1HSJA

Sarr mbp fusion structure
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
487
structure length
487
Chain Sequence
KIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALAAAQTNAAAEFMSKINDINDLVNATFQVKKFFRDTKKKFNLNYEEIYILNHILRSESNEISSKEIAKCSEFKPYYLTKALQKLKDLKLLSKKRSLQDERTVIVYVTDTQKANIQKLISELEEYIKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/sugar binding protein
molecule keywords FUSION PROTEIN CONSISTING OF STAPHYLOCOCCUS ACCESSORY REGULA
publication title Crystal structure of the SarR protein from Staphylococcus aureus.
pubmed doi rcsb
source organism Escherichia coli
total genus 143
structure length 487
sequence length 487
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
A PF12802 MarR_2 MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1hsjA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1hsjA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1hsjA01
1H43A 1KWHA 2MLKA 4WK8F 1XHYA 1ZLQA 1T98A 4WEDA 2DPUA 3TKYA 3LA7A 3C9HA 1BIAA 4P0IA 4YB6A 5E8GA 1IRFA 1IUDA 1B5IA 3FM3A 2OU2A 4HX7A 3TQWA 3I71A 4E0XA 1QZYA 3PQJA 5F1RA 4L9TA 1UQWA 3LR1A 3ROUA 1NMUA 1S8NA 3BFTA 3V7SA 4EGZA 1YQAA 4IRHA 3RYPA 1BP5A 3JAMZ 5IT3A 2MA3A 1O3RA 3KOTA 3E4RA 3PD8A 2F5FA 1YTYA 3I6VA 2VHAA 4OIRF 1OLAA 5I2NB 2PMHA 1MQJA 2QMXA 1CB6A 2DFIA 4EF2A 2KIMA 3GX4X 2GFEA 3WG9A 5AA2D 1B4HA 3KEQA 3N4MA 3O66A 2VODA 1URDA 1Y3QA 1RUNA 1B1HA 1YW8A 5ITOA 1Y9UA 1WWXA 1U2WA 3KG2A 1L0OC 2R3SA 4HAMA 2EWNA 4G2ZA 1SYHA 3ERED 2O69A 1URGA 2O1LA 2TDXA 3EF7A 4YB5A 3GW2A 3RT6B 2Y7IA 4R9FA 1I6QA 2KKOA 4Y15A 4GXOA 2VC0A 3G7WA 4OU0A 1PP7U 2OWTA 4BXUA 4HQMA 5ILUA 1B9NA 3H06B 3ILTB 1N7WA 1MY2A 1FP1D 3WGGA 2GHAA 4MTEA 1JVYA 5L8DA 4HV6A 1MXYA 4HDUA 1YLFA 3WTZA 4E0WA 3OOAA 3S2WA 4H0WA 1YYVA 2IA0A 3HSTA 5KDTB 5H8HA 3LSXA 1Q35A 3JTGA 4S04A 1FYKA 2EA4A 3WTTC 4LMYA 4JSDA 3PPQA 5CBSA 2I6EA 1Y0UA 4DNCA 1TFAA 5I2KA 2Y48A 2VE9A 3HO7A 1EH8A 3CFXA 2QQ9A 4I1DA 2NNNA 4DIGA 4L5IA 1AL3A 1D8KA 4Q8RA 1XVXA 2P7VB 3VVDA 2ZFWA 1ZU0A 1FYLA 4MEXF 1HQCA 1FZPB 3QUJA 4Q5SF 4Q30B 4LB6B 4U2RA 4M6YA 4OOIA 5JR3A 4CICA 3FUZA 3ISPA 2O51A 4U0YA 4UACA 1SW2A 4ELPA 2VXZA 1LAGE 3VXBA 1HW2A 1H9GA 1VE4A 5FTHA 3VOEA 2PYYA 2KLFA 5LGTA 1G6NA 3RPQA 2OBGA 1UHMA 3O6BB 1MQGA 4LATA 3BY6A 1MXXA 2EV0A 4OESA 1A8EA 3VFJA 4M6XA 4GVOA 2Z22A 2M8EA 4JBAA 3PUVE 4LFUA 1QUJA 4G68B 2QVOA 4R74A 1YTVA 4WXCA 1QKAA 4DCYA 4HF2A 2VN2A 2A61A 3ZMSA 3ZMVA 1U5TC 1MXZA 2MH9A 2M5WA 3F8MA 5HLIA 4HA8A 4DDDA 2DXYA 3PMWA 1XN7A 2RKHA 2OZUA 4EQ7A 3JYRA 2EFPA 4PGHA 4DLDA 3VLVA 5LHGA 5ITPA 4NWDA 3MZYA 2P6TA 1FY7A 1HKQA 3WU0A 2RC9A 3A3UA 4JWOA 3BPVA 4OHNA 3VDFA 3FWEA 3MP1A 2DT5A 4HBLA 4IO5A 3EHUA 2OD5A 4R75A 2ZCWA 3EQLF 1IN8A 2RN7A 3OSQA 4HX4A 4UV8A 4YMBA 5FHMA 2DYXA 3BPXA 3Q5FA 1MJBA 3GBAA 2Y84A 3HRTA 3VEPA 3K9TA 2EFOA 2HTJA 1ZREA 3K6UA 2E7WA 2VP1A 5HDKA 4C0RA 1FQEA 2DQRA 3K1MA 3ZN0A 5IAIA 2QLZA 3W9WA 1QZZA 4XBFA 1MQDA 3M8EA 1UTBB 3G3FA 4OXVA 3O3KA 2FYIA 1UIVA 4KN4X 5DVJA 1POY1 4GOTA 3T9HB 2FBHA 3I59A 2EV6A 3V7RA 1BJAA 5LGNA 5K2YA 1IN4A 3U1DA 1BLFA 2L4AA 3FJMA 3SEXA 2I48A 1ZMGA 1ZBMA 1LNWA 2QENA 3LSLA 1IXCA 3TCHA 5E1ZB 3TPAA 2RCBA 4N6PA 3HRSA 2O61A 1SDXA 2Z8DA 4FATA 2CMOA 4QFLA 2V84A 4L9JA 5BMZA 1SQYA 3UIFA 1DP7P 1ZRCA 3GZ5A 3QPTA 1DPEA 3LFKA 3E5QA 3HHGA 1TFDA 4L17A 5ICFA 1SI1A 1A40A 4KUMA 1KU7A 4IO6A 4FEBA 1ONVA 5EYFA 1RZ4A 1B52A 1EH7A 5DEXB 4GYGA 5H20A 1RYOA 1U8RA 3GZ6A 3MFKA 3MZBA 1YS6A 3MBPA 1DPPA 4DQ2A 3JV9A 1P4WA 1H3DA 4AWXB 2HDCA 2A3SA 2A5SA 1W5SA 2PFBA 4EM0B 1ZG3A 2HR3A 3BJAA 3KGCA 3O97A 4XSXF 3OSRA 2EJRA 1P1NA 1USYH 5BOXA 1R7JA 2HEOA 2WKYA 2ZYKA 1UB9A 1ZTYA 3EQ1A 3QAXA 1NH7A 3ODBA 3S9LC 3TDZC 1IW7F 3Q27A 4X9TA 3LQQA 3I54A 1RKMA 1LQ1A 1O7TA 4P0GA 2K27A 4OIQF 1V3FA 3GLBA 1EV7A 3Q28A 3SETA 1ZKBA 5J1DA 2Q8KA 4PETA 1LEBA 5D5UB 2X4HA 3TTNA 5B70A 4RPOA 3KN8A 1D3YA 4A12A 3PV0E 1TQPA 3F23A 5JI6A 4QHQA 4OINF 4ZZAA 2F34A 4ESFA 4M71A 1GV8A 5ERIA 2BYVE 4IPAA 4KD5A 4G7ZF 2FBIA 4KMUX 4ZZDA 4ZYDA 2V3QA 2PVUA 4F29A 4O3CA 5FLXZ 1ZARA 3FGSA 2QBYA 2HZKA 1A04A 1BTJA 3SHFA 2K86A 2CZLA 3THIA 2VBWA 2J5PA 3PMXA 1TTYA 1C0WA 2E1CA 4BDMA 1W7PB 4C1TA 1H45A 4UXNA 3U94A 2RGVA 2HQRA 4EJWA 1TQMA 4YZZA 2XXRA 3TQLA 1LB2A 3R7XA 4QRZA 4I7HA 3FD3A 1S7AA 3HRUA 5L3CA 2P5VA 2F78A 4GFRA 1OVTA 2COMA 4F39A 2XAHA 2F2EA 5HS7A 4POXA 5CVIA 4EXLA 3TAJA 2K7LA 1CGPA 1GVJA 4LK0F 5L3DA 5HDGA 2ANJA 3TQNA 3T22A 3ZP5A 1KU2A 1XDSA 3BDDA 2P5KA 2LSOA 4EQ9A 5EEHA 5DUKA 5E1WA 5TRDA 1XSDA 1FP2A 3QAHA 1JQFA 3IOTA 4FIMA 2DBBA 3A3CA 3VVFA 1I1SA 5DD8A 1B51A 4P5OA 2XXPA 1FC3A 1H9TA 4L0YB 4JDFA 3HCQA 1IZ1A 3UN6A 2JPBA 2RF1A 4XKNA 1BI3A 3RN8A 1FCKA 3E6MA 4LQ5A 2P5LC 2YSRA 4MQ9F 4H0EA 3C35A 2ONKE 4U0WA 4B09A 3ZKLA 1XSVA 4JWXA 4ZECA 2FNAA 4EQQA 1T38A 4NF8B 3R6UA 2DW4A 1AH5A 2Y7RA 4QF9A 5FLXK 3REOA 4POWA 5B7DA 3SDFA 4OVJA 3M8FA 3WTWC 3U9GA 5BS6A 4XTCQ 1MDQA 3U2RA 3FXQA 4QSEA 5CMBA 3R0JA 2PBIA 2XROA 3DP4A 4HW8A 2QUFA 4I2OA 5F7VA 1K78A 2L54A 1AIVA 3M3LA 1D4NA 4G6QA 4JWYA 3FATA 3G3KA 3J80K 3L2CA 1M5BA 2UXNA 2QS4A 2W84A 2HFHA 3TGNA 2JT1A 1YFHA 3FMRA 2X26A 4KCCA 4RS8A 1IUYA 2HFBA 3E5XA 1P92A 2ISZA 3TTMA 2FMYA 1LAFE 2NAZA 5E8IA 1VFDA 1TNSA 2WV0A 4NQWA 3VLUA 3IR1A 1FYMA 5ICGA 2OA4A 5FHNA 4WXDA 1B32A 3MQ9A 2D5WA 4MQVA 3C33A 3TYHA 2Q8JA 4F1VA 3T93B 2HTSA 2KRFA 5AA4A 3CTAA 4EJVA 3WTYC 1MH3A 2XVCA 3JW4A 4RAYA 3CUQB 3EYIA 4O5VA 4BAYA 2VC1A 3LQRA 5KK1A 5DTBA 4G94A 3ZMTA 2JRTA 5CC2A 2VBZA 4HTGA 3OV8A 1OMIA 1DPUA 3ZMUA 4ENNA 1W4MA 3L7WA 4BDNA 2DQVA 1F1ZA 3V8XB 5KVRA 5H8HB 1LDKB 1R9LA 3HSEA 4TV7A 4P9FA 4H65A 3FMSA 1SFEA 4HV5A 3JTHA 4IO3A 4X1BA 4UVAA 4MLQA 1O7FA 4PP0A 4XLNF 2MD5A 3K69A 1Y4CA 2VONA 5I2KB 4P11A 3T9VA 5IT9Z 4RK9A 1HKTA 1FQFA 3J81K 5BWJA 2Y75A 2ZNSA 3SEWA 2BEOA 3OOPA 4EVIA 1GHCA 4KDPA 5I58A 1URSA 1IRGA 2PT1A 5D4RA 2IPQX 2P8TA 1CF7B 1B7ZA 1R6ZA 1P1UA 1ZRDA 4KYSA 1MY1A 2LNBA 4R79A 1FQBA 4JK1X 4P9UA 2OLBA 2JZYA 4LP2B 1R58A 2M30A 4EXKA 2Z8FA 3T0YA 1PBPA 1B05A 4KIFA 2FQ3A 5F1QA 1XSXA 3KN7A 5DVFA 3LSWA 3QRFF 1N7XA 5DT6A 4BDLA 3U8QA 2XD3A 2G7UA 4LLLA 4M9ZA 2XXWA 5I84A 3M8UA 3ZS6A 3M9AA 3AAFA 3C18A 5A2QK 3U93A 4KI0E 1DDNA 4R6HA 2XXHA 5H6RA 4FJPA 1STZA 3CG3A 1LDJA 2LAOA 3RPUA 4L9NA 2FA7A 4FECA 4FE8A 5F64A 3FHZA 3UGWA 2XKPA 1XGSA 3F22A 4GQOA 1H44A 2D3IA 4ZYGA 2HYFA 1XOCA 3IO6A 4LQ2A 5CI5A 5LRRA 5BPIA 2O7UA 1PUEE 2WWYA 2IP2A 2DP8A 4FEDA 4RB3C 3JZJA 2RVCA 3P9KA 4B8XA 4OMBA 2REJA 4EJTA 3IKVA 2H6CA 5KCJA 2MLGA 4GIZA 5IT9K 3P7NA 3KSJA 1I6BA 1I27A 2PG4A 4HF0A 2OCUA 4R2FA 4OFOA 2G9WA 5TJJA 2BGCA 1JHFA 2PI0A 4UVCA 1HW1A 5L9SA 4UUVA 1HW5A 1B4ZA 1GTKA 3KZGA 4MLVA 2ZYOA 3EYYA 5H8QA 5JFRA 3RJPA 2HCAA 2UVJA 3IAZA 2F97A 1FX7A 1I5ZA 1N76A 3F21A 1O3TA 3I5UA 1SMTA 1BIYA 5CBRA 4WXHA 1UCRA 1QULA 1OYYA 1SVXB 1TXFA 1MPBA 3DF8A 3FM5A 3D0SA 4NF5A 2XAFA 2ACJA 2QQBA 3PQKA 3IL2A 3ABUA 3WODF 3MZHA 2I4BA 3W6KB 4LZ7A 3K2DA 4ISUA 4IO7A 3T8RA 5JTYA 3ZMDA 1IXSB 5K5QA 2I0CA 1RIOH 3VFZA 1AOVA 1A99A 5K2XA 5ICCA 4I01A 5DEQA 3DELB 1K6OA 5A5XB 4F3SA 2P2AA 5H8FB 1B9JA 5CLSA 2X7QA 3HSFA 1IXGA 4H5FA 3ELKA 4QSDA 4AB5A 1SW5A 5HLGA 4R6KA 3ML6A 4YG2F 2MH2A 1J2XA 2RNJA 4U88A 4GXSB 1Y20A 4GYIA 2B0LA 2WTEA 3DP7A 5HVQC 3GVAA 3QYTA 1Y1ZA 2V1UA 4QFKA 4AD9A 3DFGA 2PQ8A 1XGMA 1B3EA 3ZQ7A 2IEEA 4H6DA 2HXWA 4I02A 4YMAA 4F19A 3HPIA 5LEJA 2HQ0A 1Q1HA 1F9BA 1YAEA 3RYRA 2XHDA 4O3MA 4ZEDA 5ICQA 3T9XB 4FORA 4L9VA 1FPQA 5D5VB 3K1NA 3VODA 3OO6A 4WXJA 3KZZA 2DOJA 1FTLA 1BI1A 5I57A 3DPLC 3F6VA 3TEPA 3KEOA 5DCMA 5HM4B 2DU9A 3SERA 2ONSA 3O6IA 4ENKA 3FXRA 3FVGA 5L9MA 2XXXA 3N94A 1BM9A 5DDGA 4LLNA 2PBWA 2RINA 3B7DA 3MVZA 1YG2A 2GHBA 4TQUQ 3OO8A 4IO2A 2ZMEA 3WE2A 5J6XA 4F22A 4QFOA 3V5AA 4Z2YA 1MDP1 1QUIA 2H99A 1LGBC 1MQHA 2DXRA 3O9PA 2V3TA 4AIJA 1XMKA 3GF2A 3PMVA 1JXSA 2FE3A 2IJLA 3ABTA 3K01A 5AA2B 3S2VA 4HCYA 3L9FA 5JVTA 5HS9A 1QBJA 1FSEA 1SAXA 3K1PA 5L3GA 3O28A 3SEYA 3B6WA 1XGNA 1I69A 3L6HA 1KU9A 3HIFA 1FWZA 1PB7A 1P99A 2HZTA 1WVJA 2R71A 3MP6A 3SXYA 5D4SA 3BFUA 4CO8A 4TOZA 4O3BA 4FHTA 2DK8A 4G8XA 3SZPA 1FTJA 1JVXA 1O64A 3IK6B 2A69F 1NNFA 1JW5A 2YX4A 1JW1A 1ULYA 3IRQA 1XD7A 1P1WA 4GXAA 4F3BA 1MM7A 3WE3A 3ZN1A 4ZEBA 1B5JA 2GQQA 2F7BA 4GL0A 2FNCA 2H4IA 4CHUA 2PN6A 1RNLA 4DXBA 3MWBA 4NF4A 4PFWA 3I3VA 2XASA 1I1GA 2QMWA 3MW0A 2JSCA 1JETA 2UXAA 3C4MA 3ECHA 2QZ8A 2FSWA 4KNYA 4IGRA 4HOBA 4ZYEA 4OIOF 5H8NB 4ZYHA 1JGSA 3TO7A 3FVNA 4RK2A 4H1XA 4H8JA 4BH9A 1G3WA 2YU3A 3I4PA 5J8CA 3C34A 1HXDA 1DPRA 2PMUA 2F7CA 3H92A 2ZYNA 2P1SA 3GWZA 1TWYA 1R9QA 2O1MA 3CI8A 5LLQA 3KFWX 4CDGA 2A07F 2QRYA 1ZGAA 2XAGA 2HOEA 1L5TA 5IKBA 2M45A 3K6WA 3LA3A 3ZPLA 1KA8A 2REGA 4ENMA 2AL4A 3CIJA 3ILUB 3SESA 3OELA 1FBQA 3GLXA 4H67A 2A6EF 2LKPA 1LBCA 2VOZA 4CGZA 1XVYA 2EFNA 4OTEA 2V25A 2JPCA 2VOPA 2R7FA 3Q29A 3R61A 2I58A 2XAQA 1QUKA 2Z8EA 1HSJA 5TP9B 4G8NA 4NB5A 3TDUC 3N6UA 3MC2A 3TTLA 3TTKA 4EJUA 1VSOA 4HF1A 2PX1A 1Z1DA 1B3FA 3E5UA 5TPAB 1GVCA 4YFKF 3FV2A 1MG1A 2FXAA 4KYWA 3E97A 4AIKA 1KYWA 3I5OA 3TCGA 2ZKZA 2XXYA 1SI0A 1OMPA 3GBBA 3D5LA 5L3FA 1WDNA 1RUOA 2QJEA 3U92A 5I2NA 1QVSA 2FF4A 1N0TA 2Q88A 2A68F 1LFIA 3K00A 2GZWA 2B3BA 4ECFA 1BBYA 2P6SA 3IL1B 5ISUA 1BI0A 3OO9A 1EH6A 5AA4B 4G4PA 3LSTA 4AIHA 4U7DA 2F7AA 4RPNA 1S9TA 1OLCA 4OEUA 3GFJA 1ZJLA 1ZLJA 1R1NA 2HKXA 4MGRA 1J0RA 2ABHA 4F2OA 5L9OA 1K7AA 2Q89A 3QSLA 2GA1A 3FXUA 2A5TA 3W15C 3I53A 3PPRA 1LDDA 4THIA 1LFGA 4OFLA 2HAVA 1G3YA 1B5HA 3KCCA 3PUXE 1USSA 1F4KA 2ZNZA 4OWDA 4RXLA 2E7XA 4YIFA 5LHIA 4WCGA 3VB2A 3IWFA 1UIUA 5D6EA 3IOVA 3IX1A 2H09A 4PGGA 2NOOA 2GA2A 5CM6A 1MH4A 4CYDA 5LOMA 2E0SA 3OENA 3IB0A 3E9XA 3KP6A 4RB1A 3PU5A 4YKPA 2GWRA 1LVAA 5AA1A 1MDMA 2R6GE 1BI2A 5HPQA 3RQTA 2IA2A 5I58B 1BC8C 4IY6A 4EDPA 2OQRA 3FVKA 2QM3A 3K6XA 2L3DA 4WX9A 1MGTA 5HDNA 4GO1A 3C1DA 4ZH4F 2GH9A 2Z33A 5I56B 1NHAA 4RAZA 2LF7A 1I6AA 2K4JA 5CMCA 5HBCA 1QW0A 4PCQA 2KJCA 4I09A 3E6CC 4WKMA 1SYIA 2LF8A 2G93A 6PAXA 5AA3A 5KZTA 5DCFA 3NQOA 1LLSA 2YR2A 2F35A 3IOWA 3KEIA 1I6XA 1R1TA 1B1XA 5ED4A 3CVGA 2K4BA 4GL8A 1M5EA 2FEZA 4I9DA 3IWZA 3J80Z 4ZE8A 4G68A 3LC8A 3WAFA 1LCTA 2GXGA 4K2EA 2Y7KA 3HYIA 1TBXA 4G9YA 1R23A 4LD5A 1PB9A 4AQ4A 3RY3A 1T0KA 4LVQA 4U1ZA 4PFYA 5CVJA 2MC3A 1B3HA 2H6BA 1FBUA 4R1HA 3VE1B 4LZ8A 1S50A 4MNUA 1ZRFA 1QJMA 2P7CB 1UTHA 4N07A 1BC7C 4NF6A 4DE8A 5ILVA 1QGPA 3FX3A 1JW4A 1LB8A 1SW4A 5CJ9A 2NNYA 3IORA 3N6TA 1R36A 4GRKA 2AS5F 4GCVA 4M4GA 2MBFA 1ON2A 1XDUA 4AVPA 3TODA 5FFZA 1D9VA 1U5TB 1G4DA 2F36A 1QKBA 4BDRA 5CVUA 3VXCA 2KJBA 1MXWA 1A7LA 5TU0A 1Y3PA 4U23A 3ZKKA 1DSNA 2XX8A 1A55A 2EK5A 2OQGA 2STWA 4UV9A 1ELJA 3V7CA 5H8QB 4RA1A 1VR5A 1TT1A 2F5CA 4R8HA 3IHUA 3BWGA 2M1BA 3EDPA 3CG1A 3RIRA 5ILSA 3GXAA 1SD6A 1O57A 2KIFA 2ONRA 3FJ7A 3RTRA 4NF5B 4ZS9A 1WI9A 4HW0A 4FT8A 3SZTA 2RC8A 3V8JA 2CGPA 1Z7NE 1FQAA 3PD9A 2VOOA 1T2KA 1ZH5A 2THIA 3P9IA 4YFNF 3HTUA 1G3TA 5E20A 3CJNA 3W6JB 3BKIB 3MP8A 3RLFE 1MY0A 3N26A 1U6GA 1BN5A 3PUWE 4HDVA 4EMSA 3I64A 1IN5A 1Q1KA 2DVZA 3O6HA 3W9VA 1UTBA 3J81Z 1DMBA 1SD4A 1B59A 4GWOA 1IXHA 1JHHA 2DWAA 4XRFA 3K4UA 3GXOA 3OMBA 4EUOA 2GRVA 3OO7A 2Y7PA 3U72A 2QS3A 1B6HA 1P6RA 2RKMA 1NNPA 1U78A 3GFIA 3HOTA 3RDIA 1BIBA 5H6QA 4YU0A 1U3EM 1YPNA 1KYZA 1NNKA 2RV8A 3FVOA 3H4ZA 3SEVA 4F3GA 1KQ0A 3B6TA 5D5WB 1HBXG 4BDOA 2HEUA 4I0BA 3O2PE 5LHHA 2GAUA 3IB1A 4ZDMA 2XXTA 3TUSA 4CXFA 5A2QZ 1S7YA 3PFIA 3DV8A 2F8DA 4YAHX 2H98A 4N9HA 2NVUB 4WF2A 4KQPA 3OEMA 1S7OA 3GZGA 4KICA 2C6YA 2W25A 5DEXA 3Q9VA 3UP9A 4JBZA 2ETHA 2YLNA 4PFUA 3BJOA 4Y13A 3C36A 1H0MA 1B3GA 1SW1A 2O03A 5HS8A 5I59A 1MXUA 5L3BA 2A6HF 4LGWA 3E6BA 3F8NA 2E1NA 3F8FA 3O2AA 2STTA 4MH5A 2B3FA 3DM0A 3EHTA 1R1VA 2D1VA 1PP8F 3ECRA 2PJPA 3G3JA 3LUYA 4U21A 2DE3A 4GD5A 4LA9A 3BOQA 1P4AA 3TCFA 3F3XA 3KSXA 1WRJA 2F6PA 5D5XB 4OEVA 3R26A 1DOTA 1MPDA 1OKRA 2WC2A 2Z9OA 3NEUA 4IF4A 1E2XA 1ZG1A 3K6VA 4G68C 3V8LA 2ZNUA 3RUMA 3CUOA 2XHKA 1HSTA 2E1SA 2CQKA 4KA4A 3HTSB 1L3LA 4FX4A 2D45A 5HOOA 4RGRA 4I0AA 1B0LA 2ZYMA 4U7BA 4BNCA 1XT8A 4A0YA 4JXIA 2XIGA 4MBPA 4UA8A 3JSOA 1B6AA 3WGHA 1OYIA 2YJPA 3MEXA 4U1OA 5CVRA 3L00A 4Q4ZF 2V3UA 3F6OA 3MPLA 1S3JA 4U4SA 1SBPA 4ELOA 4RJZA 1IN6A 1B4AA 3O29A 4MF3A 4A5NA 5ICTA 2H9BA 2VT2A 3R60A 4F3PA 3VLWA 4EM1A 3P7IA 4HQEA 3FJGA 4I8CA 4NF4B 5FD6A 2R7DA 2O0YA 2F5DA 1V4RA 5CMMA 2QQAA 4N0BA 2XGXA 2O68A 4DXCA 1MD0A 1EH3A 4EJOA 5AIPA 2EA2A 2EFWA 2UVGA 2BBYA 1VTNC 2YPRA 3AXFA 3F72A 3TTRA 4K3FA 5E18F 1ATGA 2FA5A 3FF5A 3QPHA 5AIQA 1DUXC 4L0ZB 1LJ9A 3MZ1A 1B46A 3LBSA 1LFHA 3PPOA 3MVWA 2O3FA 4IJAA 3GFLA 5BPDA 1F5TA 4ESXA 1REPC 4YKKA 2P4WA 2W85A 3Q9SA 3RPWA 1R5GA 2XXVA 3UK4A 3MQ0A 4NTLA 4NF8A 3BJ6A 4M74A 1IEJA 3BROA 4MFIA 2DQLA 3I59B 4ETSA 1YW7A 4KT5C 1O3SA 1Z7ME 1O7LA 4XLPF 4IVNA 3TOBA 4IGTA 2JTVA 3TKDA 4F1UA 1ZAOA 3WU1B 1JNFA 1Z9CA 1GXPA 2UWMA 3B6QA 3TO6A 3B02A 4ZZLA 4L18B 1B7UA 1GXQA 3WTXC 3H6WA 3HRMA 1US5A 3GEZA 1MY4A 3QU6A 2HGCA 2HWVA 3K0LA 1SMYF 3N5LA 4QFNA 1IAWA 4RY1A 4M72A 2ALUA 3F8CA 4KN7X 2V9VA 3H3ZA 1D9YA 4FX0A 2XX9A 1TW2A 1Z6TA 2ZNYA 2UZKA 4E70A 5ICEA 3C31A 5EHMA 2EB7A 3K0VA 5CYVA 2FOKA 5LGUA 3G73A 2Y7WA 1P4XA 2NXOA 2Z99A 3IB2A 3S4UA 2DI3A 2J5OA 4KFCA 4F7ZA 2Q9TA 4KYEA 2ZBKA 2A5TB 1EZ9A 4IRIA 3BZ6A 3M1EA 3EUHA 4R9GA 2DK5A 2O84X 2HS5A 4KMFA 4GF8A 3CUQA 4NE4A 4WEPA 4ZEKA 4PZJA 3EETA 4RGSA 3H6TA 2L4MA 4OMYA 3KZYA 3QP6A 2FBKA 4R6YA 1FTMA 4C1UA 1IXRC 3GYHX 1Z6RA 1P2FA 3MVYA 4LG0A 4XXUA 2I3WA 1B9MA 2O8XA 2Z23A 2UVHA 2DTRA 4BDQA 3ZMZA 3FASA 1XB4A 1Y3NA 1BKAA 2I3VA 1MDMB 4G7OF 2QPQA 3TELA 3OXNA 3KJ7A 3P9CA 3F8BA 3JAMK 4LB5A 3PGFA 3COAC 1POTA 4G7HF 1R00A 3CSGA 3WTSC 1S6LA 2W7YA 2QBYB 1MJ9A 3A09A 4KHZE 1SFXA 4NMYA 4O3AA 4KPTA 1LAHE 3RKXA 1B58A 5DUIA 1B40A 4QSCA 3FV1A 2K02A 1CF7A 1NKXA 1DTGA 1J9IA 4JB7A 4EQBA 3MAJA 3GO5A 2VD2A 2V1DA 3IJXB 3G3ZA 1USYE 3G3HA 4HYEA 3CFLA 3M7GA 2ZNTA 3D4GA 3J7AO 4ASNA 2RC7A 4EGYA 2XAJA 3KN3A 3LWFA 2LDUA 5AONA 1II5A 4ESJA 2DE4A 4M9SA 3QXMA 4UVBA 3DP8A 1QQIA 2I4CA 1R5HA 3UA8A 3USDA 4R2BA 5DVIA 1OYWA 4BHBA 2L02A 2ZO4A 5EEGA 1YS7A 1FQCA 1O63A 1KQ9A 1UTHB 2IA1A 1D8JA 4NF6B 4HS7A 1D3KA 3KP4A 1M5FA 2DE2A 5LBQA 1ZLKA 2FNPA 4OYVA 3CFZA 3MCZA 1Z91A 1MZBA 5FD5A 2W57A 1KU3A 2QL3A 4Z0IA 4ZE9A 1OPCA 1GR2A 3M3FA 2XXIA 3CO7C 4Y17A 1EU8A 2AIXA 3L6GA 5CRYA 1AMFA 1NL5A 3SQNA 3MUQA 3MJNA 1YIOA 1PC3A 1P1OA 2XX7A 3DPTA 3DQVC 4IY5A 1T0FA 3SKPA 2CWEA 3HHFA 1K78B 1E17A 4G77A 4OZ9A 2NWJA 1B7HA 4LONB 4P96A 3DP6A 4JQFA 1F9NA 3K02A 2DAOA 4IXAA 2RC4A 1FNNA 1O3QA 3H03A 4LK1F 5FTIA 4EM2A 1N3XA 4LUBA 2RDPA 2UYEA 4X1DA 3ZSFA 4HZFA 3EHSA 3KP3A 3H7MA 3GFMA 3V83A 1MM6A 2ZXJA 3I58A 4DCXA 1FW0A 2ZJ2A 4PDKA 2O6GE 2D1HA 3CUQC 2Q2EA 2FMLA 1B0HA 4PFTA 1XCBA 4OQOA 5DV5A 2H94A 1VFEA 3QK6A 3OEKA 4AB6A 5A5XA 2I49A 5H8FA 3U1OA 4MTDA 2IRFG 2QS1A 1EZPA 4XKRA 4OIPF 2CW0F 2RCAA 3E3VA 4ND9A 1IIWA 1LSTA 3QOPA 2OK2A 1MY3A 3NRVA 1B1BA 1LAXA 2DVCA 4ZZEA 5BQTA 3IJOB 1MXVA 4KR5A 3HOSA 2H27A 2DO7A 1IF1A 1PB8A 1Z05A 4G8MA 1W7PD 3RKWA 2UYFA 2L01A 2YX7A 3WTVC 3KJTA 3KFMA 1NFTA 4P55A 5K1YA 3HN0A 2PMSA 4GGGA 1SD7A 3QP5A 4MHGA 1RI7A 2R9JA 5I59B 3M3KA 2AYSA 1Z7UA 2Z3YA 5K5RA 5F6FA 3CDHA 1CE2A 5KDTA 3TZAA 3DEUA 1NH8A 3MVXA 1MQIA 1N3WA 4A6EA 2PT2A 1MJAA 3FZVA 4LJZF 2HQNA 1QPMA 4OMZA 3D4CA 4PE5B 1B3LA 2H5YA 2IA4A 2NRAC 2G29A 1KGSA 2GXBA 4LZ5A 4YIIA 1K79A 2M87A 1OQHA 3T66A 1XS5A 3FIRA 3T5XA 2UVIA 3UORA 4M9XA 4A6DA 1IXIA 4EV0A 1D5VA 4L5JA 2F5XA 4RNSA 5LEKA 3G3IA 2EFQA 3B73A 3E6DA 1T39A 2IT0A 2NS0A 4YICA 1MKMA 2DSFA 3RT8A 1US4A 3H3GA 4YB7A 2NYXA 2X7PA 4DXUA 2VGQA 4F31B 4G6DA 5AA2A 4UNOA 2D21A 4Q5TA 1T6SA 2Q2CA 3L09A 5CVVA 2V1XA 5EHSA 1P1QA 3LAPA 2OAZA 1SD5A 1IITA 4HLXA 1WODA 2ISYA 1FQDA 4Q47A 3BP8A 3MPKA 3CRBA 4H5GA 2OBPA 2P0SA 4YFXF 3RGYA 3T96B 2ZXTA 4RB0A 3N97A 3H6UA 4HCWA 1RYXA 2CO5A 1HKSA 2O7IA 3KP7A 5JK4A 5D8LB 4R72A 1QNTA 3QUFA 2D2WA 4O6JA 3RTWB 4ZEIA 5KCJB 4U22A 1OVBA 3VVEA 1IQ7A 3S9EA 4F2QA 3SFZA 5JEIA 1USTA 4ZEFA 4PQJA 2A5YB 1FLIA 5ELVA 1W5TA 1FTKA 3HUGA 3DXJF 1PDAA 1LEAA 2VBXA 3T8TA 2OWSA 1TW3A 5FGMA 4NEDA 4ESWA 1B2HA 1XCVA 2V79A 1MPCA 1Y4TA 1G3SA 1YO5C 3Q26A 2QYOA 4H8IA 3IKTA 5H8NA 2CFXA 4FAJA 1ZN2A 3H3UA 2DPDA 3R0AA 3RTFB 2DWJA 2OZZA 3EN3A 5FO5A 4OERA 2VBYA 3WTUC 2QSXA 3RI4A 2O6AA 3CO6C 3R6SA 1FSHA 5K5OA 1ZHFA 1FOKA 4QWQA 2X0LA 5DYMA 2QWWA 4ELQA 2CSOA 3TOAA 1IN7A 4X48A 3CSBA 1X3UA 3IC7A 2IW5A 2XV4S 1ZG5A 2HKOA 2EV5A 2XRNA 3TMGA 2ADUA 3PPNA 4I98B 3LA2A 4U0VA 5JTYB 4TLMB 3LSFB 2F6GA 5FFXA 3H6VA 1YCJA 1XGOA 2OZ6A 3KP5A 3IRRA 1WSUA 1UFMA 1A8FA 2HZLA 5TP9A 1UHWA 4S05A 4XKPA 5M2VA 1BOAA 4KIBA 1SD3A 3FMQA 2Q2AA 4A0ZA 3VV5A 5TPAA 1WKMA 2ESHA 1EZOA 1AWCA 4MEYF 2Y0MA 3TDJA 1R1UA 1TNTA 1DTZA 2ELHA 1Y1MA 1ANFA 2G7HA 3RNNA 3C32A 1M5DA 4RGUA 2AXLA 1H76A 3C7JA 3S9MC 4BQAA 1OIBA 1FTOA 1ZGJA 4BHPA 2Q0OA 2BJJX 1FBSA 1QO0D 4ONYA 2CYYA 4Q48A 3SEUA 3IOUA 4A2UA 3ECOA 1S29A 3I0TA 2XUBA 3KOSA 4KFQA 4R73A 1TQIA 4N9IA 4F18A 4TLLB 4A0XA 1OQGA 5H8SA 3WGIA 1J59A 2IVMA 3QIMA 4OFJA 4XKQA 5J8FA 3OD7A 3BBRA 5I57B 4OENA 5DCMB 3DKWA 2OJTA 1HSLA 2UXXA 2VT3A 2YPNA 5FB2A 5LRSA 4NWCA 4QLCU 5CMKA 4IO4A 1PBQA 3ULQB 2V93A 4LG0B 4JSOA 2ZMEB 2XKOA 3E3KA 3EPEA 4YKIA 1XC1A 3PPPA 4D0PA 4N13A 3KP2A 3R4KA 1J1NA 2ZMBA 2GIVA 4HLYA 2V6CA 4ESBA 4IB2A 1ZYRF 1KQ8A 1ON1A 1NNTA 3KBRA 1SFUA 4QFPA 3O6GA 3E13X 3KE2A 3LAJA 2NUVA 3ONMA 4XIGQ 2BE5F 4KYDA 1YW9A 2M8CA 1JE8A 3HSRA 5FHOA 5E17F 4YKJA 1J75A 2XXUA 1PDNC 2W24A 5DD4A 3PUYE 2DWIA 1GGGA 4ENJA 2FRHA 1WQ2A 3WAEA 3GUDA 2B65A 2VE8A 2RQPA 1AOYA 2DWHA 1M5CA 4IHSA 4XSZF 4RB2C 3KETA 3V4GA 1OR7A 5I56A 3KLOA 4IRGA 1J5YA 4BHCA 3MWMA 4RGXA 4F1YA 5D6FA 1J7KA 4NHJA 1MRPA 4Q0CA 1R22A 5HLHA 1XMAA 4ON0A 3G3GA 1W7PA 3T9UA 2I0BA 2HAUA 4M1VA 2VD3A 2XXQA 5D8KB 2AL5A 5JHUA 1TLHB 3IO4A 3MAMA 2CG4A 1LBBA 4DZ1A 3HHHA 1A54A 5AE4A 1HSEA 3QU3A 3RKYA 3F11A 4M73A 4I62A 3TO9A 4IHTA 5L3EA 2PEXA 3HV1A 2ESNA 2HYGD 4RYAA 3CLOA 4OETA 3C3WA 4LLGF 4Z7EA 2H25A 1LCFA 4BLAA 2PLYA 1FT9A 1N84A 5BUUA 2QS2A 1ZIUA 3V89B 2DLLA 1LB9A 3KLNA 3TFLA 2BV6A 4U4XA 4G8HA 3MZ9A 3T1BA 1N04A 3Q25A 4UHTA 3V8KA 3S9NC 1PEBA 4ELRA 5E1XA 4HX8A 2DS9A 3PUZE 1ODDA 3CR9A 5DYHA 4GLIA 2KIUA 4BYYA 4KIGA 4A5MA 1MS7A 3JSPA 4WWCA 1JEUA 4KCDA 2F5EA 4EF1A 4CZZA 3DLNA 2XD2A 2FU4A 3K2ZA 1U5TA 1JEVA 2Z5UA
chains in the Genus database with same CATH superfamily
2MSYA 1H43A 1KWHA 2MLKA 4WK8F 1XHYA 3S15J 4O7MA 1ZLQA 1T98A 3S3MA 2DPUA 1AKHA 3K70C 2GXAA 3TKYA 3BR6A 3LA7A 4CCMA 3C9HA 1F36A 4F39A 1BIAA 4P0IA 2E5NA 4YB6A 4CCNA 5E8GA 1IRFA 4BEHA 1IUDA 3OS1A 3S3NA 1B5IA 2DOEA 4F93B 4KJZA 2KRHA 3PIPF 5EYHA 3FM3A 3VYRB 1DGWY 1UELB 2OU2A 4HX7A 4XRSG 3TQWA 3I71A 2WB1A 4E0XA 1QZYA 3PQJA 4IHVA 5F1RA 1S7EA 4L9TA 1UQWA 3LR1A 3ROUA 2BVLA 1SVOA 4RM3A 1W1WE 1VQ4I 1NMUA 3OYDA 1U9NA 2L0KA 2B4MA 1WPKA 1S8NA 3BFTA 1WJEA 3V7SA 4EGZA 3H9JA 2GOMA 3I9V2 5E3LA 1YQAA 4IRHA 3RYPA 1BP5A 4MCOA 2KDOA 4Y33A 4A3CJ 3JAMZ 5IT3A 1KONA 2MA3A 1O3RA 3KOTA 3E4RA 3PD8A 2F5FA 5LDZA 1YTYA 3I6VA 1NUWA 1VI0A 4O8MA 1X1PA 2K40A 3QYEA 2KQZA 1DGRM 2VHAA 4OIRF 1OLAA 5I2NB 3TEDA 2PMHA 1MQJA 2ZZVA 2QMXA 2LBFB 2JQ7A 1LVKA 1JKOC 3RZOJ 1CB6A 4PJ0C 3GTGJ 2DFIA 4H4KC 2KIMA 3GX4X 3PO3J 1ZELA 4EF2A 2GFEA 2QVVA 3WG9A 5AA2D 1B4HA 1YRNA 3KEQA 3N4MA 2LY2A 3O66A 2VODA 1URDA 3CESA 1Y3QA 1RUNA 1I3AA 5CKTA 1B1HA 1YW8A 5ITOA 1Y9UA 1WWXA 1U2WA 3KG2A 1L0OC 1OFCX 2K3PA 2R3SA 1X2NA 2EWNA 4HAMA 4MFDA 1SYHA 4G2ZA 3ERED 2O69A 1URGA 4NC6A 2O1LA 4C3HJ 2TDXA 2VQLA 3EF7A 4YB5A 3GW2A 3RT6B 2V7FA 4AUXA 2Y7IA 4R9FA 1I6QA 2KKOA 2NOGA 4Y15A 4GXOA 2VC0A 5TGTA 3G7WA 4RDUA 4OU0A 1GDTA 1PP7U 4IQJA 1WGXA 2OWTA 4OANA 1QZEA 4HQMA 4BXUA 4A3JJ 5ILUA 3HFUA 2TRTA 1B9NA 3H06B 3ILTB 1N7WA 1MY2A 4NAPA 1FP1D 3WGGA 2M7AA 5EG0B 2GHAA 4MTEA 2R4GA 2M4KA 1JVYA 5L8DA 4HV6A 3OIQA 1MMNA 1EKEA 1MXYA 2DDAA 4HDUA 4MHFA 1YLFA 2K9LA 3PM1A 3WTZA 4A3BJ 1K9ZA 3OOAA 2JJ7A 4BY7J 3S2WA 5M5XJ 1Z3YA 3DBHB 3OR2C 1FIAA 4H0WA 1YYVA 2IA0A 4HNVA 1T8IA 4XK4A 1DU6A 3HSTA 1UJ8A 3FBNB 3LSXA 5H8HA 3W2VA 5KDTB 2CQQA 1Q35A 3HOYJ 3JTGA 1OR7C 4S04A 1FYKA 1LBZA 2EA4A 3WTTC 2VQHA 2LD5A 4LMYA 9ANTA 4JSDA 3PPQA 4DI4B 5CBSA 5LFAA 2I6EA 1Y0UA 4DNCA 1TFAA 5H2FC 5I2KA 2O5RA 1B72A 2Y48A 3HJEA 2VE9A 3HO7A 1VQ7I 1EH8A 3CFXA 2QQ9A 4I1DA 2NNNA 3A4CA 3S16J 4DIGA 4L5IA 5J1YA 1D8KA 1AL3A 4C2MJ 1XVXA 2IBDA 2XWOA 4N4UA 2P7VB 2DMNA 2ZFWA 3VVDA 1ZU0A 1FYLA 4MEXF 1HQCA 4IEJA 1FZPB 5FJ8J 3QUJA 4RM2A 4Q5SF 3BT9A 3LSHA 1JI8A 3NARA 1WJFA 3M07A 4LB6B 1FPGA 1YXIA 4Q30B 5M5WJ 1K4SA 4U2RA 4M6YA 4OOIA 5JR3A 4CICA 3FUZA 1WZ2A 3ISPA 2O51A 4U0YA 4UACA 4ABZA 1SW2A 3W3CA 2OTLI 4ELPA 4PSXA 2VXZA 1LAGE 3VXBA 1HW2A 1H9GA 3OSGA 2XDVA 3LSKA 1VE4A 3VOEA 4HG2A 2DA5A 3M4OJ 2PYYA 5FTHA 2KLFA 5LGTA 1G6NA 1MNEA 3RPQA 2OBGA 1UHMA 3O6BB 1MQGA 4LATA 5B1BH 3BY6A 1MXXA 2EV0A 4OESA 3QWLA 1A8EA 3VFJA 2FJ1A 4M6XA 4GVOA 4M3GA 2Z22A 2M8EA 1XC5A 4JBAA 4LFUA 2GOXB 1YITI 1QUJA 3PUVE 2QVOA 2QEXI 4G68B 4R74A 1YTVA 3HG9A 4WXCA 1QKAA 4DCYA 4HF2A 2VN2A 2A61A 4RLFA 3ZMSA 1JKQC 2MKZA 3FK7A 1U5TC 3ZMVA 3QODA 2VPLA 1MXZA 2MH9A 3Q0UA 2M5WA 3F8MA 2PMZA 4MIMA 5EGOA 1X4PA 1QRYA 5HLIA 2FVZA 2ZJRF 1A6QA 4W1UA 3ZQGA 4HA8A 1Y39A 2VT5A 4HXVA 2DXYA 3PMWA 4DDDA 1XN7A 2DDBA 2AO9A 2E35A 1LEVA 4NBQA 1WJDA 2RKHA 2OZUA 4EQ7A 3DTEA 2HNHA 4PDHA 4B48A 2KRCA 4PFBA 3JYRA 2V4JC 2EFPA 4PGHA 4DLDA 3VLVA 3HUGB 3MZ8A 2W82A 5LHGA 1SVLA 3BZKA 5ITPA 4NN3A 3IAM2 2R8TA 4NWDA 4BS9A 3D1RA 3MZYA 2P6TA 1FY7A 1HKQA 3WU0A 2RC9A 3A3UA 4JWOA 2X1CA 3BPVA 4N6KA 4OHNA 3VDFA 2WY7Q 2Y2ZA 3FWEA 4F52A 3MP1A 2BJIA 2FUG2 2DT5A 2L7MP 4HBLA 1AU7A 1FMVA 1YX5A 3OYKA 4A3EJ 1MMDA 4ZDOA 3EHUA 2OD5A 4R75A 2ZCWA 3EQLF 1IN8A 2RN7A 3OSQA 3CJQB 4HX4A 3BCBA 4UV8A 5KNLA 4YMBA 3JRFA 1MSEC 5FHMA 2DYXA 2VKVA 3BPXA 4LG3A 4I3EA 3Q5FA 1MJBA 4X1EA 4C9YA 3GBAA 2Y84A 3HRTA 3VEPA 2PJRB 3K9TA 2EFOA 2HTJA 2K9SA 1ZREA 3K6UA 2E7WA 2VP1A 2VKDA 3MVPA 5HDKA 3TP3A 3KC1A 1J09A 1WVRA 3VPRA 4C0RA 1K83J 3PUFA 1FQEA 2DQRA 2E60A 3K1MA 3ZN0A 5IAIA 2QLZA 4UB8C 5FHOA 4RAGA 3W9WA 1QZZA 2M0MA 4XBFA 1MQDA 3M8EA 1UTBB 3G3FA 4O94A 4OXVA 3O3KA 1FBGA 2FYIA 1Y1VJ 1UIVA 4KN4X 1YZ0A 2HXIA 5DVJA 2WAQN 1POY1 4OA4A 5I3SA 4GOTA 3KYDB 2FBHA 1A6IA 3T9HB 3I59A 2EV6A 3V7RA 1BJAA 1W5CC 5LGNA 5K2YA 1ETWA 3QQAA 3I4NJ 1FPIA 1IN4A 4FCYA 3SDGA 3U1DA 4MX6A 4XKBA 2L4AA 4UUSB 1BLFA 3FJMA 3SEXA 2I48A 2JRMA 4IOCF 1ZMGA 2BY2A 1ZBMA 1LNWA 3KPHA 2QENA 1I50J 4N81A 1ZKGA 1IXCA 1LBVA 3LSLA 4E4HA 3TCHA 5E1ZB 3TPAA 2RCBA 2MABA 3HRSA 4N6PA 5EQ7A 5J1UA 2O61A 1SDXA 2Z8DA 4FATA 3L2WA 2CMOA 4QFLA 3HOVJ 2V84A 4L9JA 4B4CA 5BMZA 1MBEA 5BNGA 1JP4A 1DP7P 1ZRCA 1SQYA 3GZ5A 3UIFA 3QPTA 3FK6A 1DPEA 2QKMB 3LFKA 3E5QA 3CP2A 3K4JA 3HHGA 1RKTA 1TFDA 5ICFA 4L17A 1QU3A 1SI1A 1A40A 4KUMA 1KU7A 4DBRA 4IO6A 4FEBA 1ONVA 5EYFA 1RZ4A 1B52A 5GAHJ 5IM2A 1EH7A 5DEXB 3C2HA 4V2GA 1HCRA 4GYGA 5H20A 1RYOA 1YJNI 1U8RA 3GZ6A 5B3SH 3HB9A 3MFKA 1MIJA 1QGXA 1APLC 3MZBA 1YS6A 3WG7H 1DPPA 3ASOH 3MBPA 4DQ2A 3HGYA 3JV9A 1M1EB 2N8GA 2HOTA 1DBZA 1P4WA 1H3DA 4FE4A 4AWXB 2HDCA 2P81A 2A3SA 4XR6A 1W5SA 3CCJI 2PFBA 4EM0B 1ZG3A 3RPUD 1YJ9I 1B8IA 5IP9J 2HR3A 3BJAA 3KGCA 3O97A 4XSXF 3OSRA 2EJRA 5EJCA 1P1NA 2OJED 1USYH 3PFYA 5BOXA 4AU7A 2XGCA 3GTMJ 1R7JA 2HEOA 2WKYA 2ZYKA 4XL9A 4D5CA 1PVEA 1UB9A 1H8AC 4BQNA 3DTIA 2DMPA 4CZCA 1ZTYA 3EQ1A 3QAXA 4P56A 1NH7A 3ODBA 3S9LC 4C2UA 4IX7A 3TDZC 4DYCA 1IW7F 3Q27A 4X9TA 3LQQA 1SANA 3I54A 3OYIA 2HVSA 1RC9A 1RKMA 1LQ1A 1TWFJ 1O7TA 4P0GA 4II3A 2K27A 4JVIA 4OIQF 1V3FA 3GLBA 1EV7A 3Q28A 3SETA 1ZKBA 4GWUA 1S72I 5J1DA 2NS8A 2Q8KA 4PETA 1LEBA 3DEWA 5D5UB 2X4HA 3TTNA 3SZGA 5B70A 4RPOA 3KN8A 3IH2A 1D3YA 4A12A 2Y9ZA 1P7JA 3PV0E 1TQPA 3LFUA 3PSIA 3F23A 5JI6A 4QHQA 4OINF 4ZZAA 2F34A 2MGQA 4KT6A 1PJRA 4ESFA 3A2KA 4P9KA 4M71A 1GV8A 5ERIA 2BYVE 2ZFUA 3HM5A 3K2AA 4IPAA 2HQAA 1UAAA 3I4MJ 4KD5A 4G7ZF 2FBIA 4KMUX 4ZZDA 4ZYDA 4D7MA 2PVUA 2CUFA 2V3QA 4HE1A 4F29A 4H46A 4O3CA 4XLAA 1ZARA 5FLXZ 3FGSA 5DS9A 1YE9A 2QBYA 2HZKA 1A04A 1IDYA 1BTJA 3F0CA 3SHFA 2Q1ZB 2K86A 4B44A 3UKGA 3H5RA 2VBWA 2CZLA 2J5PA 3OYGA 3PMXA 3THIA 4UB6C 3OS2A 1TTYA 1C0WA 2E1CA 4BDMA 1W7PB 4X8RA 4C1TA 1H45A 4UXNA 3U94A 2RGVA 2HQRA 4EJWA 1R71A 1TQMA 4YZZA 2KLOA 2XXRA 3TQLA 2JK3A 1LB2A 2E2IJ 3R7XA 1JJ6C 4QRZA 4I7HA 1D9QA 3FD3A 5IZ1A 1S7AA 2ZXIA 3HRUA 3L1PA 1XI6A 5L3CA 2P5VA 2F78A 4GFRA 1WJBA 2DFEA 4DIQA 3L2UA 2COMA 1FOXA 1OVTA 2XAHA 4G12A 4JVDA 2F2EA 3WU2C 5HS7A 4BXFA 4P8BA 4POXA 5CVIA 4EXLA 3BG5A 4BACA 3TAJA 2BY3A 2K7LA 4F3QA 1CGPA 1GVJA 2ID6A 4LK0F 3QYFA 2X6OA 5L3DA 1FTAA 5HDGA 2ANJA 3TQNA 3T22A 3ZP5A 1KU2A 1NG7A 3BDDA 1XDSA 1FTTA 2XGEA 2P5KA 2BW3B 2LSOA 4EQ9A 5EEHA 5DUKA 1A31A 1Z67A 2HPGA 5CPRB 5E1WA 5TRDA 5LD2C 2ID3A 1XSDA 1FP2A 3QAHA 1JQFA 4BDYA 3IOTA 2LLKA 2DBBA 1Y6IA 5J4YA 1EA3A 1I1SA 3A3CA 4FIMA 5DD8A 3SEQA 3VVFA 1B51A 1VDWA 4P5OA 1NK2P 1FC3A 2XXPA 1H9TA 1DP3A 4L0YB 4JDFA 1G8XA 1IZ1A 3HCQA 3UN6A 2JPBA 5ET8A 2RF1A 4XKNA 1BI3A 3RN8A 1FCKA 3E6MA 5E3OA 4LQ5A 2P5LC 2YSRA 2R5ZB 3DU5A 4MQ9F 3D1NI 3F9KA 4H0EA 3C35A 3OMYA 2ONKE 3QYBA 4U0WA 4B09A 3ZKLA 3G4SI 1XSVA 4JWXA 4ZECA 2FNAA 4EQQA 2QA4I 1T38A 4MMPA 1LBXA 2XWVA 4NF8B 3R6UA 3MMYB 2DW4A 1AH5A 2Y7RA 2ME0A 4QF9A 5FLXK 2O9LA 1T33A 3S17J 3GTLJ 4XLFA 4BUPA 3REOA 3HL2A 2EIMH 5KHDA 4POWA 5B7DA 3SDFA 5F27A 4OVJA 2LTPA 3M8FA 2V9KA 2WAQA 4N4NB 3U9GA 5BS6A 3WTWC 3HOXJ 1MDQA 4XTCQ 3U2RA 3NAUA 1RETA 3FXQA 3L2QA 4QSEA 5CMBA 3R0JA 2PBIA 2XROA 3DP4A 5TISC 1NTCA 2QUFA 3FKJA 4I2OA 5F7VA 4HW8A 3O8GA 4DGWB 1K78A 2KZGA 4RAFA 2L54A 4P1WA 1AIVA 3M3LA 2K9MA 1D4NA 4G6QA 1BR2A 4JWYA 2NVYJ 2QKLB 1IGNA 3OIOA 2ZZXA 3FATA 4XQFA 1I39A 3EUAA 2ZZWA 3G3KA 1OCZH 3ABLH 1IUFA 3J80K 4L5EA 3L2CA 1M5BA 2DA3A 2UXNA 2QS4A 3ROJA 4RMNA 2W84A 2HFHA 3TGNA 2JT1A 1YFHA 3FMRA 2X26A 4KCCA 3HBLA 4RS8A 1IUYA 2HFBA 3JRBA 4XOPA 3MKZA 1JGGA 3E5XA 2Z2SB 1VQKI 1P92A 2OF7A 2ISZA 2DMUA 4DYQA 3TTMA 3CZ6A 2FMYA 1LAFE 4C3JJ 2NAZA 3DPUA 3J7ZI 5E8IA 1VFDA 1TNSA 2WV0A 4NQWA 1BW5A 3IR1A 3VLUA 1FYMA 5ICGA 2OA4A 2YS9A 5FHNA 3OYLA 4Q8RA 4WXDA 1B32A 3MQ9A 2D5WA 4UABA 2JN6A 4CUGA 3JRCA 4MQVA 4HNTA 2Z16A 3C33A 3J7YJ 3TYHA 2Q8JA 4F1VA 2R92J 1TZLA 3T93B 2HTSA 2KRFA 5AA4A 1BJZA 2E34A 3CTAA 4EJVA 4KISA 1MH3A 3WTYC 4ZDPA 2XVCA 1N77A 3JW4A 4M6VA 1T08B 4RAYA 3CUQB 4OWRB 3EYIA 4PFOA 1IMAA 4O5VA 2LH9A 2QF7A 2VC1A 3LQRA 4NC7A 5KK1A 4BAYA 4N6DA 5DTBA 2CV0A 4G94A 2ZC2A 1V54H 3UR3C 2JRTA 3ZMTA 5CC2A 2VBZA 4HTGA 3U65A 3OV8A 1OMIA 2R7TA 1DPUA 3ZMUA 2WAFA 2L9NA 3HC7A 4ENNA 4F55A 1W4MA 4E7IA 2CZKA 3B8BA 3L7WA 3ZCOA 4AYBN 3JREA 4BDNA 3OIPA 2DQVA 1F1ZA 3V8XB 3HPHA 5KVRA 5H8HB 1LDKB 1R9LA 1FPEA 3HSEA 5EZGA 4TV7A 4P9FA 4H65A 3FMSA 1SFEA 3DLAA 4HV5A 3JTHA 4IO3A 2XPWA 3V42A 4X1BA 4UVAA 4BE0A 1O7FA 1WJ5A 4XLNF 3ZQLA 4MLQA 4PP0A 2MD5A 3K69A 1Y4CA 3ZRGA 3CC2I 2VONA 1B72B 5I2KB 3K7AJ 1NG6A 3A01A 4BXXJ 5HNHA 4P11A 3T9VA 5IT9Z 4RK9A 4CCJA 1FBFA 1EF4A 1HKTA 1TP4A 1FQFA 3J81K 3DBLB 3SYTA 4GWSA 5BWJA 2Y75A 2ZNSA 4KITB 3SEWA 2BEOA 4PGNA 3OOPA 3H3VK 5FKNA 4EVIA 4XORA 4KDPA 1GHCA 5I58A 1URSA 5IGAA 1IRGA 2PT1A 5D4RA 3K4BA 3S2DJ 2IPQX 2P8TA 1CF7B 2OC6A 2Y0SN 2DA6A 3VSKA 1B7ZA 3SDBA 1R6ZA 1P1UA 1ZRDA 4KYSA 1MY1A 1TT0A 2LNBA 4R79A 1FQBA 4JK1X 4P9UA 4N17A 2OLBA 2JZYA 4LP2B 1R58A 2M30A 5HNFA 3ABMH 2LK2A 1MSFC 3T0YA 2Z8FA 4GWWA 1PBPA 4EXKA 1JUMA 1B05A 4GWZA 1JUPA 4KIFA 2FQ3A 5F1QA 1XSXA 5CBRA 3KN7A 3BZCA 5DVFA 3LSWA 2DYRH 3QRFF 1N7XA 5DT6A 4BDLA 3U8QA 1Q9DA 2G7UA 3OL4A 4LLLA 2XD3A 4M9ZA 4QTRA 2XXKA 3A0HC 2XXWA 5I84A 3M8UA 3ZS6A 1NV3A 2DJNA 3M9AA 3AAFA 3C18A 5A2QK 3U93A 5IOYA 4KI0E 1DDNA 2XSJC 3JRIA 3EUKL 4R6HA 4N15A 1N75A 2XXHA 5H6RA 4FJPA 3LSGA 1STZA 1OCCH 3CG3A 1JKRC 1LDJA 2LAOA 3RPUA 4L9NA 2FA7A 3K4CA 4FECA 4FE8A 3OR1C 5ESYA 1ZTRA 2XGDA 5F64A 3FHZA 1OQYA 3UGWA 2XKPA 1XGSA 1IMFA 3F22A 3HOUJ 4GQOA 1AWBA 1V5EA 1H44A 2D3IA 1LE8A 4ZYGA 1H88C 4BBRJ 2HYFA 1XOCA 3IO6A 1W0TA 4LQ2A 5CI5A 5LRRA 5BPIA 2O7UA 1PUEE 2W48A 2WWYA 2IP2A 3J7AY 2DP8A 4FEDA 4RB3C 3JZJA 2MD0A 2RVCA 1I3QJ 4YRVA 4JYKA 1HC8A 2V1NA 3P9KA 2R7WA 4B8XA 2M8GX 3ZXSA 4PAIA 1BW6A 4OMBA 2WV1A 2REJA 1Z21A 4EJTA 4OVPA 3IKVA 2H6CA 3FXOA 5KCJA 2MLGA 4GIZA 2ELJA 2LRDA 5IT9K 3P7NA 3KSJA 3S1QJ 5FROA 1I6BA 1I27A 1IV8A 2PG4A 4HF0A 2OCUA 4R2FA 4OFOA 2G9WA 3U21A 5TJJA 1NH3A 1VQNI 2BGCA 1JHFA 2PI0A 4UVCA 1HW1A 5FLMJ 5L9SA 4UUVA 4PF8A 5CQGA 2WYPA 2WX9A 1HW5A 1K9YA 1B4ZA 4MNIA 2M0CA 1GTKA 3KZGA 1BOBA 4YIRX 1YI2I 4MLVA 2ZYOA 3EYYA 5H8QA 5JFRA 3RJPA 2HCAA 2UVJA 1MMSA 1N78A 2CV1A 3IAZA 4PJJA 2F97A 1FX7A 1I5ZA 1N76A 3F21A 4IQ4A 2CQ7A 3ONQA 1O3TA 3I5UA 1SMTA 3CMMA 1BIYA 4WXHA 1TWAJ 1UCRA 1OYYA 1QULA 1SVXB 1TXFA 3LSIA 1MPBA 3DF8A 2BOLA 3FM5A 2X1DA 3D0SA 4NF5A 2XAFA 1DCUA 2K5CA 4RA2A 4N91A 2KZVA 3JRGA 2ACJA 2NVXJ 2QQBA 3PQKA 4NGUA 1VQ8I 3IL2A 4DW6A 3ABUA 3O8HA 3WODF 1A5JA 3MZHA 1V5FA 4N4OB 3CCSI 2I4BA 2JSPA 3W6KB 1D5YA 4LZ7A 3K2DA 4ISUA 4IO7A 3T8RA 2A5SA 1LKXA 4PFIA 3TMOA 5JTYA 3OYJA 2BHZA 3OYMA 3ZMDA 1IXSB 3RYDA 5K5QA 2Q2EB 2I0CA 2BVMA 2L7FP 3C2BA 1RIOH 3FIWA 3VFZA 1AOVA 4PFPA 1A99A 2PFZA 4A3LJ 5K2XA 1ETVA 1SFKA 3QPSA 1P9QC 5ICCA 4I01A 5DEQA 3DELB 1K6OA 5A5XB 4F3SA 2P2AA 5H8FB 4Y4RA 1B9JA 5CLSA 5EYRA 2X7QA 4LN5A 3HSFA 1Y1WJ 1IXGA 4H5FA 2DMQA 3ELKA 4QSDA 2FD5A 4AB5A 3K10A 1SW5A 5HLGA 3CLQA 4R6KA 3ML6A 4YG2F 2MH2A 1NV0A 1J2XA 3CCVI 2RNJA 1TWHJ 4U88A 2MC4A 4CYCB 1Y20A 4GXSB 3BQZA 4GYIA 2B0LA 2WTEA 3DP7A 3IUOA 3TBIA 5HVQC 1HDDC 3GVAA 3QYTA 1Y1ZA 4BGDA 4QXDA 2V1UA 5GTHC 4QFKA 4AD9A 3DFGA 2PQ8A 1XGMA 2LREA 2CUEA 1B3EA 3ZQ7A 3LSJA 2IEEA 1R4MB 3GLLA 1FBPA 4V19K 3DKXA 4H6DA 2HXWA 2HXOA 2VQGA 4I02A 3FXMA 1FSAA 4F19A 4YMAA 3HPIA 5LEJA 5J40A 2HQ0A 1Q1HA 1NI9A 2R5YA 1F9BA 1YAEA 3RYRA 1B8IB 4ZTFA 2XHDA 4HNUA 4D9JA 4O3MA 4ZEDA 5ICQA 3AG4H 3T9XB 4FORA 4QBAA 4L9VA 1FPQA 5D5VB 3K1NA 3VODA 2YUSA 3OO6A 4WXJA 1YHQI 3KZZA 2DOJA 3MKWB 1FTLA 1MBGA 1BI1A 1WI3A 2AHQA 3DPLC 5I57A 3F6VA 4OAYA 2LFBA 3TEPA 1R49A 3KEOA 5DCMA 4E7LA 2HDDA 4KXPA 3T0JA 5HM4B 2HDWA 2CEXA 2DU9A 3SERA 1FPJA 3PSFA 5EZHA 2ONSA 3O6IA 2CJJA 4NDLA 4E7SA 4ENKA 3FXRA 3G1OA 3H1CA 1EYIA 3FVGA 5L9MA 2XXXA 3N94A 1BM9A 3BG3A 5DDGA 4LLNA 2PBWA 2X6YA 3FXJA 2NVQJ 2RINA 3B7DA 3MVZA 1YG2A 1XPXA 1SAUA 2GHBA 4TQUQ 3OO8A 4NHBA 2IS2A 4IO2A 2ZMEA 3WE2A 5J6XA 2ME6A 2QSGX 4QFOA 4F22A 3V5AA 1QA6A 4Z2YA 1MDP1 4XICA 1QUIA 1LGBC 1MQHA 2H99A 2DXRA 3O9PA 1VF9A 3PO2J 2V3TA 1BL0A 4AIJA 1XMKA 3GF2A 3PMVA 4MJOA 4M3EA 1JXSA 2FE3A 4PAKA 4BKXA 2IJLA 3ABTA 3K01A 5IZ3B 3RCOA 2H8RA 4B3XA 5AA2B 3DKYA 5FKMA 3S2VA 4V2FA 4HCYA 1FPDA 3L9FA 2CV2A 4MAGA 5IYDJ 5JVTA 5HS9A 2R7VA 1RDXA 1QBJA 1FSEA 2B7EA 3K1PA 5L3GA 1SAXA 3O28A 1FPKA 3SEYA 3B6WA 2M7BA 1XGNA 4JX4A 4MNPA 1I69A 1OJLA 3L6HA 1KU9A 3HIFA 1YJWI 1FWZA 1PB7A 1P99A 2HZTA 1WVJA 4XFEA 2VB6A 2R71A 3MP6A 3IAS2 2PX9A 3SXYA 5D4SA 3BFUA 4CO8A 4TOZA 4O3BA 2E1MC 4FHTA 2DK8A 4RBOA 4G8XA 3SZPA 1FTJA 1JVXA 4MEVA 1O64A 3IK6B 3DTKA 2A69F 1NNFA 2F6CA 2VJ4A 1JW5A 5FRNA 2LR8A 2YX4A 3W2AA 1JW1A 5IZ3A 1ULYA 3IRQA 1XD7A 4E7HA 1P1WA 4GXAA 4F3BA 2R7RA 1MM7A 3WE3A 3ZN1A 4ZJZA 1ZGWA 1B5JA 4ZEBA 2GQQA 2F7BA 4LIVA 4GL0A 2FNCA 2H4IA 4CHUA 1BR1A 2PN6A 2DFHA 5IY5H 3G6EI 5K7FA 1RNLA 1G59A 4DXBA 4XIDA 1SPIA 3MWBA 4NF4A 4BBSJ 1IO2A 2BY1A 2Y69H 3TW7A 4PFWA 3I3VA 1NV5A 2XWKA 2LC2A 2JVHA 4E7JA 2XASA 1I1GA 1IG7A 2OX3A 2QMWA 3MW0A 2JSCA 1JETA 2UXAA 3C4MA 3ECHA 2QZ8A 2FSWA 4KNYA 4IGRA 4HOBA 4ZYEA 4OIOF 2X6WA 1NUYA 5H8NB 4ZYHA 1ETXA 2LMDA 1JGSA 4AS5A 2XA5A 4DJAA 2JWTA 3TO7A 3FVNA 4RK2A 3CMYA 4H1XA 4H8JA 4BH9A 5DM7F 1G3WA 2MYSA 2YU3A 3I4PA 5J8CA 3C34A 1HXDA 4NUBA 2HQ5A 5B66C 3KYLA 1DPRA 5GAGJ 2HZDA 2OV7A 2PMUA 4BE2A 2F7CA 3H92A 2ZYNA 2P1SA 1JTXA 3GWZA 1TWYA 1R9QA 2O1MA 1WCMJ 1JUSA 3CI8A 5LLQA 1T56A 3KFWX 4CDGA 4J19A 2A07F 2QRYA 3BTIA 4F92B 1ZGAA 2XAGA 2HOEA 1L5TA 3OYBA 1RPWA 5IKBA 2UV1A 2M45A 3K6WA 3LA3A 3ZPLA 1KA8A 3BTLA 4ENMA 2AL4A 2REGA 3CIJA 3ILUB 3D5SC 2F48A 4BJTA 1LFPA 4BJ5C 3SESA 1QHGA 1R4NB 2W1OA 3OELA 2V9PA 1ACIA 1FBQA 2ZB9A 3GLXA 4H67A 2A6EF 2DN0A 2LKPA 1LBCA 4AIDA 4CGZA 2VOZA 2V26A 2EFNA 3PNVA 1XVYA 2V25A 4OTEA 5KAFC 2JPCA 2ZSIB 3TP0A 2R7FA 2OCCH 2VOPA 3Q29A 3R61A 3OYCA 1X3ZB 2XAQA 2I58A 1QUKA 2Z8EA 1HSJA 5TP9B 4D5FA 4G8NA 5M5YJ 4PFRA 4NB5A 3TDUC 3N6UA 3L2VA 3MC2A 3TTLA 3TTKA 4EJUA 1VSOA 4HF1A 2PX1A 1Z1DA 1B3FA 3E5UA 5TPAB 1GVCA 3CMEI 4YFKF 3FV2A 1MG1A 2FXAA 2GQ1A 3SEZA 1KZ8A 4KYWA 3E97A 4AIKA 1KYWA 3I5OA 4HE0A 2BXYA 3TCGA 2ZKZA 3KIOA 1X58A 2R7XA 4QPQA 3DBRB 2XXYA 4PF6A 1SI0A 4IO5A 1OMPA 3GBBA 3D5LA 3OYEA 5L3FA 4N8YA 1WDNA 2F5VA 3K4LA 1RR7A 5J4VA 1RUOA 2QJEA 4P1EA 3U92A 1XS9A 4IO9F 4FASD 4NQWB 1QVSA 2FF4A 5I2NA 1N0TA 2Q88A 2A68F 1CQTA 2LBFA 1LFIA 1LUJB 2W7NA 3K00A 2GZWA 2B3BA 4ECFA 4DZPA 1BBYA 2P6SA 3IL1B 5ISUA 3ZQCA 3RQIA 2CS3A 1BI0A 2EZHA 3OO9A 1EH6A 1RDZA 5GPAA 5AA4B 2ZMEC 2BHYA 4G4PA 4IHWA 1MNDA 3LSTA 2FX0A 4AIHA 4U7DA 2F7AA 4RPNA 1S9TA 2KL4A 1OLCA 4OEUA 3GFJA 1ZJLA 1ZLJA 4XONA 2DYSH 3BR1A 3LSPA 1R1NA 2HKXA 4MGRA 1J0RA 2ABHA 4F2OA 4XM3A 1K7AA 5L9OA 2Q89A 3QSLA 1IMCA 2GA1A 3FXUA 4QIWN 2A5TA 4XF5A 3W15C 4CH7A 3I53A 3PPRA 1LDDA 4THIA 1LFGA 1CNQA 4OFLA 2HAVA 1G3YA 1B5HA 1BR4A 2K85A 3KCCA 2XD2A 1USSA 1F4KA 3PUXE 2ZNZA 1Z77A 4OWDA 5EG0A 4RXLA 4PC9A 2E7XA 4G6TB 4PJNA 4YIFA 2KT0A 5LHIA 3CJRB 4WCGA 3VB2A 3IWFA 1UIUA 5D6EA 5KAIC 3IOVA 2HOSA 3IX1A 2H09A 4PGGA 1RR8C 2NOOA 1FPFA 2GA2A 5CM6A 1MH4A 4CYDA 4CA0A 1OLTA 2E0SA 2HHMA 3A01B 5LOMA 2HPMA 3OENA 2H1LA 1BK4A 3IB0A 3BG7A 5IP6A 1HDPA 2IS1A 3E9XA 3KP6A 4RB1A 3PU5A 4YKPA 2GWRA 1LVAA 3K4KA 5EYGA 5AA1A 4M3FA 1MDMA 2E1OA 5FKKA 3QOEA 1BI2A 3HKZN 2GLOA 2R6GE 3VSLA 2IA2A 3RQTA 1BC8C 5HPQA 5I58B 1JKPC 2EPFA 4IY6A 4EDPA 2OQRA 3FVKA 2RAEA 1ETYA 2QM3A 2XAUA 3K6XA 1Y8RB 2IGNA 2L3DA 4WX9A 1MGTA 2Z1DA 5HDNA 4IZZA 4GO1A 4OAZA 3C1DA 4A69C 2X1EA 4ZH4F 3JRAA 2GH9A 2Z33A 5I56B 1NHAA 4RAZA 4GBWA 2LF7A 1I6AA 2K4JA 4GWXA 5CMCA 5HBCA 1QW0A 4PCQA 1ORKA 2FQ4A 1EJ9A 2KJCA 4I09A 3E6CC 4WKMA 2WYKA 1SYIA 2LF8A 2G93A 6PAXA 5AA3A 2CRGA 3LUZA 5KZTA 5DCFA 3NQOA 2JA2A 2YR2A 2GIZA 5HLTA 1LLSA 1XG1A 2CUJA 2F35A 3OS0A 3IOWA 3BR0A 1I6XA 1R1TA 3KEIA 1B1XA 5ED4A 3CVGA 2K4BA 4GL8A 1UG2A 2O7OA 4ZTJA 1M5EA 2FEZA 2L9VA 2DDKA 2K9NA 1JJ8C 4IKFA 3IWZA 3J80Z 3A02A 2QFLA 4I9DA 5CQEA 3AG1H 4QPOA 4ZE8A 2BXZA 4XKWA 4G68A 3LC8A 2DODA 4X04A 4E0WA 5IYBJ 1DQUA 2L7ZA 2XF7A 3WAFA 3M8JA 1LCTA 2GXGA 4K2EA 1D0XA 2Y7KA 3HYIA 1TBXA 4G9YA 1R23A 4LD5A 3LSRA 1PB9A 3KBZA 4PE3A 4LVQA 3RY3A 4AQ4A 4N8GA 3IFCA 4U1ZA 4PFYA 1W36D 5CVJA 2MC3A 1B3HA 2COBA 2H6BA 1FBUA 4R1HA 4A3DJ 3VE1B 2CW7A 4LZ8A 1S50A 4MNUA 1ZRFA 1QJMA 4DOZA 2P7CB 1UTHA 4N07A 1BC7C 4NF6A 4DE8A 3B6AA 5ILVA 1QGPA 3AG3H 3FX3A 1JW4A 1D0YA 1LB8A 5CJ9A 2NNYA 1SW4A 3IORA 5F24A 3N6TA 1R36A 4GRKA 2AS5F 4GCVA 3P5JA 4M4GA 2MBFA 1ON2A 3MSTA 1XDUA 4XOTA 4AVPA 3TODA 1OCTC 5FFZA 1D9VA 1U5TB 2DA4A 1G4DA 2F36A 2VLAA 1QKBA 4BDRA 5J16A 5CVUA 5EQAA 3VXCA 2KJBA 1MXWA 1A7LA 5TU0A 1Y3PA 4U23A 3ZKKA 1DSNA 2XX8A 2ECCA 1A55A 1AKHB 2EK5A 1OCOH 2OQGA 4UV9A 4YEJA 1D1BA 2STWA 3V7CA 4BY1J 5C4XJ 1ELJA 2CZHA 1RKWA 3HDDA 1VR5A 4RA1A 5H8QB 1TT1A 2F5CA 4R8HA 4BEHB 3M1CA 2BY0A 3BWGA 2M1BA 3IHUA 2V6EA 3FISA 3EDPA 3CG1A 3RIRA 5ILSA 3GXAA 2IGKA 1MNMC 1SD6A 3I55I 2M3AA 1O57A 2KIFA 2ONRA 4JX6A 3RTRA 3FJ7A 4NF5B 4ZS9A 1WI9A 4HW0A 1YX3A 2RNGA 4FT8A 3SZTA 2L7KA 3V8JA 2XSDC 2CGPA 1FQAA 1Z7NE 2RC8A 2VOOA 3PD9A 3S32A 4NC8A 1T2KA 1ZH5A 2THIA 3P9IA 4YFNF 3HTUA 1G3TA 5E20A 3CJNA 3W6JB 3BKIB 3MP8A 3RLFE 1MY0A 1S9HA 1T0KA 2CU7A 2I5UA 2Y9YA 3A1YA 3N26A 4F91B 1U6GA 1BN5A 2JA5J 3PUWE 4HDVA 4EMSA 3HGGA 3I64A 1IN5A 3U1KA 1IMDA 1Q1KA 2HU9A 2DVZA 1IMEA 1UTBA 3J81Z 3KYCB 3O6HA 1DMBA 3W9VA 1SD4A 1B59A 4GRIA 4GWOA 2VASA 4LIUA 1JHHA 2X51A 1IXHA 4MO7A 1FOYA 2KPMA 2DWAA 4XRFA 3S14J 3GXOA 1Z3XA 3K4UA 3OMBA 2GRVA 4EUOA 1VQLI 3OO7A 2Y7PA 3U72A 2QS3A 1B6HA 1P6RA 1MBHA 2G0EA 3ERMA 2RKMA 1EYJA 1YRNB 4XN3A 3ZQIA 5J1RA 3GFIA 1U78A 1NNPA 3DU6A 3HOTA 4UUSA 1VNDA 3RDIA 3VYTB 1BIBA 5H6QA 4YU0A 4P1LA 1U3EM 1YPNA 1KYZA 1NNKA 2RV8A 3IFAA 2IEKA 3FVOA 3H35A 3OYHA 1OISA 3H4ZA 3SEVA 4F3GA 1KQ0A 3B6TA 3BTJA 5D5WB 1HBXG 4BDOA 1F43A 2HEUA 1D1CA 4I0BA 3O2PE 3IH4A 5LHHA 2GAUA 3IB1A 4ZDMA 2XXTA 2QSHX 3TUSA 2CUZA 4CXFA 5A2QZ 2D5VA 3PFIA 3DV8A 1S7YA 2F8DA 2H98A 4YAHX 1ZR4A 4N9HA 2NVUB 1W0UA 4WF2A 4CCKA 2EQRA 4KQPA 3OEMA 4PBHA 1S7OA 3GZGA 4KICA 3CCEI 2C6YA 2W25A 2I8DA 5DEXA 2IAIA 3Q9VA 2R5YB 3UP9A 4Z6YA 2ETHA 4JBZA 2YLNA 4PFUA 3BJOA 4Y13A 1TC3C 3C36A 3KC0A 3CCQI 1H0MA 1B3GA 2AQFA 1SW1A 2O03A 5HS8A 4ZC3A 1MXUA 5I59A 5L3BA 2A6HF 4LGWA 2XWIA 2LOOA 1T95A 3E6BA 3F8NA 2E1NA 3F8FA 3OYNA 2H1KA 4ZDLA 3O2AA 4QSHA 2STTA 2B3FA 4MH5A 3JCUC 3DM0A 1R1VA 2VJ5A 2D1VA 1PP8F 3ECRA 2PJPA 3EHTA 3G3JA 3LUYA 4U21A 2DE3A 5FBPA 3H9GA 4GD5A 4LA9A 3BOQA 3FDYA 1P4AA 3TCFA 3F3XA 3KSXA 1WRJA 2F6PA 5D5XB 4OEVA 1G2HA 3R26A 1VQ6I 4Y52J 1DOTA 1MPDA 1OKRA 1FMWA 2WC2A 1PUFA 2Z9OA 3NEUA 3CF2A 2DOFA 1D0ZA 3Q0WA 1E2XA 4FE7A 3LL7A 4IF4A 1ZG1A 3V8LA 2ZNUA 3K6VA 4G68C 1JTYA 3CUOA 3RUMA 2XHKA 1HSTA 1RDYA 2E1SA 4GX6A 2CQKA 3UNGC 4KA4A 3CDIA 2ZXHA 3LSMA 3HTSB 2WEFA 1L3LA 1LFBA 4FX4A 2EBIA 3B50A 2D45A 5HOOA 4FETA 4RGRA 4I0AA 1B0LA 3CJTB 2ZYMA 4U7BA 4BNCA 1XT8A 4A0YA 4JXIA 4HSTA 1MBKA 2XIGA 4JP0A 2LP0A 4MBPA 4UA8A 3BTCA 1B6AA 5K7ZA 3JSOA 1FEXA 4D1QA 3B6CA 3WGHA 5F1JA 3BC8A 1OYIA 4FISA 2RQQA 3GTQJ 3MEXA 2YJPA 4U1OA 5F08A 5CVRA 2X48A 3L00A 4Q4ZF 1Y0NA 2V3UA 2OPTA 3F6OA 3AG2H 3MPLA 1S3JA 4U4SA 2R93J 1NV2A 5T3JA 5EGOB 1UMQA 1SBPA 1QHHD 2BZTA 4ELOA 4RJZA 1IN6A 1B4AA 2H8WA 3O29A 4A5NA 2WADA 4MF3A 3QPLA 4BE1A 2VT2A 2H9BA 3R60A 5ICTA 4DBQA 4F3PA 3VLWA 4BU2A 4EM1A 2KR0A 2IGMA 3P7IA 4HQEA 2B9SA 3FJGA 4I8CA 5FD6A 4NF4B 2R7DA 4MIJA 4DZJA 2O0YA 2F5DA 1V4RA 5CMMA 4X6AJ 2KQRA 1Z7LA 2QQAA 4N0BA 2XGXA 2O68A 4DXCA 1MD0A 4IHXA 1EH3A 4EJOA 5GPCA 4A3GJ 5AIPA 3H0GJ 2EA2A 3E78A 2PMZN 2EFWA 2UVGA 3ZQFA 2BBYA 4Y7NJ 1ZK8A 4JX5A 3LOCA 2XC7A 1VTNC 5E3MA 2KDZA 2YPRA 2DJIA 1FTZA 3AXFA 3F72A 5F0CA 3TTRA 1KZHA 4K3FA 2WBMA 5E18F 1ATGA 2FA5A 3MKLA 3FF5A 3QPHA 1LBWA 4C3IJ 5AIQA 2F3DA 1HF0A 3FKIJ 1X1CA 1DUXC 3S3OA 2EZLA 1IDZA 3PTYA 4L0ZB 1LJ9A 2CW8A 3MZ1A 1B46A 3LBSA 1LFHA 3PPOA 3MVWA 2F4OB 3ZQQA 2CFOA 2O3FA 4IJAA 3GFLA 5BPDA 1F5TA 4ESXA 1OCPA 1REPC 2E2JJ 2P4WA 4YKKA 2W85A 3Q9SA 1FJ6A 1ITYA 3RPWA 4AS4A 3CCLI 3S1RJ 5DW8A 1R5GA 2XXVA 3UK4A 5M3FJ 3AL0C 4A3IJ 4I3YA 3MQ0A 4A3MJ 2JA7J 4NF8A 3BJ6A 4NTLA 3W6VA 4M74A 2CMPA 1WH5A 1IEJA 1G0HA 4U87A 3BROA 3PL8A 2DQLA 4MFIA 4PTKA 3I59B 2DOAA 2MW8A 4ETSA 1X1DA 1YW7A 4KT5C 1O3SA 1Z7ME 1VQ5I 1O7LA 4IVNA 4XLPF 3TOBA 4IGTA 4M3BA 2JTVA 1VQ9I 3TKDA 4F1UA 1MMAA 4OVTA 1ZAOA 3WU1B 5DM6F 3AKZA 3NOHA 2OCEA 2VKEA 4B43A 1Z9CA 1JNFA 2KIQA 1GXPA 2UWMA 3B6QA 1IRXA 2JVGA 4PUSA 3TO6A 3B02A 2JA6J 2HYJA 4ZZLA 4L18B 1E3OC 1B7UA 1GXQA 3WTXC 3H6WA 3HRMA 1US5A 3GEZA 2A5WA 4ITVA 3BG6A 1MY4A 2R7QA 2HGCA 3QU6A 2HWVA 2CZIA 3K0LA 1SMYF 3A03A 1VZ0A 2AQEA 3N5LA 4QFNA 1IAWA 4RY1A 4M72A 1Q1VA 5EQ8A 2ALUA 3F8CA 5JHFA 3OWTA 3HOZJ 3OYAA 4IOAF 2DA1A 4KN7X 2I10A 2V9VA 1GUUA 1P7IA 4JOMA 3H3ZA 3IV5A 4FX0A 1D9YA 3CCMI 2XX9A 1TW2A 1Z6TA 2ZNYA 4MLOA 4E6KG 2UZKA 4E70A 5F04A 3CC7I 5ICEA 5IPAA 3C31A 4GWYA 3GTOJ 2EB7A 3ASNH 5FLVA 3K0VA 5EHMA 5CYVA 4HPQA 1JT0A 4AYBA 2FOKA 5LGUA 3G73A 2P3NA 2Y7WA 1P4XA 2DMTA 2NXOA 1MW7A 2Z99A 3IB2A 2AXTC 1NUXA 3S4UA 1UHSA 2DI3A 2J5OA 5E3NA 4KFCA 3FBIB 4F7ZA 2PFYA 1KA1A 1NV7A 2Q9TA 4KYEA 2ZBKA 2A5TB 1EZ9A 4IRIA 3BZ6A 5I7IA 3M1EA 2LYCA 3EUHA 4R9GA 1YIJI 2DK5A 2O84X 4II2A 2HS5A 4KMFA 4GF8A 3CUQA 4NE4A 4WEPA 4GDFA 4ZEKA 4PZJA 3PNTA 4A3KJ 2VJIA 3EETA 4RGSA 3FXKA 4HEA2 3H6TA 2HVRA 3ZQHA 2L4MA 2NXNB 4OMYA 3KZYA 3QP6A 2FBKA 3DLLF 1FTMA 3CCYA 4R6YA 4C1UA 1HOMA 1IXRC 3GYHX 1Z6RA 3CF5F 1P2FA 3MVYA 2M34A 4P47A 4LG0A 4XXUA 2I3WA 2F4MB 1B9MA 2O8XA 1U0JA 5K7HA 4X0GA 2PCRA 5ET7A 2Z23A 2CQNA 2UVHA 2DTRA 4BDQA 2Y0SA 3ZMZA 3FASA 1XB4A 1Y3NA 5J3LA 4G61A 2VUMJ 1BKAA 3GTPJ 2IS6A 3E79A 1TWCJ 2I3VA 1MDMB 4G7OF 2QPQA 2Y30A 5C3EJ 3TELA 2LKXA 3OXNA 3KJ7A 3P9CA 3F8BA 3JAMK 4I76A 4LB5A 3PGFA 4PDDA 3COAC 1POTA 4G7HF 1R00A 3CSGA 1X19A 3WTSC 1S6LA 2W7YA 2QBYB 1MJ9A 3A09A 4KHZE 1SFXA 4NMYA 2HXRA 4NG7A 5JLXA 3FXBA 4KPTA 4O3AA 3K6GA 4IHYA 1LAHE 3RKXA 1B58A 4XEQA 5DUIA 1B40A 4QSCA 3FV1A 2K02A 1HLVA 1CF7A 2EZIA 2UUZA 4AC0A 1DTGA 1NKXA 1J9IA 2XF5A 4JB7A 4EQBA 3MAJA 3GO5A 3Q3SA 4XKCA 2VD2A 2V1DA 3IJXB 2GM4A 3EPZA 1TL8A 1NUZA 3G3ZA 3KEYA 1GT0C 2ECBA 1USYE 4XKVA 3KX2A 3G3HA 1FPLA 4HYEA 3RPLA 3CFLA 2Y31A 2VPOA 4C2TA 3M7GA 2ZNTA 3D4GA 5F0FA 1ETKA 3J7AO 2M4GA 4ASNA 2RC7A 1QVTA 4EGYA 2XAJA 3OSFA 3KN3A 3LWFA 2LDUA 5AONA 3CC4I 1II5A 1YYZA 4Y3OA 5EF6A 4ESJA 3HZJA 2DE4A 4M9SA 3QXMA 2DXIA 3H5NA 4LOCA 1QQIA 4UVBA 1R5HA 2I4CA 3DP8A 3UA8A 3USDA 1V5GA 4R2BA 1OYWA 5DVIA 4BHBA 3MKYB 2L02A 2ZO4A 5EEGA 1YS7A 1FQCA 1O63A 1KQ9A 1UTHB 2IA1A 1LFUP 1D8JA 4OVSA 4NF6B 5JLWA 4HS7A 2DTZA 1D3KA 3K70D 3BCAA 3KP4A 3FBPA 1M5FA 3I56I 2DE2A 5LBQA 2E5ZA 1ZLKA 2ZXWH 4HRIA 4UUTA 2FNPA 4OYVA 3RT8A 1U9OA 4ESWA 3CFZA 3MCZA 1Z91A 1MZBA 5FD5A 1K4TA 3G71I 2W57A 1KU3A 2QL3A 4Z0IA 3NWSA 4ZE9A 2E71A 1OPCA 1GR2A 3M3FA 4E7ZA 2XXIA 5A5LA 2WBBA 3MD2A 3CO7C 4Y17A 3HEFA 3GTJJ 1W36C 5C44J 1EU8A 2AIXA 3L6GA 5CRYA 1AMFA 1NL5A 1SFOJ 3SQNA 1ETQA 3MUQA 1QPIA 2QSFX 3BIHA 3MJNA 3RQ4A 1YIOA 2V4CA 3E1SA 1P1OA 1PC3A 2XX7A 3DPTA 3DQVC 4IY5A 3OYFA 4UY8I 1T0FA 2FOWA 3SKPA 2CWEA 3HHFA 1PYVA 1IJWC 1K78B 4PGPA 3H9QA 2EINH 2JUGA 3WHCA 1TT5B 1E17A 4G77A 4OZ9A 2NWJA 1B7HA 2JUCA 4P96A 2Y5LA 4LONB 3DP6A 4JQFA 4CCOA 2HI3A 1F9NA 5B5EC 3K02A 2DAOA 4IXAA 2P3VA 5DTDA 2RC4A 1FNNA 1O3QA 3H03A 4LK1F 2ZJPF 5FTIA 4EM2A 3W2WA 2NVTJ 3OY9A 2RDPA 5B1AH 1N3XA 4LUBA 4NQ8A 2L9RA 2UYEA 4X1DA 3ZSFA 4HZFA 3EHSA 1E3PA 3KP3A 3GFMA 2HVQA 3GCMA 3H7MA 3V83A 1MM6A 2ZXJA 3I58A 4NX1A 4DCXA 1FW0A 3EUHC 2ZJ2A 4PDKA 2O6GE 2HPIA 2D1HA 3CUQC 2Q2EA 2FMLA 2QQ8A 1B0HA 3BLYA 4PFTA 3GZNB 1XCBA 4YELA 4OQOA 5DV5A 2H94A 1E0EA 1VFEA 3QK6A 2L2OA 3OEKA 4MNCA