1HSJA

Sarr mbp fusion structure
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
487
structure length
487
Chain Sequence
KIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALAAAQTNAAAEFMSKINDINDLVNATFQVKKFFRDTKKKFNLNYEEIYILNHILRSESNEISSKEIAKCSEFKPYYLTKALQKLKDLKLLSKKRSLQDERTVIVYVTDTQKANIQKLISELEEYIKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FUSION PROTEIN CONSISTING OF STAPHYLOCOCCUS ACCESSORY REGULA
publication title Crystal structure of the SarR protein from Staphylococcus aureus.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription/sugar binding protein
total genus 143
structure length 487
sequence length 487
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
A PF12802 MarR_2 MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1hsjA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1hsjA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1hsjA01
1TW3A 1JQFA 2DE3A 4HF0A 2W7YA 2LKPA 1ZG1A 1VFEA 3E13X 2HTJA 4MQ9F 4C0RA 3DPTA 5DEQA 1Y0UA 4KA4A 2F7AA 2XXWA 1URGA 1S29A 3PQKA 4U7DA 1FQEA 5DDGA 4GXSB 2B65A 2ZFWA 4CICA 1NNPA 4N13A 2FEZA 4HOBA 4E70A 4R75A 2NS0A 4HF1A 3TCFA 4EV0A 3GYHX 5LOMA 4Z2YA 1LB9A 1I1GA 3WODF 5HDGA 1O3RA 4WK8F 2GRVA 3TUSA 2DQRA 3V7RA 5AIPA 3K69A 5L3DA 3V7SA 4OERA 3VDFA 4UXNA 4O3AA 3KSXA 4EJTA 5KCJB 1NNTA 4L9JA 5LRRA 2AYSA 2RINA 1TFDA 3SHFA 1FTMA 1FCKA 1MQDA 2YU3A 3HRMA 2PN6A 4AD9A 5K2YA 3FXQA 3REOA 1MY0A 3EQ1A 3MQ9A 4ZECA 3C4MA 2Z99A 2QWWA 3MJNA 2VONA 5HVQC 1X3UA 2FBIA 3CUQA 5D5UB 3FVNA 2RKHA 3GLXA 4FX0A 2QS3A 3MP1A 3VXBA 1BOAA 1F9NA 5K1YA 4ESWA 2ISZA 4UA8A 3QU6A 3O9PA 4ZE8A 3L09A 4G8MA 5BWJA 2XXIA 3A09A 3ZSFA 2MLKA 3HYIA 1YCJA 3GFIA 1FSHA 2D5WA 3W9WA 3GX4X 1CGPA 2ELHA 4OFJA 1GR2A 1LBBA 5BOXA 2O6AA 2V1DA 2HZKA 2PT1A 4WKMA 1EH8A 3E3VA 1VFDA 1I6AA 1REPC 1P1UA 4A0ZA 5D8KB 3THIA 1IRGA 1N7WA 2HAVA 4XSXF 2HEUA 5LGUA 2A68F 1USYH 3E6DA 2RCBA 2E1CA 3G7WA 3PUZE 4L17A 1B9MA 1F5TA 4H1XA 3N26A 5ILUA 3IJXB 3J80K 3MZ1A 4GGGA 3ZMDA 3SXYA 4P5OA 4KR5A 3TOAA 3I3VA 2GA1A 2RC9A 1D8KA 3WE2A 4HQEA 1XS5A 3MPKA 4EUOA 2VBWA 1N3XA 3I4PA 2YX4A 5DCMB 2G93A 2CSOA 1A8EA 3W15C 2P5VA 5JR3A 5DVJA 3LA7A 3IORA 2QVOA 1O3SA 2H99A 3E4RA 2UZKA 3D4CA 3LQQA 4GRKA 1P92A 1R5HA 1YQAA 2V93A 5ITOA 1MD0A 4LP2B 5L3FA 1CF7A 3OOPA 1HKTA 3ABUA 2Y7KA 3V8KA 1JW5A 1QW0A 3HSFA 1J0RA 3C31A 5BQTA 3K6UA 3L6HA 2HCAA 2VOOA 2VE9A 5CVUA 3IL2A 4LD5A 1TQIA 3I53A 5ICEA 4IVNA 5FLXK 1SYHA 4IRHA 5L9SA 2XKOA 2ZBKA 3CI8A 4A2UA 2LF7A 3QSLA 3VOEA 5E1XA 2H9BA 4EDPA 3BOQA 4EQ9A 4A0YA 3TEPA 3U92A 2YX7A 4D0PA 2DWHA 1BIBA 2V1UA 2HQ0A 2A07F 3OD7A 3RUMA 4ESFA 2M8EA 1QUIA 5CVIA 1FTKA 1KU3A 1B5JA 3BP8A 1BC7C 3ONMA 4LQ5A 1A7LA 4EQ7A 3MP8A 1PB8A 1WI9A 2HFHA 3MWBA 3CSBA 3T66A 2CFXA 3BPXA 2OQRA 1PP7U 4KFCA 2RC4A 1UFMA 1OYYA 2X0LA 1S50A 2Q2EA 4GLIA 4KPTA 4QWQA 1KU9A 1B4AA 1HSEA 2F5XA 2EV5A 4KIGA 3E5QA 1TNSA 3MUQA 2XV4S 3FJGA 4X1DA 2P7CB 1SMTA 1TWYA 2HTSA 5LHGA 2G7UA 3DLNA 4L9TA 2Y84A 2KJCA 3Q5FA 3TCHA 3QPTA 3DP7A 2I3VA 3RPUA 2I48A 4XRFA 1IN5A 4MLQA 1FC3A 4NWCA 4QFOA 3KP6A 4R6KA 5TU0A 3ECOA 4IRIA 3IRRA 1OMPA 2DOJA 1SW5A 2XXRA 1OMIA 2O6GE 4LZ7A 3G3FA 2XXHA 5KCJA 3TKYA 4MTEA 2OJTA 3GZ5A 1MXXA 1IITA 4IO2A 5DCFA 3PD8A 1ZMGA 3TELA 1I5ZA 4RNSA 3RKWA 3BFTA 2VT3A 2H25A 4R6YA 1LAGE 3EPEA 3TFLA 2JSCA 3FMQA 3W6JB 2D45A 2EK5A 4ZYHA 1R9QA 1LDDA 1PP8F 3O6BB 2B3BA 2L3DA 2QM3A 2OU2A 3IK6B 4LZ5A 2XXUA 1XDSA 4RA1A 4JK1X 3HIFA 2D21A 2Y48A 2Q2AA 4GFRA 4KIFA 2GWRA 2QENA 4A6DA 4IJAA 1O3TA 4Z7EA 2Q2CA 2Y7RA 1ZKBA 4G68B 4IB2A 3SEXA 4BDQA 3IKVA 3BJ6A 1SD3A 2G7HA 2ISYA 4Q5TA 4DXBA 4HLYA 5CMBA 1YIOA 5F64A 5DD4A 2UYFA 3FM5A 5HPQA 1PBPA 3HUGA 2VBYA 2M5WA 5CMKA 4G4PA 4EQBA 2IJLA 1B1BA 3BBRA 3OMBA 4H8IA 3FV2A 3N97A 5DD8A 2ZO4A 3UGWA 5ISUA 4XLNF 1S7OA 4R9FA 5FO5A 3VV5A 4TQUQ 2DI3A 3L9FA 4NWDA 4GCVA 4OEUA 4KIBA 4PE5B 1P2FA 4A5NA 1ZLQA 3Q26A 2PMUA 1K79A 5ILVA 5DCMA 3ULQB 1Q35A 6PAXA 4OEVA 1IQ7A 3TDZC 1FBUA 3GFMA 1O64A 1R7JA 4K2EA 2R71A 3I6VA 2P0SA 3HRSA 1VTNC 2Z5UA 4KI0E 5LHHA 1CE2A 4IO7A 4ESXA 3PGFA 4U88A 4QFPA 3RTRA 5H8FB 2QUFA 3R0AA 1K6OA 4IHTA 1ULYA 3M8UA 4N6PA 4YG2F 1B46A 1US4A 4GWOA 1PBQA 4CYDA 1BI0A 1XCBA 3RKYA 4F2QA 1LQ1A 3VFJA 2GXGA 4M4GA 5ITPA 3E6CC 1IXRC 3N4MA 4G7OF 5D4SA 3O6GA 4BHPA 5JTYB 4QFNA 4FX4A 4DCYA 3D5LA 5E20A 2IVMA 1G4DA 2VC1A 3RQTA 3QOPA 4GOTA 4DE8A 3CFLA 1NMUA 3KJTA 1LB8A 4M72A 3H4ZA 4FT8A 4EM0B 2P6TA 2A6HF 1IN4A 2IP2A 2VXZA 2F35A 4KUMA 5AA3A 2A3SA 1MDP1 3L7WA 3LSFB 4LONB 4LVQA 2IPQX 4YKJA 2CMOA 3QYTA 4RAZA 1MKMA 4OVJA 2ZNSA 4YB7A 1Y3PA 4ASNA 3V8LA 4O6JA 4PGHA 5HS8A 3O28A 3M3FA 2B3FA 4F3BA 5HM4B 1ZRDA 1JNFA 3E3KA 4OIPF 4QF9A 5HOOA 3IX1A 1B6AA 1GV8A 3BFUA 3JYRA 2VN2A 1A55A 1B40A 3JW4A 3IC7A 4U0WA 4RK9A 3FATA 2NVUB 2HDCA 4G6QA 4HW8A 4PETA 2KKOA 3IB2A 4PFUA 1PEBA 3E6BA 4XXUA 5I56B 3BWGA 3LC8A 3NQOA 4YFKF 4YB6A 4Z0IA 4UVCA 5A5XB 1ZRFA 1ELJA 4HTGA 2RF1A 3JAMK 4L0ZB 4AIKA 2DK5A 1G3TA 1SD4A 3ILUB 3N5LA 5DEXB 5H8SA 4ENNA 2DU9A 1U8RA 2VE8A 3HTUA 3KOTA 4LG0B 1B3LA 3KZYA 3H6WA 3F3XA 5FHMA 1STZA 2JPBA 4M9XA 3W6KB 3KJ7A 4GXAA 1H3DA 2LSOA 3GUDA 3WTYC 2EFOA 1CB6A 1LB2A 1YG2A 3QAHA 3OO9A 3OV8A 4F19A 4ENJA 1FQAA 4RGUA 4BNCA 2XXTA 4RGXA 3H6UA 1QKAA 5ED4A 4F1UA 3E5XA 4G8NA 1WDNA 3CUQC 2CYYA 1YFHA 1S6LA 1P4XA 1E17A 1UCRA 5K2XA 2V3QA 3B02A 4YMAA 2NAZA 4G68A 2EB7A 4ZEKA 1WKMA 3ECRA 3TTNA 1SI1A 3H6VA 3O6HA 1GXQA 1I6QA 2ZMBA 3T9HB 4I2OA 3PFIA 3Q9SA 2FMLA 3BJAA 4ZEBA 4L5JA 1W7PD 2Y7IA 4P96A 4OOIA 2ESNA 5LLQA 3PMWA 4XTCQ 4P9UA 3WTXC 2E1NA 4AWXB 4EGYA 4POXA 4DDDA 4G8HA 1MJ9A 1EH3A 4N07A 1XVXA 3D4GA 1JXSA 1FZPB 3A3UA 1B58A 1M5FA 2OCUA 3ZP5A 2ONRA 1V4RA 5FHOA 1FTJA 3MW0A 1B1HA 4JWXA 4QSCA 3M1EA 3F6OA 4GD5A 1LFGA 3IKTA 4ZZEA 3FJ7A 3WTZA 3D0SA 1UTHB 2QS2A 1B2HA 3JV9A 1PUEE 3R6SA 4ENKA 4PCQA 4WX9A 1Y4CA 3S9EA 2PMHA 1SI0A 1HKQA 2CW0F 3VVEA 2EV0A 5DV5A 1XVYA 1NNFA 5H8FA 3JAMZ 1TBXA 1D5VA 1LJ9A 1JGSA 1N76A 4YU0A 1OR7A 1FQBA 3ISPA 4CDGA 5CMCA 1DPPA 3CG3A 5L3BA 1AOYA 2Z22A 1IZ1A 1MQIA 4JB7A 1E2XA 2ZCWA 4P11A 1B7ZA 3SKPA 1DTZA 3DKWA 2OK2A 5JTYA 4QLCU 1J7KA 2VT2A 4JWOA 2FYIA 2Q88A 4MFIA 2OZUA 3T93B 1LNWA 3DP4A 4BYYA 1J1NA 1M5DA 1J9IA 3WTVC 3ILTB 1MJAA 4GQOA 3HRUA 2HKOA 4OIOF 1I6XA 4G7ZF 2F34A 3VXCA 4XBFA 4NHJA 5H8QB 3F22A 4G8XA 2O61A 1SFEA 2J5PA 5JVTA 2ALUA 5J8FA 1ZLJA 4EVIA 1XSVA 1MXYA 4KT5C 3HOTA 3FXRA 3OEMA 4IGRA 1XSXA 2DYXA 2V9VA 1BI2A 1B52A 2V79A 4AIHA 4GYIA 2VODA 1Y4TA 4U7BA 5F6FA 2B0LA 2Z3YA 5FTIA 2CG4A 4Q4ZF 5H6RA 1QUJA 3IOTA 3CRBA 3OEKA 4POWA 1XD7A 2XD3A 5CYVA 1OLAA 5KVRA 1F9BA 3MVWA 2BYVE 1MM7A 4YFNF 3K6VA 4R8HA 1IUDA 2PFBA 1PC3A 3IR1A 2DSFA 2HKXA 4ZZAA 4GYGA 1BLFA 4R2BA 2CO5A 4TLMB 5I56A 4RS8A 3C18A 3UK4A 3HRTA 5D5VB 5JI6A 4ZEFA 3TYHA 4HLXA 3V83A 3SETA 1WVJA 4R72A 1GXPA 3G3KA 1KU2A 2DQLA 3TCGA 3V89B 5IT9Z 5A5XA 4H0EA 1IW7F 2DPDA 4H8JA 1IXCA 4EGZA 1FTLA 3GZ6A 3KLOA 2KIFA 2ADUA 2XAQA 2HZTA 1NL5A 4UV9A 2HOEA 3T22A 3C7JA 5DEXA 4Q5SF 1ZN2A 3CTAA 4LG0A 5M2VA 4RGSA 5CBSA 2UYEA 2MH2A 3PMVA 1T98A 3G73A 3G3GA 3I64A 4MGRA 2OA4A 5FGMA 4HDVA 3CUOA 2QS1A 1KA8A 2DVCA 5D6FA 1JVXA 3S4UA 4N9IA 4LGWA 4U23A 5HDKA 2H4IA 2F5CA 1UHMA 1OLCA 4CXFA 1MS7A 1D9YA 1A54A 1GVCA 2RQPA 4L18B 4K3FA 3LSXA 2PI0A 4NF6B 5B7DA 1BBYA 5AONA 2QMXA 3LR1A 2YR2A 4YICA 4EQQA 3ERED 4I0BA 1ZYRF 5BUUA 2XXXA 1A04A 2PT2A 1EU8A 4OFOA 4OETA 2GZWA 2ZYOA 4NF4B 5DVIA 2QLZA 3OENA 4GL0A 3COAC 4KYSA 3RPQA 1UHWA 4EM2A 2XD2A 3ELKA 2FA5A 3QRFF 4UUVA 4I98B 3VEPA 4U2RA 3K6WA 4UVBA 2DWAA 3FVGA 4KFQA 1XDUA 4F31B 3HN0A 4ND9A 3FJMA 5TP9B 1KYZA 2AS5F 5D4RA 2XX8A 3M8FA 5E8GA 4GVOA 3T9VA 2CWEA 2UXAA 3RN8A 3VLWA 3U2RA 1YPNA 1U5TC 3TO6A 2NOOA 1J2XA 3U9GA 4JWYA 2TDXA 1UTHA 4L5IA 3LA2A 2Q0OA 4BDRA 4CGZA 1ZU0A 2IRFG 5H8HB 2H6CA 1O63A 2HZLA 4WEPA 4E0XA 4KN4X 2KLFA 1LDJA 5ICCA 2E1SA 1URSA 3TDUC 2P4WA 1XGNA 2H5YA 2XIGA 2RN7A 4LLNA 2M1BA 4DNCA 5K5QA 1W7PB 1G3YA 1SW1A 4BDMA 3LAJA 5FHNA 1HXDA 3NRVA 3VE1B 4DXCA 4F39A 2M8CA 5LEJA 5KZTA 1LSTA 4YKIA 1MDMB 1B3FA 5H8QA 4FE8A 3KP7A 5EHSA 3LWFA 1N0TA 1NKXA 4LJZF 3MCZA 1B3EA 1DPEA 3B6WA 4LUBA 3K1MA 5CMMA 1R1NA 1TNTA 2WTEA 1MQGA 1R1TA 2F5FA 1YS6A 2FSWA 2GXBA 5AA2D 2W57A 1WODA 1P1WA 1ZRCA 4KYWA 5JHUA 4PFWA 3ZN1A 2FU4A 5DYMA 1MY3A 3RY3A 5CJ9A 3WGHA 3PQJA 3T1BA 2Q89A 2A69F 4X1BA 1DTGA 2P5KA 4CZZA 3GBAA 2MBFA 3CR9A 4R74A 4KCCA 5HLGA 2PLYA 3GVAA 1ZBMA 1MXWA 3E97A 4ON0A 2BJJX 2VP1A 4MBPA 1MPCA 1MPBA 4HZFA 4LB5A 3F8FA 1FP1D 5CLSA 3J81Z 1VSOA 2WKYA 2GA2A 1YS7A 4U0VA 4FHTA 1IAWA 4XLPF 1QQIA 1D3KA 4ELRA 1R36A 2FXAA 1D3YA 2RC8A 3O3KA 4M9SA 2MA3A 1XSDA 4LATA 3GEZA 3SZPA 1WQ2A 3PU5A 3T9XB 4F3SA 3FZVA 5HDNA 1B0LA 3ZKKA 2RC7A 4UV8A 2L01A 2W24A 3FUZA 2PMSA 1SW4A 2ESHA 3DELB 1R00A 4PGGA 1I27A 5ELVA 2KRFA 3J7AO 1N84A 2ZNYA 3R0JA 4MHGA 3S9MC 1R1UA 3CFXA 3DP6A 1MQJA 4TOZA 3TGNA 1B3HA 3BJOA 1B51A 3E9XA 3IOWA 2GHBA 1OVTA 5CRYA 4NF6A 4ZEIA 3S2WA 3K9TA 3EN3A 4GL8A 1NHAA 2G29A 1ZREA 4UHTA 3WTWC 2NNYA 3S9LC 1RI7A 2W84A 1U2WA 3N6UA 4ZZDA 5HLHA 4PFTA 2P2AA 3TPAA 2GAUA 1MH4A 4HDUA 1D4NA 5CVJA 1MQHA 3PPQA 1NNKA 1USSA 3KFMA 4NF4A 4M6XA 4KCDA 2DPUA 2ACJA 1B5HA 3IO6A 3WG9A 2VOZA 1QULA 1FLIA 2Q9TA 1O3QA 2AXLA 1MDQA 1QNTA 2FQ3A 4HX7A 2JTVA 3EDPA 4IPAA 1QKBA 1QGPA 2QL3A 5TP9A 4ELQA 1J5YA 3EHUA 1IRFA 1S8NA 3DPLC 2I0CA 4EXLA 4NMYA 4H67A 4QFKA 5BS6A 3FV1A 1A8FA 2LAOA 4WXCA 2ZMEB 3O6IA 4KQPA 3KG2A 3MZ9A 2QS4A 4ECFA 1B5IA 3Q25A 1H9GA 2REGA 2HAUA 1QPMA 3BDDA 1II5A 2V3UA 4HCWA 1R23A 4AB6A 3O2AA 5H8HA 1HSJA 2ZXJA 4F1VA 2E0SA 2XKPA 2EV6A 4U1ZA 3K0LA 2AL5A 3GFLA 4WXJA 1LGBC 4DZ1A 2OWSA 2OZZA 1TQMA 1Z05A 5BPIA 2D1VA 3PPOA 5L9MA 5ICFA 2HS5A 1JW4A 5H8NB 2DP8A 4LK0F 4QFLA 1Y20A 3K4UA 4R73A 4GO1A 4O5VA 1ODDA 5D5WB 2F5EA 2JPCA 5FFZA 2E7XA 2YPNA 1P4WA 1W7PA 3GZGA 5DUIA 4RAYA 1XGOA 2O7UA 1KGSA 2C6YA 4Q30B 2H98A 4RPNA 3CG1A 1A99A 3QP5A 3H7MA 1JHHA 4HA8A 4R2FA 3B6QA 3CJNA 2F78A 1W4MA 3ABTA 3M9AA 5J8CA 5TJJA 2DTRA 1J75A 1MDMA 2VBZA 4HYEA 2M45A 3Q9VA 3GXAA 2ZYMA 4NTLA 3V8XB 2HQNA 4BHCA 4QSEA 5ICQA 5IKBA 2HGCA 1P6RA 2RGVA 4JQFA 3IL1B 2NRAC 4I1DA 3I59B 5A2QK 4FIMA 2V3TA 2O1LA 5AE4A 3T8TA 3AAFA 2VHAA 1QJMA 1QZZA 3SQNA 2F5DA 1MPDA 1LAHE 2F97A 1DPUA 1ZAOA 2PJPA 4R79A 5JK4A 5I84A 1YAEA 5EEGA 2ETHA 1JEUA 4O3CA 4BDOA 2WC2A 4KMFA 1ZARA 3P9KA 3JSPA 1WWXA 3ROUA 2HQRA 1RYXA 1LAFE 2M87A 1G3WA 3BY6A 2YJPA 1HW5A 2Q8JA 1P1QA 1C0WA 2HR3A 1DOTA 1OQGA 5BPDA 1KQ8A 3K1NA 4DCXA 3P9CA 1N04A 1W5SA 2EA2A 4JSOA 3EHTA 2EA4A 3QU3A 2DK8A 1M5EA 2I49A 1TFAA 1H76A 3TODA 4TV7A 3DP8A 3TTLA 3I0TA 1FP2A 1MG1A 5EHMA 3DQVC 5E17F 3LSWA 3PUYE 2JRTA 4P9FA 1YTYA 1MM6A 5EYFA 3MFKA 1MRPA 3HO7A 1IUYA 1Z7NE 3C1DA 1DPRA 1N3WA 1MGTA 1AMFA 4AVPA 3WTSC 3JTGA 1IN8A 3H3UA 3O29A 3ZS6A 3PUXE 5L8DA 4ZDMA 3PUVE 3B73A 4KD5A 4XKRA 2E7WA 4KHZE 5D8LB 1LEBA 2AL4A 5AA2B 4N0BA 4IO5A 1SFXA 2PQ8A 2ZKZA 4ELPA 1EH7A 2UVJA 1ZTYA 2D3IA 1R1VA 4CHUA 4I02A 1IEJA 3UIFA 1Z91A 1FYLA 3IB0A 1UTBB 2ZNTA 2RCAA 1GVJA 5ICTA 1EV7A 3HHHA 3FASA 1MXZA 1FYKA 2K02A 3EYYA 4G6DA 4PDKA 2I0BA 1V3FA 3WGIA 3FWEA 3HV1A 4A5MA 2PBWA 1TTYA 3BZ6A 4L9NA 1FBSA 3TO7A 3MAJA 2X26A 3W9VA 3KEOA 3MWMA 3MAMA 4OU0A 5F1QA 3TDJA 5A2QZ 1LDKB 1RZ4A 3ZMUA 4ISUA 4ESBA 1B7HA 3BROA 3KP5A 3FD3A 5K5RA 4A6EA 4RGRA 4F7ZA 1SAXA 3ZMVA 5D5XB 3V5AA 4I62A 3U93A 2DE4A 3OO6A 3FVKA 1PB9A 2ZYNA 5DTBA 4EJWA 3G3HA 1IXIA 1Y3QA 2DE2A 4CO8A 1ZG3A 2ZMEA 4ZYGA 4DQ2A 2FA7A 2D1HA 2O7IA 1KQ9A 2OWTA 5KDTB 3WTUC 3FMSA 4HS7A 4F1YA 3HCQA 3QPHA 4DXUA 3B6TA 3FIRA 2DO7A 4PFYA 4A0XA 2MLGA 4BXUA 1RNLA 1Y3NA 2Y0MA 1T0KA 1O7TA 1ZIUA 5I57B 2FF4A 3DXJF 2I58A 3U1OA 1XCVA 2I4BA 4KICA 1SD5A 3HSEA 2PEXA 4PZJA 5HS9A 3F8BA 3ZMTA 4RJZA 1TQPA 3QP6A 1IXHA 4R6HA 5CC2A 1UB9A 5IT9K 4OHNA 4ENMA 2I3WA 1HQCA 4UACA 5H8NA 1U6GA 3IOVA 5LHIA 4MEXF 2QQAA 5K5OA 3WU1B 3OXNA 2DS9A 3IJOB 4U21A 3TTRA 1P99A 1JEVA 2K27A 4OINF 3U72A 4ZE9A 3H03A 3ML6A 1MY4A 3CFZA 4MF3A 4FORA 3CO7C 4EJOA 1P4AA 4FATA 4JXIA 5I58B 2WV0A 3MZYA 4M73A 1FTOA 3HSRA 4BQAA 4L9VA 1KQ0A 1SQYA 2VOPA 4THIA 2XXQA 4WCGA 4AB5A 1FY7A 2FBKA 1LEAA 5L3CA 3H6TA 1O57A 4M1VA 1BIYA 3A3CA 1OPCA 1IN7A 3I59A 3SZTA 3TQNA 1JVYA 2DAOA 2O8XA 3KN7A 4IY6A 5FD5A 2R3SA 5DT6A 3I5OA 1ZGAA 4A12A 3RYPA 4MH5A 3ZN0A 4FAJA 1MH3A 1B3GA 5HS7A 4OIRF 3R26A 4IRGA 4LZ8A 3MZBA 4YKKA 5LRSA 3CVGA 3MC2A 1PB7A 4P0GA 3VLUA 3FHZA 4XKPA 4KNYA 4HX8A 2QMWA 2O51A 4BDLA 2CQKA 2XAJA 2ONSA 2K4JA 1U78A 3F11A 1QUKA 2RDPA 3B7DA 3LSTA 2L54A 3L00A 3WU0A 3ZQ7A 5FD6A 1B6HA 5I2KB 4YMBA 4P0IA 1SD6A 1WSUA 5JEIA 5CBRA 1ZLKA 2FRHA 4O3MA 2F2EA 1HBXG 5E1WA 3HTSB 1G3SA 2A61A 2L4AA 4F3GA 3KP3A 2LNBA 2FNPA 1ON2A 4H5GA 4U4XA 4EM1A 4NE4A 3KLNA 5AA2A 5AIQA 4OMZA 4TLLB 3ZMZA 4ESJA 2R7DA 1XB4A 1ZH5A 2P6SA 2HFBA 4OIQF 1UTBA 1Z9CA 1MJBA 3MEXA 3SESA 3DF8A 3C34A 2STWA 4ZS9A 3BPVA 5I59B 1NFTA 4U1OA 3C32A 3KE2A 1GTKA 3OO7A 1A40A 3OSQA 1K7AA 2BEOA 2Z23A 1FT9A 1B4HA 5FFXA 4BH9A 3RDIA 2K86A 2DT5A 4XKQA 1EH6A 3CO6C 3PPPA 2JT1A 4BAYA 1IF1A 3K0VA 4C1UA 2XAGA 4YKPA 1L3LA 5CI5A 4G94A 4I0AA 4LFUA 3KEIA 2ZXTA 3F23A 3O66A 2GIVA 4LK1F 1M5CA 4U22A 2Q8KA 3HHGA 3RNNA 4UVAA 2DFIA 1K78B 1SW2A 3MP6A 5AA1A 3ECHA 3R7XA 1EZPA 2IEEA 2Z9OA 3SEYA 1AH5A 1JHFA 1OKRA 2RV8A 2J5OA 1S3JA 2OLBA 2DW4A 3SERA 1EZOA 2HYGD 2THIA 2IT0A 4X48A 2VGQA 3QXMA 3WTTC 5KDTA 1R58A 3UORA 1M5BA 3SFZA 3KEQA 4OXVA 3N6TA 3GBBA 3J81K 4LQ2A 4S04A 1Y1MA 1P1OA 5I57A 3F8MA 4LMYA 1YO5C 1ANFA 5HLIA 4BLAA 4QSDA 1UIVA 3DM0A 1SFUA 1Z1DA 1RIOH 1HSTA 2MH9A 1SD7A 4NB5A 1J59A 3GF2A 1Z7ME 1T0FA 2XASA 1SVXB 3EHSA 1YW7A 3HSTA 3L2CA 2QSXA 4EF2A 1RYOA 3FM3A 2NUVA 4FEDA 4LB6B 4AIJA 1U5TB 3KP4A 2LDUA 2DXRA 2EFWA 4ZH4F 4JDFA 2YLNA 1QVSA 2ZNZA 1XT8A 3PUWE 1AOVA 3H92A 4FJPA 1Y1ZA 5KK1A 5I58A 1ZJLA 2XHKA 3LA3A 1LFIA 2ZYKA 2AIXA 2H6BA 2PYYA 1BTJA 3UA8A 3T8RA 5LEKA 2HEOA 2DWIA 3JZJA 1AWCA 4I9DA 3LSLA 4N9HA 4Q47A 1XN7A 4HF2A 1MY1A 1O7LA 2FMYA 3VVDA 3F8CA 1LLSA 4RB0A 4HQMA 2ABHA 4M6YA 3P7IA 2QQBA 1URDA 3QAXA 1FW0A 4B8XA 1XGMA 2MC3A 3LUYA 3K2DA 2Y75A 4U4SA 3KFWX 3QUFA 1T2KA 2BV6A 2L02A 4OYVA 4QRZA 4WWCA 1MZBA 3WE3A 1TXFA 4GIZA 3R4KA 3JTHA 1UQWA 3K02A 2XX9A 2Z33A 3KZGA 3NEUA 4IHSA 1WRJA 2BGCA 2LF8A 2DXYA 4IGTA 2QJEA 1USTA 3N94A 2P8TA 3LQRA 4XKNA 2A5TB 2QPQA 3C9HA 1SDXA 2KJBA 3SEUA 2A5YB 2BE5F 2Z8FA 3I71A 4EMSA 1B59A 1XMKA 4RB1A 5F1RA 1MXUA 3M3KA 2RNJA 5FTHA 5I2KA 4PP0A 1F4KA 1D8JA 2UVHA 3EF7A 4JSDA 3LBSA 4MQVA 1Q1HA 5E1ZB 2I4CA 4F3PA 1IXGA 2ZJ2A 3HPIA 2O68A 5L3GA 2Y7PA 3IOUA 2DVZA 3Q29A 4Q0CA 1H44A 3I58A 4OENA 2FBHA 3VVFA 3RJPA 3HHFA 2A5SA 1L0OC 1T38A 4L0YB 1I6BA 3MVZA 3C33A 1POTA 1S7AA 3OSRA 5AA4B 3J80Z 3PPNA 3UP9A 4FECA 2QYOA 2GFEA 1FSEA 3RT8A 5ERIA 3U8QA 4I8CA 2PG4A 2XXVA 3GLBA 2EWNA 3IWFA 1BN5A 3WAEA 3GXOA 4GXOA 5F7VA 3PPRA 2UXNA 2VD3A 1RUNA 3F72A 2OBPA 3OOAA 2O1MA 4X9TA 2YSRA 3F21A 4EF1A 3H3GA 4NF8B 3Q28A 3GO5A 5TRDA 1DMBA 4O3BA 4IO4A 3LFKA 3CLOA 1IIWA 1Y9UA 5LBQA 3P9IA 1FQFA 1MXVA 1L5TA 3VLVA 5DVFA 1GGGA 3EQLF 2F8DA 3RPWA 1R22A 1K78A 4KN7X 2O69A 4HBLA 5CVRA 2REJA 2FNAA 2K7LA 3TZAA 3FXUA 4G68C 5CM6A 2GHAA 1FQCA 4IO3A 3RIRA 5FLXZ 2HXWA 4ETSA 1B05A 1BKAA 2F7BA 3QIMA 3V4GA 1TT1A 4G2ZA 1FX7A 3CIJA 2XVCA 1T6SA 2UVIA 5J6XA 5TPAB 4OQOA 1P1NA 3ZMSA 2XX7A 3ZPLA 1FBQA 3G3IA 3MVYA 3PMXA 1LBCA 4E0WA 2V84A 1XMAA 3USDA 4G9YA 1BP5A 2NNNA 4KYEA 4MNUA 2QBYB 2H27A 4ONYA 4RXLA 1OIBA 3KGCA 5CVVA 4PQJA 1U3EM 3JSOA 5DUKA 4YB5A 4M9ZA 4IXAA 1LCFA 2OD5A 3FF5A 3G3JA 2V1XA 4R9GA 1SMYF 1MY2A 1U5TA 4NF5B 1JETA 2X7QA 1RUOA 3L6GA 3PV0E 3WAFA 2G9WA 4H6DA 3TAJA 4HW0A 3IB1A 1EZ9A 3K2ZA 2YPRA 4ZEDA 2EFQA 2DWJA 2EFNA 2RVCA 2CZLA 3R61A 5IAIA 1UIUA 4IO6A 3M3LA 1KU7A 2XXYA 3KETA 4HX4A 1LFHA 1RKMA 1IXSB 4RYAA 4OMBA 1H45A 4KYDA 4P55A 3H06B 1O7FA 1Z6RA 1OYWA 3MZHA 3EYIA 1HW1A 2KIUA 1T39A 3MQ0A 4HAMA 3TO9A 2XHDA 3I5UA 4IF4A 1DP7P 3RLFE 3KP2A 2QZ8A 3DV8A 2R6GE 1DDNA 1FQDA 2JZYA 2NYXA 2H09A 2NWJA 4YFXF 2DBBA 2V6CA 1AL3A 3FX3A 2W85A 3C36A 3ZKLA 5I2NB 4Q8RA 3KOSA 3KN8A 3EETA 2XXPA 5LGTA 4M71A 1Q1KA 4LA9A 2A5TA 1YW9A 2DQVA 4NQWA 4YAHX 2OZ6A 3RI4A 4R1HA 4S05A 1R6ZA 1JE8A 1QZYA 3O2PE 2P1SA 4OMYA 3IWZA 5DYHA 3BKIB 1B1XA 1YYVA 2GQQA 1R9LA 4Q48A 2L4MA 4XSZF 4F2OA 3TOBA 1FPQA 4JBAA 4MEYF 1B7UA 1H0MA 3KSJA 2KIMA 2OQGA 2PBIA 3OO8A 1FNNA 3V8JA 2UVGA 2V25A 4BDNA 5L9OA 4Y13A 4G7HF 3TTKA 1G6NA 1FWZA 1B32A 1ZG5A 1KYWA 1B9JA 3DEUA 1KWHA 3MBPA 1ZGJA 3G3ZA 2MD5A 3R6UA 4C1TA 1LVAA 4ZZLA 3GFJA 2STTA 3FVOA 5AA4A 1S7YA 4NEDA 4YZZA 2H94A 5JFRA 2ANJA 2VD2A 3O97A 3V7CA 5H20A 4H0WA 3KN3A 4WEDA 3IO4A 1BI3A 3CSGA 4H65A 4LLLA 3C35A 3IAZA 1XC1A 2UXXA 3FMRA 1USYE 2W25A 2NXOA 2F36A 2R9JA 4KDPA 3K1PA 4I09A 1ONVA 1TW2A 3IHUA 2UWMA 4NF8A 3MPLA 4OWDA 3RGYA 5ICGA 4YIIA 3TKDA 3KCCA 1SYIA 2CGPA 3QUJA 2F6GA 4I7HA 1Z6TA 1BI1A 4Y17A 1YLFA 3FGSA 4G77A 4DLDA 2X4HA 4RY1A 1XOCA 3S2VA 4HV5A 3VODA 2R7FA 1H43A 1XHYA 4OTEA 2ZNUA 1IN6A 3LAPA 4GF8A 3P7NA 1R5GA 5BMZA 5H6QA 1QBJA 2FNCA 2Z8EA 4AQ4A 2X7PA 2HWVA 3DFGA 2GH9A 2D2WA 4U0YA 5B70A 1YW8A 1QO0D 1ATGA 1D9VA 4WF2A 1YTVA 3CUQB 5TPAA 5LGNA 4OESA 4M74A 2XUBA 4Y15A 1FOKA 3EUHA 1JW1A 3RT6B 1TLHB 5ILSA 5IT3A 4H5FA 4XIGQ 1ZHFA 2IW5A 2IA2A 2QBYA 3TQWA 2IA1A 2O84X 3SDFA 1OYIA 1DUXC 1OQHA 1B9NA 4YIFA 2PX1A 3Q27A 4F18A 1SBPA 3RTFB 4BHBA 3WGGA 1VR5A 1F1ZA 2P7VB 3RTWB 4NF5A 2VC0A 3AXFA 3H3ZA 1HKSA 4JBZA 1PDNC 4HCYA 1H9TA 1BIAA 5FB2A 3GW2A 4EXKA 3K01A 3T96B 2F6PA 4RB2C 5J1DA 2FE3A 4EJUA 2XROA 4HV6A 2DLLA 3U94A 3E5UA 2O0YA 2F7CA 1GHCA 1PDAA 3K00A 4MTDA 1ON1A 3M7GA 1I1SA 2FOKA 4ZYEA 1HW2A 1N7XA 1OVBA 2Z8DA 2COMA 3RYRA 3ODBA 2XAFA 3PD9A 2A6EF 3TQLA 2P5LC 2M30A 2BBYA 1POY1 1HSLA 3MVXA 2IA0A 4LLGF 3RKXA 2Y7WA 4KMUX 2XAHA 3OELA 2EFPA 5D6EA 2HYFA 2EJRA 1S9TA 4OFLA 5HBCA 5I59A 3F6VA 2RKMA 4F22A 3T9UA 3KBRA 5EEHA 5E18F 3T0YA 3CDHA 2VBXA 3VFZA 3K6XA 1XGSA 2I6EA 3HOSA 1B4ZA 5E8IA 3IRQA 4RPOA 2K4BA 5I2NA 3T5XA 1CF7B 1NH7A 1FYMA 4WXDA 1VE4A 2QQ9A 4EJVA 2ONKE 4UNOA 3M8EA 2PVUA 3S9NC 3KZZA 3C3WA 1BJAA 1AIVA 2O03A 3R60A 3VB2A 2OBGA 1BM9A 4B09A 3U1DA 1Z7UA 2OAZA 4I01A 1DSNA 4RK2A 4DIGA 1LAXA 1NH8A 3SEWA 2WWYA 1BC8C 2QRYA 4MLVA 2IA4A 2XRNA 2XGXA 3TTMA 4FEBA 1B0HA 4OZ9A 4IY5A 3E6MA 3F8NA 4WXHA 5L3EA 4ZYDA 3UN6A 4F29A 1I69A 4ELOA 1LCTA 3QK6A 1W5TA 3GWZA 1US5A 2O3FA 4QHQA 3I54A 3SEVA 4RB3C 3TMGA
chains in the Genus database with same CATH superfamily
3SDBA 1TW3A 1JQFA 4PSWA 1RC9A 2DE3A 5E3LA 3CF2A 4HF0A 1J09A 1CQTA 2W7YA 2LKPA 1ZG1A 1VFEA 4XN3A 1W0TA 3GCMA 3E13X 2K9LA 3H9GA 1OISA 2FQ4A 2HTJA 3OYAA 1YJ9I 3HOXJ 4II3A 4MQ9F 1FBCA 4C0RA 3DPTA 5DEQA 4P47A 3WHCA 1Y0UA 4KA4A 3OSGA 2F7AA 2XXWA 4MJOA 1VQLI 1S29A 1OCOH 3PQKA 4U7DA 5DDGA 1FQEA 1URGA 2H1LA 2Y5KA 4GXSB 2MW8A 2B65A 2ZFWA 5J4VA 2M2EA 3F0CA 1V54H 2Q2EB 2X85A 4CICA 2XWIA 1NNPA 4N13A 4XRMA 5HNFA 1PUFA 2FEZA 1NV5A 1WJCA 2COBA 4HOBA 4E70A 1SFKA 4R75A 2NS0A 4HF1A 3TCFA 3JRGA 4EV0A 3GYHX 4U2RA 2NVQJ 5LOMA 4Z2YA 1LB9A 4XORA 1FIPA 1I1GA 2JN6A 3WODF 1UJ8A 5HDGA 2E2HJ 1O3RA 4WK8F 1MMNA 2M4KA 2GRVA 1MNEA 2QQ8A 2DQRA 3TUSA 3ONQA 3V7RA 5AIPA 3K69A 1UHSA 5L3DA 3CP2A 3V7SA 4OERA 3VDFA 4UXNA 1D1BA 4O3AA 3CJQB 3KSXA 3FK7A 1HCRA 4EJTA 1VQ7I 5KCJB 1NNTA 4L9JA 5LRRA 1APLC 3FHNA 2AYSA 2RINA 3I3LA 2NOJB 3ZQQA 1TFDA 3SHFA 1FTMA 1FCKA 1MQDA 2YU3A 1LBXA 3HRMA 2PN6A 4AD9A 3GTJJ 3FXQA 4ZYAA 3REOA 1MY0A 4ZDOA 1SPIA 3EQ1A 3C4MA 3MQ9A 2Z99A 2QWWA 3GBGA 2VONA 3OMYA 3MJNA 4XEQA 5HVQC 2VI6A 1HLVA 1U9OA 1X3UA 2FBIA 3CUQA 5D5UB 3FVNA 2IS1A 4E7SA 2RKHA 3GLXA 4FX0A 4NDLA 5IYCJ 2QS3A 3MP1A 1Y6IA 3VXBA 1WH5A 1BOAA 1F9NA 2DYRH 5K1YA 4ESWA 2ISZA 4UA8A 3QU6A 3O9PA 5F1JA 1D0ZA 4C3HJ 3L09A 4B1RA 4G8MA 4ZE8A 3K4JA 4JOMA 5BWJA 4NUBA 1IJWC 3S3NA 2XXIA 3A09A 3ZSFA 2MLKA 4FTHA 3HYIA 3P5JA 3RZDJ 1YCJA 4JX4A 3GFIA 2R5YA 1FSHA 2D5WA 4O8MA 3W9WA 3GX4X 1S72I 1CGPA 2ELHA 4OFJA 1GR2A 1LBBA 5BOXA 4PFOA 2V1DA 1BK4A 2HZKA 2O6AA 3S1RJ 4Y3OA 2PT1A 4WKMA 5LTCA 1EH8A 1Y8RB 1JKRC 1UAAA 3E3VA 1VFDA 1I6AA 1REPC 1P1UA 4A0ZA 5D8KB 3HUGB 2IGMA 3GTQJ 1IRGA 3THIA 1N7WA 2HAVA 4XSXF 2HEUA 4PE3A 1X3ZB 3HBLA 3DLAA 2A68F 5LGUA 1USYH 3VYTB 3E6DA 4IO9F 2RCBA 2E1CA 3G7WA 4BXFA 2DFEA 2LRDA 2OCEA 2ZB9A 3TMOA 3PUZE 4L17A 1B9MA 1F5TA 4H1XA 3N26A 5ILUA 4GWZA 3IJXB 3J80K 3MZ1A 1I3AA 4GGGA 3ZMDA 3AG4H 3SXYA 4P5OA 4U87A 3H5AA 1EYKA 3TOAA 1JKOC 1A35A 2GA1A 2RC9A 3I3VA 1D8KA 3WE2A 3MZ8A 4HQEA 1XS5A 2CZIA 2QVRA 2PJRB 3MPKA 4EUOA 2VBWA 1N3XA 5EYHA 3I4PA 2YX4A 2EH3A 3S1NJ 2GIZA 5DCMB 2CSOA 2G93A 1A8EA 5T3JA 3W15C 2P5VA 1BJZA 5JR3A 4XL9A 4JVDA 1K61A 3LA7A 5DVJA 5J16A 4JYKA 2QVOA 3IORA 1O3SA 2H99A 3FXKA 1FTZA 2ICWG 3IUOA 2UZKA 2AXTC 3E4RA 1NUXA 3V42A 3D4CA 1PYVA 4NHBA 3LQQA 4GFBA 3RPLB 4GRKA 1P92A 1R5HA 1YQAA 2V93A 5ITOA 1MD0A 4LP2B 5L3FA 2A5WA 3OOPA 1CF7A 1HKTA 2JA5J 3ABUA 1MBHA 2Y7KA 3CMEI 5M5XJ 3FXMA 4BE1A 1RKTA 3V8KA 5IYDJ 1JW5A 1QW0A 5DW8A 3HSFA 1J0RA 2Y0SN 3C31A 5BQTA 3K6UA 1YX5A 3L6HA 2DFFA 2HCAA 2VOOA 3BTJA 2VE9A 5CVUA 1FMVA 5EYRA 3IL2A 4LD5A 1TQIA 3I53A 5ICEA 4IVNA 5FLXK 4PJLA 4DYRA 2EZHA 2B9SA 2CW7A 1SYHA 4IRHA 4PBQA 5L9SA 2XKOA 2ZBKA 3CCYA 3CI8A 2XC7A 4N8YA 4A2UA 2LF7A 3QSLA 1VI0A 2NOGA 3VOEA 5E1XA 2H9BA 4EDPA 1WPKA 3BOQA 2WYPA 4EQ9A 4A0YA 2MGQA 3TEPA 2ZC2A 4LIVA 3U92A 2HVQA 2YX7A 4D0PA 2DWHA 1BIBA 2V1UA 4LIUA 2ELKA 2HQ0A 2XGEA 2A07F 3OD7A 3RUMA 4ESFA 2M8EA 1QUIA 4FE4A 5CVIA 2QVUA 1AU7A 3G71I 4ZDPA 5EQAA 4OAYA 2HYJA 4XM3A 1KU3A 1B5JA 1FPLA 1FTKA 3BP8A 1BC7C 3ONMA 4XKCA 4LQ5A 1A7LA 1RDZA 4EQ7A 3MP8A 1PB8A 1WI9A 2BY0A 2HFHA 2LR8A 3MWBA 3CSBA 2LP0A 3T66A 2CFXA 3BPXA 2OQRA 1PP7U 4KFCA 2RC4A 1UFMA 1OYYA 1A6QA 1NI9A 4RAFA 2X0LA 1S50A 2Q2EA 4GLIA 4KPTA 4QWQA 3UR3C 1KU9A 4QF9A 1B4AA 1FOWA 1HSEA 2F5XA 2HXIA 2HQ5A 4HE2A 2BVMA 2EV5A 4KIGA 3A02A 1MNMC 3E5QA 5GTHC 2GLOA 1TNSA 3MUQA 2XV4S 3FJGA 4X1DA 3OYCA 1KONA 5FKKA 2P7CB 3S1QJ 1SMTA 3OS1A 1TWYA 2HTSA 5LHGA 3PO2J 1NG6A 2G7UA 4J19A 2OV7A 3DLNA 4L9TA 2Y84A 1XG1A 2BXYA 2KJCA 3M8JA 3I55I 3Q5FA 4XFEA 3TCHA 3QPTA 3DP7A 2L7MP 4X1EA 2BVLA 2X1CA 3RPUA 4XRFA 1IN5A 3L2QA 5FRMA 1FC3A 2I48A 4MLQA 1TWGJ 4NWCA 4QFOA 3KP6A 4R6KA 5TU0A 3ECOA 4IRIA 3IRRA 1OMPA 2DOJA 4N15A 1SW5A 2QCOA 2XXRA 1OMIA 3A0HC 2O6GE 4LZ7A 3G3FA 2XXHA 5EQ9A 5KCJA 3TKYA 2MYSA 4MTEA 2OJTA 3GZ5A 1MXXA 2E71A 2LK2A 4CA0A 1IITA 4IO2A 5DCFA 3PD8A 2Q8MA 1ZMGA 3JRHA 3TELA 3SDGA 1I5ZA 1TWHJ 1G0HA 4RNSA 3RKWA 3VSKA 1FPBA 3BFTA 2VT3A 2H25A 4R6YA 1P9QC 2XF6A 1LAGE 3JR9A 3EPEA 4G6TB 3TFLA 2JSCA 3FMQA 3K4CA 3Q0WA 3W6JB 2Y9ZA 2D45A 2EK5A 2R4GA 2CEYA 4ZYHA 3U65A 1R9QA 1LDDA 1EYJA 2CZHA 1PP8F 2ZXWH 5M3MJ 4N81A 3O6BB 3PNTA 1FJLA 2B3BA 2L3DA 2QM3A 2OU2A 2K3PA 4Y7NJ 2XXUA 1XDSA 3IK6B 4LZ5A 4RA1A 2V9PA 3HIFA 4JK1X 1IV8A 5GPAA 2Y48A 3GTMJ 2D21A 3QYFA 2Q2AA 2FOWA 4KIFA 2V4CA 2GWRA 4E7ZA 1R71A 4DYQA 1G8XA 3K4NA 5KNLA 2QENA 5EJCA 2I5UA 1DK4A 4A6DA 4IJAA 1O3TA 4XRSA 4Z7EA 2ZMEC 3L2WA 2Q2CA 3S15J 2Y7RA 1ZKBA 3J7ZI 3C2HA 4A3IJ 4FASD 3OYBA 2VQLA 4G68B 4MCOA 4IB2A 3SEXA 4BDQA 3IKVA 3BJ6A 1SD3A 1VQMI 2G7HA 2ISYA 2O7OA 2CZKA 4HLYA 4Q5TA 5CMBA 1YIOA 5F64A 5DD4A 4G12A 2UYFA 1SVMA 3FM5A 3OL3A 3HJEA 5HPQA 1PBPA 5IYBJ 4O7IA 1MBKA 2VBYA 3HUGA 2M5WA 5CMKA 4G4PA 3CHGA 4PTKA 2IS2A 4EQBA 2IJLA 1B1BA 5C4JJ 3BBRA 3OMBA 2W4SA 3LV0A 4H8IA 3FV2A 2DMQA 3N97A 5DD8A 4XQFA 1ETXA 2ZO4A 3UGWA 5ISUA 4XLNF 1S7OA 3BR5A 4LOCA 2W1OA 5FO5A 3OS0A 4R9FA 2DI3A 4TQUQ 3L9FA 4NWDA 3VV5A 1WFXA 4GCVA 4OEUA 4KIBA 2PJRA 5FKMA 4PE5B 1P2FA 4A5NA 1ZLQA 3Q26A 5GPCA 2PMUA 1K79A 5ILVA 5DCMA 3ULQB 1Q35A 3I4MJ 6PAXA 1DGWY 4OEVA 1IQ7A 3TDZC 2W7NA 1FBUA 3GFMA 1ETKA 1O64A 1R7JA 4K2EA 2R71A 4MFEA 3I6VA 2P0SA 3HRSA 1VTNC 2Z5UA 4KI0E 3AG1H 1W5CC 4BU2A 5LHHA 3BG6A 4A3EJ 1CE2A 4IO7A 3PGFA 4NC6A 4ESXA 3RPLA 2DMNA 2XPUA 4U88A 4QFPA 3RTRA 5H8FB 2QUFA 3R0AA 3OYFA 1K6OA 1ULYA 4IHTA 3M8UA 4N6PA 5EF6A 2GM4A 1G59A 4YG2F 5J4YA 1B46A 1US4A 3KFMA 5FKOA 4GWOA 2Y5LA 5A5LA 1PBQA 3RKYA 1BI0A 1XCBA 4CYDA 5ET6A 4F2QA 1LQ1A 3VFJA 2WYKA 1U8BA 2GXGA 3QOEA 4M4GA 4NF5A 5ITPA 1HA8A 3E6CC 1IXRC 2MSYA 3N4MA 4G7OF 5D4SA 1QVTA 3O6GA 4I76A 4BHPA 2MC4A 5JTYB 4QFNA 4HSTA 4FX4A 3JREA 4DCYA 3D5LA 5E20A 2IVMA 2DA3A 1G4DA 4OAZA 2CQQA 3K4MA 3W2AA 3D1NI 2VC1A 3RQTA 2HPMA 3QOPA 1Y56A 3E1SA 4GOTA 3CFLA 1NMUA 3KJTA 4DE8A 1LB8A 4MIJA 4M72A 1INPA 1QGXA 3H4ZA 1X2NA 4FT8A 4EM0B 3LNQA 2P6TA 2A6HF 1IN4A 2IP2A 4B47A 2VXZA 2F35A 4KUMA 3OYNA 3RPUD 5AA3A 1V5GA 2A3SA 4F92B 1MDP1 3L7WA 3LSFB 4LONB 4LVQA 5I5PA 2IPQX 4YKJA 3CCMI 2VLAA 2DYSH 3M3YJ 1XMXA 1MBEA 2MFZA 2PX9A 2CMOA 1LBWA 1U9NA 3OYEA 3QYTA 3H9JA 4RAZA 1MKMA 3OS2A 4E7JA 2GQ1A 2E60A 4OVJA 2ZNSA 4YB7A 1Y3PA 2VJ4A 4YIRX 4C2TA 1K4SA 4ASNA 4YELA 3V8LA 4O6JA 4PGHA 5HS8A 3KC1A 3O28A 3M3FA 2F3DA 4N17A 3PM1A 2B3FA 5IZ1A 4F3BA 5HM4B 3MKWB 1ZRDA 1SVOA 1JNFA 4OIPF 3E3KA 5HOOA 2Y2ZA 1B6AA 2FUG2 1VQNI 3IX1A 3BFUA 1GV8A 4IOCF 3JYRA 2VN2A 1A55A 1B40A 3JW4A 3IC7A 4U0WA 4RK9A 4PFPA 3FATA 1VF9A 2D5VA 3GTLJ 2NVUB 1Y0NA 1QZEA 5HNHA 2HDCA 4G6QA 3VYUB 4GWYA 1XS9A 4HW8A 2M34A 2X6YA 1B72B 4PETA 2F3BA 2KKOA 3W6VA 2GBYA 3IB2A 3J7YJ 4OVTA 4PFUA 3FXLA 1PEBA 5IP7J 1AA7A 3E6BA 4XXUA 1M1EB 3BWGA 5I56B 3LC8A 3NQOA 3BQYA 1RPWA 4YFKF 4YB6A 4PSXA 4Z0IA 4UVCA 5A5XB 4P1EA 1ZRFA 1W36D 1ELJA 4HTGA 4PBHA 2RF1A 1SC7A 3JAMK 4L0ZB 4AIKA 2VUMJ 3UNGC 2ZZVA 2DK5A 1G3TA 3CC7I 1SD4A 3ILUB 3N5LA 5E79C 5DEXB 5H8SA 3RZOJ 3FXJA 4ENNA 2DU9A 1U8RA 1K9ZA 3ZR8X 2VE8A 3HTUA 3KOTA 4LG0B 1B3LA 3KZYA 3H6WA 2PFYA 4GWSA 3F3XA 4PJJA 5B1BH 4O7MA 3ZQGA 4IHXA 5FHMA 2R7WA 1STZA 1YOVB 2JPBA 4M9XA 3W6KB 3KJ7A 4GXAA 1H3DA 2LSOA 1OCZH 3GUDA 5J3LA 3WTYC 2EFOA 4JVCA 4XLHA 1JJ8C 1CB6A 1LBYA 5DM7F 1LB2A 1VNDA 1YG2A 3QAHA 3OO9A 3OV8A 4F3QA 2KLOA 4F19A 4ENJA 1FQAA 3PNYA 4RGUA 4BNCA 2XXTA 4RGXA 3H6UA 2JK3A 4HXVA 2M9HA 1QKAA 3ABKH 3DWLE 5ED4A 4F1UA 4KT6A 3E5XA 4G8NA 1WDNA 3CUQC 2CYYA 1YFHA 5DTDA 4X0GA 1IO2A 1P4XA 1S6LA 4B48A 3CESA 3PUFA 1E17A 1UCRA 5K2XA 2V3QA 3B02A 3L2RA 4YMAA 3CDIA 2NAZA 4G68A 2EB7A 4ZEKA 1WKMA 3FK6A 3ECRA 3JRDA 3TTNA 4AU7A 1SI1A 3H6VA 3BIHA 1GXQA 1I6QA 3O6HA 2FD5A 2ZMBA 2Q8JA 3T9HB 4I2OA 1HF0A 3PFIA 3Q9SA 1N78A 2FMLA 3BJAA 4G61A 4L5JA 4ZEBA 2IGOA 1W7PD 2VKHA 2Y7IA 4P96A 4OOIA 2R8TA 2EIJH 1IV6A 2ESNA 5LLQA 3PMWA 2QFLA 5I3SA 4XTCQ 4P9UA 3WTXC 1IG7A 2E1NA 4AWXB 5IPAA 4EGYA 4A3CJ 4POXA 4G8HA 3TQLA 4DDDA 4CH7A 1MJ9A 1EH3A 4N07A 2TCTA 1FPFA 1XVXA 4BJ5C 3D4GA 2ME0A 2FVZA 1JXSA 4RDUA 1FZPB 3A3UA 1B58A 1M5FA 2OCUA 2CQXA 3ZP5A 5FLVA 4M3FA 2ONRA 1V4RA 5FHOA 4IQ4A 1FTJA 3MW0A 1B1HA 2E19A 2ZJQF 4JWXA 4QSCA 1RKWA 3M1EA 3F6OA 4DBRA 4GD5A 1LFGA 3IKTA 4ZZEA 1TWCJ 4XN0A 3ASOH 3D0SA 3WTZA 1UTHB 3FJ7A 2QS2A 1B2HA 3JV9A 4DYCA 1PUEE 3R6SA 4ENKA 3G2BA 4PCQA 4WX9A 1Y4CA 3S9EA 2PMHA 1SI0A 2L9VA 1HKQA 1RETA 2CW0F 3VVEA 2EV0A 3D5SC 5DV5A 1XVYA 1NNFA 5H8FA 3JAMZ 1R9TJ 1ETQA 1TBXA 2KL4A 1D5VA 1LJ9A 1JGSA 1N76A 4YU0A 5ET8A 1OR7A 2IGNA 2VPLA 2CFOA 1WZ2A 1FQBA 3DKXA 1RDYA 5J1RA 2K9MA 3ISPA 3HZJA 4CDGA 5CMCA 1DPPA 4NNJA 4DGWB 3CG3A 5L3BA 1YIJI 3UKGA 1AOYA 3ZGKA 2Z22A 1IZ1A 1MQIA 3FISA 4JB7A 1E2XA 1V55H 2ZCWA 4P11A 1B7ZA 5E3MA 3SKPA 1DTZA 3LSPA 3DKWA 2OK2A 2QVVA 5JTYA 4QLCU 1J7KA 4UABA 2VT2A 1VQOI 4JWOA 2FYIA 2Q88A 4MFIA 3PSFA 2OZUA 3T93B 3EPZA 1LNWA 3DP4A 4BYYA 2GOMA 1J1NA 1M5DA 4P1LA 1J9IA 3WTVC 1FBGA 3ILTB 1MJAA 4GQOA 3HRUA 2HKOA 1WHUA 3TW7A 1I6XA 4G7ZF 3GZNB 4OIOF 3J7AY 2F34A 2LREA 4XBFA 3AKZA 3VXCA 4NHJA 5H8QB 3F22A 2R7VA 4G8XA 1Y8QB 3G1OA 4BE2A 2O61A 1SFEA 2J5PA 3KYLA 1JGGA 5JVTA 2ALUA 4X04A 2HXRA 5GTIC 5J8FA 1ZLJA 1T8IA 4EVIA 1XSVA 2LBFB 4KT5C 1MXYA 3HOTA 3FXRA 1NTCA 3OEMA 4IGRA 1YITI 2LG4A 1XSXA 2DYXA 2V9VA 3AFHA 1BI2A 1B52A 2V79A 3FDYA 4AIHA 4GYIA 4ABZA 2VODA 1Z3YA 1Y4TA 5K7FA 4U7BA 5F6FA 2B0LA 2Z3YA 3HG9A 3LSRA 4ZTFA 1H89C 5FTIA 2OPTA 1R5ID 2CG4A 2AQEA 5H6RA 4Q4ZF 1QUJA 3CRBA 1G2HA 3IOTA 1QRYA 3OEKA 1XD7A 3HDDA 2XD3A 4OVRA 4POWA 2VKEA 1P7IA 1JUPA 5CYVA 1VQ6I 1OLAA 5KVRA 1F9BA 2DDKA 3MVWA 2BYVE 2JVHA 1MM7A 4YFNF 2DT6A 1YE9A 3K6VA 4R8HA 1IUDA 4KISA 2VJJA 2KQRA 1S7EA 2PFBA 3VYRB 1B72A 1DCUA 1PC3A 3IR1A 3ZOBA 2DSFA 2HKXA 4ZZAA 4GYGA 1BLFA 4R2BA 2CO5A 4TLMB 5I56A 4RS8A 3C18A 3UK4A 3TMGA 3HRTA 5D5VB 5JI6A 1IMDA 4ZEFA 2DN0A 2ID6A 3TYHA 4HLXA 3V83A 3SETA 1WVJA 4GDFA 4R72A 1GXPA 1VQKI 3G3KA 1KU2A 2DQLA 4W1UA 3TCGA 1X58A 4DW6A 5IT9Z 3RSNA 1IW7F 3IH3A 1ETWA 1NG7A 4H0EA 2DPDA 1IXCA 4H8JA 4EGZA 4BS9A 1FTLA 3GZ6A 3KLOA 3BR2A 4A3FJ 3LL7A 4D7MA 2KIFA 4PDDA 2ADUA 2XAQA 2HZTA 1HOMA 4RAGA 1NL5A 4UV9A 2HOEA 3T22A 3C7JA 5DEXA 4KJZA 4Q5SF 4N4UA 4GX3A 1ZN2A 3CTAA 1Z77A 4LG0A 3K2AA 4IHYA 3GTPJ 1VQ8I 4UY8I 5M2VA 4RGSA 4ZJZA 3H9QA 2ZFUA 2ECBA 5CBSA 2O8KA 2UYEA 2MH2A 3PMVA 1T98A 3G73A 3G3GA 3I64A 4MGRA 2OA4A 5FGMA 1AWBA 4HDVA 3CUOA 3QYEA 4IHWA 1KA8A 2QS1A 2DVCA 5D6FA 1YI2I 1JVXA 3S4UA 4N9IA 4BDZA 4LGWA 4U23A 5HDKA 2H4IA 2F5CA 1UHMA 2IBDA 1OLCA 4CXFA 4I3YA 1MS7A 1D9YA 1A54A 1GVCA 2RQPA 4IHVA 2XF7A 4L18B 4K3FA 3LSXA 3LSJA 2PI0A 1OCPA 4NF6B 5B7DA 1BBYA 5AONA 5HODA 3Q0UA 2QMXA 1W0UA 2YR2A 3LR1A 4YICA 4EQQA 2FIEA 3ERED 2CJJA 4I0BA 1ZYRF 5BUUA 2XXXA 1JTYA 5F0FA 4RM3A 5H2FC 3S3MA 1UG0A 1A04A 3OWTA 4F93B 2PT2A 4RLFA 1EU8A 4OFOA 4OETA 3U21A 3IV5A 2CEXA 2GZWA 3SEQA 3VDXA 2ZYOA 4NF4B 1ETOA 5DVIA 2QLZA 3OENA 4GL0A 3COAC 4KYSA 3RPQA 2VT5A 1UHWA 2CUJA 4EM2A 3I9V2 2XD2A 3CJTB 2FA5A 3ELKA 3QRFF 4I98B 3VEPA 4UUVA 3DTIA 3BT9A 4UVBA 2DWAA 3FVGA 3K6WA 1XDUA 4FCYA 4KFQA 4F31B 3HN0A 4ND9A 3FJMA 4BJTA 4I99C 1XX5A 1K4TA 5TP9B 1KYZA 2AS5F 5D4RA 2XX8A 3M8FA 5E8GA 4BQOA 3GTGJ 4GVOA 3T9VA 3B8BA 2CWEA 2UXAA 3RN8A 2WADA 3VLWA 4NBQA 3U2RA 2VJIA 4Z6YA 1U5TC 1YPNA 3TO6A 3OL4A 3OIQA 1J2XA 2KP6A 2NOOA 3U9GA 4JWYA 4I40A 2TDXA 3KEYA 1UTHA 4ANJA 4L5IA 3KZIC 1LVKA 3LA2A 1KA0A 3ZQFA 2R93J 2Q0OA 2VPNA 4CGZA 4BDRA 4DIQA 2HHMA 4U4SA 2KIQA 1ZU0A 2IRFG 5H8HB 5B5EC 1NH3A 1LBZA 2H6CA 3MD2A 4A3GJ 4AVZA 1O63A 2HZLA 4WEPA 1GDTA 4E0XA 2XDVA 2DA2A 2L7KA 4KN4X 5JLXA 3M4OJ 1LDJA 2KPMA 2MG4A 5ICCA 1FTTA 2PFZA 2E1SA 3CCSI 1URSA 3TDUC 4JVIA 2B4LA 3K70C 3C2GA 1WJDA 4A69C 5GAGJ 1G0IA 2P4WA 4P1WA 1QPIA 1XGNA 1NV2A 2MKZA 2H5YA 4PC9A 2DJNA 2XIGA 3OYMA 3HGYA 3HOYJ 2RN7A 4LLNA 2M1BA 1NV0A 2E5NA 2H8RA 4DNCA 5K5QA 1W7PB 1G3YA 1SW1A 4BUPA 2JUCA 4BDMA 2EZLA 5KHDA 3LAJA 4NX1A 2JA8J 1LE8B 5HLTA 5FHNA 1HXDA 3NRVA 4DOZA 3VE1B 5IP6A 4DXCA 4F39A 1BR4A 2M8CA 2ZSHB 2LMDA 4QPOA 5LEJA 5KZTA 4N4OB 1LSTA 4YKIA 2JMWA 1MDMB 2YJPA 4B4CA 1DU0A 1B3FA 4IOAF 1GV2A 5H8QA 2IAIA 4FE8A 3KP7A 4BE0A 2AO9A 1NK3P 3LWFA 5EHSA 4S0HB 1N0TA 1NKXA 1OCRH 1A31A 4LJZF 2DODA 3MCZA 3ERMA 1B3EA 3DCFA 1DPEA 3B6WA 2LBFA 3K1MA 4LUBA 2CV1A 5CMMA 1R1NA 2VPOA 1TNTA 2WTEA 1MQGA 1R1TA 5ESYA 2DA4A 1YS6A 2F5FA 2FSWA 3DBLB 2GXBA 5AA2D 2W57A 3JRBA 1WODA 3WHBA 1P1WA 5IZ3B 1ZRCA 4KYWA 5JHUA 4PFWA 2DMTA 3ZN1A 2FU4A 5DYMA 1MY3A 3LUZA 5CJ9A 3WGHA 1Z21A 3PQJA 3NOHA 2V4JC 3T1BA 2Q89A 3RY3A 2A69F 4X1BA 2KRHA 1DTGA 1WJEA 2P5KA 3PSIA 4CZZA 3GBAA 2MBFA 2EQRA 5JHFA 3CR9A 5HLGA 2PLYA 3GVAA 3CLQA 4KCCA 4R74A 2L5QA 1ZBMA 1JP4A 1MXWA 3E97A 4ON0A 2BJJX 2VP1A 4MBPA 4NGUA 1FPIA 1MPCA 1XI6A 1MPBA 4HZFA 3L1PA 4LB5A 3F8FA 1FP1D 3GLLA 5CLSA 3J81Z 1VSOA 2GA2A 1YS7A 4CCJA 2WKYA 4F55A 4U0VA 4FHTA 1Y1VJ 4C2MJ 1IAWA 2HVSA 4HRIA 4XLPF 1QQIA 1WI3A 4UB8C 1LBVA 2X48A 1D3KA 4UUSB 5ET5A 4ELRA 1R36A 2FXAA 1D3YA 4E6KG 3O3KA 2RC8A 2LFBA 4M9SA 2MA3A 2QGUA 1XSDA 4LATA 3G1MA 3GEZA 3SZPA 1VQ4I 1WQ2A 2B4MA 3PU5A 3T9XB 4F3SA 3IH2A 3G1LA 3BC8A 1K6YA 2DMUA 5GAEJ 3FZVA 3HOZJ 1ETVA 5HDNA 4XF5A 1B0LA 3ZKKA 2RC7A 4UV8A 2L01A 2W24A 3FUZA 4HSRA 4C3IJ 1NV6A 2PMSA 4IX7A 1SW4A 2ESHA 4CCLA 3DELB 9ANTA 1R00A 4PGGA 1I27A 1IGNA 2HQAA 5ELVA 2KRFA 4BQQA 3J7AO 1N84A 2ZNYA 4CCOA 3R0JA 2V26A 4XKBA 1R1UA 4MHGA 4BDYA 3ASNH 1LPQA 1MQJA 4CZCA 3CFXA 3DP6A 4TOZA 2F4MB 3TGNA 1B3HA 3BJOA 1B51A 2LYCA 3E9XA 3NWTA 5FBPA 3IOWA 3HFUA 2GHBA 3CDLA 3FBPA 3S14J 1KA1A 1OVTA 2AQFA 5CRYA 4NF6A 4ZEIA 3S2WA 3K9TA 3EN3A 4GL8A 1NHAA 3SZGA 2G29A 1ZREA 4UHTA 3WTWC 2NNYA 3WG7H 2R7UA 3S9LC 2QKMB 1F36A 1RI7A 2W84A 1HDDC 1U2WA 3GTOJ 3N6UA 2QA4I 5A5XA 4ZZDA 3FKJA 5HLHA 1MBFA 4PFTA 2R92J 2P2AA 3TPAA 4HE1A 1S5LC 2WY7Q 1MH4A 2GAUA 2LVSA 4HDUA 1D4NA 5CVJA 3H5RA 3BTIA 1MQHA 3PPQA 3CZ6A 4E7HA 1VQPI 1USSA 1WJBA 4XIDA 4M6XA 1ZR2A 2DPUA 2XAUA 3ZQCA 3LFUA 3EUHC 2ACJA 1B5HA 3FXOA 4W97A 3WG9A 2VOZA 3IO6A 1QULA 4MNCA 2BW3B 5JLWA 1FLIA 1QA6A 2Q9TA 1O3QA 2AXLA 2FJ1A 1MDQA 1QNTA 2FQ3A 2WB1A 4HX7A 2JTVA 3EDPA 4IPAA 1QKBA 5EQ7A 4PGPA 1QGPA 2QL3A 1LEVA 1IDYA 3ZXSA 5TP9A 1J5YA 4ELQA 3EHUA 3KPHA 1IRFA 1S8NA 1X2MA 3DPLC 2CUZA 2I0CA 4H67A 4NMYA 5BS6A 4QFKA 4EXLA 3FV1A 4B43A 1A8FA 4WXCA 2LAOA 3HGGA 2ZMEB 1R4NB 3O6IA 3PJRA 4H4KC 4KQPA 3KG2A 3MZ9A 3T0JA 2QS4A 4ECFA 1B5IA 3Q25A 4GWXA 1H9GA 2REGA 1RRJA 4D7NA 1TP4A 2FBPA 2HAUA 1QPMA 1TT5B 3BDDA 1II5A 2V3UA 2VJ5A 4HCWA 1R23A 4AB6A 3E0JB 2YU9J 3S16J 3O2AA 1NV3A 4XR6A 5H8HA 3H1CA 3TW6A 1HSJA 2ZXJA 2NVTJ 1IMCA 3S2DJ 4F1VA 4A3LJ 2E0SA 2DDAA 2XKPA 2EV6A 3H0GJ 4BEHB 4D5FA 1ZK8A 4U1ZA 3K0LA 2AL5A 2CH0A 3GFLA 1I39A 4IQJA 1RR8C 2F4OB 1IMFA 1LGBC 4WXJA 4DZ1A 2OWSA 2OZZA 3ABLH 4HNVA 1TQMA 5J47A 1Z05A 2M7AA 5BPIA 2D1VA 1JJ6C 2HPGA 3PPOA 5L9MA 4F52A 4HG2A 5ICFA 2HS5A 2K9SA 1JW4A 5H8NB 1X1CA 4LK0F 2DP8A 1Y20A 4QFLA 3IP4B 3K4UA 1WCMJ 4R73A 4GO1A 4O5VA 2V9KA 1ODDA 5D5WB 2F5EA 2JPCA 5FFZA 3OY9A 2E7XA 3BQZA 1P4WA 1W7PA 2YPNA 5DUIA 1PJRA 3DU5A 1OR7C 1XGOA 4RAYA 2O7UA 1KGSA 2C6YA 4Q30B 2H98A 4RPNA 4P8BA 3CG1A 1A99A 1YXIA 3QP5A 1EA3A 4HPQA 1LE8A 2L5VA 1FBHA 3H7MA 1JHHA 4HA8A 3SFIA 4R2FA 3B6QA 3CJNA 2XSDC 2F78A 4MNPA 1W4MA 3ABTA 4YRVA 3M9AA 5J8CA 2OTJI 5TJJA 2DTRA 1J75A 1MDMA 2KLFA 1R49A 1FEXA 2VBZA 1IRZA 4PUSA 4HYEA 4MNIA 2M45A 3Q9VA 5J1YA 3GXAA 3X2QH 2ZYMA 1FOYA 4NTLA 3V8XB 4RBOA 2OCCH 2HQNA 4BHCA 1JUSA 4QSEA 3BLYA 2QSFX 4V19K 4HE0A 5ICQA 4PAKA 5IKBA 2HGCA 1P6RA 2RGVA 3M1CA 3GMEA 4JQFA 3I4NJ 3IL1B 2NRAC 4I1DA 3I59B 5A2QK 1I3QJ 4EEFG 2UUZA 4FIMA 2WBMA 2V3TA 2O1LA 5IZ3A 5EGOB 2LY9A 5AE4A 3T8TA 3AAFA 2VHAA 1QJMA 1QZZA 2XPWA 3SQNA 2F5DA 1MPDA 2WV1A 1LAHE 2L2OA 2F97A 2H8WA 2CQ7A 2XF5A 4CCKA 5K7ZA 1A36A 1DPUA 1ZAOA 3Q0VA 2PJPA 1V5EA 4R79A 5JK4A 5I84A 2Y31A 1YAEA 2HOTA 5EEGA 2ETHA 1JEUA 4O3CA 4BDOA 2WC2A 4KMFA 2IS4A 4M6VA 1ZARA 3P9KA 3B6AA 1WWXA 3JSPA 1Z3XA 2DJIA 3ROUA 2HQRA 1RYXA 4N4NB 2M87A 1G3WA 3BY6A 1LAFE 1HW5A 2RQQA 1P1QA 1C0WA 2HR3A 3AG2H 2VKDA 1NUWA 3ZCOA 1D1CA 2KR0A 4UUSA 1DOTA 1OQGA 5BPDA 1LKXA 1KQ8A 1DQUA 3K1NA 3P9CA 2M3AA 4P56A 1N04A 4DCXA 1W5SA 3LOCA 4MFDA 1ZTRA 2EA2A 4JSOA 3EHTA 2EA4A 3QU3A 1IMBA 2DK8A 5FKLA 1M5EA 1VQ9I 2I49A 1TFAA 1H76A 4BQNA 4TV7A 4KXPA 4P3LA 3TODA 3DP8A 3A01B 3JRCA 3TTLA 3I0TA 1FP2A 2OF7A 1MG1A 3FBIB 5EHMA 3DQVC 3BR1A 5IP9J 5E17F 3KBZA 3LSWA 3PUYE 2WAFA 2JRTA 4P9FA 1YTYA 1MM6A 2M0CA 2CRGA 3MFKA 1MRPA 3HO7A 5EYFA 2JA6J 3RQIA 1IUYA 3C1DA 1DPRA 2DDBA 1MGTA 1N3WA 3DLLF 1Z7NE 1FJ9A 1AMFA 4AVPA 3WTSC 3JTGA 1IN8A 1ENHA 1X4OA 3H3UA 3O29A 1R4MB 4AYBA 3PUXE 4ZDMA 3PUVE 2VPRA 3B73A 4A3MJ 1MMSA 4KD5A 2E7WA 4XKRA 3S17J 2JSPA 2K85A 1X3WB 4KHZE 3JRAA 5D8LB 2Z2SB 1ZGWA 1LEBA 2AL4A 3W2WA 5AA2B 3JRIA 3CCLI 4N0BA 2JWTA 2LH9A 1ERDA 2P3NA 4IO5A 1SFXA 2E1OA 2NS7A 2PQ8A 2ZKZA 2B63J 3RKQA 1EH7A 2UVJA 4ELPA 3HEFA 1ZTYA 2D3IA 1R1VA 4CHUA 4I02A 4D5CA 1IEJA 3LSMA 3UIFA 2DOEA 3LSHA 1Z91A 1FYLA 1Q1VA 3A1YA 2E35A 4BBRJ 3G4SI 3IB0A 1UTBB 2ZNTA 2RCAA 1GVJA 3IFAA 1EV7A 5ICTA 3HHHA 3FASA 1MXZA 4C30A 1FYKA 2K02A 3EYYA 4E7IA 5EG0B 4G6DA 5KCMA 4PDKA 2I0BA 5EYGA 3BCAA 5FKNA 3WU2C 1V3FA 3OIPA 3KYCB 3WGIA 3A03A 3FWEA 3HV1A 4L5EA 4A5MA 2PBWA 1TTYA 3BZ6A 4L9NA 1FBSA 4II2A 3TO7A 1N25A 3MAJA 2X26A 3W9VA 1X1AA 3CQZJ 3KEOA 3MWMA 4OU0A 3MAMA 5F1QA 3TDJA 5A2QZ 1LDKB 1RZ4A 3ZMUA 5KAFC 4ISUA 4ESBA 3AL0C 1B7HA 2BW3A 3BROA 1UZCA 4QPQA 2FX0A 3KP5A 3HPHA 3FD3A 5K5RA 3CD6I 4A6EA 4OANA 4RGRA 2K9NA 4F7ZA 1SAXA 3S1MJ 1NV4A 3CC2I 1SANA 3FKIJ 3ZMVA 5D5XB 5C44J 2F4IA 4I62A 1VQ5I 3U93A 3V5AA 4BY1J 2DE4A 3CCRI 3FVKA 3OO6A 1PB9A 2ZYNA 5DTBA 4EJWA 3G3HA 2VQHA 1IXIA 4A3DJ 1Y3QA 3DPUA 2DE2A 1WJAA 4CO8A 1IDZA 4PDHA 2WB1N 1ZG3A 2DT7B 2BHZA 2ZMEA 4DQ2A 4ZYGA 2D1HA 2FA7A 1KQ9A 2ZXIA 2FIXA 2O7IA 2OWTA 2HPIA 4OVSA 5KDTB 3WTUC 3FMSA 4HS7A 4F1YA 3IH4A 1POGA 3HCQA 3QPHA 1WGXA 5TGTA 4DXUA 3B6TA 3FIRA 4JX5A 1IMAA 2DO7A 4PFYA 4A0XA 2MLGA 4BXUA 1RNLA 1Y3NA 4O94A 2K40A 4GWUA 2Y0MA 1T0KA 4ZDLA 1O7TA 1ZIUA 3PNVA 2FF4A 3DXJF 5I57B 2I58A 3U1OA 2X6OA 1XCVA 2I4BA 4KICA 1SD5A 3HSEA 4BEHA 2PEXA 4PZJA 5HS9A 3F8BA 3ZMTA 1H8AC 1TQPA 3QP6A 4RJZA 1IXHA 3ZRGA 4R6HA 5CC2A 1UB9A 5IT9K 4OHNA 3CJRB 4BKXA 4ENMA 2I3WA 1HQCA 4XKVA 4UACA 1U6GA 4BY7J 3IOVA 5H8NA 5LHIA 2VKVA 4MEXF 2QQAA 5K5OA 3WU1B 1FBEA 3OXNA 1X4PA 2DS9A 4PJMA 3IJOB 4U21A 4C3JJ 5M5YJ 5IOYA 1IMEA 4P9KA 3TTRA 1P99A 1MNDA 4H46A 1W1WE 1EJ9A 1JEVA 2K27A 4OINF 3U72A 2R7QA 4ZE9A 1R6RA 4RA2A 3QMFA 3DBHB 3H03A 3ML6A 1MY4A 3CFZA 4MF3A 3DTEA 4NF4A 4FORA 3QQAA 4UUTA 3CO7C 1OCTC 4IKFA 4EJOA 3ROJA 1P4AA 4FATA 1JKPC 4C2UA 4PK4A 4JXIA 5I58B 2JJ7A 2O5RA 4PF6A 1BR2A 2Q1ZB 1VDWA 2WV0A 3MZYA 4M73A 1FTOA 4GFRA 3HSRA 3BG5A 4BQAA 4L9VA 1KQ0A 4DI3D 3Q3SA 2VOPA 1SQYA 1E3PA 4H45A 4THIA 2L0KA 2XXQA 4WCGA 4DI4B 4AB5A 3SJMA 1MY1A 3C2BA 1FY7A 2XWKA 2FBKA 4XICA 1LEAA 1QVUA 5L3CA 3H6TA 1O57A 4M1VA 2P81A 1BIYA 3GZGA 3A3CA 2V6EA 1OPCA 1IN7A 3I59A 3SZTA 1MMDA 5C3EJ 3TQNA 1JVYA 5EGOA 2DAOA 3O8GA 2O8XA 3D1RA 3KN7A 1YJNI 5FD5A 2DTZA 5JVGF 2R3SA 4IY6A 5DT6A 1SVLA 5F0HA 3I5OA 1ZGAA 4B44A 4A12A 1GV5A 3MKZA 2R7OA 5TISC 2EZIA 4IL6C 2BY3A 3RYPA 4MH5A 3ZN0A 4FAJA 1MH3A 2CMPA 1SEUA 4PCDA 1B3GA 3EUAA 4RLQA 5HS7A 4OIRF 4IRGA 5K7HA 3R26A 4LZ8A 3MZBA 4YKKA 5LRSA 3CVGA 3MC2A 1PB7A 4P0GA 3VLUA 3FHZA 4XKPA 3U1KA 1OFCX 1RESA 3PIPF 4KNYA 4HX8A 2QMWA 1T56A 3O8HA 3PL8A 2O51A 4BDLA 2CQKA 1H88C 1VZ0A 2XAJA 2ONSA 2K4JA 3B50A 4KCDA 1U78A 3F11A 1AHDP 2EILH 3CMYA 1QUKA 2RDPA 3B7DA 3LSTA 2L54A 3L00A 3WU0A 3ZQ7A 2JA2A 3A01A 3V89B 2E1MB 5FD6A 1XPXA 1B6HA 2KFDA 1LUJB 4OA4A 3L2UA 5I2KB 4YMBA 1MMAA 4XMYA 2CUEA 4P0IA 2WAQA 4HNTA 4AS5A 1SD6A 1WSUA 3D5RC 4LG3A 4PFIA 1AKHB 5CBRA 5JEIA 1ZLKA 2FRHA 4D9JA 2E36A 4O3MA 2CV0A 1OJLA 1OLTA 2F2EA 1HBXG 5E1WA 3HTSB 1G3SA 1A5JA 5IZZA 2A61A 2L4AA 4F3GA 1BW5A 3KP3A 1FJ6A 2KISA 2LNBA 2KZGA 2DMPA 2FNPA 5EZGA 1ON2A 3H3VK 2DXIA 4V2FA 4H5GA 4U4XA 4EM1A 3KIOA 4AYBN 4NE4A 3KLNA 5AA2A 2OC6A 2DA7A 2P0WA 3IAM2 5AIQA 1FOXA 1CNQA 4BACA 4OMZA 4TLLB 1S9HA 3ZMZA 1X1PA 3E78A 2L9RA 4ESJA 2R7DA 1YRNB 1XB4A 2R7SA 3VYSB 3JCUC 4M3DA 2P6SA 1ZH5A 2HFBA 4OIQF 1UTBA 1D9QA 1Z9CA 1MJBA 1TWAJ 3MMYB 3MEXA 3K4LA 3SESA 3QWLA 4PFRA 5DM6F 3DF8A 3C34A 2STWA 4ZS9A 3BPVA 5IM2A 5I59B 2WA0A 5EG0A 1U0JA 3DBRB 1NFTA 4U1OA 3C32A 2WBBA 2BHYA 3KE2A 3OSFA 1GTKA 1A40A 3OO7A 3OSQA 1K7AA 5L8DA 1GLNA 2BEOA 4Y4RA 4XRSG 2Y30A 2Z23A 1FT9A 1B4HA 5FFXA 1O4XA 1RDXA 4BH9A 3RDIA 4AM3A 2K86A 2DT5A 4A3BJ 4XKQA 1DGRM 1BL0A 1EH6A 3CO6C 3PPPA 1DP3A 2JT1A 3OR2C 4BAYA 1IF1A 3K0VA 4C1UA 2XAGA 4YKPA 1L3LA 5CI5A 4G94A 4I0AA 4LFUA 3KEIA 2ZXTA 4XKWA 2E34A 3F23A 2GIVA 4LK1F 3S3OA 2WEFA 3M07A 1M5CA 3O66A 1P7JA 3BR3A 3HHGA 4UVAA 2Q8KA 2DFIA 4U22A 3GYYA 3PFYA 1K78B 3TP0A 1SW2A 1UMQA 2RREA 3ECHA 4XOPA 1GT0C 3MP6A 2IEEA 2Z9OA 3FXBA 3R7XA 3SEYA 1EZPA 1AH5A 2RV8A 1JHFA 1OKRA 2J5OA 1QU3A 1KZHA 1S3JA 2HI3A 2WAEA 1ZR4A 2IS6A 2OLBA 4RM2A 2DW4A 1W36C 3SERA 3DEEA 2HYGD 2MD0A 1EZOA 2THIA 2IT0A 3EKIA 4PAFA 2JQ7A 3VSLA 1LFUP 2VGQA 3WTTC 2XWVA 3QXMA 4X48A 2GOXB 5KDTA 2W82A 1R58A 5CQEA 3UORA 4V2GA 1M5BA 3SFZA 4AC0A 5CKTA 2E2IJ 3KEQA 2NVYJ 2DA5A 2IEKA 4Y52J 4OXVA 3N6TA 4IZZA 3GBBA 4CYCB 3J81K 1TL8A 4S04A 1Y1MA 1D1AA 2DOFA 1P1OA 4LQ2A 1D0YA 5I57A 3F8MA 4LMYA 4NF0A 1YO5C 1ANFA 5EZHA 5HLIA 4BLAA 4QSDA 2HZDA 1UIVA 3DM0A 1SFUA 1T95A 2MABA 2X6WA 3PIOF 1Z1DA 1RIOH 3CC4I 1HSTA 2MH9A 1SD7A 4NB5A 1J59A 3GF2A 3ZS6A 1Z7ME 1T0FA 5CPRB 2XASA 1SVXB 3EHSA 3A2KA 1YW7A 5IY5H 3HSTA 2R7TA 4KITB 3L2CA 2CU7A 2VL8A 2QSXA 5FJ8J 1RYOA 1EKEA 3FM3A 3S93A 4EF2A 2NUVA 4DBQA 4FEDA 1TWFJ 3PUBA 3K4KA 2BY2A 4LB6B 4CSWA 4AIJA 1U5TB 2DOAA 2OX3A 2DA6A 3KP4A 2LDUA 4GX6A 2CUFA 2DXRA 2EFWA 4ZH4F 3F9KA 4ZC3A 2YLNA 4JDFA 3NAUA 1QVSA 2ZNZA 1XT8A 3PUWE 4E7KA 1AOVA 3H92A 2X9DA 3MN2A 4FJPA 3CMMA 1Y1ZA 1X1DA 1XC5A 2BY1A 2NS8A 2XGDA 4NC7A 5KK1A 2XHKA 1ZJLA 4N6DA 4OVPA 5I58A 4LITA 3LA3A 1LFIA 2WBDA 2ZYKA 4I6ZA 2AIXA 2H6BA 2PYYA 1BTJA 3UA8A 3T8RA 5LEKA 4OVQA 2HEOA 2DWIA 2EINH 3JZJA 3BR6A 1AWCA 4GBVA 4I9DA 2EBIA 3LSLA 4N9HA 4Q47A 1XN7A 3LSGA 3CCUI 1XTAA 1O7LA 2HOSA 3KYDB 3OYGA 2FMYA 4HF2A 3VVDA 1T33A 3F8CA 2TRTA 1TT0A 1LLSA 4RB0A 4HQMA 2ABHA 4M6YA 3P7IA 2QQBA 4HNUA 2HOAA 1URDA 4AUXA 3QAXA 1FW0A 4QXDA 3FBNB 2RAEA 4B8XA 1XGMA 1K83J 2MC3A 3LUYA 5FROA 2Z8DA 1FBPA 2K5CA 2H1KA 2Y75A 3K2DA 3KFWX 5B3SH 1T2KA 2Q74A 2BV6A 2L02A 2L9NA 5CQGA 3QUFA 4OYVA 4QRZA 4WWCA 1MZBA 2NVXJ 5F27A 3WE3A 1TXFA 3ABMH 4GIZA 3NWSA 3R4KA 2ELJA 3JTHA 1UQWA 3K02A 2XX9A 2Z33A 3KZGA 1WVRA 4XK4A 3NEUA 5LFAA 4ZTJA 4IHSA 5GAHJ 1WRJA 2BGCA 2LF8A 2DXYA 4IGTA 3HM5A 1USTA 2QJEA 3N94A 1E3HA 3DU6A 3BCBA 2P8TA 3LQRA 4XKNA 3OYLA 2A5TB 2QPQA 3C9HA 1SDXA 2KJBA 3DKYA 1NUYA 3SEUA 2A5YB 4NQWB 4XLEA 1X1BA 2BE5F 5LD2C 2Z8FA 3I71A 3LMMA 4BBSJ 4EMSA 3A29A 1B59A 1XMKA 4HEA2 5F1RA 4RB1A 1D5YA 1MXUA 3M3KA 3TL4X 2RNJA 3W2VA 5EEAA 5FTHA 5I2KA 4PP0A 1F4KA 3HOVJ 1D8JA 2UVHA 3EF7A 4JSDA 4X8RA 3LBSA 1IUFA 4MQVA 2VQCA 1Q1HA 1AKHA 5E1ZB 2I4CA 2ID3A 4PAIA 4F3PA 1IXGA 2ZJ2A 5KAIC 3HPIA 2O68A 3AG3H 1K9YA 4DZPA 5L3GA 2LLKA 2Y7PA 4FQGA 5M5WJ 2WAQN 3IOUA 1TC3C 2DVZA 1ZELA 3Q29A 1IRXA 2Y69H 5I7IA 4Q0CA 1H44A 3I58A 4OENA 2FBHA 3VVFA 3RLFE 3RJPA 3HHFA 1JTXA 1MIJA 3H35A 2A5SA 1L0OC 4NC8A 3H0DA 1ZQ3P 5M3FJ 1T38A 4L0YB 1I6BA 2JUGA 4YEJA 3MVZA 3C33A 1POTA 1S7AA 3OSRA 1Z0XA 3LSKA 1YRNA 5AA4B 3J80Z 3PPNA 3UP9A 3QODA 2F6CA 2OJED 2ZSIB 4FECA 2QYOA 2GFEA 3ZQHA 2XA5A 1FSEA 5EDNA 3RT8A 1MW7A 5ERIA 3U8QA 4I8CA 2PG4A 2X1EA 2XXVA 1NV7A 3GLBA 2EWNA 3OYKA 2IXSA 4N6KA 3IWFA 1BN5A 3OYDA 1MSFC 3WAEA 3GXOA 4GXOA 4MHFA 2OWZA 2XWOA 5F7VA 3PPRA 2UXNA 2VD3A 1N77A 1RUNA 3F72A 2OBPA 2UV1A 3OOA