1HSJA

Sarr mbp fusion structure
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
487
structure length
487
Chain Sequence
KIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALAAAQTNAAAEFMSKINDINDLVNATFQVKKFFRDTKKKFNLNYEEIYILNHILRSESNEISSKEIAKCSEFKPYYLTKALQKLKDLKLLSKKRSLQDERTVIVYVTDTQKANIQKLISELEEYIKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the SarR protein from Staphylococcus aureus.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription/sugar binding protein
molecule keywords FUSION PROTEIN CONSISTING OF STAPHYLOCOCCUS ACCESSORY REGULA
total genus 143
structure length 487
sequence length 487
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
A PF12802 MarR_2 MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1hsjA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1hsjA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1hsjA01
1LDJA 4EM1A 1Q1KA 2VT3A 3RLFE 4IRHA 4G94A 4LB5A 3K0VA 5CMMA 3SZTA 2QPQA 3WTWC 2IVMA 4GD5A 3S9NC 5IT9K 3FVOA 1LB2A 2HGCA 4LFUA 3J7AO 2L4MA 4IGRA 1MXZA 5LGNA 3BPXA 3I64A 1PDNC 1O3SA 3U2RA 4M9ZA 4ELRA 3I5OA 2DXYA 3CVGA 4JDFA 3MQ0A 3CO7C 1MD0A 5H8FB 2P6TA 4XBFA 1B4ZA 2FYIA 4XXUA 5D6EA 1EH8A 1ATGA 1H9TA 2DP8A 2VOZA 1HSTA 2CW0F 4H1XA 1ZRCA 3W15C 2F5FA 5IT3A 1DP7P 4R73A 2DQLA 1FW0A 2I58A 1P1OA 1T98A 5ICEA 1UFMA 1B6HA 1N3WA 3R0AA 4L9VA 3S4UA 1B7UA 5D5XB 1MQIA 5KVRA 4GL8A 1LVAA 2JRTA 3A3CA 4F22A 4NF6A 2QQAA 3AXFA 5H20A 1U2WA 3LBSA 4KN7X 4OIPF 2ISZA 2B0LA 3CLOA 2FEZA 1MRPA 1M5BA 4BHBA 1LAXA 4UV9A 4ZEKA 1US4A 2Q89A 3B7DA 3QUJA 4I8CA 3KN3A 2ONSA 4LUBA 1TW2A 4RS8A 2H98A 3T1BA 1OQHA 1MM6A 3TPAA 3WU0A 3V7CA 1NNPA 5L3CA 4NF4B 1R5GA 1P4WA 2XXTA 3HSEA 5L8DA 1IXCA 5KZTA 1B59A 3HHHA 2OWSA 1RIOH 4GLIA 3KFWX 2IEEA 2HZLA 1B32A 3UN6A 1QUJA 4EQ9A 5A5XA 1TQIA 2YX7A 3FMQA 3PMWA 1NKXA 4KA4A 5I2NB 5LHIA 2NWJA 4RAYA 4A0YA 4DLDA 3C3WA 5K1YA 4ND9A 3F6OA 4M6YA 2LF7A 2O03A 1YO5C 3QU3A 2XHDA 3QAHA 2Z5UA 1A7LA 2XXHA 3KLNA 4N9IA 3HHFA 3VFZA 3F23A 5K2XA 1U8RA 2MC3A 4QLCU 1MQJA 1BI1A 1GTKA 3JTHA 3ELKA 3I71A 1BI0A 2QBYB 1D4NA 2ESNA 2DWHA 4YKKA 3GEZA 2CO5A 5EEHA 3RT8A 3RYRA 1TXFA 3CSBA 4ON0A 3WTYC 1B46A 5DYMA 2V79A 4OMBA 4GIZA 1FBSA 2JZYA 4P5OA 3ONMA 4QSCA 4EXKA 1FTMA 2H99A 3R26A 4GOTA 1FX7A 3PQKA 4N13A 1SFEA 1FZPB 2OZ6A 1MQHA 3N97A 5JK4A 2PMSA 3OMBA 1TLHB 3BJAA 4PFWA 2DFIA 3I6VA 4ZS9A 3LA3A 2VONA 4X9TA 4L5IA 1FYMA 5I2KA 2HOEA 1Z1DA 4N9HA 2NVUB 1B5HA 3H6TA 4D0PA 2VT2A 4A5MA 2X7PA 1DTGA 1SDXA 1JNFA 2XAFA 3DPTA 3ILTB 1FTKA 3OELA 4UVBA 1JW4A 1YCJA 1OMPA 1KU2A 3PPPA 3GWZA 2RGVA 2Z22A 3CG3A 1ON2A 3MJNA 1D8KA 3ROUA 2LNBA 4H8JA 3FVGA 4M71A 1OVBA 1OIBA 2OJTA 1WVJA 1EV7A 4IXAA 3WAEA 3CI8A 3CO6C 1OKRA 3E6CC 1USSA 4OFJA 2F34A 2O7UA 1TNSA 4X1BA 5J8CA 2R7DA 1MKMA 4IPAA 3FVKA 3M8EA 4M9SA 1SD6A 4JBAA 5TPAB 3RNNA 3SETA 3MVXA 1P92A 4KI0E 3MZHA 3M3LA 1J1NA 4O5VA 3TO9A 4IHTA 3IB2A 1I1GA 1LB9A 2Q8KA 5JI6A 2F7CA 4FJPA 1W4MA 2DSFA 1O7LA 4RGUA 5DVFA 2OQGA 2OWTA 3EHSA 3H7MA 2DPDA 3JAMZ 1H76A 1JVXA 2GAUA 1HKQA 2O3FA 2O61A 4FECA 3KP5A 1KU7A 4N0BA 4O3AA 1YQAA 1N76A 2H6CA 2K86A 3RI4A 3H4ZA 4UVAA 3GZGA 3U8QA 1B4HA 3MP8A 1B1HA 3FV1A 4G7ZF 1R6ZA 3N6UA 1O3TA 4FIMA 4DXCA 1S29A 1P99A 3TQNA 1I6XA 1XSVA 4ZH4F 2XAJA 2D3IA 3MPKA 5I58B 2NRAC 4M1VA 4RXLA 2M5WA 4OIOF 3MC2A 3VVDA 2NS0A 2PFBA 5H6QA 5ELVA 2D21A 4OFOA 4IHSA 5FD6A 3EDPA 2ZMEB 4L18B 2L02A 1XCBA 5KK1A 2UXXA 1PBPA 4HW8A 1IXRC 4EJVA 4KR5A 2XX9A 3EETA 3FJMA 2Z99A 2O0YA 1YYVA 4GWOA 4PP0A 2M1BA 2PMUA 4G8NA 3RUMA 5CLSA 5DYHA 2ESHA 1NNKA 1BI3A 1N7XA 2G9WA 4LA9A 4OU0A 4YIIA 1OR7A 4PFYA 4LZ5A 4OQOA 2KRFA 5BQTA 3V89B 4G68B 4HX8A 3K9TA 1GGGA 2ZNSA 3RYPA 3QP6A 3BZ6A 2R71A 4HLYA 3PPQA 4K3FA 1B3LA 3QOPA 5FHOA 3SDFA 2O68A 4A2UA 1ZBMA 1QQIA 2L3DA 3K69A 1ANFA 3PUYE 4IO4A 3A3UA 5JVTA 3HUGA 5BWJA 5CBSA 5D4SA 1QZZA 2I3WA 5CVIA 2DOJA 3R6UA 2ETHA 1POTA 2RINA 3RN8A 4F2OA 3DFGA 2G7UA 4HZFA 3EYIA 1MY1A 1TNTA 4YFXF 2THIA 3DM0A 2O84X 3I3VA 4F39A 1J59A 5HLHA 5DUKA 2W24A 2Q8JA 2QMWA 2XXIA 2C6YA 2GWRA 1DSNA 3FF5A 4ENJA 4AB6A 4R8HA 4WXJA 1XHYA 5AA4B 1FSEA 3T8TA 3TAJA 2I4BA 2I49A 1ZAOA 1B9MA 2L54A 4ZYEA 1B5JA 5K5QA 1HW1A 2XHKA 3E9XA 1K79A 4BDMA 2RF1A 5L9OA 3HHGA 2VODA 5FHNA 3E5QA 1HKTA 2RC8A 4H65A 4F3BA 4KYEA 3WTTC 2P5KA 2F6GA 4P55A 5LRSA 3HIFA 3K6VA 4F31B 5CMBA 1EU8A 2FA5A 2XGXA 3TKDA 4ENMA 3TKYA 2FQ3A 3DKWA 1HSEA 2QMXA 4QSDA 1S3JA 1B3EA 1SYHA 3FVNA 3OOAA 3UGWA 4RA1A 3K2DA 3FUZA 4HOBA 1MJBA 2DE4A 3BDDA 3CDHA 1L3LA 1S7AA 2RKMA 4WEDA 2GXGA 4EF1A 4HX7A 3FWEA 1NFTA 3JYRA 3QPTA 3R60A 5DCFA 2XAHA 1B40A 3ECRA 3FIRA 3TO7A 3KOTA 2QENA 2DQRA 1XN7A 2JPCA 1II5A 2DI3A 1K78B 3S9LC 1P6RA 2DVZA 4QF9A 4GXAA 4ZZLA 4HAMA 2RKHA 4YKPA 4MFIA 1KGSA 1URSA 4IO2A 3DXJF 3NEUA 1UTBB 2Z3YA 1WQ2A 1IIWA 1JXSA 4LP2B 5I59A 2VHAA 2LKPA 1HQCA 2XKOA 3QXMA 1JETA 1MPCA 2QLZA 2QBYA 1R1TA 4UACA 2W25A 1B05A 3L2CA 3SZPA 2VD2A 2ZNZA 2CWEA 3QP5A 4WF2A 3V8LA 1Y9UA 3H06B 5CJ9A 1O63A 3LSFB 4FORA 4KYSA 3F8CA 3W9WA 3ISPA 2Y75A 3S2WA 3WG9A 1W7PB 2AS5F 4IGTA 2H09A 1DPUA 4I1DA 4MQVA 1AOYA 5H8SA 1GV8A 5ILUA 4A0XA 1W7PA 1FQBA 2QSXA 1S7OA 2DLLA 4FX0A 4G77A 2WC2A 3P9CA 4PZJA 1YTYA 1B0LA 3R4KA 4R6YA 5CM6A 3VEPA 1LBCA 3J80K 2E1NA 1JHHA 3WODF 1IITA 5J1DA 2P5LC 3EF7A 4BH9A 2A07F 4EJTA 5DT6A 4EQBA 3FGSA 2V25A 4H5FA 3Q9VA 3K1MA 1BTJA 4PE5B 3IOUA 3LAJA 4LK0F 4WXDA 3T22A 4OIRF 5DCMA 1ZRDA 3H3ZA 1R1VA 3T66A 4E70A 1B0HA 3K02A 2QL3A 4RYAA 2HKXA 2HQNA 3LSTA 4ELPA 2BGCA 3JAMK 1BN5A 3TTKA 5CC2A 2HXWA 4PFUA 4YMBA 2GHBA 3PPNA 4CO8A 2ZYNA 2DVCA 1USYE 3P9IA 3KCCA 2XV4S 3QYTA 3GFLA 1TQMA 1SAXA 4ZE8A 3Q5FA 4JK1X 3OEMA 2BE5F 4IY6A 4Z0IA 4KN4X 3C18A 1UIVA 2UVJA 3QUFA 3WTZA 1NL5A 1VTNC 1B52A 2EWNA 3LWFA 1K78A 2OZUA 4RNSA 2CYYA 3M9AA 2QJEA 4NEDA 2COMA 4MLQA 2P6SA 1ZRFA 1CE2A 3KP6A 1NHAA 3C34A 3PV0E 1LB8A 4U2RA 2IRFG 2ALUA 3TOAA 3BPVA 2XD2A 4AVPA 5AA2D 3MEXA 4RGSA 2QYOA 4RGXA 2OQRA 4JQFA 1DOTA 2PEXA 3T5XA 4KNYA 1QULA 3FV2A 3QK6A 4HA8A 5L3BA 4EQQA 2RVCA 1T39A 4G6QA 1XCVA 5D5UB 1FTLA 1YW9A 2BV6A 4N6PA 1KQ8A 1WODA 3L7WA 5LHGA 2EK5A 4EMSA 1MY2A 4YG2F 1FSHA 1VSOA 2D45A 5H8HB 1L5TA 3GFIA 5FFZA 3H6VA 5AIPA 2O6GE 2L01A 4QRZA 4XKRA 2XASA 2R6GE 3O2AA 2K4BA 2H25A 5DUIA 4IB2A 4FAJA 3COAC 3KGCA 3TMGA 4C1UA 3R6SA 3DP6A 3T8RA 5DD8A 3GZ6A 2OBGA 2ZYMA 1Y4TA 3E6DA 4GQOA 4E0XA 3KN7A 3T9VA 3TGNA 1H43A 1FNNA 1ELJA 1O64A 1MY0A 5F1QA 1FWZA 4H0WA 3VDFA 4NWDA 1ZLQA 3IOVA 1IUYA 2EA2A 3C9HA 1MJ9A 4O3BA 4HF2A 1I1SA 3I59A 3EQ1A 4OWDA 4ETSA 1XOCA 3IB0A 5FGMA 2YX4A 3FM5A 1Y3NA 3MVZA 1USYH 3CSGA 3ZKLA 3IAZA 1H0MA 2HYGD 1HKSA 1BLFA 4I7HA 2PQ8A 4YICA 2H94A 1ZYRF 1B1BA 3WAFA 4GL0A 3D0SA 1TFAA 4EJUA 1QZYA 3KBRA 2CG4A 4I2OA 3GFJA 5H6RA 2STWA 1ZIUA 5CVUA 1QO0D 3P9KA 4QFNA 4RPNA 5AE4A 4Q30B 3PGFA 1A55A 5LLQA 1U5TB 4EVIA 1B9JA 3R61A 1MPDA 1H3DA 3TZAA 4LGWA 1SFUA 2B3FA 5CVJA 2HQRA 1UQWA 2P5VA 3KOSA 2FSWA 4DNCA 3HCQA 1MY3A 4AIHA 4OENA 1KYZA 1W5SA 5DCMB 3O66A 4F2QA 4IO3A 3KP3A 1QNTA 2DK5A 4G9YA 3C7JA 5E8IA 2DE3A 1AWCA 4RB1A 1LAHE 4CICA 1MQDA 5K5RA 1G3SA 1PB8A 1ONVA 5DDGA 3RPQA 1OYWA 1QUKA 3M3KA 2HTJA 5CVRA 3MP1A 3UORA 4O6JA 1HXDA 3PU5A 4I02A 5E1XA 2PBIA 5AA3A 1VFDA 3RPWA 3OV8A 2DU9A 4TOZA 4TQUQ 1G3WA 3GLBA 1QGPA 3ZQ7A 4KT5C 4ISUA 1XGSA 1IAWA 2OU2A 3R0JA 2Z23A 2IA0A 1URDA 1SI0A 1Y3QA 2QS4A 3GX4X 1WDNA 5JHUA 3IRQA 4I09A 2I4CA 2EV6A 3HSFA 4PQJA 4DE8A 2XXYA 3GBBA 4H8IA 5KCJB 1NH7A 1A40A 1BC8C 1N04A 1F9NA 1B3GA 4GFRA 4ZECA 2R7FA 2F2EA 3D4CA 3OEKA 4M73A 3B73A 3KEOA 4WCGA 3O2PE 3BFUA 4I0AA 4IO7A 4HDUA 2NUVA 3I4PA 1POY1 1IN8A 4THIA 4LB6B 3TEPA 2IW5A 2V3QA 3ML6A 1SFXA 5I59B 3T9HB 3I5UA 4Z2YA 4EGYA 3G3KA 2HWVA 1JVYA 2F6PA 4LVQA 5I58A 2EFNA 3TDJA 2ANJA 4OOIA 5KDTA 4XSZF 4ZYGA 4S05A 2REGA 4ECFA 1QKAA 1GVJA 3BJOA 5DVJA 1CB6A 1SVXB 4M72A 2P1SA 3CIJA 3CJNA 3M7GA 3LA7A 3UA8A 2A6HF 3FMSA 5BPIA 1FQDA 3GLXA 4HCYA 1YIOA 3V83A 5I56B 3GXOA 1ZJLA 1E2XA 2YPRA 3C33A 1P1WA 1JGSA 4IY5A 4KFQA 1UHWA 1D3YA 4NQWA 4G8HA 4Y13A 3PD8A 4EQ7A 5EHMA 4HLXA 4U4XA 3VFJA 3E97A 1UTHA 5DEXB 2DWJA 2GH9A 1FQEA 4WK8F 4A5NA 3O29A 1A54A 4L9TA 2F5XA 2BYVE 4N07A 4JBZA 4I01A 4CZZA 2YSRA 1H44A 4P9UA 3J81K 5FTHA 2FU4A 1IUDA 5BOXA 4XKPA 2NNNA 3TTLA 3WGIA 3I58A 3HV1A 4G8XA 1B3FA 4BHPA 3G3ZA 2OCUA 1G6NA 3ZMDA 3BBRA 1SMTA 2QS2A 5CMKA 3WGGA 2D1HA 5B7DA 3OXNA 2XAGA 1RZ4A 4BAYA 1IXGA 2ZYKA 5TPAA 3MZYA 2PI0A 3OD7A 3SEYA 4LD5A 5LEKA 1XVYA 3KJTA 4KQPA 2HDCA 3ZN0A 3CFZA 1T38A 5HVQC 3L9FA 4U21A 5A2QK 1GR2A 4LQ2A 1U5TA 3LSXA 4Q0CA 3B6WA 5JTYB 3LA2A 4KICA 3K01A 1R7JA 1B7ZA 2EV0A 2V1DA 1YPNA 3KEQA 3TO6A 4BYYA 1D9VA 3VODA 1U78A 1M5CA 4F3GA 1F4KA 3Q26A 2DE2A 1JHFA 3ECHA 5I57B 2A5YB 4AD9A 4U4SA 3AAFA 4L9NA 4FATA 3DQVC 1YFHA 1A8EA 1NNFA 2DTRA 3CG1A 3CFXA 4TLLB 1Y1MA 1FTOA 3Q28A 1P1UA 2PLYA 2WKYA 2PMHA 2REJA 1ULYA 4O3MA 4XIGQ 3F3XA 3BFTA 2TDXA 2XXQA 4X1DA 2P0SA 5HM4B 2LF8A 2K02A 3PD9A 2HEOA 1S6LA 4YB5A 3OENA 2P4WA 2MD5A 2VC0A 4KDPA 4R2FA 2L4AA 3U1OA 2JSCA 1OPCA 2PYYA 4LG0A 1SD4A 4ZEFA 1AL3A 4M74A 2O1MA 4ZEDA 2IA2A 4EM0B 3HRSA 4P96A 1B3HA 2WV0A 4RB3C 4LG0B 1MDMB 4MBPA 4G7HF 3OO9A 1MXXA 1Z7ME 2XUBA 2ZJ2A 1WSUA 4ZYHA 2K27A 1FYLA 2GHAA 2VBYA 2BJJX 1GHCA 4NHJA 5FD5A 1PP8F 4M4GA 1EH6A 2A5SA 3ZN1A 1ZH5A 2E1CA 3SESA 5TP9B 5M2VA 5FFXA 1BP5A 4WXHA 1Y3PA 3G3HA 4ZEBA 4A6EA 4HW0A 2HAUA 3HSTA 4MTEA 4MGRA 3FASA 4KYDA 4S04A 3VXBA 3E6MA 3VLUA 5FO5A 2I48A 3ERED 1P4AA 4EF2A 1UB9A 1PBQA 2QM3A 4L0YB 2FRHA 4OESA 5F7VA 2MH2A 1ZGJA 2ZYOA 4F29A 1O3QA 2HFHA 5D5VB 3O6IA 4OTEA 3SERA 1I27A 5IAIA 3HOTA 1NH8A 5JR3A 2ZNYA 5J6XA 4RY1A 1XD7A 2Y84A 2J5OA 1BJAA 4LJZF 3OSQA 3O6GA 4E0WA 3LR1A 2CSOA 4UA8A 4OMZA 1LAGE 2ZXJA 3C36A 4AIJA 5ICFA 2KJCA 4R1HA 3H3GA 3IOWA 2YR2A 3FZVA 4XSXF 2VOOA 3T0YA 3O28A 3I54A 3S2VA 3Q9SA 4NTLA 2D1VA 5DEQA 2OA4A 2DXRA 2FA7A 1R36A 3G3FA 2EB7A 2UXAA 1Z05A 1SBPA 3VV5A 1QUIA 2VOPA 2GXBA 3ZKKA 4L0ZB 1OMIA 3JSOA 2CGPA 5F1RA 3GZ5A 2Y7PA 2VBWA 4G6DA 4NE4A 1URGA 3C4MA 5JFRA 1B1XA 3GXAA 3IJXB 1P1QA 1BOAA 2XX7A 1B4AA 3ZMSA 5ILVA 4IF4A 1LGBC 1MQGA 1CF7A 2FNPA 2X26A 4JWYA 4YB7A 4YU0A 3B02A 3EUHA 4KMFA 4MF3A 1SYIA 4BDQA 4KFCA 3TTMA 5I84A 3WGHA 1T6SA 2VXZA 4A6DA 1ZREA 1KA8A 3MP6A 2VE8A 4HBLA 2DPUA 2V1UA 1E17A 2M8EA 3MUQA 2Y7IA 3G73A 3RKWA 1FCKA 5FB2A 3E4RA 2ONKE 4LQ5A 3TQWA 2YPNA 3O97A 1WWXA 3N26A 2V9VA 1I5ZA 2KIFA 2ZCWA 3RIRA 3ZMVA 1LFGA 2QQBA 2KLFA 4OVJA 4OZ9A 2G93A 5H8QB 3KFMA 1ZKBA 1ODDA 1Y1ZA 3PUXE 4JSOA 1KQ9A 1RUOA 1LCFA 3P7IA 2GZWA 5ICQA 1P4XA 2OZZA 1XS5A 1ZHFA 5HS7A 3ECOA 4RAZA 2OD5A 2MLKA 2P7CB 1USTA 3EHTA 1MPBA 4HV5A 3EQLF 2R9JA 4B09A 3KSJA 2FXAA 2P8TA 3QRFF 4F7ZA 1XDUA 3IL1B 3U92A 2MA3A 1J5YA 3BY6A 1EZPA 1GXPA 4KIGA 1IF1A 1T0FA 1UHMA 4I0BA 2F8DA 4KMUX 5A2QZ 3H6WA 4ZEIA 5LEJA 1ZU0A 3F8NA 5H8QA 1Z6TA 1TFDA 2RCAA 3PPOA 3U93A 3HRTA 3HTSB 1MM7A 1R22A 1R1UA 1A99A 2PN6A 3IX1A 1D8JA 3RQTA 1FC3A 3IKVA 2UYFA 2HAVA 1ZTYA 2JTVA 1JE8A 1QKBA 2RCBA 4RB0A 3SEVA 1LEBA 1PB7A 5CI5A 4NF4A 2F5EA 2V3UA 4HCWA 4HF1A 3RJPA 2X4HA 3K1PA 2KKOA 3ZP5A 1S7YA 4IO6A 5L9SA 4PETA 3C31A 4NF8A 5D8KB 2ONRA 1LDDA 3F11A 5HPQA 4IJAA 3EYYA 2I6EA 1FQCA 2LAOA 3CTAA 2HEUA 2EA4A 3GYHX 4DCYA 4F3SA 4FT8A 3RDIA 1WI9A 3C1DA 1US5A 2RN7A 5LOMA 1IXIA 3PFIA 3WTVC 3O3KA 4WX9A 1VFEA 3G3IA 2V6CA 2H6BA 2I0BA 5TP9A 3IWZA 3QU6A 2QZ8A 3B6TA 4BDOA 4XKNA 1SD7A 1ZLJA 2Y7KA 4L17A 1MXVA 2ABHA 1ZG3A 3MBPA 4NF8B 1P2FA 1TWYA 4OHNA 3FXRA 5LBQA 3KSXA 1YLFA 4GYIA 3W9VA 4DXUA 2BEOA 3T9UA 2P7VB 1W5TA 2J5PA 3HYIA 4GGGA 3TTNA 2FMLA 4MQ9F 3TODA 2A6EF 1MXUA 2Y0MA 4Q5SF 2F97A 2KIMA 3EHUA 1WRJA 2OLBA 4HX4A 5F64A 3ULQB 4POXA 1Y20A 3MVWA 1YS6A 2PG4A 2NNYA 5E20A 3ZS6A 1AMFA 1IZ1A 4FHTA 4PGGA 1J9IA 1B51A 3REOA 3Q29A 1KQ0A 1K6OA 3KJ7A 2V93A 3HN0A 3LUYA 4P11A 2Z8EA 2GA1A 3DP7A 1ZMGA 3BOQA 3O6HA 3JSPA 5TJJA 3OO7A 5E1ZB 1G3TA 3BJ6A 4HV6A 4HQEA 4MH5A 1QPMA 3IO6A 4F19A 2ZNTA 3SQNA 3V8JA 3FATA 4G7OF 3IK6B 4MLVA 1ZGAA 2ISYA 2QQ9A 3V7RA 3IR1A 5E17F 2FMYA 4QWQA 4KPTA 3O6BB 1IRGA 2UVHA 4JXIA 2E1SA 1MGTA 2CMOA 4P9FA 1SD3A 1UTHB 2O69A 5DEXA 1JW5A 3GO5A 4FEBA 3F8BA 4CYDA 4QFPA 4KCDA 3N5LA 3T93B 3GUDA 3KP4A 3KG2A 3FJGA 3ILUB 4NF6B 3C32A 1A04A 2AIXA 5HLIA 4RB2C 3J80Z 3TDZC 1OLAA 3UP9A 1U5TC 2D2WA 1LJ9A 5CVVA 2F7BA 1FP2A 3LSWA 1DPRA 2OBPA 2UXNA 1J0RA 3DLNA 2Q2AA 2STTA 4U7BA 2VN2A 2IA4A 3N4MA 2NOOA 1OLCA 5ILSA 1XSDA 4ZZEA 2NYXA 5ICGA 4FX4A 1EZOA 1DTZA 3HRMA 2FBKA 2VE9A 1PUEE 1ZARA 2G29A 4QFKA 3HRUA 1VE4A 5CMCA 4UVCA 1SI1A 3V8XB 3W6JB 1RI7A 2JT1A 1IEJA 3U72A 5HOOA 1BIYA 2NAZA 3VVEA 3V8KA 3DP4A 4OFLA 4Y15A 5AA2A 2ZXTA 4XKQA 4HQMA 5I56A 1P1NA 1SW2A 1AOVA 1HSJA 1SMYF 5AA2B 2RC7A 1IN6A 2DK8A 4LLLA 1R00A 4RGRA 4AIKA 2W85A 2K4JA 3VOEA 3F8MA 2EFWA 2A61A 1WKMA 2XD3A 2A5TB 4UNOA 3HTUA 4ESBA 4BQAA 3RY3A 1DDNA 3SFZA 4FE8A 2GFEA 4YIFA 4BDRA 5HDKA 2G7HA 1TBXA 2CZLA 2YJPA 3TYHA 5ICTA 1PDAA 3RTFB 1HSLA 2RDPA 3BKIB 5ED4A 1M5FA 3PQJA 4GO1A 3TTRA 1FY7A 2DO7A 4GXOA 1IXSB 2IJLA 4JB7A 3IHUA 4GYGA 3FMRA 1BBYA 1DPEA 4NMYA 1Y0UA 2A68F 2ADUA 5H8FA 2DYXA 1H45A 3VLVA 3IC7A 2P2AA 2UZKA 1ZLKA 1XC1A 1PP7U 1D3KA 5ICCA 2DS9A 2HFBA 3HOSA 1Z7UA 4I62A 1J75A 4WWCA 1STZA 1OYYA 4BHCA 4BXUA 2Z8DA 3RKXA 4DQ2A 1XSXA 4BDNA 3SHFA 2V3TA 4WEPA 2A3SA 5DV5A 3WTXC 2XKPA 2PT2A 1YW7A 4YFKF 1LNWA 2Z33A 1R9LA 2DT5A 5BUUA 3CUQC 2XXXA 4EM2A 3TQLA 2OK2A 1KWHA 1N84A 3MWBA 2V84A 4C1TA 1HW5A 2GQQA 5E1WA 3LC8A 1G4DA 3SEXA 3F6VA 4M9XA 4HF0A 3T96B 1QVSA 2XXRA 4R6KA 5CRYA 2DWIA 4Y17A 1U6GA 3B6QA 4HTGA 3TCHA 4WXCA 4RJZA 3PPRA 1SD5A 1O3RA 4BDLA 3H03A 3PMVA 3D5LA 3A09A 2PBWA 2ZNUA 1RUNA 2GRVA 3MWMA 3QPHA 1RYOA 3IL2A 3MZ9A 4EXLA 5DVIA 5FTIA 3MW0A 3RPUA 1N0TA 2UWMA 1RNLA 1TQPA 1MH4A 4HS7A 4LMYA 1BC7C 1JEVA 2RC4A 4U23A 2KIUA 3F21A 3LAPA 1UTBA 3V4GA 4XLNF 5L3DA 1B7HA 3KP7A 2IPQX 2RV8A 1LAFE 5HLGA 1L0OC 1IRFA 1DUXC 2O8XA 3TUSA 1FOKA 1Y4CA 2WTEA 3CUQB 1IXHA 4ESFA 1I6AA 5D8LB 2FBHA 2H27A 3ODBA 1LFHA 2VC1A 4KUMA 1XT8A 3MAMA 2EJRA 2MLGA 1LCTA 3EN3A 4A0ZA 4F1UA 4CXFA 2FE3A 1MG1A 3MZ1A 2LSOA 1MXWA 5CYVA 4BNCA 2V1XA 3MPLA 2CQKA 3PUWE 3H3UA 5HBCA 2LDUA 1UIUA 4U7DA 2Y7WA 1LLSA 4XTCQ 5AA1A 1B58A 1MY4A 2ZO4A 3GW2A 4IO5A 1BM9A 5EEGA 3V7SA 3J81Z 1SW4A 1MH3A 1BIAA 1B9NA 3LFKA 2M30A 3JV9A 4ZYDA 4KHZE 1OQGA 1KYWA 3DELB 4UHTA 2H9BA 1MJAA 1QW0A 2RQPA 4ZDMA 2VGQA 1T0KA 3GVAA 5D5WB 4R74A 4JWOA 3WTUC 1T2KA 1SW1A 4YFNF 1EZ9A 4ESWA 1Z9CA 3Q27A 4U1OA 2XXPA 2EFQA 5BS6A 1W7PD 3F22A 3KE2A 2HR3A 3MVYA 1O7FA 2VBXA 3KP2A 4NWCA 4LK1F 3E5XA 5LRRA 2H5YA 1BKAA 3L00A 3THIA 5HDNA 2FF4A 2Z9OA 4U22A 1FQFA 3RT6B 1FLIA 2VD3A 2X7QA 2XXUA 4L9JA 4H5GA 1LDKB 4OXVA 1LQ1A 2EV5A 5K5OA 2IT0A 4ELOA 3E3KA 1FPQA 1JW1A 2B3BA 3UK4A 1I6QA 1YAEA 3S9EA 4I98B 4RK2A 2XRNA 4LZ7A 3RTWB 3JZJA 1LSTA 5A5XB 3LQRA 2IA1A 3ABUA 5ITOA 3M8FA 1J2XA 4G68C 2Q2CA 4Z7EA 1JEUA 4OINF 3FJ7A 3DF8A 4DXBA 1S50A 5FLXK 3K1NA 3G7WA 2ACJA 3WTSC 1FBUA 4G2ZA 5ISUA 3ZPLA 2K7LA 2F7AA 4DZ1A 2OAZA 5ERIA 2FNCA 3L6GA 2F36A 3MFKA 2MH9A 4HYEA 1XDSA 2Q0OA 4OEVA 3PUZE 1UCRA 1XGOA 2AXLA 1NMUA 1BI2A 2HKOA 5KDTB 2NXOA 4IRGA 4LONB 2O7IA 2UVGA 2RNJA 4F18A 3Q25A 2VP1A 2QVOA 1H9GA 3HPIA 4PFTA 4M6XA 4ELQA 4C0RA 2HQ0A 4YMAA 5D6FA 3H6UA 1IQ7A 3WU1B 3GF2A 1XMAA 2AL4A 2PJPA 2ELHA 1N7WA 4RK9A 5E8GA 1IW7F 2ZBKA 3VB2A 1O7TA 2FOKA 3IWFA 1ON1A 4K2EA 1U3EM 2YU3A 5TU0A 4EDPA 4EV0A 4TLMB 3HO7A 2B65A 1B6AA 3N6TA 2I0CA 1ZG1A 1Q1HA 3IRRA 2HZKA 1ZN2A 2Q88A 1FTJA 2D5WA 2CFXA 3VVFA 2ZKZA 2DAOA 5LGUA 1XVXA 4CGZA 2AL5A 2PX1A 1C0WA 3E6BA 2UVIA 3ZMZA 1Z91A 1BIBA 2A69F 3MCZA 2A5TA 4YB6A 3IOTA 3L09A 1V3FA 4ENKA 4GVOA 4IVNA 2M87A 3FXQA 1FYKA 4G4PA 1DMBA 1V4RA 3M3FA 5F6FA 4MEYF 3RKYA 4MTDA 1QBJA 4P0GA 3DEUA 1KU3A 4XLPF 6PAXA 5I2KB 1YTVA 4CHUA 2I3VA 3ABTA 1TT1A 2Z8FA 2HTSA 4U0VA 4B8XA 3E5UA 3RGYA 4F1YA 3F72A 2ZMEA 4EJOA 3G3JA 3CUOA 1CGPA 2QS1A 2XXVA 4AWXB 3O9PA 4R75A 4OMYA 3U94A 4UV8A 4OYVA 1GXQA 3JW4A 3PMXA 5JTYA 2HYFA 4GRKA 1MZBA 3IKTA 3OOPA 3D4GA 1PB9A 4Q48A 3FHZA 4LATA 1XB4A 1LBBA 2M8CA 3PUVE 2HS5A 1PEBA 3SEUA 1O57A 2Q9TA 2MBFA 1NNTA 1KU9A 2F78A 4G68A 1SW5A 4U0WA 2RC9A 3K6XA 3BROA 3KETA 1YW8A 3TCFA 1AIVA 3MQ9A 1IN7A 1JQFA 5AIQA 4DCXA 1F1ZA 3CR9A 4EGZA 1Z6RA 2JPBA 1OVTA 2PVUA 4UUVA 2O1LA 1REPC 2WWYA 2UYEA 2E7WA 3FD3A 4RPOA 1R1NA 3VLWA 4U88A 4DDDA 1SQYA 2O51A 4GXSB 3M8UA 1XGMA 1LEAA 3GBAA 5HDGA 2HCAA 5L3FA 2YLNA 4JSDA 1F5TA 5BPDA 1TW3A 1D9YA 5EHSA 3K0LA 3SKPA 3DV8A 2XIGA 1EH3A 4G8MA 2IP2A 1TTYA 3NQOA 4ZZAA 5L3EA 1R58A 2W84A 3MZBA 3KZGA 4NB5A 1XGNA 4H0EA 5K2YA 1FBQA 3FXUA 2QRYA 4R9FA 1CF7B 1J7KA 4HDVA 5I57A 3TDUC 4EJWA 4OIQF 3TFLA 3VE1B 2XROA 3OO8A 4KYWA 1F9BA 3L6HA 2F5DA 2PT1A 3QIMA 3EPEA 4A12A 4KIFA 1HBXG 4Q4ZF 3E13X 3TCGA 3KZYA 4ZZDA 1XMKA 3IB1A 4LLNA 3BWGA 2XX8A 4JWXA 4R9GA 5IT9Z 1D5VA 2QUFA 2ZMBA 4POWA 3QAXA 4LZ8A 1N3XA 3OSRA 1YG2A 1PC3A 4QFLA 3I59B 2O6AA 5D4RA 2XAQA 2AYSA 4U0YA 4PGHA 4U1ZA 5IKBA 3T9XB 3HSRA 1ZG5A 5E18F 3CFLA 4YKIA 5AONA 3K6UA 3LSLA 1Z7NE 4YKJA 3IORA 3E3VA 2E7XA 4AB5A 4R6HA 4DIGA 5KCJA 5L9MA 1IN4A 1EH7A 2FNAA 4ENNA 3N94A 3ZMUA 2DW4A 5ITPA 5LHHA 4FEDA 2GA2A 1MXYA 5TRDA 4F1VA 2M45A 4UXNA 3SXYA 4R72A 2EFPA 3IJOB 3JTGA 2R3SA 5LGTA 3ZMTA 4O3CA 3IO4A 4GCVA 4MHGA 3I53A 3M1EA 2ZFWA 2VBZA 3W6KB 5HS9A 4Q8RA 1VR5A 5EYFA 5FLXZ 1OYIA 3U9GA 4WKMA 3KZZA 4YAHX 3KLOA 4R2BA 3TELA 3NRVA 3DP8A 2F35A 4R79A 1MS7A 4GF8A 4F3PA 4ZE9A 3WE2A 1B2HA 3F8FA 1GVCA 1LFIA 3I0TA 3SEWA 2E0SA 3K00A 3USDA 5AA4A 4P0IA 5L3GA 4PDKA 2DWAA 5CBRA 1QJMA 3V5AA 3C35A 4OEUA 2Y7RA 3KN8A 1MDQA 3KEIA 4OETA 3P7NA 2Q2EA 5BMZA 1R5HA 1I69A 4CDGA 1Q35A 2KJBA 4H67A 5J8FA 3K4UA 4ONYA 5FHMA 3S9MC 2W7YA 2EFOA 2H4IA 1IN5A 3CRBA 2DBBA 5HS8A 4H6DA 2X0LA 4Q47A 3MAJA 1R23A 4L5JA 4ESJA 4PCQA 4AQ4A 4ESXA 5H8NB 4TV7A 1FP1D 3FM3A 1M5DA 3ZSFA 4MNUA 1MDP1 3GFMA 2QWWA 4KCCA 1AH5A 1RKMA 4QSEA 1A8FA 3K2ZA 4ASNA 1I6BA 3LQQA 1M5EA 5H8NA 4OERA 2W57A 4BLAA 4IRIA 4XRFA 5DD4A 3BP8A 2FBIA 3VXCA 4KIBA 1FQAA 4NF5B 1X3UA 4I9DA 2QS3A 5H8HA 1B5IA 3CUQA 1K7AA 1R9QA 3TOBA 4NF5A 3K6WA 3DPLC 3QSLA 2BBYA 4KD5A 5B70A 5JEIA 3U1DA 3R7XA 2HZTA 4MEXF 5I2NA 3WE3A 3UIFA 1DPPA 1G3YA 1S9TA 3H92A 1YS7A 4QHQA 3FX3A 1RYXA 2DQVA 4QFOA 4EUOA 1MDMA 2XVCA 2XXWA 3G3GA 4YZZA 5DTBA 1FT9A 2F5CA 2Y48A 4X48A 1HW2A 4LLGF 3OO6A 2GIVA 4Q5TA 3RTRA 1S8NA
chains in the Genus database with same CATH superfamily
1LDJA 4EM1A 1Q1KA 2VT3A 3RLFE 4HE2A 4IRHA 2XPWA 4G94A 4LB5A 1XS9A 3K0VA 5CMMA 3SZTA 2H8RA 2QPQA 3WTWC 1MBGA 2IVMA 2HOSA 4GD5A 2XPUA 5IT9K 4GDFA 3S9NC 3FVOA 4I99C 2CFOA 1LB2A 2E5ZA 2HGCA 4LFUA 4XLFA 3J7AO 2L4MA 4IGRA 1MXZA 1SFOJ 5LGNA 3BPXA 3I64A 3PUFA 5J1UA 3OYNA 3CCSI 3U2RA 1O3SA 1PDNC 4M9ZA 4ELRA 2ZZVA 3SYTA 3I5OA 2DXYA 3CVGA 3DKXA 4IX7A 3MQ0A 1HF0A 4JDFA 1VNDA 1IV6A 3CO7C 1MD0A 4XN3A 5H8FB 2P6TA 2M4KA 4XBFA 3IH4A 2CRGA 3VYTB 1B4ZA 1E3OC 2FYIA 4MAGA 2HYJA 4XXUA 3DU5A 1EH8A 5D6EA 1ATGA 2L9NA 1XG1A 1H9TA 2DP8A 1HSTA 2CW0F 2VOZA 2M34A 1ZRCA 1K4TA 4H1XA 3W15C 2F5FA 2CZIA 3BZKA 3IH2A 5IT3A 1DP7P 4R73A 2DQLA 1FW0A 2XSJC 2I58A 1P1OA 1T98A 2AHQA 2MW8A 5ICEA 1UFMA 2WBDA 4V2FA 1B6HA 1H88C 3GTGJ 1N3WA 4HNVA 4NG7A 3R0AA 4L9VA 2QSFX 3S4UA 2B4LA 1MNEA 1B7UA 5D5XB 2IGNA 3SEZA 5KVRA 1MQIA 1IG7A 4XKCA 3S16J 1LVAA 4I76A 4GL8A 1LFPA 2JRTA 1VQPI 3A3CA 4F22A 1SEUA 2TCTA 4NF6A 4X04A 2LY1A 2QQAA 3CCEI 3AXFA 4PGNA 1KZHA 5H20A 1NH3A 2BW3B 1U2WA 4AVZA 3LBSA 3HKZN 3K70C 1NK2P 4KN7X 1ERDA 4OIPF 5FKMA 2ISZA 2B0LA 3CLOA 2FEZA 5C44J 1MRPA 4MIMA 4BHBA 1LAXA 4UV9A 1M5BA 3DEWA 5ET6A 4ZEKA 1US4A 2Q89A 3B7DA 3QUJA 4I8CA 4CCNA 2ONSA 1X1DA 3KN3A 4LUBA 1TW2A 2MYSA 3GCMA 4RS8A 2ZZXA 2H98A 1LFUP 4YEJA 1WFXA 3S32A 3T1BA 3IFCA 2IBDA 2L5QA 3HBLA 3GTOJ 1MM6A 1OQHA 1IO2A 3WU0A 3TPAA 3V7CA 1NNPA 5L3CA 4NF4B 1R5GA 1P4WA 4CH7A 2XXTA 3HSEA 2L0KA 5L8DA 1IXCA 4CCLA 1B59A 3HHHA 3S1RJ 2OWSA 5KZTA 1RIOH 3IFAA 3KFWX 2IEEA 2HZLA 1B32A 4GLIA 1QUJA 3UN6A 4EQ9A 1T95A 1TQIA 2YX7A 3FMQA 4MFDA 3RSNA 3PMWA 1NKXA 4KA4A 5I2NB 5LHIA 2M0MA 1FBFA 2NWJA 4RAYA 4A0YA 1FRPA 3C3WA 4FISA 3MKYB 4DLDA 5K1YA 1YRNB 3F6OA 4M6YA 2LF7A 1HA8A 3L1PA 4ND9A 1LUJB 2O03A 1YO5C 3QU3A 2XHDA 4V19K 2JA5J 1I39A 2EINH 3QAHA 4PBHA 2Z5UA 1A7LA 1MMGA 3KLNA 2XXHA 4KITB 3SJMA 4OVRA 1W1WE 1JKPC 4N9IA 3HHFA 3VFZA 2Q1ZB 3F23A 5K2XA 1U8RA 2MC3A 4QLCU 1MQJA 1BI1A 3RKQA 3BR0A 3JTHA 1GTKA 3ELKA 3I71A 1BI0A 2VKEA 2QBYB 1D4NA 2ESNA 1I3QJ 2DWHA 4JP0A 3ZOBA 4YKKA 3GEZA 3PSIA 2CO5A 5EEHA 5J1RA 4YZZA 3RT8A 3RYRA 1TXFA 3CSBA 4ON0A 3WTYC 4BE2A 1B46A 3DCFA 2X51A 5DYMA 3B6CA 2V79A 5GADJ 4FBPA 3KYCB 4GIZA 4O7MA 4OMBA 1FBSA 2JZYA 2Z2SB 4P5OA 5KAIC 3ONMA 3FISA 2QEXI 1FTMA 2H99A 4QSCA 3R26A 4GOTA 3RPLB 3GTPJ 1FX7A 5F04A 3PQKA 4N13A 4F91B 3CD6I 1SFEA 1FZPB 5T3JA 3VSLA 2OZ6A 1MQHA 3N97A 5JK4A 2HVQA 2PMSA 3OYAA 3OMBA 1TLHB 2HDDA 3BJAA 4PFWA 2DFIA 2BVLA 3DWLE 3I6VA 4ZS9A 2K9NA 3LA3A 2VONA 4X9TA 4L5IA 1FYMA 2O7OA 1RDYA 4Y4RA 5I2KA 4RM2A 2HOEA 1Z1DA 4B43A 1T33A 4AS5A 4B47A 4N9HA 2NVUB 1B5HA 3G71I 3H6TA 4NQWB 4D0PA 3LSIA 1IRZA 2VT2A 4A5MA 2X7PA 3H9JA 2F8DA 3I4MJ 1DTGA 3A01B 2CU7A 1JNFA 2XAFA 3DPTA 1SDXA 3ZQHA 3ILTB 1FTKA 3S8PA 3OELA 4UVBA 1JW4A 2A5WA 4DJAA 1YCJA 4P1EA 1OMPA 3RYDA 4FETA 1X1BA 1I50J 1KU2A 3PPPA 2DJIA 1GV5A 3GWZA 4GWSA 3OYLA 1MIJA 1FBHA 3K4CA 4EATA 2RGVA 2R0QC 2Z22A 3CG3A 3VYSB 2JJKA 1ON2A 3MJNA 1D8KA 4N8YA 3ROUA 2LNBA 1WJDA 3IP4B 2ZJQF 4H8JA 1E0EA 3FVGA 4M71A 1OVBA 1OIBA 2BJIA 2OJTA 1WVJA 1EV7A 3K4BA 4IXAA 5IP9J 3MKZA 2VLAA 5GPAA 3CI8A 3WAEA 5A5LA 2RAEA 5IZ3B 3CO6C 3CLQA 2JA2A 1OKRA 4YELA 3E6CC 3CC2I 4A3CJ 1USSA 4OFJA 2F34A 1TZLA 3CHGA 1LBVA 1LFBA 1TNSA 2O7UA 4X1BA 5J8CA 1P7JA 2R7DA 1MKMA 4IPAA 3FVKA 2V4JC 3M8EA 1B72A 4M9SA 5FKOA 5IZ3A 2Q74A 1SD6A 1WI3A 2KMUA 2LTPA 4JBAA 2FHYA 5TPAB 3RNNA 3SETA 4OWRB 3PL8A 3MVXA 1JP4A 4LIUA 3C2GA 1P92A 4KI0E 2VKHA 3MZHA 3M3LA 3S1QJ 4O5VA 1J1NA 3TO9A 3MD2A 4IHTA 3IB2A 1X1PA 1I1GA 1LB9A 2Q8KA 1IMFA 5JI6A 2F7CA 2EIJH 4FJPA 2QQ8A 4GWXA 5M5XJ 4O8MA 4H4KC 1W4MA 1APLC 2DSFA 1O7LA 4RGUA 5DVFA 2OQGA 2Q2EB 2OWTA 3EHSA 2R7TA 3H7MA 2IS1A 4CZCA 1DP3A 1GV2A 3B8BA 2DPDA 3E0JB 3JAMZ 4XRSA 1H76A 3AG2H 1JVXA 2R5YA 3MVPA 2GAUA 3QPSA 3H9GA 1HKQA 1YOVB 2O3FA 2O61A 2MC4A 1UJ8A 2KIQA 5LD2C 4FECA 3KP5A 1KU7A 4N0BA 4HNUA 1R6RA 1YQAA 2H6CA 1N76A 4O3AA 2K86A 1K4SA 3RI4A 1DCUA 3H4ZA 4UVAA 3BG5A 3GZGA 3U8QA 1B4HA 3MP8A 2H1LA 1B1HA 3LOCA 3FV1A 4G7ZF 1R6ZA 3N6UA 1O3TA 4FIMA 4NGUA 2ECBA 4DXCA 1S29A 5EG0B 1P99A 3TQNA 1I6XA 1XSVA 4ZH4F 2XAJA 2D3IA 4BEHB 3MPKA 5I58B 2NRAC 4GBVA 4M1VA 4XLEA 1MMSA 4RXLA 2M5WA 4OIOF 3DPUA 3MC2A 3VVDA 2NS0A 2PFBA 2XF5A 2ZSHB 5H6QA 5ELVA 1QVUA 2D21A 3VYUB 2DFEA 3HJEA 4XEQA 1QHHD 3M1CA 4OFOA 4IHSA 3RZOJ 5FD6A 3EDPA 2ZMEB 4L18B 2L02A 1XCBA 5KK1A 2UXXA 1A35A 5FLVA 1IXRC 4EJVA 4JX4A 1PBPA 2XX9A 4KR5A 3EETA 4HW8A 3FJMA 1ETYA 5GTIC 2Z99A 4M3FA 3S93A 2O0YA 3ABMH 1YYVA 4GWOA 3GZNB 2H1KA 2BVMA 4PP0A 2M1BA 2ZJRF 2PMUA 1RKWA 5M3FJ 5CLSA 4G8NA 3RUMA 3DTKA 2ESHA 1NNKA 3OYGA 1BL0A 1BI3A 2LH9A 3MKWB 1N7XA 2WYKA 2G9WA 4LA9A 4ITVA 4OU0A 1D1BA 4YIIA 5EG0A 1BR2A 1OR7A 4LZ5A 4PFYA 1FSAA 3CCRI 2PFZA 2KRFA 5BQTA 4OQOA 3V89B 5FKLA 4G68B 4M3EA 1SVOA 4HX8A 3K9TA 1GGGA 4P56A 1HOMA 2ZNSA 1Y0NA 3RYPA 1QU3A 3MMYB 1W5CC 2ME0A 3T0JA 3QP6A 3OYCA 3BZ6A 2R71A 4HLYA 4FCYA 3PPQA 4K3FA 1INPA 1B3LA 3QOPA 5FHOA 3I3LA 2Z16A 3SDFA 1WJ5A 4OAZA 2O68A 3HG9A 2XRLA 4A2UA 4BJ5C 1ZBMA 1QQIA 2XWKA 2L3DA 3PIPF 3K69A 1ANFA 3PUYE 4MCOA 4CSWA 4IO4A 3L2RA 4G6TB 3A3UA 4MO7A 2WB1A 3JCUC 5JVTA 2V1NA 3HUGA 5BWJA 5CBSA 5D4SA 1QZZA 4EXKA 2I3WA 5CVIA 2QKMB 2DOJA 2ETHA 1POTA 2RINA 3R6UA 5GAHJ 3DFGA 2G7UA 4HZFA 3K7AJ 4NBQA 4A93J 1NUYA 4QBAA 3EYIA 1MY1A 1TNTA 4YFXF 2THIA 3DM0A 5CQGA 2O84X 3I3VA 4F39A 1J59A 1YE9A 5HLHA 5DUKA 2W24A 5K7ZA 2Q8JA 2QMWA 2XXIA 2I8DA 2KZVA 3K6GA 4P47A 2C6YA 2GWRA 1DSNA 3FF5A 1IMCA 4ENJA 4AB6A 3FXOA 4R8HA 4WXJA 1XHYA 5AA4B 3UR3C 1FSEA 3T8TA 1RC9A 3TAJA 2DA1A 2DE3A 2I4BA 2I49A 1ZAOA 3ONQA 1B9MA 2L54A 4ZYEA 2CUZA 1B5JA 5K5QA 1N77A 1HW1A 2XHKA 4C3HJ 3E9XA 1K79A 5KCMA 4BDMA 2ZXIA 2RF1A 2CQQA 1G0IA 3OL4A 5L9OA 2HQ5A 3HHGA 2VODA 4MJOA 5FHNA 1T56A 3E5QA 2BY2A 1HKTA 2RC8A 4H65A 5J4VA 4KYEA 3WTTC 4PF8A 2E71A 2P5KA 1SC7A 2M7AA 2F6GA 4P55A 5JLXA 1VQLI 5LRSA 3HIFA 3RCOA 1IMBA 3K6VA 4F31B 2ELJA 3U1KA 5CMBA 1EU8A 2FA5A 2HQAA 2XGXA 4BY1J 3TKDA 4ENMA 5TISC 3H0GJ 3TKYA 4A3EJ 3BIGA 2FQ3A 3DKWA 2DYRH 4IEJA 4IHWA 1HSEA 2QMXA 4QSDA 1S3JA 1B3EA 1SYHA 3FVNA 3KYDB 5FKNA 3OOAA 3UGWA 3DBLB 3K2DA 4RA1A 3PIOF 2XXKA 3FUZA 4HOBA 1FPJA 4NC8A 3BQYA 3OS0A 3RN8A 4ZJZA 1MJBA 2DE4A 2L7FP 1OCPA 3BDDA 2X6YA 4Y52J 3CDHA 1L3LA 1S7AA 5B5EC 2RKMA 2WEFA 1EYKA 2CV1A 4WEDA 2GXGA 4EF1A 2DA6A 1I6HJ 4HX7A 3FWEA 5JLWA 3S1MJ 1NFTA 3QPTA 3R60A 4RAFA 1SVMA 5DCFA 2XAHA 1B40A 3ECRA 3FIRA 3TO7A 4BQQA 2QENA 2DQRA 3KOTA 1XN7A 2JPCA 1II5A 2DI3A 1NV1A 1K78B 3LMMA 1VFCA 1YJWI 1P6RA 2GM4A 2OTJI 2F4IA 2DVZA 4QF9A 3S9LC 4GXAA 4ZZLA 3GTKJ 4HAMA 3UKGA 2RKHA 1JKOC 2E35A 2KDOA 4YKPA 4MFIA 1KGSA 1URSA 4IO2A 3F0CA 4XOTA 2V7FA 2P3VA 3DXJF 1Z21A 3NEUA 1UTBB 1XX5A 4GFBA 2F4MB 2Z3YA 4CCKA 1WQ2A 1F43A 3FBIB 3I56I 1IIWA 1JXSA 4LP2B 5I59A 2G0EA 2VHAA 2LKPA 1VQNI 1DBZA 1HQCA 4P1WA 2XKOA 1IMEA 3QXMA 1JETA 1D1CA 1MPCA 2QLZA 2QBYA 1R1TA 3IAM2 4MHFA 4UACA 2W25A 4FASD 1B05A 3L2CA 3FK7A 3W2WA 1Z7LA 4FTHA 3SZPA 2L9SA 3PSFA 4PAFA 2VD2A 2ZNZA 2CWEA 3G1OA 3QP5A 2VJIA 4WF2A 4XMYA 5CJ9A 3V8LA 1O63A 1Y9UA 3H06B 1R4MB 3F8CA 3LSFB 4FORA 3ISPA 2Y75A 3S2WA 3W9WA 1V55H 1W7PB 3WG9A 2AS5F 4IGTA 3HUGB 2H09A 1DPUA 4I1DA 1N75A 4MQVA 1AOYA 5H8SA 1GV8A 5ILUA 2R93J 4A0XA 3FXKA 1W7PA 2DMPA 1FQBA 3ZGKA 4JVIA 2QSXA 3VPRA 1S7OA 2DLLA 1X1AA 4FX0A 2WC2A 3P9CA 2X9DA 4PZJA 2PMZA 1YTYA 1B0LA 1GUUA 2VQGA 2JQ7A 4PJMA 2H8WA 4A3KJ 1R49A 3CCLI 3FKJA 3R4KA 1SPIA 4R6YA 1AKHA 5CM6A 2LKXA 3VEPA 1LBCA 3DTIA 3J80K 2E1NA 1YX3A 2WB1N 1JHHA 5F08A 3WODF 3OMYA 1VQ7I 1IITA 5J1DA 1UG0A 1BR4A 2P5LC 3EF7A 4BH9A 2CW8A 2A07F 5TGTA 9ANTA 3CMEI 1EYJA 4EJTA 5DT6A 2O5RA 4EQBA 2EIMH 3FGSA 2V25A 4H5FA 3GTMJ 2KQRA 3K1MA 1ENHA 3Q9VA 1BTJA 4PE5B 1RESA 3IOUA 3LAJA 4LK0F 4WXDA 3T22A 2CUEA 1A5JA 2XB0X 4OIRF 5IP7J 5DCMA 1ZRDA 3H3ZA 1R1VA 4N4OB 1D5YA 3T66A 3OIOA 4E70A 1B0HA 4MLOA 3K02A 1OCZH 2QL3A 2HKXA 2HQNA 1BR1A 3LSTA 4LN5A 4RYAA 4ELPA 2K9LA 3JRGA 2BGCA 2NOJB 1BN5A 3ZQQA 2LP0A 3JAMK 3TTKA 5CC2A 2HXWA 4XICA 3BCAA 1KA1A 4DGWB 4PFUA 4CA0A 4YMBA 2GHBA 2ZXHA 2L2OA 4P1LA 4XORA 5DS9A 1YITI 1AWBA 3PPNA 3V42A 4CO8A 2ZYNA 3MN2A 4ZTFA 4CCOA 2DVCA 2WADA 1VQMI 5E3NA 1USYE 3P9IA 3KCCA 2XV4S 3QYTA 3GFLA 1XMXA 4ZC3A 1TQMA 2M3AA 1SAXA 1Z67A 3Q5FA 4JK1X 3OEMA 4AM3A 4ZE8A 4DI4B 2BE5F 4IY6A 1K83J 4Z0IA 4KN4X 3C18A 1UIVA 2UVJA 3QUFA 3WTZA 3PFYA 1NL5A 2HXRA 4P9KA 1IMDA 1VTNC 2WV1A 2ZXWH 1N78A 1WCMJ 1B52A 4J19A 2EWNA 5IP6A 3LWFA 2ZMEC 2OZUA 4A3IJ 2CYYA 1K78A 1BW6A 4RNSA 3M9AA 4D7NA 2QJEA 2FQ4A 4NEDA 2COMA 3ZCOA 4MLQA 2P6SA 1ZRFA 1Y6IA 2DMQA 3KP6A 4XNFA 1CE2A 1NHAA 3C34A 3FIWA 3PV0E 4E4HA 4H46A 1LB8A 2HI3A 2BY0A 4U2RA 3BTLA 2E1OA 2IRFG 2DJNA 4E7KA 2ALUA 3TOAA 3BPVA 2QSGX 2XD2A 4AVPA 3IH3A 5AA2D 4MFEA 3MEXA 4RGSA 2JA6J 1HDPA 2QYOA 4RGXA 2OQRA 4JQFA 3CC7I 2WAEA 2FIEA 4M3BA 1DOTA 4XR6A 5ESYA 2PEXA 3T5XA 2F3BA 4GX6A 4ABZA 3OWTA 4KNYA 1QULA 3CP2A 3FV2A 4NDLA 3QK6A 3CQZJ 4HA8A 5L3BA 2XB5A 2RVCA 4EQQA 3QYBA 3OYBA 1T39A 1WZ2A 4G6QA 1XCVA 1N25A 5D5UB 1FTLA 1YW9A 2BV6A 2E5NA 1PUFB 1KQ8A 1WODA 1ZR4A 1FTTA 3L7WA 4N6PA 2EK5A 4EMSA 5LHGA 4BACA 4PJ0C 4YG2F 1FSHA 2D45A 1MY2A 3EUAA 1VSOA 2N8GA 5H8HB 1L5TA 3GFIA 5FFZA 5IPAA 3H6VA 1W0UA 5AIPA 2O6GE 1NG7A 1YRNA 2L01A 4F3BA 2R92J 4QRZA 4XKRA 3OYMA 4DOZA 2XASA 2R6GE 3O2AA 2E1MC 2K4BA 4F3QA 2H25A 5DUIA 2M0CA 4IB2A 4FAJA 3HXLA 3COAC 3KGCA 4A3MJ 1TWHJ 3TMGA 1I3AA 5EQ8A 4C1UA 3R6SA 4C2UA 4DZJA 4QPOA 2JUCA 1E3PA 2EH3A 3I9V2 2LVSA 5DD8A 4C30A 3T8RA 3GZ6A 1VQOI 4BDZA 2OBGA 2ZYMA 1Y4TA 3E6DA 4GQOA 5EGOA 4E0XA 3KN7A 3T9VA 3TGNA 1AU7A 4GWYA 1E3HA 2JVGA 1MNMC 1H43A 1LBXA 1FNNA 1X2MA 1ELJA 1O64A 1RR7A 1FMWA 1AHDP 1FWZA 1M1EB 1MY0A 4H0WA 2X1CA 4N4UA 5F1QA 3VDFA 4NWDA 3BG9A 3G1LA 1ZLQA 3IOVA 3AG4H 1IUYA 3KX2A 4XLHA 2EA2A 2VQHA 1MJ9A 3C9HA 4O3BA 2BW3A 4HF2A 2EIKH 2MD0A 1I1SA 3I59A 3EQ1A 4MNCA 4OWDA 4ETSA 1XOCA 3IB0A 5FGMA 2KZGA 4XL9A 3A2KA 1ZKGA 1RPWA 2YX4A 3FM5A 1MMAA 3HPHA 2XC7A 1Y3NA 3MVZA 1USYH 4IL6C 1OR7C 3CSGA 3ZKLA 3IAZA 1POGA 4XKVA 1H0MA 2NS7A 1LE8A 2AQFA 2HYGD 1HKSA 1BOBA 1MMNA 1BLFA 2ME6A 2HPIA 2V26A 4I7HA 4F92B 1Y39A 4DYRA 4XM3A 2PQ8A 1YJNI 3QODA 4YICA 2H94A 1ZYRF 1B1BA 3WAFA 4GL0A 3D0SA 5LDZA 1TFAA 4EJUA 1QZYA 3KBRA 5IGAA 2CG4A 3O8HA 4I2OA 1FOYA 3GFJA 5H6RA 2IGOA 1CQTA 3KZIC 5HLTA 2STWA 1ZIUA 5CVUA 1QO0D 3P9KA 4QFNA 4RPNA 4PK4A 5AE4A 4A69C 4IQ4A 4Q30B 4LITA 2O9LA 3PGFA 4BJ6C 1A55A 5LLQA 1U5TB 4EVIA 1B9JA 1A6IA 3R61A 3LSPA 1H3DA 1MPDA 4LGWA 2BHZA 1SFUA 5CVJA 2HQRA 2DOEA 2QCOA 3KPHA 1UQWA 2B3FA 2P5VA 1LKXA 3J7ZI 4KJZA 3KOSA 2FSWA 1H89C 4DNCA 3CMAI 4XOPA 1PJRA 1MY3A 3HCQA 2FJ1A 1IUFA 4AIHA 2Z1DA 4OENA 1KYZA 1W5SA 5DCMB 1FPFA 3O66A 4F2QA 4IO3A 3KP3A 1QNTA 2DK5A 4G9YA 3C7JA 5E8IA 1W36C 5M5YJ 1AWCA 2IXSA 5IYBJ 1SFKA 4CICA 4RB1A 2Y9ZA 1LAHE 1MQDA 5K5RA 3QYEA 4E7ZA 4AC0A 1G3SA 1PB8A 1ONVA 5DDGA 3RPQA 3JRIA 4C2TA 2KR0A 1OYWA 4BBRJ 5IZ1A 1QUKA 3M3KA 1R4NB 2HTJA 1TWCJ 5CVRA 3MP1A 1JT0A 2NOOA 3UORA 4O6JA 1HXDA 1PUFA 5DYHA 5EYHA 3PU5A 4I02A 5E1XA 2PBIA 4OVQA 2PFYA 5AA3A 3ZQGA 1VFDA 3RPWA 3OV8A 2DU9A 4TOZA 4KYSA 3A02A 2DA3A 2IGKA 4TQUQ 1G3WA 2NOGA 3GLBA 1QGPA 2DMNA 3ZQ7A 4IHYA 4KT5C 4ISUA 1XGSA 2EILH 4BEHA 1IAWA 2OU2A 3R0JA 1LEVA 2Z23A 2IA0A 1URDA 1SI0A 1Y3QA 3JRHA 2QS4A 3GX4X 1WDNA 4CUGA 5JHUA 4I09A 3IRQA 2I4CA 2EV6A 3HSFA 4PQJA 1QHGA 4DE8A 1JI8A 2UV1A 2XXYA 3HKZA 3GBBA 4H8IA 5KCJB 1NH7A 4D9JA 1BC8C 4X0GA 1A40A 1N04A 1F9NA 1B3GA 4GFRA 3HGGA 5J3LA 4PCDA 2R7FA 4ZECA 4DBQA 2QFLA 2F2EA 3C2HA 3D4CA 3OEKA 4M73A 3B73A 2CMPA 3KEOA 4WCGA 3O2PE 2DFHA 3BFUA 4I0AA 3ZQIA 4IO7A 3BT9A 2VUMJ 4HDUA 2NUVA 3I4PA 2W82A 1POY1 1IN8A 4THIA 4LB6B 3TEPA 2IW5A 1Z0XA 3DLAA 2V3QA 3ML6A 1SFXA 2VL8A 5I59B 2K40A 1JUPA 3I5UA 3OR1C 4Z2YA 4EGYA 3G3KA 3T9HB 2HWVA 1JVYA 5JHFA 2F6PA 4LVQA 5I58A 4HSTA 2EFNA 4BJTA 5FLMJ 1FPIA 2IAIA 2ANJA 4GX3A 4OOIA 3L2QA 1FTZA 3TDJA 5KDTA 3M8JA 4XSZF 4ZYGA 4S05A 2REGA 4ECFA 1QKAA 1GVJA 2FOWA 2K9QA 3BJOA 2OX3A 5DVJA 1CB6A 1SVXB 4M72A 4B44A 4BE1A 1FPBA 2P1SA 3CIJA 1GVDA 1NV0A 3CJNA 2X6OA 3LA7A 3M7GA 3OYIA 2HHMA 2A6HF 3UA8A 3OS1A 3FBPA 2W48A 3FMSA 4BXFA 3CCVI 1VZ0A 5BPIA 2V6EA 3GLXA 1FQDA 4HCYA 2LD5A 1Y1VJ 3SDGA 4EEFG 2M2EA 1YIOA 3V83A 3TP3A 5I56B 1J09A 3GXOA 1ZJLA 3K4MA 4KXPA 2YPRA 3G2BA 1E2XA 2KDZA 1EYIA 3C33A 1P1WA 1JGSA 2DDAA 4O94A 2KLOA 3DLLF 2B9SA 4IY5A 3QMFA 4KFQA 1UHWA 4V2GA 1X4OA 1D3YA 4NQWA 2OPTA 4G8HA 4Y13A 3PD8A 4EQ7A 5EHMA 4D7MA 4HLXA 4HE1A 4U4XA 3VFJA 3E97A 1UTHA 5DEXB 2DWJA 3HM5A 1R5ID 3BR5A 2GH9A 1FQEA 3QWLA 4WK8F 4A5NA 1HDDC 2JJ7A 3A0HC 3O29A 4J01A 3D5RC 1A54A 4L9TA 2F5XA 2BYVE 3HB9A 4N07A 2DA4A 4JBZA 4I01A 4CZZA 2YSRA 1A6QA 1H44A 4P9UA 3J81K 5FTHA 2FU4A 2I10A 1OISA 5C3EJ 5BOXA 1IUDA 4XKPA 2NNNA 3TTLA 3WGIA 3I58A 3HV1A 4G8XA 1B3FA 3JRCA 3S14J 2TRTA 2Y30A 4BHPA 4BDYA 3G3ZA 1VQ9I 2OCUA 1G6NA 3E78A 5GAGJ 3ZMDA 3BBRA 3ZXSA 2B7EA 1SMTA 2QS2A 5CMKA 3FHNA 2CZKA 3WGGA 2D1HA 3AKZA 2NVXJ 4C3JJ 1JT6A 1OCRH 3OXNA 2XAGA 4XONA 1NI9A 5B7DA 5E3MA 1RZ4A 2KQZA 4HNTA 2OUMA 1RDXA 4BAYA 1IXGA 2ZYKA 5EQ9A 5TPAA 1FBPA 3MZYA 2PI0A 3OD7A 3SEYA 3H5NA 1WGXA 4LD5A 5LEKA 1XVYA 3KJTA 2HDCA 4KQPA 3ZN0A 4BE0A 1W0TA 2MFZA 1T38A 5HVQC 3CFZA 3L9FA 1MSEC 4U21A 2CUFA 5A2QK 2EZHA 4AU7A 1GR2A 3A29A 2Y9YA 4LQ2A 1U5TA 3LSXA 4Q0CA 3B6WA 5JTYB 4FE4A 3LA2A 4KICA 3K01A 3BZCA 1ETXA 1V54H 2LYCA 2PJRB 1R7JA 1B7ZA 4FQGA 2EV0A 4QXDA 2MG4A 2V1DA 1YPNA 3BR1A 3KEQA 3TO6A 4BYYA 3VODA 1U78A 1D9QA 1D9VA 1M5CA 4F3GA 2LC2A 3BLYA 1JKRC 1F4KA 3Q26A 2DE2A 1JHFA 3ECHA 5I57B 2A5YB 5IM2A 2K5CA 4AD9A 2OJED 4U4SA 3S3OA 3AAFA 4L9NA 4FATA 3DQVC 1YFHA 1A8EA 1NNFA 2DTRA 5EDNA 3CG1A 3VSKA 3CFXA 1Y1MA 4GRIA 1FTOA 3Q28A 4TLLB 1P1UA 2PLYA 2WKYA 2PMHA 2REJA 1RRJA 1ULYA 4GX4A 4O3MA 4XIGQ 2I5UA 3F3XA 3BFTA 1WJEA 2EZLA 4PDDA 2TDXA 2DTZA 2XXQA 4X1DA 2P0SA 5HM4B 3BR2A 2LG4A 2LF8A 1Y56A 2K02A 4LG3A 3PD9A 3F9KA 2HEOA 1S6LA 4YB5A 2HU9A 3OENA 2P4WA 2MD5A 2VC0A 1GT0C 4KDPA 2JWTA 4IKFA 4R2FA 2L4AA 1VF9A 3U1OA 2JSCA 1OPCA 2PYYA 4LG0A 1SD4A 1G59A 4ZEFA 1AL3A 5A5XA 4AYBA 4M74A 2O1MA 4ZEDA 2IA2A 4EM0B 3HRSA 4P96A 1B3HA 2WV0A 4RB3C 3H3VK 5E3LA 4LG0B 1QPIA 2KISA 1MDMB 1D1AA 4MBPA 3GTLJ 4G7HF 1FJ6A 4NF0A 2VJ5A 1YIJI 2EPFA 1YJ9I 2XUBA 2ZJ2A 1S72I 1MXXA 1Z7ME 3OO9A 3CF2A 5IOYA 4LOCA 1WSUA 4ZYHA 2K27A 1FYLA 2GHAA 2B4MA 1S7EA 2VBYA 1GHCA 4NHJA 2BJJX 4M6VA 5FD5A 1PP8F 4M4GA 1EH6A 2A5SA 3ZN1A 1ZH5A 2BHYA 2E1CA 3SESA 1VQ5I 5TP9B 5I3SA 5M2VA 4DBRA 2ZFUA 5FFXA 1BP5A 5EF6A 3AG1H 4WXHA 1Y3PA 1ZQ3P 2IS4A 3G3HA 4JX5A 2HVRA 3H1CA 4ZEBA 4A6EA 1JUMA 4PAIA 4AS4A 2VJJA 4HW0A 2HAUA 3HSTA 4MTEA 2X6XA 2DT7B 4N4NB 4UB8C 4MGRA 3BCBA 1EJ9A 3FASA 2Q8MA 4KYDA 4S04A 2HDWA 3VXBA 3PNVA 3E6MA 3VLUA 5FO5A 2I48A 3ERED 1P4AA 5J16A 4EF2A 2LOOA 1UB9A 1PBQA 4X8RA 2QM3A 4L0YB 2ZC2A 2FRHA 2IS2A 4OESA 5F7VA 2MH2A 1ZGJA 2R5ZB 1G2HA 2ZYOA 2LFBA 4F29A 1O3QA 2HFHA 5D5VB 2R7VA 3O6IA 1FJLA 4OTEA 3SERA 1I27A 5IAIA 3HOTA 1NH8A 5JR3A 3I55I 2ZNYA 5J6XA 4RY1A 1BA5A 1XD7A 2Y84A 3K4JA 2J5OA 1BJAA 3AL0B 4LJZF 3OSQA 3L2VA 1WH7A 3O6GA 3CCQI 3LR1A 4E0WA 2VI6A 1JKQC 2CSOA 4UA8A 4OMZA 3QYFA 1NV6A 3CCMI 3OSFA 1LAGE 3D1RA 3S2HJ 2ZXJA 1DGRM 3OYDA 5ICFA 4AIJA 1XTAA 2KJCA 4R1HA 3C36A 3H3GA 4O7IA 3S3NA 1IJWC 3IOWA 2YR2A 4I3YA 3BR3A 3FZVA 4XSXF 3W2VA 2VOOA 3T0YA 3O28A 3I54A 2Y0SN 3S2VA 4GWZA 2QVUA 3Q9SA 4NTLA 1JGGA 2DMTA 2D1VA 5DEQA 2JUGA 2R5YB 1A36A 2OA4A 2XGEA 2DXRA 2FA7A 3ESWB 1R36A 3G3FA 4PFIA 2EB7A 3GTJJ 2UXAA 5HODA 2HVSA 1Z05A 1SBPA 1IGNA 3VV5A 1QUIA 2DOFA 3VYRB 2VOPA 2GXBA 4QPQA 4GBWA 3ZKKA 4L0ZB 1OMIA 2YUSA 3JSOA 2CGPA 5F1RA 3GZ5A 2Y7PA 2VBWA 4G6DA 4NE4A 1URGA 3C4MA 4F93B 2W1OA 3BTJA 2OWZA 5JFRA 1B1XA 3GXAA 2A05A 3IJXB 3K70D 1P1QA 1BOAA 3HZJA 4G12A 4II2A 2GBYA 2RNGA 1FOXA 2XX7A 4N8GA 1B4AA 5F0HA 3ZMSA 5ILVA 1U9OA 4IF4A 1LGBC 2JRMA 3GMEA 1MQGA 2R7RA 1FMVA 1CF7A 2DT6A 2FNPA 2OTLI 2X26A 3HOUJ 4JWYA 1AKHB 3HGYA 4A3DJ 4YB7A 4YU0A 2ELKA 2R4GA 3B02A 2DDBA 3EUHA 4AUXA 2L7ZA 4KMFA 4MF3A 2IGMA 1SYIA 4BDQA 4BXXJ 1G0HA 1NTCA 4KFCA 1LBZA 3TTMA 5EJCA 5I84A 4D5FA 3WGHA 1K9YA 4KISA 1T6SA 2VXZA 4N6KA 5EGOB 4A6DA 1ZTRA 1KA8A 3E7LA 3LSRA 1ZREA 3MP6A 2VE8A 4HBLA 2DPUA 3CP8A 2V1UA 1E17A 2NVQJ 1A31A 3MSTA 2GOMA 4IR8A 1ETKA 2M8EA 3HEFA 2PCRA 2Y7IA 3LSHA 3MUQA 3G73A 3RKWA 3RQIA 4E7LA 1FCKA 2NS8A 4PUSA 5FB2A 5HNFA 3RPUD 2ONKE 1JTXA 3E4RA 4LQ5A 3TQWA 2YPNA 3O97A 1WWXA 3N26A 2V9VA 1I5ZA 2KIFA 2ZCWA 4I3EA 3RIRA 3ZMVA 1LFGA 2QQBA 2KLFA 1B72B 2MABA 2Y5KA 4OVJA 4OZ9A 2G93A 5H8QB 4Y3OA 3KFMA 1ZKBA 4C9YA 5K7HA 1ODDA 3JRFA 1Y1ZA 2XGCA 3PUXE 1KQ9A 4JSOA 3AL0C 1TT5B 2CQ7A 4XQFA 1RUOA 1LCFA 4NHBA 3P7IA 2FIXA 2GZWA 5ICQA 1OCCH 1P4XA 2OZZA 1XS5A 1ZHFA 5HS7A 3ECOA 4RAZA 2OD5A 3U21A 2MLKA 4JOMA 2P7CB 1USTA 3EHTA 4RLQA 2K3FA 4RBOA 1MPBA 4HV5A 3EQLF 2R9JA 3UNGC 3OS2A 3WU2C 4B09A 4BY7J 1Z77A 3ZRGA 2COBA 3KSJA 4ZYAA 2E1MB 2FXAA 2P8TA 3QRFF 4X6AJ 1TWAJ 4F7ZA 1XDUA 3IL1B 1NV4A 1QVTA 4H45A 2DOAA 3AG3H 3RZDJ 2CV2A 3U92A 1FOWA 2MA3A 1J5YA 3BY6A 1EZPA 1GXPA 4KIGA 2JA7J 3BR6A 1IF1A 1T0FA 1UHMA 4I0BA 1OCOH 4KMUX 5A2QZ 2M8GX 1ETQA 4UUSB 4J00A 3H6WA 2X1DA 4ZEIA 5J40A 2DA5A 3VWBA 5LEJA 5CKTA 4OVSA 1ETWA 1VQ6I 4W97A 4FE7A 3I4NJ 1YHQI 1ZU0A 3F8NA 5H8QA 1Z6TA 1TFDA 2RCAA 2WAQA 4YIRX 3PPOA 3U93A 3HRTA 5F1JA 1ACIA 1PVEA 3HTSB 1MM7A 1OLTA 1R22A 1V5FA 1R1UA 1Q9DA 3KIOA 1A99A 2PN6A 4XRSG 5FJ8J 1D8JA 3IX1A 3RQTA 1FC3A 3IKVA 2E2HJ 2UYFA 1OFCX 2HAVA 2VXDA 1ZTYA 3OSGA 2JTVA 1JE8A 1QKBA 2RCBA 2VPNA 2GIZA 4RB0A 1Y1WJ 2ZB9A 1LEBA 1PB7A 4P3LA 5CI5A 4NF4A 3SEVA 2F5EA 2V3UA 4HCWA 4HF1A 1ZR2A 3HOZJ 3RJPA 2X4HA 3K1PA 2KKOA 3ZP5A 1S7YA 4IO6A 5L9SA 4PETA 5GPCA 3C31A 2LMDA 5M3MJ 2VJ4A 4NF8A 4A3GJ 3ASOH 3D5SC 5E79C 5D8KB 2ONRA 1LDDA 3F11A 5HPQA 2VT5A 1JUSA 4PJNA 4IJAA 3EYYA 4OANA 4N17A 2I6EA 2OCEA 1LVKA 4RM3A 4AIDA 3S17J 1U8BA 3H5RA 1OCTC 1FQCA 2LAOA 3CTAA 1MSFC 2HEUA 2EA4A 3GYHX 3FXJA 4DCYA 4FT8A 3RDIA 4F3SA 1WI9A 3C1DA 1US5A 2RN7A 1NUWA 2CQNA 2K9SA 5LOMA 1IXIA 3PFIA 3WTVC 1PYVA 1ZELA 3O3KA 4WX9A 3CMMA 1VFEA 2V6CA 3G3IA 5K7FA 2H6BA 2I0BA 5TP9A 2HOTA 3IWZA 1X19A 5ET5A 3QU6A 2QZ8A 3SDBA 3Q3SA 3B6TA 1V5EA 4XKNA 3OY9A 1SD7A 2QVRA 1ZLJA 2OC6A 4BDOA 2QVVA 2HXIA 2Y7KA 4L17A 1BJZA 3E79A 1MBKA 3IUOA 1MXVA 2ABHA 1ZG3A 3MBPA 2FD5A 4NF8B 1P2FA 1FPLA 4DZPA 2ID3A 3TZAA 1TWYA 4OHNA 3FXRA 1T8IA 3BC8A 1FJ9A 5LBQA 3D1NI 3KSXA 4JVCA 1YLFA 4GYIA 3S15J 3W9VA 5F27A 2BEOA 4DXUA 3T9UA 2CH0A 2P7VB 1W5TA 1WHUA 2J5PA 3HYIA 4GGGA 2FMLA 1VDWA 4PTKA 3TTNA 4MQ9F 2R5ZA 3TODA 2A6EF 1MXUA 1MNDA 2Y0MA 4Q5SF 2F97A 2KIMA 3EHUA 3J7YJ 1WRJA 2OLBA 3BTIA 4HX4A 5F64A 3ULQB 4POXA 1Y20A 1AA7A 1LBWA 3MVWA 3TBIA 1WJBA 2PG4A 1YS6A 2NNYA 5E20A 3ZS6A 1AMFA 1IZ1A 2L7MP 4FHTA 1EA3A 4PGGA 3JRAA 1J9IA 3REOA 1B51A 3Q29A 1KQ0A 1K6OA 3KJ7A 2V93A 5EYRA 3HN0A 1XC5A 3LUYA 3NOHA 1FIPA 2Z8EA 4P11A 2GA1A 1P9QC 3DP7A 3S1NJ 1ZMGA 4N91A 5J1YA 3HPGA 3BOQA 1FPDA 3O6HA 3JSPA 1WH5A 1MBEA 3H35A 1G8XA 5TJJA 3OO7A 5E1ZB 1G3TA 3BJ6A 3Q0UA 1NUZA 4HV6A 4HQEA 4MH5A 3P5JA 1QPMA 5FROA 3IO6A 4F19A 3KC0A 2ZNTA 1SAUA 3SQNA 4NQ8A 3V8JA 1FBDA 5C4XJ 3FATA 4G7OF 3LNQA 3IK6B 4MLVA 1ZGAA 2ISYA 1FTAA 2QQ9A 3V7RA 5IOZA 3IR1A 5E17F 2FMYA 4QWQA 4KPTA 4ZDPA 1NG6A 3O6BB 4B3AA 2CEYA 3DBRB 4JYKA 1IRGA 2P3NA 2UVHA 3ZQCA 4B48A 2E1SA 1MGTA 2CMOA 3BG6A 3EKIA 4JXIA 3W6VA 3M4OJ 2L5VA 4P9FA 3CF5F 2F4OB 1SD3A 3FKIJ 1UTHB 2O69A 5DEXA 1JW5A 3GO5A 4FEBA 3F8BA 4CYDA 4QFPA 4KCDA 3N5LA 3T93B 3GUDA 3KP4A 3KG2A 3FJGA 3ILUB 1MBFA 4UABA 3CJRB 4NF6B 4NC7A 3C32A 1A04A 5FBPA 4A3BJ 2AIXA 5FKKA 5HLIA 4RB2C 3J80Z 3TDZC 3OYKA 1OLAA 3UP9A 2XF6A 1U5TC 3ZQLA 2D2WA 1LJ9A 2E19A 5CVVA 2XGDA 4CCJA 2F7BA 1FP2A 2F3DA 3LSWA 1DPRA 2OBPA 2UXNA 1J0RA 2GQ1A 3DLNA 2Q2AA 2STTA 4XKWA 4U7BA 2Y5LA 2L9VA 2VN2A 3JRDA 1MMDA 1OJLA 3N4MA 5ILSA 2K85A 1IMAA 1OLCA 1XSDA 2WX9A 2NYXA 4ZZEA 5ICGA 4FX4A 3A03A 1EZOA 1DTZA 4CYCA 3HRMA 2FBKA 2XF7A 2VE9A 1PUEE 1ZARA 3K2AA 2HPMA 2G29A 1B8IB 4QFKA 3LSJA 3HRUA 1VE4A 5CMCA 4UVCA 3S2DJ 1SI1A 2KPMA 3W6JB 3V8XB 1RI7A 2JT1A 3C2BA 4QTRA 1IEJA 3U72A 5HOOA 1BIYA 2IEKA 3PNYA 2NAZA 3VVEA 3V8KA 3HC7A 4B1RA 4F55A 4QIWN 3DP4A 4OFLA 4Y15A 3ZR8X 5AA2A 1DQUA 4KT6A 2ZXTA 2K3PA 4XKQA 4HQMA 1XPXA 4IOAF 1W36D 1P1NA 1SW2A 5I56A 4RAGA 1AOVA 1HSJA 1SMYF 5AA2B 2RC7A 1IN6A 1ORKA 2DK8A 4LLLA 1R00A 4NC6A 4RGRA 5M5WJ 4AIKA 1GDTA 4N6DA 2W85A 2K4JA 3VOEA 3F8MA 1WJFA 2EFWA 2A61A 1WKMA 1GLNA 4I6ZA 3G1MA 2BXZA 4XLCA 2GXAA 2XD3A 2DA7A 2A5TB 1OQYA 5J4YA 5JVGF 4UNOA 3HTUA 2DA2A 4ESBA 5DM7F 4BQAA 3RY3A 1DDNA 2FVZA 2V9KA 3SFZA 4FE8A 3HDDA 2GFEA 1X58A 2E2JJ 4YIFA 4PF6A 5HDKA 3QQAA 4NUBA 2G7HA 1TBXA 4IOCF 3U65A 2CZLA 4BDRA 3M07A 1EKEA 2YJPA 5DTBA 3TYHA 1IDYA 5ICTA 1LBYA 1PDAA 1HSLA 3RTFB 2FUG2 1H8AC 2RDPA 3BKIB 5ED4A 1M5FA 3PQJA 2UUZA 4GO1A 5EQAA 3TTRA 1FY7A 2DO7A 4II3A 2LKSA 2YS9A 4GXOA 1IXSB 2IJLA 4JB7A 3IHUA 4GYGA 1LPQA 2AXTC 3FMRA 3VDXA 1BBYA 2VB6A 3HL2A 2ZJPF 1DPEA 4NMYA 3JYRA 1IDZA 1X4PA 3BQZA 4UUTA 1Y0UA 2A68F 2ADUA 2VKVA 5H8FA 2DYXA 1F36A 1H45A 2ZZWA 3VLVA 3A0BC 3IC7A 2JA8J 2P2AA 2UZKA 2DN0A 3PUBA 1ZLKA 1XC1A 1PP7U 4ZTJA 3BG7A 1D3KA 5ICCA 2DS9A 2HFBA 3CJQB 3HOSA 1Z7UA 4I62A 1J75A 4WWCA 3BG3A 1STZA 3MYUA 1OYYA 4BHCA 4BXUA 2Z8DA 3RKXA 5FRNA 4DQ2A 2NVTJ 1XSXA 4BDNA 3SHFA 2V3TA 4WEPA 2A3SA 5DV5A 3WTXC 2XKPA 2PT2A 4BBSJ 5F0CA 1NV3A 1YW7A 4YFKF 1LNWA 5J47A 2Z33A 1R9LA 2DT5A 4E7IA 1K9ZA 2ZSIB 4MX6A 5BUUA 3CDIA 1X3ZB 1Q1VA 3CUQC 2XXXA 4EM2A 3TQLA 2E60A 3LSMA 4UUSA 2OK2A 4XK4A 1FPKA 1KWHA 1N84A 3MWBA 2Y0SA 2V84A 4C1TA 1HW5A 5KNLA 2GQQA 5E1WA 1FBGA 3NWSA 3SZGA 5B66C 1G4DA 1QZEA 3LC8A 3SEXA 4RDUA 3F6VA 2Y69H 4M9XA 1XI6A 4HF0A 3J7AY 3T96B 4DI3D 4XIDA 1QVSA 2XXRA 3BIHA 4R6KA 5CRYA 2VQLA 4HE0A 1R71A 2DWIA 2MSYA 1U6GA 2F48A 4Y17A 3B6QA 5IYCJ 4HTGA 3TCHA 4ANJA 3N05A 4WXCA 4RJZA 3PPRA 1SD5A 5F0FA 1O3RA 4BDLA 3L2WA 5IYDJ 3H03A 4OA4A 3PMVA 5GP9A 1U0JA 3D5LA 3A09A 2PBWA 4N15A 2NXNB 1DU0A 2QA4I 2ZNUA 1RUNA 3MKLA 1ETOA 2GRVA 3MWMA 4PFPA 1WJCA 3QPHA 3OYEA 3G4SI 1RYOA 1HCRA 3IL2A 1X3WB 3MZ9A 4EXLA 5DVIA 3M3YJ 5FTIA 4HSRA 4DW6A 3MW0A 3RPUA 3NARA 1FPEA 2CW7A 5IY5H 1T0FC 1VQ4I 1N0TA 2W7NA 2UWMA 1RNLA 1TQPA 2CEXA 1IRXA 1MH4A 4HS7A 4LMYA 1BC7C 1JEVA 2RC4A 4U23A 2KIUA 2P81A 2KRCA 4B4CA 3LAPA 3V4GA 5L3DA 4XLNF 3F21A 1B7HA 1UTBA 3KP7A 2IPQX 3K4KA 2MGQA 2RV8A 3TW6A 5H2FC 1L0OC 1IRFA 5HLGA 1LAFE 2KP6A 2BZTA 1DUXC 2R7QA 2O8XA 3TUSA 1FOKA 1Y4CA 4AYBN 4CYCB 2D5VA 2WTEA 3NAUA 3CUQB 4PDHA 1IXHA 4ESFA 1I6AA 5D8LB 4IZZA 2CQXA 2FBHA 2H27A 2WY8Q 3ODBA 1LFHA 2VC1A 4KUMA 3HOWJ 1XT8A 3MAMA 2L7KA 3CZ6A 2EJRA 2MLGA 4E7SA 1LCTA 3EN3A 4A0ZA 4F1UA 4CXFA 2FE3A 3TEDA 1MG1A 3GLLA 3MZ1A 2B63J 2LSOA 1MXWA 3OOUA 5CYVA 4BNCA 2V1XA 3MPLA 4UY8I 2CQKA 3PUWE 3H3UA 4BQOA 5HBCA 2LDUA 3NWTA 1UIUA 1DGWY 4U7DA 1LLSA 2Y7WA 4DYCA 4PFBA 3K10A 4XTCQ 5AA1A 1B58A 2WBMA 2ZO4A 3CCJI 1MY4A 2MKZA 1P7IA 3GW2A 3H36A 4IO5A 3JRBA 1BM9A 5EEGA 3V7SA 2YU9J 3J81Z 1SW4A 1MH3A 3TL4X 1BIAA 1B9NA 3LFKA 2M30A 1EF4A 3JV9A 4ZYDA 4KHZE 2DCEA 1OQGA 1KYWA 3IV5A 3DELB 3QOEA 3OIQA 4UHTA 2E36A 2VASA 1MJAA 4BKXA 1QW0A 2RQPA 2H9BA 1Z3XA 4ZDMA 2VGQA 1T0KA 3GVAA 5D5WB 2X1EA 4R74A 4JWOA 2GOXB 3WTUC 1T2KA 1SW1A 1VI0A 3LFUA 1QRYA 4YFNF 2FBPA 2LY2A 1EZ9A 3CMYA 2VKDA 4ESWA 1Z9CA 3Q27A 2KL4A 4U1OA 2XXPA 2EFQA 5BS6A 1W7PD 4QSHA 3F22A 3CJTB 2HR3A 3KE2A 4A3JJ 3MVYA 1O7FA 2PMZN 2VBXA 3KP2A 4Y33A 4NWCA 4LK1F 3E5XA 5LRRA 2H5YA 4HRIA 1KZ8A 1BKAA 2RREA 1FBEA 2AQEA 2QF7A 2JVHA 3L00A 1Y8RB 3JREA 5HDNA 3THIA 2FF4A 2Z9OA 4U22A 3A4CA 1FQFA 3RT6B 1IV8A 1FLIA 2VD3A 2X7QA 2XXUA 4L9JA 4H5GA 1LDKB 4W1UA 4OXVA 1LQ1A 2EV5A 4E7HA 5K5OA 3X2QH 2IT0A 4ELOA 3E3KA 1FPQA 1JW1A 2B3BA 1ZK8A 4X1EA