1HSJA

Sarr mbp fusion structure
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
487
structure length
487
Chain Sequence
KIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALAAAQTNAAAEFMSKINDINDLVNATFQVKKFFRDTKKKFNLNYEEIYILNHILRSESNEISSKEIAKCSEFKPYYLTKALQKLKDLKLLSKKRSLQDERTVIVYVTDTQKANIQKLISELEEYIKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the SarR protein from Staphylococcus aureus.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription/sugar binding protein
molecule keywords FUSION PROTEIN CONSISTING OF STAPHYLOCOCCUS ACCESSORY REGULA
total genus 143
structure length 487
sequence length 487
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
A PF12802 MarR_2 MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1hsjA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1hsjA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1hsjA01
1UTHB 3QP5A 4BLAA 3DELB 1S3JA 1EH8A 4I0BA 4M73A 4OETA 4CYDA 5LEKA 5EHMA 2PBWA 2FOKA 4IPAA 2A6EF 2PMUA 4XLPF 3P9IA 3Q25A 5IT3A 2EV5A 1MD0A 2QL3A 5I84A 3IB1A 2JT1A 3F6OA 3DPLC 4AIKA 4Y15A 3WTYC 1IXIA 1SW2A 2RN7A 5M2VA 1FBUA 2E7WA 1JW5A 1H45A 4R73A 4IO3A 2JRTA 3ILTB 3ISPA 4KYEA 5IKBA 3IL1B 3K9TA 2Q2AA 1ZHFA 2X7QA 1I5ZA 2RF1A 2DW4A 1LB8A 2HCAA 4N9HA 4U23A 4L0ZB 3SEYA 3PMVA 1IN6A 1I27A 2HYFA 3T8RA 2VD2A 4GFRA 2EFQA 3BJ6A 1U5TC 1FWZA 1H76A 2YJPA 2ZNSA 3MCZA 4KIFA 2DXYA 1UTHA 3JSPA 4FAJA 5I59B 1HW2A 2GH9A 3TZAA 1YS7A 4L9TA 3G73A 1LB2A 4H0WA 3WTTC 1LLSA 1MZBA 2YPRA 4EJWA 1S50A 3QXMA 3AAFA 1URSA 3R6SA 3ZN0A 5CRYA 1SMYF 3ZPLA 1KU9A 2A5YB 2IW5A 2GAUA 1KQ8A 2XKPA 1SW4A 5J8FA 4BDRA 1B3LA 1LAXA 3V7SA 2I4BA 2FSWA 2XX8A 3ZKLA 3KGCA 1LJ9A 2ESHA 3R4KA 4G94A 1FSHA 1RZ4A 4A5MA 2QPQA 3B7DA 1EZOA 2MH2A 3IKVA 4KIBA 1ZMGA 2OD5A 2ZMEB 3R26A 3MJNA 3T93B 1TTYA 4GQOA 4OIRF 4EM2A 3ULQB 1G3SA 4H8IA 1J75A 4I62A 1ZREA 3LUYA 4LK0F 1B52A 1OMPA 3I5OA 1RI7A 3BDDA 1XGSA 4OU0A 1B05A 3VEPA 3KOTA 3MVXA 4F1VA 3T5XA 4AVPA 1JXSA 5HDKA 4KYDA 4KHZE 1FQEA 2EK5A 1LGBC 3KLOA 3RKXA 2GWRA 3KP2A 4OMBA 2IJLA 3U94A 4UV8A 3ML6A 5F1RA 2VN2A 4I2OA 1LFIA 4TLMB 2PEXA 1D4NA 4LZ8A 3WTUC 3LBSA 1LCFA 3LA2A 3GZ6A 1L3LA 2I3VA 3QIMA 2R3SA 1US4A 3H03A 3TAJA 1LCTA 4YIIA 1ZG1A 3JAMK 4R75A 1LDKB 1B9NA 4U0VA 4A0XA 5ILVA 6PAXA 4MLQA 1PB8A 4CDGA 2JZYA 4FEDA 4UA8A 3QPTA 1UIUA 2JPBA 1MDMB 3O9PA 1LEAA 4DNCA 2LKPA 2P5LC 1OQHA 2H99A 5CVVA 4CHUA 2O6GE 2KKOA 2FNCA 3LQQA 3E97A 2L4AA 3P9CA 3S4UA 1MM6A 4U22A 5L3FA 4B8XA 3RYPA 4RGRA 2NYXA 4M9SA 5ITPA 3WU1B 1T38A 3O6HA 5DEQA 2VBWA 4QHQA 3COAC 4DXCA 2A3SA 2EFOA 3V7CA 1WI9A 3EYIA 3IOVA 3RI4A 3MAJA 3I71A 1IUYA 4P9FA 1S7YA 2A68F 2DLLA 4A12A 3GF2A 1FTJA 3FMSA 5TP9A 3U93A 3GVAA 5L9MA 1NNPA 1ELJA 4DE8A 3U1DA 3TKYA 1B40A 3T8TA 3R0JA 3HN0A 3SEVA 4F2QA 4ZZAA 4ENMA 3S9EA 3F8BA 4P5OA 2DOJA 1HKSA 1N0TA 5I56A 2ACJA 5EHSA 1R1NA 1TBXA 5FLXZ 3H6VA 3S9MC 1D9YA 1KQ0A 2XGXA 4TQUQ 4Q48A 2K4JA 1K7AA 5BS6A 1YQAA 5TPAB 4LK1F 3OOAA 3MZYA 3C33A 1ZG3A 2KJCA 2I58A 2ANJA 1JGSA 3K69A 4WWCA 2AIXA 4P96A 3FGSA 1YG2A 2A07F 2ZNZA 1FTKA 3WE2A 4F31B 1F5TA 1YIOA 4HBLA 1MQJA 3IHUA 5E17F 4JQFA 5CM6A 5JFRA 4HF2A 2O8XA 4O6JA 1AWCA 4G2ZA 3PGFA 2VC1A 4LB5A 4MF3A 1XMAA 1FNNA 3FMQA 5AA1A 1FSEA 1MH3A 3RKWA 3KN8A 2GRVA 1ZG5A 3FJMA 3CSGA 3LA7A 3IOWA 4RXLA 2H27A 2Z8EA 3TTRA 1R5GA 1JEUA 2WWYA 4S05A 3H7MA 3O6GA 2Y0MA 1ON2A 4KCDA 2O68A 3I54A 2ZJ2A 3S2VA 2OZZA 3CFZA 5BWJA 3LSLA 1BIAA 2EWNA 3NEUA 5LEJA 1SYIA 5E8GA 1XGMA 1XGNA 4G7ZF 5A5XA 5CLSA 3WGHA 3JSOA 4EF2A 3PQJA 5CYVA 3KP4A 1T6SA 3R7XA 1QUJA 1ZARA 4IO4A 1EH3A 3OEMA 4XXUA 4HF0A 3VV5A 5TRDA 4PCQA 4R6KA 2HR3A 1GV8A 3RT6B 3PPQA 4KQPA 4QFNA 2FF4A 3FVNA 4M74A 1IXRC 3WTSC 2VE8A 1W4MA 2BE5F 4PETA 4IGRA 1KA8A 5E8IA 2V9VA 3V8JA 4YMAA 4L17A 1MKMA 3IK6B 2DQLA 4ENKA 3K0VA 2YLNA 1USSA 3IJOB 1XDSA 3TTLA 2ZNYA 3OSRA 1IXHA 4UXNA 4HQEA 1B46A 3TCGA 4O3MA 4TLLB 2B3FA 2XKOA 3CUQC 4GYGA 2MBFA 2XHDA 2PJPA 4ESBA 4GL8A 1Y3PA 2XXQA 3SDFA 4YFKF 2GXGA 4Q47A 4DXUA 2O03A 5HS9A 4CICA 4RK9A 4KI0E 3EUHA 1B6AA 1U6GA 4S04A 3Q9SA 1BP5A 2M8EA 3EQLF 3FZVA 5CMMA 2CGPA 2PI0A 5EEGA 5CVIA 4LQ5A 1II5A 3KOSA 3HTUA 3OOPA 2PQ8A 1U5TA 1GVCA 1KYZA 2O3FA 1HKQA 1JQFA 1SD5A 2VOPA 1N7XA 2ZCWA 1I1SA 3HRTA 1VR5A 5I2NA 2R71A 3RLFE 1K79A 5ED4A 2DPDA 1EH7A 2GA1A 3OO7A 4XSZF 4L5IA 1R22A 3TQWA 1O3QA 3DV8A 1OYYA 3Q9VA 1ZKBA 1R1TA 3WG9A 1M5BA 4NF6B 3LQRA 1MRPA 4UHTA 1H9GA 1UIVA 3L09A 4QFKA 4R74A 2D2WA 2RQPA 2DVCA 3ZMZA 3L2CA 1LQ1A 2UYEA 4HF1A 1JVXA 3PPOA 1B3FA 2I4CA 4OINF 5DD4A 3VLUA 1CF7B 5TPAA 3MQ0A 5D8KB 3QSLA 3C3WA 1MM7A 4WKMA 4IO7A 3D4CA 1IRGA 1NMUA 3RPWA 3RKYA 2LAOA 2HAUA 3IOUA 5ISUA 3QU6A 2LF8A 5LLQA 2ELHA 4LQ2A 3WAFA 1CGPA 3M1EA 1USYH 3VXBA 3RTRA 1B7ZA 1PC3A 2IA0A 3HPIA 2NAZA 5IAIA 1U2WA 2RC4A 3O3KA 1O3SA 1VTNC 2GFEA 2OCUA 5CBSA 5BPIA 5JI6A 1B0LA 1N7WA 1YW9A 1VE4A 3VXCA 4BDLA 5CC2A 2NWJA 2A61A 1W5SA 1XSXA 3BBRA 4POWA 4X48A 3G7WA 1MY1A 1MJBA 3GW2A 4U0WA 1D3KA 1WODA 2V93A 2DSFA 5K5QA 2K86A 4OQOA 1J1NA 1NNTA 3WAEA 2XAGA 3CI8A 1OLAA 1PDNC 2G29A 5DYHA 1POY1 4DQ2A 1B32A 1QUKA 5H8SA 4FECA 2L54A 2IEEA 3V5AA 4DZ1A 3KP3A 4EXLA 1POTA 4EQ9A 2JTVA 3ZP5A 4OYVA 3K00A 4Z7EA 1IXSB 4MTEA 4IRIA 3TODA 1R1VA 2I49A 3UIFA 3E4RA 3GZGA 3MBPA 2W7YA 3UN6A 2QVOA 1W7PB 1FOKA 3QUJA 1EZ9A 1GR2A 1H3DA 3FXUA 1XVXA 4YKKA 4I02A 5DD8A 5LGTA 3RYRA 2PMSA 3PPNA 1I6AA 2I0BA 2VT3A 2KIUA 2Y75A 3K01A 4NHJA 1ZLJA 1QVSA 2TDXA 5D5WB 2X4HA 1WSUA 4AIHA 3C18A 5FTIA 3RT8A 1LDJA 2DBBA 1N3WA 3QYTA 1YS6A 3PQKA 3F8CA 3IRRA 3CO6C 3QK6A 3E5UA 1QZYA 1FBQA 4U7BA 1B1XA 2ZKZA 2A5TB 2I0CA 3CIJA 5JVTA 4POXA 3FVKA 3MWBA 2K27A 1LSTA 3RUMA 3CVGA 3JZJA 3UGWA 2GA2A 1HW1A 4HDVA 4KCCA 4G68C 2OQGA 3TCFA 4H5GA 3WU0A 1BC8C 4LGWA 3H6WA 3SESA 1XC1A 4L0YB 3IB0A 1JW4A 4YB7A 2J5OA 4HCWA 3SEWA 2DE2A 3CG1A 1BI2A 3HSTA 2Y48A 5DCMA 4M6XA 1DSNA 3TO7A 5DV5A 1QKAA 3MAMA 1XMKA 2W57A 3CUQA 1PP8F 2ZYOA 3G3HA 3IRQA 1EV7A 3I0TA 4YKPA 3H6UA 2OQRA 3U8QA 3WTWC 1TW3A 1XOCA 2XXWA 1MQIA 1QZZA 5HLHA 1R9LA 1JNFA 2DWHA 4LLLA 4KFQA 2FQ3A 2HQNA 2FA7A 2ALUA 2MC3A 3FVOA 3N94A 3T9HB 1GXPA 5IT9K 5J8CA 2UVHA 1USYE 2PVUA 3N97A 1IXCA 3KEIA 1MQGA 1TQMA 2CYYA 4U21A 5K2YA 2OU2A 4M1VA 4C1UA 5DEXA 1A40A 2W85A 3K1MA 5H8NB 4FIMA 3F8MA 2FBHA 4G8NA 1R58A 4KN7X 4RB3C 2V79A 1U3EM 1MJAA 1WQ2A 4QWQA 1FY7A 4PDKA 4U88A 2ZNTA 3MUQA 2XAFA 1Y4TA 2YPNA 5AE4A 3T1BA 4F2OA 3L9FA 1UHWA 2UYFA 1A99A 2X0LA 5DDGA 4IHTA 3VFJA 4RJZA 3JV9A 2O7UA 1YO5C 1UQWA 3I5UA 2Y7RA 2XRNA 4WXHA 1VFDA 1AL3A 4YB5A 4I1DA 3HSFA 2FMLA 3M8FA 2VHAA 1CB6A 2R6GE 2P1SA 1A04A 1MPBA 4QSEA 3CRBA 4NEDA 3V8KA 3T96B 2QLZA 2F7CA 1KU3A 4GVOA 3B6WA 1RKMA 3MQ9A 3DXJF 3FX3A 1TNSA 3QU3A 1DPEA 1D5VA 1NH8A 2A69F 1WDNA 1SD3A 4FT8A 1OQGA 3LAJA 2F8DA 3USDA 5TP9B 3U1OA 1LFHA 1YLFA 5ICCA 1P1WA 4IRHA 3VE1B 5DT6A 2FYIA 2G7HA 1S29A 3MZ9A 4MQ9F 1DP7P 1Q1HA 5L3GA 2DK5A 2D3IA 2Q0OA 4KD5A 4G9YA 4KMUX 4G68A 1I6BA 2Q8JA 2NNYA 1A8FA 2DE3A 4H0EA 1BI3A 1LAGE 4UVAA 4MLVA 2NUVA 2RCAA 1UHMA 3NRVA 2M1BA 2Z99A 3ILUB 3BFUA 1B51A 1OMIA 4G8HA 4HX4A 5I57A 1HBXG 5ICFA 4KUMA 5ERIA 3KEQA 3LWFA 4AWXB 2VC0A 5CVRA 1GHCA 4NQWA 1SW1A 1NL5A 4Q30B 3W6KB 4ISUA 3KP7A 1MY3A 4LB6B 2XX9A 4ELPA 3ONMA 1LB9A 2M30A 1WWXA 1XCVA 1J9IA 1IITA 4RB1A 3VOEA 1AIVA 4A2UA 3GFIA 3KZGA 1HSEA 3DP6A 4N07A 2UZKA 1XVYA 4P9UA 4BDQA 4WXCA 3IORA 1PB9A 1O3TA 2DP8A 2VP1A 2E1SA 2KLFA 3LR1A 3OEKA 4RPOA 3W15C 2XD3A 1I6QA 3JTHA 3FV2A 4G8MA 4ECFA 4ONYA 4OESA 4R2BA 2EV0A 2P6TA 3TQNA 3FHZA 2O1LA 2DFIA 2NVUB 3E6CC 2LSOA 1U78A 2AS5F 1XHYA 1M5CA 3V8XB 5E1XA 2F5EA 4NE4A 3H4ZA 3KZZA 3EF7A 1OIBA 2HXWA 2EA2A 4F7ZA 3H6TA 4NF8B 3TOBA 3KLNA 4F22A 3S2WA 4EQQA 1FLIA 5AA4B 3ZN1A 4OTEA 2WTEA 4FORA 5KCJA 1G6NA 1W7PA 2DXRA 2XD2A 4ZYEA 4NF4A 4ZYGA 4YZZA 3LA3A 4FE8A 2V1XA 3WTXC 3C4MA 5KVRA 2Y7PA 4QSDA 4I01A 3W6JB 3J81K 1MPCA 2XXTA 3RQTA 3SETA 1A54A 3VB2A 3KJTA 1ZH5A 4EJTA 1WVJA 4R6HA 1URGA 2H94A 3QPHA 1SMTA 2W84A 4LONB 1LAHE 5FHMA 3TOAA 5CVUA 4MEXF 4F3BA 2EFNA 1J5YA 1E17A 1P1QA 1J2XA 5A2QK 5FB2A 3CUOA 4OIOF 5LBQA 1ZTYA 3R6UA 2WC2A 1LFGA 1MXUA 2ONRA 4RGXA 4CXFA 1O57A 2XAQA 3L7WA 3C34A 2Z33A 2BGCA 1B1HA 5K1YA 2IT0A 2Z8FA 4HQMA 3IOTA 5DVJA 4RB0A 2DPUA 5F1QA 1GVJA 3ZMDA 4E70A 1M5FA 3E13X 2PT1A 3R0AA 5J1DA 3IAZA 3F6VA 3ZS6A 4HCYA 3FV1A 2OZUA 1T98A 1FTLA 4XIGQ 3TO6A 4LJZF 5I58A 3K1PA 1DTZA 2FNPA 4I8CA 4BHCA 4F18A 1QGPA 3I6VA 2UXXA 5HLGA 1P1UA 3OD7A 3C31A 3K6UA 4I0AA 1RUOA 1TFDA 4JBZA 2E7XA 3I53A 4LATA 4EJOA 5ICQA 4R72A 2R7DA 3I59A 1JVYA 2UVJA 4PFUA 1Z7UA 4EQ7A 4HLXA 2F78A 5H6RA 4G8XA 2GXBA 5D4SA 2GQQA 2ABHA 1W5TA 4ELRA 1ZGAA 1B0HA 5HM4B 2O6AA 4R79A 5CMKA 4UVCA 5DCFA 4KICA 3O2AA 1IXGA 2P5KA 3O97A 2DK8A 1L0OC 3OO9A 1G4DA 1IF1A 4AIJA 2Q2EA 1SFXA 4GCVA 1HSJA 1FX7A 2OLBA 3N4MA 2HFBA 2B3BA 2PX1A 2DYXA 2IPQX 3ZMSA 4ZEFA 4H65A 2H09A 4UNOA 2Y7KA 4BDOA 4KDPA 1HXDA 3EPEA 4NWDA 5LGNA 3FXRA 1YFHA 3JW4A 4IJAA 3VFZA 3DP4A 2RC7A 4OEVA 2PBIA 4PZJA 1QNTA 2QQBA 4UVBA 2ETHA 1US5A 1H0MA 4PFYA 3DKWA 3SXYA 1A7LA 4JSDA 4HX8A 3V8LA 1MPDA 1B1BA 3GFMA 1FPQA 5L3DA 5H20A 5H8QB 3R60A 4NF5A 1NH7A 1JETA 4B09A 3DP7A 3J7AO 2L02A 2A6HF 3LSTA 3GEZA 1WKMA 3DQVC 3TTMA 2IA1A 3M8EA 1J0RA 2Q2CA 3V89B 3KEOA 5L9SA 4Q4ZF 2I48A 5FD5A 5ILSA 5HS7A 4YU0A 2LDUA 3ELKA 4QSCA 2FE3A 1JHFA 4ZZEA 3DFGA 1RUNA 2RNJA 3TPAA 2ESNA 1Y1MA 3K6VA 4R9GA 3F22A 1EH6A 4Q5TA 4GWOA 3QAXA 4HX7A 4CZZA 5E1ZB 2Q88A 1HKTA 3O2PE 1TWYA 4QF9A 2CFXA 2QJEA 1ZIUA 4NF4B 1BC7C 1XSDA 3TFLA 3B6TA 3O6BB 4A6EA 2L3DA 2DE4A 5FHNA 3W9WA 3D0SA 1MY2A 2FNAA 2R7FA 3ABTA 1RNLA 5ITOA 5TU0A 3E3VA 4E0XA 2H4IA 1OYWA 3HSRA 5DTBA 3THIA 4LLGF 4LZ7A 4YFXF 1GTKA 3GBAA 4GOTA 2KIFA 1FQBA 4WXJA 4IY5A 2QQAA 2REJA 5AA2B 3H3UA 4WX9A 2EFWA 4FX4A 2HOEA 2E0SA 3VODA 4OMZA 3LSFB 4GGGA 3IKTA 3KN7A 4XKNA 2L01A 4HA8A 3KBRA 2HS5A 2G93A 2PT2A 2Z8DA 3MW0A 3PUYE 1HW5A 1VFEA 2EB7A 4FJPA 2XAJA 4YKJA 5I2KA 1F4KA 1D3YA 3Q26A 1Z6TA 2FA5A 3EYYA 4JXIA 4IVNA 1Y1ZA 4IY6A 4MBPA 2QBYA 2D1HA 1RYOA 3C9HA 3MP8A 2F2EA 2M87A 2IRFG 1KGSA 1ZGJA 1NKXA 1QO0D 1BM9A 4L9NA 5LHGA 2VBZA 2DQVA 3T0YA 4IGTA 5E18F 2B0LA 5FO5A 3ROUA 3OO8A 4EXKA 3J80Z 4Z2YA 1SI0A 3BOQA 4HV6A 4QLCU 2K02A 2UXAA 2ONKE 3IR1A 4RB2C 4PFTA 5LOMA 3I4PA 1EZPA 5A2QZ 3GXAA 4P55A 3A3CA 4ZZDA 1B5IA 1REPC 3B6QA 3PUVE 4Z0IA 3E5QA 1V4RA 4IF4A 3BROA 1FTOA 2RCBA 3BFTA 1Q1KA 1JEVA 2D45A 1WRJA 5I2KB 3HRMA 4OVJA 1BI0A 3TQLA 4AB6A 4GXOA 4ZYDA 3B73A 4EVIA 1MDMA 5BUUA 2WKYA 2O1MA 3CO7C 2HTJA 4PGGA 3RN8A 4MTDA 2FMYA 2QM3A 5JK4A 2H9BA 3RNNA 4PFWA 5BQTA 2XXHA 5FTHA 1YTYA 3CG3A 3JAMZ 4M9ZA 3VVFA 1FQAA 3EHSA 3RGYA 1QBJA 3MZ1A 4YKIA 5I57B 1H44A 3N6TA 3F8FA 1XB4A 1BIBA 1Z1DA 4RGSA 5KDTB 2QWWA 4E0WA 2QS3A 1T0FA 2P7VB 1N3XA 3KFMA 1YYVA 4EMSA 3OXNA 4H5FA 2EJRA 5LRSA 4IHSA 3KE2A 2QS4A 1FT9A 1FZPB 2V3QA 4ZEKA 3OENA 4Y17A 1OVBA 3VVEA 4OHNA 3M9AA 2DTRA 1DPUA 5L3EA 3MVZA 4KR5A 3GBBA 1ONVA 1ZJLA 1FCKA 1D9VA 5D5VB 2P8TA 4HTGA 2CWEA 2HZLA 1B4ZA 4ESWA 2BBYA 4ESXA 3U92A 4BH9A 2P7CB 3GX4X 1HSLA 4JWYA 2OJTA 4GYIA 5DUIA 2YX4A 1SFUA 1I1GA 1OKRA 2VOOA 1LBBA 3DPTA 3AXFA 1H43A 5DEXB 4P11A 2ZXTA 2R9JA 1NFTA 1CF7A 2V25A 2PYYA 3F21A 3PPPA 1IRFA 4N0BA 3ODBA 2NS0A 2Z5UA 2QYOA 1IQ7A 3EDPA 3PPRA 5AA2A 4MEYF 2P5VA 3SFZA 2UXNA 4C1TA 2OWTA 4WEDA 1C0WA 4DLDA 3GYHX 4G4PA 2HZTA 5AA3A 2HKOA 2QS2A 2QENA 5EEHA 1NHAA 4EDPA 2YR2A 4MHGA 4R1HA 1IEJA 1FW0A 1TW2A 2RGVA 4NF6A 3TTKA 3ZMUA 3A09A 3TDUC 3IWFA 4IO6A 5B70A 2DWAA 1B4HA 3ZMVA 3VDFA 1V3FA 4H8JA 2V6CA 3BY6A 5KK1A 1G3TA 1ZLQA 4HAMA 4BNCA 2NOOA 3G3GA 4F3PA 4GO1A 3KETA 4R8HA 5CBRA 2RDPA 3J80K 2I3WA 3MP1A 1JW1A 5FGMA 3HCQA 4MQVA 4OFJA 3T9VA 3RIRA 2THIA 4GXSB 5K2XA 3KFWX 3PV0E 3P7NA 4FX0A 3ECRA 3P9KA 1QULA 1UCRA 2VODA 4OEUA 4OFLA 1Y20A 3HV1A 3T9UA 1K78A 1NNKA 3RY3A 2MH9A 3IL2A 2AL4A 2WV0A 3FVGA 2KRFA 2VXZA 1P1OA 3PUXE 1LEBA 1TXFA 4PQJA 4QFPA 3TGNA 3U2RA 4ZYHA 4AB5A 3S9NC 1IUDA 4WCGA 1B59A 4XTCQ 3QUFA 4OOIA 3K6XA 3BPVA 4LG0B 5I56B 2BYVE 4GF8A 4RAZA 3E5XA 4RPNA 1SDXA 1UB9A 4O5VA 1BTJA 2DO7A 1S7OA 1XD7A 4ZEIA 1AMFA 4ELOA 4HW8A 4NTLA 1N04A 1K78B 3VLWA 1BJAA 2MLKA 4H67A 4LVQA 2O51A 4JWOA 1Z6RA 5A5XB 4HZFA 1SD7A 5AONA 5CMBA 3T9XB 1D8KA 3CDHA 3M3LA 4L5JA 4KPTA 1B3EA 3K6WA 1MH4A 1DMBA 1MXZA 5I2NB 1MQHA 4X1BA 5IT9Z 3E6DA 5HLIA 1ZU0A 2BEOA 2XASA 5KCJB 1DPRA 1MXYA 1QUIA 3B02A 1ODDA 3F23A 4RGUA 3MZBA 3PMWA 3OELA 5D8LB 2RC9A 1FP1D 4KA4A 1ANFA 4WEPA 4RYAA 1BBYA 1SBPA 3KN3A 1B7HA 2OBGA 2X26A 4KN4X 3M3FA 3KG2A 4ZE8A 1STZA 3NQOA 2K4BA 1Z9CA 4PE5B 4FHTA 3O28A 2NNNA 1ATGA 1ZBMA 2W25A 1Y3QA 2F5CA 5LRRA 1OR7A 2OK2A 2JPCA 5LHHA 4EQBA 3ECHA 2ZYMA 1QW0A 1YW8A 5K5OA 5I58B 1FQFA 2B65A 2DS9A 1FBSA 2C6YA 1OPCA 4EJUA 3K2DA 2FBKA 5AIQA 2FEZA 2DI3A 3C35A 3EHUA 3REOA 3J81Z 4BHPA 4I7HA 3W9VA 4NF5B 5FD6A 4THIA 1PEBA 3KP6A 1DUXC 4KIGA 5TJJA 2GHAA 3IX1A 4HDUA 3Q27A 3K2ZA 1DDNA 2P2AA 4G77A 3GO5A 1XSVA 2ADUA 4ZS9A 1QQIA 4ZZLA 4KMFA 2XV4S 4R9FA 4RAYA 1ZLKA 3FF5A 3KZYA 3C32A 3HHHA 3Q5FA 2E1CA 2P4WA 5FFZA 1KU2A 4GL0A 1YTVA 1NNFA 4CO8A 4GRKA 4AQ4A 4DCXA 2HYGD 4KYWA 5EYFA 2ZMBA 1PDAA 2W24A 3L00A 3WTVC 2F34A 3FM5A 3G3JA 4F1UA 3HOSA 2HWVA 2ZYKA 1B7UA 1DOTA 2QMXA 3LFKA 2CQKA 4L18B 3CFLA 1GGGA 2HEOA 3HO7A 2IA2A 1P99A 4ESJA 3LC8A 5HBCA 2YSRA 5B7DA 4G68B 1KYWA 1FC3A 5H6QA 2QSXA 2O61A 4GIZA 2REGA 4F3GA 4YFNF 4WXDA 2AYSA 3QAHA 3TUSA 1B9MA 3Q29A 4LUBA 1B3GA 4WK8F 2GIVA 3DP8A 3N6UA 3C7JA 2YX7A 2XXVA 2GZWA 2IA4A 5BMZA 1AOYA 1R9QA 3SHFA 4N13A 5H8QA 3SEXA 3E3KA 1T2KA 1B6HA 2QBYB 3O6IA 2FXAA 4KFCA 4RY1A 4FATA 1Y0UA 2L4MA 2XXXA 1MGTA 2RKHA 2P6SA 4XBFA 3FUZA 3BPXA 4JSOA 3HHFA 4NWCA 5DVIA 2O84X 4EGYA 2XHKA 3FM3A 3ECOA 3PUWE 4ON0A 2QZ8A 5D6FA 1QKBA 3S9LC 4HV5A 2F36A 3U9GA 2XROA 3F11A 4DXBA 4M72A 4F3SA 1UFMA 4ETSA 2UVGA 1OVTA 1PBPA 3PD8A 2A5SA 2PFBA 3OMBA 2Q9TA 2HZKA 3Q28A 3TCHA 4BHBA 1Y3NA 2HEUA 3I58A 1L5TA 1BI1A 4ENJA 4OIPF 3HUGA 1BKAA 2H25A 2ZNUA 4N6PA 3DLNA 4ZE9A 1SI1A 3E6BA 1O3RA 3TEPA 3IJXB 5HDNA 1TNTA 3TKDA 2XXUA 3SQNA 5I59A 5L3BA 1SQYA 2DWJA 2F6PA 2OWSA 3I59B 2VT2A 2M5WA 3FWEA 3HIFA 5JHUA 3IWZA 4A5NA 1N76A 3DF8A 1FYLA 3SEUA 2MA3A 3VLVA 3HSEA 2QUFA 3MZHA 5DUKA 2E1NA 3CSBA 4ZH4F 3OV8A 2ISYA 2VGQA 3L6GA 3HOTA 1Z7NE 2RVCA 1IN4A 3R61A 1URDA 5AA2D 1KQ9A 2XVCA 1B5HA 3T66A 4DIGA 4YG2F 1B9JA 5ICGA 5JEIA 1XCBA 1B4AA 2DVZA 4F19A 2XIGA 2F5DA 1BN5A 2KIMA 4IO2A 2PMHA 3C1DA 3E9XA 1F1ZA 2XXPA 1MXXA 5D4RA 1IN8A 1FTMA 5L3CA 2D21A 2JSCA 3SZPA 2HQRA 4QFOA 4BDNA 2STWA 2ZBKA 2YU3A 2HFHA 3G3ZA 2EA4A 4O3AA 4U2RA 3SKPA 4XRFA 1E2XA 5D5UB 5DYMA 1YPNA 4OENA 2H5YA 2BV6A 2VOZA 1QPMA 2HQ0A 3IB2A 4ASNA 3EN3A 4ESFA 3OO6A 2QMWA 4XKQA 3BJOA 2COMA 3C36A 5L9OA 4GXAA 4JB7A 2O7IA 1B58A 3GXOA 1BLFA 2RV8A 4ZDMA 2ZXJA 1YCJA 5AA4A 1TFAA 4EV0A 1P6RA 2ZO4A 4DCYA 2V3TA 2IVMA 4HW0A 5H8HB 4TV7A 4XSXF 1PB7A 1P92A 1MY0A 2HAVA 5F7VA 4H6DA 3HTSB 5JR3A 1LBCA 3UORA 1P4XA 3QOPA 1DTGA 4L9VA 5E20A 1R7JA 5KZTA 3LAPA 2XXIA 1R1UA 4PP0A 4R2FA 3DM0A 1SAXA 1RYXA 2RC8A 4YICA 1ZAOA 3K0LA 3ZSFA 2GHBA 4NB5A 3OSQA 3UK4A 2ZYNA 3KJ7A 2M8CA 4GD5A 1I69A 3L6HA 2NXOA 4D0PA 2ONSA 4OZ9A 3WGIA 4KYSA 1Y9UA 4A6DA 2V3UA 1LNWA 1KWHA 2ZFWA 4N9IA 2FBIA 5J6XA 3FASA 3M3KA 3HRUA 1ZRFA 1ZRCA 3MP6A 3G3IA 3TTNA 3ZKKA 1XDUA 4I9DA 3K02A 1O7TA 2CO5A 3TDJA 1ZYRF 3H92A 1Z91A 4ENNA 1JE8A 4RK2A 5ICEA 2QQ9A 4YB6A 2XXRA 1FQCA 1BOAA 4CGZA 1R00A 3EQ1A 2DAOA 4YIFA 4G7HF 2H98A 4JWXA 3BKIB 1HSTA 4EM1A 3TYHA 4X1DA 5HPQA 1YW7A 4QFLA 2VONA 1DPPA 2DT5A 3O29A 1R6ZA 5ILUA 4YMBA 1TQPA 5L8DA 1MXWA 4A0YA 2Z23A 2STTA 4HLYA 1OYIA 2RKMA 2XAHA 3LSXA 3PU5A 4C0RA 5E1WA 2OA4A 3GUDA 4M71A 1T0KA 3F72A 1UTBB 5AIPA 1LAFE 4F39A 5FHOA 1AH5A 5CMCA 3GFJA 4UUVA 3T22A 4BDMA 2F7AA 1XGOA 2D1VA 4XKPA 3BJAA 4MFIA 3RTWB 2Y7IA 4IO5A 4LLNA 1J59A 3PUZE 4O3CA 1H9TA 2OBPA 3RTFB 2VBXA 3WODF 3BP8A 4RS8A 5DCMB 3KSJA 1TQIA 3FD3A 1Q35A 4OFOA 4DDDA 4IRGA 4GLIA 3RPUA 3BZ6A 3DEUA 2CMOA 4MH5A 3WE3A 5LGUA 2F5FA 1YAEA 3GLXA 3WTZA 4LG0A 5KDTA 4G6DA 5ELVA 4YAHX 2ISZA 3HYIA 4UACA 2AXLA 1O64A 4LMYA 1OLCA 2D5WA 2PN6A 1F9NA 4ND9A 1O7FA 2OZ6A 3N26A 2UVIA 1J7KA 4U1ZA 1KU7A 3M7GA 3U72A 2ZMEA 3FMRA 5H8NA 2G7UA 4A0ZA 1SW5A 3RPQA 1S8NA 4XLNF 4F29A 3CLOA 1MJ9A 3MWMA 2DWIA 4BQAA 4Q0CA 2LNBA 3F3XA 1O63A 1FYKA 4LD5A 1R36A 2Z3YA 4EF1A 1MS7A 1ON1A 3V83A 4JK1X 3RDIA 1U8RA 5HOOA 1FYMA 1Y4CA 1Z7ME 1M5DA 1USTA 4O3BA 2V1UA 2IP2A 2V1DA 3UA8A 3TDZC 2DQRA 3FATA 2XUBA 3PD9A 1TT1A 1G3WA 5D5XB 4RA1A 3VVDA 3H3ZA 3P7IA 1MXVA 1QJMA 2HKXA 1S6LA 4JDFA 4U4XA 2G9WA 2Y84A 1SVXB 1MQDA 1MG1A 4NF8A 1S9TA 4L9JA 2DU9A 1K6OA 3HRSA 4OIQF 4X9TA 3HHGA 2QRYA 4H1XA 1G3YA 5H8FA 1EU8A 2EV6A 1P4AA 1IN5A 3D5LA 2UWMA 4ZEDA 2Z9OA 3LSWA 5FFXA 4P0GA 1AOVA 2O69A 1B3HA 3CUQB 4LP2B 5JTYA 3D4GA 3K1NA 1LDDA 5DVFA 4TOZA 1Z05A 2AL5A 4BXUA 3CR9A 5ICTA 2CW0F 3TELA 4M4GA 1W7PD 5FLXK 3ZMTA 1GXQA 1A55A 3MEXA 2VD3A 1PUEE 4AD9A 2A5TA 1XS5A 4EGZA 1ULYA 3JTGA 2QS1A 3I64A 2V84A 4OERA 3GFLA 1B5JA 3V4GA 3EHTA 4BAYA 3IC7A 1IIWA 1PBQA 4R6YA 3QRFF 2I6EA 3TO9A 3PMXA 1FQDA 1MY4A 3I3VA 1IW7F 4K3FA 4U7DA 4K2EA 3FJ7A 2HGCA 5CJ9A 3CFXA 4ELQA 4LZ5A 3KP5A 3CJNA 4IB2A 4P0IA 4QRZA 3BWGA 5HS8A 4LA9A 1UTBA 2EFPA 2VBYA 3GLBA 3N5LA 4OWDA 4WF2A 2Q8KA 2M45A 1IZ1A 3MVWA 1S7AA 4U0YA 2PLYA 3V7RA 2CSOA 1P4WA 4LFUA 5F64A 2Z22A 3MFKA 4MNUA 2O0YA 4EM0B 2RINA 4OMYA 3ZQ7A 5LHIA 1ZN2A 4U1OA 3GZ5A 3MVYA 2X7PA 3FJGA 5BPDA 1O7LA 1SFEA 4PGHA 5K5RA 2CG4A 2KJBA 4HOBA 3O66A 2FRHA 1SD6A 2XXYA 2VE9A 1I6XA 5H8FB 1F9BA 2XX7A 1XN7A 1R23A 1X3UA 4IXAA 5HVQC 4NMYA 4OXVA 5CI5A 1CE2A 1N84A 3UP9A 4Q5SF 4I98B 3KSXA 4RNSA 3A3UA 2H6BA 5BOXA 5D6EA 2H6CA 1FP2A 5HDGA 1LVAA 1HQCA 2HTSA 2NRAC 1T39A 3TMGA 4KNYA 5JTYB 2FU4A 4MGRA 1TLHB 1RIOH 4G6QA 1SD4A 3MPLA 4G7OF 2J5PA 5H8HA 2K7LA 3E6MA 4HS7A 3RJPA 3H3GA 2F35A 4FEBA 1MDP1 3SZTA 1MDQA 1PP7U 3MC2A 4UV9A 3G3FA 1IAWA 2HDCA 3MPKA 3ERED 4ZECA 4M6YA 1A8EA 3M8UA 1B2HA 2Q89A 2Y7WA 1IN7A 1JHHA 3ABUA 4I09A 2F6GA 2MD5A 5F6FA 4JBAA 3FIRA 3PFIA 4U4SA 4EUOA 1M5EA 4M9XA 1ZRDA 3KCCA 4Q8RA 2PG4A 3IO4A 3WGGA 1BIYA 1VSOA 5CVJA 3F8NA 4HYEA 3CTAA 2BJJX 4KT5C 2LF7A 4BYYA 3QP6A 1D8JA 3H06B 1XT8A 3IO6A 1SYHA 3G3KA 4ZEBA 2OAZA 3EETA 3FXQA 1R5HA 3GWZA 2F7BA 2CZLA 1P2FA 2MLGA 1P1NA 3K4UA 1U5TB 4Y13A 2F5XA 3SERA 2P0SA 4XKRA 3JYRA 2F97A 4EJVA 4F1YA
chains in the Genus database with same CATH superfamily
1UTHB 1JT6A 3QP5A 1FPEA 1NV0A 1S3JA 3DELB 1EH8A 4BLAA 4I0BA 4IR8A 3ABLH 4M73A 4EEFG 4OETA 5JLXA 4CYDA 2LRDA 2WB1A 5LEKA 3CF5F 2FOKA 4IL6C 4IPAA 2PBWA 2A6EF 2PMUA 2V4CA 1EYIA 5FBPA 4XLPF 3P9IA 1MBHA 5IT3A 3Q25A 1J09A 4PFBA 2L0KA 2EV5A 1MD0A 4N4NB 2QL3A 5I84A 3IB1A 2JT1A 1Z7LA 3F6OA 3DPLC 4AIKA 4Y15A 2IS1A 3WTYC 1ERDA 2PCRA 4BEHA 1IXIA 2KDOA 1SW2A 2RN7A 2NOGA 4A3DJ 5M2VA 1FBUA 3S1RJ 2E7WA 1JW5A 1H45A 4R73A 1SC7A 4BACA 2JRTA 4IO3A 2CS3A 3ILTB 1N75A 3HKZA 2AO9A 3ISPA 4KYEA 5IKBA 3IL1B 3K9TA 2Q2AA 1ZHFA 2X7QA 1I5ZA 2JJ7A 2RF1A 2DW4A 1LB8A 4NDLA 5ET6A 2HCAA 3DTIA 4N9HA 4PJNA 4L0ZB 4U23A 4IQ4A 3SEYA 1LKXA 3PMVA 1IN6A 2QCOA 1I27A 2HYFA 3T8RA 3GBGA 3ZCOA 2EFQA 2VD2A 4GFRA 3BJ6A 1U5TC 4MFDA 1FWZA 4XQFA 1H76A 2YJPA 3HOVJ 2ZNSA 3MCZA 4KIFA 1Z3XA 2DXYA 3BZCA 3JSPA 1A35A 3EPZA 1UTHA 1WJDA 1HW2A 2GH9A 4RAGA 4FAJA 4I76A 3TZAA 1YS7A 4L9TA 4NBQA 3G73A 1LB2A 2P3VA 4H0WA 3WTTC 1LLSA 1MZBA 2YPRA 4V19K 2XXKA 1IRXA 4EJWA 2DA3A 1HCRA 1S50A 4RBOA 3QXMA 3AAFA 1URSA 3R6SA 3ZN0A 4DBRA 3CJQB 5CRYA 1SMYF 3ZPLA 1KU9A 2A5YB 2IW5A 2MW8A 2GAUA 1KQ8A 2XKPA 1SW4A 2HDWA 4BJTA 5J8FA 4BDRA 1B3LA 1LAXA 3V7SA 1IGNA 2I4BA 3OS1A 2Q1ZB 2FSWA 4A3CJ 2XX8A 3BT9A 2JJKA 3BLYA 1BA5A 2W7NA 3ZKLA 5EEAA 2MABA 3LSKA 1U9NA 2RNGA 3KGCA 5I59B 3KEYA 1LJ9A 2ESHA 3R4KA 2CH0A 4G94A 1I6HJ 1YITI 1FSHA 1RZ4A 3G1MA 4A5MA 2K85A 1UELB 2CZKA 2QPQA 3LNQA 2HVRA 3B7DA 3K4MA 3FXLA 1EZOA 2L2OA 2MH2A 2VQGA 2Y0SA 3IKVA 4KIBA 1MBKA 2DT7B 1ZMGA 4MHFA 2OD5A 2ZMEB 3R26A 3MJNA 1YJNI 3T93B 3CCJI 3M8JA 1S72I 1TTYA 2X1EA 2BJIA 4GQOA 1VZ0A 4OIRF 3ULQB 1G3SA 4EM2A 3MKZA 1J75A 4H46A 4H8IA 4I62A 2F4MB 1ZREA 1IMCA 1NUXA 4ZYAA 3LUYA 4LK0F 1B52A 1OMPA 5GPAA 1RI7A 3BDDA 1XGSA 4OU0A 1B05A 3I5OA 3VEPA 3KOTA 5J4VA 3MVXA 4F1VA 3T5XA 4AVPA 2LR8A 1JXSA 5HDKA 3H5AA 4KYDA 4KHZE 4UABA 4ZC3A 2EK5A 1FQEA 1LGBC 3KLOA 3RKXA 3UR3C 1X1CA 2GWRA 4DI4B 3KP2A 4OMBA 3ZGKA 2IJLA 3ZQQA 3U94A 4UV8A 3ML6A 4OVTA 1WCMJ 2QKLB 3FKJA 2JUCA 5F1RA 1FPLA 2VN2A 4I2OA 1EYKA 1LFIA 1BOBA 4TLMB 2PEXA 1D4NA 4LZ8A 3WTUC 3LBSA 1LCFA 3LA2A 3GZ6A 1L3LA 2I3VA 3QIMA 1BR4A 1ETQA 2JUGA 2R3SA 2X48A 1US4A 3H03A 3TAJA 1LCTA 2P81A 4YIIA 3JAMK 1ZG1A 4XOTA 2V1NA 4R75A 2R7UA 4UY8I 4C9YA 1LDKB 3OYBA 1B9NA 4U0VA 4BBRJ 3I56I 4A0XA 5ILVA 6PAXA 3HOXJ 4MLQA 5BNGA 1PB8A 1E3PA 4CDGA 2JZYA 4FEDA 2E5NA 4UA8A 1D0YA 3QPTA 1A5JA 2Z1DA 2VJ5A 4KXPA 1UIUA 3H0GJ 2JPBA 1MDMB 2IGOA 1LEAA 3K4JA 1W0UA 4DNCA 1PUFB 2WAQA 3O9PA 2LKPA 2P5LC 1R5ID 5F08A 1OQHA 2H99A 5EYRA 5CVVA 4M3GA 3I55I 4CHUA 2O6GE 2KKOA 1LE8B 2FNCA 1V5FA 3E97A 2L4AA 3LQQA 3P9CA 1MM6A 4PCDA 3CC4I 4U22A 3S4UA 5L3FA 1AWBA 4B8XA 3RYPA 2JN6A 4PC9A 4RGRA 2NYXA 4M9SA 5ITPA 3WU1B 4B44A 1T38A 3O6HA 5DEQA 2VBWA 2X9DA 3C2HA 3LSJA 3TMOA 3COAC 2O8KA 4QHQA 3CZ6A 3J7AY 2MG4A 4DXCA 2NXNB 2A3SA 2EFOA 2TRTA 5M3MJ 3V7CA 1NTCA 1WI9A 2QSHX 3RI4A 3EYIA 3IOVA 3MAJA 3I71A 3SEQA 4P9FA 4I6ZA 1IUYA 1EYJA 1S7YA 1SANA 2A68F 1T33A 2DLLA 1XTAA 2NVQJ 4A12A 3GF2A 4GX4A 1KZHA 2CZHA 3C34A 1FTJA 3FMSA 5TP9A 1D0XA 3U93A 3GVAA 5L9MA 4H4KC 1NNPA 1ELJA 1AA7A 3U1DA 4DE8A 3TKYA 1B40A 3T8TA 3R0JA 3HN0A 3SEVA 4F2QA 4ZZAA 4ENMA 3S9EA 1Z3YA 3F8BA 4P5OA 4IHWA 1HKSA 2DOJA 4RA2A 1N0TA 3A03A 5I56A 1TP4A 2ACJA 2BVMA 1T8IA 5EHSA 1B8IB 1R1NA 2LK2A 2FX0A 1TBXA 4M3FA 5FLXZ 3H6VA 1D9YA 3S9MC 3H5NA 1KQ0A 2XGXA 4TQUQ 4Q48A 2K4JA 2XSDC 3OSGA 2E34A 1YQAA 5BS6A 1OCPA 4LK1F 4IX7A 1K7AA 2R7TA 3MZYA 5IPAA 3HZJA 3OOAA 2MSYA 3C33A 2HVQA 1ZG3A 2KJCA 2B4MA 2I58A 2ANJA 2X51A 1JGSA 2XF6A 3K69A 1IV6A 4WWCA 1MSEC 4DW6A 2AIXA 5M5XJ 3KC0A 4XK4A 2CZIA 4P96A 3DPUA 1YG2A 2A07F 3FGSA 2ZNZA 1FTKA 3RZOJ 3WE2A 4F31B 1F5TA 1YIOA 4HBLA 1MQJA 3IHUA 5E17F 4JQFA 5CM6A 5JFRA 5J1RA 4HF2A 2O8XA 4O6JA 1AWCA 2DYRH 4G2ZA 3PGFA 3L1PA 2VC1A 4LB5A 4MF3A 1XMAA 1FNNA 3FMQA 4PFRA 5AA1A 1FSEA 1X1BA 1MH3A 4XEQA 1X19A 3RKWA 3KN8A 2K9QA 4E7HA 2GRVA 1ZG5A 1JJ6C 3FJMA 3CSGA 3IH4A 3LA7A 3IOWA 2DA6A 1K4SA 4RXLA 2H27A 3B6CA 1HA8A 2Z8EA 4Y33A 4D5CA 4P3LA 1R5GA 3TTRA 1VQ7I 2LY1A 2L9VA 1JEUA 2WWYA 4PFOA 4S05A 3K4NA 3H7MA 2Y0MA 2WV1A 3O6GA 1ON2A 4KCDA 4C2MJ 2O68A 3I54A 2ZJ2A 3S2VA 2OZZA 4JP0A 4UB8C 4BY1J 1I39A 2LY2A 3CFZA 1Y1VJ 3C2GA 3PNTA 5DS9A 5BWJA 4HEA2 1RESA 3KIOA 1BIAA 3LSLA 2E35A 2EWNA 3NEUA 5LEJA 1SYIA 5E8GA 1K9ZA 3BQYA 1XGMA 1XGNA 4G7ZF 2DMNA 5IY5H 3ZQCA 1X1PA 3OYDA 5A5XA 5CLSA 3WGHA 3JSOA 2E2JJ 4EF2A 3ERMA 4XICA 3PQJA 5CYVA 1RR7A 3KP4A 1T6SA 3R7XA 4HE0A 4I3EA 1QUJA 2WX9A 1ZARA 3H3VK 4IO4A 1EH3A 3OEMA 4XXUA 4HF0A 3VV5A 1D0ZA 5TRDA 4PCQA 4R6KA 2HR3A 1GV8A 4BQQA 3RT6B 3PPQA 5M5WJ 3S1NJ 2OTJI 2LTPA 4KQPA 4QFNA 2FF4A 3FVNA 3MN2A 1IXRC 4M74A 2VE8A 3WTSC 1W4MA 2XC7A 2BE5F 2LG4A 4UUSA 4IGRA 4PETA 1KA8A 5E8IA 1PYVA 2ID3A 2V9VA 3HB9A 3V8JA 4L17A 4YMAA 1MKMA 3IK6B 2DQLA 4LIVA 4M3EA 4ENKA 5FKNA 2VXDA 1USSA 3PUFA 2YLNA 3IJOB 3K0VA 1XDSA 2A6TA 2ZNYA 3OSRA 2DTZA 4JOMA 5IP7J 1IXHA 2B9SA 3TTLA 1WJBA 4UXNA 4HQEA 1OQYA 1B46A 4O3MA 3TCGA 4TLLB 3RQIA 5DW8A 2M4GA 3K70D 2B3FA 1JTYA 3CDIA 2XKOA 3CUQC 4XNFA 4GYGA 3QYBA 2MBFA 2E2HJ 2L7ZA 1WZ2A 2XHDA 3B50A 2PJPA 4AUXA 4ESBA 1TL8A 1FBDA 4GL8A 4JX6A 4C3JJ 1Y3PA 2XXQA 4YFKF 3SDFA 2LP0A 2GXGA 4Y4RA 1JUSA 2M7AA 2Y5LA 3AL0B 4Q47A 4DXUA 2O03A 5HS9A 4CICA 4Y52J 4KI0E 4RK9A 1QVTA 1OJLA 3EUHA 1B6AA 1U6GA 2KISA 2L7MP 1D1BA 3Q9SA 4S04A 1BP5A 1YYZA 2M8EA 3EQLF 2W4SA 3FZVA 2KP6A 5CMMA 3W3CA 2CJJA 2CGPA 2PI0A 5EEGA 5CVIA 4LQ5A 3IH3A 1OCCH 3GZNB 1II5A 2HDDA 4ZDOA 3KOSA 2DOEA 1YRNB 3HTUA 3OOPA 2PQ8A 1U5TA 1VQNI 1KYZA 1GVCA 2HPIA 1FPJA 2O3FA 3G71I 1HKQA 1JQFA 1SD5A 1U8BA 4XL9A 2VOPA 1N7XA 2ZCWA 1B72A 4B3AA 1I1SA 2Q2EB 3HRTA 1VR5A 5I2NA 2Y9YA 4GBVA 5ET8A 2R71A 3RLFE 1K79A 3CCYA 5ED4A 2DPDA 1EH7A 4B1RA 2GA1A 3OO7A 1RKWA 4L5IA 4XSZF 1R22A 3TQWA 1O3QA 4BL0B 3DV8A 1OYYA 3BTJA 3Q9VA 1R1TA 3WG9A 1ZKBA 1LBXA 1M5BA 3LQRA 1AU7A 2LBFA 2Y2ZA 3QYEA 1H9GA 4UHTA 4ZTJA 3L09A 1MRPA 1VQOI 1UIVA 4QFKA 4R74A 2D2WA 1H8AC 2RQPA 3ABKH 2DVCA 4KISA 1NG7A 3S17J 2FJ1A 3IAM2 3ZMZA 3L2CA 1LQ1A 2UYEA 2BY1A 3HBLA 4HF1A 2OJED 1B3FA 1JVXA 2W00A 4II3A 4OINF 1QHGA 3BG9A 5DD4A 2I4CA 1VF9A 3VLUA 1CF7B 5TPAA 3MQ0A 1TWCJ 5D8KB 3C3WA 1MM7A 3QSLA 4IO7A 3D4CA 1IRGA 1NMUA 4WKMA 1LUJB 2K5CA 4DYQA 3RPWA 3HEFA 3RKYA 2LAOA 2VB6A 2HAUA 3IOUA 5ISUA 3QU6A 2H1KA 2LF8A 1XG1A 1T0FC 5LLQA 2ELHA 4LQ2A 3WAFA 4CZCA 1CGPA 5CBSA 3M1EA 1USYH 3VXBA 3RTRA 4BXFA 3HL2A 1B7ZA 3QPSA 1PC3A 4XOPA 2IA0A 3HPIA 2NAZA 5IAIA 1U2WA 2RC4A 3HPGA 1FBCA 2M8GX 3O3KA 1O3SA 1VTNC 2GFEA 2K3FA 3J7ZI 1DK4A 1MBGA 3ZR8X 5BPIA 2OCUA 5JI6A 1B0LA 2ELJA 1SVOA 1N7WA 1YW9A 1VE4A 3VXCA 2W48A 4BDLA 5CC2A 2NWJA 2A61A 1W5SA 1XSXA 2R7ZJ 1G0IA 1SEUA 3BBRA 4POWA 4X48A 2R4GA 3G7WA 3ASNH 2D5VA 3S14J 3I4NJ 1MY1A 4AS5A 3W6VA 1MJBA 3GW2A 4U0WA 1D3KA 1WODA 2V93A 2DSFA 5K5QA 1MMDA 2K86A 4OQOA 1J1NA 1BR1A 1NNTA 3WAEA 2WY7Q 4N8GA 2XAGA 4IEJA 1OLAA 1PDNC 2G29A 3CI8A 2F6CA 5DYHA 5LTCA 1POY1 4YELA 4DQ2A 2W1OA 1B32A 3OS2A 4L5EA 1QUKA 1OCRH 5H8SA 3LV0A 4FECA 2EQRA 2L54A 3LL7A 2IEEA 3V5AA 3OR2C 1Y56A 4DZ1A 3KP3A 2ZJPF 4D7NA 4EXLA 4NN3A 1P7IA 1POTA 3K70C 3RKQA 4EQ9A 2JTVA 2R5ZA 3ZP5A 4OYVA 3K00A 4Z7EA 3GMEA 1SPIA 1IXSB 4MTEA 4IRIA 3X2QH 3TODA 1R1VA 2I49A 3UIFA 3E4RA 3GZGA 3MBPA 2W7YA 4IHYA 3A2KA 3UN6A 2QVOA 1W7PB 2OC6A 4QTRA 1FOKA 3QUJA 1WH7A 2K40A 1EZ9A 1GR2A 3P5JA 1YZ0A 5FROA 2DFFA 1IMEA 1H3DA 3ZRGA 3FXUA 1XVXA 3JRBA 4OVSA 4YKKA 4I02A 5DD8A 5LGTA 3RYRA 4BE1A 4A3MJ 2PMSA 3PPNA 1I6AA 2I0BA 2VT3A 2KIUA 2Y75A 4NC8A 2V4JC 3K01A 1FBFA 2JK3A 4NHJA 4E6KG 1ZLJA 1QVSA 2TDXA 4PAIA 5D5WB 2X4HA 4PSWA 4ZJZA 4XLHA 1E0EA 4AYBN 2V7FA 1WSUA 4AIHA 3C18A 5FTIA 3RT8A 1LDJA 2DBBA 1RKTA 1N3WA 3QYTA 1EF4A 1YS6A 3PQKA 3F8CA 3IRRA 3NOHA 3CO6C 3QK6A 3E5UA 1QZYA 1FBQA 4H45A 4U7BA 1B1XA 2ZKZA 2A5TB 2I0CA 3CIJA 4P1EA 5JVTA 4POXA 3FVKA 2HVSA 1FPDA 3MWBA 2K27A 2R7SA 2WYPA 1LSTA 1P7JA 3RUMA 3CVGA 3JZJA 3UGWA 2GA2A 1HW1A 3BTIA 4HDVA 4KCCA 4G68C 2OQGA 3TCFA 4H5GA 3WU0A 3HC7A 4LGWA 1BC8C 3H6WA 2DA7A 3SESA 1XC1A 4L0YB 3IB0A 1JW4A 4YB7A 2J5OA 4PJJA 4HCWA 3SEWA 2DE2A 3CG1A 1BI2A 5T3JA 4QPQA 3TEDA 3HSTA 2Y48A 4E7IA 5DCMA 4M6XA 1DSNA 3TO7A 5DV5A 4NGUA 1QKAA 3MAMA 1XMKA 2W57A 3CUQA 1PP8F 2ZYOA 4IO9F 3G3HA 3IRQA 1EV7A 3CLQA 4CA0A 3I0TA 2CQ7A 3H6UA 2OQRA 4YKPA 3U8QA 3WTWC 1XI6A 1TW3A 1XOCA 2XXWA 1MQIA 4A3JJ 1QZZA 5HLHA 1R9LA 3OL3A 1JNFA 4B47A 2GOMA 4LLLA 2DWHA 4KFQA 2FQ3A 3V42A 3OYIA 2HQNA 3KBZA 1LBVA 4M6VA 3OY9A 1Y0NA 1HDDC 2FA7A 2ALUA 2MC3A 4M3DA 3E7LA 3DBLB 3FVOA 3N94A 3T9HB 1GXPA 3BR3A 5IT9K 5J8CA 2UVHA 1USYE 2PVUA 3N97A 1IXCA 3DWLE 3KEIA 1MQGA 1ETOA 1TQMA 2CYYA 3VDXA 4U21A 5K2YA 3VYRB 2KR0A 2OU2A 4M1VA 1YOVB 3JR9A 4C1UA 2BY3A 5DEXA 1A40A 2W85A 1Z67A 3K1MA 3RYDA 5H8NB 4FIMA 4FTHA 3F8MA 1IG7A 2FBHA 4G8NA 1R58A 3BIGA 4IQJA 5EQ8A 4KN7X 4V2GA 4RB3C 4P47A 2V79A 1U3EM 1MJAA 2Q8MA 1WQ2A 4A3IJ 4QWQA 1FY7A 4PDKA 4U88A 2ZNTA 2FUG2 2XAFA 3MUQA 3CCEI 1Y4TA 4C30A 2YPNA 4DZPA 2XSJC 3BCBA 5AE4A 3T1BA 4F2OA 3L9FA 1UHWA 2UYFA 3OIOA 1A99A 5IYBJ 2X0LA 5DDGA 4IHTA 3PPOA 3VFJA 4RJZA 2E1OA 4Y7NJ 1YO5C 1UQWA 2O7UA 3JV9A 3I5UA 3ZXSA 2Y7RA 2XRNA 2VPRA 1SAUA 4WXHA 1VFDA 2IGKA 1AL3A 4YB5A 5J47A 4I1DA 2N8GA 3Q0VA 3HSFA 2FMLA 2OCCH 1XMXA 2E1MB 3M8FA 1V5GA 5E3OA 1CB6A 2VHAA 1FMVA 3DCFA 3BTCA 2P1SA 1A04A 3W2WA 4B43A 4E7ZA 1MPBA 2R6GE 3CRBA 4QSEA 4NEDA 3V8KA 3T96B 2QLZA 2F7CA 1KU3A 4GVOA 3B6WA 1A31A 1RKMA 3MQ9A 3K4LA 4DJAA 3DXJF 2BHYA 3VYSB 3FX3A 1TNSA 5F24A 3QU3A 2CV0A 1DPEA 1D5VA 1K9YA 1NH8A 2A69F 1WDNA 1SD3A 4FT8A 3PJRA 3LAJA 1OQGA 3PL8A 2F8DA 5FLMJ 3USDA 5TP9B 3U1OA 2QVRA 1LFHA 2XF5A 1D9QA 4BJ6C 1YLFA 4OA4A 2VI6A 2M0CA 2IAIA 5ICCA 1P1WA 4IRHA 4MIJA 3VE1B 5DT6A 2FYIA 1FOWA 2G7HA 1S29A 3LSMA 4B3XA 2KRCA 4MQ9F 1IJWC 1DP7P 3MZ9A 1FBEA 1Q1HA 5L3GA 4JX4A 2HPMA 4M3BA 2ZXIA 2DK5A 3K4BA 2D3IA 2Q0OA 2WY8Q 4KD5A 2FOWA 4G9YA 2ZXWH 3M3YJ 4KMUX 1ACIA 1XS9A 4G68A 2L5QA 1BJZA 1I6BA 2Q8JA 2NNYA 5IYCJ 4GFBA 1LFBA 2M3AA 1A8FA 2DE3A 2BZTA 1VQ4I 4H0EA 1BI3A 3SJMA 3S2HJ 1LAGE 4UVAA 5E3MA 4MLVA 2NUVA 2RCAA 1Y1WJ 1UHMA 3NRVA 2M1BA 2Z99A 1N78A 3BFUA 3ILUB 1B51A 1OMIA 4G8HA 4HX4A 3CCSI 2ZMEC 2KIQA 1HBXG 5I57A 5ICFA 2TCTA 4KUMA 3FXBA 1VI0A 5ERIA 2X1CA 3KEQA 3LWFA 4JYKA 3MKWB 4AWXB 2VC0A 5CVRA 3S16J 1GHCA 4NQWA 1SW1A 5EDNA 1NL5A 4UB6C 4Q30B 2QVUA 3W6KB 1G2HA 1APLC 4ISUA 3RPLB 3KP7A 2BY2A 1G59A 3H9GA 1MY3A 2K3PA 4LB6B 2XX9A 3MKYB 4ELPA 1LVKA 3WHCA 3ZOBA 1FOYA 1OLTA 4B48A 2M30A 1LB9A 3ONMA 3EUKL 1WWXA 1XCVA 1J9IA 1IITA 2BW3B 3VOEA 4RB1A 1KA1A 4A2UA 1AIVA 3K6GA 2R5YB 3GFIA 4MX6A 3KZGA 1HSEA 4XMYA 4MO7A 3DP6A 3A4CA 1TT0A 4F92B 4N07A 2UZKA 3S3OA 2I5UA 1XVYA 4P9UA 5GAGJ 4BDQA 4WXCA 1TWAJ 3IORA 1PB9A 1O3TA 2DP8A 2ZZVA 5B1AH 4GWUA 2VP1A 4EATA 1XC5A 4XORA 2E1SA 2PMZN 2KLFA 3LR1A 4IOCF 3OEKA 4RPOA 3W15C 2XD3A 5KAFC 1I6QA 3JTHA 3HFUA 3FV2A 4G8MA 4ECFA 4ONYA 3G1LA 4Z6YA 2PFZA 4OESA 2VLAA 1MMAA 4R2BA 2EV0A 2P6TA 1R71A 2VL8A 1Y6IA 3H5RA 3M07A 3TP3A 2BY0A 2L7FP 2DFIA 2NVUB 3TQNA 3FHZA 2O1LA 5EGOB 3E6CC 2LSOA 1U78A 2AS5F 1XHYA 3L2VA 2GIZA 3A0HC 1M5CA 3V8XB 5E1XA 2F5EA 4NE4A 3H4ZA 3KZZA 3H36A 3EF7A 1OIBA 2HXWA 2EA2A 4F7ZA 3FDYA 1MMSA 3H6TA 4MAGA 4NF8B 3HUGB 4N15A 3TOBA 4NC7A 3S32A 3KLNA 4F22A 3S2WA 4DOZA 4EQQA 1FLIA 5AA4B 3ZN1A 4OTEA 2WTEA 4FORA 1X4PA 5KCJA 2DMPA 1G6NA 1W7PA 4DGWB 2DXRA 2GQ1A 2XD2A 4ZYEA 4NF4A 4ZYGA 4YZZA 1FIPA 3HKZN 4FISA 1HF0A 3LA3A 4FE8A 4XLCA 2V1XA 3WTXC 2KFDA 3C4MA 5KVRA 1MMGA 2Y7PA 4QSDA 4I01A 3DLAA 3IH2A 3W6JB 4ANJA 5IOZA 3J81K 4C2TA 1MPCA 2XXTA 3RQTA 3SETA 1A54A 1OCOH 3VB2A 3KJTA 1ETXA 1ZH5A 3KPHA 4CH7A 4EJTA 1WVJA 4XRMA 1MBFA 1URGA 2H94A 1HC8A 4R6HA 4NQWB 2JSPA 3QPHA 1SMTA 2W84A 4LONB 1LAHE 5FHMA 3TOAA 2JA8J 5CVUA 4MEXF 2DMUA 1RR8C 2XWOA 1A6IA 4RMNA 2EFNA 1J5YA 5F1JA 1E17A 4F3BA 1FPKA 1P1QA 1J2XA 3CCMI 3HXLA 3ONQA 5A2QK 5FB2A 3CUOA 1KONA 2ZXHA 5F04A 5LBQA 2YU9J 3VYUB 4OIOF 1ZTYA 2WC2A 1LFGA 1MXUA 2ONRA 3CC2I 1NV2A 4RGXA 4PAKA 4CXFA 1O57A 2QF7A 1OFCX 1LFPA 3QWLA 2XAQA 3L7WA 3NARA 1VQPI 4MNCA 2ZB9A 2Z33A 2BGCA 1B1HA 4KJZA 5K1YA 2Y9ZA 2IT0A 2YUSA 2Z8FA 4HQMA 3IOTA 5DVJA 1RETA 4RB0A 2DPUA 5F1QA 3G1OA 4IKFA 1GVJA 3ZMDA 4JVCA 3H35A 4E70A 1M5FA 2EPFA 2VUMJ 3E13X 4RDUA 2UV1A 2PT1A 5ESYA 2WAQN 3R0AA 5J1DA 2HXOA 3IAZA 3F6VA 3ZS6A 4HCYA 3FV1A 2OZUA 3OYAA 1T98A 1FTLA 4XIGQ 3D5SC 4LJZF 3TO6A 2ICWG 2H8WA 5I58A 1HOMA 2ME6A 3K1PA 2R0QC 1DTZA 2FNPA 4I8CA 4BHCA 1TWGJ 1QGPA 3OYHA 2R7OA 3I6VA 4F18A 2UXXA 2X6OA 4RLQA 5HLGA 1P1UA 3OD7A 3C31A 4N4UA 3K6UA 4I0AA 1RUOA 2VQHA 2DA4A 1TFDA 1T56A 3GTGJ 2E7XA 4JBZA 3I53A 4LATA 1FOXA 4EJOA 2KT0A 5ICQA 4R72A 5GAHJ 4XKBA 1U0JA 2R7DA 3I59A 1JVYA 5K7FA 1Z7UA 2HNHA 2UVJA 4GWWA 4PFUA 2VJ4A 4EQ7A 3E78A 5IGAA 1FEXA 4HLXA 2JA2A 2F78A 4G61A 2BHZA 4PFIA 5H6RA 1YE9A 4HE2A 1HLVA 4G8XA 2GXBA 3SZGA 5D4SA 2GQQA 2ABHA 1W5TA 4ELRA 1ZGAA 1B0HA 5HM4B 1AKHB 4LITA 2JA5J 4XKWA 4HNUA 2Y5KA 5A5LA 2O6AA 2Z2SB 4R79A 5CMKA 4UVCA 5DCFA 2GLOA 4KICA 4QIWN 3O2AA 3S1MJ 1IXGA 2P5KA 2Q74A 2DK8A 1L0OC 3O97A 3OO9A 1G4DA 4AIJA 5CPRB 1IF1A 2BXYA 3PIOF 2Q2EA 1SFXA 3H9JA 1IUFA 4GCVA 4N6KA 4PTKA 4E7JA 1HSJA 1FX7A 2OLBA 1H89C 3N4MA 2HFBA 2B3BA 1Q1VA 2PX1A 2DYXA 2IPQX 3ZMSA 4ZEFA 2IS6A 2QSFX 4H65A 3I3LA 4S0HB 2H09A 5FJ8J 1BW6A 4UNOA 4KDPA 1HXDA 2Y7KA 3EPEA 1JJ8C 4BDOA 4NWDA 4MLOA 3ZQLA 2CUZA 5KAIC 5LGNA 3FXRA 3JW4A 4IJAA 1YFHA 3VFZA 4AC0A 2PFYA 1NG6A 3DP4A 2RC7A 4OEVA 2PBIA 4PZJA 1QNTA 2QQBA 4UVBA 2XWKA 4J00A 4HNTA 4XM3A 1OISA 2ETHA 1RDYA 1US5A 1H0MA 1QA6A 3DKWA 4PFYA 3SXYA 1A7LA 4JSDA 4HX8A 3V8LA 1MPDA 1B1BA 1UG0A 5J16A 3GFMA 2AXTC 1FPQA 5L3DA 5H20A 1E3HA 4BUPA 5H8QB 3L2RA 3R60A 4NF5A 1NH7A 5DTDA 1FTTA 1JETA 4B09A 3DP7A 3J7AO 1NI9A 2L02A 2A6HF 4BY7J 2HHMA 2NS7A 3LSTA 1JI8A 2XPVA 3GEZA 5K7ZA 1E3OC 1WKMA 3DQVC 2K9MA 3TTMA 2IA1A 3M8EA 1BW5A 3CMAI 1J0RA 2M9HA 3VWBA 3KEOA 5FRMA 4Q4ZF 2I48A 2Q2CA 5FD5A 5ILSA 3V89B 5HS7A 4YU0A 2F3DA 2LDUA 2L9SA 5EF6A 3ELKA 1S7EA 4AYBA 4QSCA 2FE3A 4CCNA 1JHFA 4ZZEA 3DFGA 1RUNA 2RNJA 3TPAA 2ESNA 1Y1MA 3K6VA 2ZSHB 4R9GA 1MBJA 2DMTA 1MBEA 2DA2A 2G0EA 3F22A 2R93J 1EH6A 4MNPA 3FKIJ 4Q5TA 4GWOA 4NF0A 3KYLA 3E79A 4HX7A 3QAXA 4CZZA 5E1ZB 3GTPJ 2Q88A 1HKTA 3O2PE 4CYCA 1TWYA 2O5RA 2CFXA 2QJEA 4QF9A 1ZIUA 4NF4B 1BC7C 1XSDA 3TFLA 2COBA 3B6TA 2RREA 3O6BB 4A6EA 2L3DA 3EUAA 2DE4A 5FHNA 2LREA 3D0SA 4A3KJ 1MY2A 2FNAA 2R7FA 3ABTA 2L7KA 3K2AA 1RNLA 1OR7C 4A3GJ 5ITOA 3E3VA 3LOCA 5TU0A 1R49A 4E0XA 2H4IA 1OYWA 3HSRA 3BTLA 5DTBA 3VPRA 2KMUA 3THIA 4LLGF 4LZ7A 1JTXA 4YFXF 3S15J 1GTKA 4O94A 5DM7F 5JVGF 3QOEA 2WBBA 2KIFA 3GBAA 1FQBA 2EILH 4GOTA 1X1AA 4WXJA 4IY5A 2X6XA 2QQAA 3BQZA 2REJA 5AA2B 1IMBA 3H3UA 4WX9A 4F91B 2EFWA 4FX4A 2HOEA 1VFCA 4YIRX 3FXOA 3TL4X 2E0SA 5I5PA 3VODA 3O66A 4C3IJ 3I4MJ 4OMZA 1WJFA 4GGGA 1KA0A 3IKTA 3KN7A 3LSFB 2L01A 2QQ8A 4XKNA 4HA8A 3FBIB 3KBRA 4CCKA 4A3BJ 3IFAA 2HS5A 2G93A 2PT2A 2Z8DA 3MW0A 3PUYE 1HW5A 3GTMJ 1VFEA 2AQEA 5C3EJ 2EB7A 3CMEI 1LEVA 4FJPA 2XAJA 4YKJA 5I2KA 1F4KA 4GBWA 1D3YA 3Q26A 1Z6TA 2FA5A 3EYYA 4JXIA 4IVNA 1Y1ZA 4IY6A 1IRZA 4MBPA 2QBYA 2D1HA 1UG2A 1RYOA 3C9HA 3MP8A 2F2EA 2M87A 4X0GA 2IRFG 1KGSA 1ZGJA 1NKXA 4QSHA 5GTHC 1QO0D 1BM9A 1UJ8A 4L9NA 2VBZA 5LHGA 3DBRB 2DQVA 1W5CC 3T0YA 4NUBA 1FPIA 4IGTA 5E18F 4IHVA 2B0LA 3CCRI 5FO5A 3ROUA 1JKPC 3OO8A 4EXKA 3J80Z 4Z2YA 1SI0A 1T08B 3BOQA 3CCVI 2KPMA 4HV6A 4N4OB 4QLCU 2K02A 2JA7J 2UXAA 1R9TJ 2ONKE 3IR1A 5EQ9A 4BXXJ 4IOAF 3JRAA 3TW7A 3K4CA 4RB2C 3ZQHA 1OCTC 4PFTA 5LOMA 3I4PA 2HPGA 3FBPA 3O8GA 1EZPA 5A2QZ 3ASOH 4P55A 4PJLA 3A3CA 3GXAA 4ZZDA 1B5IA 1REPC 3B6QA 4HSTA 3GYYA 3PUVE 4Z0IA 3E5QA 4I99C 1V4RA 4IF4A 3BROA 1FTOA 2RCBA 5B66C 1RPWA 3BFTA 1R4NB 4NNJA 2OPTA 3PIPF 3HOZJ 1Q1KA 1JEVA 4KT6A 2D45A 2EIJH 1WFXA 1WRJA 3ESWB 5I2KB 1NUYA 5TISC 3HRMA 1INPA 4OVJA 3OYMA 1BI0A 3CD6I 2FQ4A 3TQLA 4AB6A 1QRYA 1UZCA 4GXOA 4ZYDA 4OWRB 2WYKA 3B73A 4EVIA 1MDMA 5BUUA 2E36A 2WKYA 2O1MA 4XLFA 3DLLF 3CO7C 4KITB 2DJIA 2HTJA 4PGGA 3RN8A 4MTDA 2FMYA 2QM3A 2CUEA 5JK4A 2H9BA 3RNNA 4PFWA 5BQTA 2GM4A 3BZKA 2XXHA 5FTHA 2F48A 2WBMA 1YTYA 1ETWA 2VJJA 3JAMZ 5FLVA 3S1QJ 3CG3A 5EG0A 4M9ZA 3VVFA 1FQAA 5FKLA 3Q3SA 4I3YA 2FBPA 3EHSA 4RAFA 3QQAA 2P0WA 3RGYA 1QBJA 3MZ1A 4YKIA 4W1UA 5I57B 1H44A 3N6TA 4MIMA 3SEZA 3WU2C 4CCOA 1N77A 3F8FA 1XB4A 2HXRA 1BIBA 4A69C 5FRNA 1SVMA 1Z1DA 4RGSA 5KDTB 2QWWA 3NAUA 5F0FA 3CMYA 4E0WA 1VDWA 2QS3A 1T0FA 2P7VB 1N3XA 5IZ3B 3KFMA 1YYVA 4EMSA 3OXNA 4ZDPA 4H5FA 4O8MA 4XR6A 2EJRA 5LRSA 1PVEA 2R7XA 4IHSA 1YX3A 3KE2A 2QS4A 1FT9A 2XPWA 1FZPB 2V3QA 4ZEKA 3OENA 4Y17A 1PJRA 3DBHB 1W36D 1OVBA 3VVEA 5LDZA 4OHNA 5B5EC 3M9AA 3O8HA 5J3LA 5IZZA 2DTRA 2OCEA 1DPUA 5L3EA 3MVZA 4KR5A 4V2FA 3GBBA 1ONVA 2DOFA 1SFKA 4C2UA 1ZJLA 1FCKA 1GVDA 1D9VA 5D5VB 2P8TA 5HNFA 1IDYA 2CWEA 2NS8A 4HTGA 3RQ4A 1B4ZA 2JVGA 2HZLA 4ESWA 4BU2A 2BBYA 3G4SI 4ESXA 3U92A 4BH9A 2P7CB 1VQ6I 3GX4X 2W82A 1HSLA 4JWYA 4E7KA 2OJTA 4GYIA 5DUIA 2YX4A 1SFUA 2ELKA 1I1GA 1OKRA 4HPQA 1A36A 2VOOA 3C2BA 1FSAA 1LBBA 5E79C 3BIHA 2DDAA 1FBGA 3DPTA 3RSNA 4GWXA 3AXFA 1H43A 5DEXB 4AM3A 1K6YA 4P11A 2ZXTA 2R9JA 3PO2J 1NFTA 3CJTB 1CF7A 2V25A 5FKMA 2PYYA 3F21A 3PPPA 1IRFA 4N0BA 2M2EA 3ODBA 2NS0A 2Z5UA 2QYOA 1IQ7A 3EDPA 9ANTA 3PPRA 2MKZA 4FBPA 5AA2A 4MEYF 1X2MA 2P5VA 3KC1A 3ABMH 3SFZA 2UXNA 4C1TA 2OWTA 3EUHC 4WEDA 2E1MC 4FCYA 3AKZA 2CV2A 1C0WA 4DLDA 5ET7A 3GYHX 3DEWA 2VASA 4G4PA 2HZTA 5AA3A 2HKOA 3CDLA 2QS2A 2QENA 5EEHA 1NHAA 5C44J 2CUFA 2YR2A 3AFHA 4EDPA 2HYJA 4MHGA 4NC6A 3BR0A 4R1HA 4Y3OA 2CFOA 2VIXA 1IEJA 1FW0A 1TW2A 2VKVA 2LBFB 4O7MA 2RGVA 4NF6A 1X2NA 3WHBA 3ZMUA 3A09A 3TTKA 4YRVA 3TDUC 1V55H 3IWFA 4IO6A 5B70A 2DWAA 1B4HA 3CJRB 3ZMVA 4EJVA 3VDFA 1FJ6A 1V3FA 4H8JA 2V6CA 3BY6A 4PSXA 5KK1A 1G3TA 2R92J 4HAMA 4BNCA 1YXIA 1ZLQA 2NOOA 3G3GA 4GO1A 4R8HA 3KETA 1JKRC 4F3PA 4X8RA 5CBRA 3HOUJ 2RDPA 4CCLA 4X1EA 3K10A 3J80K 5J1UA 3OYEA 3CCQI 2I3WA 3MP1A 3Q0WA 1JW1A 5FGMA 3HCQA 4MQVA 4OFJA 3KZIC 3T9VA 5IP9J 3RIRA 2A5WA 4ZTFA 2THIA 4GXSB 4XLEA 5K2XA 3KFWX 3PV0E 3P7NA 4FX0A 1FBHA 3ECRA 3P9KA 2XGCA 5F0CA 1W0TA 1EA3A 2IXSA 1QULA 3KX2A 1UCRA 2VODA 4OEUA 4OFLA 1R4MB 1Y20A 3HV1A 2ZJRF 3T9UA 1K78A 1NNKA 3RY3A 2MH9A 3IL2A 2DJNA 2AL4A 2WV0A 3QYFA 3FVGA 2KRFA 2VXZA 2QSGX 4A3FJ 1P1OA 5EHMA 2R8TA 3PUXE 1LEBA 2FD5A 2BOLA 1TXFA 4PQJA 2VPOA 3TGNA 4QFPA 3U2RA 1NUWA 2DDBA 4ZYHA 2EZIA 4AB5A 2R7QA 1QU3A 4GWSA 2XB5A 3IUOA 4PJMA 4WCGA 2O9LA 1IUDA 1B59A 3S9NC 2DCEA 2DOAA 4XTCQ 1FBPA 3QUFA 2F4IA 1ZTRA 4OOIA 3K6XA 3BPVA 4LG0B 5I56B 1CQTA 2BYVE 4GF8A 4RAZA 3E5XA 4RPNA 1SDXA 1UB9A 1G8XA 4O5VA 3A01B 1BTJA 2DO7A 1S7OA 4PDDA 1XD7A 4ZEIA 2R7VA 1AMFA 4MNIA 1W36C 4ELOA 4HW8A 4NTLA 1N04A 1K78B 4XFEA 3VLWA 4F1YA 1BJAA 2MLKA 2K9NA 3L2WA 1LFUP 4H67A 4LVQA 2O51A 2WEFA 4JWOA 4DYRA 2KQRA 3U65A 1Z6RA 5A5XB 4HZFA 2FVZA 1SD7A 5AONA 5CMBA 3T9XB 4GDFA 3DEEA 1D8KA 3CDHA 3M3LA 4L5JA 2DFHA 4KPTA 1B3EA 2LFBA 3K6WA 1VQMI 2JVHA 3HM5A 5KNLA 1MH4A 1DMBA 1MXZA 5I2NB 1MQHA 4X1BA 3W9WA 1F43A 5IT9Z 3E6DA 4PUSA 2E19A 5HLIA 4P8BA 3W2VA 1ZU0A 2BEOA 2XASA 1O4XA 3B8BA 5KCJB 1DPRA 1MXYA 1QUIA 2X85A 3B02A 1ODDA 3F23A 4HSRA 3Q0UA 3K7AJ 4RGUA 3MZBA 3VSLA 1WJAA 1FJLA 3PMWA 3OELA 5GAEJ 5D8LB 2RC9A 1FP1D 3TW6A 4KA4A 1ANFA 4WEPA 3RPUD 4RYAA 2Y69H 4PK4A 3CF2A 1FTAA 1BBYA 1Q9DA 1SBPA 3DKXA 4DZJA 3KN3A 1B7HA 2KZGA 2RAEA 2OBGA 1VNDA 2FHYA 1MSFC 2X26A 2DA5A 4KN4X 3M3FA 3KG2A 4ZE8A 1STZA 2Y0SN 3NQOA 2K4BA 2E2IJ 1Z9CA 4PE5B 4FHTA 3O28A 2NNNA 1ATGA 4HG2A 1ZBMA 2W25A 1Y3QA 1UMQA 1XPXA 2F5CA 5EGOA 5LRRA 1OR7A 5JHFA 2OK2A 1IC8A 4E4HA 2JPCA 4N8YA 3GTLJ 5LHHA 4EQBA 1ENHA 3ECHA 2ZYMA 2KZVA 1QW0A 1YW8A 4AIDA 3JRDA 1B8IA 5K5OA 2CMPA 1K61A 5I58B 1FQFA 2HQAA 2B65A 1LBYA 3SFIA 1YJ9I 4BGDA 5FKKA 2DS9A 1FBSA 2C6YA 1OPCA 2VJIA 4EJUA 3K2DA 2FBKA 5AIQA 2FEZA 3AL0C 2DI3A 4BE2A 2VQCA 3GTQJ 2XAUA 1NV1A 3AG3H 4OANA 4QPOA 3R6UA 4QBAA 2LVSA 2WAEA 3C35A 3EHUA 3REOA 4XRSA 4BHPA 4I7HA 3J81Z 2L9NA 3W9VA 4NF5B 5FD6A 4THIA 4GX6A 1PEBA 3KP6A 1DUXC 4KIGA 5TJJA 2GHAA 4PGPA 3IX1A 4HDUA 3Q27A 2QKMB 3K2ZA 1DDNA 2DODA 5HLTA 1VQ9I 2P2AA 3GO5A 2F5VA 4FQGA 1XSVA 3DKYA 2ADUA 2X6YA 4ZS9A 1QQIA 3G2BA 4ZZLA 4KMFA 4LIUA 2XV4S 4II2A 4HXVA 4R9FA 2R7WA 3J7YJ 4RAYA 4DI3D 3JRGA 1ZLKA 3FF5A 1RDXA 3KZYA 3C32A 4LN5A 1ZR4A 4IZZA 3HHHA 2JMWA 3Q5FA 2E1CA 2HOSA 2P4WA 3PUBA 5FFZA 4G12A 3S8PA 1KU2A 1AHDP 4GL0A 1YTVA 1I3AA 4CO8A 3OSFA 1NNFA 2ZZWA 3LUZA 4GRKA 4AQ4A 4DCXA 2HYGD 4KYWA 3ZQIA 1DGWY 2HI3A 1LE8A 5EYFA 2ZMBA 2IS2A 1PDAA 2W24A 3L00A 3GCMA 3WTVC 2F34A 3FM5A 1K4TA 3G3JA 4F1UA 1JT0A 1XX5A 2HWVA 3PM1A 4AU7A 3HOSA 2ZYKA 1B7UA 3JRHA 1DOTA 2QMXA 3LFKA 2CQKA 4L18B 3CFLA 1GGGA 1V5EA 3H9QA 5GADJ 2HEOA 2IA2A 1LBZA 1P99A 3HO7A 4ESJA 3LC8A 5HBCA 4AS4A 3FXJA 2YSRA 3FK6A 1R6RA 2HOAA 5B7DA 1EJ9A 4G68B 1KYWA 1FC3A 2KLOA 1FPGA 5H6QA 5IYDJ 3CCUI 2QSXA 3CC7I 2O61A 4GIZA 5EYHA 2REGA 5LD2C 4HE1A 4F3GA 4YFNF 2KHMA 4WXDA 2AYSA 3QAHA 4GWYA 3D5RC 1B9MA 3TUSA 2KDZA 3Q29A 3OYLA 4LUBA 3F9KA 1B3GA 2VKDA 3LMMA 4WK8F 2WBDA 5TPAB 2GIVA 3DP8A 1QZEA 3N6UA 1WJCA 1X1DA 2MD0A 2YX7A 3C7JA 2XXVA 1N25A 4ABZA 2GZWA 2IA4A 5BMZA 4BE0A 2I8DA 1AOYA 1R9QA 3SHFA 4N13A 4D5FA 3T0JA 3H1CA 5H8QA 3SEXA 4PBHA 3E3KA 1T2KA 3PNYA 1B6HA 2QBYB 3O6IA 3F0CA 1NV4A 1TC3C 5J4YA 2FXAA 3CMMA 3MZ8A 4U87A 2HOTA 4KFCA 1CNQA 4RY1A 4CUGA 2LMDA 4FATA 1DP3A 2XDVA 1Y0UA 2L4MA 2KRHA 2XXXA 2RKHA 1MGTA 2QFLA 2P6SA 3PSFA 4XBFA 3FUZA 3BPXA 2V26A 3OYFA 4OAYA 3HHFA 4JSOA 4N81A 4P9KA 3QODA 2L5VA 4NWCA 4UUSB 1QPIA 5DVIA 3K4KA 2E71A 2O84X 4EGYA 2XHKA 4MJOA 3FM3A 3ECOA 3PUWE 4BQOA 1M1EB 4ON0A 2QZ8A 5D6FA 1QKBA 3S9LC 4HV5A 2F36A 2PX9A 3U9GA 2XROA 3F11A 4DXBA 3OYJA 4M72A 4F3SA 1UFMA 1W1WE 4ETSA 2UVGA 1OVTA 1PBPA 3PD8A 3JREA 3OL4A 1DU6A 2A05A 2A5SA 2PFBA 3N05A 1RRJA 3OMBA 2OUMA 1Z21A 3B6AA 3AG1H 3DTEA 4FE7A 2Q9TA 2HZKA 2QA4I 2EH3A 2NVYJ 3Q28A 4BHBA 2ZJQF 1Y3NA 3TCHA 4MCOA 3A0BC 1YHQI 2DMQA 3I58A 2HEUA 1L5TA 1BI1A 4ENJA 4OIPF 3HUGA 1BKAA 2VKEA 2H25A 2VT5A 2ZNUA 3DLNA 4N6PA 4ZE9A 1SI1A 3E6BA 3FXMA 1NK3P 5I3SA 4PF6A 2MFZA 1O3RA 3TEPA 2PJRB 3IJXB 2LKSA 5HDNA 1VQKI 4F93B 3PO3J 1TNTA 5I7IA 3TKDA 2XXUA 3SQNA 5I59A 5L3BA 1SQYA 2DWJA 1B72B 2F6PA 3BR1A 1I3QJ 2E60A 2OWSA 3I59B 3L2QA 2VT2A 4W97A 2M5WA 3FWEA 3HIFA 3LSHA 5JHUA 3IWZA 4A5NA 1N76A 3OOUA 3DF8A 1ZQ3P 5M5YJ 1YI2I 1FYLA 3IFCA 3SEUA 2MA3A 3VLVA 3HSEA 3KYDB 2QUFA 2LLKA 3MZHA 5DUKA 2E1NA 2LD5A 5CQEA 2IGMA 3CSBA 2QGUA 3ZQFA 4ZH4F 3OV8A 2ISYA 4OVRA 2VGQA 3ROJA 3L6GA 3HOTA 1Z7NE 2RVCA 4BEHB 3OYCA 1IN4A 3R61A 1URDA 5AA2D 1KQ9A 2XVCA 1B5HA 3FBNB 3T66A 1IO2A 4DIGA 5EQAA 4YG2F 1X3WB 5ICGA 1B9JA 1XCBA 4XKCA 5JEIA 1B4AA 4PE3A 2DVZA 2CU7A 2M4KA 4E7LA 4F19A 2XIGA 1BN5A 2F5DA 2KIMA 4YEJA 4XF5A 4IO2A 2PMHA 3C1DA 3OYNA 1JP4A 4P1WA 3VSKA 1F1ZA 1WHUA 2HQ5A 1MXXA 2XXPA 2GBYA 1NV5A 3E9XA 5D4RA 1IN8A 1FTMA 5L3CA 2D21A 2JSCA 4BJ5C 3SZPA 2HQRA 4QFOA 4BDNA 2OF7A 2STWA 2LOOA 1UAAA 1NK2P 2ZBKA 2YU3A 2HFHA 3G3ZA 2EA4A 1VQ5I 4O3AA 4U2RA 3SKPA 1ZR2A 4D9JA 2XB0X 5J40A 4XRFA 1E2XA 5D5UB 5DYMA 1YPNA 1GDTA 4OENA 1H88C 2BV6A 2H5YA 2VOZA 1QPMA 2LY9A 5EG0B 2HQ0A 2XA5A 3IB2A 3CESA 4ASNA 3EN3A 5B1BH 4ESFA 5GPCA 3OO6A 2X1DA 3LSRA 2HU9A 2QMWA 2ZFUA 4XKQA 3BJOA 2COMA 3C36A 5L9OA 2DT6A 5E3NA 4GXAA 4JB7A 5HNHA 2O7IA 1B58A 3FXKA 3GXOA 1BLFA 2RV8A 2F3BA 1JKQC 4ZDMA 2ZXJA 3OYGA 1YCJA 5AA4A 1TFAA 4AVZA 4EV0A 3DU6A 1P6RA 2EZHA 2ZO4A 3FISA 4DCYA 5IP6A 4MFEA 1WGXA 2V3TA 2IVMA 3S3MA 4HW0A 5H8HB 3RZDJ 1Y8RB 1RDZA 1FMWA 3DU5A 1WH5A 5E3LA 4TV7A 4XSXF 1SFOJ 1P92A 1PB7A 1MY0A 3CHGA 2HAVA 2K9LA 2BVLA 2XGDA 2NVTJ 3HDDA 2AQFA 4H6DA 5F7VA 3HTSB 2CUJA 5JR3A 1LBCA 4PGNA 3UORA 1P4XA 3QOPA 1DTGA 2CW8A