1HSJA

Sarr mbp fusion structure
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
487
structure length
487
Chain Sequence
KIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALAAAQTNAAAEFMSKINDINDLVNATFQVKKFFRDTKKKFNLNYEEIYILNHILRSESNEISSKEIAKCSEFKPYYLTKALQKLKDLKLLSKKRSLQDERTVIVYVTDTQKANIQKLISELEEYIKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the SarR protein from Staphylococcus aureus.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription/sugar binding protein
molecule keywords FUSION PROTEIN CONSISTING OF STAPHYLOCOCCUS ACCESSORY REGULA
total genus 143
structure length 487
sequence length 487
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
A PF12802 MarR_2 MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1hsjA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1hsjA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1hsjA01
4F3GA 2H27A 1LBBA 2UXAA 3OEMA 4HLYA 1B3HA 4R6HA 1XGOA 4RAYA 1XC1A 3BDDA 2EV6A 4L0ZB 3TELA 2F7BA 3O6BB 4RB2C 3R0JA 4N07A 2P1SA 3IHUA 4RS8A 4OMBA 3R6SA 1LSTA 4XIGQ 3MVWA 3DP6A 1W5TA 1VSOA 4KDPA 4ASNA 4LZ8A 2RV8A 1B2HA 4MTEA 1FQCA 1LFIA 3VXBA 4F3BA 1Y1ZA 3NQOA 3RKWA 3WTZA 1USTA 3DELB 4NQWA 2PEXA 1HKSA 2Y48A 1AIVA 1AOVA 3EQ1A 1S7YA 4R6KA 5ED4A 4WEDA 4BLAA 2XX8A 5FHMA 2Q0OA 3L7WA 4UHTA 3B6TA 2VBYA 4GFRA 5I59B 3HHHA 1GV8A 4FIMA 1XCVA 1FBSA 1F1ZA 3FASA 3O29A 1JETA 5L3CA 1T0FA 5LLQA 1O3SA 1P4XA 4M72A 3V8LA 3T0YA 5DUKA 3PUVE 1UB9A 3O3KA 3U72A 1YW8A 2HGCA 4G8XA 2YSRA 1B7UA 4QFLA 3U8QA 4XRFA 4F19A 3FVNA 3VVFA 4YMBA 1B5HA 3KG2A 2P7VB 5DCFA 1PDNC 3I5OA 2P6TA 3IAZA 2PMHA 2XAQA 1V3FA 2CMOA 4OWDA 3B6WA 4EJWA 1DPRA 2D5WA 2XKPA 1YYVA 3TQLA 1MM6A 5ILVA 3F3XA 2CO5A 3NRVA 3KGCA 1OIBA 3ELKA 4KYDA 3LQQA 3WODF 1J75A 2UYFA 4FHTA 4QFNA 5DTBA 1IXIA 2OZUA 4HLXA 3TEPA 5FLXZ 1B9MA 4HCYA 2M5WA 3T9XB 2D21A 1XS5A 3C1DA 4G68A 3CUQC 2ZMBA 3SETA 2X7PA 1P1OA 4ONYA 3GZ6A 3U1OA 5AIPA 3W15C 2C6YA 2ZMEA 1JW4A 5LGNA 2FMLA 4M74A 2O51A 4BDRA 1A8EA 2VBWA 2DE2A 3D5LA 3KLOA 4N9IA 3TZAA 3B73A 5JTYB 5K1YA 4HF2A 3K0LA 2L4AA 4U7BA 3U94A 1OYWA 3M8EA 3OXNA 1LVAA 4QRZA 1NHAA 1QZYA 4UV9A 1HSJA 4IRHA 1IITA 2F6PA 1LLSA 2ZO4A 4U0YA 1EH6A 3GFMA 2OA4A 4RY1A 1UCRA 1F9BA 1IW7F 4KR5A 3U92A 2V84A 2FU4A 3G3JA 3BP8A 3T1BA 4JQFA 4PZJA 2V79A 4OQOA 4HV5A 3ULQB 2GRVA 4XLPF 4F29A 3UP9A 3SKPA 4D0PA 1UTBA 4IO5A 4H8JA 2HKXA 3SESA 1J1NA 2V1DA 1I6AA 5LHGA 3J80K 2OAZA 2ISZA 5IT3A 5F1RA 1N3WA 1MXYA 3R26A 2UZKA 4WF2A 4LG0B 3TKDA 2F2EA 4FX4A 2M8EA 1OYYA 1LEAA 4HW0A 4WWCA 1MPBA 4WXHA 3MZ1A 2YX4A 3OO6A 4QHQA 3C34A 3KE2A 2VD2A 3G3ZA 1D5VA 1G4DA 2UVGA 4JWYA 1SMTA 3U9GA 4R1HA 2H98A 3KN3A 2GH9A 4HX7A 3KP7A 5A5XB 1BIYA 3BY6A 3EF7A 3VVEA 1HSTA 3E6CC 4F39A 4BDMA 4YAHX 4DE8A 4KT5C 1B4HA 1MPDA 2CSOA 4KFCA 3CDHA 1OQGA 1FQDA 2L02A 4LK1F 1NMUA 2OBGA 2ABHA 1W4MA 3GBAA 3E6DA 2XXVA 1H44A 2UVJA 4IGTA 5AIQA 1KU7A 1IZ1A 3H06B 1LCTA 3PUZE 1ZG3A 3GW2A 3TO7A 2KIUA 4EVIA 4AB6A 2QQAA 4EM0B 1MRPA 3RPQA 1ZBMA 1FTOA 3DP4A 3KZZA 2ZXJA 3ILTB 2ZYOA 2M8CA 2E1CA 2D1VA 3L00A 3REOA 4NHJA 1XD7A 1AL3A 1US5A 2Y7RA 3VFZA 5H8HB 1FYKA 4R2BA 1KA8A 5E1XA 1TFDA 2H99A 1LDKB 2K27A 3KZGA 1LBCA 5HOOA 4GF8A 2QS4A 4M1VA 3K2DA 1OQHA 3RUMA 3RLFE 3GX4X 3K69A 2LNBA 2XD2A 4RPOA 1QJMA 3EUHA 4Q5TA 3RN8A 3N94A 5FHOA 5I57A 3JV9A 5DCMA 1SDXA 4OENA 4BHCA 2YX7A 2YPNA 1QVSA 1ON2A 2FF4A 5KVRA 1USSA 2XROA 1ZLQA 1MQHA 5CMKA 2W57A 3RKXA 2VBZA 3TGNA 4KQPA 1B5IA 1IEJA 1T38A 3MQ0A 3U1DA 4IHSA 1T39A 1ZARA 3G7WA 2MH2A 5ILUA 3T8RA 2WC2A 3PUXE 3MC2A 2R7DA 1QKBA 1FP1D 3L6HA 1EH7A 2RC7A 3P7IA 4ESXA 2G29A 5AA2A 2VODA 1W7PB 1FSHA 3IC7A 2HYGD 3CR9A 3LSLA 5L9OA 2Z99A 4KPTA 3K01A 3TCFA 4XLNF 1S7AA 3V7RA 5ITPA 3GLBA 2Q88A 2DP8A 1O7LA 2FA5A 4L5JA 1EZ9A 3E3VA 3R61A 5I2KB 1H76A 4OXVA 2VE9A 2PG4A 4YFNF 1FYMA 2YPRA 2Z5UA 3MP6A 2ADUA 1A04A 4MTDA 2H5YA 3W9WA 4FE8A 4AWXB 3DP7A 1U2WA 4G4PA 4OIOF 2DQLA 1N0TA 5CBRA 4BDNA 2JT1A 1NNKA 2ZMEB 4KICA 3GZ5A 1Y4TA 2F5XA 4ZZEA 4WEPA 1E2XA 3WTUC 3SEYA 3MAMA 1B1XA 4GVOA 4C0RA 1MPCA 5D6EA 2HTSA 3K6WA 1P1UA 4EJTA 3MZHA 2JTVA 5IT9K 2P8TA 3LUYA 2DQVA 2EV5A 4ZZAA 1ZREA 1PB8A 2ZNTA 5K5RA 1IXSB 4PGGA 3HRUA 1J0RA 1G3TA 2P5LC 5HDGA 1Y20A 2O7IA 2I3VA 3QP5A 1EU8A 4R2FA 3PV0E 4KNYA 1E17A 2GFEA 3KP5A 4NEDA 5E1ZB 4H1XA 4QWQA 4MGRA 4H0EA 3EHTA 1I6XA 3AAFA 5D5VB 1IF1A 5HS7A 3ZMTA 1WVJA 4BHPA 3COAC 4PDKA 1IN4A 4IRGA 4A0XA 1FWZA 3WG9A 4GWOA 5I57B 4UVCA 1O3TA 1PUEE 3GFIA 2GAUA 1M5FA 1PDAA 2REJA 3PPOA 4ZS9A 5DDGA 3K4UA 1MH3A 4M9XA 5J1DA 4RPNA 3FHZA 5AA3A 5A2QK 3OSQA 1CF7B 4YB6A 2JSCA 4MNUA 4BQAA 3LSFB 2STWA 4RGRA 3HO7A 2W24A 4IO4A 5ICCA 4GGGA 5CI5A 1D9YA 1XSXA 3RQTA 1SD6A 1ATGA 2H25A 3OSRA 1UFMA 2G9WA 1K78A 2ZFWA 3A3UA 3KJ7A 3ZPLA 1D8KA 1B0LA 3UIFA 4IJAA 5H6QA 3SQNA 2XXUA 4WXDA 3MZ9A 4AIJA 2GXBA 3V5AA 4GOTA 2LF8A 1N3XA 1QPMA 2XGXA 1OPCA 2NXOA 2FRHA 4OINF 1DTZA 1UTHA 2PYYA 4HCWA 3QAHA 1QW0A 1R9LA 4R75A 1RZ4A 5CMCA 1BBYA 3MPKA 3I59B 2FBIA 2A5TB 3GXOA 3BFUA 4YU0A 3PU5A 3KETA 1I6QA 2XXXA 4EQBA 3KEQA 2QJEA 4WXCA 2OJTA 2RNJA 5DVJA 4K3FA 2HFBA 2RCAA 4R72A 2XAGA 1X3UA 3ZN0A 3CI8A 1YAEA 4IB2A 3CFLA 3VLUA 2F8DA 1G6NA 3FMRA 1XDUA 4I2OA 3VLVA 1USYE 1SW1A 3IOUA 3QU6A 4DIGA 5E18F 2ONKE 3T66A 3RDIA 5HDKA 4L9JA 5K2XA 3M9AA 1HW2A 5LHHA 1F9NA 3EYIA 4YZZA 4G7OF 3TMGA 1QNTA 3QK6A 4N13A 3N4MA 2HYFA 4JBZA 5CJ9A 3PD9A 2W25A 3FUZA 4F22A 3VDFA 5K2YA 2IW5A 5E8GA 3JSPA 1U5TA 4GXSB 2LSOA 5KDTB 2RDPA 5L3BA 3KOSA 1B3FA 1O63A 3I54A 3KFWX 2ALUA 4YKJA 3HHGA 5D8KB 1PP8F 3T9UA 4EGYA 4OVJA 1JQFA 1M5EA 2OQGA 3R7XA 1LB2A 1B4ZA 4LQ5A 1R1UA 2FNPA 4A6EA 3OENA 1Q1KA 3Q9SA 2DS9A 3LSWA 5B7DA 4G9YA 2MLGA 3L09A 4GIZA 4EM1A 1Q35A 2VOOA 4E0XA 5AA4B 5I58B 5E20A 3G3IA 4R8HA 2CW0F 2O6AA 2A5SA 1DMBA 2H9BA 2G7HA 1J7KA 1GR2A 1FTLA 4TQUQ 2GA2A 2L3DA 3H3GA 5HM4B 2O68A 2VOPA 2BGCA 1IUDA 1ZYRF 2G93A 3M3KA 3LA7A 5H8QA 2HZLA 3F8MA 4BAYA 3GO5A 4LLNA 4EQ7A 2L4MA 2XX7A 4JSOA 3EETA 4YFXF 5ICGA 4DXCA 5H8FB 3E9XA 1LNWA 3CUOA 4NF4A 6PAXA 3ROUA 5ICFA 2I3WA 3BOQA 2PT1A 1GVJA 1P2FA 3IWFA 2NWJA 3KN7A 1BI2A 1YPNA 4RYAA 1WI9A 3JZJA 4OZ9A 1QUKA 1ZTYA 5FD6A 3LAPA 3VV5A 2XXYA 3U2RA 3IORA 1DSNA 4ZZDA 3FGSA 4LA9A 3M8FA 4HQEA 1OVTA 5JHUA 1K7AA 2Q2AA 4JDFA 4EXKA 2PJPA 2FSWA 3IO4A 4U23A 1WKMA 1I27A 4YFKF 1SD7A 3SDFA 2VONA 3K1MA 5LRSA 4LONB 2O69A 3RT6B 2AS5F 4XKPA 4ZYDA 3QSLA 4P9UA 4H8IA 1EH3A 2EJRA 2M1BA 3UGWA 1TW2A 3IRQA 2OK2A 5ICQA 4RB0A 2IA4A 1F5TA 1YTYA 3OV8A 3WTYC 3GWZA 1P92A 3QRFF 1RUNA 3F8BA 3I3VA 3I53A 1ZRFA 4X1DA 5IAIA 1BJAA 4N9HA 4JB7A 1HXDA 1TLHB 3HTSB 5FTHA 2ZXTA 4GD5A 3SEXA 5EEHA 2VOZA 3OOPA 3FXRA 4BYYA 5CM6A 1N04A 2HQNA 4WX9A 1DPPA 2M87A 4ZYEA 1LAXA 2MH9A 5CYVA 1JNFA 1GXPA 3VVDA 3FMSA 1MQIA 2PBWA 3TO9A 4NWDA 4LZ7A 3HSEA 3OEKA 2D45A 1I5ZA 4GXOA 1LFHA 3QOPA 4G7ZF 4MHGA 3WGGA 2QS1A 1MS7A 3PUYE 2F97A 1ZH5A 3TAJA 3PUWE 1XHYA 1FQFA 3C36A 3CFZA 1S29A 4DNCA 2DO7A 1GTKA 2KKOA 2AXLA 5KCJA 1NL5A 1B40A 2I49A 3CUQB 1A40A 2HAUA 3QYTA 3RYRA 3ZKKA 5F6FA 2QMWA 1Z7UA 1IN5A 4IO2A 2QQBA 3ECRA 1GGGA 2EFOA 3H7MA 2RN7A 2DOJA 3BJ6A 1MZBA 1G3SA 4CXFA 4M6YA 3V7CA 4LK0F 1FTJA 3OMBA 4I8CA 3WGIA 2OU2A 2RVCA 5E8IA 3MZYA 2NOOA 2I58A 2F35A 1KU2A 1V4RA 3Q25A 4GRKA 3VB2A 1S6LA 4BDLA 2V1UA 2ZNUA 4LUBA 1I69A 3FJMA 5H8SA 2LKPA 4HDVA 1A54A 1ZGJA 4U0WA 4A6DA 3EQLF 1YQAA 4PFTA 4TV7A 3K1NA 4LG0A 1J9IA 3MVXA 5LHIA 1JHFA 4BXUA 2MD5A 3RTRA 1VR5A 3VFJA 5ERIA 1B32A 2K4BA 4A0YA 1TTYA 1LFGA 3G3GA 5LGUA 4IO6A 2PLYA 2QS3A 4KIFA 1UHMA 4NTLA 4BDQA 5B70A 5I2NB 3W9VA 3IRRA 3E6BA 1P4WA 3VEPA 2VT2A 3WE3A 1IXHA 3WTWC 3MAJA 1BN5A 1HSLA 2DI3A 5AA2D 2DU9A 2NYXA 5FFXA 1C0WA 3OO8A 2OLBA 1WQ2A 1ULYA 3CTAA 1WRJA 1FY7A 4P9FA 1SFXA 3JYRA 3O97A 4UV8A 4G6DA 5LOMA 3V8XB 4KN7X 4EF2A 2M45A 3HYIA 3JAMK 1LGBC 2QRYA 4ETSA 4GYGA 4QFPA 1OKRA 1I1GA 4UVAA 3TOBA 3FD3A 1KQ0A 1QUJA 4LLGF 1I1SA 4F3SA 2Q8KA 3QPHA 4G68C 3FWEA 4AQ4A 5I84A 5JR3A 4S04A 1MDQA 2HAVA 2CYYA 1L5TA 4HDUA 3I58A 4KIGA 4Y17A 2F5FA 3ISPA 1CF7A 4Q47A 1FPQA 5IKBA 3SZPA 3Q5FA 5L8DA 1YIOA 2IA1A 5F1QA 1SQYA 5J8FA 2DTRA 1JW1A 1A99A 3S2WA 1S3JA 2UVHA 3F6OA 3GF2A 3F72A 4R73A 2DSFA 2EFNA 3GXAA 2O03A 5CVUA 2QL3A 1UHWA 1MXWA 4RA1A 3LSTA 2QZ8A 3HRMA 3IX1A 5D4SA 2QLZA 2XXHA 4OMZA 1B51A 1FT9A 4L9VA 3H6WA 1BI3A 1M5CA 2H6CA 2D2WA 2Z8FA 5D8LB 2OZ6A 4ZEIA 3WU0A 1ZJLA 2ESHA 3UA8A 2VC1A 1EH8A 4RGUA 3GEZA 4Y13A 1P4AA 1AWCA 1UTHB 3Q28A 4FEDA 1R5GA 4HAMA 2O3FA 5IT9Z 1B3EA 4Z2YA 1XGMA 2I0BA 1OVBA 5L9MA 4PFYA 3V89B 5BQTA 2D1HA 5F7VA 1MQDA 4KYWA 5D6FA 3V8KA 1ZIUA 1SD3A 4MLQA 5CMBA 3F22A 4CDGA 4U1OA 5HPQA 1AMFA 3HHFA 4ZEFA 4EQ9A 1HQCA 1H9TA 4OFLA 2FE3A 2A5TA 1U5TB 5KDTA 3RGYA 3IKTA 2BJJX 3GFLA 4QSDA 5DD4A 4XSXF 4QSEA 3KP6A 3E97A 5DD8A 3LA3A 1SFEA 3M7GA 2GQQA 4HF1A 1A8FA 2OBPA 4ON0A 3QPTA 2XASA 2E7WA 3F21A 3SHFA 2VBXA 1PB7A 4LZ5A 2ZNSA 5BUUA 3C35A 4G8HA 4Q0CA 5DUIA 3TYHA 3GFJA 2ZNYA 2VHAA 4G94A 1FW0A 1USYH 3H03A 1XSVA 1FBUA 1BIAA 2PT2A 2RINA 3HRTA 2R71A 3KCCA 4WK8F 2ISYA 1SYHA 4TLLB 2TDXA 4JWOA 1SD5A 4NF4B 1ZAOA 1R22A 1B3LA 2XV4S 2EFWA 1HSEA 2FQ3A 1UQWA 1R1VA 3C3WA 1BLFA 2ONSA 4GYIA 4NF5A 1NKXA 1FOKA 3F8CA 3H3UA 1MG1A 3O2PE 3K02A 2EB7A 2LDUA 1XMKA 3SEWA 4RGXA 3LSXA 1POTA 3J7AO 1B7ZA 2IT0A 1ZGAA 4G77A 4IF4A 3S9NC 1R5HA 1QUIA 2P2AA 2JPBA 5CVIA 2HOEA 4WCGA 4C1TA 1Z1DA 4F2OA 3WTSC 2Y7IA 1URGA 3RT8A 1YFHA 1B9NA 1BM9A 3R60A 3JTHA 1TQIA 3Q29A 2P7CB 2ZJ2A 3HCQA 4F7ZA 3S9MC 1MH4A 4L9NA 4Q8RA 2ANJA 4EJVA 4OIQF 3KOTA 2KJCA 2RC9A 1VFDA 5DV5A 4I62A 1FSEA 4KN4X 3HOSA 2PVUA 5I2KA 3W6KB 3VE1B 3WTTC 5JFRA 1QBJA 3KJTA 3PPPA 4MEXF 3TO6A 2E1NA 4H5FA 3OOAA 3I0TA 4K2EA 2PQ8A 3T5XA 3FJ7A 2W7YA 1HKTA 1KGSA 3CSBA 5AE4A 5I56B 2ELHA 1TFAA 1KYZA 3FIRA 3FM3A 3JSOA 1SAXA 2RC4A 4R9GA 1Z05A 4H65A 2I4BA 3FV2A 3G3FA 3FXQA 1CE2A 1F4KA 4RK2A 1FQEA 2O1LA 2HZKA 1R23A 4CYDA 3F8NA 2Y7WA 4IO7A 1ZMGA 2K7LA 4IGRA 2HXWA 2DXYA 4R74A 1SVXB 4NMYA 3I71A 4EF1A 3P7NA 4TLMB 4LB6B 1DUXC 5HLHA 4M9SA 1LAHE 3THIA 2VXZA 4HBLA 4NF8A 4OIRF 3F8FA 1RUOA 4LGWA 3RY3A 4KA4A 4M9ZA 3S2VA 1BI1A 1NNFA 4OFJA 1HBXG 5M2VA 4M4GA 4EM2A 1O3RA 2ZYNA 1IXGA 5LEKA 1XDSA 3I4PA 2B0LA 3WE2A 1IXRC 4B8XA 5FD5A 3PMWA 4QSCA 4I98B 4ZH4F 5J6XA 3TUSA 4ZDMA 4P0IA 2XXQA 4POWA 5ELVA 1IIWA 5H8NA 5A5XA 3WAFA 5E1WA 2V3TA 2DK8A 4E70A 2HDCA 2E0SA 2VC0A 4R6YA 2XHKA 4ZYHA 5BMZA 2XXWA 3KN8A 4UVBA 3H4ZA 5CLSA 1H45A 3C32A 5KK1A 4G2ZA 1LAFE 2BEOA 2PFBA 3T93B 5JI6A 3EN3A 1Z6TA 3PPNA 4C1UA 1O57A 2STTA 1YS7A 2JZYA 3KP4A 3IB2A 4YICA 2KLFA 2K86A 4IY6A 4F31B 2PBIA 4P0GA 1ZG5A 4FEBA 5LEJA 2DT5A 4FORA 1B5JA 3JTGA 3VLWA 4PETA 4IXAA 4EJUA 1U3EM 4KD5A 2EV0A 4YKIA 4FECA 2FNAA 1B9JA 4OTEA 1O3QA 2DXRA 3W6JB 1URSA 4YIFA 5KCJB 5BPIA 2EWNA 3TKYA 2L01A 3CG3A 1OLCA 4ESFA 1T98A 2DE3A 3MZBA 4YIIA 3ODBA 1KU9A 2VT3A 3T8TA 1QZZA 3LFKA 2QS2A 4MQ9F 2E7XA 4GCVA 4KYSA 1I6BA 2NVUB 4YKKA 3TFLA 3MW0A 3K6UA 1S8NA 2DYXA 3CVGA 5FTIA 4LATA 2RC8A 3N97A 3GYHX 1DOTA 2QBYA 3K6VA 2RKMA 5J8CA 2IJLA 2ZBKA 2UXNA 4FJPA 2NNYA 2FYIA 4RJZA 3G3HA 3MUQA 4G8NA 1J2XA 5AA1A 1JE8A 4KYEA 1KU3A 5K5QA 4X48A 3UN6A 5ICEA 2KIMA 2ETHA 1VTNC 1RYOA 1H43A 3MVYA 2QUFA 4IRIA 1P1WA 1S9TA 5BPDA 4YB7A 3V83A 1DPUA 1P99A 4OIPF 3F23A 3TTMA 4WKMA 1MXZA 3IOTA 5I56A 4XSZF 2LF7A 3K6XA 5H8QB 4Y15A 4XKQA 2ZYKA 3CO7C 2XX9A 1IAWA 2P4WA 3N6TA 4PE5B 5ISUA 1TW3A 1LJ9A 4IO3A 5FO5A 1TT1A 4KI0E 3P9KA 4GQOA 4NWCA 2EFPA 4I0AA 1MJBA 1S7OA 3E5QA 1NH8A 2FNCA 2AYSA 2XVCA 3ZMDA 1ELJA 4A5MA 2HR3A 3TQWA 1FC3A 3D0SA 3CRBA 3HN0A 3MPLA 4CO8A 4GL0A 4JXIA 4OESA 3ABTA 2DPDA 2X7QA 3RTWB 3F11A 3KEIA 5AONA 2CG4A 2GA1A 3J81K 5HVQC 2I6EA 5EYFA 1H9GA 3HSFA 1FX7A 2GHAA 1YO5C 4ENNA 5EEGA 5D4RA 1Y4CA 3FX3A 3H6UA 2WWYA 2F36A 3O66A 2FEZA 2UYEA 1XGSA 1R6ZA 4DXUA 2QMXA 3FZVA 4NE4A 4LFUA 3R4KA 1XVYA 1ZLJA 3IB0A 3DM0A 1D4NA 4EDPA 4ENJA 3FM5A 2RGVA 4YMAA 1N84A 4FAJA 1ANFA 3VOEA 2CGPA 2Z8EA 4PFWA 4UA8A 2A3SA 3KP3A 2VGQA 2XRNA 4OU0A 2F7CA 4ECFA 2VE8A 1G3WA 5L9SA 1N7WA 5HBCA 2V1XA 1B52A 5D5XB 4RB3C 4P55A 1K78B 3TDUC 3GBBA 5LRRA 4EMSA 3M3LA 4O3MA 1MY3A 1RI7A 1FTMA 2DPUA 1KWHA 4O3CA 4UUVA 2FOKA 4LMYA 1IUYA 1FTKA 2F34A 2DBBA 1QGPA 1IRGA 3IR1A 2O6GE 3HUGA 2GXGA 3IJXB 4HV6A 2ACJA 2CWEA 1Y0UA 3GZGA 2ZYMA 3QUJA 2A61A 1JEUA 3DPLC 3ZKLA 3P9IA 3K00A 4ESWA 1SBPA 4AD9A 2WKYA 1B6AA 1IRFA 4EQQA 1YW7A 3TTRA 5I59A 2V93A 1MQJA 4ESBA 3FVGA 2Y75A 2Z33A 2IRFG 3IJOB 1AOYA 1D8JA 1WODA 2RF1A 2BE5F 3OO9A 1U5TC 4U7DA 4NF5B 2OQRA 4RGSA 1D3YA 4LB5A 3V4GA 2K02A 1Z91A 2HQ0A 3KEOA 4I02A 3WU1B 2A68F 1MDMA 1QQIA 2IA2A 1ZKBA 3ZP5A 4P11A 1XOCA 5EHSA 4HOBA 5DYHA 3QUFA 4ELOA 2EA4A 1ODDA 2OZZA 3LBSA 2FBHA 1BP5A 3A09A 1MDMB 4RK9A 3WTVC 4KIBA 5HLGA 2FXAA 4HYEA 4POXA 1TQPA 1MXUA 3IKVA 2YJPA 2COMA 3ZMZA 3ZQ7A 4H67A 3HTUA 1H3DA 3QIMA 1Y3QA 3K0VA 4OERA 3UK4A 3MWMA 3JAMZ 1KYWA 1RNLA 1US4A 4G7HF 1NNPA 2DQRA 3IOWA 5TPAA 2UXXA 1MY4A 2FA7A 3MVZA 1EV7A 3MJNA 3SERA 1VE4A 4N6PA 3HSRA 1B6HA 3PQKA 1TBXA 1MKMA 3MBPA 1K79A 5DVFA 4M6XA 1H0MA 3ML6A 2O84X 4HW8A 2HTJA 3HIFA 4KMUX 1NFTA 2BYVE 3PMXA 3Q26A 1DDNA 2M30A 1B7HA 5ITOA 3M8UA 3OD7A 4RAZA 4I1DA 3ZS6A 4HX4A 1MGTA 1OMPA 4BH9A 4WXJA 1PP7U 1MJAA 1W7PD 3DF8A 3LR1A 2XXTA 4ENMA 4FX0A 1B05A 2P6SA 1XMAA 1XVXA 3ECOA 4MQVA 2V9VA 3KSJA 1TNTA 4A2UA 2O0YA 2JPCA 1FQAA 3GVAA 1WDNA 3MWBA 5JEIA 4CZZA 3GLXA 1O7TA 3E5UA 2QM3A 1OLAA 4XTCQ 3RI4A 5TJJA 1MQGA 3EHUA 5DT6A 1DPEA 3KP2A 5DYMA 4H0WA 1Z7NE 2KJBA 2HEUA 3WGHA 3LWFA 1JVXA 1S50A 4THIA 3BJAA 1IN7A 2ZKZA 5DCMB 4QF9A 2G7UA 4BHBA 3C9HA 1O64A 3DEUA 2DAOA 1MXXA 2HS5A 3FF5A 1R36A 2O7UA 2Q9TA 5TRDA 1R1TA 3CFXA 1ZHFA 5TU0A 4HTGA 3TTLA 3HRSA 1JHHA 3MFKA 1D3KA 4P5OA 1IQ7A 2HEOA 2PMUA 1YS6A 2A07F 5DEXA 3GUDA 3L2CA 1KQ8A 4JWXA 3E13X 4LLLA 4BDOA 1LEBA 4NF6A 2F5EA 2PMSA 4Q30B 1OMIA 4H6DA 3CSGA 3MEXA 4RXLA 1A55A 2R6GE 4QFKA 2YLNA 4EGZA 3C4MA 3O28A 4EUOA 3H6TA 3ZMVA 1YTVA 1TNSA 4ZYGA 4A0ZA 3HPIA 4QFOA 4NF6B 2H6BA 1L0OC 1SI1A 2I0CA 2MC3A 2QVOA 2Y7KA 1G3YA 1IN8A 5E17F 1FNNA 3DPTA 2X26A 4L0YB 1ONVA 2EK5A 2O61A 3FVOA 3EYYA 4PGHA 2ONRA 3H6VA 4DXBA 3FJGA 1ZRDA 4I01A 5I2NA 5CVJA 1XGNA 2OCUA 4Q4ZF 2HFHA 3BJOA 3CJNA 3R0AA 3N6UA 4ELPA 1HW1A 2VD3A 1T6SA 3V7SA 4Q5SF 4A12A 3CUQA 5DVIA 4ZZLA 4EV0A 5FB2A 1UIVA 4OEVA 1Z9CA 2DVZA 3SXYA 3ECHA 1UTBB 2B3BA 2QBYB 4KHZE 3SEVA 5LBQA 1TWYA 5FLXK 4DDDA 4KCCA 1QO0D 3B6QA 4U1ZA 1R9QA 4AIKA 2Z9OA 3WAEA 3ABUA 3C31A 4G6QA 3B7DA 4LQ2A 3TODA 4DCYA 1BTJA 2R9JA 2HWVA 4HF0A 1LAGE 4OMYA 2NNNA 2DLLA 2K4JA 5TP9A 3ERED 4GLIA 2DWJA 4NF8B 3O6IA 2Z8DA 4LP2B 2OWSA 3CG1A 3P9CA 1Z6RA 4L9TA 3IL2A 2UWMA 4YKPA 2NUVA 2BV6A 2Z23A 2GZWA 3RPWA 2QQ9A 4U0VA 3S4UA 4F1UA 3T9VA 5F64A 4ZEKA 3BFTA 3RJPA 3SEUA 1P1QA 1BC8C 3S9EA 2YR2A 1B1HA 4LJZF 4BNCA 4ELRA 3TDZC 2VN2A 3PD8A 2D3IA 3USDA 1GXQA 3I5UA 3TQNA 1SW4A 5A2QZ 4G68B 4MH5A 2H09A 3EDPA 1SW2A 2PI0A 1MDP1 2OWTA 3LA2A 4NB5A 2QPQA 2J5PA 3ONMA 2XIGA 2X0LA 3MQ9A 4CICA 3QAXA 4EXLA 1YW9A 1M5BA 2A6EF 2F5CA 3K9TA 2LAOA 4U22A 1ZU0A 3G3KA 4JSDA 4TOZA 1Y3NA 3CLOA 5KZTA 1LDDA 1U8RA 4L17A 4OEUA 5FHNA 1B0HA 1N76A 4M73A 1L3LA 4QLCU 1FQBA 3ZMUA 3D4CA 3IB1A 2H94A 5BWJA 5CVVA 1JW5A 2XAHA 2R7FA 2YU3A 2UVIA 4FATA 3H3ZA 1GVCA 3AXFA 1PC3A 3MCZA 2CFXA 4JK1X 5HS9A 5BS6A 3C18A 1XB4A 1XT8A 5CVRA 1PBQA 4UXNA 2GIVA 3HOTA 2L54A 2MBFA 4ND9A 2IA0A 3PFIA 2AL4A 4PFUA 3RTFB 5LGTA 2P5VA 1MY2A 1REPC 1KQ9A 3IWZA 3O6GA 4DQ2A 4OYVA 3LC8A 2I48A 2XHDA 1TXFA 1DTGA 4ZEDA 1N7XA 1QKAA 3UORA 1Y1MA 3TCHA 2ZCWA 4O3BA 1SI0A 2QSXA 3E3KA 4M71A 3BWGA 2NS0A 3LAJA 2GWRA 5BOXA 2P0SA 5D5WB 2A6HF 1O7FA 4PCQA 5H8NB 4FT8A 1SMYF 2REGA 3DLNA 5JVTA 4OOIA 2XD3A 4GL8A 2R3SA 2XUBA 1PEBA 3M1EA 3I59A 2B65A 4GXAA 5TP9B 4ENKA 1RIOH 1WWXA 1P6RA 2DW4A 3DQVC 3FXUA 5FGMA 1CB6A 3I6VA 1JGSA 1NNTA 2V6CA 1JXSA 5AA4A 2DWIA 4A5NA 3Q9VA 3J81Z 5I58A 3MP8A 5H6RA 2Y7PA 4IHTA 2RCBA 2PX1A 2P5KA 2WV0A 1P1NA 1A7LA 1LCFA 4ZEBA 1LDJA 2A69F 1YLFA 4U4SA 3OELA 1SYIA 4ZE8A 2B3FA 2PN6A 2DVCA 4F1VA 3H92A 4O5VA 4PP0A 4XKRA 3DXJF 4B09A 1YCJA 1R7JA 4X9TA 2GHBA 4F1YA 5EHMA 1YG2A 3E6MA 3PMVA 1MD0A 2XXIA 4LD5A 3QP6A 3VXCA 5L3GA 3F6VA 4YB5A 1EZOA 3ZMSA 4JBAA 1JVYA 3TTNA 3BPXA 3TPAA 2F6GA 2WTEA 4H5GA 1W5SA 2X4HA 1BC7C 5K5OA 1SFUA 4I9DA 2QYOA 4G8MA 1R00A 3DKWA 1J5YA 4ZECA 3V8JA 2HKOA 3FMQA 4XBFA 1Y9UA 3J80Z 1D9VA 5HDNA 4PQJA 1T0KA 3I64A 1MY0A 4OFOA 4MFIA 1T2KA 1B58A 4U88A 1POY1 1FLIA 3E5XA 1Z7ME 2THIA 2NAZA 3A3CA 1U6GA 4EJOA 4IY5A 3BZ6A 3BBRA 3ZSFA 2QENA 1R1NA 3PGFA 1SD4A 4Q48A 2Z3YA 2I4CA 2CQKA 3B02A 2J5OA 4GO1A 4MBPA 4UACA 3DV8A 2ZNZA 3D4GA 1XN7A 1B59A 1BI0A 2ESNA 1FCKA 2QWWA 2AL5A 4I0BA 3R6UA 2Q2EA 3PPQA 4O3AA 4YG2F 4DZ1A 1RKMA 2EA2A 3C33A 4DCXA 3K1PA 1M5DA 1BOAA 3PQJA 3IO6A 4XXUA 5CC2A 3RNNA 4LVQA 2OD5A 2HCAA 3T22A 2IPQX 2VP1A 2DWAA 2XXPA 5JK4A 2Q2CA 4KUMA 4MLVA 4HA8A 1K6OA 3L9FA 2Q89A 2DK5A 5ILSA 2MA3A 3DP8A 1J59A 1JEVA 2F7AA 5TPAB 4HZFA 4IVNA 3KZYA 2XXRA 2V3UA 2IVMA 2F5DA 1OYIA 5H20A 2V3QA 4ISUA 2CZLA 1MJ9A 4R79A 4N0BA 4KCDA 2KRFA 4HS7A 2Q8JA 3HSTA 5CBSA 2FMYA 1STZA 2EFQA 1HKQA 2XAFA 3RYPA 3RIRA 3KSXA 3MP1A 4U4XA 5DEXB 3VODA 4P96A 4UNOA 3JW4A 3RPUA 4ESJA 3IL1B 2HZTA 3FV1A 5H8HA 4IPAA 5AA2B 2MLKA 1LB9A 1MY1A 2Y84A 1W7PA 4OETA 2HQRA 2BBYA 3M3FA 1ON1A 1TQMA 2AIXA 5HLIA 3KFMA 1GHCA 4I09A 5CRYA 1ZN2A 3BKIB 3LQRA 2E1SA 2FBKA 4O6JA 3TTKA 2Z22A 3S9LC 2O1MA 2JRTA 5HS8A 1SW5A 4S05A 5ICTA 3EPEA 4U2RA 1XCBA 1XSDA 4DLDA 3RKYA 2IEEA 4CHUA 4RB1A 3PPRA 3FATA 4L5IA 1UIUA 3G73A 3CO6C 3O9PA 2Y0MA 4E0WA 2DFIA 1B3GA 3SFZA 1LQ1A 1FZPB 3TCGA 3IK6B 3IOVA 3Q27A 4U21A 1DP7P 4MF3A 1B1BA 1RYXA 5CMMA 3TOAA 2NRAC 3N26A 1OR7A 3QXMA 2O8XA 3C7JA 4KMFA 3FVKA 4OHNA 1FP2A 1FYLA 3TDJA 4Z7EA 4R9FA 1ZG1A 1EZPA 2RQPA 4CGZA 1BKAA 2H4IA 2IP2A 1ZLKA 2KIFA 2F78A 5JTYA 5DEQA 4XKNA 4F2QA 2V25A 4L18B 4KFQA 5H8FA 3N5LA 2RKHA 4AVPA 3EHSA 4ELQA 3O6HA 3K2ZA 1VFEA 4AIHA 1URDA 1HW5A 2W85A 1LB8A 3OO7A 3U93A 4HQMA 4I7HA 3KLNA 4ZE9A 3BPVA 1MXVA 4AB5A 5FFZA 1Q1HA 3CIJA 3NEUA 2XAJA 1B4AA 4RNSA 5D5UB 4MEYF 2W84A 4X1BA 2XKOA 3DFGA 3ILUB 5L3DA 4F18A 1Y3PA 5L3FA 3HV1A 1PB9A 1PBPA 1CGPA 1BIBA 3T9HB 1MM7A 3WTXC 3T96B 1WSUA 3BROA 3L6GA 3O2AA 1U78A 1FBQA 2DWHA 4Z0IA 2A5YB 3E4RA 1QULA 1IXCA 4F3PA 1IN6A 1II5A 3KBRA 2DE4A 3QU3A 1NH7A 4HX8A 1ZRCA 1R58A 3SZTA 1B46A 5L3EA 3ZN1A 1AH5A
chains in the Genus database with same CATH superfamily
3VYSB 3QQAA 4F3GA 2H27A 3M1CA 4D9JA 2FOWA 4UUSB 3ABLH 1LBBA 3K70D 2UXAA 3OEMA 4HLYA 1B3HA 4R6HA 1XGOA 4RAYA 1XC1A 1PYVA 3BDDA 2EIJH 2EV6A 4L0ZB 2DJIA 2W4SA 1S9HA 3TELA 3FK6A 2F7BA 4PFRA 3O6BB 5GTHC 3R0JA 4RB2C 3W2AA 3U21A 3MSTA 1CNQA 2DDKA 4BJTA 2P1SA 4N07A 1FJ9A 3M3YJ 3IHUA 4RS8A 5KCMA 4OMBA 2CS3A 3R6SA 2R7OA 1MBKA 4NQWB 2R92J 1DGWY 1R5ID 3CZ6A 4JX5A 1LSTA 1NV1A 4XIGQ 4YRVA 4RLQA 1RDYA 3MVWA 5EG0A 1W5TA 1VSOA 2KPMA 4KDPA 4ASNA 3DP6A 4LZ8A 2RV8A 4XRSG 2E2IJ 4MTEA 1B2HA 1FQCA 1LFIA 4PAFA 5EQAA 3VXBA 2EINH 3QYFA 4F3BA 1WHUA 3OYEA 1VQ6I 4P56A 1Y1ZA 3NQOA 3RKWA 3WTZA 3JRGA 1USTA 3DELB 4NQWA 2PEXA 1HKSA 2Y48A 2HOSA 1AIVA 2PFYA 1AOVA 3EQ1A 3BG9A 1S7YA 4R6KA 5ED4A 4WEDA 5GPCA 4BLAA 2ME0A 1K4TA 2XX8A 5EZHA 5FHMA 2Q0OA 3L7WA 1Z7LA 4UHTA 2VBYA 3B6TA 3WHCA 3HHHA 4GFRA 1GV8A 5I59B 2R7RA 2W7NA 2XPWA 3TP3A 4FIMA 1XCVA 4MCOA 4MMPA 2HQAA 1FBSA 1JKPC 1F1ZA 1GUUA 3CC7I 4D5CA 4UUSA 3FASA 2DT7B 3O29A 1OCCH 3M07A 1DCUA 1JETA 1RKWA 1T0FA 5L3CA 4Y7NJ 3GCMA 3MD2A 5LLQA 1O3SA 1P4XA 5IPAA 4M72A 3V8LA 3T0YA 5DUKA 3PUVE 1UB9A 2OTJI 3O3KA 4DI4B 1AKHA 3PO2J 3U72A 1YW8A 1X1AA 2HGCA 4G8XA 2Y2ZA 4NX1A 2YSRA 2F4OB 1B7UA 4QFLA 3U8QA 2XWOA 4XRFA 4KJZA 3RPLB 2NS7A 2XC7A 4Y3OA 4F19A 3FVNA 3VVFA 4YMBA 2QA4I 1B5HA 3KG2A 4X1EA 2KQRA 4N91A 2P7VB 5DCFA 1PDNC 1MBEA 3I5OA 2P6TA 3L2QA 3IAZA 5EYGA 5T3JA 2PMHA 2GXAA 2XAQA 1V3FA 2CMOA 4OWDA 3AG4H 2F3BA 1WJDA 9ANTA 3SEQA 3B6WA 4EJWA 1DPRA 3HG9A 2D5WA 2XKPA 1YYVA 3CQZJ 3S3MA 1MM6A 3TQLA 5ILVA 5FRNA 3F3XA 1X1DA 2CO5A 3NRVA 3PJRA 1YE9A 3KGCA 1OIBA 3ELKA 4KYDA 3LQQA 3WODF 2EPFA 2E1MB 1YITI 4FHTA 1J75A 2R93J 2UYFA 4QFNA 1IXIA 2OZUA 4HLXA 4ZC3A 3TEPA 2CEYA 5FLXZ 1B9MA 2RNGA 4RAGA 4HCYA 2M5WA 2QCOA 2D21A 1XS5A 3T9XB 3Q3SA 3C1DA 4PJ0C 1TWAJ 2QGUA 3CUQC 2ZMBA 4G68A 3SETA 4BEHB 2X7PA 1P1OA 4ONYA 3GZ6A 3U1OA 5AIPA 3W15C 2C6YA 3PUBA 2DFHA 4MFEA 2ZMEA 1JW4A 5LGNA 2FMLA 4M74A 2O51A 1FBFA 1A8EA 2VBWA 2DE2A 3D5LA 4QBAA 3KLOA 4BDRA 4N9IA 4PFBA 3TZAA 3B73A 5JTYB 5K1YA 2BHYA 4HF2A 3K0LA 2L4AA 4U7BA 4C3JJ 3U94A 3DKXA 1OYWA 3M8EA 3OXNA 2DOAA 1LVAA 1FPDA 4E7KA 4QRZA 1NHAA 3TBIA 1QZYA 4UV9A 1HSJA 4IRHA 3GTOJ 1IITA 2F6PA 2F4MB 4I99C 2VKDA 3ZGKA 1LLSA 2KRCA 2ZO4A 4U0YA 1EH6A 3GFMA 2OA4A 4RY1A 1VNDA 1UCRA 2R7TA 4IOCF 1IW7F 1F9BA 4KR5A 3U92A 4LITA 2V84A 2FU4A 3G3JA 1UHSA 3BP8A 3T1BA 2FIEA 3DBLB 4JQFA 1T95A 5C44J 4KITB 4PZJA 2V79A 3CCJI 4OQOA 4HV5A 1VQ9I 1ZKGA 3ULQB 1ETVA 2GRVA 4XLPF 1UZCA 4F29A 3GMEA 3UP9A 3SKPA 5TGTA 4D0PA 2TCTA 1UTBA 4IO5A 3CCEI 4E7SA 4PJMA 4H8JA 2HKXA 2VQLA 3SESA 1J1NA 4NQ8A 2V1DA 3HXLA 1I6AA 2Q1ZB 5LHGA 3J80K 1TT0A 2OAZA 2ISZA 2LY2A 3ZQGA 2ZMEC 5IT3A 5F1RA 1N3WA 1MXYA 4HRIA 2JMWA 4KT6A 4RBOA 3R26A 2UZKA 4WF2A 5JLWA 4LG0B 5IM2A 3TKDA 2F2EA 4FX4A 2M8EA 1OYYA 4C9YA 1LEAA 4HW0A 2HVQA 2QSGX 4A3MJ 4WWCA 1MPBA 3EPZA 4WXHA 3MZ1A 2YX4A 3FXOA 1TL8A 3OO6A 4QHQA 3C34A 3KE2A 4G61A 3ZQIA 3G3ZA 1YX5A 4DJAA 3MKZA 1G4DA 1D5VA 2UVGA 1SMTA 2VD2A 3U9GA 4AU7A 4JWYA 4R1HA 2H98A 3KN3A 2GH9A 4HX7A 3KP7A 3QPSA 5A5XB 3D5SC 1BIYA 2FBPA 3BY6A 3EF7A 1FOWA 3I56I 1HSTA 3VVEA 3E6CC 1S5LC 4F39A 4BDMA 4YAHX 4DE8A 2VL8A 4KT5C 1B4HA 1MPDA 3FKJA 1MBFA 2CSOA 4KFCA 2WAFA 3CDHA 2OC6A 3J7AY 1FQDA 2L02A 4LK1F 4UB6C 1NMUA 1OQGA 5K7ZA 2ABHA 1W4MA 2E1MC 3E6DA 2OBGA 2XXVA 3GBAA 1H44A 2UVJA 4IGTA 2VIXA 5AIQA 4IO9F 1KU7A 1MIJA 2LTPA 1IZ1A 3H06B 1LCTA 4JVDA 3PUZE 1ZG3A 3GW2A 3TO7A 1Y1VJ 2KIUA 4EVIA 1ETOA 2VLAA 2QQAA 4EM0B 4AB6A 3NARA 1MRPA 3RPQA 1ZBMA 1FTOA 3DP4A 3KZZA 4BDZA 1B8IB 2LR8A 3KC0A 1NUWA 2ZXJA 4ZE9A 3A4CA 4XIDA 3ILTB 1RPWA 2ZYOA 4B3XA 3VSLA 2M8CA 3SFIA 1EKEA 4BXFA 2E1CA 2D1VA 3L00A 3REOA 4NHJA 1XD7A 1AL3A 1US5A 2Y7RA 5LD2C 3EUKL 3VFZA 5DTBA 4BJ6C 1Y8QB 1FYKA 3A29A 4R2BA 5H8HB 1KA8A 5E1XA 2DYSH 1TFDA 4AM3A 2H99A 1G0HA 2ECCA 1LDKB 2E60A 1FOYA 1AHDP 2K27A 2CMPA 4MNCA 3KZGA 2BVLA 5HOOA 3IUOA 4LIVA 1LBCA 4GF8A 3DLAA 2QS4A 3K2DA 3JRAA 1OQHA 4M1VA 4E7IA 2RAEA 2Y0SN 3RLFE 2W1OA 3GX4X 3RUMA 3K69A 2LNBA 2XD2A 4KXPA 4RPOA 1QJMA 2X6OA 3EUHA 2CUFA 4Q5TA 3RN8A 3N94A 2IS4A 2CZKA 1FPLA 1XC5A 5FHOA 5I57A 3JV9A 2XPUA 3H5NA 5DCMA 1SDXA 4OENA 4BHCA 2YX7A 2YPNA 1QVSA 1ON2A 2FF4A 5KVRA 1USSA 3D1RA 1TWCJ 2XROA 1ZLQA 1MQHA 5CMKA 2W57A 3RKXA 1DBZA 2VBZA 3TGNA 4KQPA 5GP9A 1B5IA 1IEJA 3E7LA 1T38A 1SVOA 4JP0A 4EATA 3MQ0A 3U1DA 1QVUA 3VYUB 4IHSA 1T39A 2PX9A 1ZR2A 4IQJA 1ZARA 3RQ4A 3OS0A 3G7WA 2MH2A 5ILUA 2NVQJ 5IGAA 1EJ9A 3T8RA 3VYRB 3EUAA 2WC2A 2ZXIA 5BNGA 2IGKA 3PUXE 3MC2A 5HLTA 2R7DA 1QKBA 1FP1D 1FEXA 1JKQC 1EH7A 2RC7A 3L6HA 1FBHA 2R8TA 2KQZA 3M8JA 3TEDA 2G29A 3P7IA 4ESXA 4MX6A 5AA2A 3JRHA 2VODA 1MMAA 2R7VA 4U87A 1W7PB 2M3AA 1FSHA 3IC7A 2HYGD 3CR9A 2KISA 3LSLA 4FBPA 1IMFA 1BR4A 5L9OA 2Z99A 1G0IA 4KPTA 3K01A 2JWTA 3TCFA 4XLNF 1S7AA 3V7RA 5ITPA 4DI3D 3B8BA 1DU0A 3GLBA 2Q88A 2DP8A 5F24A 2L2OA 1T56A 1WCMJ 1O7LA 1NTCA 3HGGA 4BS9A 2DOEA 2FA5A 4L5JA 2EZKA 1EZ9A 3IV5A 3BR5A 1BJZA 3E3VA 3R61A 3BQZA 5I2KB 1H76A 4OXVA 1I39A 2VE9A 4N4OB 2R5ZB 2PG4A 3RPUD 4YFNF 3B6AA 1FYMA 4RA2A 2YPRA 2Z5UA 3CP8A 3MP6A 2ADUA 1A04A 4MTDA 1NV2A 2H5YA 3W9WA 2JVHA 4FE8A 4AWXB 4D5FA 3DP7A 5IY5H 4DBQA 2LY1A 5J47A 2H1KA 1U2WA 4G4PA 2EIKH 4OIOF 3HEFA 3BTLA 2JA6J 2K9NA 2DA3A 2DQLA 1N0TA 5CBRA 1IMDA 1MMGA 4BDNA 2JT1A 1NNKA 2ZMEB 4KICA 4CUGA 4HNVA 3GZ5A 1Y4TA 2F5XA 4ZZEA 4WEPA 2F6CA 1E2XA 3QYEA 2NVYJ 1M1EB 3WTUC 3SEYA 3MAMA 1B1XA 4XLFA 2GQ1A 4GVOA 3W2WA 4C0RA 1MPCA 5D6EA 2HTSA 1A6IA 4N4NB 2DDBA 4CCMA 3K6WA 2DODA 1P1UA 4EJTA 1MBGA 1NV0A 1K6YA 3I9V2 4PFOA 3MZHA 4PTKA 1FIAA 2JTVA 5IT9K 2P8TA 2QSFX 3AL0B 4W97A 4PBQA 3LUYA 2DQVA 2EV5A 2CW7A 1VF9A 2L5VA 2XSDC 4ZZAA 4F55A 3AKZA 1ZREA 5EF6A 3CF2A 1PB8A 5K5RA 2ZNTA 1IXSB 4PGGA 3HRUA 1J0RA 1G3TA 3U1KA 5HDGA 2P5LC 4E7HA 1Y20A 2O7IA 4IHVA 2I3VA 1HDPA 3QP5A 1EU8A 4R2FA 3PV0E 5DS9A 4KNYA 1E17A 2GFEA 3KP5A 4NEDA 5E1ZB 4H1XA 2EQRA 4XR6A 4S0HB 4QWQA 4MGRA 4HXVA 4H0EA 3CCRI 5DM7F 3JRIA 4J00A 3S93A 3EHTA 1I6XA 4RM2A 3OL4A 3ZRGA 5D5VB 3AAFA 1IF1A 3K4MA 5HS7A 3ZMTA 1WVJA 4BHPA 1YRNB 5ESYA 3COAC 4PDKA 3K4JA 1V55H 1IN4A 5E3LA 1IDYA 4IRGA 4A0XA 4I3EA 4NHBA 3CHGA 1FWZA 3WG9A 4UABA 1RR7A 4GWOA 4UVCA 1O3TA 1PUEE 3GFIA 2GAUA 1M5FA 1PDAA 2REJA 3PPOA 2EH3A 5J4YA 2HVRA 4ZS9A 5DDGA 1FPEA 3K4UA 1MH3A 4LOCA 4M9XA 5J1DA 4RPNA 3FHZA 4XF5A 3ZXSA 5A2QK 1CF7B 3OSQA 5AA3A 4YB6A 3ZQCA 2JSCA 4PDDA 4MNUA 4BQAA 1JP4A 2XA5A 1D0ZA 3LSFB 4OVRA 2STWA 4F52A 4RGRA 3HO7A 2W24A 4IO4A 4MNIA 5ICCA 4I3YA 5E3OA 4GGGA 2WYPA 3KC1A 3OYHA 3M4OJ 1I50J 5CI5A 5I5PA 4AYBA 2OF7A 1D9YA 1JTXA 1XSXA 3RQTA 2BJIA 1SD6A 1ATGA 2ZXHA 2H25A 3OSRA 1UFMA 2G9WA 1K78A 3LFUA 1YJ9I 2ZFWA 1YJWI 1NV3A 3A3UA 3KJ7A 3U65A 2GOXB 3ZPLA 1D8KA 1P7IA 3TMOA 3MKLA 1PVEA 4IJAA 5H6QA 3KYLA 1B0LA 3UIFA 3DEWA 3SQNA 4HNTA 4WXDA 2XXUA 2HYJA 4AIJA 2GXBA 3CLQA 2OPTA 3MZ9A 2VKHA 2JVGA 5EG0B 3V5AA 4XN3A 2KR0A 4GOTA 2LF8A 3KIOA 4XONA 1N3XA 1QPMA 2XGXA 1OPCA 1H8AC 2FRHA 1I3AA 3AFHA 4PSWA 4OINF 1DTZA 1LKXA 1UTHA 2PYYA 4HCWA 3QAHA 1QW0A 1R9LA 3K4BA 4R75A 4B44A 3E78A 4II2A 2CW8A 1FSAA 1RZ4A 2HPGA 3H0GJ 1BBYA 2P81A 2HQ5A 4FQGA 3MPKA 5CMCA 2DMUA 3I59B 2FBIA 2VKVA 5GAHJ 2A5TB 3GXOA 3BFUA 4YU0A 4CCKA 2QSHX 3PU5A 2DA1A 3KETA 1I6QA 2XXXA 4EQBA 3KEQA 2QJEA 4WXCA 2OJTA 2RNJA 5DVJA 4K3FA 2HFBA 4I76A 2RCAA 4R72A 2XAGA 2NOJB 2BXZA 1X3UA 3ZN0A 3CJRB 3CI8A 5IOZA 1YAEA 4IB2A 1JGGA 1FPKA 3CFLA 3VLUA 1X2NA 2F8DA 3LSGA 1JUSA 1G6NA 1IG7A 3FMRA 1XDUA 5B3SH 4I2OA 3VLVA 3DBHB 1USYE 4IHWA 1SW1A 5IOYA 3IOUA 3RYDA 3QU6A 4DIGA 5E18F 2ME6A 2ONKE 2IS2A 5IP6A 3T66A 4NGUA 3IFCA 3B50A 3RDIA 5HDKA 4L9JA 1XI6A 4GDFA 5K2XA 3M9AA 2FJ1A 1SANA 1HW2A 2CQ7A 1F9NA 5LHHA 2ZZVA 3EYIA 4DZPA 2O9LA 2LD5A 4G7OF 4PDHA 4YZZA 3TMGA 1QNTA 3QK6A 4N13A 1ERDA 3N4MA 1OCPA 2HYFA 3H35A 4JBZA 5CJ9A 3PD9A 2W25A 5JLXA 5B1AH 3FUZA 4F22A 4OVTA 3VDFA 5K2YA 2JA5J 3KYDB 3D5RC 2VXDA 2IW5A 3GTKJ 4YIRX 5E8GA 2XGEA 3JSPA 1U5TA 4GXSB 2LSOA 5KDTB 3JRFA 2RDPA 5L3BA 3KOSA 1B3FA 1O63A 3I54A 3KFWX 2ALUA 4YKJA 3HHGA 3PNTA 1PJRA 5D8KB 1PP8F 4EGYA 3S2DJ 1FTZA 4OVJA 3T9UA 1JQFA 1M5EA 2OQGA 3R7XA 2FD5A 2MW8A 1LB2A 1B4ZA 3S1QJ 3HJEA 4LQ5A 4H4KC 4D1QA 2PMZA 1R1UA 2FNPA 4A6EA 3OENA 1Q1KA 3Q9SA 4MLOA 2DS9A 3LSWA 1AA7A 3UN6A 5B7DA 4G9YA 2M0MA 1BOBA 2MLGA 3L09A 4GIZA 4EM1A 1Q35A 2OCCH 2VOOA 4E0XA 5AA4B 5E20A 5I58B 5J40A 4R8HA 3G3IA 4A3LJ 2CW0F 2O6AA 2A5SA 1DMBA 2H9BA 2A5WA 1LBZA 1MW7A 3JRCA 2G7HA 1J7KA 1WJEA 1GR2A 1FTLA 4TQUQ 4E7ZA 2GA2A 2L3DA 3CCLI 3JCUC 3A01A 4M3FA 3H3GA 5HM4B 2ZJRF 2OX3A 2O68A 2VOPA 2BGCA 1IUDA 1ZYRF 2G93A 3KZIC 3M3KA 3LA7A 1IV8A 5H8QA 2HZLA 3F8MA 4BAYA 2DN0A 2WYKA 3GO5A 4GWXA 1GVDA 4LLNA 4EQ7A 2L4MA 2XX7A 3K2AA 4JSOA 2HNHA 3EETA 4YFXF 5ICGA 4DXCA 5H8FB 3E9XA 1LNWA 3CUOA 4NF4A 6PAXA 4GFBA 4A3JJ 3ROUA 1SEUA 5ICFA 1VZ0A 2I3WA 3BOQA 2PT1A 1GVJA 5JHFA 1P2FA 4HE0A 3IWFA 2NWJA 3KN7A 1S7EA 1BI2A 1YPNA 4RYAA 5FBPA 1WI9A 1Y6IA 5GAEJ 3JZJA 4OZ9A 2HI3A 1QUKA 3G1OA 1ZTYA 5FD6A 4A3CJ 4A3EJ 3LAPA 4UUTA 2M4KA 4XN0A 1VQKI 2XXYA 3VV5A 3K4NA 1UJ8A 1NV7A 4PCDA 3U2RA 3I4MJ 1QRYA 3IORA 3RQIA 1DSNA 4ZZDA 1GDTA 3FGSA 4LA9A 1GV5A 4QPOA 4E7JA 5F1JA 3M8FA 4HQEA 1OVTA 1Z0XA 2BY2A 1X1PA 5JHUA 4G6TB 5GPAA 4X8RA 2Y5KA 5DW8A 4GWSA 1K7AA 1JJ6C 2Q2AA 4JDFA 4EXKA 2PJPA 1ETYA 2FSWA 2QVRA 3IO4A 4JVIA 4U23A 1WKMA 3OMYA 3RCOA 1I27A 4YFKF 2BY3A 3G1LA 1SD7A 3CDLA 2X6YA 3SDFA 2VONA 3K1MA 2F48A 5LRSA 4LONB 2O69A 3RT6B 2AS5F 4XKPA 4ZYDA 3QSLA 4P9UA 4H8IA 2CFOA 1EH3A 2EJRA 2M1BA 3TP0A 2DXIA 3UGWA 1EYJA 4IZZA 1TW2A 3IRQA 1EYIA 2OK2A 2COBA 4JYKA 4RB0A 5ICQA 2IA4A 1F5TA 3S1NJ 2LP0A 1YTYA 3OV8A 1IC8A 3WTYC 3VWBA 3GWZA 3TW7A 1P92A 2AQFA 3QRFF 2DMNA 1RUNA 2XPVA 3F8BA 3I3VA 2DA6A 3I53A 4P1EA 1ZRFA 4X1DA 5IAIA 1BJAA 2IBDA 4N9HA 1RKTA 4JB7A 1HXDA 1TLHB 1ACIA 3HTSB 2TRTA 5FTHA 2ZXTA 4GD5A 3SEXA 2B4MA 5EEHA 2D5VA 2VOZA 3OOPA 3FXRA 4BYYA 5CM6A 1SFOJ 1N04A 4N81A 2HQNA 4WX9A 1DPPA 4MIJA 2L0KA 2M87A 4ZYEA 1LAXA 3CDIA 2MH9A 5CYVA 3BLYA 1JNFA 1GXPA 3VVDA 3FMSA 5EDNA 1MQIA 2PBWA 3TO9A 4NWDA 4LZ7A 3HSEA 1DU6A 3OEKA 2D45A 4MAGA 3DBRB 1I5ZA 3LV0A 4ZDLA 4GXOA 1LFHA 3QOPA 2AHQA 4G7ZF 4MHGA 3WGGA 5IZZA 2QS1A 1MS7A 3PUYE 2F97A 2Z2SB 1ZH5A 5FLMJ 3TAJA 3OR1C 1XHYA 3PUWE 2DDAA 1ZGWA 1FQFA 2AQEA 3C36A 3CFZA 1S29A 4DNCA 2DO7A 1GTKA 2KKOA 5IZ3B 2AXLA 3OYJA 5KCJA 1NL5A 3MKYB 1YOVB 1B40A 3AG1H 3S8PA 2I49A 3CUQB 1A40A 4C2TA 2HAUA 3RYRA 3QYTA 3ZKKA 5F6FA 2QMWA 1JTYA 2V26A 1Z7UA 3A01B 1IN5A 4IO2A 2QQBA 1RDZA 3ECRA 2K9MA 5FKLA 2EFOA 1GGGA 3H7MA 3UR3C 3EKIA 4C3HJ 2RN7A 1VI0A 2DOJA 1UG2A 2N8GA 1MZBA 1G3SA 3BJ6A 4M6YA 3V7CA 4LK0F 4CXFA 2KFDA 1FTJA 3OMBA 4I8CA 3WGIA 1ETXA 1WFXA 2OU2A 2OTLI 2RVCA 5E8IA 1SAUA 3MZYA 2NOOA 3MYUA 1SVMA 2I58A 2F35A 5FKKA 1KU2A 1V4RA 3Q25A 4GRKA 2K3FA 3VB2A 4XOTA 1A35A 1BK4A 4N6DA 5DM6F 1S6LA 4BXXJ 2V1UA 2ZNUA 3GYYA 4LUBA 1I69A 3FJMA 4BDLA 1OCZH 2Y69H 3DCFA 4UB8C 5H8SA 3DEEA 2LKPA 4HDVA 3DTIA 3K10A 1A54A 5IZ1A 1ZGJA 2DT6A 3IH4A 3OOUA 4U0WA 3PM1A 4A6DA 3EQLF 1WZ2A 1YQAA 4PFTA 4TV7A 3K1NA 4LG0A 1J9IA 3MVXA 4P47A 5LHIA 1JHFA 4BXUA 3GTLJ 2MD5A 3RTRA 1VR5A 3VFJA 3OYKA 3KBZA 5ERIA 1VFCA 1B32A 1DK4A 4XICA 2K4BA 5J3LA 4A0YA 3RZOJ 5LFAA 1TTYA 1LFGA 3G3GA 5LGUA 4IO6A 2PLYA 2JJKA 2QS3A 2VASA 5TISC 4KIFA 1UHMA 4NTLA 4BDQA 2K9QA 1INPA 4GBWA 5B70A 5I2NB 1N25A 2BY1A 4DYRA 3IRRA 3W9VA 3E6BA 1P4WA 3KPHA 3VEPA 2VT2A 3WE3A 2QFLA 2EZIA 1IXHA 3WTWC 3MAJA 1BN5A 2CQQA 1HSLA 1JUPA 2DI3A 4M3GA 5AA2D 2DU9A 2NYXA 5FFXA 1C0WA 3OO8A 2WBMA 2OLBA 3FK7A 1WQ2A 4C2UA 1ULYA 1EF4A 2VQGA 3CTAA 4PUSA 1WRJA 2L7KA 1FY7A 1PUFA 4P9FA 1SFXA 3JYRA 3O97A 4UV8A 3HBLA 4G6DA 5LOMA 3V8XB 4KN7X 3BG3A 4EF2A 2M45A 3P5JA 3HYIA 3JAMK 1LGBC 2QRYA 4BGDA 5KAFC 4ETSA 4GYGA 3PNVA 4QFPA 1OKRA 4I40A 1I1GA 4UVAA 3TOBA 5KHDA 3FD3A 1KQ0A 1QUJA 1QPIA 4LLGF 1I1SA 4F3SA 4AVZA 1SFKA 2Q8KA 1N77A 1F43A 2A05A 3QPHA 4XKWA 4BEHA 4G68C 2IS6A 3FWEA 2HDWA 2M7AA 4C30A 1JKRC 4AQ4A 5I84A 5JR3A 2BY0A 4S04A 3SDBA 2OJED 1MDQA 2HAVA 2BOLA 2CYYA 3BTIA 3H9GA 4GX4A 1L5TA 1ITYA 3HC7A 4HDUA 3I58A 4KIGA 4Y17A 2F3DA 2BW3A 2F5FA 1FPIA 3ISPA 1CF7A 4OVPA 1B72B 4Q47A 1FPQA 1X3WB 3SZPA 5ET7A 5IKBA 3LSIA 3Q5FA 5L8DA 1YIOA 3WHBA 2IA1A 2V9PA 5F1QA 3L2UA 1SQYA 5J8FA 2LVSA 2DTRA 1JW1A 1A99A 3S2WA 1S3JA 3J7YJ 2UVHA 2VPLA 2CUJA 3BR2A 1GV2A 3WG7H 2VJ5A 3F6OA 3F72A 3GF2A 4IEJA 4R73A 1AKHB 2DSFA 2EFNA 3GXAA 2O03A 5CVUA 3CCYA 4CYCB 2QL3A 1JUMA 1UHWA 1MXWA 4M3DA 1RRJA 4RA1A 1V54H 3LSTA 2QZ8A 3HRMA 1VQ5I 3IX1A 2LK2A 5FKNA 2QLZA 5D4SA 2XXHA 3ZQQA 4OMZA 1B51A 1FT9A 4L9VA 3H6WA 1BI3A 5EYRA 1M5CA 2H6CA 3K4CA 2Y0SA 2IS1A 1Y8RB 2KT0A 2D2WA 2Z8FA 5D8LB 2OZ6A 1IJWC 4ZEIA 3WU0A 2JN6A 4HPQA 3OYDA 2ESHA 3L2VA 1ZJLA 1MNDA 2VJIA 3UA8A 2VC1A 1EH8A 3ZOBA 5I3SA 2X48A 2GLOA 4RGUA 3GEZA 4Y13A 2Y31A 3K6GA 1H89C 1P4AA 1AWCA 5FRMA 1D1CA 1UTHB 4OAZA 3DKYA 2WV1A 4XOPA 2XAUA 3Q28A 4L5EA 1R9TJ 4FEDA 1R5GA 4HAMA 2O3FA 5IT9Z 1B3EA 4PGPA 4Z2YA 1XGMA 2ZXWH 2UUZA 3OIPA 4HEA2 2I0BA 1OVBA 5L9MA 4PFYA 3K4KA 3V89B 5BQTA 2GOMA 2D1HA 5F7VA 1MQDA 2M0CA 1V5EA 4MIMA 3NOHA 4KYWA 5D6FA 3V8KA 1ZIUA 1SD3A 4MLQA 5CMBA 3F22A 4CDGA 4U1OA 1NK2P 5HPQA 1LFPA 1E3PA 1AMFA 3HHFA 4ZEFA 3AG2H 4EQ9A 1HQCA 3OWTA 1H9TA 4OFLA 2DA2A 2FE3A 3GTGJ 2A5TA 1U5TB 5KDTA 5J1RA 3OYGA 3IKTA 4NG7A 2BJJX 1WGXA 3W6VA 1WJFA 3GFLA 4NBQA 5DD4A 4QSDA 4XSXF 4QSEA 2K9LA 3KP6A 5GADJ 2RREA 3E97A 5DD8A 3LA3A 1SFEA 2CUEA 3M7GA 4NUBA 2GQQA 4DW6A 4HF1A 1A8FA 2OBPA 3JR9A 4ON0A 3QPTA 2XASA 2E7WA 3F21A 3SHFA 2XF6A 2VBXA 1QGXA 1PB7A 1BA5A 4F3QA 3L2RA 2ZNSA 4LZ5A 5BUUA 4NDLA 3C35A 2DJNA 4G8HA 3PIOF 4Q0CA 5DUIA 3TYHA 3GFJA 2ZNYA 2VHAA 4G94A 3QPLA 1FW0A 1USYH 3H03A 4MHFA 1HDDC 1XG1A 1Q9DA 1XSVA 1FBUA 1BIAA 3G71I 2VQCA 1WH7A 3OYCA 2PT2A 2RINA 3HRTA 2R71A 3KCCA 4F91B 4WK8F 4P9KA 4ABZA 2ISYA 1SYHA 4TLLB 2TDXA 2GM4A 4JWOA 1SD5A 4NF4B 1ZAOA 3CMYA 3FHNA 1R22A 1B3LA 2XV4S 3ONQA 4LIUA 2JUCA 2HPIA 2MYSA 2EFWA 1HSEA 2FQ3A 1UQWA 1QHHD 1R1VA 3C3WA 1BLFA 2ONSA 5EQ8A 4GYIA 4NF5A 1NKXA 2LMDA 1FOKA 3H3UA 3F8CA 1K83J 2JJ7A 1RDXA 1MG1A 3O2PE 3KYCB 3K02A 2EB7A 2LDUA 1XMKA 3SEWA 2R7WA 4RGXA 3LSXA 1POTA 3J7AO 4XFEA 3HZJA 1B7ZA 1UMQA 4PF6A 1ZGAA 2IT0A 2KZVA 4G77A 4IF4A 3S9NC 3CMEI 1R5HA 1QUIA 2P2AA 4XEQA 2JPBA 5CVIA 4UY8I 2HOEA 4WCGA 4C1TA 1Z1DA 1V5FA 2QQ8A 5IYCJ 3OYFA 2Q74A 4DZJA 4F2OA 3S1RJ 3WTSC 2Y7IA 1URGA 3RT8A 1YFHA 1NK3P 1MBJA 1B9NA 1BM9A 3R60A 3JTHA 5H8NA 1ENHA 1TQIA 2P7CB 3Q29A 2ZJ2A 4CH7A 5GAGJ 3HCQA 4F7ZA 5I57B 3S9MC 4BU2A 2K40A 1MH4A 4L9NA 4Q8RA 4A3DJ 3DTEA 4KI0E 2ANJA 4EJVA 4BQQA 4OIQF 2QVUA 3KOTA 2KJCA 2P3NA 2RC9A 4PE3A 1VFDA 5DV5A 2MFZA 4I62A 1FSEA 2ZFUA 4KN4X 3HOSA 2PVUA 2DFEA 5I2KA 3W6KB 1D1BA 3PSIA 3VE1B 3WTTC 4QSHA 5JFRA 1QBJA 3KJTA 3PPPA 4MEXF 3TO6A 2E1NA 4H5FA 4PGNA 3OOAA 4BUPA 3I0TA 4FE4A 3LSHA 4K2EA 2PQ8A 3T5XA 3FJ7A 2W7YA 4XMYA 1HKTA 2PCRA 2LBFB 1KGSA 2IEKA 3LSKA 5C3EJ 3CSBA 5AE4A 5I56B 2ELHA 2L9SA 1KYZA 1TFAA 3FIRA 3FM3A 3CD6I 3JSOA 1SAXA 2B9SA 2RC4A 2FIXA 2HU9A 1D1AA 2KHMA 3LSJA 1Z77A 3HM5A 4R9GA 1X4PA 1Z05A 4H65A 2CRGA 2I4BA 3FV2A 4NC8A 3G3FA 3FXQA 2NVXJ 4OVQA 2CJJA 1CE2A 1F4KA 4RK2A 1FQEA 2O1LA 4XLCA 1R23A 2HZKA 3Q0WA 4CYDA 3F8NA 2Y7WA 1SVLA 1ZMGA 2K7LA 1S72I 2HXWA 2DXYA 4IGRA 4IO7A 2L7MP 1SVXB 4NMYA 3I71A 3IAS2 3P7NA 4R74A 4TLMB 4LB6B 1DUXC 5HLHA 4EF1A 4M9SA 4IX7A 5ET6A 1LAHE 3THIA 3VYTB 4CCJA 2VXZA 3OSGA 4HBLA 4NF8A 2E71A 4DOZA 4C3IJ 2XRLA 4OIRF 2M8GX 1DQUA 3F8FA 1RUOA 4LGWA 3RY3A 3LNQA 4A69C 4M9ZA 4KA4A 3S2VA 1BI1A 1T33A 1U9NA 1NNFA 1HBXG 4OFJA 5M2VA 2KDOA 4EM2A 1YIJI 1X58A 1O3RA 2ZYNA 4M4GA 1IXGA 5LEKA 1XDSA 3I4PA 2B0LA 3WE2A 1IXRC 4B8XA 5FD5A 3PMWA 4DCYA 4QSCA 5EGOA 4I98B 4ZH4F 5J6XA 3TUSA 4ZDMA 2DMQA 3WU2C 2XXQA 2M7BA 3CC2I 1IIWA 4P0IA 1WJ5A 4POWA 2VJJA 5ELVA 5A5XA 2HXIA 3WAFA 5E1WA 2LREA 4PJJA 1FRPA 1GT0C 2PFZA 2V3TA 2ICWG 2DK8A 3OYMA 4E70A 1OCOH 2HDCA 2E0SA 3DWLE 2R5YB 2VC0A 4R6YA 2XHKA 4ZYHA 5BMZA 1D5YA 2XXWA 2V7FA 2E35A 3KN8A 4UVBA 3H4ZA 5CLSA 1H45A 1POGA 3H9JA 5KK1A 3C32A 4Y33A 1LAFE 1Z3YA 4G2ZA 2BEOA 2PFBA 2Y9YA 3PNYA 3T93B 5JI6A 3RZDJ 3MZ8A 3EN3A 1Z6TA 3PPNA 1D0YA 3AG3H 2IAIA 1BW6A 1O57A 2JK3A 2R5YA 3RKQA 1A31A 2STTA 1KZ8A 1YS7A 2JZYA 3KP4A 3IB2A 4YICA 2KLFA 3G6EI 4O7MA 2R7UA 1X1CA 5K7HA 3E79A 2H8WA 2K86A 2OCEA 1Z21A 2WAQN 4IY6A 3BR6A 4F31B 1FBPA 2JSPA 3AL0C 3OS1A 2PBIA 4P0GA 1ZG5A 4FEBA 5LEJA 3ZQHA 2DT5A 2R7XA 2WAEA 4X6AJ 4FORA 1B5JA 3JTGA 3VLWA 4PETA 4IXAA 4EJUA 1U9OA 2LFBA 1U3EM 4KD5A 1UG0A 3HB9A 5B1BH 2EV0A 3MMYB 4YKIA 4FECA 1ZTRA 2FNAA 1B9JA 3OYBA 4OTEA 3FXJA 1O3QA 2DXRA 5IP9J 2R5ZA 4V19K 1OJLA 3W6JB 1URSA 2CZHA 4YIFA 4NC7A 2MG4A 4N8YA 5KCJB 5BPIA 2WAQA 3D1NI 3BIHA 2EWNA 3OIQA 4NE4A 5E79C 3TKYA 4ZDPA 2L01A 3CG3A 5LTCA 4NF0A 1TZLA 3ABKH 2LY9A 2NS8A 4BE1A 4CCLA 1T98A 4ESFA 1OLCA 2DE3A 2HXRA 3MZBA 5ET5A 3FIWA 4YIIA 3ODBA 1NG6A 1KU9A 3JREA 2VT3A 3T8TA 1Y1WJ 1QZZA 2PMZN 3OL3A 2JQ7A 3LFKA 2QS2A 4MQ9F 2E7XA 4GCVA 4KYSA 1R6RA 2ECBA 1I6BA 2NVUB 1FMWA 4RLFA 4YKKA 4C2MJ 3LSPA 4IHYA 4HNUA 3TFLA 3MW0A 2MABA 2X1CA 1S8NA 3K6UA 2DYXA 3CVGA 5FTIA 2W48A 4LATA 4XLHA 1GLNA 2RC8A 3A02A 3CCSI 5F0CA 2YUSA 4QXDA 3N97A 3A0BC 3GYHX 1DOTA 1FIPA 2QBYA 4NNJA 3B6CA 2GBYA 3K6VA 2RKMA 4N6KA 5J8CA 1FPFA 2IJLA 2ZBKA 1MMDA 2UXNA 4FJPA 3SYTA 2NNYA 2UV1A 3G2BA 2FYIA 4N17A 4OANA 4RJZA 3G3HA 3MUQA 4G8NA 1J2XA 5AA1A 2XB5A 3S17J 1JE8A 1G2HA 4KYEA 1KU3A 5K5QA 4ZTJA 4X48A 3E0JB 2DFFA 5ICEA 2KIMA 1RR8C 3L2WA 2ETHA 1VTNC 1RYOA 1H43A 3MVYA 2NVTJ 2DA7A 2QUFA 3PFYA 4IRIA 2JA7J 1LBXA 1P1WA 1S9TA 5BPDA 1B8IA 4YB7A 3V83A 1DPUA 3ZQLA 1IDZA 1P99A 4OIPF 4DGWB 3F23A 1WJCA 3KX2A 3TTMA 1D0XA 2XGCA 3S32A 2LKXA 1MXZA 4WKMA 3HOUJ 4NC6A 5M3MJ 3IOTA 4XSZF 5I56A 2LF7A 1ETKA 3K6XA 3CMMA 5H8QB 4Y15A 4XKQA 2HZDA 1FPBA 2L5QA 5M5WJ 4J19A 2ZYKA 3CO7C 1XPXA 2XX9A 1IAWA 2P4WA 3N6TA 2CUZA 4PE5B 3OYAA 1TW3A 5ISUA 1LJ9A 4IO3A 5FO5A 1KONA 2ZC2A 3P9KA 4AIDA 2BW3B 1TT1A 4GQOA 2EFPA 4I0AA 4NWCA 4MNPA 1MJBA 1S7OA 3E5QA 4XKCA 1NH8A 2Q2EB 2FNCA 2AYSA 2XVCA 3ZMDA 1ELJA 1BR2A 4A5MA 5K7FA 2HR3A 3TQWA 1FC3A 3D0SA 3CRBA 2XGDA 4XNFA 3HN0A 3MPLA 4CO8A 4MFDA 2DA4A 3RSNA 4GL0A 1A5JA 4JXIA 4OESA 3ABTA 2DPDA 2X7QA 3RTWB 2R0QC 3F11A 3KEIA 5AONA 3J7ZI 4GWUA 2HVSA 2CG4A 4XKVA 2GA1A 3J81K 2CU7A 5HVQC 2I6EA 2G0EA 5EYFA 1H9GA 2XXKA 2BHZA 4PBHA 2ZZXA 3K4LA 3HSFA 1FX7A 2GHAA 1IMBA 1YO5C 4IR8A 4ENNA 5H2FC 5EEGA 3PTYA 5D4RA 1T0FC 1Y4CA 3FX3A 1X3ZB 2WWYA 1XTAA 1MNMC 2F36A 2QF7A 3H6UA 3O66A 4A93J 3BR3A 2FEZA 2UYEA 1XGSA 1R6ZA 4DXUA 2QMXA 3FZVA 3IP4B 2M34A 4LFUA 1KA0A 1DP3A 2XB0X 3R4KA 1ZLJA 1XVYA 1YXIA 1D4NA 1K9YA 3DM0A 3IB0A 4EDPA 1E0EA 4ENJA 1LUJB 3FM5A 2RGVA 4YMAA 1N84A 4FAJA 1ANFA 3VOEA 2CGPA 2Z8EA 3F0CA 3I55I 1QZEA 1Z3XA 4PFWA 4UA8A 2A3SA 3KP3A 2VGQA 2XRNA 4OU0A 2F7CA 4ECFA 5JVGF 2VE8A 1E3OC 1G3WA 5L9SA 5EJCA 1N7WA 5HBCA 2QKLB 2V1XA 1B52A 5D5XB 4RB3C 4P55A 4JX6A 4BBRJ 3TDUC 1K78B 3GBBA 1WH5A 1I3QJ 5LRRA 4EMSA 4O3MA 1MY3A 3M3LA 1RI7A 3H1CA 2P3VA 3H3VK 1FTMA 2ZB9A 2DPUA 1KWHA 4XM3A 4O3CA 4UUVA 4A3KJ 2FOKA 4FISA 3DU6A 4JVCA 5A5LA 3CC4I 1R49A 2VPOA 4LMYA 1IUYA 1MSFC 4DBRA 5B66C 1FTKA 1SC7A 2F34A 2DBBA 3IFAA 1QGPA 1IRGA 4E4HA 5F0HA 2O6GE 3IR1A 4C1UA 3HUGA 2GXGA 3IJXB 5LDZA 4HV6A 2ACJA 2CWEA 1Y0UA 3GZGA 2ZYMA 1NV5A 3QUJA 2HOTA 2A61A 1JEUA 3DPLC 1D9QA 3ZKLA 3P9IA 1FBCA 3K00A 4ESWA 1SBPA 3OY9A 4AD9A 3OYLA 3PO3J 2WKYA 1B6AA 1IRFA 1MMNA 1JT6A 4EQQA 1YW7A 3TTRA 5I59A 1OCRH 3BCBA 2V93A 1MQJA 1ZELA 4ESBA 3FVGA 2Y75A 2P0WA 2Z33A 2IRFG 3IJOB 1T8IA 1AOYA 1D8JA 1WODA 2HHMA 2OUMA 2RF1A 4IOAF 2BE5F 1MBHA 3OO9A 3BG5A 2E5NA 2V4JC 1U5TC 4U7DA 3ZCOA 5KAIC 4NF5B 2OQRA 4RGSA 1D3YA 4XRSA 3G4SI 4LB5A 3S2HJ 3V4GA 4RDUA 3CCUI 2K02A 1Z91A 2E19A 2HQ0A 3KEOA 4I02A 3WU1B 2A68F 1MDMA 1QQIA 2I5UA 4YELA 4BE0A 2IA2A 1ZKBA 3ZP5A 4P11A 1XOCA 5EHSA 2CEXA 4HOBA 5DYHA 3RPLA 3QUFA 4ELOA 2EA4A 1ODDA 3CP2A 4O94A 3HOXJ 2OZZA 1OCTC 1N75A 3LBSA 2FBHA 2CQNA 1SPIA 1BP5A 3A09A 5FKMA 4D7NA 5EEAA 1MDMB 4RK9A 4GWYA 2M2EA 3WTVC 4KIBA 4PFPA 2FXAA 5HLGA 4HYEA 3HOVJ 4POXA 4J01A 1TQPA 1MXUA 3IKVA 5IYBJ 2YJPA 2WY8Q 4BE2A 2DA5A 2VI6A 1LBVA 2LLKA 2WB1A 2COMA 3ZMZA 3ZQ7A 4H67A 1VQLI 1HC8A 3HTUA 2EZLA 1H3DA 1Y3QA 3K0VA 3QIMA 4OERA 4AS4A 4DYCA 3UK4A 3MWMA 3KEYA 3JAMZ 3LSRA 1KYWA 1RNLA 1OFCX 1US4A 2F4IA 3BC8A 4G7HF 1NNPA 2DQRA 3IOWA 3S3OA 4PAKA 2KIQA 3DU5A 5TPAA 2UXXA 1MY4A 2FA7A 1HOMA 3MVZA 2BVMA 2HPMA 1EV7A 4QPQA 4ZTFA 3MJNA 3SERA 1VE4A 2E2HJ 4N6PA 5FLVA 3HSRA 4IKFA 1B6HA 3PQKA 1TBXA 1MKMA 3MBPA 1K79A 3C2GA 5DVFA 4M6XA 1H0MA 1KZHA 3CCVI 3ML6A 4PJNA 3S14J 2O84X 3HUGB 2FHYA 4HW8A 2HTJA 3HIFA 4KMUX 4PK4A 3EUHC 5F08A 4NN3A 3H5AA 1NFTA 5IYDJ 2BYVE 3PMXA 3Q26A 1DDNA 2M30A 1B7HA 5ITOA 3M8UA 3OD7A 4RAZA 4I1DA 3ZS6A 4HX4A 1MGTA 2LKSA 1OMPA 4BH9A 4WXJA 3H36A 4BJ5C 4E6KG 1PP7U 1MJAA 1R4MB 2JA8J 1W7PD 3DF8A 1HA8A 3LR1A 2QEXI 2XXTA 2AXTC 1WJBA 4ENMA 4FX0A 1B05A 4PC9A 2P6SA 1XMAA 1XVXA 2KMUA 1W1WE 2X1DA 3ECOA 4MQVA 1U8BA 5DTDA 2X6XA 2V9VA 4XLAA 3KSJA 1TNTA 4A2UA 2BZTA 2O0YA 2JPCA 1FQAA 2WBDA 3GVAA 1WDNA 3MWBA 3C2HA 3FDYA 4CZZA 5JEIA 2V4CA 3GLXA 2Z16A 3E5UA 1O7TA 4AS5A 2QM3A 4CCOA 1OLAA 3RI4A 5TJJA 1MQGA 4XTCQ 4ZJZA 2CV1A 4A3GJ 3EHUA 2EZHA 5DT6A 1DPEA 4RMNA 3KP2A 5DYMA 4H0WA 1Z7NE 2KJBA 2HEUA 5KNLA 1AWBA 3WGHA 3LWFA 1JVXA 1S50A 3MKWB 3F9KA 4THIA 3BJAA 1IN7A 2ZKZA 1U0JA 2L7ZA 5DCMB 3LUZA 4QF9A 2G7UA 2EBIA 5IP7J 4BHBA 3C9HA 4XL9A 1O64A 3BG6A 2DAOA 3DEUA 1MXXA 2OWZA 2HS5A 3FF5A 1R36A 4CZCA 2O7UA 2FUG2 1YX3A 2Q9TA 5TRDA 4YEJA 1PUFB 1R1TA 3FKIJ 3NAUA 3CFXA 1ZHFA 5TU0A 4HTGA 5J16A 3TTLA 3HL2A 2IGMA 3HRSA 1JHHA 4PSXA 3MFKA 1D3KA 4P5OA 1IQ7A 1NV6A 2ID6A 2PMUA 2HEOA 4P3LA 3DPUA 1YS6A 3OR2C 2A07F 4O8MA 5DEXA 3GUDA 3L2CA 3FBNB 1KQ8A 1LBYA 1LVKA 4BQNA 2FX0A 3E13X 4JWXA 4LLLA 1O4XA 4BDOA 2R7SA 1LEBA 4NF6A 2F5EA 4PFIA 2PMSA 3BIGA 4Q30B 1OMIA 1IRZA 1W0UA 3CSGA 3MEXA 4H6DA 3OIOA 5J1YA 1A55A 4RXLA 1FJLA 2R6GE 3L1PA 4QFKA 2W00A 4EGZA 2VQHA 2YLNA 3C4MA 3O28A 4EUOA 5CQEA 4CCNA 3H6TA 2LYCA 4AYBN 4A3IJ 3ZMVA 1YTVA 1TNSA 4ZYGA 1OISA 2YS9A 4A0ZA 3PL8A 3SZGA 3HPIA 4QFOA 5ET8A 3SDGA 4NF6B 1T08B 1BR1A 2H6BA 1IMCA 4P1LA 2KDZA 3CF5F 3S3NA 1H88C 1L0OC 3ASNH 4JOMA 1SI1A 4XLEA 2I0CA 1V5GA 5CKTA 2MC3A 5E3MA 2QVOA 2Y7KA 1OLTA 1FPGA 1G3YA 3Q0VA 1IN8A 1NH3A 5E17F 3DPTA 1FNNA 2E34A 2W82A 1ONVA 3BT9A 3ZN1A 4L0YB 2EK5A 2X26A 2O61A 3FVOA 2L7FP 3EYYA 3GLLA 4PGHA 2ONRA 3H6VA 4DXBA 3BR0A 3FJGA 4BDYA 4A3FJ 4I01A 1ZRDA 5M3FJ 3ABMH 5I2NA 5CVJA 1XGNA 2NXOA 4FETA 2OCUA 3GTPJ 1CQTA 4BBSJ 1Y39A 4Q4ZF 2HFHA 2L9RA 3BJOA 3CJNA 4ZYAA 3R0AA 3N6UA 4ELPA 2M4GA 1MMSA 1HW1A 2VD3A 4IQ4A 1T6SA 4N4UA 3V7SA 4Q5SF 4A12A 2EILH 4HSTA 4BY7J 3CUQA 3TL4X 5DVIA 2XDVA 1NUXA 4ZZLA 4EV0A 5FB2A 1VQNI 3S15J 1UIVA 4OEVA 1Z9CA 2DVZA 1WVRA 3SXYA 3ECHA 1UTBB 3VSKA 2B3BA 2QBYB 5FKOA 4KHZE 3SEVA 5LBQA 1VQ7I 1A36A 5FLXK 1TWYA 4DDDA 5M5YJ 4KCCA 1P9QC 1W36D 1QO0D 1LBWA 3HKZN 1HLVA 3B6QA 3SEZA 4U1ZA 2MC4A 3X2QH 4AIKA 1R9QA 2K9SA 2Z9OA 4BQOA 3WAEA 3ABUA 2WADA 1RETA 3C31A 4G6QA 2VUMJ 3B7DA 4LQ2A 3TODA 5EYHA 1BTJA 1JKOC 2HWVA 2R9JA 4MJOA 2DOFA 4HF0A 1VDWA 1LAGE 4OMYA 2NNNA 4A3BJ 2DLLA 2K4JA 3O8GA 1E3HA 3SJMA 5TP9A 3ERED 4GLIA 2DWJA 3HFUA 3O6IA 4NF8B 2Z8DA 4LP2B 2OWSA 2FQ4A 3CG1A 3P9CA 5I7IA 4OWRB 1Z6RA 2EIMH 3H9QA 4L9TA 2V9KA 3IL2A 2H8RA 2UWMA 1MNEA 2NUVA 4YKPA 1FJ6A 1NUYA 2BV6A 2Z23A 2GZWA 3RPWA 4OVSA 2QQ9A 4U0VA 2E1OA 4Y4RA 1FPJA 2HDDA 3S4UA 2LRDA 4F1UA 3T9VA 3QYBA 5F64A 4ZEKA 3BFTA 3RJPA 4DIQA 3SEUA 1P1QA 4GX3A 1HF0A 2FVZA 4HE1A 1BC8C 4DYQA 3S9EA 2YR2A 4AC0A 1B1HA 4LJZF 3GTJJ 3H0DA 4BNCA 4ELRA 3TDZC 2VN2A 1APLC 1TC3C 3PD8A 4Z6YA 2D3IA 3USDA 1GXQA 3I5UA