 5CC2A 4RK9A 2O7UA 2H25A 4R6KA 1N7XA 4P0GA 5I58B 3UGWA 1N3WA 3TUSA 4ZECA 1O63A 4G68B 1VR5A 1JEVA 3N94A 3OENA 4K3FA 4EQBA 2ABHA 1ZIUA 2OZZA 4JXIA 3MVYA 1POY1 1BP5A 2R9JA 3T9UA 3LSWA 4F3BA 4RK2A 3PUYE 2XXRA 3PUXE 3LSXA 3FATA 3OOAA 1P1NA 5AA2B 1T0KA 2B3FA 3FXQA 4NF8A 2QS3A 4G8HA 4FJPA 1PBPA 2REJA 4LZ8A 2DVCA 5DTBA 4R6YA 3HCQA 2DYXA 4LA9A 2ZYOA 3IR1A 4GWOA 3RN8A 4RPOA 2I58A 1FQCA 4H0WA 1IXIA 1NNKA 3DM0A 3QUFA 4U22A 3W9WA 5HBCA 1HSLA 4F2OA 1UTBA 4G8NA 1FCKA 1NMUA 4M4GA 4YKJA 3T93B 4ZEIA 3RQTA 2H9BA 4R9FA 2QRYA 1O7TA 1A99A 3FV1A 3FJMA 5CMKA 4Z0IA 3K02A 3GXAA 1H44A 3H6VA 3HHFA 4RY1A 4FORA 4KFQA 3G3IA 1DSNA 3BFUA 3MW0A 3SERA 5I58A 3TTRA 3OEMA 4H8IA 1XHYA 4XXUA 1A40A 2DE3A 3VDFA 4PFUA 2GHBA 2Y7IA 4ISUA 1ZBMA 1BIYA 1D4NA 1RYXA 4FAJA 4QHQA 2CMOA 1FTOA 2UVGA 2VP1A 3MZ1A 2O7IA 2F36A 1US5A 1B9JA 4JDFA 2Y84A 5AA2A 4QFLA 2F6GA 2PYYA 4EQ7A 1XS5A 1QUJA 4OTEA 3V89B 2YJPA 3DP8A 1M5EA 3E13X 3K0VA 3FASA 3L6HA 1M5CA 2AL5A 4I62A 3VLWA 4IO3A 1MXWA 2XXYA 2PX1A 4OQOA 1B52A 1UIVA 2X7PA 1DTGA 3MPLA 5DT6A 3O28A 4HCYA 4OHNA 3OEKA 3FJ7A 1H76A 4HTGA 4MLQA 1MDQA 5FHNA 1ZMGA 3HV1A 1MDP1 3U8QA 1DMBA 3TYHA 2I49A 2VOZA 1LCFA 3THIA 4THIA 3ZSFA 3PD8A 4EF2A 2OJTA 3A3UA 1D9VA 4GIZA 3FVGA 4H5FA 2HEUA 2NVUB 4NF4B 4DIGA 4ZEKA 4ZZEA 4EQ9A 3IB2A 2H98A 1QJMA 4YKIA 3CG1A 2AIXA 1UTHB 5I59B 3PMVA 3I6VA 1S9TA 3PUVE 2I0BA 4FATA 4LONB 3D4GA 2DWIA 1EZ9A 3PUWE 5H8FB 4YU0A 3PD9A 3PPRA 2GFEA 5I2NB 3MAMA 4I8CA 2H99A 2Y7KA 2Y7WA 4ZEDA 1LB9A 4RNSA 2HFBA 3C34A 4YMAA 2XXWA 1VFDA 3JYRA 5L9SA 4GXAA 2PT1A 3MJNA 3V8XB 1BKAA 5FHMA 4F1UA 4ZE9A 2GHAA 3H06B 2PT2A 4YB5A 1S50A 2FYIA 1N04A 1P1QA 3PGFA 5ITPA 3LSFB 1R9LA 3FZVA 4R75A 3VE1B 4YICA 1SYIA 1GTKA 3K00A 4KYDA 3CRBA 4BDOA 3MPKA 2P1SA 4KR5A 4H1XA 1SI1A 2NXOA 3HHGA 4U1OA 1Y9UA 2PMSA 4POXA 1MQHA 2XXIA 3MQ9A 3MWBA 3H3GA 1PC3A 2DP8A 2M8CA 1B5IA 2Z8DA 4LATA 4OEVA 2QS2A 1TFDA 2Q89A 4UA8A 5H8SA 4DCYA 1SVXB 3ILTB 1SD3A 3LC8A 4UACA 5I57B 4BLAA 1URGA 2XXTA 2Z23A 4NF4A 1WODA 3OMBA 4JWOA 2QPQA 1UTHA 3CFXA 3FVNA 4MH5A 1B3HA 3TEPA 2XXPA 4EUOA 2REGA 2XD3A 1LFHA 2F7CA 4WKMA 4U2RA 1LFIA 1FTKA 3O6GA 1GV8A 5H8FA 4LP2B 3IX1A 1YTVA 1Y4TA 3VLUA 3CVGA 2ONSA 3JV9A 3ECRA 1NNPA 2F35A 4KYSA 2DWJA 5CMMA 1MXVA 4E0WA 5BUUA 2I6EA 4ZEBA 4R72A 1M5BA 4OXVA 4F39A 3WAFA 4PFYA 3RT6B 1SW2A 4H6DA 1AOVA 1B05A 1JVYA 5AA3A 2ZYMA 3KSXA 3P7IA 3EQ1A 5I84A 2OLBA 5F7VA 4DCXA 1OQGA 3VLVA 2P0SA 1R6ZA 4QSCA 4IO4A 3H6WA 1ELJA 3IOUA 5L9MA 1Z7ME 1ANFA 2AL4A 4WEPA 4BDLA 5L8DA 4ND9A 3TTLA 2OBGA 3C4MA 2HQ0A 2XD2A 3OO9A 3KFMA 4QSDA 3VVDA 3DLNA 3U1OA 4Q30B 1Y4CA 4HW8A 2ONRA 3FV2A 3S9NC 2QMWA 3ZKKA 5I57A 3S9EA 2DE2A 4ELQA 2UXAA 3CSGA 4Q0CA 1BTJA 4F3SA 3Q27A 3PMWA 4F2QA 1B46A 4R2BA 4MLVA 1LAXA 4OFJA 1R1NA 1UTBB 4BDRA 4YKKA 1Y3PA 5DVIA 1LBBA 3RTFB 2AYSA 3C32A 3QXMA 5KZTA 5JTYB 5DYHA 4EF1A 5AA4B 4P11A 3A3CA 2F34A 3IOTA 4EDPA 1QULA 3HPIA 1GR2A 4HCWA 1FQFA 2OWSA 1B1HA 2BJJX 1R9QA 3PMXA 2VD2A 4H67A 1TT1A 1MY0A 3KG2A 4R6HA 5JK4A 3M3KA 4GVOA 1IIWA 4X9TA 1TXFA 2ZXTA 4U4SA 1N3XA 2Q2AA 4POWA 1AH5A 3KN8A 2DOJA 1MRPA 3T22A 1LB8A 3O6IA 1ZTYA 2DS9A 3GBAA 1J1NA 3TCGA 3TPAA 3TDJA 1EH3A 4OYVA 5KDTB 1B6HA 5EYFA 1OVTA 2ZYKA 5IAIA 4YKPA 3OD7A 2F78A 1QUKA 4G77A 2X26A 3FVOA 1B0HA 5AA1A 1VE4A 2HAVA 4N6PA 3IJXB 4QSEA 2DWHA 4YZZA 5KCJA 1MXZA 2IA4A 4G68C 1NNTA 2O69A 1MQJA 2LAOA 2GRVA 2QS4A 3TODA 3I5OA 3KJTA 1A8FA 1A7LA 2ESNA 4FE8A 4YB7A 4NWCA 2ZNSA 2UVHA 4OMBA 5ELVA 3F11A 5H8NB 3TFLA 1MG1A 1MPBA 3H4ZA 3G3JA 1NNFA 5JTYA 2V84A 1D3KA 5AA4A 1SW1A 5CM6A 1B3GA 2Z22A 4I1DA 4DXCA 4BDNA 3M8UA 2A5TB 1NH7A 2F7BA 1USYE 3E9XA 5FTIA 4ZDMA 2VGQA 2NOOA 4L17A 3KOSA 3R7XA 1Y3NA 4YMBA 3KZGA 3G3HA 1B5JA 2KLFA 4IO2A 4F18A 3U93A 3GBBA 2O84X 1H3DA 4FECA 5KDTA 1B3LA 4QFOA 1FTMA 2UVIA 2DXRA 3VVEA 4YAHX 1P1UA 1I6AA 2QSXA 3PV0E 2XXUA 3HN0A 1IXGA 3CG3A 2YLNA 1M5FA 1IXHA 1I69A 3O9PA 1MXUA 5B7DA 2DSFA 3KN3A 3G3FA 4N07A 3R26A 4IB2A 3R6UA 3IB0A 4KYEA 5I2KB 2ZMBA 1POTA 5BWJA 3VVFA 1D9YA 1EZOA 1WDNA 3UORA 2HZLA 1SBPA 5H8NA 3IK6B 2V3UA 2DE4A 4KQPA 2V93A 1XVXA 4OZ9A 3MZ9A 4DLDA 5ITOA 4GXSB 2R6GE 3O66A 2D5WA 3MC2A 4NMYA 5CRYA 4ZEFA 2A5TA 1PBQA 4KD5A 4OVJA 2XX8A 4PQJA 1OLCA 4I9DA 5TP9A 2W7YA 4O3AA 2VD3A 3Q28A 3K6XA 4Q5TA 1IZ1A 4ELRA 4JB7A 2DXYA 5FTHA 2THIA 3K6VA 3G7WA 1JW1A 2B65A 4FEBA 4EXKA 3MVZA 4LVQA 5A5XB 3IOWA 2I3WA 3CIJA 4NF5B 2XXXA 3O2AA 5CBRA 3QUJA 4Z7EA 4TLLB 3UIFA 1JQFA 5HPQA 1Q1KA 4RPNA 4MF3A 1MY3A 2G93A 3T9VA 3FUZA 1MH4A 4JBZA 2DQVA 2VHAA 3UA8A 1P1OA 5I2KA 1SYHA 2V3QA 3RUMA 1Y20A 2UYEA 4GL8A 4GQOA 4QFKA 4GL0A 2XHDA 1QKAA 4LZ7A 4QFPA 3U92A 3M3LA 1PB7A 1SI0A 4QFNA 3TQLA 5FHOA 1S7YA 5K2XA 3H6TA 4F3GA 3MVWA 3Q25A 2OWTA 1QUIA 2PBWA 1LAGE 1LGBC 2QJEA 3TCFA 3H03A 1B4HA 3OSRA 2ZNUA 2Z8EA 4NF6B 4AQ4A 3TELA 5K2YA 5TPAB 3O97A 3H6UA 2Q2CA 4KHZE 4JWXA 2I48A 1JVXA 3I3VA 1DOTA 5DVJA 3TTKA 2O1MA 3EHSA 3E4RA 1GVCA 4U21A 3K1NA 5A5XA 5ICTA 1QKBA 1AMFA 4Q8RA 3QAXA 4NF5A 1FTLA 4N13A 4R9GA 1PDAA 3KSJA 3ZS6A 4DZ1A 4H8JA 4NTLA 1ZLQA 1MQDA 1XT8A 3RGYA 3IB1A 1B7ZA 4ECFA 3IJOB 3TKDA 2D3IA 3KOTA 4DDDA 1LLSA 1LFGA 1UIUA 3PUZE 5DEXB 2RCAA 3TTMA 3Q29A 5CMCA 5LOMA 5H8QB 3QYTA 2RF1A 1JW4A 5ICQA 1A8EA 2CZLA 2I0CA 1H43A 4H5GA 4DE8A 1DTZA 4G8MA 3TMGA 1FTJA 2H4IA 1I6QA 4WXJA 4F29A 5KCJB 4YB6A 3U72A 2ZNTA 1QVSA 1NKXA 4NE4A 4NWDA 2F7AA 5AE4A 3OO7A 4NF6A 1SQYA 3N5LA 1PB8A 5TPAA 3G3GA 3ILUB 4OFLA 2RC9A 1N76A 3UK4A 4ONYA 3SETA 3EHUA 4TOZA 1UQWA 4TLMB 1L5TA 2HAUA 2PVUA 3C35A 3N26A 4IO5A 5B70A 4OESA 3K4UA 1OQHA 4U4XA 3LR1A 4BDMA 3RT8A 2V3TA 1FW0A 5JEIA 5M2VA 1FQEA 1B3FA 1AL3A 4OERA 1HSEA 1B7UA 2XXHA 5TU0A 5F1QA 1MY1A 1IEJA 5J1DA 3S2VA 4XTCQ 4E0XA 3N6TA 3TTNA 3FD3A 3OELA 1MQIA 4ZZAA 5DEXA 3MVXA 3JZJA 2Q88A 3CR9A 4M1VA 2RCBA 5H8QA 5AA2D 1IUDA 4F19A 3FVKA 3FIRA 1OVBA 1US4A 3SEUA 1B3EA 4OEUA 1MM7A 3OXNA 4IY5A 2QL3A 1NFTA 3K01A 3VXCA 1IXCA 2QS1A 1B2HA 3QK6A 4JSDA 1PEBA 3RPWA 3WAEA 2RC7A 1OLAA 3ZKLA 4IY6A 3EF7A 4RYAA 1EU8A 3V5AA 1JNFA 3HSTA 3SESA 3TCHA 4FEDA 4IGTA 5DVFA 3QIMA 3HO7A 1A54A 3OO6A 1B0LA 4PFWA 3TZAA 3IO6A 3VFJA 4LUBA 3CFLA 2I4CA 3B6QA 5H8HA 1O64A 1CE2A 1LAHE 2R71A 1DPEA 3BKIB 2I3VA 2HZKA 2Q8JA 3OSQA 3CFZA 3ODBA 2XX7A 4ELOA 4GF8A 4XKQA 4XKPA 1B7HA 3CI8A 4KI0E 4OETA 3B7DA 4H65A 5TP9B 3LUYA 1ATGA 3DP4A 4G4PA 1URSA 3FXUA 4X1BA 3TQWA 1B5HA 3O29A 3RTWB 4KCCA 3V83A 1VSOA 1KWHA 4G68A 2HCAA 1MM6A 3K1MA 3CSBA 3ONMA 3VXBA 3O6HA 3LBSA 4F22A 2Y7PA 5IKBA 3PPPA 3SEYA 4WEDA 3KEIA 2RC8A 1P1WA 4C0RA 1H45A 1MH3A 2RINA 4ZE8A 1LAFE 1YAEA 2ONKE 3VV5A 1URDA 3PU5A 1N0TA 4FIMA 3EN3A 4O3BA 4X1DA 5CMBA 1A55A 2O68A 4F31B 3E3KA 4IO6A 4U1ZA 5I56B 3MP8A 2DVZA 4XIGQ 3T9HB 2OK2A 4RXLA 4GOTA 4DXUA 1WVJA 3QSLA 4EXLA 4RA1A 1RYOA 2XXVA 2UYFA 4ESXA 1B1XA 2X7QA 1NH8A 4IGRA 3N6UA 1B58A 2WKYA 2H5YA 3UP9A 2Z8FA 3M3FA 2HXWA 3IL1B 4QRZA 2RKMA 4NEDA 1F9BA 3T66A 4GLIA 1B4ZA 3RNNA 1I6BA 2D21A 4F1VA 3MP1A 4R74A 1YCJA 1TWYA 2Q9TA 3S4UA 1GGGA 2E0SA 4MBPA 2E1SA 4OFOA 4OENA 1OIBA 2OCUA 1B32A 5CBSA 3MP6A 2XXQA 4G2ZA 3DELB 5CI5A 4R2FA 2B3BA 4GRKA 4JWYA 3C36A 1II5A 1PB9A 2A5SA 1USYH 1ZJLA 1P99A 3C33A 2FA7A 2F6PA 1TFAA 2UVJA 5L9OA 3LSLA 2P2AA 3G3KA 3K2DA 1IQ7A 1HSJA 5EHSA 1JW5A 1SDXA 3SEVA 3KBRA 3W15C 1Y3QA 3D4CA 3U94A 5I56A 3GZGA 4ZS9A 4ELPA 3USDA 3K1PA 2FNCA 3PPQA 3SKPA 4PP0A 3T9XB 2QMXA 4GD5A 1XVYA 4MFIA 1RKMA 4PETA
chains in the Genus database with same CATH superfamily
2ZYNA 1MQGA 1G0HA 2O51A 4PGNA 3T96B 3ROJA 1OMPA 2F3BA 4JSOA 3OO8A 3S9MC 1MY2A 1MXYA 3RLFE 5I59A 4PE5B 1DPPA 4C1UA 2YPNA 3H7MA 4LZ5A 3W9VA 2F97A 1MPCA 1XC1A 4N8GA 1B51A 4P0IA 4O3CA 3PPNA 4TQUQ 1FPIA 3EKIA 1ZKBA 2I4BA 1MXXA 4AB6A 5IM2A 4O7IA 2IEEA 3B6WA 1Y1MA 5I2NA 2Y5LA 5IZZA 2F8DA 3L6GA 3EPEA 4OWDA 5ISUA 1BLFA 4XKNA 5IZ3B 1SW5A 4AB5A 1MY4A 2V4CA 1Q35A 3TAJA 3C9HA 1XOCA 1MPDA 2DDKA 3FGSA 1QW0A 1Y1ZA 2Q8MA 4P47A 2ANJA 2XWVA 4LQ2A 3SEXA 5EYGA 2Y5KA 4RJZA 3SDFA 4DXBA 2CEXA 4U23A 4ESWA 3KN7A 4BDQA 3RY3A 2V25A 5HM4B 1VFEA 1AIVA 1N84A 2Y7RA 3MZBA 1JETA 3EHTA 2O6AA 1NV3A 2ZZWA 4KCDA 3KGCA 3IOVA 4IO7A 2NUVA 5IZ1A 3BFTA 3S9LC 1KA0A 1LSTA 3K6WA 4NF8B 3IO4A 1FPLA 3C31A 1LBCA 3A09A 3FXRA 1SW4A 4G61A 1EZPA 5EHMA 3SEWA 3MUQA 3BBRA 2XX9A 3RYDA 2DWAA 4P56A 1LBWA 3AXFA 4QF9A 1M5DA 3MBPA 4PFTA 4LQ5A 2FBPA 4F1YA 1YZ0A 3DP6A 1FRPA 1JP4A 2NWJA 4F3PA 4PGPA 2GH9A 1CB6A 5H8HB 4GFRA 3UN6A 3PPOA 5EYHA 1ZU0A 2G29A 1MS7A 1Z7NE 3KJ7A 1FQBA 1N7WA 3FJGA 2F5XA 4QBAA 1FPDA 4XKRA 1B40A 4NQ8A 2O1LA 5IZ3A 3K6UA 4X48A 1FQDA 4R73A 1JEUA 4C1TA 1IMEA 1IITA 3Q26A 1NL5A 4KPTA 3B6TA 1LCTA 3IAZA 1FQAA 4N17A 3GLBA 4MNPA 3IORA 2ALUA 1YPNA 4H45A 4HS7A 5CC2A 4RK9A 2O7UA 2H25A 2XWIA 4R6KA 1N7XA 4P0GA 5I58B 3UGWA 1N3WA 3TUSA 4ZECA 1O63A 4G68B 5ET8A 1VR5A 1JEVA 3N94A 1Q9DA 3OENA 4K3FA 4EQBA 2ABHA 1ZIUA 2OZZA 4JXIA 3MVYA 1POY1 1BP5A 2R9JA 4IR8A 3T9UA 3LSWA 4F3BA 4RK2A 3PUYE 2XXRA 3PUXE 4PCDA 3LSXA 3FATA 4MEVA 4P3LA 3OOAA 2FIEA 1P1NA 5AA2B 1T0KA 2B3FA 3FXQA 4NF8A 2QS3A 4G8HA 4FJPA 1PBPA 2BJIA 2REJA 4LZ8A 2DVCA 5DTBA 4R6YA 3HCQA 2DYXA 4LA9A 2ZYOA 4NX1A 1AWBA 3IR1A 4P9KA 4GWOA 3RN8A 1EYKA 4RPOA 2I58A 1FQCA 2QVUA 4H0WA 1IXIA 1NNKA 3DM0A 3QUFA 4U22A 3W9WA 5HBCA 1DCUA 1HSLA 4F2OA 1UTBA 4G8NA 1FCKA 1NMUA 3IFCA 4M4GA 4YKJA 4XFEA 3T93B 5J16A 4ZEIA 3GYYA 3RQTA 2H9BA 4OVQA 4R9FA 1FBCA 2QRYA 5EQ8A 1O7TA 2WYPA 4PTKA 1A99A 3FV1A 3FJMA 3HFUA 5CMKA 4Z0IA 4N8YA 3K02A 3GXAA 1H44A 3H6VA 1NUWA 1FBDA 3HHFA 4RY1A 4FORA 4KFQA 3G3IA 1DSNA 3BFUA 3MW0A 3SERA 5I58A 3TTRA 3OEMA 4H8IA 1XHYA 4XXUA 1A40A 2DE3A 3VDFA 4PFUA 2PFZA 2GHBA 2Y7IA 4ISUA 1FPJA 1ZBMA 1BIYA 1D4NA 1RYXA 4FAJA 4QHQA 2CMOA 1FTOA 2UVGA 2VP1A 3MZ1A 4QXDA 2O7IA 2F36A 1US5A 5EQ9A 1B9JA 5I5PA 4JDFA 2Y84A 5AA2A 4QFLA 4OVSA 2F6GA 2PYYA 4EQ7A 1XS5A 4OTEA 1QUJA 3V89B 4GX3A 2WX9A 2YJPA 4DI3D 2HPGA 1NV6A 3DP8A 1M5EA 3E13X 3K0VA 4MIJA 3FASA 3L6HA 1M5CA 2AL5A 4I62A 3VLWA 4IO3A 1MXWA 2XXYA 2PX1A 4OQOA 1B52A 1UIVA 2X7PA 1DTGA 3MPLA 2R8TA 5DT6A 3O28A 4HCYA 1KZ8A 4OHNA 3OEKA 2XWOA 3FJ7A 1H76A 1FSAA 4HTGA 4I40A 4MLQA 1MDQA 5FHNA 4MNIA 4O94A 1ZMGA 3HV1A 1MDP1 3U8QA 1DMBA 3TYHA 2I49A 2VOZA 1LCFA 3THIA 4THIA 1CNQA 3ZSFA 3PD8A 3B50A 4N81A 4EF2A 2OJTA 3A3UA 1D9VA 4GIZA 3FVGA 4H5FA 2QVRA 2HEUA 1FPGA 4GWXA 2NVUB 4NF4B 4DIGA 4ZEKA 4ZZEA 4EQ9A 3IB2A 2H98A 1QJMA 4YKIA 3CG1A 2AIXA 1UTHB 5I59B 3PMVA 3I6VA 1S9TA 3PUVE 2I0BA 4FATA 4LONB 3D4GA 2DWIA 1EZ9A 5F24A 4KXPA 3PUWE 5H8FB 4YU0A 3PD9A 3PPRA 2GFEA 5I2NB 3MAMA 4I8CA 2H99A 2MKZA 2Y7KA 2Y7WA 1EYIA 4ZEDA 1DBZA 1LB9A 4RNSA 2HFBA 3C34A 4YMAA 2XXWA 1VFDA 3JYRA 1FBFA 5L9SA 4GXAA 2PT1A 3MJNA 3V8XB 1BKAA 2XA5A 5FHMA 4F1UA 4ZE9A 2GHAA 3H06B 4N6KA 2PT2A 4NAPA 4YB5A 1S50A 4OVRA 1RDZA 2FYIA 1N04A 1P1QA 4FBPA 3PGFA 5ITPA 3LSFB 1R9LA 3FZVA 4R75A 3VE1B 4YICA 1SYIA 1GTKA 3K00A 4KYDA 3CRBA 4BDOA 3MPKA 2P1SA 4JVIA 4KR5A 2HXRA 4H1XA 1SI1A 2NXOA 3HHGA 4U1OA 1Y9UA 2PMSA 4POXA 1MQHA 2CEYA 2XXIA 3MQ9A 3MWBA 1NV7A 3H3GA 1PC3A 2DP8A 2M8CA 1B5IA 2Z8DA 4LATA 4OEVA 2QS2A 1TFDA 2Q89A 4UA8A 5H8SA 4DCYA 1FPKA 1FPFA 1SVXB 3ILTB 1SD3A 2VPOA 3LC8A 4UACA 5I57B 4BLAA 1URGA 2XXTA 2Z23A 4NF4A 1WODA 3OMBA 4JWOA 2QPQA 1UTHA 3CFXA 3FVNA 3LUZA 4MH5A 1B3HA 3TEPA 2XXPA 4EUOA 2REGA 2XD3A 1DK4A 1LFHA 2F7CA 4WKMA 4U2RA 1LFIA 1FTKA 3O6GA 1GV8A 5H8FA 4LP2B 3IX1A 1YTVA 1Y4TA 3VLUA 3CVGA 2ONSA 3JV9A 3ECRA 1NNPA 2F35A 4KYSA 2DWJA 5CMMA 1MXVA 4E0WA 5BUUA 2I6EA 4ZEBA 4R72A 1M5BA 4OXVA 4F39A 3WAFA 4PFYA 3RT6B 1SW2A 4H6DA 1AOVA 1B05A 1LBYA 1JVYA 5AA3A 2ZYMA 3KSXA 3P7IA 3EQ1A 4MNCA 5I84A 2OLBA 5F7VA 2KQZA 4DCXA 1OQGA 3VLVA 2P0SA 1R6ZA 4QSCA 4IO4A 1KA1A 3H6WA 1ELJA 1NV2A 2FVZA 3IOUA 5L9MA 1Z7ME 2JJKA 1ANFA 2AL4A 4WEPA 4BDLA 4N91A 5L8DA 4ND9A 3TTLA 2OBGA 3C4MA 4NN3A 2HQ0A 2XD2A 3OO9A 3KFMA 4N4UA 1FBHA 4QSDA 5I7IA 3VVDA 3DLNA 3U1OA 4Q30B 1Y4CA 4HW8A 2ONRA 3FV2A 3S9NC 2QMWA 3ZKKA 5I57A 1BK4A 3S9EA 2DE2A 4ELQA 2UXAA 3CSGA 4Q0CA 1BTJA 4F3SA 3Q27A 3PMWA 4F2QA 1B46A 4R2BA 4MLVA 4MMPA 1LAXA 4OFJA 4PDHA 1R1NA 1UTBB 4BDRA 4YKKA 1Y3PA 5DVIA 1LBBA 3RTFB 2AYSA 3C32A 3QXMA 5KZTA 5JTYB 4X04A 5DYHA 4EF1A 3PTYA 5AA4B 4P11A 3A3CA 2F34A 4PF8A 3IOTA 4EDPA 1QULA 3HPIA 1GR2A 4HCWA 1FQFA 2OWSA 1FJ9A 1B1HA 1NV4A 2BJJX 1R9QA 3PMXA 2VD2A 4H67A 1TT1A 1MY0A 3KG2A 4R6HA 5JK4A 3M3KA 4GVOA 1IIWA 4X9TA 1TXFA 2ZXTA 4PFIA 4U4SA 1IMAA 1N3XA 2Q2AA 1INPA 4POWA 4PBHA 1AH5A 4OVPA 3KN8A 2DOJA 1MRPA 4XEQA 3T22A 1LB8A 3O6IA 1ZTYA 1FJ6A 2DS9A 3GBAA 4PAKA 1J1NA 3TCGA 3TPAA 1FPBA 4GX4A 3TDJA 1EH3A 5IGAA 4OYVA 5KDTB 1B6HA 5EYFA 1OVTA 5DW8A 2ZYKA 5IAIA 3A29A 4YKPA 3OD7A 2F78A 1QUKA 2P3NA 4G77A 2X26A 3FVOA 1B0HA 2FHYA 5AA1A 1VE4A 1NUYA 2HAVA 4N6PA 3IJXB 4QSEA 2DWHA 4YZZA 5KCJA 1MXZA 2IA4A 2VPNA 2F3DA 4G68C 4P1LA 1NNTA 5ET7A 4H46A 2O69A 3E78A 1MQJA 2LAOA 4NHBA 2GRVA 2QS4A 3TODA 3I5OA 1LBVA 4PAFA 5ESYA 3KJTA 1A8FA 1A7LA 2ESNA 4FE8A 4YB7A 4NWCA 2ZNSA 2UVHA 4OMBA 5ELVA 3F11A 4GWSA 5H8NB 3TFLA 5FBPA 1MG1A 1MPBA 3H4ZA 3G3JA 1NNFA 5JTYA 2V84A 1D3KA 1K9ZA 5AA4A 1SW1A 1NV0A 5CM6A 1B3GA 2Z22A 4I1DA 4DXCA 4BDNA 3M8UA 2A5TB 1NH7A 1FPEA 2F7BA 1USYE 3E9XA 1YXIA 5FTIA 4ZDMA 2VGQA 2NOOA 4PBQA 2B4LA 4L17A 4GWUA 3KOSA 3R7XA 1Y3NA 3KC1A 4YMBA 1SPIA 3KZGA 3G3HA 1B5JA 2KLFA 4IO2A 4F18A 3U93A 3GBBA 2O84X 3B8BA 1H3DA 4FECA 5KDTA 1B3LA 4QFOA 4NG7A 1FTMA 2UVIA 2DXRA 3VVEA 4YAHX 1P1UA 1I6AA 2QSXA 3PV0E 2XXUA 3HN0A 1IXGA 3CG3A 2YLNA 1M5FA 1IXHA 1I69A 3O9PA 4PFRA 5ET6A 1MXUA 5B7DA 2DSFA 3KN3A 3G3FA 4N07A 3R26A 4IB2A 3R6UA 2ZZXA 3IB0A 4KYEA 5I2KB 2ZMBA 1D9QA 1POTA 5BWJA 1NUXA 3VVFA 4AS4A 1D9YA 1EZOA 1WDNA 3UORA 2WBBA 2HZLA 1SBPA 5H8NA 3IK6B 4JVDA 2V3UA 4GWYA 3T0JA 2DE4A 4KQPA 2V93A 1XVXA 4OZ9A 3MZ9A 4DLDA 5ITOA 4GXSB 3KBZA 2R6GE 3SZPA 3O66A 2D5WA 3MC2A 4NMYA 5CRYA 4ZEFA 2A5TA 1PBQA 4KD5A 4OVJA 4P1EA 2XX8A 4PQJA 1OLCA 4I9DA 4PFBA 5TP9A 2W7YA 4O3AA 2VD3A 3Q28A 3K6XA 4Q5TA 1IZ1A 4ELRA 4JB7A 2DXYA 3BIHA 3CHGA 5FTHA 2WBDA 2THIA 2WYKA 3K6VA 3G7WA 1JW1A 2B65A 4FEBA 4MX6A 4EXKA 3MVZA 4LVQA 5A5XB 3IOWA 2I3WA 4O8MA 1LBXA 3CIJA 4PF6A 4NF5B 2XXXA 3O2AA 5CBRA 3QUJA 4Z7EA 4TLLB 3UIFA 1JQFA 5HPQA 1Q1KA 4RPNA 4MF3A 1MY3A 4O7MA 2G93A 3T9VA 3FUZA 1MH4A 5EQ7A 4JBZA 3NOHA 1NV1A 2DQVA 2VHAA 4OA4A 3UA8A 1P1OA 5I2KA 1SYHA 2V3QA 2CZKA 3RUMA 1IMBA 1Y20A 4GBVA 2UYEA 4GL8A 4GQOA 4QFKA 4GL0A 3LV0A 2XHDA 1QKAA 4LZ7A 4QFPA 3U92A 4UABA 3M3LA 1PB7A 1SI0A 4QFNA 3TQLA 5FHOA 1S7YA 1FTAA 5K2XA 3H6TA 4F3GA 3QMFA 3MVWA 3Q25A 2OWTA 1QUIA 2PBWA 1LAGE 1LGBC 2QJEA 1RDXA 3TCFA 3H03A 1B4HA 3OSRA 2ZNUA 2Z8EA 4NF6B 4AQ4A 3TELA 5K2YA 1NV5A 5TPAB 3O97A 3H6UA 2OX3A 2Q2CA 4KHZE 4JWXA 2I48A 1JVXA 3I3VA 1DOTA 1K9YA 5DVJA 3TTKA 3FXBA 2O1MA 3EHSA 2B4MA 2WEFA 3E4RA 5T3JA 1GVCA 4U21A 3K1NA 5A5XA 5ICTA 4HE0A 1QKBA 1AMFA 4Q8RA 3QAXA 4NF5A 1FTLA 4N13A 4R9GA 1PDAA 4GBWA 3KSJA 3ZS6A 1LEVA 4H8JA 4DZ1A 1EYJA 4NTLA 2CZHA 1ZLQA 1MQDA 1XT8A 3IB1A 2XWKA 3RGYA 1B7ZA 4ECFA 4P8BA 3IJOB 3TKDA 2D3IA 3KOTA 1LLSA 4DDDA 1LFGA 1FBGA 1UIUA 1VDWA 3PUZE 5DEXB 1NUZA 2RCAA 3TTMA 3Q29A 5CMCA 5LOMA 1YYZA 5H8QB 1IMCA 3QYTA 2RF1A 1JW4A 5ICQA 1A8EA 2CZLA 2I0CA 1H43A 2QVVA 4H5GA 4DE8A 1DTZA 3RPLB 4G8MA 3TMGA 1FTJA 2H4IA 1I6QA 2ZZVA 4WXJA 4PDDA 4F29A 5KCJB 4YB6A 4MCOA 3U72A 2ZNTA 1QVSA 1NKXA 4NE4A 4NWDA 2F7AA 5AE4A 3OO7A 4NF6A 1SQYA 3N5LA 1PB8A 5TPAA 3G3GA 3ILUB 4OFLA 2RC9A 1N76A 3UK4A 4ONYA 4I3YA 3SETA 3EHUA 4TOZA 4MHFA 2PCRA 1UQWA 1LBZA 4NF0A 1IMFA 4TLMB 4X8RA 1L5TA 1FBPA 2HAUA 2PVUA 3C35A 3N26A 4IO5A 4I3EA 5B70A 4OESA 3K4UA 3FBPA 1OQHA 4U4XA 3LR1A 4BDMA 3RT8A 2V3TA 1FW0A 5JEIA 5M2VA 1FQEA 1B3FA 1AL3A 4OERA 1HSEA 1B7UA 2XXHA 5LDZA 4MAGA 3MSTA 5TU0A 5F1QA 4GX6A 1MY1A 1IEJA 5LTCA 5J1DA 3S2VA 4XTCQ 4E0XA 3N6TA 3KC0A 3E79A 3TTNA 3FD3A 3OELA 1IMDA 2Q74A 1MQIA 4HE2A 4ZZAA 5DEXA 3MVXA 3JZJA 2Q88A 3CR9A 4M1VA 1RDYA 2RCBA 5H8QA 5AA2D 1IUDA 4F19A 3FVKA 3FIRA 1OVBA 1QGXA 2HHMA 1US4A 3SEUA 1B3EA 3RPLA 4OEUA 1MM7A 3OXNA 4IY5A 1G0IA 2QL3A 1NFTA 3K01A 3VXCA 1IXCA 4MJOA 4AS5A 2QS1A 2FIXA 2OWZA 1B2HA 3QK6A 4JSDA 1PEBA 3RPWA 3WAEA 2RC7A 1OLAA 3ZKLA 4IY6A 3EF7A 4RYAA 1EU8A 3V5AA 1JNFA 3HSTA 1NI9A 3SESA 3TCHA 4FEDA 4IGTA 5DVFA 3QIMA 2QFLA 3HO7A 1A54A 3OO6A 2PFYA 1B0LA 4PFWA 3TZAA 3IO6A 3VFJA 4LUBA 3CFLA 2I4CA 3B6QA 3T1BA 5H8HA 1O64A 4XF5A 1CE2A 1LAHE 2R71A 1DPEA 2KR0A 3BKIB 2I3VA 2HZKA 2Q8JA 3OSQA 3CFZA 3ODBA 2XX7A 4ELOA 4GF8A 4XKQA 4XKPA 3MYUA 1B7HA 3CI8A 4KI0E 4OETA 3B7DA 4H65A 5TP9B 4N15A 3LUYA 1ATGA 3DP4A 4G4PA 1URSA 3FXUA 4X1BA 3TQWA 1B5HA 3O29A 3RTWB 4KCCA 3V83A 1VSOA 1KWHA 4G68A 2HCAA 1FBEA 1MM6A 3K1MA 5ET5A 3D1RA 3CSBA 3ONMA 3VXBA 3O6HA 3BIGA 3LBSA 4F22A 2Y7PA 5IKBA 3PPPA 3SEYA 4WEDA 3KEIA 4PAIA 2RC8A 5EQAA 1P1WA 4C0RA 1H45A 1MH3A 2RINA 4ZE8A 1LAFE 1YAEA 2ONKE 3VV5A 1URDA 3PU5A 1N0TA 4FIMA 3EN3A 4O3BA 4X1DA 5CMBA 2GQ1A 1A55A 2O68A 4F31B 3E3KA 3IFAA 4IO6A 4OVTA 4U1ZA 4NGUA 5I56B 3MP8A 2DVZA 4PC9A 4XIGQ 3T9HB 2OK2A 4RXLA 4GOTA 4DXUA 1WVJA 3QSLA 4EXLA 4RA1A 1RYOA 2XXVA 2UYFA 4ESXA 1B1XA 2X7QA 2L5VA 1NH8A 4HE1A 4IGRA 3N6UA 1B58A 2P3VA 2XXKA 2WKYA 2H5YA 3UP9A 1XI6A 2Z8FA 3M3FA 2HXWA 3IL1B 4QRZA 2RKMA 4NEDA 1F9BA 3T66A 4GLIA 4GWZA 1B4ZA 3RNNA 5I3SA 1I6BA 2D21A 4F1VA 4GWWA 3MP1A 4R74A 3U65A 1YCJA 1TWYA 2Q9TA 2CZIA 3S4UA 1GGGA 4DI4B 2E0SA 4MBPA 2E1SA 4OFOA 4OENA 4HXVA 1OIBA 2VT5A 2OCUA 1B32A 5CBSA 3MP6A 2XXQA 4G2ZA 3DELB 5CI5A 4R2FA 2B3BA 4GRKA 4JWYA 3C36A 1II5A 1PB9A 2A5SA 1USYH 1ZJLA 1P99A 3C33A 2FA7A 2F6PA 1TFAA 4LN5A 2UVJA 5L9OA 3LSLA 2P2AA 3G3KA 5A5LA 4JVCA 3K2DA 1IQ7A 3ISPA 1HSJA 5EHSA 1JW5A 1SDXA 3SEVA 3KBRA 3W15C 1Y3QA 3D4CA 4OANA 3U94A 5I56A 3GZGA 4ZS9A 4ELPA 3USDA 3K1PA 2FNCA 3PPQA 4N6DA 3SKPA 4PE3A 4PP0A 3T9XB 2QMXA 4GD5A 1XVYA 4MFIA 1RKMA 4PETA
chains in the Genus database with same CATH topology
2ZYNA 1MQGA 2O51A 3T96B 1OMPA 4JSOA 3OO8A 3S9MC 1MY2A 1MXYA 3RLFE 5I59A 4PE5B 1DPPA 4C1UA 2YPNA 3H7MA 4LZ5A 3W9VA 2F97A 1MPCA 1XC1A 1B51A 4P0IA 4O3CA 3PPNA 4TQUQ 1ZKBA 2I4BA 1MXXA 4AB6A 2IEEA 3B6WA 1Y1MA 5I2NA 2F8DA 3L6GA 3EPEA 4OWDA 5ISUA 1BLFA 4XKNA 1SW5A 4AB5A 1MY4A 1Q35A 3TAJA 3C9HA 1XOCA 1MPDA 3FGSA 1QW0A 1Y1ZA 2ANJA 4LQ2A 3SEXA 4RJZA 3SDFA 4DXBA 4U23A 4ESWA 3KN7A 4BDQA 3RY3A 2V25A 5HM4B 1VFEA 1AIVA 1N84A 2Y7RA 3MZBA 1JETA 3EHTA 2O6AA 4KCDA 3KGCA 3IOVA 4IO7A 2NUVA 3BFTA 3S9LC 1LSTA 3K6WA 4NF8B 3IO4A 3C31A 1LBCA 3A09A 3FXRA 1SW4A 1EZPA 5EHMA 3SEWA 3MUQA 3BBRA 2XX9A 2DWAA 3AXFA 4QF9A 1M5DA 3MBPA 4PFTA 4LQ5A 4F1YA 3DP6A 2NWJA 4F3PA 2GH9A 1CB6A 5H8HB 4GFRA 3UN6A 3PPOA 1ZU0A 2G29A 1MS7A 1Z7NE 3KJ7A 1FQBA 1N7WA 3FJGA 2F5XA 4XKRA 1B40A 2O1LA 3K6UA 4X48A 1FQDA 4R73A 1JEUA 4C1TA 1IITA 3Q26A 1NL5A 4KPTA 3B6TA 1LCTA 3IAZA 1FQAA 3GLBA 3IORA 2ALUA 1YPNA 4HS7A 5CC2A 4RK9A 2O7UA 2H25A 4R6KA 1N7XA 4P0GA 5I58B 3UGWA 1N3WA 3TUSA 4ZECA 1O63A 4G68B 1VR5A 1JEVA 3N94A 3OENA 4K3FA 4EQBA 2ABHA 1ZIUA 2OZZA 4JXIA 3MVYA 1POY1 1BP5A 2R9JA 3T9UA 3LSWA 4F3BA 4RK2A 3PUYE 2XXRA 3PUXE 3LSXA 3FATA 3OOAA 1P1NA 5AA2B 1T0KA 2B3FA 3FXQA 4NF8A 2QS3A 4G8HA 4FJPA 1PBPA 2REJA 4LZ8A 2DVCA 5DTBA 4R6YA 3HCQA 2DYXA 4LA9A 2ZYOA 3IR1A 4GWOA 3RN8A 4RPOA 2I58A 1FQCA 4H0WA 1IXIA 1NNKA 3DM0A 3QUFA 4U22A 3W9WA 5HBCA 1HSLA 4F2OA 1UTBA 4G8NA 1FCKA 1NMUA 4M4GA 4YKJA 3T93B 4ZEIA 3RQTA 2H9BA 4R9FA 2QRYA 1O7TA 1A99A 3FV1A 3FJMA 5CMKA 4Z0IA 3K02A 3GXAA 1H44A 3H6VA 3HHFA 4RY1A 4FORA 4KFQA 3G3IA 1DSNA 3BFUA 3MW0A 3SERA 5I58A 3TTRA 3OEMA 4H8IA 1XHYA 4XXUA 1A40A 2DE3A 3VDFA 4PFUA 2GHBA 2Y7IA 4ISUA 1ZBMA 1BIYA 1D4NA 1RYXA 4FAJA 4QHQA 2CMOA 1FTOA 2UVGA 2VP1A 3MZ1A 2O7IA 2F36A 1US5A 1B9JA 4JDFA 2Y84A 5AA2A 4QFLA 2F6GA 2PYYA 4EQ7A 1XS5A 1QUJA 4OTEA 3V89B 2YJPA 3DP8A 1M5EA 3E13X 3K0VA 3FASA 3L6HA 1M5CA 2AL5A 4I62A 3VLWA 4IO3A 1MXWA 2XXYA 2PX1A 4OQOA 1B52A 1UIVA 2X7PA 1DTGA 3MPLA 5DT6A 3O28A 4HCYA 4OHNA 3OEKA 3FJ7A 1H76A 4HTGA 4MLQA 1MDQA 5FHNA 1ZMGA 3HV1A 1MDP1 3U8QA 1DMBA 3TYHA 2I49A 2VOZA 1LCFA 3THIA 4THIA 3ZSFA 3PD8A 4EF2A 2OJTA 3A3UA 1D9VA 4GIZA 3FVGA 4H5FA 2HEUA 2NVUB 4NF4B 4DIGA 4ZEKA 4ZZEA 4EQ9A 3IB2A 2H98A 1QJMA 4YKIA 3CG1A 2AIXA 1UTHB 5I59B 3PMVA 3I6VA 1S9TA 3PUVE 2I0BA 4FATA 4LONB 3D4GA 2DWIA 1EZ9A 3PUWE 5H8FB 4YU0A 3PD9A 3PPRA 2GFEA 5I2NB 3MAMA 4I8CA 2H99A 2Y7KA 2Y7WA 4ZEDA 1LB9A 4RNSA 2HFBA 3C34A 4YMAA 2XXWA 1VFDA 3JYRA 5L9SA 4GXAA 2PT1A 3MJNA 3V8XB 1BKAA 5FHMA 4F1UA 4ZE9A 2GHAA 3H06B 2PT2A 4YB5A 1S50A 2FYIA 1N04A 1P1QA 3PGFA 5ITPA 3LSFB 1R9LA 3FZVA 4R75A 3VE1B 4YICA 1SYIA 1GTKA 3K00A 4KYDA 3CRBA 4BDOA 3MPKA 2P1SA 4KR5A 4H1XA 1SI1A 2NXOA 3HHGA 4U1OA 1Y9UA 2PMSA 4POXA 1MQHA 2XXIA 3MQ9A 3MWBA 3H3GA 1PC3A 2DP8A 2M8CA 1B5IA 2Z8DA 4LATA 4OEVA 2QS2A 1TFDA 2Q89A 4UA8A 5H8SA 4DCYA 1SVXB 3ILTB 1SD3A 3LC8A 4UACA 5I57B 4BLAA 1URGA 2XXTA 2Z23A 4NF4A 1WODA 3OMBA 4JWOA 2QPQA 1UTHA 3CFXA 3FVNA 4MH5A 1B3HA 3TEPA 2XXPA 4EUOA 2REGA 2XD3A 1LFHA 2F7CA 4WKMA 4U2RA 1LFIA 1FTKA 3O6GA 1GV8A 5H8FA 4LP2B 3IX1A 1YTVA 1Y4TA 3VLUA 3CVGA 2ONSA 3JV9A 3ECRA 1NNPA 2F35A 4KYSA 2DWJA 5CMMA 1MXVA 4E0WA 5BUUA 2I6EA 4ZEBA 4R72A 1M5BA 4OXVA 4F39A 3WAFA 4PFYA 3RT6B 1SW2A 4H6DA 1AOVA 1B05A 1JVYA 5AA3A 2ZYMA 3KSXA 3P7IA 3EQ1A 5I84A 2OLBA 5F7VA 4DCXA 1OQGA 3VLVA 2P0SA 1R6ZA 4QSCA 4IO4A 3H6WA 1ELJA 3IOUA 5L9MA 1Z7ME 1ANFA 2AL4A 4WEPA 4BDLA 5L8DA 4ND9A 3TTLA 2OBGA 3C4MA 2HQ0A 2XD2A 3OO9A 3KFMA 4QSDA 3VVDA 3DLNA 3U1OA 4Q30B 1Y4CA 4HW8A 2ONRA 3FV2A 3S9NC 2QMWA 3ZKKA 5I57A 3S9EA 2DE2A 4ELQA 2UXAA 3CSGA 4Q0CA 1BTJA 4F3SA 3Q27A 3PMWA 4F2QA 1B46A 4R2BA 4MLVA 1LAXA 4OFJA 1R1NA 1UTBB 4BDRA 4YKKA 1Y3PA 5DVIA 1LBBA 3RTFB 2AYSA 3C32A 3QXMA 5KZTA 5JTYB 5DYHA 4EF1A 5AA4B 4P11A 3A3CA 2F34A 3IOTA 4EDPA 1QULA 3HPIA 1GR2A 4HCWA 1FQFA 2OWSA 1B1HA 2BJJX 1R9QA 3PMXA 2VD2A 4H67A 1TT1A 1MY0A 3KG2A 4R6HA 5JK4A 3M3KA 4GVOA 1IIWA 4X9TA 1TXFA 2ZXTA 4U4SA 1N3XA 2Q2AA 4POWA 1AH5A 3KN8A 2DOJA 1MRPA 3T22A 1LB8A 3O6IA 1ZTYA 2DS9A 3GBAA 1J1NA 3TCGA 3TPAA 3TDJA 1EH3A 4OYVA 5KDTB 1B6HA 5EYFA 1OVTA 2ZYKA 5IAIA 4YKPA 3OD7A 2F78A 1QUKA 4G77A 2X26A 3FVOA 1B0HA 5AA1A 1VE4A 2HAVA 4N6PA 3IJXB 4QSEA 2DWHA 4YZZA 5KCJA 1MXZA 2IA4A 4G68C 1NNTA 2O69A 1MQJA 2LAOA 2GRVA 2QS4A 3TODA 3I5OA 3KJTA 1A8FA 1A7LA 2ESNA 4FE8A 4YB7A 4NWCA 2ZNSA 2UVHA 4OMBA 5ELVA 3F11A 5H8NB 3TFLA 1MG1A 1MPBA 3H4ZA 3G3JA 1NNFA 5JTYA 2V84A 1D3KA 5AA4A 1SW1A 5CM6A 1B3GA 2Z22A 4I1DA 4DXCA 4BDNA 3M8UA 2A5TB 1NH7A 2F7BA 1USYE 3E9XA 5FTIA 4ZDMA 2VGQA 2NOOA 4L17A 3KOSA 3R7XA 1Y3NA 4YMBA 3KZGA 3G3HA 1B5JA 2KLFA 4IO2A 4F18A 3U93A 3GBBA 2O84X 1H3DA 4FECA 5KDTA 1B3LA 4QFOA 1FTMA 2UVIA 2DXRA 3VVEA 4YAHX 1P1UA 1I6AA 2QSXA 3PV0E 2XXUA 3HN0A 1IXGA 3CG3A 2YLNA 1M5FA 1IXHA 1I69A 3O9PA 1MXUA 5B7DA 2DSFA 3KN3A 3G3FA 4N07A 3R26A 4IB2A 3R6UA 3IB0A 4KYEA 5I2KB 2ZMBA 1POTA 5BWJA 3VVFA 1D9YA 1EZOA 1WDNA 3UORA 2HZLA 1SBPA 5H8NA 3IK6B 2V3UA 2DE4A 4KQPA 2V93A 1XVXA 4OZ9A 3MZ9A 4DLDA 5ITOA 4GXSB 2R6GE 3O66A 2D5WA 3MC2A 4NMYA 5CRYA 4ZEFA 2A5TA 1PBQA 4KD5A 4OVJA 2XX8A 4PQJA 1OLCA 4I9DA 5TP9A 2W7YA 4O3AA 2VD3A 3Q28A 3K6XA 4Q5TA 1IZ1A 4ELRA 4JB7A 2DXYA 5FTHA 2THIA 3K6VA 3G7WA 1JW1A 2B65A 4FEBA 4EXKA 3MVZA 4LVQA 5A5XB 3IOWA 2I3WA 3CIJA 4NF5B 2XXXA 3O2AA 5CBRA 3QUJA 4Z7EA 4TLLB 3UIFA 1JQFA 5HPQA 1Q1KA 4RPNA 4MF3A 1MY3A 2G93A 3T9VA 3FUZA 1MH4A 4JBZA 2DQVA 2VHAA 3UA8A 1P1OA 5I2KA 1SYHA 2V3QA 3RUMA 1Y20A 2UYEA 4GL8A 4GQOA 4QFKA 4GL0A 2XHDA 1QKAA 4LZ7A 4QFPA 3U92A 3M3LA 1PB7A 1SI0A 4QFNA 3TQLA 5FHOA 1S7YA 5K2XA 3H6TA 4F3GA 3MVWA 3Q25A 2OWTA 1QUIA 2PBWA 1LAGE 1LGBC 2QJEA 3TCFA 3H03A 1B4HA 3OSRA 2ZNUA 2Z8EA 4NF6B 4AQ4A 3TELA 5K2YA 5TPAB 3O97A 3H6UA 2Q2CA 4KHZE 4JWXA 2I48A 1JVXA 3I3VA 1DOTA 5DVJA 3TTKA 2O1MA 3EHSA 3E4RA 1GVCA 4U21A 3K1NA 5A5XA 5ICTA 1QKBA 1AMFA 4Q8RA 3QAXA 4NF5A 1FTLA 4N13A 4R9GA 1PDAA 3KSJA 3ZS6A 4DZ1A 4H8JA 4NTLA 1ZLQA 1MQDA 1XT8A 3RGYA 3IB1A 1B7ZA 4ECFA 3IJOB 3TKDA 2D3IA 3KOTA 4DDDA 1LLSA 1LFGA 1UIUA 3PUZE 5DEXB 2RCAA 3TTMA 3Q29A 5CMCA 5LOMA 5H8QB 3QYTA 2RF1A 1JW4A 5ICQA 1A8EA 2CZLA 2I0CA 1H43A 4H5GA 4DE8A 1DTZA 4G8MA 3TMGA 1FTJA 2H4IA 1I6QA 4WXJA 4F29A 5KCJB 4YB6A 3U72A 2ZNTA 1QVSA 1NKXA 4NE4A 4NWDA 2F7AA 5AE4A 3OO7A 4NF6A 1SQYA 3N5LA 1PB8A 5TPAA 3G3GA 3ILUB 4OFLA 2RC9A 1N76A 3UK4A 4ONYA 3SETA 3EHUA 4TOZA 1UQWA 4TLMB 1L5TA 2HAUA 2PVUA 3C35A 3N26A 4IO5A 5B70A 4OESA 3K4UA 1OQHA 4U4XA 3LR1A 4BDMA 3RT8A 2V3TA 1FW0A 5JEIA 5M2VA 1FQEA 1B3FA 1AL3A 4OERA 1HSEA 1B7UA 2XXHA 5TU0A 5F1QA 1MY1A 1IEJA 5J1DA 3S2VA 4XTCQ 4E0XA 3N6TA 3TTNA 3FD3A 3OELA 1MQIA 4ZZAA 5DEXA 3MVXA 3JZJA 2Q88A 3CR9A 4M1VA 2RCBA 5H8QA 5AA2D 1IUDA 4F19A 3FVKA 3FIRA 1OVBA 1US4A 3SEUA 1B3EA 4OEUA 1MM7A 3OXNA 4IY5A 2QL3A 1NFTA 3K01A 3VXCA 1IXCA 2QS1A 1B2HA 3QK6A 4JSDA 1PEBA 3RPWA 3WAEA 2RC7A 1OLAA 3ZKLA 4IY6A 3EF7A 4RYAA 1EU8A 3V5AA 1JNFA 3HSTA 3SESA 3TCHA 4FEDA 4IGTA 5DVFA 3QIMA 3HO7A 1A54A 3OO6A 1B0LA 4PFWA 3TZAA 3IO6A 3VFJA 4LUBA 3CFLA 2I4CA 3B6QA 5H8HA 1O64A 1CE2A 1LAHE 2R71A 1DPEA 3BKIB 2I3VA 2HZKA 2Q8JA 3OSQA 3CFZA 3ODBA 2XX7A 4ELOA 4GF8A 4XKQA 4XKPA 1B7HA 3CI8A 4KI0E 4OETA 3B7DA 4H65A 5TP9B 3LUYA 1ATGA 3DP4A 4G4PA 1URSA 3FXUA 4X1BA 3TQWA 1B5HA 3O29A 3RTWB 4KCCA 3V83A 1VSOA 1KWHA 4G68A 2HCAA 1MM6A 3K1MA 3CSBA 3ONMA 3VXBA 3O6HA 3LBSA 4F22A 2Y7PA 5IKBA 3PPPA 3SEYA 4WEDA 3KEIA 2RC8A 1P1WA 4C0RA 1H45A 1MH3A 2RINA 4ZE8A 1LAFE 1YAEA 2ONKE 3VV5A 1URDA 3PU5A 1N0TA 4FIMA 3EN3A 4O3BA 4X1DA 5CMBA 1A55A 2O68A 4F31B 3E3KA 4IO6A 4U1ZA 5I56B 3MP8A 2DVZA 4XIGQ 3T9HB 2OK2A 4RXLA 4GOTA 4DXUA 1WVJA 3QSLA 4EXLA 4RA1A 1RYOA 2XXVA 2UYFA 4ESXA 1B1XA 2X7QA 1NH8A 4IGRA 3N6UA 1B58A 2WKYA 2H5YA 3UP9A 2Z8FA 3M3FA 2HXWA 3IL1B 4QRZA 2RKMA 4NEDA 1F9BA 3T66A 4GLIA 1B4ZA 3RNNA 1I6BA 2D21A 4F1VA 3MP1A 4R74A 1YCJA 1TWYA 2Q9TA 3S4UA 1GGGA 2E0SA 4MBPA 2E1SA 4OFOA 4OENA 1OIBA 2OCUA 1B32A 5CBSA 3MP6A 2XXQA 4G2ZA 3DELB 5CI5A 4R2FA 2B3BA 4GRKA 4JWYA 3C36A 1II5A 1PB9A 2A5SA 1USYH 1ZJLA 1P99A 3C33A 2FA7A 2F6PA 1TFAA 2UVJA 5L9OA 3LSLA 2P2AA 3G3KA 3K2DA 1IQ7A 1HSJA 5EHSA 1JW5A 1SDXA 3SEVA 3KBRA 3W15C 1Y3QA 3D4CA 3U94A 5I56A 3GZGA 4ZS9A 4ELPA 3USDA 3K1PA 2FNCA 3PPQA 3SKPA 4PP0A 3T9XB 2QMXA 4GD5A 1XVYA 4MFIA 1RKMA 4PETA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZYN A;  1MQG A;  2O51 A;  3T96 B;  1OMP A;  4JSO A;  3OO8 A;  3S9M C;  1MY2 A;  1MXY A;  3RLF E;  5I59 A;  4PE5 B;  1DPP A;  4C1U A;  2YPN A;  3H7M A;  4LZ5 A;  3W9V A;  2F97 A;  1MPC A;  1XC1 A;  1B51 A;  4P0I A;  4O3C A;  3PPN A;  4TQU Q;  1ZKB A;  2I4B A;  1MXX A;  4AB6 A;  2IEE A;  3B6W A;  1Y1M A;  5I2N A;  2F8D A;  3L6G A;  3EPE A;  4OWD A;  5ISU A;  1BLF A;  4XKN A;  1SW5 A;  4AB5 A;  1MY4 A;  1Q35 A;  3TAJ A;  3C9H A;  1XOC A;  1MPD A;  3FGS A;  1QW0 A;  1Y1Z A;  2ANJ A;  4LQ2 A;  3SEX A;  4RJZ A;  3SDF A;  4DXB A;  4U23 A;  4ESW A;  3KN7 A;  4BDQ A;  3RY3 A;  2V25 A;  5HM4 B;  1VFE A;  1AIV A;  1N84 A;  2Y7R A;  3MZB A;  1JET A;  3EHT A;  2O6A A;  4KCD A;  3KGC A;  3IOV A;  4IO7 A;  2NUV A;  3BFT A;  3S9L C;  1LST A;  3K6W A;  4NF8 B;  3IO4 A;  3C31 A;  1LBC A;  3A09 A;  3FXR A;  1SW4 A;  1EZP A;  5EHM A;  3SEW A;  3MUQ A;  3BBR A;  2XX9 A;  2DWA A;  3AXF A;  4QF9 A;  1M5D A;  3MBP A;  4PFT A;  4LQ5 A;  4F1Y A;  3DP6 A;  2NWJ A;  4F3P A;  2GH9 A;  1CB6 A;  5H8H B;  4GFR A;  3UN6 A;  3PPO A;  1ZU0 A;  2G29 A;  1MS7 A;  1Z7N E;  3KJ7 A;  1FQB A;  1N7W A;  3FJG A;  2F5X A;  4XKR A;  1B40 A;  2O1L A;  3K6U A;  4X48 A;  1FQD A;  4R73 A;  1JEU A;  4C1T A;  1IIT A;  3Q26 A;  1NL5 A;  4KPT A;  3B6T A;  1LCT A;  3IAZ A;  1FQA A;  3GLB A;  3IOR A;  2ALU A;  1YPN A;  4HS7 A;  5CC2 A;  4RK9 A;  2O7U A;  2H25 A;  4R6K A;  1N7X A;  4P0G A;  5I58 B;  3UGW A;  1N3W A;  3TUS A;  4ZEC A;  1O63 A;  4G68 B;  1VR5 A;  1JEV A;  3N94 A;  3OEN A;  4K3F A;  4EQB A;  2ABH A;  1ZIU A;  2OZZ A;  4JXI A;  3MVY A;  1POY 1;  1BP5 A;  2R9J A;  3T9U A;  3LSW A;  4F3B A;  4RK2 A;  3PUY E;  2XXR A;  3PUX E;  3LSX A;  3FAT A;  3OOA A;  1P1N A;  5AA2 B;  1T0K A;  2B3F A;  3FXQ A;  4NF8 A;  2QS3 A;  4G8H A;  4FJP A;  1PBP A;  2REJ A;  4LZ8 A;  2DVC A;  5DTB A;  4R6Y A;  3HCQ A;  2DYX A;  4LA9 A;  2ZYO A;  3IR1 A;  4GWO A;  3RN8 A;  4RPO A;  2I58 A;  1FQC A;  4H0W A;  1IXI A;  1NNK A;  3DM0 A;  3QUF A;  4U22 A;  3W9W A;  5HBC A;  1HSL A;  4F2O A;  1UTB A;  4G8N A;  1FCK A;  1NMU A;  4M4G A;  4YKJ A;  3T93 B;  4ZEI A;  3RQT A;  2H9B A;  4R9F A;  2QRY A;  1O7T A;  1A99 A;  3FV1 A;  3FJM A;  5CMK A;  4Z0I A;  3K02 A;  3GXA A;  1H44 A;  3H6V A;  3HHF A;  4RY1 A;  4FOR A;  4KFQ A;  3G3I A;  1DSN A;  3BFU A;  3MW0 A;  3SER A;  5I58 A;  3TTR A;  3OEM A;  4H8I A;  1XHY A;  4XXU A;  1A40 A;  2DE3 A;  3VDF A;  4PFU A;  2GHB A;  2Y7I A;  4ISU A;  1ZBM A;  1BIY A;  1D4N A;  1RYX A;  4FAJ A;  4QHQ A;  2CMO A;  1FTO A;  2UVG A;  2VP1 A;  3MZ1 A;  2O7I A;  2F36 A;  1US5 A;  1B9J A;  4JDF A;  2Y84 A;  5AA2 A;  4QFL A;  2F6G A;  2PYY A;  4EQ7 A;  1XS5 A;  1QUJ A;  4OTE A;  3V89 B;  2YJP A;  3DP8 A;  1M5E A;  3E13 X;  3K0V A;  3FAS A;  3L6H A;  1M5C A;  2AL5 A;  4I62 A;  3VLW A;  4IO3 A;  1MXW A;  2XXY A;  2PX1 A;  4OQO A;  1B52 A;  1UIV A;  2X7P A;  1DTG A;  3MPL A;  5DT6 A;  3O28 A;  4HCY A;  4OHN A;  3OEK A;  3FJ7 A;  1H76 A;  4HTG A;  4MLQ A;  1MDQ A;  5FHN A;  1ZMG A;  3HV1 A;  1MDP 1;  3U8Q A;  1DMB A;  3TYH A;  2I49 A;  2VOZ A;  1LCF A;  3THI A;  4THI A;  3ZSF A;  3PD8 A;  4EF2 A;  2OJT A;  3A3U A;  1D9V A;  4GIZ A;  3FVG A;  4H5F A;  2HEU A;  2NVU B;  4NF4 B;  4DIG A;  4ZEK A;  4ZZE A;  4EQ9 A;  3IB2 A;  2H98 A;  1QJM A;  4YKI A;  3CG1 A;  2AIX A;  1UTH B;  5I59 B;  3PMV A;  3I6V A;  1S9T A;  3PUV E;  2I0B A;  4FAT A;  4LON B;  3D4G A;  2DWI A;  1EZ9 A;  3PUW E;  5H8F B;  4YU0 A;  3PD9 A;  3PPR A;  2GFE A;  5I2N B;  3MAM A;  4I8C A;  2H99 A;  2Y7K A;  2Y7W A;  4ZED A;  1LB9 A;  4RNS A;  2HFB A;  3C34 A;  4YMA A;  2XXW A;  1VFD A;  3JYR A;  5L9S A;  4GXA A;  2PT1 A;  3MJN A;  3V8X B;  1BKA A;  5FHM A;  4F1U A;  4ZE9 A;  2GHA A;  3H06 B;  2PT2 A;  4YB5 A;  1S50 A;  2FYI A;  1N04 A;  1P1Q A;  3PGF A;  5ITP A;  3LSF B;  1R9L A;  3FZV A;  4R75 A;  3VE1 B;  4YIC A;  1SYI A;  1GTK A;  3K00 A;  4KYD A;  3CRB A;  4BDO A;  3MPK A;  2P1S A;  4KR5 A;  4H1X A;  1SI1 A;  2NXO A;  3HHG A;  4U1O A;  1Y9U A;  2PMS A;  4POX A;  1MQH A;  2XXI A;  3MQ9 A;  3MWB A;  3H3G A;  1PC3 A;  2DP8 A;  2M8C A;  1B5I A;  2Z8D A;  4LAT A;  4OEV A;  2QS2 A;  1TFD A;  2Q89 A;  4UA8 A;  5H8S A;  4DCY A;  1SVX B;  3ILT B;  1SD3 A;  3LC8 A;  4UAC A;  5I57 B;  4BLA A;  1URG A;  2XXT A;  2Z23 A;  4NF4 A;  1WOD A;  3OMB A;  4JWO A;  2QPQ A;  1UTH A;  3CFX A;  3FVN A;  4MH5 A;  1B3H A;  3TEP A;  2XXP A;  4EUO A;  2REG A;  2XD3 A;  1LFH A;  2F7C A;  4WKM A;  4U2R A;  1LFI A;  1FTK A;  3O6G A;  1GV8 A;  5H8F A;  4LP2 B;  3IX1 A;  1YTV A;  1Y4T A;  3VLU A;  3CVG A;  2ONS A;  3JV9 A;  3ECR A;  1NNP A;  2F35 A;  4KYS A;  2DWJ A;  5CMM A;  1MXV A;  4E0W A;  5BUU A;  2I6E A;  4ZEB A;  4R72 A;  1M5B A;  4OXV A;  4F39 A;  3WAF A;  4PFY A;  3RT6 B;  1SW2 A;  4H6D A;  1AOV A;  1B05 A;  1JVY A;  5AA3 A;  2ZYM A;  3KSX A;  3P7I A;  3EQ1 A;  5I84 A;  2OLB A;  5F7V A;  4DCX A;  1OQG A;  3VLV A;  2P0S A;  1R6Z A;  4QSC A;  4IO4 A;  3H6W A;  1ELJ A;  3IOU A;  5L9M A;  1Z7M E;  1ANF A;  2AL4 A;  4WEP A;  4BDL A;  5L8D A;  4ND9 A;  3TTL A;  2OBG A;  3C4M A;  2HQ0 A;  2XD2 A;  3OO9 A;  3KFM A;  4QSD A;  3VVD A;  3DLN A;  3U1O A;  4Q30 B;  1Y4C A;  4HW8 A;  2ONR A;  3FV2 A;  3S9N C;  2QMW A;  3ZKK A;  5I57 A;  3S9E A;  2DE2 A;  4ELQ A;  2UXA A;  3CSG A;  4Q0C A;  1BTJ A;  4F3S A;  3Q27 A;  3PMW A;  4F2Q A;  1B46 A;  4R2B A;  4MLV A;  1LAX A;  4OFJ A;  1R1N A;  1UTB B;  4BDR A;  4YKK A;  1Y3P A;  5DVI A;  1LBB A;  3RTF B;  2AYS A;  3C32 A;  3QXM A;  5KZT A;  5JTY B;  5DYH A;  4EF1 A;  5AA4 B;  4P11 A;  3A3C A;  2F34 A;  3IOT A;  4EDP A;  1QUL A;  3HPI A;  1GR2 A;  4HCW A;  1FQF A;  2OWS A;  1B1H A;  2BJJ X;  1R9Q A;  3PMX A;  2VD2 A;  4H67 A;  1TT1 A;  1MY0 A;  3KG2 A;  4R6H A;  5JK4 A;  3M3K A;  4GVO A;  1IIW A;  4X9T A;  1TXF A;  2ZXT A;  4U4S A;  1N3X A;  2Q2A A;  4POW A;  1AH5 A;  3KN8 A;  2DOJ A;  1MRP A;  3T22 A;  1LB8 A;  3O6I A;  1ZTY A;  2DS9 A;  3GBA A;  1J1N A;  3TCG A;  3TPA A;  3TDJ A;  1EH3 A;  4OYV A;  5KDT B;  1B6H A;  5EYF A;  1OVT A;  2ZYK A;  5IAI A;  4YKP A;  3OD7 A;  2F78 A;  1QUK A;  4G77 A;  2X26 A;  3FVO A;  1B0H A;  5AA1 A;  1VE4 A;  2HAV A;  4N6P A;  3IJX B;  4QSE A;  2DWH A;  4YZZ A;  5KCJ A;  1MXZ A;  2IA4 A;  4G68 C;  1NNT A;  2O69 A;  1MQJ A;  2LAO A;  2GRV A;  2QS4 A;  3TOD A;  3I5O A;  3KJT A;  1A8F A;  1A7L A;  2ESN A;  4FE8 A;  4YB7 A;  4NWC A;  2ZNS A;  2UVH A;  4OMB A;  5ELV A;  3F11 A;  5H8N B;  3TFL A;  1MG1 A;  1MPB A;  3H4Z A;  3G3J A;  1NNF A;  5JTY A;  2V84 A;  1D3K A;  5AA4 A;  1SW1 A;  5CM6 A;  1B3G A;  2Z22 A;  4I1D A;  4DXC A;  4BDN A;  3M8U A;  2A5T B;  1NH7 A;  2F7B A;  1USY E;  3E9X A;  5FTI A;  4ZDM A;  2VGQ A;  2NOO A;  4L17 A;  3KOS A;  3R7X A;  1Y3N A;  4YMB A;  3KZG A;  3G3H A;  1B5J A;  2KLF A;  4IO2 A;  4F18 A;  3U93 A;  3GBB A;  2O84 X;  1H3D A;  4FEC A;  5KDT A;  1B3L A;  4QFO A;  1FTM A;  2UVI A;  2DXR A;  3VVE A;  4YAH X;  1P1U A;  1I6A A;  2QSX A;  3PV0 E;  2XXU A;  3HN0 A;  1IXG A;  3CG3 A;  2YLN A;  1M5F A;  1IXH A;  1I69 A;  3O9P A;  1MXU A;  5B7D A;  2DSF A;  3KN3 A;  3G3F A;  4N07 A;  3R26 A;  4IB2 A;  3R6U A;  3IB0 A;  4KYE A;  5I2K B;  2ZMB A;  1POT A;  5BWJ A;  3VVF A;  1D9Y A;  1EZO A;  1WDN A;  3UOR A;  2HZL A;  1SBP A;  5H8N A;  3IK6 B;  2V3U A;  2DE4 A;  4KQP A;  2V93 A;  1XVX A;  4OZ9 A;  3MZ9 A;  4DLD A;  5ITO A;  4GXS B;  2R6G E;  3O66 A;  2D5W A;  3MC2 A;  4NMY A;  5CRY A;  4ZEF A;  2A5T A;  1PBQ A;  4KD5 A;  4OVJ A;  2XX8 A;  4PQJ A;  1OLC A;  4I9D A;  5TP9 A;  2W7Y A;  4O3A A;  2VD3 A;  3Q28 A;  3K6X A;  4Q5T A;  1IZ1 A;  4ELR A;  4JB7 A;  2DXY A;  5FTH A;  2THI A;  3K6V A;  3G7W A;  1JW1 A;  2B65 A;  4FEB A;  4EXK A;  3MVZ A;  4LVQ A;  5A5X B;  3IOW A;  2I3W A;  3CIJ A;  4NF5 B;  2XXX A;  3O2A A;  5CBR A;  3QUJ A;  4Z7E A;  4TLL B;  3UIF A;  1JQF A;  5HPQ A;  1Q1K A;  4RPN A;  4MF3 A;  1MY3 A;  2G93 A;  3T9V A;  3FUZ A;  1MH4 A;  4JBZ A;  2DQV A;  2VHA A;  3UA8 A;  1P1O A;  5I2K A;  1SYH A;  2V3Q A;  3RUM A;  1Y20 A;  2UYE A;  4GL8 A;  4GQO A;  4QFK A;  4GL0 A;  2XHD A;  1QKA A;  4LZ7 A;  4QFP A;  3U92 A;  3M3L A;  1PB7 A;  1SI0 A;  4QFN A;  3TQL A;  5FHO A;  1S7Y A;  5K2X A;  3H6T A;  4F3G A;  3MVW A;  3Q25 A;  2OWT A;  1QUI A;  2PBW A;  1LAG E;  1LGB C;  2QJE A;  3TCF A;  3H03 A;  1B4H A;  3OSR A;  2ZNU A;  2Z8E A;  4NF6 B;  4AQ4 A;  3TEL A;  5K2Y A;  5TPA B;  3O97 A;  3H6U A;  2Q2C A;  4KHZ E;  4JWX A;  2I48 A;  1JVX A;  3I3V A;  1DOT A;  5DVJ A;  3TTK A;  2O1M A;  3EHS A;  3E4R A;  1GVC A;  4U21 A;  3K1N A;  5A5X A;  5ICT A;  1QKB A;  1AMF A;  4Q8R A;  3QAX A;  4NF5 A;  1FTL A;  4N13 A;  4R9G A;  1PDA A;  3KSJ A;  3ZS6 A;  4DZ1 A;  4H8J A;  4NTL A;  1ZLQ A;  1MQD A;  1XT8 A;  3RGY A;  3IB1 A;  1B7Z A;  4ECF A;  3IJO B;  3TKD A;  2D3I A;  3KOT A;  4DDD A;  1LLS A;  1LFG A;  1UIU A;  3PUZ E;  5DEX B;  2RCA A;  3TTM A;  3Q29 A;  5CMC A;  5LOM A;  5H8Q B;  3QYT A;  2RF1 A;  1JW4 A;  5ICQ A;  1A8E A;  2CZL A;  2I0C A;  1H43 A;  4H5G A;  4DE8 A;  1DTZ A;  4G8M A;  3TMG A;  1FTJ A;  2H4I A;  1I6Q A;  4WXJ A;  4F29 A;  5KCJ B;  4YB6 A;  3U72 A;  2ZNT A;  1QVS A;  1NKX A;  4NE4 A;  4NWD A;  2F7A A;  5AE4 A;  3OO7 A;  4NF6 A;  1SQY A;  3N5L A;  1PB8 A;  5TPA A;  3G3G A;  3ILU B;  4OFL A;  2RC9 A;  1N76 A;  3UK4 A;  4ONY A;  3SET A;  3EHU A;  4TOZ A;  1UQW A;  4TLM B;  1L5T A;  2HAU A;  2PVU A;  3C35 A;  3N26 A;  4IO5 A;  5B70 A;  4OES A;  3K4U A;  1OQH A;  4U4X A;  3LR1 A;  4BDM A;  3RT8 A;  2V3T A;  1FW0 A;  5JEI A;  5M2V A;  1FQE A;  1B3F A;  1AL3 A;  4OER A;  1HSE A;  1B7U A;  2XXH A;  5TU0 A;  5F1Q A;  1MY1 A;  1IEJ A;  5J1D A;  3S2V A;  4XTC Q;  4E0X A;  3N6T A;  3TTN A;  3FD3 A;  3OEL A;  1MQI A;  4ZZA A;  5DEX A;  3MVX A;  3JZJ A;  2Q88 A;  3CR9 A;  4M1V A;  2RCB A;  5H8Q A;  5AA2 D;  1IUD A;  4F19 A;  3FVK A;  3FIR A;  1OVB A;  1US4 A;  3SEU A;  1B3E A;  4OEU A;  1MM7 A;  3OXN A;  4IY5 A;  2QL3 A;  1NFT A;  3K01 A;  3VXC A;  1IXC A;  2QS1 A;  1B2H A;  3QK6 A;  4JSD A;  1PEB A;  3RPW A;  3WAE A;  2RC7 A;  1OLA A;  3ZKL A;  4IY6 A;  3EF7 A;  4RYA A;  1EU8 A;  3V5A A;  1JNF A;  3HST A;  3SES A;  3TCH A;  4FED A;  4IGT A;  5DVF A;  3QIM A;  3HO7 A;  1A54 A;  3OO6 A;  1B0L A;  4PFW A;  3TZA A;  3IO6 A;  3VFJ A;  4LUB A;  3CFL A;  2I4C A;  3B6Q A;  5H8H A;  1O64 A;  1CE2 A;  1LAH E;  2R71 A;  1DPE A;  3BKI B;  2I3V A;  2HZK A;  2Q8J A;  3OSQ A;  3CFZ A;  3ODB A;  2XX7 A;  4ELO A;  4GF8 A;  4XKQ A;  4XKP A;  1B7H A;  3CI8 A;  4KI0 E;  4OET A;  3B7D A;  4H65 A;  5TP9 B;  3LUY A;  1ATG A;  3DP4 A;  4G4P A;  1URS A;  3FXU A;  4X1B A;  3TQW A;  1B5H A;  3O29 A;  3RTW B;  4KCC A;  3V83 A;  1VSO A;  1KWH A;  4G68 A;  2HCA A;  1MM6 A;  3K1M A;  3CSB A;  3ONM A;  3VXB A;  3O6H A;  3LBS A;  4F22 A;  2Y7P A;  5IKB A;  3PPP A;  3SEY A;  4WED A;  3KEI A;  2RC8 A;  1P1W A;  4C0R A;  1H45 A;  1MH3 A;  2RIN A;  4ZE8 A;  1LAF E;  1YAE A;  2ONK E;  3VV5 A;  1URD A;  3PU5 A;  1N0T A;  4FIM A;  3EN3 A;  4O3B A;  4X1D A;  5CMB A;  1A55 A;  2O68 A;  4F31 B;  3E3K A;  4IO6 A;  4U1Z A;  5I56 B;  3MP8 A;  2DVZ A;  4XIG Q;  3T9H B;  2OK2 A;  4RXL A;  4GOT A;  4DXU A;  1WVJ A;  3QSL A;  4EXL A;  4RA1 A;  1RYO A;  2XXV A;  2UYF A;  4ESX A;  1B1X A;  2X7Q A;  1NH8 A;  4IGR A;  3N6U A;  1B58 A;  2WKY A;  2H5Y A;  3UP9 A;  2Z8F A;  3M3F A;  2HXW A;  3IL1 B;  4QRZ A;  2RKM A;  4NED A;  1F9B A;  3T66 A;  4GLI A;  1B4Z A;  3RNN A;  1I6B A;  2D21 A;  4F1V A;  3MP1 A;  4R74 A;  1YCJ A;  1TWY A;  2Q9T A;  3S4U A;  1GGG A;  2E0S A;  4MBP A;  2E1S A;  4OFO A;  4OEN A;  1OIB A;  2OCU A;  1B32 A;  5CBS A;  3MP6 A;  2XXQ A;  4G2Z A;  3DEL B;  5CI5 A;  4R2F A;  2B3B A;  4GRK A;  4JWY A;  3C36 A;  1II5 A;  1PB9 A;  2A5S A;  1USY H;  1ZJL A;  1P99 A;  3C33 A;  2FA7 A;  2F6P A;  1TFA A;  2UVJ A;  5L9O A;  3LSL A;  2P2A A;  3G3K A;  3K2D A;  1IQ7 A;  1HSJ A;  5EHS A;  1JW5 A;  1SDX A;  3SEV A;  3KBR A;  3W15 C;  1Y3Q A;  3D4C A;  3U94 A;  5I56 A;  3GZG A;  4ZS9 A;  4ELP A;  3USD A;  3K1P A;  2FNC A;  3PPQ A;  3SKP A;  4PP0 A;  3T9X B;  2QMX A;  4GD5 A;  1XVY A;  4MFI A;  1RKM A;  4PET A; 
#chains in the Genus database with same CATH topology
 2ZYN A;  1MQG A;  1G0H A;  2O51 A;  4PGN A;  3T96 B;  3ROJ A;  1OMP A;  2F3B A;  4JSO A;  3OO8 A;  3S9M C;  1MY2 A;  1MXY A;  3RLF E;  5I59 A;  4PE5 B;  1DPP A;  4C1U A;  2YPN A;  3H7M A;  4LZ5 A;  3W9V A;  2F97 A;  1MPC A;  1XC1 A;  4N8G A;  1B51 A;  4P0I A;  4O3C A;  3PPN A;  4TQU Q;  1FPI A;  3EKI A;  1ZKB A;  2I4B A;  1MXX A;  4AB6 A;  5IM2 A;  4O7I A;  2IEE A;  3B6W A;  1Y1M A;  5I2N A;  2Y5L A;  5IZZ A;  2F8D A;  3L6G A;  3EPE A;  4OWD A;  5ISU A;  1BLF A;  4XKN A;  5IZ3 B;  1SW5 A;  4AB5 A;  1MY4 A;  2V4C A;  1Q35 A;  3TAJ A;  3C9H A;  1XOC A;  1MPD A;  2DDK A;  3FGS A;  1QW0 A;  1Y1Z A;  2Q8M A;  4P47 A;  2ANJ A;  2XWV A;  4LQ2 A;  3SEX A;  5EYG A;  2Y5K A;  4RJZ A;  3SDF A;  4DXB A;  2CEX A;  4U23 A;  4ESW A;  3KN7 A;  4BDQ A;  3RY3 A;  2V25 A;  5HM4 B;  1VFE A;  1AIV A;  1N84 A;  2Y7R A;  3MZB A;  1JET A;  3EHT A;  2O6A A;  1NV3 A;  2ZZW A;  4KCD A;  3KGC A;  3IOV A;  4IO7 A;  2NUV A;  5IZ1 A;  3BFT A;  3S9L C;  1KA0 A;  1LST A;  3K6W A;  4NF8 B;  3IO4 A;  1FPL A;  3C31 A;  1LBC A;  3A09 A;  3FXR A;  1SW4 A;  4G61 A;  1EZP A;  5EHM A;  3SEW A;  3MUQ A;  3BBR A;  2XX9 A;  3RYD A;  2DWA A;  4P56 A;  1LBW A;  3AXF A;  4QF9 A;  1M5D A;  3MBP A;  4PFT A;  4LQ5 A;  2FBP A;  4F1Y A;  1YZ0 A;  3DP6 A;  1FRP A;  1JP4 A;  2NWJ A;  4F3P A;  4PGP A;  2GH9 A;  1CB6 A;  5H8H B;  4GFR A;  3UN6 A;  3PPO A;  5EYH A;  1ZU0 A;  2G29 A;  1MS7 A;  1Z7N E;  3KJ7 A;  1FQB A;  1N7W A;  3FJG A;  2F5X A;  4QBA A;  1FPD A;  4XKR A;  1B40 A;  4NQ8 A;  2O1L A;  5IZ3 A;  3K6U A;  4X48 A;  1FQD A;  4R73 A;  1JEU A;  4C1T A;  1IME A;  1IIT A;  3Q26 A;  1NL5 A;  4KPT A;  3B6T A;  1LCT A;  3IAZ A;  1FQA A;  4N17 A;  3GLB A;  4MNP A;  3IOR A;  2ALU A;  1YPN A;  4H45 A;  4HS7 A;  5CC2 A;  4RK9 A;  2O7U A;  2H25 A;  2XWI A;  4R6K A;  1N7X A;  4P0G A;  5I58 B;  3UGW A;  1N3W A;  3TUS A;  4ZEC A;  1O63 A;  4G68 B;  5ET8 A;  1VR5 A;  1JEV A;  3N94 A;  1Q9D A;  3OEN A;  4K3F A;  4EQB A;  2ABH A;  1ZIU A;  2OZZ A;  4JXI A;  3MVY A;  1POY 1;  1BP5 A;  2R9J A;  4IR8 A;  3T9U A;  3LSW A;  4F3B A;  4RK2 A;  3PUY E;  2XXR A;  3PUX E;  4PCD A;  3LSX A;  3FAT A;  4MEV A;  4P3L A;  3OOA A;  2FIE A;  1P1N A;  5AA2 B;  1T0K A;  2B3F A;  3FXQ A;  4NF8 A;  2QS3 A;  4G8H A;  4FJP A;  1PBP A;  2BJI A;  2REJ A;  4LZ8 A;  2DVC A;  5DTB A;  4R6Y A;  3HCQ A;  2DYX A;  4LA9 A;  2ZYO A;  4NX1 A;  1AWB A;  3IR1 A;  4P9K A;  4GWO A;  3RN8 A;  1EYK A;  4RPO A;  2I58 A;  1FQC A;  2QVU A;  4H0W A;  1IXI A;  1NNK A;  3DM0 A;  3QUF A;  4U22 A;  3W9W A;  5HBC A;  1DCU A;  1HSL A;  4F2O A;  1UTB A;  4G8N A;  1FCK A;  1NMU A;  3IFC A;  4M4G A;  4YKJ A;  4XFE A;  3T93 B;  5J16 A;  4ZEI A;  3GYY A;  3RQT A;  2H9B A;  4OVQ A;  4R9F A;  1FBC A;  2QRY A;  5EQ8 A;  1O7T A;  2WYP A;  4PTK A;  1A99 A;  3FV1 A;  3FJM A;  3HFU A;  5CMK A;  4Z0I A;  4N8Y A;  3K02 A;  3GXA A;  1H44 A;  3H6V A;  1NUW A;  1FBD A;  3HHF A;  4RY1 A;  4FOR A;  4KFQ A;  3G3I A;  1DSN A;  3BFU A;  3MW0 A;  3SER A;  5I58 A;  3TTR A;  3OEM A;  4H8I A;  1XHY A;  4XXU A;  1A40 A;  2DE3 A;  3VDF A;  4PFU A;  2PFZ A;  2GHB A;  2Y7I A;  4ISU A;  1FPJ A;  1ZBM A;  1BIY A;  1D4N A;  1RYX A;  4FAJ A;  4QHQ A;  2CMO A;  1FTO A;  2UVG A;  2VP1 A;  3MZ1 A;  4QXD A;  2O7I A;  2F36 A;  1US5 A;  5EQ9 A;  1B9J A;  5I5P A;  4JDF A;  2Y84 A;  5AA2 A;  4QFL A;  4OVS A;  2F6G A;  2PYY A;  4EQ7 A;  1XS5 A;  4OTE A;  1QUJ A;  3V89 B;  4GX3 A;  2WX9 A;  2YJP A;  4DI3 D;  2HPG A;  1NV6 A;  3DP8 A;  1M5E A;  3E13 X;  3K0V A;  4MIJ A;  3FAS A;  3L6H A;  1M5C A;  2AL5 A;  4I62 A;  3VLW A;  4IO3 A;  1MXW A;  2XXY A;  2PX1 A;  4OQO A;  1B52 A;  1UIV A;  2X7P A;  1DTG A;  3MPL A;  2R8T A;  5DT6 A;  3O28 A;  4HCY A;  1KZ8 A;  4OHN A;  3OEK A;  2XWO A;  3FJ7 A;  1H76 A;  1FSA A;  4HTG A;  4I40 A;  4MLQ A;  1MDQ A;  5FHN A;  4MNI A;  4O94 A;  1ZMG A;  3HV1 A;  1MDP 1;  3U8Q A;  1DMB A;  3TYH A;  2I49 A;  2VOZ A;  1LCF A;  3THI A;  4THI A;  1CNQ A;  3ZSF A;  3PD8 A;  3B50 A;  4N81 A;  4EF2 A;  2OJT A;  3A3U A;  1D9V A;  4GIZ A;  3FVG A;  4H5F A;  2QVR A;  2HEU A;  1FPG A;  4GWX A;  2NVU B;  4NF4 B;  4DIG A;  4ZEK A;  4ZZE A;  4EQ9 A;  3IB2 A;  2H98 A;  1QJM A;  4YKI A;  3CG1 A;  2AIX A;  1UTH B;  5I59 B;  3PMV A;  3I6V A;  1S9T A;  3PUV E;  2I0B A;  4FAT A;  4LON B;  3D4G A;  2DWI A;  1EZ9 A;  5F24 A;  4KXP A;  3PUW E;  5H8F B;  4YU0 A;  3PD9 A;  3PPR A;  2GFE A;  5I2N B;  3MAM A;  4I8C A;  2H99 A;  2MKZ A;  2Y7K A;  2Y7W A;  1EYI A;  4ZED A;  1DBZ A;  1LB9 A;  4RNS A;  2HFB A;  3C34 A;  4YMA A;  2XXW A;  1VFD A;  3JYR A;  1FBF A;  5L9S A;  4GXA A;  2PT1 A;  3MJN A;  3V8X B;  1BKA A;  2XA5 A;  5FHM A;  4F1U A;  4ZE9 A;  2GHA A;  3H06 B;  4N6K A;  2PT2 A;  4NAP A;  4YB5 A;  1S50 A;  4OVR A;  1RDZ A;  2FYI A;  1N04 A;  1P1Q A;  4FBP A;  3PGF A;  5ITP A;  3LSF B;  1R9L A;  3FZV A;  4R75 A;  3VE1 B;  4YIC A;  1SYI A;  1GTK A;  3K00 A;  4KYD A;  3CRB A;  4BDO A;  3MPK A;  2P1S A;  4JVI A;  4KR5 A;  2HXR A;  4H1X A;  1SI1 A;  2NXO A;  3HHG A;  4U1O A;  1Y9U A;  2PMS A;  4POX A;  1MQH A;  2CEY A;  2XXI A;  3MQ9 A;  3MWB A;  1NV7 A;  3H3G A;  1PC3 A;  2DP8 A;  2M8C A;  1B5I A;  2Z8D A;  4LAT A;  4OEV A;  2QS2 A;  1TFD A;  2Q89 A;  4UA8 A;  5H8S A;  4DCY A;  1FPK A;  1FPF A;  1SVX B;  3ILT B;  1SD3 A;  2VPO A;  3LC8 A;  4UAC A;  5I57 B;  4BLA A;  1URG A;  2XXT A;  2Z23 A;  4NF4 A;  1WOD A;  3OMB A;  4JWO A;  2QPQ A;  1UTH A;  3CFX A;  3FVN A;  3LUZ A;  4MH5 A;  1B3H A;  3TEP A;  2XXP A;  4EUO A;  2REG A;  2XD3 A;  1DK4 A;  1LFH A;  2F7C A;  4WKM A;  4U2R A;  1LFI A;  1FTK A;  3O6G A;  1GV8 A;  5H8F A;  4LP2 B;  3IX1 A;  1YTV A;  1Y4T A;  3VLU A;  3CVG A;  2ONS A;  3JV9 A;  3ECR A;  1NNP A;  2F35 A;  4KYS A;  2DWJ A;  5CMM A;  1MXV A;  4E0W A;  5BUU A;  2I6E A;  4ZEB A;  4R72 A;  1M5B A;  4OXV A;  4F39 A;  3WAF A;  4PFY A;  3RT6 B;  1SW2 A;  4H6D A;  1AOV A;  1B05 A;  1LBY A;  1JVY A;  5AA3 A;  2ZYM A;  3KSX A;  3P7I A;  3EQ1 A;  4MNC A;  5I84 A;  2OLB A;  5F7V A;  2KQZ A;  4DCX A;  1OQG A;  3VLV A;  2P0S A;  1R6Z A;  4QSC A;  4IO4 A;  1KA1 A;  3H6W A;  1ELJ A;  1NV2 A;  2FVZ A;  3IOU A;  5L9M A;  1Z7M E;  2JJK A;  1ANF A;  2AL4 A;  4WEP A;  4BDL A;  4N91 A;  5L8D A;  4ND9 A;  3TTL A;  2OBG A;  3C4M A;  4NN3 A;  2HQ0 A;  2XD2 A;  3OO9 A;  3KFM A;  4N4U A;  1FBH A;  4QSD A;  5I7I A;  3VVD A;  3DLN A;  3U1O A;  4Q30 B;  1Y4C A;  4HW8 A;  2ONR A;  3FV2 A;  3S9N C;  2QMW A;  3ZKK A;  5I57 A;  1BK4 A;  3S9E A;  2DE2 A;  4ELQ A;  2UXA A;  3CSG A;  4Q0C A;  1BTJ A;  4F3S A;  3Q27 A;  3PMW A;  4F2Q A;  1B46 A;  4R2B A;  4MLV A;  4MMP A;  1LAX A;  4OFJ A;  4PDH A;  1R1N A;  1UTB B;  4BDR A;  4YKK A;  1Y3P A;  5DVI A;  1LBB A;  3RTF B;  2AYS A;  3C32 A;  3QXM A;  5KZT A;  5JTY B;  4X04 A;  5DYH A;  4EF1 A;  3PTY A;  5AA4 B;  4P11 A;  3A3C A;  2F34 A;  4PF8 A;  3IOT A;  4EDP A;  1QUL A;  3HPI A;  1GR2 A;  4HCW A;  1FQF A;  2OWS A;  1FJ9 A;  1B1H A;  1NV4 A;  2BJJ X;  1R9Q A;  3PMX A;  2VD2 A;  4H67 A;  1TT1 A;  1MY0 A;  3KG2 A;  4R6H A;  5JK4 A;  3M3K A;  4GVO A;  1IIW A;  4X9T A;  1TXF A;  2ZXT A;  4PFI A;  4U4S A;  1IMA A;  1N3X A;  2Q2A A;  1INP A;  4POW A;  4PBH A;  1AH5 A;  4OVP A;  3KN8 A;  2DOJ A;  1MRP A;  4XEQ A;  3T22 A;  1LB8 A;  3O6I A;  1ZTY A;  1FJ6 A;  2DS9 A;  3GBA A;  4PAK A;  1J1N A;  3TCG A;  3TPA A;  1FPB A;  4GX4 A;  3TDJ A;  1EH3 A;  5IGA A;  4OYV A;  5KDT B;  1B6H A;  5EYF A;  1OVT A;  5DW8 A;  2ZYK A;  5IAI A;  3A29 A;  4YKP A;  3OD7 A;  2F78 A;  1QUK A;  2P3N A;  4G77 A;  2X26 A;  3FVO A;  1B0H A;  2FHY A;  5AA1 A;  1VE4 A;  1NUY A;  2HAV A;  4N6P A;  3IJX B;  4QSE A;  2DWH A;  4YZZ A;  5KCJ A;  1MXZ A;  2IA4 A;  2VPN A;  2F3D A;  4G68 C;  4P1L A;  1NNT A;  5ET7 A;  4H46 A;  2O69 A;  3E78 A;  1MQJ A;  2LAO A;  4NHB A;  2GRV A;  2QS4 A;  3TOD A;  3I5O A;  1LBV A;  4PAF A;  5ESY A;  3KJT A;  1A8F A;  1A7L A;  2ESN A;  4FE8 A;  4YB7 A;  4NWC A;  2ZNS A;  2UVH A;  4OMB A;  5ELV A;  3F11 A;  4GWS A;  5H8N B;  3TFL A;  5FBP A;  1MG1 A;  1MPB A;  3H4Z A;  3G3J A;  1NNF A;  5JTY A;  2V84 A;  1D3K A;  1K9Z A;  5AA4 A;  1SW1 A;  1NV0 A;  5CM6 A;  1B3G A;  2Z22 A;  4I1D A;  4DXC A;  4BDN A;  3M8U A;  2A5T B;  1NH7 A;  1FPE A;  2F7B A;  1USY E;  3E9X A;  1YXI A;  5FTI A;  4ZDM A;  2VGQ A;  2NOO A;  4PBQ A;  2B4L A;  4L17 A;  4GWU A;  3KOS A;  3R7X A;  1Y3N A;  3KC1 A;  4YMB A;  1SPI A;  3KZG A;  3G3H A;  1B5J A;  2KLF A;  4IO2 A;  4F18 A;  3U93 A;  3GBB A;  2O84 X;  3B8B A;  1H3D A;  4FEC A;  5KDT A;  1B3L A;  4QFO A;  4NG7 A;  1FTM A;  2UVI A;  2DXR A;  3VVE A;  4YAH X;  1P1U A;  1I6A A;  2QSX A;  3PV0 E;  2XXU A;  3HN0 A;  1IXG A;  3CG3 A;  2YLN A;  1M5F A;  1IXH A;  1I69 A;  3O9P A;  4PFR A;  5ET6 A;  1MXU A;  5B7D A;  2DSF A;  3KN3 A;  3G3F A;  4N07 A;  3R26 A;  4IB2 A;  3R6U A;  2ZZX A;  3IB0 A;  4KYE A;  5I2K B;  2ZMB A;  1D9Q A;  1POT A;  5BWJ A;  1NUX A;  3VVF A;  4AS4 A;  1D9Y A;  1EZO A;  1WDN A;  3UOR A;  2WBB A;  2HZL A;  1SBP A;  5H8N A;  3IK6 B;  4JVD A;  2V3U A;  4GWY A;  3T0J A;  2DE4 A;  4KQP A;  2V93 A;  1XVX A;  4OZ9 A;  3MZ9 A;  4DLD A;  5ITO A;  4GXS B;  3KBZ A;  2R6G E;  3SZP A;  3O66 A;  2D5W A;  3MC2 A;  4NMY A;  5CRY A;  4ZEF A;  2A5T A;  1PBQ A;  4KD5 A;  4OVJ A;  4P1E A;  2XX8 A;  4PQJ A;  1OLC A;  4I9D A;  4PFB A;  5TP9 A;  2W7Y A;  4O3A A;  2VD3 A;  3Q28 A;  3K6X A;  4Q5T A;  1IZ1 A;  4ELR A;  4JB7 A;  2DXY A;  3BIH A;  3CHG A;  5FTH A;  2WBD A;  2THI A;  2WYK A;  3K6V A;  3G7W A;  1JW1 A;  2B65 A;  4FEB A;  4MX6 A;  4EXK A;  3MVZ A;  4LVQ A;  5A5X B;  3IOW A;  2I3W A;  4O8M A;  1LBX A;  3CIJ A;  4PF6 A;  4NF5 B;  2XXX A;  3O2A A;  5CBR A;  3QUJ A;  4Z7E A;  4TLL B;  3UIF A;  1JQF A;  5HPQ A;  1Q1K A;  4RPN A;  4MF3 A;  1MY3 A;  4O7M A;  2G93 A;  3T9V A;  3FUZ A;  1MH4 A;  5EQ7 A;  4JBZ A;  3NOH A;  1NV1 A;  2DQV A;  2VHA A;  4OA4 A;  3UA8 A;  1P1O A;  5I2K A;  1SYH A;  2V3Q A;  2CZK A;  3RUM A;  1IMB A;  1Y20 A;  4GBV A;  2UYE A;  4GL8 A;  4GQO A;  4QFK A;  4GL0 A;  3LV0 A;  2XHD A;  1QKA A;  4LZ7 A;  4QFP A;  3U92 A;  4UAB A;  3M3L A;  1PB7 A;  1SI0 A;  4QFN A;  3TQL A;  5FHO A;  1S7Y A;  1FTA A;  5K2X A;  3H6T A;  4F3G A;  3QMF A;  3MVW A;  3Q25 A;  2OWT A;  1QUI A;  2PBW A;  1LAG E;  1LGB C;  2QJE A;  1RDX A;  3TCF A;  3H03 A;  1B4H A;  3OSR A;  2ZNU A;  2Z8E A;  4NF6 B;  4AQ4 A;  3TEL A;  5K2Y A;  1NV5 A;  5TPA B;  3O97 A;  3H6U A;  2OX3 A;  2Q2C A;  4KHZ E;  4JWX A;  2I48 A;  1JVX A;  3I3V A;  1DOT A;  1K9Y A;  5DVJ A;  3TTK A;  3FXB A;  2O1M A;  3EHS A;  2B4M A;  2WEF A;  3E4R A;  5T3J A;  1GVC A;  4U21 A;  3K1N A;  5A5X A;  5ICT A;  4HE0 A;  1QKB A;  1AMF A;  4Q8R A;  3QAX A;  4NF5 A;  1FTL A;  4N13 A;  4R9G A;  1PDA A;  4GBW A;  3KSJ A;  3ZS6 A;  1LEV A;  4H8J A;  4DZ1 A;  1EYJ A;  4NTL A;  2CZH A;  1ZLQ A;  1MQD A;  1XT8 A;  3IB1 A;  2XWK A;  3RGY A;  1B7Z A;  4ECF A;  4P8B A;  3IJO B;  3TKD A;  2D3I A;  3KOT A;  1LLS A;  4DDD A;  1LFG A;  1FBG A;  1UIU A;  1VDW A;  3PUZ E;  5DEX B;  1NUZ A;  2RCA A;  3TTM A;  3Q29 A;  5CMC A;  5LOM A;  1YYZ A;  5H8Q B;  1IMC A;  3QYT A;  2RF1 A;  1JW4 A;  5ICQ A;  1A8E A;  2CZL A;  2I0C A;  1H43 A;  2QVV A;  4H5G A;  4DE8 A;  1DTZ A;  3RPL B;  4G8M A;  3TMG A;  1FTJ A;  2H4I A;  1I6Q A;  2ZZV A;  4WXJ A;  4PDD A;  4F29 A;  5KCJ B;  4YB6 A;  4MCO A;  3U72 A;  2ZNT A;  1QVS A;  1NKX A;  4NE4 A;  4NWD A;  2F7A A;  5AE4 A;  3OO7 A;  4NF6 A;  1SQY A;  3N5L A;  1PB8 A;  5TPA A;  3G3G A;  3ILU B;  4OFL A;  2RC9 A;  1N76 A;  3UK4 A;  4ONY A;  4I3Y A;  3SET A;  3EHU A;  4TOZ A;  4MHF A;  2PCR A;  1UQW A;  1LBZ A;  4NF0 A;  1IMF A;  4TLM B;  4X8R A;  1L5T A;  1FBP A;  2HAU A;  2PVU A;  3C35 A;  3N26 A;  4IO5 A;  4I3E A;  5B70 A;  4OES A;  3K4U A;  3FBP A;  1OQH A;  4U4X A;  3LR1 A;  4BDM A;  3RT8 A;  2V3T A;  1FW0 A;  5JEI A;  5M2V A;  1FQE A;  1B3F A;  1AL3 A;  4OER A;  1HSE A;  1B7U A;  2XXH A;  5LDZ A;  4MAG A;  3MST A;  5TU0 A;  5F1Q A;  4GX6 A;  1MY1 A;  1IEJ A;  5LTC A;  5J1D A;  3S2V A;  4XTC Q;  4E0X A;  3N6T A;  3KC0 A;  3E79 A;  3TTN A;  3FD3 A;  3OEL A;  1IMD A;  2Q74 A;  1MQI A;  4HE2 A;  4ZZA A;  5DEX A;  3MVX A;  3JZJ A;  2Q88 A;  3CR9 A;  4M1V A;  1RDY A;  2RCB A;  5H8Q A;  5AA2 D;  1IUD A;  4F19 A;  3FVK A;  3FIR A;  1OVB A;  1QGX A;  2HHM A;  1US4 A;  3SEU A;  1B3E A;  3RPL A;  4OEU A;  1MM7 A;  3OXN A;  4IY5 A;  1G0I A;  2QL3 A;  1NFT A;  3K01 A;  3VXC A;  1IXC A;  4MJO A;  4AS5 A;  2QS1 A;  2FIX A;  2OWZ A;  1B2H A;  3QK6 A;  4JSD A;  1PEB A;  3RPW A;  3WAE A;  2RC7 A;  1OLA A;  3ZKL A;  4IY6 A;  3EF7 A;  4RYA A;  1EU8 A;  3V5A A;  1JNF A;  3HST A;  1NI9 A;  3SES A;  3TCH A;  4FED A;  4IGT A;  5DVF A;  3QIM A;  2QFL A;  3HO7 A;  1A54 A;  3OO6 A;  2PFY A;  1B0L A;  4PFW A;  3TZA A;  3IO6 A;  3VFJ A;  4LUB A;  3CFL A;  2I4C A;  3B6Q A;  3T1B A;  5H8H A;  1O64 A;  4XF5 A;  1CE2 A;  1LAH E;  2R71 A;  1DPE A;  2KR0 A;  3BKI B;  2I3V A;  2HZK A;  2Q8J A;  3OSQ A;  3CFZ A;  3ODB A;  2XX7 A;  4ELO A;  4GF8 A;  4XKQ A;  4XKP A;  3MYU A;  1B7H A;  3CI8 A;  4KI0 E;  4OET A;  3B7D A;  4H65 A;  5TP9 B;  4N15 A;  3LUY A;  1ATG A;  3DP4 A;  4G4P A;  1URS A;  3FXU A;  4X1B A;  3TQW A;  1B5H A;  3O29 A;  3RTW B;  4KCC A;  3V83 A;  1VSO A;  1KWH A;  4G68 A;  2HCA A;  1FBE A;  1MM6 A;  3K1M A;  5ET5 A;  3D1R A;  3CSB A;  3ONM A;  3VXB A;  3O6H A;  3BIG A;  3LBS A;  4F22 A;  2Y7P A;  5IKB A;  3PPP A;  3SEY A;  4WED A;  3KEI A;  4PAI A;  2RC8 A;  5EQA A;  1P1W A;  4C0R A;  1H45 A;  1MH3 A;  2RIN A;  4ZE8 A;  1LAF E;  1YAE A;  2ONK E;  3VV5 A;  1URD A;  3PU5 A;  1N0T A;  4FIM A;  3EN3 A;  4O3B A;  4X1D A;  5CMB A;  2GQ1 A;  1A55 A;  2O68 A;  4F31 B;  3E3K A;  3IFA A;  4IO6 A;  4OVT A;  4U1Z A;  4NGU A;  5I56 B;  3MP8 A;  2DVZ A;  4PC9 A;  4XIG Q;  3T9H B;  2OK2 A;  4RXL A;  4GOT A;  4DXU A;  1WVJ A;  3QSL A;  4EXL A;  4RA1 A;  1RYO A;  2XXV A;  2UYF A;  4ESX A;  1B1X A;  2X7Q A;  2L5V A;  1NH8 A;  4HE1 A;  4IGR A;  3N6U A;  1B58 A;  2P3V A;  2XXK A;  2WKY A;  2H5Y A;  3UP9 A;  1XI6 A;  2Z8F A;  3M3F A;  2HXW A;  3IL1 B;  4QRZ A;  2RKM A;  4NED A;  1F9B A;  3T66 A;  4GLI A;  4GWZ A;  1B4Z A;  3RNN A;  5I3S A;  1I6B A;  2D21 A;  4F1V A;  4GWW A;  3MP1 A;  4R74 A;  3U65 A;  1YCJ A;  1TWY A;  2Q9T A;  2CZI A;  3S4U A;  1GGG A;  4DI4 B;  2E0S A;  4MBP A;  2E1S A;  4OFO A;  4OEN A;  4HXV A;  1OIB A;  2VT5 A;  2OCU A;  1B32 A;  5CBS A;  3MP6 A;  2XXQ A;  4G2Z A;  3DEL B;  5CI5 A;  4R2F A;  2B3B A;  4GRK A;  4JWY A;  3C36 A;  1II5 A;  1PB9 A;  2A5S A;  1USY H;  1ZJL A;  1P99 A;  3C33 A;  2FA7 A;  2F6P A;  1TFA A;  4LN5 A;  2UVJ A;  5L9O A;  3LSL A;  2P2A A;  3G3K A;  5A5L A;  4JVC A;  3K2D A;  1IQ7 A;  3ISP A;  1HSJ A;  5EHS A;  1JW5 A;  1SDX A;  3SEV A;  3KBR A;  3W15 C;  1Y3Q A;  3D4C A;  4OAN A;  3U94 A;  5I56 A;  3GZG A;  4ZS9 A;  4ELP A;  3USD A;  3K1P A;  2FNC A;  3PPQ A;  4N6D A;  3SKP A;  4PE3 A;  4PP0 A;  3T9X B;  2QMX A;  4GD5 A;  1XVY A;  4MFI A;  1RKM A;  4PET A; 
#chains in the Genus database with same CATH homology
 2ZYN A;  1MQG A;  2O51 A;  3T96 B;  1OMP A;  4JSO A;  3OO8 A;  3S9M C;  1MY2 A;  1MXY A;  3RLF E;  5I59 A;  4PE5 B;  1DPP A;  4C1U A;  2YPN A;  3H7M A;  4LZ5 A;  3W9V A;  2F97 A;  1MPC A;  1XC1 A;  1B51 A;  4P0I A;  4O3C A;  3PPN A;  4TQU Q;  1ZKB A;  2I4B A;  1MXX A;  4AB6 A;  2IEE A;  3B6W A;  1Y1M A;  5I2N A;  2F8D A;  3L6G A;  3EPE A;  4OWD A;  5ISU A;  1BLF A;  4XKN A;  1SW5 A;  4AB5 A;  1MY4 A;  1Q35 A;  3TAJ A;  3C9H A;  1XOC A;  1MPD A;  3FGS A;  1QW0 A;  1Y1Z A;  2ANJ A;  4LQ2 A;  3SEX A;  4RJZ A;  3SDF A;  4DXB A;  4U23 A;  4ESW A;  3KN7 A;  4BDQ A;  3RY3 A;  2V25 A;  5HM4 B;  1VFE A;  1AIV A;  1N84 A;  2Y7R A;  3MZB A;  1JET A;  3EHT A;  2O6A A;  4KCD A;  3KGC A;  3IOV A;  4IO7 A;  2NUV A;  3BFT A;  3S9L C;  1LST A;  3K6W A;  4NF8 B;  3IO4 A;  3C31 A;  1LBC A;  3A09 A;  3FXR A;  1SW4 A;  1EZP A;  5EHM A;  3SEW A;  3MUQ A;  3BBR A;  2XX9 A;  2DWA A;  3AXF A;  4QF9 A;  1M5D A;  3MBP A;  4PFT A;  4LQ5 A;  4F1Y A;  3DP6 A;  2NWJ A;  4F3P A;  2GH9 A;  1CB6 A;  5H8H B;  4GFR A;  3UN6 A;  3PPO A;  1ZU0 A;  2G29 A;  1MS7 A;  1Z7N E;  3KJ7 A;  1FQB A;  1N7W A;  3FJG A;  2F5X A;  4XKR A;  1B40 A;  2O1L A;  3K6U A;  4X48 A;  1FQD A;  4R73 A;  1JEU A;  4C1T A;  1IIT A;  3Q26 A;  1NL5 A;  4KPT A;  3B6T A;  1LCT A;  3IAZ A;  1FQA A;  3GLB A;  3IOR A;  2ALU A;  1YPN A;  4HS7 A;  5CC2 A;  4RK9 A;  2O7U A;  2H25 A;  4R6K A;  1N7X A;  4P0G A;  5I58 B;  3UGW A;  1N3W A;  3TUS A;  4ZEC A;  1O63 A;  4G68 B;  1VR5 A;  1JEV A;  3N94 A;  3OEN A;  4K3F A;  4EQB A;  2ABH A;  1ZIU A;  2OZZ A;  4JXI A;  3MVY A;  1POY 1;  1BP5 A;  2R9J A;  3T9U A;  3LSW A;  4F3B A;  4RK2 A;  3PUY E;  2XXR A;  3PUX E;  3LSX A;  3FAT A;  3OOA A;  1P1N A;  5AA2 B;  1T0K A;  2B3F A;  3FXQ A;  4NF8 A;  2QS3 A;  4G8H A;  4FJP A;  1PBP A;  2REJ A;  4LZ8 A;  2DVC A;  5DTB A;  4R6Y A;  3HCQ A;  2DYX A;  4LA9 A;  2ZYO A;  3IR1 A;  4GWO A;  3RN8 A;  4RPO A;  2I58 A;  1FQC A;  4H0W A;  1IXI A;  1NNK A;  3DM0 A;  3QUF A;  4U22 A;  3W9W A;  5HBC A;  1HSL A;  4F2O A;  1UTB A;  4G8N A;  1FCK A;  1NMU A;  4M4G A;  4YKJ A;  3T93 B;  4ZEI A;  3RQT A;  2H9B A;  4R9F A;  2QRY A;  1O7T A;  1A99 A;  3FV1 A;  3FJM A;  5CMK A;  4Z0I A;  3K02 A;  3GXA A;  1H44 A;  3H6V A;  3HHF A;  4RY1 A;  4FOR A;  4KFQ A;  3G3I A;  1DSN A;  3BFU A;  3MW0 A;  3SER A;  5I58 A;  3TTR A;  3OEM A;  4H8I A;  1XHY A;  4XXU A;  1A40 A;  2DE3 A;  3VDF A;  4PFU A;  2GHB A;  2Y7I A;  4ISU A;  1ZBM A;  1BIY A;  1D4N A;  1RYX A;  4FAJ A;  4QHQ A;  2CMO A;  1FTO A;  2UVG A;  2VP1 A;  3MZ1 A;  2O7I A;  2F36 A;  1US5 A;  1B9J A;  4JDF A;  2Y84 A;  5AA2 A;  4QFL A;  2F6G A;  2PYY A;  4EQ7 A;  1XS5 A;  1QUJ A;  4OTE A;  3V89 B;  2YJP A;  3DP8 A;  1M5E A;  3E13 X;  3K0V A;  3FAS A;  3L6H A;  1M5C A;  2AL5 A;  4I62 A;  3VLW A;  4IO3 A;  1MXW A;  2XXY A;  2PX1 A;  4OQO A;  1B52 A;  1UIV A;  2X7P A;  1DTG A;  3MPL A;  5DT6 A;  3O28 A;  4HCY A;  4OHN A;  3OEK A;  3FJ7 A;  1H76 A;  4HTG A;  4MLQ A;  1MDQ A;  5FHN A;  1ZMG A;  3HV1 A;  1MDP 1;  3U8Q A;  1DMB A;  3TYH A;  2I49 A;  2VOZ A;  1LCF A;  3THI A;  4THI A;  3ZSF A;  3PD8 A;  4EF2 A;  2OJT A;  3A3U A;  1D9V A;  4GIZ A;  3FVG A;  4H5F A;  2HEU A;  2NVU B;  4NF4 B;  4DIG A;  4ZEK A;  4ZZE A;  4EQ9 A;  3IB2 A;  2H98 A;  1QJM A;  4YKI A;  3CG1 A;  2AIX A;  1UTH B;  5I59 B;  3PMV A;  3I6V A;  1S9T A;  3PUV E;  2I0B A;  4FAT A;  4LON B;  3D4G A;  2DWI A;  1EZ9 A;  3PUW E;  5H8F B;  4YU0 A;  3PD9 A;  3PPR A;  2GFE A;  5I2N B;  3MAM A;  4I8C A;  2H99 A;  2Y7K A;  2Y7W A;  4ZED A;  1LB9 A;  4RNS A;  2HFB A;  3C34 A;  4YMA A;  2XXW A;  1VFD A;  3JYR A;  5L9S A;  4GXA A;  2PT1 A;  3MJN A;  3V8X B;  1BKA A;  5FHM A;  4F1U A;  4ZE9 A;  2GHA A;  3H06 B;  2PT2 A;  4YB5 A;  1S50 A;  2FYI A;  1N04 A;  1P1Q A;  3PGF A;  5ITP A;  3LSF B;  1R9L A;  3FZV A;  4R75 A;  3VE1 B;  4YIC A;  1SYI A;  1GTK A;  3K00 A;  4KYD A;  3CRB A;  4BDO A;  3MPK A;  2P1S A;  4KR5 A;  4H1X A;  1SI1 A;  2NXO A;  3HHG A;  4U1O A;  1Y9U A;  2PMS A;  4POX A;  1MQH A;  2XXI A;  3MQ9 A;  3MWB A;  3H3G A;  1PC3 A;  2DP8 A;  2M8C A;  1B5I A;  2Z8D A;  4LAT A;  4OEV A;  2QS2 A;  1TFD A;  2Q89 A;  4UA8 A;  5H8S A;  4DCY A;  1SVX B;  3ILT B;  1SD3 A;  3LC8 A;  4UAC A;  5I57 B;  4BLA A;  1URG A;  2XXT A;  2Z23 A;  4NF4 A;  1WOD A;  3OMB A;  4JWO A;  2QPQ A;  1UTH A;  3CFX A;  3FVN A;  4MH5 A;  1B3H A;  3TEP A;  2XXP A;  4EUO A;  2REG A;  2XD3 A;  1LFH A;  2F7C A;  4WKM A;  4U2R A;  1LFI A;  1FTK A;  3O6G A;  1GV8 A;  5H8F A;  4LP2 B;  3IX1 A;  1YTV A;  1Y4T A;  3VLU A;  3CVG A;  2ONS A;  3JV9 A;  3ECR A;  1NNP A;  2F35 A;  4KYS A;  2DWJ A;  5CMM A;  1MXV A;  4E0W A;  5BUU A;  2I6E A;  4ZEB A;  4R72 A;  1M5B A;  4OXV A;  4F39 A;  3WAF A;  4PFY A;  3RT6 B;  1SW2 A;  4H6D A;  1AOV A;  1B05 A;  1JVY A;  5AA3 A;  2ZYM A;  3KSX A;  3P7I A;  3EQ1 A;  5I84 A;  2OLB A;  5F7V A;  4DCX A;  1OQG A;  3VLV A;  2P0S A;  1R6Z A;  4QSC A;  4IO4 A;  3H6W A;  1ELJ A;  3IOU A;  5L9M A;  1Z7M E;  1ANF A;  2AL4 A;  4WEP A;  4BDL A;  5L8D A;  4ND9 A;  3TTL A;  2OBG A;  3C4M A;  2HQ0 A;  2XD2 A;  3OO9 A;  3KFM A;  4QSD A;  3VVD A;  3DLN A;  3U1O A;  4Q30 B;  1Y4C A;  4HW8 A;  2ONR A;  3FV2 A;  3S9N C;  2QMW A;  3ZKK A;  5I57 A;  3S9E A;  2DE2 A;  4ELQ A;  2UXA A;  3CSG A;  4Q0C A;  1BTJ A;  4F3S A;  3Q27 A;  3PMW A;  4F2Q A;  1B46 A;  4R2B A;  4MLV A;  1LAX A;  4OFJ A;  1R1N A;  1UTB B;  4BDR A;  4YKK A;  1Y3P A;  5DVI A;  1LBB A;  3RTF B;  2AYS A;  3C32 A;  3QXM A;  5KZT A;  5JTY B;  5DYH A;  4EF1 A;  5AA4 B;  4P11 A;  3A3C A;  2F34 A;  3IOT A;  4EDP A;  1QUL A;  3HPI A;  1GR2 A;  4HCW A;  1FQF A;  2OWS A;  1B1H A;  2BJJ X;  1R9Q A;  3PMX A;  2VD2 A;  4H67 A;  1TT1 A;  1MY0 A;  3KG2 A;  4R6H A;  5JK4 A;  3M3K A;  4GVO A;  1IIW A;  4X9T A;  1TXF A;  2ZXT A;  4U4S A;  1N3X A;  2Q2A A;  4POW A;  1AH5 A;  3KN8 A;  2DOJ A;  1MRP A;  3T22 A;  1LB8 A;  3O6I A;  1ZTY A;  2DS9 A;  3GBA A;  1J1N A;  3TCG A;  3TPA A;  3TDJ A;  1EH3 A;  4OYV A;  5KDT B;  1B6H A;  5EYF A;  1OVT A;  2ZYK A;  5IAI A;  4YKP A;  3OD7 A;  2F78 A;  1QUK A;  4G77 A;  2X26 A;  3FVO A;  1B0H A;  5AA1 A;  1VE4 A;  2HAV A;  4N6P A;  3IJX B;  4QSE A;  2DWH A;  4YZZ A;  5KCJ A;  1MXZ A;  2IA4 A;  4G68 C;  1NNT A;  2O69 A;  1MQJ A;  2LAO A;  2GRV A;  2QS4 A;  3TOD A;  3I5O A;  3KJT A;  1A8F A;  1A7L A;  2ESN A;  4FE8 A;  4YB7 A;  4NWC A;  2ZNS A;  2UVH A;  4OMB A;  5ELV A;  3F11 A;  5H8N B;  3TFL A;  1MG1 A;  1MPB A;  3H4Z A;  3G3J A;  1NNF A;  5JTY A;  2V84 A;  1D3K A;  5AA4 A;  1SW1 A;  5CM6 A;  1B3G A;  2Z22 A;  4I1D A;  4DXC A;  4BDN A;  3M8U A;  2A5T B;  1NH7 A;  2F7B A;  1USY E;  3E9X A;  5FTI A;  4ZDM A;  2VGQ A;  2NOO A;  4L17 A;  3KOS A;  3R7X A;  1Y3N A;  4YMB A;  3KZG A;  3G3H A;  1B5J A;  2KLF A;  4IO2 A;  4F18 A;  3U93 A;  3GBB A;  2O84 X;  1H3D A;  4FEC A;  5KDT A;  1B3L A;  4QFO A;  1FTM A;  2UVI A;  2DXR A;  3VVE A;  4YAH X;  1P1U A;  1I6A A;  2QSX A;  3PV0 E;  2XXU A;  3HN0 A;  1IXG A;  3CG3 A;  2YLN A;  1M5F A;  1IXH A;  1I69 A;  3O9P A;  1MXU A;  5B7D A;  2DSF A;  3KN3 A;  3G3F A;  4N07 A;  3R26 A;  4IB2 A;  3R6U A;  3IB0 A;  4KYE A;  5I2K B;  2ZMB A;  1POT A;  5BWJ A;  3VVF A;  1D9Y A;  1EZO A;  1WDN A;  3UOR A;  2HZL A;  1SBP A;  5H8N A;  3IK6 B;  2V3U A;  2DE4 A;  4KQP A;  2V93 A;  1XVX A;  4OZ9 A;  3MZ9 A;  4DLD A;  5ITO A;  4GXS B;  2R6G E;  3O66 A;  2D5W A;  3MC2 A;  4NMY A;  5CRY A;  4ZEF A;  2A5T A;  1PBQ A;  4KD5 A;  4OVJ A;  2XX8 A;  4PQJ A;  1OLC A;  4I9D A;  5TP9 A;  2W7Y A;  4O3A A;  2VD3 A;  3Q28 A;  3K6X A;  4Q5T A;  1IZ1 A;  4ELR A;  4JB7 A;  2DXY A;  5FTH A;  2THI A;  3K6V A;  3G7W A;  1JW1 A;  2B65 A;  4FEB A;  4EXK A;  3MVZ A;  4LVQ A;  5A5X B;  3IOW A;  2I3W A;  3CIJ A;  4NF5 B;  2XXX A;  3O2A A;  5CBR A;  3QUJ A;  4Z7E A;  4TLL B;  3UIF A;  1JQF A;  5HPQ A;  1Q1K A;  4RPN A;  4MF3 A;  1MY3 A;  2G93 A;  3T9V A;  3FUZ A;  1MH4 A;  4JBZ A;  2DQV A;  2VHA A;  3UA8 A;  1P1O A;  5I2K A;  1SYH A;  2V3Q A;  3RUM A;  1Y20 A;  2UYE A;  4GL8 A;  4GQO A;  4QFK A;  4GL0 A;  2XHD A;  1QKA A;  4LZ7 A;  4QFP A;  3U92 A;  3M3L A;  1PB7 A;  1SI0 A;  4QFN A;  3TQL A;  5FHO A;  1S7Y A;  5K2X A;  3H6T A;  4F3G A;  3MVW A;  3Q25 A;  2OWT A;  1QUI A;  2PBW A;  1LAG E;  1LGB C;  2QJE A;  3TCF A;  3H03 A;  1B4H A;  3OSR A;  2ZNU A;  2Z8E A;  4NF6 B;  4AQ4 A;  3TEL A;  5K2Y A;  5TPA B;  3O97 A;  3H6U A;  2Q2C A;  4KHZ E;  4JWX A;  2I48 A;  1JVX A;  3I3V A;  1DOT A;  5DVJ A;  3TTK A;  2O1M A;  3EHS A;  3E4R A;  1GVC A;  4U21 A;  3K1N A;  5A5X A;  5ICT A;  1QKB A;  1AMF A;  4Q8R A;  3QAX A;  4NF5 A;  1FTL A;  4N13 A;  4R9G A;  1PDA A;  3KSJ A;  3ZS6 A;  4DZ1 A;  4H8J A;  4NTL A;  1ZLQ A;  1MQD A;  1XT8 A;  3RGY A;  3IB1 A;  1B7Z A;  4ECF A;  3IJO B;  3TKD A;  2D3I A;  3KOT A;  4DDD A;  1LLS A;  1LFG A;  1UIU A;  3PUZ E;  5DEX B;  2RCA A;  3TTM A;  3Q29 A;  5CMC A;  5LOM A;  5H8Q B;  3QYT A;  2RF1 A;  1JW4 A;  5ICQ A;  1A8E A;  2CZL A;  2I0C A;  1H43 A;  4H5G A;  4DE8 A;  1DTZ A;  4G8M A;  3TMG A;  1FTJ A;  2H4I A;  1I6Q A;  4WXJ A;  4F29 A;  5KCJ B;  4YB6 A;  3U72 A;  2ZNT A;  1QVS A;  1NKX A;  4NE4 A;  4NWD A;  2F7A A;  5AE4 A;  3OO7 A;  4NF6 A;  1SQY A;  3N5L A;  1PB8 A;  5TPA A;  3G3G A;  3ILU B;  4OFL A;  2RC9 A;  1N76 A;  3UK4 A;  4ONY A;  3SET A;  3EHU A;  4TOZ A;  1UQW A;  4TLM B;  1L5T A;  2HAU A;  2PVU A;  3C35 A;  3N26 A;  4IO5 A;  5B70 A;  4OES A;  3K4U A;  1OQH A;  4U4X A;  3LR1 A;  4BDM A;  3RT8 A;  2V3T A;  1FW0 A;  5JEI A;  5M2V A;  1FQE A;  1B3F A;  1AL3 A;  4OER A;  1HSE A;  1B7U A;  2XXH A;  5TU0 A;  5F1Q A;  1MY1 A;  1IEJ A;  5J1D A;  3S2V A;  4XTC Q;  4E0X A;  3N6T A;  3TTN A;  3FD3 A;  3OEL A;  1MQI A;  4ZZA A;  5DEX A;  3MVX A;  3JZJ A;  2Q88 A;  3CR9 A;  4M1V A;  2RCB A;  5H8Q A;  5AA2 D;  1IUD A;  4F19 A;  3FVK A;  3FIR A;  1OVB A;  1US4 A;  3SEU A;  1B3E A;  4OEU A;  1MM7 A;  3OXN A;  4IY5 A;  2QL3 A;  1NFT A;  3K01 A;  3VXC A;  1IXC A;  2QS1 A;  1B2H A;  3QK6 A;  4JSD A;  1PEB A;  3RPW A;  3WAE A;  2RC7 A;  1OLA A;  3ZKL A;  4IY6 A;  3EF7 A;  4RYA A;  1EU8 A;  3V5A A;  1JNF A;  3HST A;  3SES A;  3TCH A;  4FED A;  4IGT A;  5DVF A;  3QIM A;  3HO7 A;  1A54 A;  3OO6 A;  1B0L A;  4PFW A;  3TZA A;  3IO6 A;  3VFJ A;  4LUB A;  3CFL A;  2I4C A;  3B6Q A;  5H8H A;  1O64 A;  1CE2 A;  1LAH E;  2R71 A;  1DPE A;  3BKI B;  2I3V A;  2HZK A;  2Q8J A;  3OSQ A;  3CFZ A;  3ODB A;  2XX7 A;  4ELO A;  4GF8 A;  4XKQ A;  4XKP A;  1B7H A;  3CI8 A;  4KI0 E;  4OET A;  3B7D A;  4H65 A;  5TP9 B;  3LUY A;  1ATG A;  3DP4 A;  4G4P A;  1URS A;  3FXU A;  4X1B A;  3TQW A;  1B5H A;  3O29 A;  3RTW B;  4KCC A;  3V83 A;  1VSO A;  1KWH A;  4G68 A;  2HCA A;  1MM6 A;  3K1M A;  3CSB A;  3ONM A;  3VXB A;  3O6H A;  3LBS A;  4F22 A;  2Y7P A;  5IKB A;  3PPP A;  3SEY A;  4WED A;  3KEI A;  2RC8 A;  1P1W A;  4C0R A;  1H45 A;  1MH3 A;  2RIN A;  4ZE8 A;  1LAF E;  1YAE A;  2ONK E;  3VV5 A;  1URD A;  3PU5 A;  1N0T A;  4FIM A;  3EN3 A;  4O3B A;  4X1D A;  5CMB A;  1A55 A;  2O68 A;  4F31 B;  3E3K A;  4IO6 A;  4U1Z A;  5I56 B;  3MP8 A;  2DVZ A;  4XIG Q;  3T9H B;  2OK2 A;  4RXL A;  4GOT A;  4DXU A;  1WVJ A;  3QSL A;  4EXL A;  4RA1 A;  1RYO A;  2XXV A;  2UYF A;  4ESX A;  1B1X A;  2X7Q A;  1NH8 A;  4IGR A;  3N6U A;  1B58 A;  2WKY A;  2H5Y A;  3UP9 A;  2Z8F A;  3M3F A;  2HXW A;  3IL1 B;  4QRZ A;  2RKM A;  4NED A;  1F9B A;  3T66 A;  4GLI A;  1B4Z A;  3RNN A;  1I6B A;  2D21 A;  4F1V A;  3MP1 A;  4R74 A;  1YCJ A;  1TWY A;  2Q9T A;  3S4U A;  1GGG A;  2E0S A;  4MBP A;  2E1S A;  4OFO A;  4OEN A;  1OIB A;  2OCU A;  1B32 A;  5CBS A;  3MP6 A;  2XXQ A;  4G2Z A;  3DEL B;  5CI5 A;  4R2F A;  2B3B A;  4GRK A;  4JWY A;  3C36 A;  1II5 A;  1PB9 A;  2A5S A;  1USY H;  1ZJL A;  1P99 A;  3C33 A;  2FA7 A;  2F6P A;  1TFA A;  2UVJ A;  5L9O A;  3LSL A;  2P2A A;  3G3K A;  3K2D A;  1IQ7 A;  1HSJ A;  5EHS A;  1JW5 A;  1SDX A;  3SEV A;  3KBR A;  3W15 C;  1Y3Q A;  3D4C A;  3U94 A;  5I56 A;  3GZG A;  4ZS9 A;  4ELP A;  3USD A;  3K1P A;  2FNC A;  3PPQ A;  3SKP A;  4PP0 A;  3T9X B;  2QMX A;  4GD5 A;  1XVY A;  4MFI A;  1RKM A;  4PET A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...