1HSJA

Sarr mbp fusion structure
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
487
structure length
487
Chain Sequence
b'KIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALAAAQTNAAAEFMSKINDINDLVNATFQVKKFFRDTKKKFNLNYEEIYILNHILRSESNEISSKEIAKCSEFKPYYLTKALQKLKDLKLLSKKRSLQDERTVIVYVTDTQKANIQKLISELEEYIKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FUSION PROTEIN CONSISTING OF STAPHYLOCOCCUS ACCESSORY REGULA
publication title Crystal structure of the SarR protein from Staphylococcus aureus.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription/sugar binding protein
total genus 143
structure length 487
sequence length 487
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
A PF12802 MarR_2 MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1hsjA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1hsjA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1hsjA01
1Q1KA 3F8CA 3CI8A 3IJXB 1QZYA 3FM3A 1P4XA 2ETHA 1BOAA 2VC1A 3SDFA 2WWYA 2VONA 3EHTA 1WWXA 1ZLKA 1QKBA 3FATA 5TRDA 4N0BA 3BJAA 4M73A 1T0FA 4WWCA 4POWA 3M3KA 2O03A 3O6GA 3QP6A 1B6AA 2OD5A 4ZYDA 4HA8A 1PP7U 2Z9OA 3N6TA 3R0JA 3GWZA 3R6SA 2PX1A 2HAUA 3MP6A 1LSTA 4F3BA 1MJ9A 2F5DA 2FOKA 3I5UA 1PB7A 3KGCA 1BI1A 4LB5A 3KEOA 4XSZF 1NNFA 3TTKA 5ITOA 4XKRA 4YIFA 2DXYA 2UVJA 3I59B 1Y3NA 2M45A 3OV8A 5HLHA 4QLCU 3BP8A 2DQLA 4ESJA 5F1RA 2O61A 3T66A 3EETA 4ECFA 2HGCA 4NB5A 2KLFA 1EV7A 1RUNA 3GUDA 4IXAA 3JSOA 1UQWA 4OWDA 1MDMA 5L3FA 4M74A 1YTYA 3IRQA 3C31A 3K2ZA 4RB0A 3ISPA 1QGPA 1NH8A 1BIAA 4RGXA 2I3VA 2AIXA 3C4MA 1LAFE 4PDKA 3BFUA 3PGFA 1P4WA 1LJ9A 3RNNA 1IXGA 1F5TA 2W24A 2NAZA 3S2VA 1HSEA 4NF5B 3UGWA 2Y7PA 4I2OA 4KNYA 1B51A 4AQ4A 3KJ7A 3L9FA 3ZS6A 3E4RA 1IAWA 3EHSA 2G7HA 4LFUA 2R3SA 1EH3A 3K1NA 1FTJA 3LAPA 4OINF 5CMCA 4KIGA 2DT5A 2GHBA 3CFXA 2PVUA 4FJPA 4FT8A 4MTEA 1FP2A 3TKDA 2DQVA 1R1NA 3PV0E 4Y13A 1QPMA 3N94A 1A8FA 1ZGAA 1DUXC 3KP3A 4L9JA 2JSCA 3FVGA 2B0LA 4P5OA 5TP9B 1FY7A 1ZU0A 3N26A 3U1OA 5DCFA 3KBRA 3GZ5A 2VGQA 4M4GA 4RPNA 3COAC 1IUYA 1ZIUA 3ZMUA 4DCXA 1IITA 4I02A 4IPAA 3HUGA 4I1DA 1LAHE 2YPNA 2F5EA 1NFTA 1QJMA 3GXOA 4LD5A 2CZLA 1B5IA 1MXWA 2XXWA 1VSOA 2GFEA 1YCJA 3ZQ7A 3FXQA 5JK4A 4JK1X 1UIVA 4LUBA 2P5VA 2M30A 2MH2A 1B4HA 1CB6A 3B7DA 1WSUA 1MH3A 5E17F 4GRKA 4OYVA 4OENA 4XRFA 2R6GE 1MY3A 4Z7EA 3PU5A 4IHSA 4ZE8A 3U2RA 3E9XA 5B7DA 3KOTA 3UORA 3O97A 5L9OA 1FTMA 3IJOB 4H1XA 3KZGA 1MXYA 4OESA 2HDCA 1LNWA 3H3GA 1I6BA 1ATGA 3J80K 4LP2B 3DPTA 1XGMA 2EA4A 3C34A 4HYEA 1B7ZA 4XKNA 3T9XB 2ZNTA 1MQHA 4YB5A 2I3WA 3P9CA 3CUQA 3ZKLA 2HWVA 2PLYA 3M3FA 4FX0A 4QFOA 4TLMB 5H8FB 1JEUA 3IL2A 4G77A 1B4ZA 4YZZA 2EFWA 1QULA 1QBJA 4LZ8A 3ZN1A 2XXIA 3FVOA 1I27A 1U5TA 3K69A 1LBCA 3N6UA 2ZBKA 3I5OA 2CFXA 1B1HA 3FVNA 4R2FA 3K0LA 1B5HA 2I0BA 2V25A 4KMUX 5D5VB 3K6WA 4KA4A 2QRYA 2GA2A 3GXAA 3WG9A 4G9YA 1U8RA 3CG3A 1XN7A 3AAFA 1JXSA 3RKWA 4ZEBA 2PG4A 4LG0A 4ELOA 3O6IA 3KOSA 3K9TA 2ZCWA 3OSQA 3LR1A 4I01A 3C1DA 2P6SA 2UXNA 1Z9CA 5KZTA 4QRZA 2YLNA 4WCGA 4OHNA 2VBXA 4IGTA 2Z8DA 4HLXA 1LEBA 3CFLA 2F35A 3OO7A 3HRTA 1IZ1A 1UTBB 5CMKA 5HDGA 1NKXA 2GRVA 4RXLA 2RVCA 1WRJA 2FMLA 5LHIA 3TQWA 3MVWA 5AA2B 1AH5A 1DTGA 2Y0MA 4P0GA 3B02A 3KP7A 1ZHFA 4X9TA 3RY3A 3BJ6A 1OYYA 2DYXA 2F36A 4ZH4F 3CSBA 1YPNA 1U78A 3HSRA 3OSRA 5H8QB 3H03A 2DK5A 1MXZA 3N5LA 2V1UA 1G3TA 2UWMA 1OKRA 2UYEA 2FEZA 2DTRA 4XKPA 2FNPA 4BHCA 1GVCA 2IW5A 5D5UB 5BWJA 4HBLA 1IXRC 3MZBA 1R5GA 2G93A 1R00A 4ZEDA 4TOZA 1QZZA 1G4DA 4IO3A 5DEXB 4PFYA 3BZ6A 2QLZA 4HAMA 2IA2A 3ABUA 5DCMB 3ML6A 3R0AA 4L5JA 3T1BA 3ZN0A 1OLAA 2V3QA 1E17A 1SFXA 2DQRA 3VODA 4N6PA 3JTGA 1P1NA 4FHTA 4KCDA 4PQJA 4ZEKA 5M2VA 3NEUA 3LSWA 2QYOA 3IOTA 3TTNA 4NHJA 4EM0B 3JAMK 2GH9A 2XHDA 2I58A 3TTLA 3UK4A 2QS1A 1FQFA 1ZMGA 4GL0A 3THIA 3W6KB 4L0ZB 1FW0A 2H98A 1S7AA 2K27A 2Q0OA 2DWJA 1ZTYA 1GV8A 1YS6A 3IB2A 1M5EA 3F23A 4IF4A 1VTNC 1K79A 4RGSA 5EYFA 4YG2F 3KP6A 3R61A 5FHMA 2ONRA 4ENJA 2JPBA 1GVJA 2VE8A 5IT3A 1JVXA 1M5CA 2HQNA 4OOIA 3ONMA 1ZLQA 4KQPA 4AIHA 2DLLA 2L54A 4S05A 5E1XA 1F9NA 1EH6A 1TFAA 4F3PA 5EHSA 5ILUA 1RYOA 4IJAA 2D5WA 3E5UA 3QRFF 1VE4A 3QUFA 3IL1B 2VBYA 1W4MA 4G94A 2ISYA 2P2AA 5HOOA 4X48A 2HKOA 2KKOA 2EJRA 3ELKA 2H4IA 3FVKA 4Y17A 3WGGA 2CO5A 4ONYA 1FSHA 1HSJA 5EEGA 3BY6A 3KZZA 3GYHX 4TV7A 4A6DA 4RK9A 4NMYA 3UIFA 1YQAA 1ZN2A 3OOAA 3VOEA 4EF1A 2ZYOA 3C33A 4EUOA 2UVHA 2DW4A 2DO7A 1MDQA 2REJA 3RDIA 4DXCA 3HTSB 4XLPF 5I57A 3B73A 2HKXA 4HV5A 4KN4X 4UUVA 4DIGA 3PUXE 3SKPA 2XXQA 1Q1HA 4OMZA 1MPBA 4EMSA 5CVUA 3R26A 2Z3YA 2O51A 2LNBA 1JETA 4A2UA 4U7DA 2HCAA 4YFXF 2CMOA 3H06B 4AB6A 2QVOA 2QZ8A 4KYDA 2VD2A 3TEPA 3VXBA 3Q9VA 1F4KA 1USYE 1SD3A 2O6AA 2XKOA 5I59A 3E6DA 1LLSA 1S7YA 1OVTA 1BIBA 2XGXA 4E70A 1JW4A 2GAUA 5DVIA 4X1DA 1XD7A 3S4UA 1TNTA 3F8NA 4OIPF 1B7HA 3HN0A 4OIQF 4KYSA 4CHUA 2FBIA 4M9ZA 1LCFA 2DE4A 2DK8A 1Y0UA 4TQUQ 1R1TA 2F7CA 3GW2A 4G7ZF 1V3FA 4B09A 1MM7A 3RUMA 3M8EA 4EJTA 4I98B 1T2KA 1HW5A 1UHWA 1KGSA 4GYGA 2F5XA 1BN5A 1REPC 1B40A 3MAMA 5DT6A 2AS5F 1DMBA 3M7GA 2P6TA 2XHKA 2HFHA 3HIFA 5I84A 5H8NA 4I0BA 4BHBA 4Y15A 1LAXA 3CVGA 2OK2A 1FQCA 1YW7A 1B9MA 3KE2A 4GXAA 1T6SA 1P2FA 2CGPA 2L01A 1I69A 4G68C 4U0YA 4Q30B 5DD4A 3TOBA 4F2OA 1RZ4A 4ZYEA 1A54A 4A6EA 4F7ZA 3V8JA 2NWJA 4OXVA 2XXXA 4GD5A 2QS2A 4RNSA 4DZ1A 2FSWA 2HZLA 3LAJA 4D0PA 4YKKA 3L7WA 2RINA 3L09A 4POXA 3J80Z 5BS6A 4KHZE 2F7BA 1N0TA 1FCKA 1XOCA 2XXVA 1FT9A 4GXSB 3U1DA 2XASA 3VLWA 3RGYA 3RJPA 2H5YA 4THIA 3U72A 4QWQA 4O3MA 1FTOA 4ASNA 5CC2A 2DVZA 1MD0A 1ZYRF 1BI3A 1NNPA 3LUYA 1ZRFA 4HX7A 3QSLA 3HSEA 3FF5A 2RQPA 3V7RA 1FPQA 2W7YA 2VN2A 5ICEA 2IP2A 4H8IA 3JSPA 2KRFA 4F19A 3K4UA 5I2NB 1FYKA 2IPQX 5B70A 1MRPA 4F29A 3O29A 4DDDA 4KIFA 2DE2A 4ZZAA 2O1MA 2FQ3A 1LBBA 4JXIA 3ILTB 1D4NA 2D3IA 3TUSA 4WK8F 5LBQA 4KICA 2H6BA 1B05A 4GQOA 3S9MC 1USYH 5IT9Z 3RN8A 2GIVA 2IJLA 2QMWA 3HHFA 5KVRA 2RN7A 3N97A 3KSXA 4R74A 3HYIA 2Y84A 5LGNA 4U4XA 2VT3A 1QO0D 2NS0A 4R1HA 1FX7A 3VVFA 1ZGJA 5FGMA 2ZO4A 4FE8A 3FXUA 1URDA 1B0LA 4L9NA 1Y4CA 1ZAOA 3H6TA 4O3BA 1H43A 5CLSA 3KP5A 1CGPA 5FHOA 5FTHA 3OENA 3MPLA 5E8IA 2KJCA 2R9JA 5I56B 1IXCA 1Z6RA 4EXLA 1R7JA 1O63A 2DI3A 2FXAA 3ZPLA 1N3XA 4MQ9F 3HRMA 4H67A 4U23A 3H6WA 1BP5A 2OQGA 4G68B 5HBCA 5CVVA 4RAZA 1QNTA 1P1WA 4R73A 3PUYE 1XHYA 1MZBA 4IRHA 4OIOF 2P5KA 3FHZA 3E97A 4ZE9A 4LATA 5AONA 3G3HA 3G3IA 4GO1A 1KQ0A 5J8CA 4YB7A 4MEYF 3IWZA 1SDXA 1ZLJA 2OWTA 4L18B 2K4BA 1FTKA 2Z99A 2W84A 1MJAA 2DWHA 4XBFA 1PP8F 3TMGA 1ZRDA 3I53A 5LRSA 1VFEA 3C36A 4UHTA 1USSA 5JI6A 2L3DA 5L3BA 2DOJA 4DLDA 4U0VA 3I59A 5L3EA 1MDP1 3LA7A 1UTHB 2I49A 2IA1A 3IKVA 1WODA 3QOPA 3EN3A 3MBPA 3WAEA 4CO8A 3DLNA 2E0SA 3D5LA 4R6YA 3RTWB 1LEAA 2ONSA 2XXRA 2P7CB 1NHAA 1G3YA 5DDGA 2J5PA 1KU9A 3SZPA 2KJBA 1OQHA 2EFQA 1DOTA 2UVIA 1US4A 2XX9A 2A6HF 5K5RA 3FXRA 1F9BA 4QFLA 3JAMZ 5CVIA 4OMBA 1B9JA 3MVZA 3T9UA 4EJVA 2V3TA 5DV5A 3KEIA 3H4ZA 4MLQA 2VOPA 3T93B 1ON2A 3TOAA 4WXHA 4BNCA 3TCFA 2I48A 1XVXA 1MY0A 1N84A 4MGRA 3I6VA 4NF5A 4LLGF 1IW7F 3M8UA 4ISUA 4OFLA 3MJNA 3VVEA 2ELHA 4KFQA 5AA2D 3KN3A 2XAJA 3A3CA 3K1MA 3P7IA 3KLNA 1YTVA 1B7UA 5KDTB 2JTVA 1D9YA 3SFZA 4CDGA 3TO6A 4KI0E 1TW2A 3W9WA 4PFTA 1LCTA 3FJMA 2V93A 1RUOA 4HDVA 2B3FA 3HHHA 5BOXA 1HW1A 4OTEA 1MXUA 4XKQA 4AIJA 4ZYHA 2YJPA 5LLQA 3QPTA 2ZYKA 4HF0A 2CG4A 2QS3A 3BOQA 1KYWA 1N7XA 4UVBA 1IEJA 2QS4A 3HTUA 1O3TA 4U7BA 3OEMA 3T5XA 4RAYA 2Q8JA 2GZWA 3HV1A 1MJBA 1S50A 4GFRA 2QQ9A 3M8FA 3IRRA 1RIOH 3PQKA 2H27A 1US5A 4MFIA 4OQOA 1BTJA 4R2BA 1G3SA 1KU3A 3LA2A 2O1LA 4QFKA 4P55A 4OFJA 3SESA 4MTDA 1IQ7A 4BH9A 5CI5A 1WKMA 2KIMA 4KD5A 4UA8A 3VVDA 3PPQA 3TELA 4LQ5A 5FD5A 2COMA 3V4GA 3IKTA 1WQ2A 4EQ9A 2LSOA 4M71A 4F1VA 1PDAA 3RYRA 1O7LA 3FX3A 3WODF 3BKIB 4PCQA 2ZXJA 2R71A 1XSXA 1Z1DA 1T39A 2K4JA 2HTJA 2PEXA 4BDQA 3T8RA 4A0YA 4CXFA 3KJTA 2LF7A 1P1OA 5JVTA 5HDKA 3LQQA 3FGSA 2H25A 3MZ1A 3E6CC 1HXDA 4G8MA 1R9LA 1ZG1A 4NQWA 5BQTA 4BDLA 2IA4A 3D4GA 5H8FA 2ADUA 4G8XA 4WKMA 3F72A 2BV6A 2VBWA 1PBPA 4YIIA 2OAZA 1SD5A 3OMBA 4M9SA 4YKIA 3HRUA 3PPOA 4A5MA 2THIA 4P11A 5FLXK 1TW3A 2TDXA 3OOPA 1XT8A 4EJWA 3E6BA 1A40A 3D0SA 1NNKA 3V89B 4IO2A 1T38A 2FA5A 2EFOA 1MG1A 1S7OA 4NF4B 3IO4A 3ROUA 3PPPA 2XXYA 5BUUA 2OU2A 2A07F 4OFOA 5DYMA 4CICA 4H0WA 3HCQA 3FUZA 5I58B 3USDA 2DP8A 1GXPA 3NQOA 5LHGA 2DS9A 4FATA 1GGGA 5K5QA 1IRGA 4G8HA 3V5AA 4XSXF 2FA7A 1B58A 2XX7A 2F97A 4QF9A 2XXHA 2A6EF 1WI9A 2L02A 2QPQA 1Y3QA 2GHAA 3F8FA 1A8EA 1W5SA 1OQGA 2XXPA 1M5BA 4E0WA 2Z22A 1UTBA 5J6XA 4ELQA 1RI7A 4BAYA 3EF7A 4IY5A 4QSDA 4LJZF 3F22A 4I7HA 5IT9K 4HX4A 4OEUA 3WU0A 2ZYNA 2XV4S 5JHUA 5AA2A 1A55A 3DELB 2CQKA 5AE4A 3DEUA 1S29A 4IO5A 1IN6A 1CF7A 3PD9A 2I6EA 1D8KA 4RK2A 1TXFA 3QPHA 3ZMTA 5H8QA 4JSDA 1FWZA 1RYXA 1R1VA 5JR3A 2RC7A 2H94A 2OJTA 4RPOA 1HKQA 2OA4A 1TQMA 3ULQB 1D8JA 3S9NC 2YU3A 1XGSA 1SI1A 1XSVA 1NNTA 4PFWA 3IWFA 2DPUA 1Z91A 3OO8A 2D2WA 1ANFA 1BLFA 2A5SA 2CSOA 4ETSA 3HSTA 5ILVA 2CWEA 2XXTA 5DEXA 2F8DA 4JWYA 4HF1A 2FU4A 3RPUA 3TODA 5DCMA 3IB1A 4XXUA 3P7NA 1B52A 4C1UA 3QU6A 3SQNA 3Q29A 2V9VA 4LVQA 5ITPA 5FFXA 3B6TA 4GCVA 4U21A 3QXMA 1L3LA 2Z33A 2B65A 2E1NA 4GVOA 3MAJA 3MW0A 4H65A 4DXUA 2ACJA 2WKYA 1W7PB 1USTA 1YLFA 3VDFA 1DPPA 1SW1A 3WTZA 1OIBA 2Z8FA 4HW0A 3C3WA 4U1OA 1FQDA 5HLGA 4ESWA 3IB0A 5KCJB 2BYVE 3OXNA 3QIMA 5CM6A 3MWMA 3FIRA 2O68A 5L9MA 4NE4A 3GEZA 1K7AA 5E20A 5ICGA 1ODDA 2MC3A 3CJNA 1J9IA 1B4AA 1BC7C 1T0KA 4EF2A 2DU9A 1P6RA 3EYYA 1UB9A 3GFMA 1K78B 5D4RA 3WU1B 4IRIA 3C32A 3N4MA 3TPAA 4JDFA 2UZKA 2STWA 4OETA 3IOUA 1Y9UA 3Q26A 4WXCA 1F1ZA 1OVBA 2OZ6A 1AIVA 1SW4A 1OPCA 3KLOA 1ZH5A 1POTA 2NNNA 1N3WA 5D6EA 4HW8A 4GGGA 4F18A 2PQ8A 4UV9A 4UACA 3ZMVA 2P8TA 3H3ZA 1YG2A 4FEBA 3MQ0A 1EZ9A 1B6HA 2QUFA 1BM9A 5H8HB 2NNYA 3DF8A 2PBIA 4PFUA 5E18F 1XVYA 1SFEA 1Y20A 4YB6A 5L3CA 4I62A 1G6NA 3T9HB 2D45A 1ZG3A 5FD6A 2HFBA 2NYXA 1XDSA 3FASA 1IXHA 1FSEA 4BQAA 1H0MA 1FYLA 4BDOA 5TJJA 1LFHA 3W15C 1UIUA 2RCAA 4DXBA 1W5TA 1RKMA 4KDPA 1OR7A 1LDKB 2FE3A 1YW9A 1FLIA 2FNCA 4NTLA 4P9FA 2UYFA 4UXNA 5JTYB 5LGUA 4P9UA 2DVCA 5CVRA 3A3UA 5FHNA 3K6XA 1WDNA 1J2XA 3BWGA 2PT1A 3K00A 4R9GA 2VP1A 1MH4A 4R6KA 3FJ7A 2PMHA 4WEDA 3FMSA 4ESBA 2ISZA 1QVSA 3ZMZA 3E5QA 4RB1A 2E7XA 1L5TA 3DXJF 5CJ9A 2XKPA 1IUDA 1D3YA 3GVAA 2X7QA 5LOMA 2ZNUA 4RA1A 4O3CA 1I6AA 2W57A 1B3LA 3FV2A 1D3KA 3MP1A 2Y75A 2VC0A 1HKSA 1PEBA 3HPIA 1SW2A 4RY1A 3MPKA 3GLBA 4AB5A 1C0WA 2BGCA 2F5FA 3EPEA 1OMIA 3I58A 2HEUA 3V8LA 2L4AA 2ZYMA 2V3UA 3K2DA 3FD3A 2VBZA 4XLNF 1Y1MA 4Z2YA 4Q8RA 4NF8B 2GWRA 5J1DA 1MKMA 2Y48A 4NWCA 3OO9A 5EEHA 2XD2A 3TO7A 3L6HA 4ON0A 2IVMA 3DV8A 5D5XB 1E2XA 3H6UA 4E0XA 4RB3C 4YICA 1ZBMA 5CMBA 5DTBA 2X26A 3G3GA 2V6CA 3CSGA 1UCRA 5LEKA 2HOEA 2YSRA 1MM6A 4KUMA 1KU2A 4GF8A 3ABTA 5AIPA 4AIKA 2F6PA 5D4SA 1P1UA 3FMRA 1EH8A 3ZP5A 4WX9A 3OD7A 2HXWA 2HZKA 4NF6B 1JEVA 1AOYA 1DPRA 2L4MA 3LQRA 5ELVA 2QM3A 4YKPA 4WXJA 4KMFA 4DCYA 3I0TA 5E1WA 2D1HA 3ZMSA 3BPXA 5H6RA 1XSDA 1TQPA 3F6OA 2PJPA 4YAHX 1SI0A 1OMPA 2M8CA 2UVGA 5F6FA 4ENMA 4HTGA 4L5IA 3KP4A 3WTSC 4HS7A 2P5LC 3O28A 3ILUB 1DP7P 4BDNA 4KT5C 2M8EA 3HHGA 2ZFWA 2Z8EA 2PYYA 4PGHA 4OMYA 4JBZA 4BXUA 3H3UA 4FX4A 3DP4A 1SYHA 3MWBA 5DEQA 3KN8A 4KCCA 3HRSA 2PBWA 4QFPA 5HS9A 2XAGA 1R1UA 3IK6B 1MPDA 1KQ9A 4M72A 5CRYA 4PZJA 1YFHA 3RYPA 2RKHA 1QKAA 1UHMA 1MGTA 1I1GA 1B59A 3C7JA 1TQIA 2PMSA 1URGA 1D5VA 1R36A 5FLXZ 1O64A 3J81K 1DPUA 3QAHA 5I2NA 3VLUA 3KETA 3FZVA 3U93A 4ND9A 5HS8A 3A09A 3ECHA 4KN7X 1XGNA 4ZZLA 1VR5A 3MCZA 1ON1A 2CW0F 3B6QA 1BI0A 4BDRA 5ERIA 1EH7A 5ICCA 3BPVA 1MY2A 4FECA 2F2EA 2UXAA 3ODBA 4C0RA 3KFMA 1Q35A 3PUWE 3QU3A 2MA3A 2W25A 3PUZE 3E5XA 4AWXB 2MH9A 5A5XB 4JSOA 3RPWA 3FMQA 2DE3A 3TYHA 1O3RA 2HQRA 1DTZA 1TFDA 3P9KA 5I56A 3C18A 1N7WA 3MEXA 2ESHA 1KQ8A 2DSFA 2MLKA 2VODA 1SMYF 2LDUA 1U3EM 4MNUA 4ELRA 1IRFA 4MF3A 3CFZA 4G68A 3KCCA 5BMZA 2XRNA 4KIBA 4MEXF 2OZUA 4DNCA 4KFCA 5DYHA 4EDPA 4HDUA 4U22A 4EXKA 3CO7C 2VT2A 1OLCA 4H5GA 1J5YA 4YFNF 2Q2AA 2QBYB 2P0SA 4EJOA 3SEUA 3B6WA 4HV6A 2OCUA 4CGZA 2R7DA 2WV0A 4MH5A 1EZOA 1B3GA 1CE2A 3IOWA 5ICQA 1JNFA 3WTWC 2RCBA 3TCHA 1RNLA 5FTIA 1O3QA 1A7LA 4FORA 2V1XA 1UTHA 3BDDA 2GA1A 4EV0A 3CUOA 1XDUA 1HW2A 3IOVA 5CBSA 1A04A 3KN7A 2HQ0A 4L9VA 1H3DA 2LF8A 1LFGA 3PMXA 3HSFA 1YO5C 2OBGA 3S9EA 4XIGQ 3TFLA 2A5TB 2MLGA 2H9BA 5AA1A 3VE1B 2M1BA 3LA3A 4ZZDA 3RPQA 4ZZEA 5TPAB 1O57A 2ZMEB 1DSNA 4PP0A 4AD9A 3RT6B 3U92A 5I2KB 1PDNC 4U88A 5FB2A 2DXRA 2A68F 1PB8A 4GIZA 3SEVA 4LLLA 4EQQA 2AL5A 2ZNZA 3O6HA 4ZS9A 3EYIA 1IN8A 2IA0A 4AVPA 1IXSB 2M5WA 3TQLA 2VHAA 3H7MA 3DP8A 4OEVA 1NL5A 3RT8A 4LGWA 3F11A 4Q47A 5HS7A 3T96B 3QP5A 2P7VB 4NEDA 2D21A 4IO7A 5AA4B 1LB8A 5LGTA 4U1ZA 2YR2A 3RI4A 2EFPA 3Q25A 1VFDA 1IIWA 2K86A 3PFIA 4IO4A 2PMUA 1FTLA 5KDTA 3K0VA 3TGNA 3JV9A 1R58A 2RGVA 4PE5B 4MHGA 4GXOA 3VB2A 3WGHA 4EJUA 4KPTA 1Y4TA 2F78A 4FIMA 4L0YB 1ZREA 4H5FA 3T8TA 2M87A 2WTEA 3M1EA 1B1XA 1FQBA 1IN4A 5ED4A 3EHUA 1LAGE 3GZGA 1GXQA 4GWOA 3V7CA 3WGIA 3SETA 4RS8A 3KG2A 3OEKA 2V84A 2I4CA 3UA8A 2HAVA 4JB7A 1H9TA 1LDDA 1AOVA 3W6JB 4UV8A 5TP9A 1SYIA 5AA3A 5HDNA 3G3JA 2H09A 4Q0CA 4LA9A 4MQVA 1AL3A 2B3BA 5D8KB 3K6UA 4YMAA 1B9NA 5FO5A 3PMWA 2X4HA 4G4PA 1P99A 4P96A 4QSCA 3VLVA 3VXCA 1U2WA 1W7PD 3BROA 1QUJA 1MDMB 4GOTA 4ZDMA 2DFIA 1AWCA 4YKJA 2OBPA 3SEYA 4F3GA 1P4AA 3CUQC 2G7UA 3I71A 1O7FA 3TO9A 5DUIA 1II5A 3V8XB 2QENA 4ENKA 3LWFA 3G3FA 1TWYA 1J7KA 2ESNA 4MBPA 1Z7NE 1PB9A 1U5TC 3DFGA 2NVUB 1BIYA 3TZAA 1TTYA 3PUVE 3Q9SA 2EK5A 1L0OC 2KIFA 4CYDA 5DVJA 3BFTA 4EM2A 3BBRA 2EWNA 1XCBA 3KEQA 4O6JA 2FYIA 3F3XA 1Z6TA 2FNAA 4HF2A 1GHCA 4L9TA 2XD3A 3FWEA 1Y1ZA 3LSXA 1U6GA 3DM0A 2EV6A 3DPLC 3LC8A 2KIUA 3Q28A 2LKPA 3JYRA 4NF4A 1EZPA 5ICTA 3EDPA 2Y7KA 3GF2A 2QJEA 2O3FA 3MC2A 1MXXA 5FFZA 1JE8A 2ZNSA 4MLVA 4YU0A 5AIQA 4N9IA 4A5NA 1ZJLA 4EM1A 5I58A 5LEJA 2V79A 1IN5A 2P4WA 4P0IA 1LQ1A 5K2YA 3F8MA 3SZTA 2Y7IA 4M1VA 4EGZA 3MVXA 3K6VA 3AXFA 1XB4A 3U8QA 2WC2A 4HX8A 3CG1A 3SEWA 1XMKA 3IC7A 1ZARA 3GBBA 4IY6A 3GX4X 2I0CA 5ILSA 3IO6A 2O7UA 2FF4A 2R7FA 3GFLA 3KZYA 2EV5A 3JZJA 2VXZA 5DVFA 2JPCA 1H76A 1LFIA 1S3JA 2GXGA 5L3GA 2ZMBA 4XTCQ 3VV5A 3MUQA 3SERA 1BBYA 1ONVA 2JT1A 4JBAA 1WVJA 4KR5A 1I1SA 3H92A 1MQGA 3TTMA 3LSTA 3VFZA 4ENNA 4NWDA 5CBRA 1JQFA 1R23A 1K6OA 3MP8A 1R6ZA 2W85A 2O7IA 3OELA 5L8DA 1XCVA 3G3KA 3R6UA 1NMUA 2AL4A 3CUQB 1B0HA 3FJGA 3WTUC 3KFWX 3LSFB 1KU7A 3RTFB 4GYIA 3J81Z 1SD6A 1B1BA 4R79A 4IO6A 4FAJA 1MY4A 1U5TB 1XS5A 2E1CA 2QQBA 3SEXA 4A12A 3DP7A 3IAZA 3TCGA 2Q9TA 3ERED 2MD5A 1JW5A 2BJJX 1T98A 1SMTA 1SFUA 2XXUA 2Q8KA 2HYFA 2NXOA 3G3ZA 2BBYA 5BPIA 4LK1F 3DQVC 1FBQA 5E1ZB 2VOZA 4LZ5A 2XROA 2AXLA 1TT1A 3NRVA 4U0WA 1POY1 4Q5TA 4RYAA 1W7PA 5D5WB 1M5DA 3I3VA 1HBXG 4G8NA 4LG0B 1SBPA 3T22A 4UVAA 3M9AA 5KCJA 2FBHA 4ZYGA 3QK6A 4IHTA 4JQFA 2BE5F 4HOBA 4RB2C 3PPNA 1PUEE 1YIOA 3RTRA 2RC4A 3FM5A 1CF7B 4ELPA 2QWWA 3L6GA 5HVQC 4F39A 4HQEA 3K02A 3C9HA 3P9IA 3EUHA 3TTRA 4OZ9A 2Z5UA 2XIGA 1K78A 3TDZC 3G7WA 1ULYA 3J7AO 3Q27A 2YPRA 1IXIA 2F6GA 2IEEA 3JW4A 3RKXA 4TLLB 1FQAA 5CVJA 4C1TA 3ZSFA 4ZECA 4RGUA 1FBUA 5A2QZ 5BPDA 3S9LC 1GTKA 1LGBC 3IR1A 1B32A 2AYSA 4KYEA 4U2RA 5CYVA 1MS7A 5H20A 1G3WA 1JVYA 1FBSA 3MFKA 1URSA 3LSLA 4ESFA 5E8GA 1MY1A 3F21A 2DBBA 4A0XA 5H8HA 2K02A 1O7TA 1KA8A 2G9WA 3KSJA 4N07A 4LONB 4GL8A 4IB2A 5K1YA 3TAJA 2VD3A 5L9SA 5IKBA 1B3FA 2ZXTA 3O66A 2RNJA 4S04A 5HLIA 3K01A 3PMVA 1FOKA 1JHFA 3U9GA 2RKMA 1BC8C 1R22A 4G6DA 2FMYA 2XUBA 3VEPA 4Q5SF 1TLHB 1B2HA 3FV1A 4R9FA 3QYTA 1Y3PA 5CMMA 4Q48A 2ONKE 4F1YA 5JTYA 4HCYA 2Y7RA 2MBFA 2DPDA 3V8KA 1IF1A 1JHHA 2HEOA 4BLAA 4R8HA 1H45A 3ECOA 1Z7ME 2RV8A 3O3KA 5DD8A 3TDJA 1FYMA 1EU8A 4QSEA 5ISUA 2OZZA 3D4CA 3V7SA 1PC3A 2A5YB 5LRRA 2IT0A 3MVYA 2JZYA 4HQMA 1SW5A 4N9HA 2Q89A 1XGOA 3MQ9A 2NRAC 4EQ7A 1R9QA 1LDJA 1AMFA 4F3SA 3L00A 3REOA 1TNSA 2HZTA 4YMBA 4QFNA 1HKTA 2A3SA 4NF8A 3WE3A 5J8FA 3CLOA 5H6QA 1B46A 2G29A 3GFJA 2RC8A 3W9VA 2ZJ2A 3PPRA 3HO7A 2E7WA 5D8LB 3CRBA 4LMYA 2UXXA 2C6YA 1ZKBA 2FRHA 1I6XA 2E1SA 1M5FA 2STTA 1FZPB 1P1QA 3RIRA 2Z23A 1Z7UA 4PETA 2VE9A 1SD7A 2RC9A 3R7XA 5JEIA 4UVCA 1I5ZA 2Q2CA 2QSXA 3EQLF 2O84X 4H6DA 5F1QA 3ZKKA 4NF6A 3PD8A 3MZ9A 3O9PA 2J5OA 1QUIA 2XVCA 3T9VA 2ALUA 2EFNA 3O2PE 3WTVC 1YAEA 3K1PA 3OO6A 2A61A 2VOOA 1ELJA 2O69A 4HLYA 4IRGA 2EV0A 3JTHA 2Q2EA 3R60A 2XX8A 5I57B 4WXDA 4OERA 1STZA 5JFRA 2PI0A 3ECRA 1N04A 1FNNA 2ZKZA 1MQJA 6PAXA 1B5JA 1DPEA 5LHHA 4G2ZA 1H44A 4GLIA 5L3DA 2NOOA 4G6QA 3SHFA 1OYWA 1QQIA 3M3LA 1B3HA 4O5VA 5DUKA 4LZ7A 4EGYA 1FP1D 3E3KA 1KYZA 4F1UA 4B8XA 3EQ1A 2DWIA 3GFIA 4EVIA 4I0AA 4WEPA 2YX7A 1XMAA 1LVAA 3SXYA 2Y7WA 3CTAA 1A99A 3E3VA 4YFKF 5I59B 4U4SA 3UN6A 4M6YA 4UNOA 2HS5A 4DQ2A 3E13X 3PQJA 4R72A 5HPQA 5F7VA 1UFMA 3ZMDA 2X0LA 1N76A 3U94A 3H6VA 4LQ2A 4WF2A 4M6XA 4Z0IA 2EB7A 4ZEFA 3I4PA 2PFBA 3T0YA 1J0RA 1Z05A 2DAOA 2HYGD 4Q4ZF 4QHQA 2HTSA 1B3EA 2PN6A 1QUKA 4R6HA 2ANJA 2NUVA 2GXBA 3S2WA 2D1VA 4OIRF 1ZRCA 2QQAA 3LBSA 5EHMA 3GO5A 3WAFA 4OVJA 3F8BA 3MZYA 1S8NA 4N13A 3UP9A 1QW0A 4H8JA 1SQYA 2I4BA 1MXVA 4JWXA 2A69F 5A5XA 5H8NB 3IORA 4ESXA 1I6QA 3I54A 4G7OF 2QL3A 3HOSA 4RGRA 4A0ZA 2K7LA 2OWSA 1BI2A 4LK0F 4LB6B 3R4KA 3WTXC 3KP2A 3GZ6A 4RJZA 1SAXA 1S9TA 2QMXA 1FQEA 2X7PA 4LLNA 4PGGA 5KK1A 3I64A 1NH7A 4HCWA 1J1NA 1O3SA 2F34A 5TU0A 1MQIA 4BYYA 1MPCA 2ABHA 2P1SA 5K2XA 1J59A 4R75A 1KWHA 4O3AA 4I9DA 4I8CA 3F6VA 2Q88A 1BJAA 2JRTA 4BHPA 2XAHA 1YW8A 3DKWA 5HM4B 3TKYA 3VFJA 2OQRA 3RLFE 1TBXA 5F64A 3O6BB 3CDHA 1P92A 3IHUA 1FC3A 1PBQA 4F31B 2CYYA 3MZHA 2QBYA 1JW1A 4IGRA 4G7HF 2O0YA 4H0EA 1S6LA 3GLXA 1HSLA 4ZEIA 1OYIA 3E6MA 1D9VA 1IN7A 2YX4A 1J75A 2F5CA 2RDPA 2H99A 5ICFA 1YS7A 3LFKA 3QAXA 5K5OA 1HSTA 4HZFA 3WE2A 3Q5FA 2GQQA 3CR9A 2XAQA 1SD4A 5A2QK 5D6FA 2EA2A 4IVNA 3TDUC 4K2EA 4JWOA 3CO6C 2LAOA 2A5TA 2H6CA 3C35A 3GBAA 3WTYC 4X1BA 3TQNA 5TPAA 3IX1A 4F22A 2XAFA 1HQCA 4K3FA 4EQBA 2ZMEA 2ZNYA 1ZG5A 4F2QA 1LB2A 4DE8A 1GR2A 2IRFG 1X3UA 5I2KA 3V83A 1BKAA 2O6GE 2DWAA 2RF1A 4I09A 5IAIA 1MQDA 2BEOA 1V4RA 3DP6A 3WTTC 3G73A 3RQTA 2HR3A 1XC1A 1JGSA 1YYVA 4BDMA 3HOTA 5H8SA 2V1DA 3BJOA 3O2AA 2O8XA 4CZZA 3CIJA 1H9GA 3QUJA 3L2CA 3RKYA 4KYWA 1LB9A 5AA4A 2FBKA 4OU0A 1R5HA 2REGA 2F7AA 4FEDA 1SVXB 1DDNA 2OLBA 2PT2A 4L17A 4M9XA
chains in the Genus database with same CATH superfamily
1RR8C 2CH0A 4V2GA 1Q1KA 3F8CA 3CI8A 3IJXB 1QZYA 4NNJA 1QPIA 3FM3A 1P4XA 1SVMA 2ETHA 4P1WA 4GRIA 2KR0A 4NHBA 1BOAA 2VC1A 1YITI 3SDFA 2WWYA 2VONA 2EH3A 2X6XA 3EHTA 1WWXA 1ZLKA 1FPDA 1QKBA 3FATA 2VQLA 2M3AA 4AC0A 5TRDA 4N0BA 2VKDA 4OWRB 3I4NJ 2EINH 3BJAA 4M73A 1T0FA 5BNGA 4WWCA 4POWA 3M3KA 1XG1A 1VI0A 3BTLA 5ET5A 1Y0NA 2O03A 3O6GA 3QP6A 1B6AA 2OD5A 3CC2I 4ZYDA 4HA8A 1PP7U 2Z9OA 2K9SA 3R0JA 3N6TA 3GWZA 3R6SA 2PX1A 4XKWA 2HAUA 3UNGC 3MP6A 1LSTA 4F3BA 4BQOA 1MJ9A 2F5DA 2FOKA 3I5UA 1PB7A 2CV0A 3KGCA 1BI1A 4LB5A 3KEOA 2BVLA 2Y9YA 3HBLA 2M9HA 4XSZF 4Y52J 3IP4B 1NNFA 5ITOA 3TTKA 3GYYA 4XKRA 4YIFA 2DXYA 2UVJA 3EUAA 3I59B 1U8BA 1RRJA 1Y3NA 2R7OA 2M45A 2RREA 3OV8A 3OYBA 5HLHA 4QLCU 3BP8A 2XXKA 3OYNA 2HVRA 2DQLA 4ESJA 5F1RA 2O61A 3T66A 3EETA 4ECFA 2HGCA 4NB5A 1D1BA 2KLFA 1EV7A 1RUNA 2VUMJ 3ABKH 5J1YA 3GUDA 4U87A 4IXAA 3JSOA 3TW7A 4A3DJ 1UQWA 5FROA 4OWDA 4MLOA 4QXDA 1MDMA 1M1EB 4CZCA 1AKHA 5ET8A 5L3FA 4M74A 5GAGJ 1WI3A 1YTYA 3IRQA 3C31A 3K2ZA 4RB0A 2M4GA 3ISPA 1QGPA 1NH8A 1LBVA 1BIAA 4RGXA 2I3VA 2AIXA 3C4MA 2M0MA 5LDZA 2ME0A 4UABA 2JVGA 2M8GX 1LAFE 4XM3A 4JX4A 4PDKA 3BFUA 3PGFA 1P4WA 1LJ9A 2QA4I 4G61A 3RNNA 2HPGA 1IXGA 1F5TA 2W24A 2NAZA 3S2VA 1D1AA 3CCVI 1FBEA 1HSEA 4MAGA 4NF5B 3UGWA 1ZK8A 4I2OA 4KNYA 1B51A 2Y7PA 4AQ4A 2L2OA 3KJ7A 3L9FA 4ANJA 3ZS6A 2EZLA 5DM7F 1LUJB 1IAWA 2JQ7A 3E4RA 3EHSA 4XLFA 2G7HA 4LFUA 3HL2A 2OTJI 2R3SA 1TWGJ 3BC8A 1BR2A 3G71I 4XKBA 1EH3A 3K1NA 4NC6A 4MMPA 1FTJA 3LAPA 4OINF 5CMCA 3RPLB 3DU5A 2DT5A 4KIGA 1NV7A 3AG1H 2GHBA 1OCPA 2PVUA 3CFXA 4FJPA 1GLNA 3CCLI 4FT8A 4MTEA 1FP2A 1UMQA 3TKDA 2DQVA 4HPQA 1R1NA 3MZ8A 3PV0E 4Y13A 1QPMA 1UELB 1IRXA 3N94A 3BIHA 2BY2A 3K4MA 1A8FA 2XAUA 3RPUD 2WAEA 3FBIB 4S0HB 1ZGAA 3CZ6A 1DUXC 3KP3A 4L9JA 2JSCA 3FVGA 2WV1A 2B0LA 5KNLA 2VPNA 4P5OA 5TP9B 1FY7A 1ZU0A 3N26A 3U1OA 3A29A 5DCFA 1YIJI 3KBRA 3GZ5A 2QKMB 2VGQA 5F1JA 4M4GA 5GTHC 4RPNA 3COAC 1IUYA 1ZIUA 1RR7A 3ZMUA 4KISA 4DCXA 1IITA 4I02A 3M3YJ 4IPAA 3HUGA 1FMWA 1WJEA 3IH3A 4I1DA 1LAHE 1NH3A 1W0TA 2YPNA 4X0GA 1R4NB 2F5EA 2M2EA 2XB5A 3GXOA 1NFTA 1QJMA 4LD5A 4CH7A 2CZLA 1B5IA 3KC1A 3OIQA 5EEAA 1MXWA 1VSOA 2GFEA 2XXWA 4GWWA 1KZHA 1YCJA 4IQJA 3ZQ7A 3FXQA 5JK4A 1V5FA 4JK1X 1Z3YA 1UIVA 4LUBA 2P5VA 1V5GA 2LD5A 1EKEA 2M30A 2MH2A 1B4HA 3SYTA 1WSUA 1MH3A 3S1RJ 5E17F 2XC7A 1CB6A 3B7DA 4GRKA 4OENA 4XRFA 1LFPA 1K9ZA 4OYVA 2XDVA 2R6GE 4Y7NJ 2M0CA 1MY3A 2DOFA 4Z7EA 3PU5A 1FPEA 1MNDA 4OVTA 4IHSA 4ZE8A 1FOXA 3U2RA 3E9XA 5B7DA 3DU6A 3KOTA 3UORA 3O97A 5L9OA 1FTMA 2R7TA 3IJOB 4IL6C 4H1XA 1SPIA 1MXYA 3KZGA 2A5WA 2HDCA 5E3OA 4OESA 1LNWA 3H3GA 1I6BA 1LBXA 4PF8A 1WVRA 1ATGA 2DODA 2KZVA 3J80K 5F0HA 4LP2B 3DPTA 2DA3A 1XGMA 2EA4A 3C34A 1A6IA 4HYEA 4G12A 1B7ZA 4XKNA 3T9XB 3JRDA 3ASOH 1K4TA 2ZNTA 1MQHA 4YB5A 4NQWB 2I3WA 1VF9A 3P9CA 3CUQA 3ZKLA 2HWVA 2PLYA 3M3FA 4FX0A 4QFOA 4TLMB 5H8FB 1JEUA 1LPQA 2KFDA 2DT6A 3GLLA 3IL2A 1B4ZA 2DDKA 4G77A 1IJWC 4YZZA 2CU7A 2EFWA 1MBHA 4UY8I 2XSJC 2PMZA 1QULA 1QBJA 4LZ8A 3ZN1A 2XXIA 3FVOA 1I27A 1U5TA 3K69A 3CF5F 1LBCA 2ZBKA 3N6UA 4LN5A 3I5OA 2CFXA 2MYSA 1B1HA 3D5RC 3FVNA 1W0UA 4R2FA 3K0LA 1B5HA 2I0BA 2V6EA 3CCJI 4KMUX 5D5VB 2V25A 3K6WA 3FISA 4KA4A 4I76A 1JI8A 5EGOB 2OWZA 3JR9A 2QRYA 4X04A 2GA2A 1G0HA 3GXAA 3WG9A 3OYEA 5C4JJ 4G9YA 3GTGJ 4D5CA 3D5SC 1U8RA 3CG3A 3S3OA 1OCOH 1XN7A 3AAFA 1JXSA 3RKWA 4ZEBA 2PG4A 5TISC 1V54H 4LG0A 2IGOA 4XLCA 1JTXA 4ELOA 3O6IA 1DGRM 3KOSA 3K9TA 2ZCWA 5J4YA 2DYSH 3OSQA 3LR1A 4O94A 4I01A 3C1DA 2P6SA 2UXNA 1Z9CA 5KZTA 3U72A 4QRZA 2YLNA 4WCGA 4FBPA 4OHNA 2VBXA 4NN3A 4IGTA 2FIEA 3U21A 2Z8DA 4HLXA 4N91A 1LEBA 3CFLA 2LREA 1IMCA 5DVFA 3FKJA 2F35A 3OO7A 3K4KA 3HRTA 1IZ1A 1UTBB 5CMKA 5HDGA 3VWBA 5FTHA 2KHMA 5GTIC 2X6OA 2R5YA 1NKXA 1MBJA 2GRVA 4RXLA 2MGQA 1WRJA 2RVCA 2FMLA 2DA4A 3EPZA 3K6GA 3OYCA 3JRCA 1KZ8A 5LHIA 2O9LA 4P8BA 2CZIA 3TQWA 3MVWA 5AA2B 1AH5A 1OCCH 1DTGA 4BDYA 2Y0MA 3NAUA 4P0GA 3B02A 4LOCA 1S9HA 5FKMA 1JKOC 3KP7A 1ZHFA 2L7FP 3E79A 4X9TA 3RY3A 3BJ6A 1OYYA 1Z67A 2DYXA 2F36A 2GOXB 4ZH4F 3CSBA 4BJTA 1GV5A 1YPNA 4L5EA 2LKSA 5B5EC 1U78A 3H5AA 1X1CA 3HSRA 1MNMC 3H03A 3OSRA 4MIJA 5H8QB 3SDGA 2DK5A 1MXZA 3N5LA 2Y0SN 3DBLB 2CQXA 4YEJA 2W82A 2Z16A 4P47A 2ZXWH 2V1UA 1G3TA 1KONA 4A3FJ 2UWMA 3DTEA 3FXKA 1AHDP 1MW7A 1OKRA 1DBZA 2UYEA 2FEZA 4BEHA 2DTRA 4XKPA 2FNPA 3WHCA 4BHCA 4I3YA 1T08B 1GVCA 5IZZA 1ORKA 2IW5A 5D5UB 5BWJA 3CDLA 3CP2A 4HBLA 4M9XA 2ID3A 1IXRC 2FQ4A 1T8IA 4ZZAA 3S9EA 1A35A 1R5GA 3MZBA 2G93A 1R00A 3VYTB 2LP0A 4ZEDA 3LSRA 3BCBA 4XOTA 1B8IB 4TOZA 1WJCA 1QZZA 1UAAA 5FJ8J 3L2VA 1NUWA 1G4DA 3LUZA 4IO3A 4PFYA 5DEXB 1OR7C 3BZ6A 4UB8C 2QLZA 2ECCA 2ZSHB 3LSMA 4HAMA 2WYKA 4MX6A 2IA2A 3ABUA 5DCMB 1FPKA 1QU3A 3JRAA 3ML6A 2Y69H 3R0AA 4L5JA 3T1BA 3ZN0A 2HHMA 1OLAA 2V3QA 1JUSA 2CW8A 1E17A 1K83J 1SFXA 2DQRA 3VODA 4N6PA 3ZQFA 2E34A 3GZNB 2DN0A 3JTGA 4FTHA 1P1NA 4FHTA 4KCDA 4PQJA 4J01A 4ZEKA 5M2VA 3NEUA 3LSWA 2QYOA 3ZXSA 1G0IA 3IOTA 4JOMA 1POGA 4NHJA 3TTNA 4EM0B 3JAMK 3OYKA 3DKXA 2MW8A 2GH9A 1E3PA 4A3BJ 5K7FA 2QVVA 4H45A 2XHDA 2I58A 2ELJA 2P3VA 3TTLA 3UK4A 3Q0VA 5IP6A 1DU0A 2JVHA 3BR0A 3VDXA 2QS1A 1FQFA 1ZMGA 4GL0A 3THIA 1KA0A 3H5NA 1ERDA 3W6KB 1HC8A 4BUPA 4L0ZB 3DPUA 1FW0A 2H98A 2XF5A 1S7AA 2K27A 2Q0OA 2DWJA 1ZTYA 1GV8A 1YS6A 3IB2A 1M5EA 3ONQA 3F23A 2CRGA 1EYIA 3LSGA 5F0FA 4IF4A 1VTNC 1K79A 4RGSA 5EYFA 3VPRA 4YG2F 1XPXA 3KP6A 1S72I 1FEXA 5IZ3A 3R61A 4MNIA 5FHMA 2ONRA 2JPBA 1GVJA 2VE8A 2VJIA 4CCLA 5IT3A 5K7HA 4ENJA 3HOVJ 3HKZA 1A5JA 2HQNA 4OOIA 1LEVA 3ONMA 1ZLQA 3SJMA 4KQPA 4AIHA 2DLLA 2L54A 2WB1N 4S05A 5M5XJ 1GV2A 2CEYA 5E1XA 1F9NA 5GADJ 1EH6A 1TFAA 3F9KA 4F3PA 5EHSA 2V4CA 5ILUA 2JN6A 1RYOA 4IJAA 3CMMA 2D5WA 3E5UA 4F52A 3QRFF 1VE4A 1LBWA 3QUFA 3PIOF 4A3LJ 2AO9A 5JLWA 2VBYA 1W4MA 4G94A 2ISYA 4UUSB 3IL1B 5EJCA 5HOOA 4BDZA 2X1CA 2HKOA 2KKOA 2EJRA 3ELKA 2H4IA 4CCKA 1LVKA 1HOMA 3FVKA 3S14J 1VQOI 4HXVA 4Y17A 3WGGA 3ZGKA 3D1RA 1U9NA 2V7FA 2CO5A 4ONYA 1FSHA 1HSJA 5EEGA 4IHWA 1YOVB 2M34A 3BY6A 3KZZA 3A03A 3GYHX 4TV7A 3GTJJ 4A6DA 5B1AH 4NMYA 4RK9A 1YQAA 1ZN2A 1FPGA 1LE8B 3OOAA 3UIFA 2GIZA 3VOEA 1JGGA 4EF1A 4AYBA 2R5ZA 2ZYOA 3C33A 4HEA2 4EUOA 2UVHA 2DW4A 2DO7A 1MDQA 2REJA 2OJED 4I99C 3RDIA 4DXCA 4D7MA 3HTSB 4XLPF 3EUKL 5I57A 4A69C 3B73A 4N6DA 2HKXA 4HV5A 4KN4X 4ZTJA 4UUVA 4DIGA 3PUXE 4BU2A 3PJRA 3SKPA 2XXQA 1Q1HA 3L2WA 4OMZA 3S15J 4MCOA 1MPBA 4EMSA 2E5ZA 5CVUA 3GCMA 3NWSA 3R26A 3CMEI 2Z3YA 2O51A 2LNBA 1JETA 4A2UA 2OCCH 4U7DA 2DMPA 2HCAA 4YFXF 4GWYA 3RQ4A 2CMOA 3MMYB 3H06B 4AB6A 2QVOA 2QZ8A 4KYDA 3PIPF 2VD2A 2VT5A 1XC5A 4GBWA 3TEPA 2F3DA 3VXBA 2EIMH 2JJ7A 1MBFA 2FJ1A 1Y6IA 4PC9A 3Q9VA 3GBGA 1F4KA 1USYE 4XRMA 3N05A 4IQ4A 1SD3A 2O6AA 4HCWA 4PTKA 2XKOA 5I59A 3E6DA 1LLSA 1S7YA 3CDIA 1OVTA 1K9YA 5F0CA 3OYAA 1BIBA 2XGXA 5EYRA 1BOBA 4E70A 3BZCA 2W1OA 1JW4A 2GAUA 5DVIA 4MHFA 4X1DA 1XD7A 4GX3A 1TNTA 1NUYA 3S4UA 3F8NA 4OIPF 1B7HA 2K40A 3HN0A 4O7IA 4OIQF 4KYSA 1I6HJ 3FDYA 4CA0A 4CHUA 2FBIA 4M9ZA 1LCFA 2ICWG 2DE4A 2DK8A 4D1QA 3CQZJ 4HNVA 1Y0UA 4TQUQ 1R1TA 2F7CA 3GW2A 2LG4A 4G7ZF 2ECBA 1V3FA 4B09A 1MM7A 3RUMA 3MD2A 3M8EA 1G2HA 4EJTA 2L5QA 4I98B 2LFBA 1T2KA 3NWTA 1HW5A 2OX3A 1WJDA 1UHWA 2QSGX 1YRNB 3M8JA 1KGSA 4GYGA 2F5XA 1BN5A 1REPC 1B40A 3MAMA 5DT6A 2AS5F 5K7ZA 1DMBA 2L9VA 4X6AJ 3M7GA 2P6TA 2XHKA 2CQQA 1IUFA 2HFHA 3HIFA 5I84A 5H8NA 4I0BA 4PFPA 4Y15A 4BHBA 4HE0A 1LAXA 3CVGA 4C30A 2VPLA 2OK2A 3I4MJ 1FQCA 1YW7A 4PJ0C 1B9MA 4LITA 3HZJA 3KE2A 4GXAA 1T6SA 1P2FA 2LBFA 2CGPA 1VQ5I 2K85A 2L01A 1I69A 2OUMA 5FLMJ 4G68C 4II2A 4U0YA 4Q30B 1Q9DA 5DD4A 3TOBA 4F2OA 1UG0A 1RZ4A 4ZYEA 1A54A 3H9QA 3OIPA 4JX6A 2V9KA 4A6EA 4F7ZA 3V8JA 2NWJA 4OXVA 2F4OB 1FIAA 1EJ9A 2XXXA 4GD5A 4NG7A 5J1RA 2QS2A 4RNSA 4DZ1A 5J4VA 2FSWA 2HZLA 3LAJA 2EZIA 4D0PA 4YKKA 3WU2C 3L7WA 4DYRA 5BUUA 2RINA 3L09A 4NC8A 3B8BA 4POXA 1SANA 1X4PA 3GTMJ 3J80Z 5BS6A 4KHZE 2F7BA 3CF2A 1N0TA 1FCKA 1XOCA 2XXVA 1FT9A 1LBZA 2OPTA 4GXSB 4JVIA 3U1DA 3L2UA 1JUMA 1ZELA 2XASA 4BE2A 4M3BA 1FBFA 1YX3A 1D1CA 3RJPA 4D5FA 2H5YA 4THIA 4QWQA 4O3MA 3RGYA 3B6AA 3FXMA 2F4MB 4ASNA 1FTOA 2DVZA 1MD0A 4MFDA 3KC0A 5CC2A 1ZYRF 2JA2A 3CJTB 1BI3A 2LY2A 1NNPA 3LUYA 1ZRFA 4HX7A 3QSLA 2DYRH 3FF5A 3HSEA 5DM6F 2RQPA 3V7RA 1FPQA 3HPGA 1QGXA 2BVMA 1QHHD 2VN2A 2W7YA 5ICEA 2IP2A 4H8IA 3JSPA 2KRFA 4F19A 3K4UA 3JRIA 5I2NB 1FYKA 2IPQX 5B70A 1R4MB 1MRPA 3ROJA 4F29A 3O29A 4DDDA 1TL8A 4KIFA 3I55I 2DE2A 2O1MA 1D5YA 4ABZA 3BIGA 2FQ3A 1LBBA 3CJRB 4JXIA 3ILTB 1D4NA 4ZDLA 3U1KA 2XSDC 2D3IA 3TUSA 2VPRA 4F92B 4WK8F 3KYLA 4PSXA 5LBQA 4KICA 2H6BA 3K4BA 1B05A 4PDHA 4Y3OA 3BR2A 1ITYA 4DIQA 2NVYJ 4C2MJ 4XQFA 1MMSA 1USYH 4GQOA 4N81A 3S9MC 4PJNA 5IT9Z 1IDZA 2GIVA 2IJLA 2QMWA 3HHFA 5KVRA 2RN7A 3N97A 3KSXA 4R74A 3HYIA 1XS9A 5LGNA 2Y84A 4U4XA 2VT3A 5J40A 3VLWA 3HC7A 1QO0D 2NS0A 4R1HA 3A4CA 1FX7A 3VVFA 1ZGJA 2PMZN 5FGMA 2ZO4A 4FE8A 3FXUA 2WAQA 4IOCF 1URDA 1UJ8A 1B0LA 4L9NA 1Y4CA 3LL7A 4C9YA 3H6TA 4PBHA 4O3BA 2EPFA 1H43A 5CLSA 3KP5A 1CGPA 4O8MA 5FHOA 3OENA 1JUPA 3MPLA 5E8IA 2KJCA 2FX0A 2GOMA 2R9JA 4C2UA 1IXCA 1NI9A 5I56B 1YJNI 1Z6RA 3UKGA 1IGNA 4EXLA 3A02A 4X1EA 1R7JA 3G2BA 3BG6A 3G4SI 5F24A 3VSKA 1O63A 2DI3A 2FXAA 5HNFA 3ZPLA 1N3XA 5IM2A 4MQ9F 3HRMA 3TW6A 4H67A 4U23A 4FE7A 3H6WA 2YS9A 2JA6J 2OQGA 1BP5A 4G68B 5HBCA 1ETXA 5CVVA 1IMBA 2R92J 4RAZA 3BLYA 1QNTA 1P1WA 4MNCA 1ZTRA 4R73A 3PUYE 1XHYA 4BS9A 2FD5A 1NV5A 1MZBA 4IRHA 1KA1A 2XWOA 4OIOF 4HE1A 2P5KA 2CS3A 3FHZA 3E97A 4ZE9A 4LATA 5AONA 4NDLA 2UV1A 4AS4A 2K3PA 3G3HA 3BR1A 3G3IA 2QSHX 4RBOA 4CUGA 2L9NA 2ZC2A 4GO1A 1NV0A 1KQ0A 3E1SA 4E7KA 5J8CA 1BW5A 4YB7A 2A05A 2LH9A 4MEYF 3IWZA 5GAEJ 1SDXA 1IMAA 1ZLJA 2VQHA 4N4OB 1MSEC 4L18B 2K4BA 1FTKA 2Z99A 2OWTA 2W84A 2WYPA 1MJAA 2DWHA 4XBFA 1PP8F 3TMGA 1ZRDA 3I53A 5LRSA 1VFEA 3C36A 4UHTA 1USSA 4FETA 2L3DA 3K4NA 5JI6A 5L3BA 2DOJA 4U0VA 4DLDA 3I59A 5L3EA 2NVQJ 3LA7A 2XF6A 4RAFA 3QPLA 1EYKA 1MDP1 1UTHB 2I49A 1MMGA 2IA1A 3MP1A 1JP4A 3IKVA 3LSHA 1WODA 2K5CA 3QOPA 3JRBA 3EN3A 3MBPA 3BTCA 3WAEA 4CO8A 4B44A 1OJLA 2EIJH 3DLNA 3M1CA 1H88C 2E0SA 2XPUA 4XOPA 3D5LA 4R6YA 3RTWB 1LEAA 2ONSA 2XXRA 1PVEA 4A93J 2P7CB 1NHAA 1G3YA 5DDGA 2J5PA 1KU9A 3SZPA 2KJBA 1EF4A 1OCRH 2EFQA 2IGMA 1IV6A 1DOTA 1OQHA 2QSXA 1X2NA 2UVIA 1US4A 1FBDA 2XX9A 2A6HF 5K5RA 3FXRA 2GBYA 1F9BA 4QFLA 3JAMZ 2H8RA 5CVIA 4OMBA 4PAKA 1B9JA 3MVZA 3T9UA 1X4OA 1LFUP 4EJVA 2XA5A 2IXSA 2V3TA 5DV5A 2DCEA 1X1DA 3KEIA 3H4ZA 2I10A 4MLQA 2VOPA 3T93B 1ON2A 3TOAA 3AG4H 4WXHA 4BNCA 3TCFA 4D9JA 2I48A 1T39A 4FASD 1XVXA 1MY0A 2F3BA 1N84A 2ELKA 4MGRA 3I6VA 4NF5A 1IG7A 4LLGF 3S1MJ 2DMNA 4PGPA 1IW7F 2F6CA 3M8UA 3H9GA 4ZJZA 1SFOJ 4ISUA 4OFLA 3MJNA 3VVEA 1SFKA 2ELHA 3WG7H 4KFQA 5AA2D 3KN3A 4C3JJ 2XAJA 3A3CA 3C2BA 3RPLA 3K1MA 3P7IA 3KLNA 2PX9A 1YTVA 1VQ8I 1B7UA 5KDTB 1XMXA 2JTVA 1D9YA 3S16J 3SFZA 4CDGA 3TO6A 1FRPA 3W2WA 4KI0E 2BW3B 1TW2A 3W9WA 1GDTA 4PFTA 1GT0C 1LCTA 2W48A 2X48A 1Z21A 2M4KA 4HDVA 1NK2P 1RUOA 2V93A 3FJMA 2B3FA 3HHHA 2X51A 5BOXA 1HW1A 4OTEA 4DZJA 1MXUA 2Q1ZB 4XKQA 4AIJA 4ZYHA 4DYQA 3L2QA 2YJPA 5LLQA 2FHYA 3QPTA 2KRHA 1NV1A 4HF0A 2CG4A 4HNUA 2QS3A 2ZYKA 3BOQA 1KYWA 1N7XA 4UVBA 1IEJA 5IZ1A 5I7IA 2QS4A 3HTUA 1O3TA 4U7BA 3OEMA 3T5XA 3RN8A 4RAYA 1MMDA 2Q8JA 2GZWA 2R7ZJ 3HV1A 1MJBA 1S50A 4GFRA 3M4OJ 4E7ZA 4V2FA 3GTLJ 2QQ9A 3M8FA 3IRRA 1RIOH 3ZR8X 3PQKA 2H27A 1US5A 4MFIA 4OQOA 1BTJA 4R2BA 1G3SA 1KU3A 3LA2A 2O1LA 4QFKA 4P55A 4OFJA 3SESA 3FKIJ 2NVTJ 1PUFB 4MTDA 3HKZN 1IQ7A 4BH9A 5CI5A 1WKMA 2KIMA 4KD5A 4UA8A 3VVDA 3PPQA 3TELA 4LQ5A 5FD5A 2COMA 3V4GA 2IGNA 1WQ2A 3IKTA 3JRGA 4A3EJ 2LSOA 4M71A 4PDDA 3PPPA 4EQ9A 4F1VA 3SEQA 1AA7A 1PDAA 1GUUA 5J47A 3RYRA 1O7LA 3FX3A 3K10A 3WODF 3BKIB 4ZDOA 4PCQA 2ZXJA 2R71A 2VQCA 1XSXA 1Z1DA 2DMTA 2EIKH 1SVOA 2HTJA 2JK3A 2K4JA 2PEXA 4DZPA 2ZJQF 3B6CA 3T8RA 4A0YA 5ET7A 4BDQA 3DEEA 4CXFA 3KJTA 2V4JC 4AIDA 2JRMA 2LF7A 3FHNA 5JVTA 1P1OA 4A3GJ 5HDKA 3LQQA 4GX6A 2KQRA 4IKFA 3KIOA 3HB9A 4O7MA 3FGSA 2H25A 3MZ1A 3E6CC 1HXDA 4G8MA 1Y39A 1R9LA 1ZG1A 2JA5J 4NQWA 5BQTA 4BDLA 2IA4A 3D4GA 5H8FA 5JLXA 2ADUA 4G8XA 4WKMA 1MBKA 4N8GA 2O8KA 4B48A 2I8DA 1Y56A 3F72A 2BV6A 2VBWA 2QCOA 1PBPA 4YIIA 2OAZA 1SD5A 3OMBA 5C3EJ 4M9SA 2P3NA 4YKIA 3OOUA 1E0EA 1FTAA 3HRUA 4J00A 3PPOA 4A5MA 2BXZA 2THIA 4P11A 5FLXK 1TW3A 2TDXA 3OOPA 3PNVA 5GP9A 1XT8A 4EJWA 1ZKGA 3E6BA 1R9TJ 2QVRA 5F08A 2E60A 1A40A 3D0SA 1NNKA 3V89B 2H1KA 4IO2A 1T38A 5EGOA 2FA5A 3TP0A 2EFOA 1MG1A 1S7OA 1X3WB 2LMDA 1A31A 3IO4A 3ROUA 3K70C 3DKYA 2HU9A 2L5VA 2XXYA 2ZFUA 3HUGB 2FVZA 2OU2A 2Y2ZA 2A07F 2R7UA 4OFOA 4KT6A 1JT6A 3A01B 5DYMA 4CICA 4EATA 4H0WA 3RQIA 3HCQA 1LFBA 1FPFA 2HZDA 3FUZA 5I58B 1I3QJ 2CEXA 5EYGA 2DP8A 1GXPA 3NQOA 2F4IA 2MFZA 5LHGA 1GGGA 2DS9A 4FATA 5K5QA 1IRGA 4G8HA 1TP4A 3V5AA 4XSXF 2FA7A 1D0ZA 1WJ5A 5H2FC 3H3VK 1B58A 2B4LA 2V9PA 4J19A 2F97A 2XX7A 4QF9A 1D9QA 2XXHA 2A6EF 1WI9A 2L02A 4CSWA 2QPQA 1Y3QA 3HXLA 3W6VA 1FSAA 2GHAA 1APLC 3F8FA 2WX9A 4N15A 1A8EA 1W5SA 1OQGA 2XXPA 1M5BA 4E0WA 2Z22A 3RCOA 4C3HJ 1UTBA 5J6XA 1UHSA 1V55H 3EUHC 4ELQA 5M3MJ 1V5EA 1RI7A 2VLAA 4XIDA 1VQ4I 4BAYA 3EF7A 5E3MA 3BZKA 4IY5A 2JWTA 4QSDA 4LJZF 2NOGA 3MKWB 3F22A 4I7HA 4Z6YA 5IT9K 4HX4A 4OEUA 3WU0A 4A3CJ 3FBPA 2ZYNA 4UB6C 2XV4S 2E2HJ 5JHUA 1OQYA 5AA2A 2WBMA 1A55A 3DELB 2CQKA 5AE4A 4M3DA 3TEDA 3DEUA 2L9RA 4B3XA 1S29A 4ZDPA 4IO5A 1IN6A 1CF7A 1YHQI 3PD9A 2HNHA 2I6EA 2AQFA 3ZQCA 1D8KA 4RK2A 1TXFA 3QPHA 3ZMTA 3BG5A 4N4UA 4JSDA 2IEKA 1FWZA 5H8QA 1RYXA 1R1VA 4BY1J 5JR3A 3J7YJ 2RC7A 1VQLI 4I3EA 2H94A 1A36A 3BTJA 4E7LA 2OJTA 4RPOA 1HKQA 2OA4A 4BGDA 1TQMA 3ULQB 1D8JA 1ETYA 3S9NC 2LTPA 3LMMA 2YU3A 1XGSA 1SI1A 1XSVA 4F93B 1NNTA 4PFWA 3IWFA 4AU7A 2DPUA 1Z91A 3OO8A 2D2WA 5M5YJ 1ANFA 1BLFA 2A5SA 2CSOA 1Y8QB 4HG2A 5CQEA 4ETSA 2LKXA 4IEJA 5IYCJ 3HSTA 5ILVA 2M7BA 3ZQHA 3H5RA 2CWEA 1B8IA 2XXTA 5DEXA 4OVRA 2F8DA 4JWYA 2KZGA 4HF1A 2FU4A 3RPUA 1X1AA 1FBGA 2E2JJ 5DCMA 3IB1A 1LBYA 3TODA 4RLFA 4XXUA 3P7NA 5F1QA 1B52A 4C1UA 3QU6A 3SQNA 4OVQA 3Q29A 2V9VA 3JCUC 5FKNA 4LVQA 5FFXA 5ITPA 3B6TA 1M5CA 4GCVA 2FUG2 2JSPA 5B3SH 4U21A 3PUBA 2R7RA 3QXMA 2CQNA 1L3LA 2Z33A 3S1NJ 2E1NA 2HVQA 4IZZA 2B65A 4PK4A 4GVOA 2UUZA 3MAJA 3MW0A 1BK4A 4H65A 4DXUA 2ACJA 2WADA 2WKYA 3O8HA 1F43A 1W7PB 1USTA 4RMNA 1YLFA 1ENHA 3VDFA 1DPPA 1SW1A 3WTZA 2LYCA 3FIWA 4HW0A 1OIBA 3MKLA 3C3WA 2Z8FA 4U1OA 1FQDA 3G1OA 5HLGA 4ESWA 3IB0A 5KCJB 1OLTA 1T95A 3L1PA 3RKQA 2BYVE 3OXNA 3QIMA 2XPVA 5CM6A 3MWMA 4QIWN 2YU9J 4JYKA 4CCOA 3SDBA 3FIRA 1FBPA 2O68A 5L9MA 4NE4A 3GEZA 4XN3A 1K7AA 5E20A 5ICGA 1ODDA 2MC3A 1IO2A 3OWTA 3CJNA 1J9IA 1TWHJ 3OSGA 1IMDA 1B4AA 5J1UA 3ESWB 1BC7C 3SZGA 1T0KA 2BY0A 5KHDA 4EF2A 2DU9A 4GWXA 1IRZA 1P6RA 5EG0B 3EYYA 1UB9A 2E5NA 3GFMA 1K78B 5D4RA 1RETA 3WU1B 1W1WE 4IRIA 4XONA 3TMOA 1QA6A 3C32A 3N4MA 4N8YA 2VI6A 3MVPA 2GQ1A 2DOAA 3TPAA 4JDFA 5JHFA 2UZKA 2STWA 4OETA 3IOUA 1Y9UA 3Q26A 4WXCA 1F1ZA 4JX5A 2HPIA 1OVBA 2OZ6A 1AIVA 1SW4A 1MBEA 1OPCA 3KLOA 1ZH5A 1VFCA 1POTA 2NNNA 4UUSA 1N3WA 2H8WA 5D6EA 4HW8A 4GGGA 4F18A 4PJJA 2PQ8A 3LSKA 4UV9A 3WHBA 2KP6A 3CCUI 3TBIA 2XGEA 3BQZA 2HDDA 4UACA 3ZMVA 2P8TA 3H3ZA 1YG2A 4CYCB 2KLOA 2L0KA 3MQ0A 4FEBA 1EZ9A 1VNDA 1B6HA 2QUFA 1BM9A 3JREA 2NNYA 3DF8A 5H8HB 4NF4B 2PBIA 4HE2A 5E18F 4PFUA 1XVYA 1BW6A 2ZXHA 1SFEA 1DP3A 1Y20A 4YB6A 5L3CA 4I62A 1G6NA 4CCJA 1JTYA 3BQYA 3BR6A 3S8PA 2CUJA 1LE8A 3T9HB 3G1MA 2D45A 1ZG3A 5FD6A 3M07A 2NYXA 1XDSA 2HFBA 1IXHA 1FSEA 1AWBA 4BQAA 4LIVA 3FASA 2O7OA 2XWKA 1H0MA 1NK3P 1FYLA 4BDOA 2XRLA 5TJJA 1FTTA 3W15C 2TCTA 1UIUA 1LFHA 1RC9A 2RCAA 3HGGA 3BCAA 2B9SA 2P2AA 4DXBA 1W5TA 4PFOA 1RKMA 3S2DJ 4KDPA 1OR7A 3I9V2 1LDKB 4HSTA 1HDPA 2FE3A 1YW9A 5F27A 1FLIA 4MJOA 2FNCA 5I3SA 4NTLA 4P9FA 1RDZA 4RAGA 2UYFA 4UXNA 2CZHA 5JTYB 5LGUA 4P9UA 2DVCA 5CVRA 3A3UA 2WAFA 5FHNA 3K6XA 1WDNA 4XLEA 1J2XA 3BWGA 3Q0WA 3A1YA 2PT1A 3K00A 3K2AA 5EZGA 4R9GA 2VP1A 3ABMH 2KT0A 1MH4A 1VQMI 4R6KA 3DBHB 1RPWA 3FJ7A 3NOHA 4BXFA 2PMHA 4WEDA 4A3IJ 3FMSA 4ESBA 2MG4A 2ISZA 1JJ8C 3ZMZA 1QVSA 3E5QA 4RB1A 1QHGA 2E7XA 1L5TA 3DXJF 5CJ9A 2XKPA 1IUDA 1D3YA 3E0JB 3GVAA 2X7QA 5LOMA 1K4SA 2DA6A 2ZNUA 4RA1A 4O3CA 5EF6A 1I6AA 4NF0A 2W57A 4BKXA 1B3LA 2DMUA 2GXAA 1D3KA 2CZKA 3FV2A 3GTKJ 2Y75A 4F3QA 2VC0A 1HKSA 2BXYA 2W00A 4XKVA 1PEBA 1QRYA 1SW2A 3HPIA 4RY1A 3MPKA 2DA1A 3GLBA 4AB5A 3P5JA 1C0WA 2BGCA 1K6YA 2BHYA 2F5FA 5IP9J 3EPEA 1CNQA 1OMIA 2OCEA 3I58A 2HEUA 3V8LA 2L4AA 1SEUA 3ZOBA 2V3UA 3QYFA 2ZYMA 3FD3A 3K2DA 5EQ8A 2VBZA 4XLNF 1ETOA 1VQNI 1Y1MA 5J16A 4Z2YA 3EKIA 3ABLH 4Q8RA 3S3MA 1HDDC 4NF8B 3OS1A 2GWRA 1YRNA 1MKMA 5J1DA 2Y48A 2BOLA 3OYDA 4NWCA 3KYCB 3FXOA 1WPKA 5EEHA 3TO7A 2XD2A 3L6HA 4CCMA 3OO9A 4ON0A 2VJJA 2IVMA 3DV8A 5D5XB 1E2XA 3AKZA 3H6UA 4E0XA 4RB3C 1NTCA 4YICA 1P9QC 1X19A 2R7QA 2KDZA 3HEFA 1ZBMA 5CMBA 5DTBA 5DW8A 2X26A 3G3GA 2V6CA 4AS5A 3CSGA 2NS8A 4KITB 1UCRA 5LEKA 3VSLA 1D0XA 2HOEA 2W4SA 2YSRA 1MM6A 4KUMA 1KU2A 4PJMA 4GF8A 3HGYA 2VPOA 3ZQQA 3ABTA 2R93J 4BBSJ 4AM3A 1Y1WJ 2IGKA 5AIPA 4AIKA 2F6PA 5D4SA 1JKQC 1P1UA 4BACA 3FMRA 1EH8A 3ZP5A 3HOUJ 4WX9A 3USDA 3OD7A 2HXWA 2HZKA 4NF6B 1JEVA 1AOYA 4RA2A 1DPRA 2L4MA 3LQRA 5ELVA 2QM3A 4YKPA 4WXJA 4KMFA 4DCYA 1VQKI 3I0TA 3J7AY 1IDYA 5GAHJ 5E1WA 2D1HA 3BPXA 5H6RA 3ZMSA 1XSDA 3HG9A 1TQPA 4XLHA 3ZQLA 3F6OA 1W36C 2PJPA 1SI0A 4YAHX 1OMPA 1RDYA 2M8CA 2UVGA 5F6FA 5GPCA 2G0EA 4ENMA 4HTGA 2Q2EB 3OYIA 4L5IA 4M3EA 3KP4A 3WTSC 4HS7A 2P5LC 2WBBA 3O28A 2HDWA 1DP7P 3HOZJ 3ILUB 4KT5C 2M8EA 3HHGA 2ZFWA 3OYJA 3C2GA 2PYYA 2Z8EA 1Z77A 3CJQB 4H4KC 4PGHA 1EYJA 4OMYA 4PFRA 4JBZA 2HI3A 3H3UA 4BXUA 4FX4A 2TRTA 3DP4A 1SYHA 3MWBA 1QVUA 5DEQA 3KN8A 4KCCA 4P9KA 2HYJA 4M6VA 2HVSA 4A3KJ 3HRSA 3QQAA 2PBWA 4MFEA 5HS9A 2XAGA 3H36A 4QFPA 1R1UA 3IK6B 1MPDA 1KQ9A 2QQ8A 1J09A 4M72A 4UUTA 2DA7A 5CRYA 4PZJA 4NC7A 4BL0B 1YFHA 3MKYB 2Q8MA 3RYPA 4FISA 2L7KA 2RKHA 1QKAA 1UHMA 5E79C 1MGTA 1I1GA 1B59A 3C7JA 1TQIA 2PMSA 1URGA 2DFHA 5LFAA 1VZ0A 1D5VA 1R36A 5FLXZ 1VQ7I 1O64A 3J81K 1DPUA 3QAHA 4DI4B 5I2NA 1RKWA 3KETA 3VLUA 3FZVA 3U93A 1XX5A 1FJ9A 2NVXJ 4ND9A 1FOYA 2ZMEC 5HS8A 3A09A 3ECHA 1VDWA 2X85A 4KN7X 1XGNA 4ZZLA 1VR5A 3IV5A 3S32A 1INPA 1YX5A 3MCZA 1ON1A 3DCFA 5T3JA 5C44J 2CW0F 2Y0SA 3OYFA 3B6QA 1BI0A 4BDRA 1P7IA 5ERIA 5M3FJ 3FXBA 1EH7A 4PGNA 4QTRA 5ICCA 3BPVA 1MY2A 4FECA 3BT9A 4RDUA 2F2EA 1ETQA 2UXAA 3ODBA 4C0RA 4MO7A 3GTOJ 1WFXA 3KFMA 1G8XA 1Q1VA 1Q35A 1TWCJ 4Y33A 3PUWE 1EA3A 1MNEA 2NXNB 3QU3A 4GFBA 2MA3A 2W25A 4DI3D 1I50J 3W2VA 3PUZE 3E5XA 4XN0A 4AWXB 4DW6A 5KCMA 2MH9A 5A5XB 4JSOA 4XORA 3DLAA 1NG6A 3RPWA 3IH4A 2Q74A 3FMQA 3PL8A 2DE3A 4X48A 3TYHA 4B43A 1O3RA 2HQRA 1DTZA 2R7WA 2ZJRF 3P9KA 1TFDA 1BL0A 2VIXA 5I56A 3BR3A 3C18A 1MSFC 2JA7J 1N7WA 3MEXA 2ID6A 3E7LA 3CMYA 2ESHA 1ETWA 2K9QA 2VASA 2PJRB 1KQ8A 2DSFA 3ZKKA 2MLKA 3BG9A 2VODA 1SMYF 2LDUA 1U3EM 4MNUA 4ELRA 1IRFA 4MF3A 3CFZA 4PAFA 3ZRGA 2FBPA 4G68A 3KCCA 1Z0XA 4NBQA 3IFCA 3CMAI 2CMPA 5BMZA 2XRNA 4KIBA 3LSIA 4MEXF 4XR6A 3QPSA 3FBNB 2OZUA 2CQ7A 4DNCA 4KFCA 5DYHA 4EDPA 1T0FC 4IHXA 2VXDA 4GWSA 4F91B 4HDUA 2R7SA 4U22A 2DT7B 4EXKA 3CO7C 1CQTA 2VT2A 2LVSA 1OLCA 2PCRA 1H8AC 3K7AJ 4H5GA 1J5YA 4YFNF 1DK4A 3OSFA 3BTIA 2Q2AA 2QBYB 2P0SA 4EJOA 3SEUA 4M3FA 3B6WA 1N78A 4HV6A 2V26A 2OCUA 4CGZA 2R7DA 2WV0A 4MH5A 1EZOA 1B3GA 1CE2A 3IOWA 5ICQA 4II3A 2PFZA 3H9JA 1JNFA 3WTWC 4ITVA 2RCBA 2BY1A 3ZCOA 3TCHA 1RNLA 2JJKA 5FTIA 1HF0A 2DTZA 1NV2A 1O3QA 1A7LA 4FORA 2V1XA 1UTHA 4FQGA 1QVTA 3BDDA 1JKRC 2GA1A 4EV0A 3CUOA 1XDUA 4B4CA 1YE9A 4IHVA 1HW2A 3IOVA 1Y8RB 2AQEA 5CBSA 1A04A 2B7EA 3KN7A 2VJ5A 4EEFG 2HQ0A 3S93A 4L9VA 1VQ9I 2LF8A 3NARA 1H3DA 3HSFA 1YO5C 1LFGA 2OBGA 2OC6A 5KAFC 3PMXA 1K61A 4BXXJ 4XIGQ 3TFLA 2A5TB 3RZOJ 3LSJA 2MLGA 2H9BA 5AA1A 3VE1B 2M1BA 3LA3A 5IY5H 4ZZDA 4XEQA 3RPQA 4QSHA 1NV3A 1MMAA 1B72B 4ZZEA 5TPAB 1O57A 2ZMEB 2W7NA 1DSNA 4PE3A 2JMWA 2P0WA 2N8GA 3X2QH 4PP0A 4AD9A 3RT6B 3U92A 2L9SA 5I2KB 1PDNC 4U88A 5ESYA 5FB2A 1JJ6C 2XB0X 2A68F 5HODA 1PB8A 2DXRA 5C4XJ 4GIZA 3SEVA 4LLLA 4EQQA 2AL5A 1SVLA 3BR5A 3VYSB 2ZNZA 3GTPJ 4XL9A 3O6HA 4ZS9A 3EYIA 1IN8A 2IA0A 4AVPA 1IXSB 2M5WA 4MIMA 1WZ2A 2VHAA 3DP8A 3H7MA 3TQLA 4OEVA 1NL5A 4P56A 3RT8A 4LGWA 4DYCA 4Q47A 3IAS2 3G1LA 3F11A 5HS7A 3T96B 3QP5A 2P7VB 3CD6I 4NEDA 2D21A 2EBIA 2DOEA 5B1BH 4IO7A 3HOXJ 3OMYA 3H1CA 1LB8A 5LGTA 5AA4B 4U1ZA 2YR2A 3RI4A 2EFPA 3Q25A 2LC2A 1FPIA 1VFDA 2DFEA 2K3FA 2K9NA 1IIWA 3UR3C 2K86A 3CESA 3PFIA 4IO4A 2PMUA 1FTLA 5KDTA 2LY9A 3K0VA 3KEYA 2IAIA 3TGNA 3Q3SA 3JV9A 2F48A 1R58A 2BW3A 2RGVA 1YI2I 1R71A 1NUXA 4MHGA 4PE5B 4GXOA 3VB2A 2ZXIA 3WGHA 4EJUA 4KPTA 1Y4TA 2F78A 4FIMA 1TC3C 2ZZWA 4L0YB 1BR1A 1ZREA 4PF6A 4H5FA 3FXLA 3T8TA 2M87A 2WTEA 4OAYA 1X2MA 5IPAA 5ET6A 3M1EA 9ANTA 4JP0A 3QYEA 1B1XA 1WJFA 3O8GA 1FQBA 1IN4A 4W97A 5ED4A 3EHUA 3CCEI 1T56A 1LAGE 3GZGA 1GXQA 4GWOA 5LTCA 3V7CA 3WGIA 2KISA 1HLVA 3MN2A 1S5LC 4RLQA 4RS8A 3SETA 3KG2A 3MSTA 3OEKA 2V84A 1XI6A 2QGUA 2I4CA 3UA8A 4OAZA 2HAVA 1FMVA 4JB7A 3CC4I 1H9TA 1LDDA 4XK4A 1PUFA 1AOVA 3W6JB 2HOTA 3OL4A 4UV8A 5TP9A 3PSIA 1SYIA 5AA3A 4DGWB 5HDNA 5DS9A 3G3JA 2H09A 4Q0CA 1ZR2A 3LV0A 5FKOA 4LA9A 4MQVA 1AL3A 2B3BA 5D8KB 3K6UA 2OF7A 4FE4A 1B9NA 4YMAA 5FO5A 3PMWA 3PUFA 3AL0C 2X4HA 5IOYA 5EDNA 3A0HC 4G4PA 1P99A 4P96A 4QSCA 2JUGA 1WJBA 3VLVA 3VXCA 1U2WA 1W7PD 2CUFA 4B47A 3HPHA 3BROA 1QUJA 1VQPI 3K70D 1MDMB 1AKHB 4CCNA 2AHQA 4GOTA 4PBQA 3A2KA 4ZDMA 1GVDA 2DFIA 1AWCA 5JVGF 1JT0A 3A0BC 4YKJA 2OBPA 4XFEA 3SEZA 3SEYA 4F3GA 5HNHA 1P4AA 1D0YA 3CUQC 2G7UA 3I71A 1O7FA 1SAUA 1WJAA 3TO9A 1UG2A 5DUIA 2IS1A 1II5A 1Z7LA 4BQQA 4PFIA 3V8XB 2QENA 4ENKA 1X1BA 3LWFA 1T33A 1YJWI 4E7HA 2B63J 1TWYA 3G3FA 1J7KA 2ESNA 2X1EA 4ZTFA 1Z7NE 4MBPA 1PB9A 5FBPA 3DFGA 1U5TC 1WH5A 1A6QA 1N75A 2NVUB 4BE1A 3HDDA 1Y1VJ 1BIYA 1TTYA 3PUVE 3TZAA 3Q9SA 4GX4A 2ZSIB 2EK5A 1L0OC 2KIFA 4CYDA 5DVJA 3BFTA 4A3JJ 3HOWJ 2JUCA 2VJ4A 4EM2A 3BBRA 2EWNA 1XCBA 3KEQA 4O6JA 5HLTA 1DGWY 3F3XA 2FYIA 2VKVA 1Z6TA 3OR1C 4NGUA 2FNAA 4HF2A 1GHCA 4L9TA 2XD3A 3FWEA 5EQ7A 1Y1ZA 3LSXA 1U6GA 3PSFA 3DM0A 2EV6A 3OS0A 5IYDJ 2HXIA 3DPLC 2HQ5A 3LC8A 2KIUA 3Q28A 2LKPA 3JYRA 3OYHA 4NF4A 1EZPA 5ICTA 3EDPA 3PNYA 4AYBN 2Y7KA 3GF2A 1NV6A 3FK6A 2QJEA 2O3FA 3MC2A 1MXXA 5FFZA 3A01A 1JE8A 2ZNSA 5CPRB 4MLVA 2QKLB 4YU0A 1FIPA 5AIQA 4N9IA 4A5NA 3KBZA 1ZJLA 3MYUA 4EM1A 4NQ8A 5LEJA 5I58A 2OTLI 1N25A 2V79A 4IHYA 1IN5A 2P4WA 4N4NB 1LQ1A 4P0IA 3F8MA 3SZTA 4MNPA 3J7ZI 5K2YA 2XPWA 2Y7IA 3K4JA 1IMEA 5FRNA 4M1VA 4EGZA 3MVXA 2D5VA 3K6VA 1MBGA 3RSNA 3H35A 2GM4A 3AXFA 1XB4A 3U8QA 2WC2A 3QYBA 4HX8A 3CG1A 2CV2A 3SEWA 1QZEA 1XMKA 1E3OC 3IC7A 2MKZA 1JVXA 1ZARA 3GBBA 4IY6A 5A5LA 2K9LA 3GX4X 3CCSI 2I0CA 4OANA 2KMUA 5ILSA 3IO6A 2O7UA 2FF4A 2R7FA 3KZIC 4V19K 4OVSA 3GFLA 1JKPC 2R7VA 1LKXA 1P7JA 3KZYA 2EV5A 3JZJA 2VXZA 1BR4A 2JPCA 1H76A 4GWZA 4MEVA 1LFIA 1S3JA 2GXGA 2VL8A 5L3GA 2HQAA 3KYDB 2ZMBA 2BHZA 4IO9F 3JRFA 3IH2A 4A3MJ 4XTCQ 2E19A 3VV5A 3MUQA 3OS2A 1O4XA 3SERA 1BBYA 4OA4A 1ONVA 3CHGA 4LIUA 2JT1A 4JBAA 1WVJA 2BY3A 1SC7A 3HJEA 1I1SA 4KR5A 3H92A 1MQGA 4NX1A 3TTMA 2E36A 3OL3A 3AL0B 1FJ6A 3LSTA 4BJ6C 1YZ0A 4E4HA 4QBAA 3VFZA 4ENNA 1RKTA 4NWDA 5CBRA 1JQFA 2HXRA 1R23A 1K6OA 3MP8A 2LR8A 1R6ZA 2W85A 2O7IA 3OELA 5L8DA 1XCVA 4BY7J 2XF7A 3G3KA 2L7MP 3R6UA 3U94A 1NMUA 2AL4A 3CUQB 3OYGA 1B0HA 3FJGA 3WTUC 3KFWX 3LSFB 1KU7A 1HA8A 3RTFB 4GYIA 3J81Z 4XF5A 2Z1DA 4ZYAA 1RDXA 4H6DA 1SD6A 1B1BA 4R79A 4IO6A 4FAJA 1TWAJ 2ZJPF 1U5TB 2KRCA 3ZQGA 1MY4A 1XS5A 2E1CA 4E7IA 2QQBA 5CKTA 1ZR4A 2B4MA 3SEXA 1NV4A 4A12A 3DP7A 4B3AA 3IAZA 3TCGA 2Q9TA 3D1NI 3ERED 2MD5A 1JW5A <