1HSJA

Sarr mbp fusion structure
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
487
structure length
487
Chain Sequence
KIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALAAAQTNAAAEFMSKINDINDLVNATFQVKKFFRDTKKKFNLNYEEIYILNHILRSESNEISSKEIAKCSEFKPYYLTKALQKLKDLKLLSKKRSLQDERTVIVYVTDTQKANIQKLISELEEYIKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FUSION PROTEIN CONSISTING OF STAPHYLOCOCCUS ACCESSORY REGULA
publication title Crystal structure of the SarR protein from Staphylococcus aureus.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription/sugar binding protein
total genus 143
structure length 487
sequence length 487
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
A PF12802 MarR_2 MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1hsjA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1hsjA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1hsjA01
2P5KA 1XVXA 3C34A 4NF4B 3C18A 4U1ZA 2REJA 1B52A 4GL8A 5HDGA 1ZBMA 2XXWA 2XXUA 3T0YA 4WF2A 5TP9B 4BHBA 1IRGA 3O6HA 1XCVA 2DPUA 3V89B 4GYIA 1EV7A 1KU3A 2GA2A 3DP7A 1POTA 3JAMK 1CE2A 3ELKA 2P2AA 3FXQA 2HS5A 1I1GA 3CUQC 1R22A 2EFWA 2HAVA 3PU5A 1ON2A 4HCWA 5KCJA 4I1DA 4YKJA 4A12A 3WU0A 1FP2A 2I4CA 3RT6B 1W7PD 4R74A 3S2VA 3R61A 3ABUA 5KZTA 4KT5C 3ISPA 3MZBA 4LP2B 2Y7WA 1IXCA 1LEAA 2W84A 1BIAA 2JPBA 2QQAA 4LQ2A 4OTEA 4XKPA 3EETA 2VBZA 2F97A 1M5CA 1MS7A 3VOEA 4ZZAA 3BFUA 3K6WA 5LRSA 2P6SA 2M5WA 4N13A 2GAUA 3BY6A 3KP7A 1SMYF 3MQ0A 4U88A 3J81Z 4WXDA 3ZMDA 2MH9A 4NF8B 3K6UA 1MH3A 4H1XA 1R00A 1YW8A 1JVYA 5CLSA 3FJMA 2DP8A 1FWZA 2F78A 1ZGJA 1Q1HA 4A5NA 1MDMA 3N5LA 3ZSFA 1NH7A 3QUFA 2QL3A 2PQ8A 4F2OA 3CUQA 4CXFA 4XKRA 2Q89A 1WVJA 1LSTA 5FHMA 2DK5A 3I3VA 1USSA 1ATGA 3G3GA 3LFKA 2IJLA 1D3KA 2HAUA 1I6AA 1J1NA 2H94A 3HSFA 2FE3A 1J0RA 2ZYNA 4I01A 2H99A 3RPWA 1OLAA 4ZZEA 2Z3YA 3BJOA 1TTYA 3RY3A 4IRHA 1NKXA 1K79A 1IEJA 3R26A 4YICA 1VE4A 5AONA 4S05A 4ZDMA 5IKBA 4NB5A 5BMZA 5CVRA 1UFMA 5I56B 3KZZA 3EHUA 3VLVA 2DBBA 3TGNA 2K4JA 4OVJA 4ONYA 5AA3A 4QF9A 3B02A 4AVPA 1JETA 3C7JA 3HO7A 4EJVA 3TPAA 4YFNF 4O3BA 1URDA 3T8RA 2PEXA 4XLPF 4L0ZB 4QFPA 5EHSA 4GIZA 3D5LA 1IXGA 2QYOA 3I5UA 1B3HA 1R1NA 3TELA 4ELQA 4ZECA 1MY2A 4RGRA 3EF7A 1BI2A 1FTJA 1NHAA 4QHQA 2A5TB 1OLCA 1L5TA 2RV8A 2DOJA 2QQ9A 1I69A 3O28A 2KIMA 3MZHA 4LLGF 2IEEA 5FLXZ 1LQ1A 5B70A 1SD7A 1US4A 3P9IA 1FQBA 3KP5A 3CTAA 2WWYA 5FO5A 2DS9A 3H03A 3VVDA 2K27A 2IVMA 4HDVA 4Y15A 3FASA 3FATA 3I53A 1MRPA 1O3RA 2UVIA 3KSJA 5DT6A 1P1NA 3BJAA 1B1BA 4B09A 1J9IA 4FE8A 2OZ6A 4F3PA 3RKWA 2E1NA 2EFPA 5CMCA 5KCJB 3O66A 2Y0MA 3P7IA 2NAZA 3HUGA 3I64A 5EEHA 4EJWA 2QQBA 3TTNA 1GXQA 5LEKA 2H25A 1QJMA 2DLLA 3RPQA 3FUZA 3VVEA 2L01A 4L9NA 4Z7EA 4U23A 1FBUA 1A8FA 1TT1A 2O84X 2Z33A 3L6GA 3I59A 1B51A 3K2DA 1D5VA 4YMBA 3O9PA 3FX3A 4RAZA 3FHZA 1O7TA 2O69A 2UVHA 3FJ7A 3MCZA 1OYWA 2PMUA 4FJPA 2PFBA 3K1MA 5D5UB 1FW0A 4G8NA 2XAJA 4GXAA 4OFJA 1A04A 3BBRA 2DWJA 4RK9A 4OOIA 1PP7U 1LDKB 2FNAA 1U5TC 2ZMEA 3Q9SA 2E0SA 3HV1A 4ELOA 4TOZA 3PUVE 4L9JA 2LKPA 4Z2YA 3EDPA 1Y1MA 4F19A 2A69F 1Z6RA 2FBHA 4YKPA 1OKRA 3CUQB 1FOKA 4I7HA 2HEOA 5LHGA 2RKMA 2FEZA 3SEWA 2RN7A 2V1UA 1AWCA 3VB2A 5HBCA 4U1OA 3GVAA 5BS6A 1E17A 1VR5A 3KP2A 1HW5A 3QIMA 4DDDA 1B3EA 3A09A 5HS8A 1PB8A 4F22A 1ODDA 4PGGA 4ENMA 1UIVA 5ICCA 5TPAA 3TQWA 1M5BA 2R7DA 4P96A 3BZ6A 4IJAA 1FP1D 5ICQA 3GZ5A 1ZYRF 4M4GA 1U5TA 3KG2A 4R72A 3SEUA 1D3YA 2W25A 2O1MA 3E5QA 5CM6A 2YX4A 1ZLKA 2F5XA 5DVJA 3RIRA 3T96B 4R6HA 4ISUA 4F1VA 4F1UA 5K2XA 1SAXA 5HS7A 3U1OA 5TU0A 4R9FA 2VC1A 2EV0A 2XAGA 3S9NC 1O3QA 2UYEA 3OO9A 3KP3A 3HRMA 3MAJA 3U9GA 2ZXJA 3DP4A 3T66A 2WV0A 4EUOA 5DYHA 3QU3A 1LDDA 1S7OA 1GTKA 3MVWA 3NEUA 5DD4A 3R6SA 4OZ9A 3JYRA 3KE2A 3ECRA 3O29A 3AXFA 4KHZE 4EDPA 2CG4A 5CI5A 3F23A 1FQFA 2GZWA 5HDNA 2I3VA 3KJTA 2QENA 2R71A 1F9NA 4P9UA 5CJ9A 2STWA 1IXHA 4MFIA 1ZARA 4Y17A 1I6BA 5DUIA 2ZJ2A 3J7AO 2M30A 5DD8A 2HYGD 3DV8A 1PEBA 2M8EA 1SQYA 2ZKZA 2DWAA 3W6KB 4KICA 2Q2EA 3IK6B 3LQQA 4EQ9A 3HPIA 1B5IA 4EXLA 2FSWA 5J8FA 1FTKA 4DXCA 3FMQA 4I0BA 3WTSC 4G7OF 3FGSA 3H3GA 3EUHA 4F1YA 2EJRA 1J7KA 5L3BA 4OFOA 2NXOA 3J81K 4ZZLA 3MAMA 2X0LA 1GV8A 2F7AA 4H5FA 4U7BA 3OXNA 4Y13A 3TTRA 2WKYA 2A5SA 2THIA 1LAXA 4IY6A 4P5OA 2LSOA 1FQCA 1R1VA 3RKXA 5D4SA 3Q5FA 1FNNA 4NE4A 2Y7IA 3I59B 4IPAA 4EV0A 2L4MA 1OVTA 4GQOA 2OLBA 1O64A 3MVZA 2LF8A 3Q25A 3CO7C 4DE8A 4EGZA 1NL5A 2XD3A 3G3HA 5K5QA 1VTNC 3VXCA 1MQGA 3MP8A 1M5DA 4B8XA 1B1HA 3DP6A 1REPC 3PFIA 2D2WA 1EH8A 2ZMEB 3LSTA 3PUZE 1ONVA 2HGCA 3TQNA 1J2XA 3LC8A 1X3UA 1IXRC 1B05A 5DVIA 4WEPA 3IOVA 3UK4A 1TLHB 1B9JA 4KD5A 4TQUQ 5CMMA 1N76A 1T0FA 2YLNA 3WTTC 4GO1A 2FXAA 3F3XA 2EFOA 3BFTA 3PPNA 3PUWE 5E1WA 4H6DA 3CUOA 2Y48A 3RTWB 3TMGA 2GHAA 1AOVA 1YTVA 1IZ1A 3GW2A 2ZYKA 3IRQA 3TZAA 3AAFA 2Q9TA 4KCDA 2UVGA 3D4CA 1J59A 2OK2A 1N04A 4MF3A 2OA4A 5L9MA 1LB2A 2FMLA 2RVCA 5TPAB 3HTSB 1MH4A 4M9XA 3V5AA 1TQMA 4U7DA 4OIRF 1TW3A 4IO6A 2HZKA 1Y4CA 2XXTA 3TAJA 5FHNA 1OVBA 2DU9A 5FLXK 3HRSA 4QRZA 4IB2A 1YW7A 3ECOA 2V25A 5TP9A 2XXYA 5B7DA 4EVIA 2VT2A 4NWCA 3KEQA 3CFLA 2EV6A 3ULQB 1Y0UA 4AIJA 3DP8A 2UYFA 3VLUA 4OEVA 1ZRFA 1JW1A 3FIRA 3RTFB 2H6CA 3L2CA 1RUOA 2H27A 4OMBA 2QVOA 5K1YA 2GHBA 4PQJA 4LK1F 3KJ7A 3WU1B 2H5YA 3TTLA 1SVXB 3CG3A 1H9GA 4GWOA 1Z05A 1SI0A 5CC2A 2A6EF 3DPTA 2DTRA 2FBKA 3LA7A 3IOWA 4RAYA 4HLYA 4GL0A 4M9SA 1HKQA 1AMFA 2GA1A 1HSTA 2ELHA 5CMBA 1HQCA 2O6AA 3H92A 1B6HA 3E6BA 1SMTA 4F3GA 1OYIA 3T93B 2VE9A 1QZZA 2RGVA 1I6QA 5CRYA 1TQIA 1H76A 2KRFA 2AXLA 1XGMA 4ZZDA 1TNSA 2NVUB 3VXBA 2KKOA 3IOUA 2Q8JA 4NF5A 4R2BA 4MQVA 2TDXA 1CF7A 1MY1A 3M8EA 1IF1A 2V3TA 1HW2A 1QW0A 1XD7A 2H4IA 2EK5A 2L54A 2OBPA 3PQKA 1D8JA 1ZREA 1QZYA 1W5SA 4NHJA 4QFNA 1ZRDA 4LJZF 4OXVA 3MFKA 4ENJA 3PMWA 2BGCA 2MC3A 1NNFA 4BDOA 2COMA 1JQFA 2QUFA 1FBSA 2FQ3A 1Q1KA 3C31A 2DVZA 5FGMA 5E18F 2XD2A 2X4HA 1ELJA 2F2EA 1FYMA 3JSOA 3I0TA 1URSA 1EH7A 3RNNA 4GVOA 2FOKA 1JEUA 3EHTA 2BBYA 3ZS6A 3MQ9A 5K2YA 4LZ7A 1JGSA 4XKQA 3KLNA 1UIUA 1KU7A 2IA0A 4IRGA 3MPLA 2M8CA 4IO7A 1DUXC 1YO5C 4RGSA 1H45A 2UZKA 3MZYA 3RKYA 4AD9A 5E17F 2XASA 4DZ1A 2V1XA 1T98A 4ELPA 3RT8A 3TO9A 4HF1A 3OO8A 3CFXA 1FC3A 2XXVA 4RY1A 1Z91A 1QULA 1F5TA 2O8XA 3BDDA 1OIBA 5FD6A 1BIBA 5I59A 2F5EA 4ZH4F 3MW0A 3GZ6A 3WE2A 4IO4A 1N0TA 2NNYA 4MEYF 2OZZA 3IO4A 3WGGA 3ZN1A 1DPUA 3QK6A 3FVOA 4XBFA 2EA4A 1SFUA 3CJNA 1LEBA 3B6WA 4YB5A 5JHUA 2XAHA 2QPQA 4G68B 1I27A 3BP8A 1VSOA 2ONKE 1FY7A 4HA8A 1GHCA 5J1DA 2PI0A 2O3FA 4JB7A 5BWJA 2AIXA 3G3JA 4FX0A 2P1SA 2PN6A 3PPOA 2MH2A 3F11A 4OMZA 2I6EA 1SYIA 4EJTA 4OETA 2HOEA 3Q26A 5KDTB 4ENNA 4IXAA 1WSUA 3BOQA 2O6GE 4HZFA 2E1SA 1HW1A 3LSLA 1F1ZA 3K6VA 1KQ9A 4EQQA 3TKYA 2A6HF 5EYFA 5H8SA 3R7XA 3M9AA 2MLKA 2I49A 4IO3A 3Q28A 4WEDA 1D9YA 3FXRA 2VOOA 5I2NA 3BKIB 4OIPF 5CBRA 3BROA 1O3SA 1LCFA 4UACA 2QLZA 3QAXA 2GXBA 3V7SA 1BP5A 4JSDA 2MA3A 4CZZA 4XSZF 4ZYEA 3I6VA 4RNSA 3IOTA 3PD9A 1N7XA 1B0HA 2HKOA 4R9GA 4O3MA 3TTKA 4KFQA 1LFIA 3R4KA 4YKIA 2NS0A 1XSDA 2QMXA 4R2FA 4X1BA 3TDZC 2HDCA 1USYE 1UQWA 4THIA 1JHFA 1RI7A 2XKOA 2ZFWA 4HX8A 4N9IA 3MZ1A 2QMWA 4JBAA 3MWMA 1ZG5A 4H65A 3GFJA 2PG4A 2F34A 3N6TA 4Z0IA 5I58A 2FNPA 3QP6A 2NNNA 2XXHA 2YPNA 5I2KA 4LD5A 3M8UA 5DCMA 3GUDA 2VBXA 1XGNA 3HOSA 3KEIA 3R0JA 1MQHA 4NF5B 2VOZA 1T6SA 3KN3A 1CF7B 2P0SA 1WKMA 1YYVA 3FVNA 3FJGA 3G3IA 2RDPA 4MLQA 3E5XA 1P4XA 1ON1A 2DW4A 4GFRA 3M7GA 2RCAA 5L3GA 3FVGA 3KOTA 4MGRA 3FZVA 1KU9A 1YPNA 1L0OC 3M3FA 3K00A 1A54A 2R6GE 5DYMA 4YU0A 4AIKA 2IA2A 1H44A 3SZTA 4I09A 4I2OA 4U22A 2O0YA 2XHKA 4G8XA 5F7VA 4I8CA 2HZLA 5IT9Z 4OERA 1XN7A 3L09A 1G3SA 1EZ9A 2O7UA 4PETA 4I0AA 1XGSA 4PZJA 1OMIA 2JPCA 2Z8FA 3B6TA 3K02A 4P0IA 3E13X 2VN2A 1ZMGA 4S04A 3A3CA 3SZPA 1EU8A 4YFXF 5ITPA 1FSHA 4PGHA 3T9XB 2X26A 1P2FA 2R7FA 4G9YA 5H8FA 4F31B 2JTVA 3C36A 2VP1A 2PX1A 3R6UA 5I59B 1FQDA 2P7VB 3Q27A 4XRFA 4K3FA 5H8NB 2DO7A 5AE4A 4L9TA 1B9NA 5L3DA 3LBSA 3TCHA 2K4BA 3RTRA 5E8IA 3LAPA 5JEIA 4I62A 3P9KA 1CB6A 3JV9A 2UXXA 4WK8F 3RLFE 1B4ZA 3GF2A 4L5JA 4LG0A 4KDPA 4YZZA 4IGTA 4ESXA 3TDJA 4P9FA 2B3BA 5LGNA 4POWA 3W6JB 2VC0A 2D21A 2ZNSA 2FA7A 2ONSA 4LZ5A 2JRTA 3ILTB 3OELA 1RKMA 4HF0A 1R5HA 3N94A 5L9SA 4F7ZA 2DSFA 3EYYA 3CSBA 3ONMA 3HN0A 3GO5A 4IHSA 1F9BA 2I4BA 4GLIA 3A3UA 4BHPA 1MPBA 2RCBA 4JWOA 3VDFA 4BHCA 2IPQX 1HKSA 2OAZA 4KFCA 1MXUA 2DWHA 5H8QA 2DE3A 3PPQA 4WXCA 3TFLA 2FU4A 4XSXF 1P1OA 3WAEA 3SDFA 5I2NB 1DTGA 5DVFA 3U93A 4M72A 1XMKA 1LLSA 3R0AA 4PCQA 2V9VA 4U0WA 1MXYA 3MVYA 2H9BA 4JDFA 3DF8A 5D8LB 3UA8A 3D0SA 3PV0E 2PYYA 2YPRA 1QNTA 2IA4A 2UXAA 2RC8A 2B3FA 1N3WA 3EPEA 2HQRA 1USYH 3WODF 4U4XA 4RYAA 1K6OA 1LB9A 4O3CA 3V8XB 3E3VA 1BBYA 5LRRA 3FV2A 4LB6B 1IIWA 1IW7F 3V4GA 5D6EA 4RPNA 4P0GA 3HHHA 5HDKA 3UP9A 2Z99A 4HAMA 2GFEA 5I58B 1KQ8A 3TTMA 3E4RA 1MY3A 1VFEA 5I2KB 1D8KA 5DCMB 3VLWA 4ON0A 5H8HA 3GLBA 1B1XA 3B73A 2Z8DA 4TLLB 4KA4A 1OQHA 1P99A 2B0LA 3ROUA 5ED4A 1V4RA 2XVCA 5BQTA 3K2ZA 5L9OA 3G73A 1G3YA 2JT1A 4QSEA 4EJUA 1DP7P 2KLFA 1O7LA 1R1TA 1PBPA 3LUYA 1ZKBA 4ELRA 1R1UA 3LA3A 2UWMA 5ISUA 3E6MA 1B40A 1ZU0A 3U72A 4N9HA 4C0RA 5LOMA 5H20A 3WG9A 2HQNA 2XRNA 5JVTA 4G94A 4HW8A 3KGCA 4L9VA 4N6PA 4BQAA 2A68F 1PB9A 3MZ9A 1O57A 5ITOA 1FTMA 1KA8A 4WCGA 2P7CB 2HCAA 2ZO4A 5E8GA 2ZNTA 3T22A 4RGUA 4MEXF 5E1ZB 5H8FB 3I71A 2XXQA 2G7HA 3KFMA 4FX4A 1PB7A 1BTJA 2ESNA 4HF2A 1ZLQA 3OOAA 3PQJA 2BV6A 5DCFA 2W7YA 3VV5A 2J5OA 3G3KA 2V93A 3LA2A 4IRIA 1A99A 3KN8A 5HM4B 2E7XA 5H6RA 1ZH5A 2XUBA 3V83A 4KPTA 5ILUA 5HLHA 3IC7A 1LBBA 2QRYA 3T9HB 1T38A 2Z23A 1MZBA 3L9FA 4EM1A 2AL4A 3ZQ7A 3O2PE 2R3SA 2M45A 3L00A 5L3FA 4KYSA 5HVQC 2LF7A 4G7ZF 4LG0B 2OWTA 2HFBA 2V6CA 2RC4A 1B32A 4DIGA 4O5VA 1U8RA 1QKAA 4RB3C 1QVSA 3WE3A 1FBQA 4KIGA 2QM3A 3MPKA 2EA2A 4GGGA 4JWXA 2OCUA 4BH9A 1A40A 3OOPA 3KETA 3RN8A 3SEVA 1BN5A 3HYIA 3C32A 3K01A 2RC7A 3QPTA 3FV1A 1JNFA 5H8QB 4BDMA 1LFHA 4LK0F 3O2AA 5HLGA 1B5HA 1BKAA 3MWBA 4IO2A 3RDIA 1GVCA 2O7IA 1ZGAA 2B65A 4YB6A 3WTXC 1MDQA 1SBPA 2A5YB 1B3FA 4U4SA 4DLDA 1SYHA 3SXYA 2FA5A 2DI3A 1LAHE 2XKPA 3SETA 5IT3A 3P7NA 2VBWA 3K0LA 1XS5A 5DV5A 4UVCA 4A0ZA 1T2KA 1ZHFA 3QRFF 3G3FA 3GZGA 2RNJA 4G68C 3SESA 3F21A 5EEGA 4AB5A 4WKMA 1POY1 2ISZA 1MPCA 2L4AA 1YS7A 4HOBA 1IN6A 2GXGA 3HSRA 3HIFA 3V8JA 1N84A 4AWXB 3LAJA 2ZNYA 4M6XA 4A0XA 4TV7A 3HRTA 2Y7PA 4P11A 5BUUA 1B59A 5CVUA 4G77A 1MXXA 3GBBA 4U0YA 3SEYA 4HYEA 1D4NA 3F8FA 5HOOA 1ZG1A 5IT9K 5AA4A 3RYPA 5H8HB 3IR1A 4MLVA 1U78A 3W15C 4G8MA 1J5YA 3OMBA 3RGYA 3E5UA 1RNLA 3HHFA 4G4PA 3IRRA 4O3AA 3T5XA 5AIPA 4PFUA 1ANFA 2XXPA 3IL1B 1IUDA 1O7FA 1JVXA 4F29A 3RI4A 2X7PA 2L02A 2J5PA 4HV5A 1UHMA 3BWGA 2DXRA 4G68A 5FTIA 2QS1A 2PBWA 5AA1A 4R75A 1QO0D 4NMYA 3K69A 1FTOA 4ZEKA 3PUYE 4GCVA 1NNTA 3N26A 3O6IA 4AB6A 5A5XA 1DTZA 5KDTA 1EZOA 5TJJA 3K1PA 1Z9CA 2FYIA 2OBGA 1B6AA 5DTBA 2HWVA 3OO7A 3ERED 2L3DA 2HFHA 5DEXA 2ABHA 1R6ZA 3NRVA 2JZYA 2DWIA 1Y3PA 2UXNA 4F18A 3IJXB 2ISYA 3THIA 1G3WA 1KU2A 3I58A 2HKXA 1FQAA 4L18B 1BC8C 5A2QZ 2D1HA 1B46A 3MBPA 4PDKA 3M8FA 1QPMA 2YU3A 4XLNF 2CYYA 2VONA 3G7WA 5F6FA 2P5VA 4O6JA 3I54A 1ZJLA 1S8NA 3RQTA 3OSQA 3RJPA 3EQ1A 1WODA 4MNUA 4U2RA 3OD7A 3KLOA 2GQQA 2XV4S 5CYVA 4RB2C 1MJAA 2K02A 2DK8A 4MQ9F 3CI8A 4OENA 4MH5A 3GYHX 4NF6A 1JHHA 1MY0A 4POXA 1OMPA 2Q2CA 4F3BA 1W5TA 2Q8KA 1U6GA 2RC9A 2QJEA 1ULYA 2XGXA 4EF2A 3GX4X 4HQEA 2E7WA 4G6DA 1B4AA 4FORA 2A07F 3HSEA 1Y4TA 2DAOA 3E97A 3RPUA 1A55A 2O61A 1G3TA 4HW0A 1MXVA 4GF8A 3T8TA 2CW0F 2Q0OA 4LMYA 4UVBA 3WTUC 5JR3A 1SW4A 4LLLA 2A3SA 1ZN2A 3O3KA 2YX7A 3VVFA 3KEOA 1P1UA 4I98B 2F7BA 1B7ZA 5I84A 4KQPA 4ZYDA 4UV9A 4HTGA 1S29A 4KR5A 3IB0A 2CWEA 4M71A 5D5VB 1I1SA 5AA4B 2HZTA 5EHMA 4RB1A 1DMBA 5E20A 4KMFA 1QBJA 1LCTA 3WTZA 4JQFA 3TO6A 2EFQA 5JI6A 3IJOB 3IB2A 4L5IA 1IQ7A 2PMHA 1P4WA 2VE8A 4EGYA 2PJPA 4OU0A 3H6UA 3MJNA 1EH6A 2IA1A 1SFEA 2OJTA 1D9VA 1SI1A 3GFIA 5K5RA 1YIOA 5H8NA 4QFKA 1FZPB 4JWYA 1M5EA 3N97A 2IRFG 2BJJX 4RB0A 4ESJA 4ETSA 2DPDA 2DQRA 1FYLA 3QP5A 4BLAA 3TEPA 1SW5A 1LVAA 5J6XA 3FM3A 4EM2A 2ZNZA 2YSRA 2XIGA 1R9LA 5BOXA 2EV5A 4ZYHA 3OENA 4KNYA 1IN8A 5KK1A 4DXUA 5F64A 2KJBA 1S7AA 2DT5A 1V3FA 3LSFB 4HDUA 5A5XB 2WTEA 3N4MA 4RJZA 2O51A 2O68A 4KMUX 4A5MA 5D5WB 1HSJA 1OPCA 2WC2A 1Y3QA 3ZMSA 3SERA 1MJ9A 1QUIA 5AA2A 1W4MA 3HSTA 5DEXB 4X1DA 1ZG3A 2UVJA 1LBCA 3V7CA 2F35A 5ILVA 3GWZA 3TDUC 4NWDA 3LSWA 4G2ZA 3IKTA 4Q30B 1XDSA 5F1QA 3IWZA 4A0YA 4IO5A 1TXFA 4PE5B 5JK4A 3DEUA 3U1DA 3JSPA 3T9UA 2EB7A 5J8CA 3OEMA 4FECA 4DQ2A 1XSVA 4A2UA 4KN7X 2DVCA 4L17A 5D5XB 4Q5TA 1FQEA 3KCCA 2AS5F 1WI9A 1Y20A 3J80Z 1PDNC 2XXXA 2K86A 4LFUA 3F6OA 4LATA 3TOBA 1BIYA 1UTBA 3DXJF 4ZE8A 1SD6A 1KYWA 3DPLC 3TKDA 2ADUA 5FFXA 1IRFA 3PMVA 2H6BA 1N3XA 1T39A 2F8DA 2I58A 1P92A 2IP2A 5JFRA 1WWXA 4WX9A 1Q35A 1UB9A 3IWFA 4GXOA 1LDJA 3I5OA 2GIVA 1I5ZA 3FVKA 1UTHA 5LGTA 4OMYA 2NUVA 4NF6B 2I48A 4CICA 3CR9A 2CFXA 5L3CA 2PMSA 4G7HF 2QS4A 3HCQA 4LA9A 1GVJA 3S9LC 1CGPA 2XAFA 1T0KA 1XT8A 1H3DA 1R36A 2V84A 1L3LA 1NNKA 2ZCWA 2FNCA 1ZTYA 3LQRA 3SKPA 1MQJA 1H0MA 2EFNA 1P1WA 4ZEIA 3ECHA 3TOAA 4P55A 2V3UA 2CGPA 1G4DA 1XHYA 4BDRA 3GFMA 2M87A 1MY4A 1WQ2A 4OYVA 3GBAA 3RUMA 4R73A 4LLNA 2STTA 3SEXA 4KN4X 4HCYA 4ZYGA 2F36A 3F8CA 3OV8A 3KZGA 4JBZA 4Q47A 4FHTA 1NMUA 4XXUA 1II5A 1PBQA 5ELVA 1MDP1 3OEKA 4BDQA 1Z7NE 5E1XA 2CQKA 3E3KA 4ZS9A 5ILSA 1VFDA 3PGFA 1OQGA 5CVJA 3I4PA 5LGUA 1NFTA 1IN7A 2XXRA 4NTLA 3DFGA 3K6XA 2VT3A 1PP8F 3KP4A 5ICFA 2RINA 2NRAC 2P4WA 3TCFA 4YMAA 1JXSA 4PFTA 4BDLA 2VOPA 3LSXA 5I57A 5CVIA 1KYZA 3IHUA 4HBLA 3E9XA 4EJOA 2QWWA 4GOTA 1Z1DA 1FCKA 3TUSA 4MHGA 2I0BA 2HQ0A 1YCJA 2CMOA 5A2QK 3CG1A 1MGTA 3K4UA 2XXIA 3PPRA 3B6QA 3JZJA 5CVVA 2OU2A 2ONRA 1DOTA 3IORA 1XMAA 1TW2A 2HYFA 3IL2A 1ZIUA 1KGSA 2KIFA 2PT1A 5BPIA 2ZYMA 4XTCQ 4U0VA 3MP1A 3REOA 3SFZA 1P1QA 1R23A 5AA2B 2E1CA 1FTLA 5L8DA 1H43A 4OFLA 4HV6A 3RYRA 4MBPA 1R58A 3IB1A 4ND9A 3COAC 4XKNA 3U92A 4JK1X 1UHWA 3NQOA 4R6KA 1MQIA 4Q48A 4UA8A 4OQOA 2ALUA 1TNTA 1EH3A 1JE8A 4UVAA 1S9TA 4ASNA 3S9EA 5D8KB 3E6DA 2XROA 5KVRA 2GRVA 3F8MA 2CO5A 5DEQA 4RK2A 1FX7A 3ZKLA 2F6GA 2HTJA 2FMYA 4ZEDA 1I6XA 4NQWA 5HPQA 3UIFA 3EHSA 3CRBA 3SHFA 3F8NA 1LAFE 1B4HA 1B7UA 4JXIA 3U2RA 1U2WA 4X9TA 1UTBB 2DYXA 4N07A 3L7WA 2V1DA 1R9QA 1B2HA 4U21A 3O97A 4Q8RA 4FIMA 3KBRA 3K9TA 2PLYA 4OIQF 4OESA 1AOYA 5F1RA 1SW2A 1P4AA 2D1VA 3KP6A 4DXBA 1YLFA 4I02A 4DNCA 4EQBA 2PT2A 3L6HA 4F39A 1UTHB 4X48A 1MKMA 2VD3A 1A7LA 1PDAA 3Q29A 2FRHA 3P9CA 1USTA 4LUBA 3USDA 4E0WA 1MG1A 4YIFA 4YB7A 4LONB 4IY5A 5LLQA 4M74A 1YG2A 4XIGQ 4PFYA 4CDGA 1MDMB 3ZN0A 1HSLA 3U8QA 1LAGE 1HKTA 2QZ8A 1TBXA 1HBXG 4M73A 4RXLA 2F5DA 1XGOA 3ZMVA 1RIOH 1BJAA 3DM0A 1BI0A 3PUXE 4OHNA 3T1BA 3DKWA 4HX7A 3KSXA 1RZ4A 3WTWC 1B7HA 3QPHA 1F4KA 1M5FA 4FEBA 3ZKKA 4YFKF 2MD5A 4ZEBA 2EWNA 2ANJA 3ZMZA 1KWHA 1TFAA 1XSXA 1YS6A 3H06B 3MP6A 4ESWA 3S2WA 5HS9A 2O1LA 2M1BA 2VBYA 1QUJA 4HX4A 2YJPA 3M3KA 4BDNA 1STZA 3LWFA 1MM6A 3M1EA 3ZMUA 3C1DA 4H0EA 1B3GA 1N7WA 4IF4A 2ZBKA 1JEVA 3CVGA 4G6QA 1Y3NA 4QSCA 2BE5F 1S3JA 4C1TA 1FSEA 4RA1A 2ESHA 2FBIA 1A8EA 1U3EM 2MLGA 2D3IA 3BJ6A 4FAJA 1B5JA 4YKKA 1TFDA 2P6TA 3FMSA 3F72A 3QOPA 2OWSA 4Q4ZF 2VODA 4LZ8A 1S7YA 4GYGA 3G3ZA 3S4UA 1IN4A 2QS3A 1UCRA 4YG2F 3WGHA 4EM0B 3CSGA 1KQ0A 3WGIA 3MC2A 4UHTA 3ILUB 3U94A 5CBSA 3R60A 3TYHA 4QWQA 5DUKA 1MJBA 2JSCA 3ODBA 3EN3A 1DPPA 3C3WA 3C35A 5I57B 2Z8EA 1PUEE 4KI0E 1R5GA 2H98A 2W24A 5LHIA 1BC7C 1NH8A 4QSDA 4R79A 2HEUA 4BNCA 3DQVC 2A61A 3IO6A 1W7PA 3V8LA 1DDNA 2XAQA 3HHGA 1DPEA 4OINF 3CO6C 3J80K 1LFGA 4YIIA 5FTHA 1AIVA 4M1VA 1SD5A 2REGA 2F5FA 1ZRCA 1Z7ME 5AA2D 3H6TA 1PC3A 3WTYC 4FT8A 3QXMA 1FT9A 3ABTA 4WXHA 1WDNA 5D4RA 2QS2A 2G29A 3CFZA 1LGBC 5K5OA 3IAZA 4DCXA 4QLCU 3JAMZ 1XCBA 4KYWA 1XDUA 1SDXA 1YQAA 3GEZA 3H7MA 2Q88A 1BLFA 2AL5A 2HTSA 4K2EA 4KCCA 2ZNUA 1K78A 3UN6A 3C9HA 3KN7A 3K0VA 1FPQA 2DE2A 4AQ4A 4EF1A 4MTDA 1GXPA 2VGQA 3FD3A 3VEPA 4ZEFA 3PD8A 4RPOA 2KJCA 4CO8A 1BM9A 4CGZA 2DFIA 2DXYA 5JTYA 3VFZA 3FMRA 1RUNA 3DLNA 4Q5SF 2RKHA 2G7UA 3IX1A 4IGRA 5AIQA 3Q9VA 3DELB 1AH5A 3H3ZA 2NYXA 1MD0A 3F6VA 1GR2A 3VODA 1BI1A 5DDGA 3PMXA 1SW1A 3ZP5A 2Z9OA 4A6EA 2VXZA 5ICTA 3H3UA 4F2QA 1QQIA 4RGXA 2ZMBA 4H8JA 1SFXA 3CLOA 3O6BB 2Y75A 4ESBA 4JSOA 1YAEA 3MVXA 3OSRA 2KIUA 1LB8A 1O63A 4ENKA 4M9ZA 3MUQA 1EZPA 3HRUA 5LBQA 3KOSA 1JW4A 4DCYA 1Y1ZA 1URGA 2R9JA 2V79A 4BAYA 2QSXA 1MXZA 1K7AA 2QBYA 5TRDA 4EMSA 2ZXTA 4LB5A 2F5CA 1Z7UA 2DE4A 1FLIA 2VHAA 4ZE9A 2F6PA 1MM7A 1O3TA 4PFWA 3C33A 4H67A 2FF4A 4M6YA 1MQDA 3QSLA 1MXWA 2HXWA 3TODA 2GWRA 2LDUA 4LVQA 4IHTA 2F7CA 2X7QA 1SD3A 4R8HA 4WWCA 1HXDA 2LAOA 2W85A 1AL3A 4ECFA 1FYKA 1B3LA 4D0PA 5FB2A 4EQ7A 2MBFA 3GXOA 2IW5A 4KUMA 4CYDA 2OQRA 3B7DA 1H9TA 2D45A 3QYTA 1Y9UA 3TCGA 4QFOA 4EXKA 5L3EA 3EQLF 2Z5UA 4CHUA 2OQGA 2RQPA 4NF4A 3O6GA 4IVNA 4GXSB 2XHDA 3E6CC 4L0YB 2G93A 2AYSA 3GFLA 1XVYA 5LHHA 1B58A 4BXUA 3TQLA 1IITA 3K1NA 4KIBA 1U5TB 2OZUA 3HOTA 5LEJA 2BEOA 2D5WA 3OO6A 4LGWA 3F8BA 2Y7KA 2CSOA 4FEDA 2DQLA 2PBIA 2Y84A 1E2XA 3UORA 3H6WA 4R6YA 4I9DA 2OD5A 3FWEA 2NWJA 3T9VA 1IN5A 5IAIA 1QKBA 5ERIA 4ESFA 1QUKA 3VE1B 3JTHA 4GRKA 2CZLA 3M3LA 2W57A 1R7JA 3BPXA 4H5GA 1W7PB 5D6FA 4N0BA 4G8HA 1WRJA 4OIOF 3H6VA 2YR2A 3H4ZA 4YAHX 4HQMA 4KYEA 4TLMB 1DSNA 3GLXA 3C4MA 4OWDA 1SD4A 4A6DA 1BI3A 1Z6TA 3JTGA 2P5LC 4OEUA 5FHOA 2XX8A 1YTYA 2NOOA 4NEDA 3W9VA 1OYYA 2I3WA 3D4GA 4NF8A 1TWYA 3VFJA 3GXAA 3JW4A 4LQ5A 3FM5A 3QUJA 3ZPLA 3WAFA 3F22A 1K78B 3N6UA 1RYXA 3W9WA 2H09A 1XC1A 4AIHA 3IKVA 1C0WA 4RS8A 1HSEA 3MEXA 3BPVA 2ACJA 4GD5A 2G9WA 4UXNA 1IUYA 2RF1A 5JTYB 4BYYA 1BOAA 1J75A 3WTVC 2LNBA 1YW9A 1RYOA 3UGWA 4MTEA 1S50A 2Y7RA 6PAXA 4HS7A 1YFHA 5ICEA 1TQPA 1ZAOA 1LNWA 5BPDA 3ML6A 1US5A 3FXUA 2Q2AA 1LJ9A 4UUVA 3V7RA 3ZMTA 3V8KA 2V3QA 2BYVE 3FF5A 4R1HA 2O03A 1B9MA 1P6RA 3EYIA 3QU6A 4E70A 3CIJA 4WXJA 4UNOA 3KFWX 2ETHA 1IXSB 2P8TA 4FATA 3TO7A 4QFLA 2GH9A 2DQVA 1JW5A 4PP0A 5I56A 5HLIA 2PVUA 2QBYB 3QAHA 1S6LA 4H0WA 1B0LA 4KYDA 3SQNA 1G6NA 3S9MC 2Z22A 4KIFA 3LR1A 1IXIA 1XB4A 1QGPA 2XX7A 4E0XA 2IT0A 2I0CA 2K7LA 1MPDA 3PPPA 2XX9A 1DPRA 3CDHA 5CMKA 2VD2A 4C1UA 4Q0CA 4HLXA 2ZYOA 4UV8A 3HTUA 3KZYA 4H8IA 1NNPA 1OR7A 1XOCA 1IAWA 2C6YA 5M2VA 4F3SA 5H6QA 2A5TA 5ICGA 2HR3A 5FD5A 1GGGA 1ZLJA 5FFZA
chains in the Genus database with same CATH superfamily
2P5KA 1XVXA 3C34A 4E7ZA 5EG0B 4NF4B 3C18A 2HDWA 3QYBA 4MFEA 2REJA 4U1ZA 2LR8A 1B52A 4GL8A 5HDGA 1ZBMA 1NG7A 2BXZA 2XXWA 2XXUA 2XGEA 2DA1A 3T0YA 5ESYA 3I55I 4NGUA 4WF2A 5TP9B 1Z67A 4BHBA 1IRGA 2DA6A 1XCVA 2DPUA 3O6HA 3V89B 4JP0A 4GYIA 1EV7A 1KU3A 4CCNA 2QVVA 2GA2A 3DP7A 1POTA 3JAMK 1CE2A 3ELKA 1LBYA 2P2AA 1A6QA 3FXQA 2X48A 2HS5A 1I1GA 3PSFA 3CUQC 1R22A 2EFWA 2HAVA 3PU5A 1ON2A 4HCWA 5KCJA 4I1DA 4UB6C 4YKJA 4A12A 1UAAA 3WU0A 5GAGJ 4A69C 5EEAA 1FP2A 2I4CA 3RT6B 1NV6A 1W7PD 4XONA 2DT7B 2MGQA 4R74A 3S2VA 3R61A 3ABUA 5KZTA 3VYUB 2X51A 4KT5C 1J09A 3E0JB 3ISPA 3MZBA 2XF7A 4LP2B 3GTGJ 2Y7WA 1IXCA 1LEAA 4J01A 2W84A 1BIAA 2JPBA 2QQAA 4XIDA 4LQ2A 4OTEA 4XKPA 3S32A 3EETA 3A1YA 2MC4A 2VBZA 5I5PA 2F97A 2CQXA 3TMOA 3L2RA 4BACA 1M5CA 1MS7A 3VOEA 4NQ8A 4ZZAA 2CV1A 3BFUA 3K6WA 2F6CA 5LRSA 2P6SA 3CVGA 3IH2A 2M5WA 4N13A 4LOCA 4BXFA 2GAUA 3BY6A 3K4LA 3KP7A 1SMYF 4QPOA 3KBZA 3MQ0A 2FUG2 4U88A 3J81Z 4WXDA 3ZMDA 2MH9A 4NF8B 3K6UA 1MH3A 4NBQA 4H1XA 1R00A 1WFXA 4D7NA 1YW8A 1JVYA 5CLSA 3FJMA 5HNFA 2DP8A 2KQRA 2F4IA 1FWZA 2DOAA 2LK2A 2F78A 1ZGJA 1Q1HA 1K9YA 4A5NA 1MDMA 3N5LA 1TL8A 3ZSFA 1EF4A 1NH7A 3QUFA 2E36A 3S1QJ 2QL3A 2PQ8A 1AHDP 4F2OA 2DJNA 3CUQA 5IP7J 5E3NA 4CXFA 1KA1A 1VI0A 3BR0A 3H0DA 4XKRA 2Q89A 1HOMA 1LSTA 1WVJA 2DK5A 2QSGX 3I3VA 5FHMA 2X1CA 3Q0UA 1USSA 4F92B 1ATGA 3G3GA 2E1MB 1FMVA 2QF7A 3LFKA 2IJLA 1D3KA 2HAUA 4BY1J 1I6AA 1J1NA 4XKBA 1V5FA 2H94A 3HSFA 2FE3A 4D5CA 1BOBA 2V6EA 2CJJA 1J0RA 2ZYNA 4I01A 2K9NA 2LMDA 2WY7Q 9ANTA 2H99A 2W00A 3RPWA 2E71A 3SFIA 1OLAA 4ZZEA 2Z3YA 3BJOA 1TTYA 1A5JA 2JRMA 5J4YA 3RY3A 4IRHA 2X6OA 2GQ1A 2OCCH 2ZXIA 1NKXA 1K79A 2WYKA 3N05A 1IEJA 2XB5A 5F08A 1YJNI 3A0BC 3R26A 4YICA 1LFBA 1VE4A 5EGOA 5AONA 4OAYA 4S05A 1JI8A 4ZDMA 2LP0A 1QHHD 5IKBA 4NB5A 5BMZA 1EKEA 5CVRA 3IP4B 1UFMA 2HVSA 5I56B 3KZZA 3EHUA 4BXXJ 3VLVA 2DBBA 3TGNA 2K4JA 4OVJA 4BL0B 3BZCA 4ONYA 5AA3A 4QF9A 3B02A 4AVPA 1JETA 3C7JA 3HO7A 4O7MA 4IO9F 1MNMC 4EJVA 3TPAA 4YFNF 1CNQA 4O3BA 2NOJB 4LITA 4ZDLA 3L1PA 3T8RA 2PEXA 1URDA 2GOMA 3ABLH 2QQ8A 4XLPF 1R9TJ 4L0ZB 4QFPA 5EHSA 4GIZA 3D5LA 5FJ8J 2QSFX 1IXGA 2QYOA 3I5UA 1B3HA 1R1NA 3TELA 4ELQA 4ZECA 1MY2A 1A36A 4RGRA 2EZIA 1BI2A 3EF7A 1FTJA 1NHAA 4QHQA 2A5TB 1OLCA 1L5TA 2RV8A 2DOJA 2QQ9A 2HU9A 4M3GA 1I69A 2OC6A 2AO9A 2KIMA 3O28A 4HPQA 4LLGF 3OYGA 3MZHA 2IEEA 5FLXZ 1LQ1A 5B70A 1SD7A 3BG3A 1US4A 3P9IA 1FPDA 1FQBA 2OX3A 3KP5A 3CTAA 3PSIA 2WWYA 5FO5A 3PO2J 2DS9A 3H03A 2M4KA 3VVDA 2K27A 2IVMA 2V9PA 2L9NA 4HDVA 3H5AA 4Y15A 3FASA 3FATA 3I53A 1UELB 2BXYA 1MRPA 1O3RA 1MIJA 4DW6A 3HZJA 2ZMEC 2UVIA 2L0KA 1WJBA 3KSJA 5DT6A 1P1NA 3BJAA 1B1BA 4B09A 1ENHA 2DMQA 1J9IA 4FE8A 4V2GA 2CUJA 2OZ6A 3K70C 4N8YA 2Y9YA 2XC7A 2ECCA 4F3PA 3RKWA 2E1NA 2EFPA 5CMCA 3V42A 5KCJB 4QSHA 3O66A 2Y0MA 1D5YA 3P7IA 5FKLA 2NAZA 3HUGA 3I64A 5EEHA 4EJWA 2QQBA 4KXPA 1GXQA 5LEKA 3TTNA 2JK3A 2H25A 4C3HJ 3PO3J 2DLLA 3PNVA 3RPQA 1QJMA 2V1NA 3FUZA 2L7KA 3MVPA 5FKKA 2L01A 4L9NA 5K7HA 3VVEA 4Z7EA 4U23A 1FBUA 1YITI 3S1NJ 1A8FA 1TT1A 2HI3A 2O84X 4LIUA 2Z33A 4FE4A 1QRYA 4PFOA 3L6GA 3I59A 1FTTA 1NK2P 4OANA 2BVLA 3ZQQA 1B51A 3K2DA 1D5VA 4YMBA 3AG1H 3BTCA 3FX3A 3SEZA 5B66C 3O9PA 4N6KA 4B48A 4RAZA 3FHZA 1WPKA 1O7TA 1FPLA 2O69A 2UVHA 3FJ7A 3MCZA 3K4MA 2FVZA 1OYWA 2PMUA 1E3HA 2Z1DA 5GAEJ 1E3PA 2PFBA 3K1MA 3ZQHA 5GAHJ 5D5UB 1TWAJ 1IC8A 4Y52J 1FW0A 3KC0A 2XAJA 4G8NA 4GXAA 4MHFA 4OFJA 2NS7A 1A04A 1XG1A 2DWJA 3BBRA 4OOIA 4RK9A 1PP7U 1LDKB 3H9JA 3S16J 1VF9A 2FNAA 2TRTA 3C2BA 1JJ8C 1U5TC 2ZMEA 4XN3A 3Q9SA 2E0SA 1WHUA 3HV1A 4CCKA 4ELOA 4TOZA 3TEDA 3DU5A 3PUVE 4L9JA 2LKPA 3S14J 1D0ZA 1YX3A 5GTHC 5CKTA 3EDPA 4Z2YA 1Y1MA 4F19A 2A69F 2ZB9A 1Z6RA 2FBHA 3S17J 1OKRA 4YKPA 3CUQB 4MO7A 1FOKA 4I7HA 2HEOA 5LHGA 2RKMA 2E2JJ 3H5NA 3ZQIA 2FEZA 3SEWA 2RN7A 4CCLA 2V1UA 1HA8A 1AWCA 1ETOA 1GLNA 3VB2A 5H2FC 5HBCA 4JVDA 2COBA 3O8GA 4U1OA 2L2OA 4XRMA 3MJNA 3GVAA 2ZXHA 1TT0A 5BS6A 1E17A 4RM2A 1VR5A 3KP2A 1HW5A 3QIMA 2LBFA 1QZEA 4DDDA 1B3EA 4I76A 3M07A 5LD2C 3A09A 5HS8A 1PB8A 4G61A 2M4GA 2R4GA 5DM7F 4MFDA 4ZDOA 4F22A 1ODDA 4PGGA 3BZKA 4ENMA 1FBGA 1UIVA 5ICCA 4BDZA 5TPAA 3TQWA 1WJEA 1M5BA 1N78A 5F1JA 2R7DA 5EYRA 4P96A 1YJWI 2VJIA 3HPHA 3BZ6A 4G6TB 4CCOA 5EGOB 2QA4I 4HXVA 5J16A 4IJAA 3PIOF 2XGDA 1FP1D 3DTIA 5ICQA 2HPIA 3GZ5A 3S93A 1ZYRF 4M4GA 1U5TA 3CESA 3KG2A 4R72A 3SEUA 1D3YA 2W25A 2O1MA 2BOLA 4FETA 3E5QA 5HODA 5CM6A 1VQPI 2YX4A 5FKNA 1ORKA 1ZLKA 3RIRA 2CEYA 4AU7A 2F5XA 4N15A 4QXDA 4ISUA 4R6HA 3T96B 4F1VA 4F1UA 5K2XA 1SAXA 5HS7A 4FASD 3U1OA 5TU0A 2M8GX 4R9FA 4P8BA 2VC1A 2EV0A 5GTIC 3K10A 2HQAA 2XAGA 4GWXA 4E7LA 3S9NC 1O3QA 1NV1A 1VQ4I 2O8KA 5ET7A 4BQNA 2UYEA 1Q1VA 3OO9A 3KP3A 3HRMA 1I50J 3NARA 4A3DJ 3MAJA 2CUEA 2ZXJA 3U9GA 3DP4A 2LLKA 2WV0A 3T66A 5DYHA 3QU3A 3OS1A 4EUOA 1LDDA 1S7OA 2IBDA 1GTKA 3NEUA 5DD4A 3R6SA 3MVWA 3I56I 3JYRA 1X1DA 2X1DA 3KE2A 4UB8C 3AXFA 3ECRA 3O29A 2CG4A 4KHZE 4X04A 5CI5A 3F23A 1FQFA 2GZWA 1FBFA 4ZTJA 5HDNA 3GTPJ 1ERDA 2I3VA 4XN0A 3KJTA 2QENA 1T8IA 2R71A 1F9NA 4P9UA 5J4VA 5CJ9A 3OO6A 2STWA 1IXHA 4MFIA 1ZARA 4RM3A 4Y17A 1I6BA 4NUBA 4Y4RA 5DUIA 1BL0A 1XI6A 2ZJ2A 3J7AO 1SPIA 2M30A 5DD8A 2HYGD 3DV8A 1PEBA 2M8EA 1SQYA 2ZKZA 2DWAA 3W6KB 4KICA 1IUFA 2Q2EA 3IK6B 3LQQA 4EQ9A 2JA6J 3HPIA 3OWTA 1B5IA 4EXLA 5CPRB 1X1AA 2FSWA 5J8FA 1FTKA 4DXCA 3FMQA 4ANJA 4I0BA 3WTSC 4G7OF 3FGSA 3H3GA 3EUHA 4F1YA 5KAFC 2EJRA 1J7KA 3K6GA 5L3BA 2DMNA 5GADJ 2EZKA 1NV4A 4OFOA 2NXOA 2CW7A 3J81K 3M3YJ 1T0FC 4ZZLA 3MAMA 2X0LA 3CP8A 4P3LA 1GV8A 2F7AA 3KEYA 4H5FA 4U7BA 3PL8A 3OXNA 1SVMA 3HUGB 4Y13A 1YIJI 3TTRA 3CCLI 2WKYA 1LVKA 2OCEA 2A5SA 2THIA 3DWLE 2PCRA 1LAXA 3GTJJ 1EYKA 1YX5A 4IY6A 4P5OA 3O2AA 2LSOA 2NVYJ 1FQCA 1R1VA 3RKXA 2R7ZJ 1Z3XA 5D4SA 3GLLA 4F52A 1FNNA 3Q5FA 3HDDA 4RMNA 4NE4A 2Y7IA 3I59B 4IPAA 4EV0A 2L4MA 1OVTA 4GQOA 2OLBA 1O64A 2EZHA 2IS4A 3MVZA 2VLAA 5GP9A 2LF8A 3Q25A 3CO7C 2B4LA 4DE8A 3H36A 4EGZA 1NL5A 2XD3A 4PJ0C 3FK6A 3K4CA 3G3HA 4NC6A 2BY1A 1V5GA 3K2AA 5K5QA 3IUOA 1VTNC 3VXCA 1MQGA 3MP8A 1F36A 1M5DA 3SDBA 4B8XA 1B1HA 3DP6A 1REPC 2Y2ZA 1FJ6A 3PFIA 3OYHA 3D5SC 3FXJA 2D2WA 1EH8A 1PYVA 2VXDA 2ZMEB 3LSTA 4HNTA 3PUZE 3CLQA 1ONVA 4NNJA 2HGCA 2HVRA 1I3AA 3H9GA 3TQNA 1J2XA 2V9KA 1X3UA 1IXRC 3MKLA 1B05A 3LC8A 5DVIA 3EPZA 4WEPA 3IOVA 3UK4A 4C3JJ 1TLHB 1HC8A 1B9JA 4KD5A 4TQUQ 5CMMA 4N4NB 4AYBN 1T0FA 1N76A 2YLNA 3WTTC 2M34A 2FXAA 2VL8A 3F3XA 2EFOA 4GO1A 3WHCA 3BFTA 3PPNA 5LTCA 3PUWE 2DMTA 5E1WA 1NV2A 4H6DA 3CUOA 4CUGA 2Y48A 3RTWB 3TMGA 2GHAA 2R7OA 4DZPA 1YTVA 1AOVA 3LSGA 1IZ1A 3GW2A 3QYEA 2M2EA 2ZYKA 5EQ7A 3IRQA 3TZAA 2V4CA 2LBFB 4P47A 4A3LJ 3AAFA 5IOZA 2Q9TA 2VJ4A 4C3IJ 3ZCOA 1ETVA 4E7HA 2X6YA 2CS3A 1MSFC 1J59A 1IMBA 2OK2A 1N04A 2UVGA 4XORA 3D4CA 4MF3A 1YE9A 2OA4A 5L9MA 2WA0A 1LB2A 2FMLA 1U9OA 2RVCA 2DA5A 5TPAB 4CYCA 1MH4A 5EG0A 4M9XA 3HTSB 3V5AA 1TQMA 4U7DA 4OIRF 4Y7NJ 3CCYA 2L5QA 1TW3A 4IO6A 1I3QJ 2HZKA 2L7ZA 4B47A 2LVSA 1A35A 1Y4CA 2XXTA 3TAJA 5FHNA 1OVBA 3OYNA 1TWCJ 2DU9A 5FLXK 3HRSA 4PDDA 4QRZA 4IB2A 1YW7A 3ECOA 3G1LA 2V25A 3B8BA 1X4PA 2QCOA 3PUFA 5J47A 5TP9A 2XXYA 5B7DA 4PBHA 2LG4A 1ELJA 4EVIA 1DCUA 2VT2A 1IRZA 4NWCA 2P0WA 3KEQA 4FE7A 3CFLA 2EV6A 2WV1A 3ULQB 1ZQ3P 1Y0UA 4AIJA 3DP8A 2UYFA 3VLUA 4OEVA 3HXLA 1ZRFA 2JUCA 1JW1A 3FIRA 2XF6A 3RTFB 1LE8B 4L5EA 5ET8A 3UR3C 3Q3SA 2H6CA 3L2CA 1YXIA 1RUOA 4P56A 2E1MC 2H27A 1MSEC 2VQCA 2XPUA 4OMBA 4PJMA 2QVOA 2RNGA 4H4KC 3CCJI 5K1YA 5M5XJ 5HNHA 3DEWA 2GHBA 4PQJA 3AG3H 3E9XA 3LV0A 3CMEI 1ETQA 4LK1F 3G6EI 3DLLF 4E7JA 1YZ0A 4E4HA 2PFZA 2ID6A 3JRCA 3KJ7A 3WU1B 2H5YA 3TTLA 1SVXB 3CG3A 1H9GA 4GWOA 1Z05A 2JA5J 1SI0A 5CC2A 2A6EF 4C2UA 3DPTA 2DTRA 2FBKA 2M0MA 3BR5A 3LA7A 3S3OA 5M3MJ 3IOWA 2BVMA 4RAYA 4HLYA 4GL0A 4M9SA 1XMXA 1HKQA 2Q2EB 4B1RA 4KITB 5TGTA 5M5WJ 4C2TA 4DYCA 1AMFA 2GA1A 1HSTA 4UABA 2ELHA 5CMBA 2R7WA 1HQCA 2VKEA 3C2HA 2O6AA 3H92A 2VKVA 1LPQA 1B6HA 3E6BA 2LC2A 3OSFA 1SMTA 4UUSA 1OYIA 4F3GA 3T93B 2LOOA 2E35A 2VE9A 4ZC3A 1QZZA 2RGVA 1I6QA 5CRYA 1M1EB 1TQIA 3FK7A 1H76A 2KRFA 2AXLA 1XGMA 4ZZDA 1TNSA 2NVUB 2XSJC 4FQGA 3VXBA 2KKOA 1RETA 4XL9A 2KL4A 5KCMA 3PJRA 3ZOBA 3IOUA 2I10A 2Q8JA 2M3AA 3WHBA 4NF5A 4MQVA 4R2BA 1OR7C 2TDXA 4F3QA 1CF7A 1MY1A 2DXIA 2F48A 3M8EA 1P7JA 1NG6A 1IF1A 2V3TA 1HW2A 1QW0A 1XD7A 2H4IA 5J3LA 2EK5A 2L54A 4GX6A 2OBPA 3PQKA 3LNQA 1R49A 1QZYA 1W5SA 1ZREA 4B4CA 4NHJA 2D5VA 1D8JA 4QFNA 2JVGA 2KHMA 1ZRDA 3OSGA 3AKZA 4I3EA 3NWSA 4LJZF 4BY7J 3TBIA 5IY5H 4OXVA 3OR2C 3MFKA 4ENJA 3PMWA 1ETXA 2BGCA 2MC3A 3S1RJ 1NNFA 2COMA 3KIOA 1JQFA 2QUFA 1FBSA 4BDOA 2FQ3A 1S7EA 1Q1KA 3C31A 2DVZA 4XR6A 5FGMA 5E18F 2XD2A 2X4HA 3CDIA 1IV8A 2CRGA 3G1MA 2F2EA 5F27A 1FYMA 1X3ZB 3I0TA 5GPAA 3JSOA 3HOYJ 1YYZA 2R8TA 1URSA 1EH7A 3BTLA 3RNNA 1APLC 5ET6A 4GVOA 2FOKA 1JEUA 3EHTA 3K70D 1VQNI 2BBYA 2R5ZA 3ZS6A 3MQ9A 5K2YA 4LZ7A 1JGSA 4XKQA 4KCDA 3KLNA 1UIUA 2ME6A 4PJLA 2IA0A 4IRGA 1KU7A 3MPLA 4GWSA 4MNPA 3VDFA 3OOUA 1WCMJ 2M8CA 4IO7A 3J7ZI 1DUXC 4OVQA 5EZGA 1YO5C 4RGSA 3CMYA 3HJEA 1H45A 2UZKA 3MZYA 3RKYA 4AD9A 5E17F 2XASA 4DZ1A 2V1XA 2KZGA 4P1EA 1T98A 1IGNA 4ELPA 3RT8A 3TO9A 4HF1A 3KX2A 3OO8A 3CFXA 1FC3A 4E7IA 2XXVA 1Z91A 1QULA 1F5TA 4RY1A 1Q9DA 2O8XA 3BDDA 3FXKA 3UKGA 5C4XJ 1OIBA 3RPLA 4IHWA 5FD6A 1BIBA 2ZXWH 5I59A 2F5EA 2OUMA 5TISC 3UNGC 1B8IA 4ZH4F 3MW0A 3GZ6A 3WE2A 4IO4A 2MFZA 1R6RA 2NNYA 1N0TA 4MEYF 4CH7A 2OZZA 1BJZA 3FISA 3WGGA 3ZN1A 1DPUA 2Q1ZB 3FVOA 1WH7A 1MBKA 4XBFA 3IAS2 3OYAA 2EA4A 1SFUA 3CJNA 1LEBA 3B6WA 4YB5A 3H1CA 5JHUA 3GBGA 3HPGA 3G1OA 4CYCB 1HDPA 2XAHA 2QPQA 4G68B 1MW7A 1X3WB 1I27A 2XF5A 3BP8A 4XQFA 1VSOA 1FY7A 3ZQCA 1UMQA 3LSKA 4HA8A 1GHCA 2EH3A 2ONKE 4JVCA 5J1DA 2PI0A 2O3FA 4JB7A 5BWJA 2M7BA 2AIXA 3G3JA 3BQYA 4FBPA 2MW8A 3BR2A 4FX0A 2P1SA 2PN6A 3PPOA 3FKJA 2EZLA 4PBQA 4UY8I 3HBLA 4II3A 2MH2A 3F11A 4OMZA 2I6EA 1SYIA 2KZVA 1WJFA 2JMWA 4EJTA 4OETA 2HOEA 5DW8A 3Q26A 1DGWY 5KDTB 4ENNA 1D1AA 2LRDA 4IXAA 4XK4A 4XKWA 1WSUA 3RSNA 3B6AA 3BOQA 2O6GE 2DOEA 4HZFA 2E1SA 4NG7A 1HW1A 3LSLA 1F1ZA 1DK4A 4CSWA 3K6VA 2HPMA 1KQ9A 4EQQA 3TKYA 3E79A 2A6HF 5EYFA 5H8SA 3R7XA 3M9AA 2WADA 2YU9J 2MLKA 2ZJPF 2I49A 3Q28A 4IO3A 1D9YA 4WEDA 3FXRA 2VOOA 5I2NA 5F0FA 4S0HB 3BKIB 3DBRB 1TWHJ 4OIPF 4NAPA 5CBRA 4PF8A 3BROA 1O3SA 1LCFA 4UACA 2QLZA 3U21A 3JR9A 3QAXA 4GWYA 2GXBA 2L7MP 3V7SA 1BP5A 4JSDA 2MA3A 2PMZN 2CH0A 2X6XA 3GMEA 3QQAA 4CZZA 4XSZF 4ZYEA 3I6VA 4RNSA 4AM3A 3IOTA 3PD9A 1NV3A 1POGA 4PF6A 3CC7I 3W6VA 1N7XA 3FBPA 2IGOA 1GT0C 4MLOA 1B0HA 2HKOA 3BIGA 4R9GA 4O3MA 3TTKA 4KFQA 1LFIA 4N4OB 5JHFA 3R4KA 4YKIA 2NS0A 1XSDA 2QMXA 4R2FA 4X1BA 3TDZC 2HDCA 1USYE 1UQWA 4THIA 1JHFA 1RI7A 2XKOA 2FX0A 2E34A 2P81A 2Q74A 1P7IA 1Y8QB 3CCMI 2ZFWA 3G4SI 2R5YA 1IRXA 4HX8A 4N9IA 2QMWA 1LUJB 3MWMA 4JBAA 1ZG5A 3MZ1A 3IFAA 2VASA 4H65A 2X1EA 4XRSA 2ME0A 4UUSB 3GFJA 1TT5B 3OYEA 2PG4A 2F34A 3N6TA 4Z0IA 5I58A 2FNPA 3QP6A 4M3EA 2XWKA 4AYBA 2NNNA 4E6KG 2XXHA 2YPNA 4QSCA 5I2KA 2DYSH 4LD5A 3M8UA 5DCMA 3GUDA 1JJ6C 2VBXA 1XGNA 1Z77A 4NHBA 3HOSA 3KEIA 3R0JA 3MKZA 1MQHA 1NUXA 3W3CA 2VOZA 4NF5B 1T6SA 3OYJA 1CF7B 3KN3A 4OAZA 2P0SA 2VKDA 4HG2A 1WKMA 1YYVA 2K9QA 2HVQA 3FJGA 2K5CA 3FVNA 3G3IA 2RDPA 3FXOA 4MLQA 3E5XA 1P4XA 1ON1A 2DW4A 2UUZA 3M7GA 4GFRA 2RCAA 1WH5A 5L3GA 3FVGA 1LBVA 3KOTA 4MGRA 3FZVA 1KU9A 1YPNA 1L0OC 3M3FA 2HYJA 1X1PA 3A29A 3K00A 3B50A 2EPFA 3X2QH 1Y6IA 1A54A 2A5WA 2R6GE 5DYMA 4YU0A 4AIKA 3CHGA 4BQQA 2IA2A 1H44A 3SZTA 4FCYA 4QBAA 5FKOA 4I09A 4OVPA 1H8AC 4I2OA 2FOWA 3PUBA 4U22A 5B1BH 3QK6A 2O0YA 2XHKA 1EYIA 4G8XA 5F7VA 4I8CA 4N91A 2HZLA 1SVOA 4DYRA 5IT9Z 3NWTA 4OERA 1XN7A 3L09A 1G3SA 4RDUA 2R5ZB 1EZ9A 2O7UA 1Z21A 4I0AA 1XGSA 2ZZXA 4PETA 4PZJA 1OMIA 2JPCA 2K9SA 1ACIA 4ZTFA 1LFPA 1SEUA 5FRNA 1VQMI 2Z8FA 3B6TA 3K02A 5EJCA 4P0IA 1VNDA 2VN2A 3E13X 1ZMGA 4S04A 2HQ5A 3A3CA 3HOZJ 3SZPA 1CQTA 4YFXF 1EU8A 5ITPA 1FSHA 4PGHA 3T9XB 2X26A 3HFUA 4MIMA 1P2FA 2R7FA 4G9YA 5H8FA 4F31B 1X19A 2JTVA 3C36A 2VP1A 1W0TA 2PX1A 2M7AA 4A3MJ 1V5EA 3R6UA 3RPLB 3HOUJ 1D1BA 2IAIA 5I59B 1KONA 1FQDA 2P7VB 1B8IB 2L5VA 3EKIA 3Q27A 4PE3A 4XRFA 1G0HA 4K3FA 5H8NB 2DO7A 5AE4A 4F55A 4L9TA 1B9NA 5L3DA 3LBSA 2EINH 4JX6A 3TCHA 2K4BA 3RTRA 5E8IA 4AUXA 4BEHA 3LAPA 3GYYA 2FIXA 3QODA 5JEIA 4M3FA 3TP0A 3P9KA 4I62A 1CB6A 1HLVA 2UXXA 3JV9A 4B3XA 1T33A 4P1WA 4WK8F 3RLFE 1WJDA 1QU3A 2WAEA 1B4ZA 3GF2A 4L5JA 4LG0A 4RLQA 4KDPA 1LBWA 4XKCA 4IGTA 5FRMA 4YZZA 4ESXA 3TDJA 3ESWB 1R71A 4P9FA 5E79C 4BBSJ 2B3BA 5LGNA 4POWA 3W6JB 1V55H 2VC0A 4RAGA 2D21A 3J7YJ 2ZNSA 2FA7A 2ONSA 4LZ5A 2JRTA 3ILTB 3OELA 1RKMA 4HF0A 1R5HA 3N94A 5L9SA 4F7ZA 5EF6A 3EYYA 2DSFA 2WBBA 3CSBA 2JN6A 3HN0A 3ONMA 2DJIA 3GO5A 5EQAA 1QA6A 4IHSA 1F9BA 2I4BA 1YRNA 1ETYA 3W2WA 4M6VA 2KDZA 3A3UA 3LUZA 4BHPA 1MPBA 4GLIA 4O94A 1FTAA 1T08B 2RCBA 4JWOA 4PAFA 4BHCA 2IPQX 1HKSA 2OAZA 4BE1A 4KFCA 3I4NJ 1MXUA 2DWHA 2DE3A 1ETKA 2OF7A 3PPQA 4WXCA 3TFLA 2QKMB 3BR3A 2LYCA 3NAUA 5DM6F 1X4OA 2FU4A 4XSXF 4Y33A 1P1OA 5CQEA 3WAEA 3SDFA 1YI2I 5I2NB 2CZIA 3FXMA 5DS9A 1DTGA 5DVFA 3U93A 3WG7H 1SVLA 4M72A 1XMKA 4FTHA 1LLSA 3R0AA 1U8BA 2R92J 4BJ5C 1Y8RB 2VKHA 2YS9A 4PCQA 2V9VA 1DGRM 4U0WA 1MXYA 3MVYA 2H9BA 4JDFA 3DF8A 5D8LB 3CQZJ 3UA8A 3D0SA 3PV0E 2PYYA 2YPRA 4IL6C 1IMAA 2CZKA 1QNTA 2IA4A 2UXAA 1VQ9I 2RC8A 2B3FA 4CCJA 1N3WA 1JUMA 3EPEA 2HQRA 3S3NA 1USYH 3WODF 4U4XA 4RYAA 1K6OA 2FD5A 3CJTB 1LB9A 4O3CA 2QFLA 3V8XB 3E3VA 1BBYA 5LRRA 4BBRJ 4LB6B 2VQGA 1IIWA 3FV2A 2R5YB 1IDYA 1Z3YA 1IW7F 3V4GA 3JRGA 5D6EA 2R7VA 3HL2A 4RPNA 2Y0SN 4P0GA 1SANA 3K4NA 3CZ6A 3QPLA 3W2AA 3MYUA 3HHHA 5HDKA 3UP9A 1G59A 2P3NA 2Z99A 2HXOA 4HAMA 2GFEA 5I58B 3HOXJ 1KQ8A 3TTMA 3E4RA 3PNYA 2IEKA 1MY3A 1VFEA 5I2KB 1KZHA 1D8KA 5DCMB 1PJRA 3QPSA 3VLWA 4ON0A 5H8HA 3GLBA 1B1XA 3B73A 2Z8DA 1XTAA 4TLLB 2WB1N 4KA4A 1OQHA 1P99A 2B0LA 3ROUA 5ED4A 1V4RA 2XVCA 5BQTA 3K2ZA 5L9OA 3G73A 1TWGJ 1G3YA 3BIHA 2FQ4A 2JT1A 4EJUA 4QSEA 1DP7P 2ZC2A 5JLWA 2KLFA 1IMFA 2JVHA 1O7LA 1R1TA 1PBPA 3LUYA 1ZKBA 1HDDC 4ELRA 2PFYA 4J19A 1R1UA 2F5VA 3LA3A 2UWMA 2HHMA 2W1OA 1AA7A 3E6MA 5ISUA 2E2HJ 4LN5A 1B40A 1ZU0A 3U72A 4N9HA 4C0RA 4MX6A 3CCVI 5LOMA 5F04A 2NVQJ 3KC1A 2F3DA 5H20A 5FLVA 2M9HA 3GTMJ 3WG9A 2HQNA 2JWTA 2XRNA 5JVTA 4QPQA 3MZ8A 3ZR8X 4G94A 4XEQA 2QSHX 4HW8A 3EUHC 3KGCA 3MD2A 4L9VA 4N6PA 1N75A 2A68F 4BQAA 4MCOA 1PB9A 1VQ6I 3MZ9A 3I9V2 1O57A 5ITOA 5GPCA 1KA8A 4WCGA 2P7CB 1FTMA 2HCAA 1QVUA 2OV7A 1FOWA 2ZO4A 2AXTC 5E8GA 2ZNTA 1SAUA 3T22A 4RGUA 5M3FJ 4MEXF 5E1ZB 1LE8A 1RDXA 5H8FB 3I71A 3JRAA 2XXQA 2G7HA 3KFMA 2FIEA 5BNGA 4FX4A 1PB7A 1BTJA 1IMDA 2ESNA 4HF2A 1ZLQA 3OOAA 3KPHA 3PQJA 2BV6A 1EA3A 5DCFA 2W7YA 2J5OA 3G3KA 3VV5A 2V93A 3F0CA 1MBGA 4PUSA 1NUZA 3SZGA 3LA2A 4IRIA 1A99A 3KN8A 5HM4B 4XLCA 2E7XA 2HNHA 1NUWA 3K4JA 2DOFA 2MYSA 5H6RA 1ZH5A 1K4SA 2XUBA 1JKPC 4KPTA 5ILUA 3V83A 5HLHA 4PFRA 3IC7A 1LBBA 2QRYA 4D1QA 3RZOJ 2PMZA 2I8DA 5F0CA 1T38A 2Z23A 3TW7A 1RDZA 3T9HB 1MZBA 1W36C 4BEHB 4DBRA 3L9FA 4EM1A 1OCPA 3E1SA 2AL4A 3ZQ7A 3O2PE 2R3SA 2M45A 3L00A 5L3FA 5IP6A 4KYSA 1VFCA 3I4MJ 1WJCA 1FBEA 5HVQC 2LF7A 4G7ZF 4LG0B 4OVRA 2OWTA 2IGKA 4IHYA 3DBHB 2HFBA 2V6CA 4X1EA 2RC4A 1B32A 4DIGA 2LTPA 4O5VA 2MSYA 1U8RA 2RQQA 1QKAA 3E78A 4RB3C 1XS9A 1QVSA 1DP3A 3BLYA 3QOEA 1ZTRA 3WE3A 1FBQA 2MG4A 1R4NB 2QM3A 4KIGA 4IKFA 1N25A 1SFKA 2EA2A 4GGGA 3MPKA 1MBEA 4JWXA 4A3GJ 2OCUA 4BH9A 1Z0XA 4GRIA 1YRNB 3OOPA 3KETA 1A40A 3RN8A 3SEVA 1BN5A 2JA2A 2N8GA 2ZSIB 3HYIA 3JRBA 3C32A 3K01A 2RC7A 3QPTA 1YJ9I 3DTEA 3FV1A 1JNFA 5H8QB 4BDMA 1LFHA 2FJ1A 4LK0F 1KA0A 3NOHA 3B6CA 5HLGA 1UZCA 1B5HA 1BKAA 3MWBA 3S2DJ 1D0XA 4IO2A 1A6IA 3RDIA 3C2GA 1GVCA 2O7IA 1ZGAA 5B3SH 1LKXA 2CUZA 2B65A 3ZGKA 1K83J 4YB6A 3WTXC 1MDQA 1SBPA 2A5YB 1B3FA 4U4SA 4DLDA 1SYHA 3SXYA 1FPGA 2HOTA 2IGNA 4BGDA 2FA5A 2DI3A 4DI4B 1LAHE 2XKPA 3SETA 5IT3A 3P7NA 2DA2A 5IP9J 2LREA 2VBWA 3K0LA 1XS5A 5DV5A 4UVCA 4A0ZA 1T2KA 4N17A 2DA3A 2CEXA 1ZHFA 3QRFF 3G3FA 3GZGA 1FEXA 1WGXA 2RNJA 4G68C 2GM4A 3SESA 3F21A 5EEGA 1PUFA 4AB5A 4WKMA 1POY1 1G8XA 2ISZA 4PGPA 1MPCA 5FLMJ 3CF2A 2L4AA 4HNUA 1YS7A 4HOBA 1IN6A 1P9QC 2B7EA 2GXGA 4A93J 4A3CJ 3LSRA 2R7TA 3HSRA 3HIFA 3V8JA 1N84A 2PX9A 2EQRA 4B43A 4AWXB 3LAJA 2ZNYA 4M6XA 2ELKA 3P5JA 4A0XA 3H9QA 4TV7A 3HRTA 2Y7PA 4P11A 5BUUA 1B59A 4I99C 4JOMA 5CVUA 1T95A 3L2UA 4G77A 1MXXA 3GBBA 4U0YA 3SEYA 1LEVA 4HYEA 2ZJQF 1D4NA 4II2A 3F8FA 1K4TA 2E1OA 5HOOA 1ZG1A 5IT9K 1OQYA 5AA4A 1RRJA 3RYPA 5H8HB 3IR1A 4MLVA 1U78A 3W15C 4G8MA 1J5YA 2H8RA 4Z6YA 3BC8A 3OMBA 3RGYA 1W1WE 2K3PA 2XGCA 3E5UA 1RNLA 3HHFA 4BU2A 4G4PA 3DEEA 3M1CA 4HNVA 1FBPA 3IRRA 5DVJA 4O3AA 3ZXSA 2LKXA 1MMDA 3T5XA 5AIPA 4PFUA 4GWZA 2LFBA 1R4MB 1Z7LA 3L2VA 1ANFA 2XXPA 1IUDA 1O7FA 3IL1B 3S8PA 3K7AJ 1GVDA 1JVXA 2CW8A 1KZ8A 3RI4A 4I3YA 1TP4A 4XLHA 4A3JJ 4F29A 2X7PA 3PTYA 2L02A 5EYHA 2J5PA 2B9SA 4HV5A 1UHMA 4D9JA 3BWGA 2DXRA 1S72I 4G68A 1XPXA 3VSLA 5FTIA 3OL3A 2QS1A 2PBWA 5AA1A 4R75A 1QO0D 4PJJA 1OFCX 3BG9A 4NMYA 1BK4A 1GUUA 2DTZA 3K69A 1FTOA 3DLAA 1V54H 1FJLA 4HE0A 3CCQI 4ZEKA 3PUYE 4GCVA 1NNTA 3N26A 3O6IA 4AB6A 5A5XA 1FPKA 1DTZA 3MKYB 5KDTA 1PVEA 1EZOA 2RREA 5TJJA 3K1PA 1Z9CA 2FYIA 2XPWA 1B6AA 2OBGA 1UG0A 4BS9A 2HWVA 3CCRI 3OO7A 5DTBA 3ERED 5EYGA 2R7SA 4XKVA 2L3DA 2HFHA 5DEXA 2ABHA 1R6ZA 3NRVA 2JZYA 3LFUA 4A3BJ 1NH3A 2DWIA 2VJ5A 1Y3PA 2UXNA 4F18A 3IJXB 2ISYA 4PTKA 3THIA 1G3WA 3BTJA 1KU2A 3I58A 2HKXA 1TZLA 4C30A 1FQAA 2R7QA 4L18B 1BC8C 1X1CA 5A2QZ 2XWIA 2D1HA 1B46A 2CUFA 3MBPA 4PDKA 3OIPA 3HGYA 3M8FA 1QPMA 2YU3A 4XLAA 4XLNF 5T3JA 1VQ7I 2CYYA 4JX4A 2VONA 3G7WA 3BTIA 4OVTA 5F6FA 1JP4A 3ZQGA 2P5VA 2E5NA 2OTLI 2XSDC 2ECBA 3RQ4A 4O6JA 2BY0A 3I54A 1ZJLA 1S8NA 3RQTA 1LBZA 3OSQA 1ZKGA 3RJPA 3EQ1A 1WODA 4MNUA 4NX1A 4U2RA 3OD7A 3KLOA 2Y0SA 2GQQA 4BUPA 1SFOJ 1FPIA 1IJWC 2XV4S 3T0JA 4PFBA 4KISA 3LMMA 4PJNA 2EBIA 1D1CA 4U87A 5CYVA 2NXNB 2F4OB 4DBQA 1MJAA 2K02A 1MMAA 4RB2C 4MIJA 2DK8A 4MQ9F 3CI8A 4OENA 2LH9A 4MH5A 3GYHX 4PAIA 4E7KA 2WB1A 1JHHA 4NF6A 2ID3A 3D5RC 2B4MA 1MY0A 4POXA 1OMPA 2LY1A 2Q2CA 4F3BA 4GX4A 1W5TA 2Q8KA 1U6GA 2RC9A 2IS6A 1ULYA 2XGXA 2QJEA 4EF2A 2Y31A 1FJ9A 3GX4X 4HQEA 2E7WA 4G6DA 1B4AA 3QMFA 4FORA 1ETWA 3CCSI 2A07F 3AL0B 2OPTA 5F24A 3HSEA 1F43A 1Y4TA 2DAOA 4HEA2 4IR8A 3E97A 3RPUA 1A55A 2O61A 2HXRA 2LD5A 1G3TA 4HW0A 2PJRA 1MXVA 5ET5A 1PUFB 4GF8A 3T8TA 2CW0F 2Q0OA 4LMYA 4UVBA 3WTUC 3OYFA 3OYIA 4MJOA 4NN3A 4F91B 5JR3A 1SW4A 4LLLA 2A3SA 4MNIA 2KPMA 1ZN2A 3O3KA 1RC9A 2YX7A 2K85A 1RR8C 2AHQA 3VVFA 1QVTA 3KEOA 1P1UA 5HLTA 4I98B 2F7BA 2O9LA 1B7ZA 5I84A 4KQPA 2CV0A 2HPGA 3L2QA 4ZYDA 1IO2A 3LSJA 1FTZA 2K9MA 4UV9A 4D5FA 1S29A 3RZDJ 3IB0A 4HTGA 2E2IJ 4KR5A 3Q0VA 2CWEA 4M71A 5D5VB 4LIVA 2DFHA 1I1SA 5AA4B 2HZTA 1U0JA 4KT6A 4RB1A 5E20A 4KMFA 2EIKH 3S3MA 1QBJA 3WTZA 1DMBA 1LCTA 4JQFA 3TO6A 4BKXA 4ZDPA 3HKZN 2EFQA 2L7FP 5JI6A 3IJOB 3IB2A 3WU2C 4L5IA 1U9NA 4DYQA 2PMHA 1P4WA 2VE8A 5C44J 4EGYA 4OU0A 2PJPA 5J1YA 1IQ7A 1EH6A 3H6UA 2IA1A 1SFEA 3DKYA 2OJTA 1IDZA 1JTYA 1D9VA 4AIDA 2IS1A 1SI1A 3GFIA 4YELA 5K5RA 4IZZA 1YIOA 5H8NA 4QFKA 2LY9A 1FZPB 4NC7A 4JWYA 1M5EA 3N97A 2IRFG 2BJJX 4RB0A 4ESJA 4ETSA 2DPDA 2DQRA 3A2KA 3GTKJ 1FYLA 3HOVJ 3QP5A 4BLAA 3TEPA 1SW5A 1LVAA 5J6XA 3KYDB 3FM3A 4EM2A 3LSPA 2WYPA 5IGAA 1I6HJ 1NI9A 2ZNZA 2YSRA 2XIGA 5K7ZA 1R9LA 4O7IA 2WBMA 2QEXI 5BOXA 2EV5A 4ZYHA 3OENA 4KNYA 1DQUA 2CQ7A 4YIRX 1IN8A 3TW6A 5KK1A 1VQ5I 5F64A 4DXUA 2QVUA 2KJBA 3CC4I 3A03A 2Y5KA 1S7AA 4XF5A 2DT5A 1V3FA 4ZJZA 3LSFB 4I6ZA 1W5CC 3RQIA 4HDUA 2MKZA 3BCBA 1NUYA 5A5XB 2V4JC 2ZZVA 2WTEA 2CZHA 4DOZA 2KISA 3N4MA 4MAGA 2O51A 4RJZA 4GWWA 4A3FJ 2O68A 1X1BA 3HEFA 4KMUX 4A5MA 1HSJA 1OPCA 5J1UA 2WC2A 3OIOA 3ZMSA 5D5WB 1Y3QA 1MJ9A 4N8GA 2ZFUA 3SERA 1QUIA 4YEJA 1W4MA 3VWBA 5AA2A 3HSTA 2KR0A 5DEXB 1FPJA 2RAEA 2DDKA 4X1DA 1ZG3A 2UVJA 1LBCA 3V7CA 3G2BA 3ONQA 2F35A 5H8QA 5ILVA 3GWZA 3TDUC 4NWDA 3LSWA 4G2ZA 3IKTA 4Q30B 1XDSA 3LSIA 5F1QA 3IWZA 4A0YA 4IO5A 4V2FA 1TXFA 4PE5B 5JK4A 1ZGWA 2W82A 3DEUA 3U1DA 5E3MA 3JSPA 4PAKA 3T9UA 2EB7A 1OISA 5J8CA 3OEMA 2FHYA 4FECA 4DQ2A 1JKRC 1XSVA 2DA4A 3GCMA 4XFEA 2OJED 4A2UA 4KN7X 2DVCA 4L17A 1RESA 5D5XB 2Y30A 4Q5TA 1FQEA 3KCCA 2AS5F 1WI9A 1Y20A 3J80Z 1PDNC 2XXXA 2K86A 3LSHA 2WAQN 4LFUA 3HG9A 1NV0A 3F6OA 2VQHA 4LATA 1AWBA 3OYCA 3GZNB 2ZZWA 4IHVA 3TOBA 4GDFA 1BIYA 3DXJF 1UTBA 4ZE8A 1SD6A 3E7LA 1KYWA 3DPLC 3TKDA 4J00A 2ADUA 1FOXA 5FFXA 1GV5A 3A0HC 1IRFA 3PMVA 2CQNA 2H6BA 1N3XA 3CMAI 1T39A 2F8DA 5C3EJ 4MEVA 1TWFJ 2I58A 1JT6A 1P92A 2IP2A 1WWXA 5JFRA 4WX9A 1Q35A 1UB9A 3S15J 3IWFA 4GXOA 1LDJA 3I5OA 5JLXA 4AC0A 3L2WA 2GIVA 1I5ZA 2MABA 3H0GJ 3FVKA 1UTHA 3DTKA 5LGTA 4OMYA 2NUVA 4NF6B 2I48A 4O8MA 4CICA 3CR9A 2CFXA 5L3CA 2PMSA 4G7HF 2QS4A 3HCQA 4LA9A 1GVJA 3SYTA 3S9LC 1CGPA 2XAFA 1T0KA 1XT8A 1H3DA 1R36A 2V84A 1L3LA 2F3BA 1NNKA 3RUMA 1W36D 3HOWJ 4HSRA 5FFZA 1RR7A 2ZCWA 2FNCA 1ZTYA 3LQRA 3SKPA 1HCRA 1MQJA 5IYCJ 1H0MA 2EFNA 4G12A 1P1WA 2V26A 3ECHA 3TOAA 3JRIA 4ZEIA 4AS4A 2KRHA 2PJRB 4P55A 2V3UA 2CGPA 1G4DA 1XHYA 2DCEA 1IMEA 3TL4X 1VQ8I 2F4MB 2CQQA 3GTQJ 4BDRA 3GFMA 2KMUA 2M87A 4A3EJ 1MY4A 1WQ2A 4OYVA 2GIZA 1IG7A 2VUMJ 1GV2A 4XOTA 2WAFA 3GBAA 4R73A 1H88C 2AQFA 3ZRGA 5F0HA 2STTA 4LLNA 3SEXA 2K9LA 4KN4X 3W2VA 4HCYA 5KAIC 1X2NA 4ZYGA 4Y3OA 4IQJA 2F36A 1HF0A 3HC7A 2BW3A 3F8CA 1FSAA 3QYFA 1Y39A 1S5LC 3OV8A 2ICWG 3KZGA 4FJPA 5FROA 4JBZA 4Q47A 3RCOA 4HSTA 4FHTA 1NMUA 4XXUA 1II5A 1MNDA 2L9SA 1PBQA 5ELVA 1MDP1 1ZELA 4D7MA 3OEKA 2G0EA 4LG3A 1Z7NE 4BDQA 5E1XA 2CQKA 3E3KA 1UJ8A 1RDYA 4ZS9A 5ILSA 1VFDA 3PGFA 1OQGA 5CVJA 3I4PA 5LGUA 3CCEI 1NFTA 1IN7A 2XXRA 4NTLA 3DFGA 3K6XA 3OYDA 3S1MJ 3JRFA 1G0IA 2VT3A 3ASOH 3KP4A 3KYLA 5ICFA 1PP8F 2RINA 2NRAC 3DPUA 3CC2I 2BJIA 2P4WA 3CP2A 4GBWA 3TCFA 3EUAA 4YMAA 1JXSA 1WZ2A 3KZIC 4PFTA 4BDLA 2VOPA 1AU7A 3D1NI 3LSXA 5I57A 5CVIA 1KYZA 3IHUA 2XB0X 2DMUA 2UV1A 2QWWA 4HBLA 3HM5A 4EJOA 4XOPA 3F9KA 3OYBA 1Z1DA 4GOTA 1FCKA 3TUSA 3OS0A 3SJMA 1NV7A 2JA7J 2R0QC 1GDTA 4MHGA 1DU0A 2I0BA 4A3IJ 2HQ0A 1YCJA 2CMOA 2LY2A 5A2QK 3OL4A 4X6AJ 1MGTA 3CG1A 1Y56A 3ASNH 2XXIA 3K4UA 3D1RA 1ZR2A 2KT0A 3PPRA 3B6QA 2BHYA 3JZJA 5CVVA 2OU2A 2ONRA 1T56A 1DOTA 3AFHA 1OCOH 3IORA 1XMAA 1JT0A 1TW2A 2HYFA 3IL2A 2HDDA 1ZIUA 1KGSA 2KIFA 3BG6A 2PT1A 5BPIA 2JA8J 2ZYMA 4XTCQ 4U0VA 3MP1A 3REOA 3SFZA 1P1QA 1R23A 5AA2B 2Y9ZA 2E1CA 1FTLA 5L8DA 1H43A 4OFLA 3DCFA 4HV6A 2DA7A 4JX5A 2E60A 3RYRA 4EEFG 3JRHA 2VT5A 4MBPA 5A5LA 1R58A 1VZ0A 3IB1A 3COAC 2KLOA 4ND9A 4XKNA 3U92A 1FOYA 4JK1X 2Z2SB 1UHWA 3VYTB 1NK3P 1FRPA 3NQOA 4R6KA 1MQIA 4Q48A 4UA8A 4HRIA 4OQOA 2XAUA 5KHDA 4IOCF 2ALUA 1TNTA 1WI3A 1EH3A 2KRCA 1JE8A 4UVAA 3BT9A 2R7UA 1S9TA 2HXIA 4ASNA 1JGGA 3S9EA 5D8KB 3E6DA 2XROA 5M5YJ 5KVRA 4B3AA 4CZCA 1K6YA 2CMPA 2H1KA 2GRVA 3F8MA 2CO5A 5DEQA 4RK2A 1OCTC 1FX7A 2WBDA 3ZKLA 3PM1A 1D0YA 2HTJA 2F6GA 2FMYA 2DYRH 4ZEDA 2JSPA 1I6XA 2MD0A 4NQWA 4DIQA 2ZJRF 3UIFA 5IZ3A 3EHSA 5HPQA 5LDZA 1A31A 3CRBA 3SHFA 2DT6A 3F8NA 1LAFE 1B4HA 1B7UA 2JJKA 3U2RA 4JXIA 1U2WA 4X9TA 1UTBB 2DYXA 4N07A 1RKWA 2V1DA 3L7WA 3OYMA 1R9QA 1B2HA 4U21A 2BHZA 2W4SA 3O97A 2VPNA 4BE2A 4AS5A 3BR1A 4Q8RA 4FIMA 3KBRA 3K9TA 1DU6A 2PLYA 4OIQF 2FBPA 1AOYA 4OESA 2NVXJ 2KQZA 5F1RA 1SW2A 1P4AA 2L9RA 3FKIJ 2D1VA 3CDLA 4BDYA 3KP6A 4DXBA 5IZZA 3M4OJ 1YLFA 4I02A 4DNCA 4EQBA 2CU7A 2NS8A 4GX3A 3KYCB 2PT2A 3L6HA 3BR6A 1D9QA 5IM2A 4B44A 4F39A 3OS2A 4IQ4A 1UTHB 4X48A 1MKMA 3OIQA 2VD3A 1A7LA 1PDAA 3HKZA 3Q29A 2FRHA 4XNFA 3RYDA 3P9CA 1JKQC 4NC8A 1USTA 4LUBA 3USDA 4ABZA 1MG1A 4YIFA 4YB7A 4LONB 4E0WA 4IY5A 2VQLA 4M74A 1YG2A 5LLQA 4XIGQ 4PFYA 2R93J 4BDNA 1VQLI 4CDGA 3CMMA 3ZN0A 1N77