1HSJA

Sarr mbp fusion structure
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
487
structure length
487
Chain Sequence
KIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALAAAQTNAAAEFMSKINDINDLVNATFQVKKFFRDTKKKFNLNYEEIYILNHILRSESNEISSKEIAKCSEFKPYYLTKALQKLKDLKLLSKKRSLQDERTVIVYVTDTQKANIQKLISELEEYIKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the SarR protein from Staphylococcus aureus.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription/sugar binding protein
molecule keywords FUSION PROTEIN CONSISTING OF STAPHYLOCOCCUS ACCESSORY REGULA
total genus 143
structure length 487
sequence length 487
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
A PF12802 MarR_2 MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1hsjA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1hsjA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1hsjA01
3KP5A 1K79A 3ELKA 5AA4A 4F22A 5A2QK 3IHUA 3L00A 2RC8A 3SXYA 3TZAA 3GXAA 4MFIA 1I27A 2DLLA 2WKYA 1RI7A 3VVEA 3RTRA 1B05A 3KFMA 1ZGAA 4UV9A 1B7ZA 2B65A 3G7WA 2G93A 2QSXA 3O6IA 3R4KA 4FEDA 2XGXA 1B7HA 4ZZEA 1NMUA 1FX7A 2LF8A 4ND9A 5EEHA 3RPUA 1US4A 2YX4A 2CFXA 4QSEA 2A3SA 4Y17A 3FVNA 2O3FA 2PQ8A 3S2WA 1VE4A 2DK5A 3K2ZA 1W5TA 2DBBA 1UHWA 4OTEA 4EXLA 4R6KA 2ESNA 4IO2A 5LRRA 4ZEIA 5L3DA 3EQ1A 4AB6A 1UB9A 2ZYNA 4OZ9A 3HV1A 4LGWA 5DDGA 1AOVA 4EF1A 1HW5A 2X7QA 4ESXA 2P0SA 2RDPA 1STZA 3E97A 5LEKA 2O51A 5F7VA 4HF0A 3K9TA 1MH4A 4BDOA 2V1DA 1LEAA 3DFGA 1YG2A 4IO6A 4XKPA 3M7GA 2K27A 2X7PA 4FJPA 5LRSA 2XD3A 3TO7A 2E1SA 4MTEA 2HQRA 1W4MA 4LG0A 4F3GA 1CF7A 4ENNA 1G6NA 3V8LA 1T39A 3DPLC 2D5WA 2R6GE 4KR5A 1ONVA 4JBAA 3N6TA 5AE4A 2A6HF 4XLPF 1ZGJA 2IT0A 1P1QA 5BWJA 2Q0OA 1Q35A 4DLDA 4GF8A 4F29A 2XHDA 1F1ZA 4OU0A 3V7RA 3DPTA 2XXWA 3HRUA 2PMUA 1HKQA 1YS7A 5M2VA 1P1OA 2RQPA 4C0RA 2F5XA 4AB5A 1JW4A 2H94A 2THIA 4OOIA 1TNSA 5HLHA 4F2OA 2W84A 3C1DA 3QYTA 1MXXA 4WEDA 4UNOA 2OLBA 3R7XA 3OXNA 3ECHA 1LAGE 3JSOA 3TO9A 4DIGA 3EPEA 3C9HA 4LK0F 5H8NA 2DQLA 3RTWB 1JXSA 3GW2A 4DXBA 1HW2A 2ONSA 3L7WA 3UORA 5ED4A 3TTRA 1U6GA 5CMKA 1WWXA 1GVJA 3JTHA 1BBYA 3L09A 1MQDA 2QPQA 3WTSC 4YKJA 5KZTA 2UWMA 3SEYA 2RF1A 1BTJA 2H4IA 3TTKA 4DNCA 3G3GA 2XXQA 3SEWA 1Z05A 4NF8B 4HAMA 1US5A 4AQ4A 3VODA 3D4GA 4R79A 1OLAA 4TLMB 4F3SA 4EQQA 2OQRA 1DTZA 1N04A 4HV6A 3O97A 3TCGA 4M9ZA 4OMBA 3PGFA 1A04A 4GD5A 2CG4A 3KSJA 1BP5A 4U0WA 1N7WA 2DQVA 4Q4ZF 3G3IA 2A69F 3TGNA 1S7YA 3G73A 1R1NA 1TQMA 4HDVA 3ERED 3V4GA 3KG2A 4IVNA 2RCBA 2OZZA 1BI3A 1Y4CA 4G7ZF 4WCGA 4CO8A 1WDNA 3Q28A 4LZ7A 4WXJA 3H7MA 1QZYA 3LAPA 1RKMA 5ILUA 1ULYA 2EFWA 2ZO4A 3SEUA 2O1LA 2W57A 3OO7A 1LCFA 1D9YA 2L01A 3AAFA 3RKYA 1CGPA 4EUOA 3W15C 2P5LC 5I58B 1B3LA 4P9UA 2CW0F 2QJEA 4Y13A 2XX9A 5FLXK 3EF7A 3U92A 1KU3A 4ZEBA 3E5XA 3E6DA 2QQ9A 1G3YA 1B4HA 1UTHA 1R22A 4CHUA 1OQHA 2QQAA 2Q88A 1YIOA 1S50A 4XSXF 3LBSA 1YCJA 3FVGA 3QXMA 4KUMA 3GXOA 5D8LB 2FNAA 5CYVA 3FMQA 3MVYA 3QOPA 4L9NA 3RJPA 4PZJA 3U9GA 1OLCA 3RPWA 1I6XA 3BROA 3LA3A 2VOZA 2FBIA 3EUHA 2OZUA 2FMLA 5K1YA 5H8HB 2YSRA 3QSLA 1H76A 4CXFA 3LUYA 1ZLJA 3Q5FA 4QFKA 4NEDA 1LFHA 3ECOA 3E3VA 2XHKA 2O6AA 4YZZA 5FTIA 3WTWC 4KHZE 3SFZA 5DV5A 1POY1 4BHPA 1ZAOA 3M9AA 1FTLA 5CVRA 3TOBA 2NRAC 3H6VA 3NEUA 3TUSA 5H8FA 5FFXA 1T0FA 2IEEA 2XVCA 5H20A 1M5BA 5TU0A 1BN5A 1LAHE 2IA1A 5K5RA 1PDAA 1QUJA 1LJ9A 3PQKA 1R7JA 3H3UA 2R71A 1K6OA 1H9TA 2M8EA 4XLNF 4F19A 4OIPF 4X48A 3SKPA 3MAMA 3QRFF 3FJ7A 3SEXA 3KE2A 4A0YA 4P0IA 1G4DA 4PGGA 3C7JA 1NFTA 4XIGQ 3MFKA 3HTUA 2QBYA 1IQ7A 1FTJA 1BIAA 5I2KB 3IO6A 4LMYA 3ODBA 1YW9A 3JSPA 3K6VA 3RYPA 3U1OA 4KIBA 2P5KA 2V1UA 3UP9A 5HVQC 2YPRA 3GYHX 1SAXA 1R9LA 2QMWA 5ISUA 2LSOA 2WWYA 3DLNA 4DZ1A 1RNLA 2RINA 1IXHA 5I59A 4GIZA 1SMTA 1IXGA 3G3FA 4HF1A 1FYLA 2MA3A 4PCQA 1NNKA 2O69A 4HX4A 5A5XA 3RDIA 3VDFA 4EM0B 3I4PA 1POTA 4KA4A 2XX7A 1P1WA 4L9VA 4ELOA 1Y9UA 1JQFA 2ANJA 3CUQA 2B3BA 5AA2D 2GRVA 3RUMA 4MGRA 1D5VA 3WTXC 4FHTA 1IN4A 1SW1A 3CTAA 4L5IA 5DD4A 4ZYDA 1ATGA 1F5TA 2QM3A 3JTGA 2XAHA 1ZIUA 1XGMA 4ETSA 1H9GA 4U1ZA 3DEUA 1MY0A 1LNWA 2Y7WA 4U21A 2EFNA 2VT2A 4PETA 1USYH 4Q0CA 1PBQA 2XKPA 3KZYA 1OMIA 2DO7A 4P55A 3KN7A 3P9KA 3W9VA 2H6CA 4YG2F 5CJ9A 3CUOA 1EV7A 3B73A 4JK1X 2HQNA 1FW0A 3MPKA 2XXHA 4M74A 4YIFA 2XX8A 2Y7PA 2HTJA 2HKXA 3UIFA 1O3QA 3QUJA 4JDFA 2IA0A 4IPAA 2NXOA 3I5OA 4IF4A 3IC7A 1SW5A 3ZS6A 4POXA 5I59B 2R9JA 3T8TA 4C1TA 1IN8A 4LQ5A 4YICA 2LF7A 1OPCA 2E1NA 3HOSA 4HF2A 5BUUA 2D1HA 4EM1A 2F6GA 2F7AA 4RB1A 1D3KA 3E5UA 5DD8A 3O6BB 3FJGA 2PEXA 4NF6B 5IT9K 1F9BA 3KOTA 3ZKLA 3S9LC 2DS9A 3RLFE 4IRHA 2KJBA 5J8FA 4YAHX 1XMKA 3G3ZA 4HBLA 5ERIA 5HS7A 1AL3A 2W85A 4HX7A 1W7PD 4A5MA 3MUQA 4OMZA 4RB3C 3PMWA 4KFQA 1KU9A 2O1MA 3ABUA 5CBRA 1IRGA 3O2AA 3HRMA 2NVUB 1IAWA 3JW4A 3DM0A 4KMUX 1PP7U 2QYOA 1U5TC 4BHCA 5TJJA 3OV8A 5F6FA 1MXUA 3KBRA 4L9TA 3WTZA 4DCYA 2K02A 4U23A 2HOEA 2RC4A 2VBYA 4PP0A 2LAOA 1FP2A 4H67A 3UGWA 3HCQA 1B7UA 1MG1A 3N5LA 4AWXB 1MQGA 1ZJLA 2NNYA 4A6DA 1I1SA 1K78A 5I57A 2EV6A 4M6XA 2A07F 3KZGA 5DTBA 4MQVA 2CYYA 4QWQA 2D2WA 4CYDA 5TPAB 1OR7A 5DVJA 2UVJA 4G4PA 3OSRA 1ZRDA 4EV0A 4HLXA 1XGNA 2V79A 2JPCA 3TMGA 3U1DA 2K7LA 3MEXA 4RPNA 3PUYE 1FT9A 2DWHA 2FXAA 1LBCA 2WV0A 3IB0A 1YO5C 5AA3A 4TQUQ 1TQIA 4E70A 3DV8A 4G94A 1B2HA 5LGUA 1V3FA 2M30A 2VE9A 2I6EA 2HZTA 2Y84A 1G3WA 1P6RA 3K00A 1MXZA 4M1VA 4BDQA 3FXQA 4M71A 2EWNA 3Q29A 1U5TA 2NUVA 3IOTA 3TCFA 3ZSFA 3KCCA 1DUXC 2FF4A 1I69A 4EGYA 4H8IA 3CVGA 4QFPA 4QFOA 1QJMA 4MEXF 2CWEA 4R9GA 2P6TA 3DXJF 4I2OA 1JVYA 1URSA 4R75A 5E1XA 1PP8F 4Y15A 2UYEA 2QLZA 5BOXA 1IUDA 1H45A 3GO5A 2I49A 2A5YB 1FQCA 1SBPA 2XD2A 4IO4A 3GZ5A 2MLGA 3C31A 1WKMA 1S3JA 4A5NA 4EVIA 4ZH4F 1MKMA 2FBHA 2STTA 1AH5A 2Y7IA 2L02A 1B1HA 2IVMA 3GF2A 4A6EA 5HOOA 3KGCA 4WF2A 2A5TA 4GVOA 1MQHA 1B1XA 3GFIA 3TKDA 1LGBC 3IL1B 1OQGA 4WKMA 3REOA 1EH6A 5D5XB 3FXUA 2RN7A 3LSTA 3SZPA 2QWWA 5I56B 1DPPA 2VC0A 4A2UA 3B6TA 1ANFA 3S9NC 2AYSA 3LC8A 1RYOA 2DK8A 4ONYA 4M73A 1HXDA 1ZMGA 2Z33A 2DI3A 2HWVA 3PQJA 3P9CA 3DELB 3BOQA 4MQ9F 1W7PB 1XN7A 3LSFB 4GRKA 3FV2A 4ZZDA 1GVCA 2OQGA 2HXWA 5DT6A 3IKTA 2F6PA 3TDZC 1R00A 4D0PA 3WAFA 2PG4A 4QRZA 1KWHA 3EDPA 1R36A 1R1VA 4MEYF 5H8SA 3HPIA 2BGCA 5ICQA 5DYMA 1BLFA 4B09A 3SQNA 2A6EF 5E1ZB 5J8CA 2CGPA 3U94A 5BPIA 5FFZA 4ECFA 5DEXB 5JFRA 4UHTA 1H3DA 1KU7A 2RC9A 3VEPA 3TYHA 3FMRA 1NNFA 2ZKZA 2KIFA 2QS1A 1NH8A 3QP6A 1XSDA 2ZXJA 5CBSA 3EHUA 2ACJA 3LFKA 1SDXA 4I01A 4KIGA 1DP7P 3VFJA 3ZMDA 3TELA 3BJOA 1TT1A 4YB6A 3HO7A 2I0BA 6PAXA 4EM2A 3M8UA 2Q8JA 3E6CC 4KFCA 3CG1A 1JVXA 5IT3A 1BI1A 3IK6B 1LB8A 1XSXA 3M3KA 4OENA 4QSCA 5D5UB 3VFZA 1EH7A 5L3GA 1JE8A 4NF4A 2HCAA 3RPQA 4GL8A 3TQLA 2PBIA 4OFJA 3IJXB 2Z8DA 2ISYA 3KLOA 3P7NA 2A61A 3CG3A 2DW4A 3C18A 1RYXA 3HIFA 5L3BA 3TODA 2XAFA 3Q9VA 4L17A 4H1XA 1EZPA 4GXOA 3I6VA 1Z91A 1S29A 2RV8A 3COAC 1ZLQA 3FV1A 2G7UA 4OERA 2HR3A 5D4SA 2Z5UA 4RB2C 2OD5A 3C33A 3C36A 3K6XA 4N07A 1TLHB 4JSDA 1JNFA 4ISUA 1RUNA 4EQ9A 4RGRA 1MJ9A 4LA9A 3WGIA 2P8TA 3K01A 5DYHA 2OBGA 2ETHA 3KP2A 3GFJA 4Q8RA 1FTMA 1OIBA 2XAQA 1MY2A 3L6GA 4FT8A 2E1CA 4NF4B 3CO7C 2DWJA 3M3LA 4BDRA 2DOJA 3DP6A 3TDJA 3MZYA 2AL4A 1VR5A 1ZRCA 1FZPB 3GVAA 3V83A 1QVSA 3L2CA 4U4XA 3RI4A 1A99A 5L9SA 2PLYA 3PFIA 1SI1A 3R61A 1B46A 3K6UA 3F21A 2W7YA 4YIIA 1FP1D 3B02A 3VB2A 4GL0A 1S6LA 3WU0A 3GWZA 3V5AA 2PX1A 4OINF 2IA2A 4HCYA 4HZFA 1N0TA 2REJA 4R2BA 4FX4A 1N7XA 4I09A 3T96B 4WWCA 4IRIA 2ALUA 4UXNA 2DWIA 3OO6A 4G8NA 2AIXA 1W7PA 2FSWA 4YKPA 3N6UA 4AVPA 2H25A 2FEZA 4UVCA 4GWOA 2XRNA 1J1NA 1QULA 1XS5A 2UXXA 5DUIA 4NF6A 3D5LA 1R1TA 3LA2A 2PMHA 2HKOA 3HTSB 2HFBA 1OVTA 2VE8A 3B7DA 5K5OA 1LDJA 2C6YA 1MM7A 5E8IA 3O9PA 4NE4A 3IR1A 5DCMA 3QPTA 4OIOF 1QUKA 3F8FA 2OA4A 4R6HA 1C0WA 2E7WA 2XASA 1KA8A 3KEOA 1R9QA 1N76A 5J6XA 1TFAA 2R3SA 2Q89A 5ELVA 5ITPA 4KCCA 2JTVA 1RZ4A 4G68B 4OVJA 3GFLA 1ZG3A 1J5YA 3WAEA 4C1UA 1FBQA 1R1UA 1Y3NA 1I6QA 3THIA 3U2RA 5I56A 3H03A 2DE4A 3O3KA 4IHSA 3OEMA 4RY1A 3SEVA 2MH9A 4NHJA 2I58A 3GX4X 1M5CA 2F8DA 1IN6A 1U78A 1I1GA 4YMAA 2FA5A 3F8CA 1ZKBA 1DPUA 2AS5F 5EYFA 1B9JA 3J81K 1IXSB 1NH7A 1XOCA 4H65A 2FU4A 2DT5A 3E4RA 4A0ZA 1LB9A 3GUDA 1B3EA 1TXFA 1IEJA 1UHMA 5BMZA 1PBPA 1MY1A 2Z99A 4FECA 1OYYA 5LEJA 1J75A 3F6VA 2GXBA 1LLSA 5H8QA 2XUBA 2DVZA 1ON1A 1XMAA 2VHAA 2OZ6A 1NL5A 2QMXA 5B7DA 3H3ZA 4IHTA 3KP7A 3HSTA 3R0AA 2LNBA 3ZN1A 1XGSA 3CDHA 5KDTA 1QO0D 3PPOA 2V3TA 3PD8A 5L9OA 3F8BA 3TKYA 2Q8KA 1U8RA 4F3BA 2ZNSA 3G3KA 2DYXA 1FSEA 3FHZA 1ZREA 4GO1A 4H5FA 4PQJA 1BKAA 1R5HA 5LGNA 2L54A 1MJAA 1MM6A 5H8QB 2R7FA 2DAOA 2X4HA 2PYYA 2VXZA 2NYXA 2EK5A 4XSZF 3GFMA 1LAFE 3I58A 2DWAA 3QU6A 2D1VA 3MP1A 3UK4A 2XIGA 1YLFA 3DP8A 3KEIA 3IX1A 1RUOA 3B6QA 4I8CA 4L5JA 3SERA 2CQKA 5K2YA 4RB0A 1D3YA 2OWTA 2HTSA 3EYYA 1BC7C 2H5YA 5I84A 4L0ZB 3WG9A 3EHSA 1B51A 4WK8F 3F8NA 1SYIA 2DE2A 4K2EA 2V84A 1B5JA 4HDUA 4LB6B 1GXPA 1P92A 3IO4A 3O66A 2ZNYA 1Q1HA 4HW0A 4G68C 3W6KB 5BQTA 1XB4A 1UTHB 1BOAA 2ONKE 5F1QA 2ADUA 4R2FA 5DVIA 2YX7A 1QPMA 3F72A 4ZE9A 4QLCU 1MZBA 2FYIA 2A68F 3ABTA 3PD9A 4BDMA 3SETA 1HQCA 3EYIA 1O63A 4QSDA 1DPRA 1PB8A 4KYDA 2ZMEB 3TTMA 5JTYB 2UXNA 4OIRF 4ZYEA 3WGHA 4EJWA 4ESFA 2Z8EA 4LZ8A 4L18B 5JK4A 3T1BA 2MD5A 3FM5A 5L3FA 4OYVA 4UACA 1Z6RA 3PPQA 3CUQC 4G6QA 3S9MC 1GR2A 4MF3A 3BP8A 3BJ6A 2O03A 4AIHA 3HN0A 2JSCA 1S9TA 2ZYOA 5JEIA 1J9IA 4WX9A 3K4UA 3KFWX 1F9NA 3HSEA 1LQ1A 2O7IA 3E5QA 3D4CA 4G8HA 5J1DA 4MHGA 2G9WA 1UIVA 3CSBA 3QAXA 2FOKA 2O84X 4MTDA 1YTVA 4G68A 1WI9A 4GGGA 5IT9Z 2M8CA 3W6JB 4FAJA 4O3BA 4ESJA 4EDPA 3RYRA 1S7AA 2PN6A 2EA4A 4BDNA 1PB9A 2HZKA 3F22A 2ISZA 2COMA 5HLGA 4CDGA 1MJBA 2BV6A 3RY3A 2I4CA 4RGXA 3I54A 2K86A 5DCMB 3MJNA 4LFUA 5FHMA 1O64A 3S4UA 4U1OA 5CM6A 5LHGA 4WEPA 2FA7A 5CRYA 3V8KA 5EHMA 4AD9A 3FUZA 1SQYA 4ESWA 3OD7A 2VBXA 3I64A 4Q47A 1S7OA 2AL5A 4NB5A 4N13A 3OOAA 5ITOA 5EEGA 4ENKA 1P4AA 4P5OA 1J59A 1H44A 5ILVA 3P9IA 5D4RA 4RJZA 5HLIA 1B4ZA 2IJLA 1LBBA 5LLQA 2ZNTA 2B0LA 2K4BA 3CFZA 3VLUA 2JT1A 4BYYA 2IP2A 2QZ8A 4ZEFA 1SW2A 3VXBA 1Y3QA 2XXXA 3FX3A 4XKQA 1JHHA 4UVBA 1FLIA 4HTGA 2ZNZA 2V3QA 1FTKA 3U72A 1K78B 4HQEA 3JZJA 5I57B 5I2KA 1B6AA 4EJTA 3QP5A 3V89B 1Q1KA 4A12A 2FNCA 2Y0MA 3RTFB 4XKNA 5TRDA 1BC8C 4U2RA 2ZYKA 3PUWE 1Z9CA 2Z3YA 2NWJA 4ON0A 3A09A 2GAUA 4U4SA 2Z9OA 1O3TA 4LP2B 3DQVC 1HSJA 2YR2A 3K0VA 3VXCA 2F97A 4X1DA 2PT2A 5CVIA 2EJRA 2GQQA 1JGSA 2P7VB 1B6HA 4YKKA 1B4AA 1VFEA 2Q2AA 4IY6A 4F1UA 4TV7A 5FB2A 3MZ1A 4EQ7A 2DVCA 2QQBA 4HQMA 1VTNC 3LQRA 1ZRFA 1NNTA 2ZCWA 1KGSA 1ZLKA 2Z22A 1QUIA 3GLBA 2DPDA 2EA2A 2XAJA 3ZPLA 3F11A 1MXVA 1FPQA 1GTKA 1B40A 5ILSA 2H6BA 4XXUA 2HAUA 4GYGA 4M4GA 3IWFA 3MWBA 3RQTA 4GCVA 3T9UA 1IW7F 3KN8A 3VVDA 4DQ2A 3ZKKA 4CGZA 1YFHA 3OSQA 4R6YA 1GGGA 1SMYF 3I3VA 1P99A 3TFLA 2HAVA 5F64A 2KIUA 3N94A 2VD2A 3K1NA 3IOWA 5FHNA 4JXIA 1PB7A 3M8FA 1UIUA 1CE2A 4R1HA 1O3SA 4EXKA 2VBWA 5CVVA 3TOAA 1IUYA 3FATA 2H98A 1VSOA 5ICEA 1N3WA 4LLGF 3UN6A 1Y1ZA 3IOVA 2CSOA 2FQ3A 1USTA 1ZG5A 5AA4B 3T9VA 3VV5A 5KCJB 2EV0A 5CMCA 3ZP5A 3WTVC 1EZOA 4L0YB 3H6TA 4R73A 1REPC 3PMVA 3GEZA 1SYHA 4UA8A 1T2KA 3H06B 5DEXA 3CUQB 3J7AO 3C32A 4E0XA 4PGHA 3QUFA 4BLAA 2OK2A 2MH2A 3KJ7A 2JRTA 2I0CA 3G3JA 3IJOB 4YFKF 1DMBA 3ILTB 5A5XB 1HSEA 1HW1A 3MZ9A 3LSLA 3Q25A 4LATA 2HS5A 2F5CA 4IGRA 4IO7A 4BXUA 4IO3A 4ZDMA 3PPNA 1B58A 4I98B 5FLXZ 3TPAA 2MC3A 2TDXA 1U5TB 1O7TA 1PDNC 4PFTA 1HKTA 4RAYA 4AIKA 5H6RA 3ZMUA 3UA8A 4ENMA 3DP7A 4NF8A 1EH8A 1ZN2A 2VONA 4HV5A 1FQBA 4PDKA 1FBUA 1P1NA 1AOYA 2M5WA 4BH9A 4KCDA 5FGMA 1TWYA 4QFLA 1USSA 2HYFA 1ODDA 4RNSA 1B3GA 3HRSA 1QGPA 1LDKB 5HDGA 2KJCA 5ICCA 2JZYA 4ENJA 2W24A 3ULQB 2DTRA 3IWZA 3WTTC 4MLQA 3IRRA 4O3AA 4IO5A 2F78A 3V7CA 3CLOA 1IXRC 3IL2A 4NTLA 4XRFA 3WE3A 3KZZA 1B3HA 2B3FA 3HHFA 1II5A 3FVKA 1TBXA 4F39A 2ESHA 3PU5A 4BDLA 4WXDA 1D4NA 1QBJA 1GHCA 2QENA 3BWGA 4U22A 4PFWA 4U0VA 1KQ8A 1ZBMA 3MVWA 2BJJX 3BFTA 4RK2A 5HM4B 2O6GE 4POWA 1ZTYA 1Y0UA 4U0YA 5EHSA 4XBFA 2NNNA 3VLWA 4M9XA 1QW0A 3U8QA 4UUVA 3RT8A 2RC7A 1X3UA 2QUFA 3VLVA 2XV4S 4LK1F 3C35A 4IJAA 3JV9A 3OELA 4OHNA 3SDFA 4LJZF 1Y1MA 4LD5A 1N84A 2VGQA 3W9WA 4DXCA 5DVFA 4HS7A 1O3RA 3FVOA 4WXCA 3ZMSA 2GFEA 3K6WA 2VBZA 3FASA 3T9HB 4JWOA 2V6CA 1B9NA 4F1YA 4KMFA 3JAMZ 1ZHFA 5CVJA 1M5DA 5JR3A 2UVHA 2I48A 4EQBA 3C34A 5FTHA 5ICGA 3MVXA 4RAZA 4BNCA 4GLIA 3RKXA 3TEPA 2XAGA 5AA1A 3OOPA 4CICA 2Y75A 3V8XB 3DKWA 1IF1A 1SFEA 3K02A 5TPAA 3ZQ7A 4HA8A 4RS8A 3MP8A 4NF5B 5JI6A 4R72A 3NQOA 1NHAA 2CO5A 1KQ9A 1FOKA 1BI0A 4GQOA 4OEUA 4IGTA 4Z2YA 2GHAA 2F36A 3K69A 4KIFA 2EV5A 1B0HA 3A3UA 1AWCA 2I4BA 2VP1A 1WVJA 1QKAA 1WQ2A 2LDUA 4ELQA 1UTBA 3E3KA 2DXYA 2HEOA 2KIMA 1FWZA 3T8RA 3N4MA 4R9FA 1FBSA 3BDDA 4EGZA 3EQLF 4Z0IA 1B5HA 3P7IA 1P4WA 4BHBA 1XSVA 3TO6A 2QS4A 2DSFA 3CFLA 2E0SA 1A8FA 5BPDA 1JEVA 4HX8A 4ESBA 4GXAA 4H5GA 2L4AA 1S8NA 5E20A 2XKOA 3TTNA 4YMBA 5HPQA 1FNNA 2EB7A 4OETA 4UVAA 3HSFA 1XVXA 3GBBA 2Y7KA 4F7ZA 1IN5A 3CJNA 3R6UA 3PUZE 1AMFA 1OVBA 1CB6A 2L3DA 3I59B 5HDNA 1FTOA 2VODA 2P6SA 3F8MA 3QPHA 1SD4A 1XGOA 3T0YA 4P96A 1MS7A 3PV0E 3LA7A 4P11A 4S05A 3I0TA 3SESA 1YYVA 4G77A 4KYSA 4YFXF 3K1PA 1FY7A 3HOTA 2A5SA 4OEVA 3T66A 1OYIA 3F23A 5HBCA 1B52A 1IXIA 4QF9A 2L4MA 2ABHA 3U93A 1J0RA 1SD6A 2OCUA 2ELHA 1B59A 2WC2A 1IZ1A 1MQJA 4OFOA 5E8GA 5K5QA 4O3CA 1E2XA 4NWDA 3IRQA 3KN3A 5LHIA 4O5VA 1PC3A 1XC1A 3CO6C 1O7FA 1QNTA 2F7CA 4U7DA 1MPDA 4K3FA 2RKMA 2P4WA 1Z7NE 4WXHA 4DDDA 3FIRA 1D8KA 1OMPA 5CMMA 3H6WA 3MPLA 3WGGA 3BZ6A 3BFUA 4OMYA 1NNPA 3T5XA 4F1VA 4F3PA 5ICFA 2PMSA 1QZZA 5LHHA 1BIYA 2DU9A 2GH9A 2NS0A 3RGYA 2FMYA 2XXYA 5DUKA 3BPXA 3R0JA 1DDNA 3V8JA 4Q5SF 4ZYGA 4F2QA 3KSXA 3LSXA 5H8HA 3RN8A 3VVFA 3LSWA 2EFQA 3GZGA 4ZECA 4YFNF 2MBFA 1MXWA 3F6OA 2UYFA 2AXLA 1P1UA 2K4JA 4G8MA 1ZARA 2VC1A 3IB2A 4GFRA 1N3XA 3I53A 3K1MA 3CR9A 2XXIA 4QFNA 2D21A 3KETA 2Y48A 3GBAA 1JEUA 3LQQA 1ZH5A 1MQIA 3Q27A 1XDUA 4YB5A 2XXUA 5B70A 1BI2A 1TNTA 5KK1A 2QRYA 3O28A 1I6BA 2F5DA 1Y3PA 3EHTA 5I2NB 5LBQA 4LONB 1R23A 3H4ZA 3OO8A 1L3LA 3VOEA 2OJTA 2BEOA 1Z7ME 4DXUA 1URGA 4G7OF 2P1SA 2D45A 1BM9A 4LUBA 4Q30B 5CI5A 2V9VA 2F35A 1YTYA 4NMYA 4N9HA 1SI0A 2QVOA 3LR1A 2UVGA 1M5EA 1MDMA 3QAHA 4I62A 5TP9B 3PUVE 5CVUA 1PUEE 4HCWA 2O0YA 2ZFWA 4H6DA 4PFYA 3MAJA 3LWFA 2P2AA 4R74A 1KYWA 1GXQA 1HBXG 1O57A 1E17A 2NOOA 5D6FA 3MCZA 4NQWA 1ZYRF 1LDDA 5FHOA 5H6QA 2ZJ2A 1GV8A 5FD6A 3KOSA 4KT5C 3T9XB 4TLLB 1B9MA 1FC3A 2HGCA 2J5OA 3QU3A 4MBPA 4IY5A 1UTBB 3HRTA 1U3EM 2G7HA 3S9EA 1L0OC 4R8HA 4RK9A 4OFLA 4BQAA 2DFIA 2XXPA 2X26A 1MD0A 1I5ZA 2GA1A 5DEQA 2H27A 4EF2A 3OO9A 3MP6A 2VOPA 4NF5A 3PMXA 2RGVA 4M6YA 2HEUA 4JB7A 4O6JA 2OWSA 5H8NB 3J80Z 1MXYA 2CZLA 2GA2A 2BE5F 4ZS9A 1VFDA 1IITA 5E1WA 2X0LA 4KYWA 4F18A 3HUGA 1SVXB 4AIJA 5IAIA 1A40A 2KRFA 1EZ9A 4ZEDA 1U2WA 3B6WA 3T22A 3PPRA 2F7BA 5AIQA 2DXRA 4MH5A 2EFPA 4MNUA 2ZXTA 3H92A 4KI0E 2BBYA 2H09A 2QS3A 2OU2A 3KLNA 3O2PE 1FYKA 3IORA 1CF7B 2M1BA 1QKBA 4LB5A 5AA2A 1A55A 1R58A 3FGSA 2ZBKA 5TP9A 3PUXE 4Q5TA 2IA4A 5D5VB 2PFBA 3RNNA 2HYGD 3FJMA 3HHGA 1RIOH 4FEBA 4I9DA 1SFUA 3LAJA 2NAZA 4LLLA 3WTYC 1MY3A 2XROA 2DE3A 4JQFA 4ZE8A 5LOMA 1I6AA 2RKHA 4JWYA 1HSLA 4H0EA 3FMSA 1YAEA 3ISPA 4KPTA 1WODA 4U88A 5I2NA 1UQWA 2IW5A 4X1BA 3Q26A 2OAZA 1MDP1 2Q9TA 2H99A 3WU1B 1TTYA 4NWCA 1A7LA 1SW4A 2Q2CA 2O8XA 3V7SA 2EFOA 4ZZLA 5D8KB 3HYIA 4GXSB 4I7HA 5KDTB 2XXRA 2UXAA 3M3FA 3GLXA 1P4XA 2DQRA 2VN2A 3ONMA 3N26A 1Y20A 3T93B 1XT8A 2ZNUA 2RCAA 4IB2A 3ROUA 3E13X 1YQAA 3L6HA 1D8JA 2F34A 2VT3A 1SD3A 1DSNA 3S2VA 1NKXA 3BKIB 4ELPA 2HQ0A 4H8JA 4N6PA 3FWEA 3O6HA 3OMBA 1EU8A 4RPOA 3J80K 1LB2A 3C3WA 4M9SA 3TDUC 2QL3A 3TAJA 2GZWA 4PFUA 1QQIA 1MH3A 3FF5A 3BPVA 3AXFA 1YW8A 5F1RA 1FSHA 1R6ZA 2OBPA 1YPNA 3RKWA 2V1XA 1WSUA 3KP3A 1KQ0A 1T98A 5CMBA 3PPPA 3KP4A 3BBRA 4OIQF 4KYEA 1B5IA 3KJTA 4A0XA 4KN7X 2WTEA 2V25A 5AIPA 1XCBA 1SD5A 1T38A 1Z1DA 1JW1A 1LSTA 1FQFA 4RA1A 2J5PA 1D9VA 3ML6A 4XKRA 2G29A 3CFXA 3ZMVA 3MWMA 1YW7A 3K2DA 3VE1B 1A8EA 3MW0A 4U7BA 5D5WB 5JVTA 1MRPA 3K0LA 3MC2A 3O6GA 4I0AA 5K2XA 1TFDA 3O29A 2O61A 4JBZA 2PBWA 2GXGA 2KLFA 2M87A 1DOTA 2XXTA 3OEKA 1FCKA 1HKSA 4I0BA 4G9YA 3F3XA 1ZG1A 3ZMZA 3ILUB 1H43A 3H3GA 2IRFG 3FZVA 1LFGA 1LVAA 3CI8A 4CZZA 1ZU0A 3R26A 5I58A 1G3TA 4KICA 4I1DA 3RT6B 4OXVA 2FRHA 1W5SA 2BYVE 2GWRA 1FYMA 4GYIA 4P0GA 3R6SA 4B8XA 2STWA 3ZN0A 1Z7UA 4ZEKA 3MQ0A 3M8EA 3R60A 4DCXA 4ZZAA 5FD5A 3IB1A 3M1EA 5L8DA 1UCRA 1J2XA 2VOOA 4LVQA 1LEBA 2FBKA 3EN3A 3N97A 4G7HF 1V4RA 3WTUC 1URDA 5JHUA 2RNJA 3JAMK 1WRJA 5DCFA 4OQOA 3L9FA 4G2ZA 1B1BA 1IXCA 2MLKA 2CMOA 1XCVA 5E17F 2KKOA 4YU0A 5LGTA 1MPBA 1TW2A 4KDPA 2ZMBA 4GOTA 3RIRA 3IKVA 1SFXA 2Y7RA 5CLSA 2I3WA 5KCJA 3TCHA 1LAXA 3E6MA 2QS2A 1TQPA 4IXAA 4FORA 1TW3A 4ASNA 1JHFA 4QHQA 1KYZA 4EJUA 2Q2EA 1KU2A 3KP6A 4OWDA 4YB7A 4EJOA 4M72A 2O68A 1B32A 4OESA 3WODF 4KN4X 4THIA 1HSTA 1XD7A 2UZKA 4L9JA 3DP4A 2YU3A 5E18F 3MZHA 3IAZA 5L3CA 4G6DA 1SD7A 5L3EA 4ELRA 5A2QZ 4F31B 2ZYMA 2XXVA 1F4KA 4P9FA 3CSGA 2YPNA 4KQPA 4Z7EA 1IIWA 4LZ5A 2F2EA 2F5EA 2P5VA 3MZBA 3IOUA 2VD3A 1B0LA 4RXLA 5FO5A 2ONRA 4PE5B 2Z8FA 3MVZA 2QBYB 4XTCQ 3E9XA 4YKIA 5ICTA 1G3SA 1Z6TA 4FX0A 2E7XA 1IRFA 3JYRA 4FATA 1Y4TA 4JSOA 1PEBA 1UFMA 5KVRA 1FQEA 2FE3A 4RGUA 3SHFA 3QK6A 3BJAA 1M5FA 3DF8A 3CIJA 4FE8A 2IPQX 2PJPA 3HHHA 5H8FB 1BJAA 4EMSA 1DTGA 1XDSA 2H9BA 4S04A 4LG0B 4JWXA 5HDKA 2YLNA 3A3CA 4N0BA 3MQ9A 2FNPA 3EETA 1EH3A 5AONA 1O7LA 4HLYA 3HSRA 4E0WA 4I02A 2P7CB 3Q9SA 3NRVA 4ZYHA 3OENA 3TQWA 3D0SA 1A54A 2DP8A 3USDA 1P2FA 2RVCA 4LQ2A 2HDCA 4O3MA 3FD3A 4H0WA 3E6BA 1YS6A 2D3IA 2PT1A 3WE2A 3CRBA 5HS8A 4DE8A 2PI0A 1LFIA 2LKPA 1MDQA 1T0KA 4MLVA 1OKRA 2F5FA 2REGA 4FIMA 4RGSA 1L5TA 2GHBA 2JPBA 5BS6A 1H0MA 2Z23A 1T6SA 2R7DA 4HOBA 3I59A 4HW8A 1XHYA 2M45A 4N9IA 1LCTA 4HYEA 4KD5A 3QIMA 3GZ6A 2O7UA 5JTYA 3ZMTA 2ZMEA 2V93A 1XVYA 3BY6A 2YJPA 4G8XA 1FQDA 4X9TA 3FXRA 4EJVA 5AA2B 1DPEA 2GIVA 1BIBA 3G3HA 3I5UA 1JETA 3I71A 1AIVA 2W25A 2HFHA 1K7AA 4KNYA 5L9MA 4TOZA 3MBPA 3TQNA 2HZLA 1OYWA 2DPUA 1USYE 4UV8A 5D6EA 4IRGA 1FQAA 1R5GA 4LLNA 3J81Z 5IKBA 4RYAA 4BAYA 3KEQA 2A5TB 3C4MA 1J7KA 1MDMB 3ECRA 2PVUA 1IN7A 1MGTA 1MY4A 1ON2A 1ELJA 2V3UA 1MPCA 3FM3A 3TTLA 1B3FA 2I3VA 2UVIA 3H6UA 4Q48A 1JW5A 5CC2A 5HS9A 3SZTA
chains in the Genus database with same CATH superfamily
5K7HA 3KP5A 1K79A 3ELKA 5ET8A 4GBWA 4F22A 5A2QK 5AA4A 1AA7A 3IHUA 3BTCA 2FQ4A 3L00A 1TWCJ 4ESXA 3OYMA 2RC8A 3SXYA 3TZAA 3GXAA 4MFIA 2IS6A 1I27A 2DLLA 2WKYA 1RI7A 2XB5A 4BEHA 3RTRA 1B05A 3KFMA 3VVEA 2D5VA 4OVTA 1ZGAA 4UV9A 1B7ZA 2B65A 4B1RA 3G7WA 2MC4A 1VQ9I 2G93A 2QSXA 3O6IA 4CYCA 1Q1VA 3R4KA 4FEDA 5E79C 2XGXA 2XF7A 1P9QC 2XXKA 4H45A 1B7HA 4ZZEA 3GCMA 1NMUA 1FX7A 2LF8A 4E7KA 4N6KA 2VIXA 3PSFA 1IDZA 4ND9A 5EEHA 3RPUA 4PBHA 2WAEA 1A31A 1US4A 2YX4A 2CFXA 1OQYA 4QSEA 2A3SA 3ZGKA 4XEQA 4Y17A 3FVNA 2WY7Q 2O3FA 2PQ8A 3S2WA 1JKQC 3S15J 1VE4A 2DK5A 2P81A 1W5TA 2DBBA 1UHWA 3K2ZA 4OTEA 4EXLA 4R6KA 4NQWB 4D7NA 1A35A 2ESNA 1ZTRA 1WH5A 5LRRA 5L3DA 3EQ1A 4IO2A 1UB9A 4ZEIA 4AB6A 1I6HJ 3P5JA 2ZYNA 4OZ9A 1X3WB 3HV1A 3BT9A 4LGWA 5DDGA 4J01A 1AOVA 2ELKA 4EF1A 5M3MJ 1HW5A 2X7QA 3HOWJ 2P0SA 3OYKA 2RDPA 1STZA 3E97A 4DBRA 5LEKA 2O51A 5F7VA 4HF0A 3K9TA 1B72A 1MH4A 5GPCA 5F1QA 4BDOA 2V1DA 1LEAA 2GOMA 2QVUA 3DFGA 1YG2A 4IO6A 3I4MJ 4XKPA 3M7GA 2K27A 2X7PA 4FJPA 5LRSA 2XD3A 3TO7A 4KISA 4C9YA 2E1SA 2BXZA 4FETA 2WAQA 4MTEA 2HQRA 1W4MA 4LG0A 4F3GA 2IEKA 1CF7A 3ERMA 2PJRB 4ENNA 4FBPA 2M3AA 4AVZA 2L7FP 1G6NA 3V8LA 1FTTA 4N15A 2Y2ZA 1T39A 3DPLC 1VQ8I 2D5WA 2VT5A 5EQAA 4ZC3A 2R6GE 4KR5A 2K9SA 1ONVA 4JBAA 3N6TA 5AE4A 2A6HF 2HDWA 1ZGJA 4XLPF 2IT0A 1P1QA 5BWJA 2Q0OA 1Q35A 3ZR8X 5I7IA 4DLDA 4GF8A 2IS1A 3NOHA 4F29A 1DP3A 2XHDA 1F1ZA 4OU0A 3V7RA 3DPTA 4DZPA 2XXWA 3HRUA 3BR1A 2PMUA 4M3BA 1HKQA 1YS7A 5B66C 5M2VA 1P1OA 2RQPA 4C0RA 1Q9DA 2F5XA 4AB5A 2JUGA 1JW4A 2M0MA 2H94A 3CCJI 4OOIA 1TNSA 5HLHA 2THIA 3OL4A 4F2OA 2W84A 1RDYA 4UB6C 3C1DA 2Y5KA 3QYTA 1AWBA 1MXXA 2XPVA 4WEDA 4IKFA 4UNOA 4L5EA 2OLBA 3R7XA 5DTDA 4H4KC 3OXNA 3ECHA 3IFAA 2CW7A 1LAGE 3A4CA 3BQYA 4W1UA 3TO9A 3JSOA 1AHDP 3EPEA 3C9HA 4LK0F 4DIGA 2W48A 2DQLA 5H8NA 1JXSA 3RTWB 3GW2A 4DXBA 1HW2A 4M3GA 1POGA 2ONSA 2R4GA 3L7WA 3UORA 5ED4A 3TTRA 1U6GA 5CMKA 1S72I 1WWXA 1OCOH 1DCUA 1GVJA 2JJKA 3JTHA 1BBYA 3L09A 1MQDA 2QPQA 3WTSC 4YKJA 5KZTA 4KJZA 2UWMA 3SEYA 1R49A 1LVKA 2LC2A 1BTJA 2RF1A 2H4IA 2TRTA 4KITB 3TTKA 2HI3A 4DNCA 3G3GA 3TW7A 2XXQA 2CUJA 2JA2A 4PAFA 3SEWA 2M7BA 1Z05A 4NF8B 3GTMJ 4HAMA 1UJ8A 1US5A 2DYSH 4QPQA 3E79A 4AQ4A 3VODA 3D4GA 4R79A 1OLAA 4TLMB 1ETYA 4F3SA 3W2VA 2KL4A 2ZZWA 3MD2A 4EQQA 2OQRA 1DTZA 1N04A 4HV6A 3O97A 3TCGA 4M9ZA 4OMBA 5I3SA 1F43A 1A04A 3PGFA 4GD5A 2CG4A 3KSJA 1BP5A 4U0WA 3OMYA 2ZJPF 1N7WA 2DQVA 4Q4ZF 5E3MA 4V2GA 3H9QA 2P3VA 3G3IA 2A69F 4FISA 1UZCA 4OVRA 1GV5A 2F4IA 3BIGA 3TGNA 1S7YA 1A6QA 1F36A 3HGYA 2ECBA 3G73A 1R1NA 2R7OA 1TQMA 1Y56A 3ERED 2KMUA 2WADA 3Q0UA 3V4GA 4HDVA 3KG2A 3LMMA 4QSHA 2KZGA 4IVNA 2OZZA 2RCBA 1BI3A 4AIDA 3WHBA 2PFZA 4IX7A 2A6TA 1RETA 4WCGA 4G7ZF 4CO8A 2MSYA 1Y4CA 1WDNA 3Q28A 3VYUB 2LLKA 4LZ7A 4WXJA 2DJIA 5GPAA 3PTYA 3H7MA 1SVMA 1QZYA 3LAPA 4FCYA 1RKMA 5ILUA 1LKXA 1ULYA 2EFWA 2ZO4A 1FTAA 3SEUA 2O1LA 4XOTA 3JREA 4HXVA 2W57A 5HODA 4CSWA 1LCFA 3OO7A 5BUUA 4A3KJ 2EQRA 4E7IA 3MYUA 1D9YA 1Z67A 2L01A 5A5LA 1FSAA 3AAFA 3RKYA 2LKXA 1CGPA 4EUOA 4PFBA 2P5LC 3W15C 5DM6F 4P9UA 2CW0F 1B3LA 5I58B 4HPQA 4Y13A 1G2HA 2QJEA 2XX9A 5FLXK 4BJ5C 3EF7A 3U92A 1KU3A 1MMAA 4ZEBA 2BY1A 4DYRA 3E5XA 3E6DA 2QQ9A 1G3YA 3HC7A 1B4HA 3MKZA 1UTHA 1R22A 4CA0A 4QTRA 1AKHB 4CHUA 1OQHA 2QQAA 2Q88A 1IC8A 1YIOA 1S50A 4BQOA 4XSXF 3LBSA 3N05A 1YCJA 3FVGA 4OVSA 3QXMA 4KUMA 3GXOA 2ZJRF 4NUBA 5D8LB 3CCSI 2FNAA 5CKTA 4NX1A 4HEA2 3FMQA 5CYVA 3MVYA 3OYEA 3QOPA 4L9NA 5ET6A 3RJPA 3CMAI 1BOBA 1X1AA 2IS2A 1V5EA 4PZJA 1XG1A 3U9GA 1OLCA 3RPWA 1I6XA 3BROA 3LA3A 1VQNI 4BQQA 2VOZA 2COBA 2FBIA 2ID6A 2W82A 3EUHA 3IH3A 4JYKA 4B3AA 1APLC 2OZUA 2FMLA 1T33A 3PUBA 5K1YA 2E34A 5H8HB 2YSRA 3QSLA 1H76A 4CXFA 3LUYA 1ZLJA 2R7WA 3Q5FA 4QFKA 3T0JA 3RSNA 4P8BA 4NEDA 1LFHA 3ECOA 4W97A 2DFFA 4XN3A 1RKWA 3E3VA 2XHKA 3L2UA 3HEFA 3GTGJ 5EZHA 5FKNA 1IMBA 2O6AA 4YZZA 5FTIA 3WTWC 4KHZE 3SFZA 5DV5A 1POY1 4BHPA 5E3OA 1VF9A 1ZAOA 1MBEA 1OCZH 3FISA 3M9AA 1FTLA 3PUFA 5CVRA 3TOBA 2NRAC 3H6VA 4F52A 3NEUA 3TUSA 2FJ1A 5H8FA 5FFXA 1UAAA 3FHNA 1T0FA 3OYLA 2IEEA 2XVCA 5H20A 3M4OJ 1M5BA 5TU0A 1BN5A 5E3NA 1LAHE 2IA1A 5K5RA 1PDAA 1QUJA 4XLHA 1WHUA 1LJ9A 3PQKA 1R7JA 2IS4A 3H3UA 1FPLA 2R71A 1K6OA 3D5RC 2BW3B 2M8EA 4XLNF 1H9TA 4F19A 4OIPF 4X48A 1ACIA 3SKPA 3MAMA 3BG7A 3QRFF 3G4SI 3RQ4A 3FJ7A 3SEXA 3KE2A 1SAUA 1NUZA 4A0YA 4P0IA 1G4DA 4PGGA 3C7JA 2NVTJ 4GFBA 1NFTA 4XIGQ 2CQ7A 3MFKA 3HTUA 2QSFX 2QBYA 1IQ7A 1FTJA 5IZZA 1BIAA 1A6IA 2QFLA 5I2KB 2E71A 1QRYA 3A01A 3IO6A 4LMYA 2BZTA 3ODBA 1YW9A 1KZHA 3JSPA 3K6VA 4BY7J 2ZZXA 1MIJA 3RYPA 3U1OA 4KIBA 3KYCB 2P5KA 2V1UA 3UP9A 3EUKL 5GADJ 5HVQC 3IV5A 4HRIA 2L9VA 2YPRA 3GYHX 1SAXA 1R9LA 2QMWA 1X1DA 4PFPA 5ISUA 2LSOA 3K4CA 2WWYA 1WPKA 3DLNA 4DZ1A 1RNLA 2LVSA 1T0FC 1IXHA 2RINA 5I59A 4GIZA 1SMTA 2EH3A 1IXGA 3G3FA 4HF1A 1FYLA 2MA3A 4PCQA 1NNKA 2O69A 4HX4A 5A5XA 3RDIA 3VDFA 4EM0B 5B5EC 2M9HA 4J00A 3I4PA 1YRNB 1VI0A 4A3DJ 1POTA 4KA4A 4PSXA 2XX7A 1FBDA 1P1WA 4L9VA 4ELOA 2XDVA 1ZKGA 1JQFA 1Y9UA 1MBHA 1X4OA 2ANJA 3CUQA 3MVPA 2B3BA 4OWRB 3PJRA 3G2BA 2F3DA 5AA2D 2DMUA 5H2FC 2VPNA 2GRVA 3RUMA 4MGRA 2KQZA 1LBYA 1D5VA 3WTXC 4FHTA 1IN4A 5CPRB 2HOSA 1SW1A 3CTAA 4L5IA 5DD4A 4ZYDA 3F0CA 3FXJA 4D5CA 2QM3A 1F5TA 1ATGA 4MCOA 3JTGA 2XAHA 1ZIUA 1XGMA 3K4BA 2DOFA 4XLFA 4ETSA 1H9GA 4XF5A 1WJAA 4U1ZA 3FKIJ 4GRIA 3DEUA 2IXSA 2WAFA 1MY0A 3RPUD 1LNWA 2Y7WA 4U21A 2EFNA 2VT2A 5CQEA 4BUPA 1XS9A 1USYH 4PETA 4Q0CA 1PBQA 2XKPA 5EEAA 2DDBA 3KZYA 1OMIA 2F3BA 2VKDA 2DO7A 1RDXA 5E3LA 4P55A 4IQJA 3KN7A 3P9KA 3JRAA 3W9VA 2H6CA 3OS0A 4YG2F 5CJ9A 3BTLA 3CUOA 1EV7A 1K6YA 1FIPA 3B73A 4JK1X 2HQNA 5BNGA 2PX9A 3GMEA 1FW0A 3BZKA 1W36D 3MPKA 2XXHA 4M74A 1FJ6A 4YIFA 2XX8A 3HZJA 2Y7PA 2QKMB 2JVHA 2HTJA 4A3IJ 2HKXA 3UIFA 1O3QA 3QUJA 4JDFA 2IA0A 4IPAA 2NXOA 3I5OA 4AS4A 1JTYA 3IC7A 4IF4A 1SW5A 3ZS6A 2CZHA 4POXA 5I59B 2R9JA 3FXOA 3T8TA 4C1TA 1IN8A 4LQ5A 4YICA 1X1PA 1OPCA 2E1NA 2LF7A 3HOSA 3CCUI 3OYIA 2D1HA 2LK2A 4EM1A 4HF2A 1NV6A 2F6GA 3NAUA 2F7AA 1IRXA 2L7KA 4RB1A 2VXDA 4DYCA 1D3KA 3E5UA 2CU7A 5DD8A 3O6BB 2LBFA 3FJGA 2PEXA 1BW6A 4OAZA 5IT9K 4NF6B 1F9BA 4P47A 3CCMI 2XPWA 4RM2A 4NG7A 4UUSA 4DI3D 2E36A 4HE0A 3KOTA 3VSLA 3ZKLA 3S9LC 4Y3OA 1X4PA 2DS9A 3RLFE 4IRHA 2KJBA 5J8FA 4D9JA 4YAHX 1XMKA 3G3ZA 4HBLA 4MFEA 5ERIA 1QA6A 4PF6A 5HS7A 1AL3A 2W85A 4HX7A 1W7PD 4A5MA 2MFZA 3MUQA 4OMZA 3E1SA 2DCEA 4RB3C 1IJWC 1KU9A 5KCMA 2O1MA 3PMWA 4KFQA 3ABUA 5CBRA 1IRGA 5FKKA 3O2AA 4MLOA 3HRMA 5KAIC 2NVUB 5GAHJ 3JW4A 3OSGA 1IAWA 3DM0A 4KMUX 1PP7U 2QYOA 1N78A 1EKEA 2H8WA 4O7IA 2ZB9A 1U5TC 4BHCA 5TJJA 3OV8A 5F6FA 5EGOA 3JRFA 1MXUA 3KBRA 3BR2A 1UG2A 4L9TA 3WTZA 4DCYA 2ICWG 2K02A 4U23A 2HOEA 2F4OB 2RC4A 2VBYA 5K7ZA 2LAOA 1FP2A 4H67A 4PP0A 3UGWA 3HCQA 1B7UA 2VJ5A 1MG1A 4AWXB 4ZJZA 1MQGA 1ZJLA 2NNYA 3N5LA 4A6DA 1I1SA 1OISA 1K78A 5I57A 2EV6A 4M6XA 2A07F 3KZGA 1S7EA 4MQVA 4CCOA 5DTBA 2CYYA 4QWQA 2D2WA 4CYDA 4QIWN 5FKOA 1OR7A 3GTJJ 5DVJA 5TPAB 3GTOJ 3CP8A 3ONQA 4X6AJ 4ZDOA 2UVJA 4G4PA 4GWZA 3OSRA 1ZRDA 1Z7LA 4EV0A 3BR5A 1SPIA 1TWGJ 4HLXA 1GDTA 4CCNA 1XGNA 1Y8QB 2V79A 2JPCA 4HSTA 1X19A 3TMGA 2L9NA 3U1DA 2K7LA 3MEXA 4RPNA 3PUYE 1FT9A 2DWHA 1IV6A 2FXAA 1LBCA 2WV0A 3GTPJ 3OIOA 1YO5C 3IB0A 2W00A 4TQUQ 1TQIA 4E70A 5AA3A 1TWHJ 4UY8I 3DV8A 4G94A 1B2HA 5LGUA 3HDDA 4XKCA 4IR8A 1V3FA 2M30A 1NTCA 2VE9A 2QSHX 2I6EA 2HZTA 2LFBA 4XOPA 2Y84A 1G3WA 1P6RA 2LR8A 1MXZA 3K00A 4M1VA 5IOYA 4BDQA 3FXQA 4M71A 2EWNA 3Q29A 1U5TA 2NUVA 3A2KA 2A5WA 3X2QH 3IOTA 3TCFA 3ZSFA 3KCCA 1DUXC 1DGRM 2KP6A 2JA6J 2FF4A 2E2JJ 1I69A 4EGYA 3AG2H 3CVGA 4H8IA 4RBOA 3KX2A 4QFPA 5IPAA 4MEXF 1NK3P 1QJMA 4QFOA 1IV8A 2WBMA 1FOXA 2VJJA 3HBLA 2CWEA 5F1JA 2DA6A 4R9GA 2P6TA 3DXJF 4I2OA 1JVYA 5JLWA 1URSA 4MHFA 4R75A 5E1XA 2QA4I 2IGMA 1PP8F 4Y15A 2UYEA 1IG7A 2QLZA 4F3QA 5BOXA 2FX0A 4BBSJ 1IUDA 1H45A 3GO5A 2I49A 3PIPF 3BTIA 2A5YB 1FQCA 1SBPA 4JX6A 2XD2A 4MNCA 4IO4A 3GZ5A 3LNQA 1VQMI 2MLGA 3C31A 1WKMA 1LE8A 1S3JA 4A5NA 4EVIA 4ZH4F 3JRHA 1MKMA 2FBHA 2STTA 4MIMA 5FKMA 2K9NA 2L02A 3HOYJ 1AH5A 1WJFA 2Y7IA 2K9QA 2XWOA 4LP2B 1B1HA 2IVMA 3GF2A 4A6EA 5HOOA 3S3MA 3KGCA 4WF2A 2M34A 3W2AA 2A5TA 4MEVA 4GVOA 1D0ZA 1MQHA 1B1XA 3GFIA 4GX3A 3TKDA 1LGBC 3IL1B 1KZ8A 1OQGA 3REOA 4WKMA 1N77A 2KLOA 5C4XJ 1EH6A 5D5XB 3FXUA 2K9MA 2RN7A 3LSTA 3SZPA 2QWWA 3SDGA 4E7SA 1ZR4A 1DPPA 2VC0A 4E7LA 5I56B 2E35A 2RNGA 4A2UA 2LD5A 4BXFA 5JVGF 3B6TA 2OTLI 1ANFA 3S9NC 2AYSA 1JI8A 3LC8A 1NV5A 4A3BJ 1RYOA 2DK8A 4ONYA 4M73A 5F0CA 1HXDA 1N75A 1ZMGA 2Z33A 2DI3A 2HWVA 3D5SC 3PQJA 3P9CA 1JJ6C 3DELB 3BOQA 1W0UA 4MQ9F 1EF4A 1W7PB 1XN7A 5DM7F 3LSFB 4GRKA 3ZQGA 3FV2A 4A93J 4ZZDA 1GVCA 2OQGA 3LSPA 1Z21A 2HXWA 2V7FA 2ZMEC 3CJQB 3IKTA 5DT6A 3IAS2 2F6PA 3TDZC 1OJLA 1R00A 2NXNB 4D0PA 2PG4A 3WAFA 4QRZA 1KWHA 3EDPA 3CDLA 1X1CA 1R36A 1R1VA 2KRCA 5IZ1A 2GLOA 4MEYF 5H8SA 3HPIA 1BR1A 2BGCA 5ICQA 5DYMA 1BLFA 4B09A 3SQNA 5TISC 2A6EF 3KC1A 1XTAA 2OWZA 3AG3H 1OR7C 5E1ZB 1B8IA 5J8CA 2CGPA 3U94A 5BPIA 5FFZA 4ECFA 5DEXB 5JFRA 4UHTA 3OYDA 1H3DA 1KU7A 2RC9A 3VEPA 2YS9A 4AYBA 2ZFUA 3FMRA 4PSWA 3I4NJ 3S32A 3TYHA 1NNFA 2ZKZA 2KIFA 2CEXA 2QS1A 1NH8A 3CF5F 2XSDC 3QP6A 5IM2A 2DMQA 1XSDA 2ZXJA 5CBSA 3EHUA 4NQ8A 2ACJA 5K7FA 3BQZA 3LFKA 3QYFA 1SDXA 4I01A 4KIGA 1DP7P 2DMTA 1NUYA 1NG6A 3VFJA 3ZMDA 3TELA 3BJOA 1GLNA 1TT1A 4YB6A 3HO7A 2HPGA 2I0BA 3GTQJ 6PAXA 4EM2A 3M8UA 2Q8JA 3E6CC 4KFCA 3CG1A 1SVLA 2H1LA 3FK7A 4D7MA 4DW6A 1JVXA 5IT3A 4B47A 1BI1A 1YHQI 1M1EB 2JK3A 2R92J 3IK6B 1LB8A 1XSXA 3M3KA 4ZTJA 1IMFA 4OENA 4QSCA 5D5UB 3VFZA 1EH7A 1I50J 3CMMA 5L3GA 1JE8A 4NF4A 2HCAA 1W1WE 3RPQA 3HOVJ 5B3SH 4GL8A 3TQLA 2PBIA 4OFJA 3IJXB 5DW8A 2Z8DA 4ZDLA 2ISYA 3KLOA 3P7NA 1T95A 3OYBA 4V19K 2A61A 3F9KA 3CG3A 2DW4A 2VJIA 3ZXSA 4XORA 3C18A 1RYXA 3HIFA 5L3BA 3TODA 1QGXA 4QXDA 3J7ZI 2XAFA 3Q9VA 1MBJA 4L17A 4H1XA 1EZPA 4GXOA 3ABMH 3I6VA 1Z91A 1S29A 4C3JJ 2RV8A 3COAC 1ZLQA 3FV1A 4PDHA 2G7UA 3CMEI 1VQ5I 4OERA 1JKOC 1QVTA 2HR3A 5D4SA 2E60A 2Z5UA 4RB2C 2OD5A 3C33A 2LBFB 3C36A 3K6XA 4N07A 2XGEA 2HOAA 1TLHB 5GAGJ 5EDNA 4JSDA 4E7HA 1JNFA 4ISUA 2M2EA 2NS7A 5EQ9A 1RUNA 1JUPA 4EQ9A 4RGRA 1MJ9A 2FUG2 3TP0A 3K4NA 4LA9A 4CYCB 3WGIA 2P8TA 3K01A 3DLAA 2OBGA 5DYHA 2ETHA 3KP2A 3GFJA 1YYZA 4Q8RA 1FTMA 1OIBA 4NN3A 2XAQA 3HJEA 2ZXIA 1MY2A 3L6GA 2KISA 4FT8A 2OCEA 5J1YA 2E1CA 4XKWA 4CCJA 4NF4B 3CO7C 2DWJA 3M3LA 4BDRA 1ORKA 2DOJA 3DP6A 3TDJA 3MZYA 1HDDC 1K83J 2AL4A 1VR5A 4I40A 1ZRCA 1FZPB 3GVAA 3V83A 1QVSA 3L2CA 4C2TA 3RI4A 1A99A 4U4XA 2CUZA 5L9SA 2PLYA 2X6OA 3PFIA 1SI1A 2HXOA 3R61A 1B46A 3K6UA 3F21A 2W7YA 4YIIA 1FP1D 2Y69H 4I99C 1WJCA 3B02A 3VB2A 4BACA 4GL0A 4DI4B 5LDZA 1S6LA 3WU0A 3GWZA 3V5AA 2YUSA 3CESA 2R5ZB 3H35A 1MBFA 4PJNA 1GT0C 1K9YA 3C2HA 2PX1A 4OINF 2QCOA 1MNEA 2I5UA 3FK6A 2IA2A 4HCYA 3CF2A 1EYKA 5HNFA 4HZFA 3OS1A 1N0TA 2REJA 4R2BA 3A03A 3VYSB 4FX4A 4NGUA 3RTFB 2IGKA 2O9LA 3AFHA 1N7XA 4I09A 3T96B 4WWCA 4IRIA 2ALUA 4UXNA 2DWIA 2PMZN 4C2MJ 3OO6A 4G8NA 3SZTA 2AIXA 4BE2A 2K40A 1HA8A 5M5XJ 2LKSA 1W7PA 2FSWA 1NV7A 4YKPA 3N6UA 4AVPA 4MNIA 1W0TA 2FEZA 2H25A 1ZK8A 4UVCA 2E1OA 4GWOA 2XRNA 1TC3C 1J1NA 1QULA 1XS5A 2UXXA 4N4OB 2DA5A 5DUIA 3D5LA 4NF6A 1R1TA 2IGNA 1GUUA 3LA2A 1FTZA 2PMHA 2BHZA 2HKOA 3ASNH 3HTSB 1OVTA 2HFBA 3A29A 2VE8A 3B7DA 5K5OA 3Q3SA 1LDJA 1FBCA 4A3GJ 2C6YA 1Y39A 1MM7A 3L1PA 5E8IA 3O9PA 4NE4A 2OC6A 3IR1A 3B6AA 2L7ZA 1NV2A 5DCMA 3QPTA 4OIOF 1QUKA 4PJMA 3F8FA 4QPOA 3J7AY 4U4SA 2OA4A 4R6HA 1C0WA 2E7WA 2XASA 1KA8A 3KEOA 1R9QA 2CRGA 1N76A 4UUTA 1QHHD 3NWSA 5J6XA 1TFAA 2R3SA 1ZR2A 1JKRC 2Q89A 2HVSA 1RDZA 5ELVA 5ITPA 3MKYB 2DA4A 4FE4A 3KYLA 2JVGA 4KCCA 2JTVA 1RZ4A 4G68B 4OVJA 3GFLA 1ZG3A 1J5YA 3WAEA 4C1UA 1FBQA 1R1UA 1Y3NA 1SFOJ 3HM5A 1I6QA 2V4CA 2EZIA 3THIA 3U2RA 3OY9A 2OPTA 5I56A 3H03A 2DE4A 2CEYA 2W4SA 3O3KA 2JMWA 3NWTA 2W7NA 4IHSA 3OEMA 2L5VA 3CCQI 4RY1A 1NG7A 2P0WA 2WV1A 3WU2C 1CQTA 4BXXJ 1XI6A 3SEVA 2MH9A 4NHJA 2I58A 4II2A 3GX4X 3RZOJ 2X51A 1M5CA 3CP2A 2LY2A 2F8DA 1IN6A 1U78A 1I1GA 4YMAA 2FA5A 3F8CA 1ZKBA 1DPUA 3ZQHA 4BU2A 1V5FA 2AS5F 5EYFA 2MG4A 3CCYA 1B9JA 4RM3A 3J81K 1IXSB 1NH7A 1XOCA 4H65A 2KHMA 2FU4A 2DT5A 3E4RA 4A0ZA 1LB9A 5FRMA 3GUDA 1B3EA 1TXFA 1IEJA 4PF8A 3DU5A 1FOWA 2OJED 2HVRA 2WYKA 2L9RA 3HPHA 1UHMA 5BMZA 5FLMJ 1PBPA 1MY1A 2Z99A 3HB9A 4FECA 1OYYA 5LEJA 1J75A 3F6VA 2GXBA 1LLSA 1HC8A 5H8QA 2XUBA 2DVZA 1ON1A 1XMAA 2KZVA 1BR2A 2OZ6A 2VPRA 1NL5A 2QMXA 2VHAA 5B7DA 3H3ZA 4IHTA 3KP7A 3HSTA 3A0BC 3R0AA 2LNBA 3ZN1A 1XGSA 3CDHA 5C4JJ 5KDTA 5M5WJ 1QO0D 3OL3A 3HL2A 2IGOA 2V3TA 3PD8A 3PPOA 5L9OA 4PCDA 3MKWB 3F8BA 3TKYA 2Q8KA 4XQFA 1U8RA 4M3FA 4F3BA 2ZNSA 3G3KA 2DYXA 1FSEA 3FHZA 1ZREA 4GO1A 3KPHA 2BHYA 3S3OA 1D9QA 1BKAA 1R5HA 3EUHC 3CCRI 1INPA 4H5FA 4PQJA 4RMNA 5LGNA 2L54A 1MJAA 2XC7A 1MM6A 2R7FA 2OV7A 5H8QB 2DAOA 2A05A 2BW3A 2X4HA 4P1WA 1ITYA 2PYYA 1SEUA 2VXZA 2NYXA 4Y4RA 2CS3A 3QYEA 4PDDA 2EK5A 4XSZF 3GFMA 1LAFE 4G6TB 3I58A 2QEXI 2CZKA 3QU6A 2DWAA 2Q74A 2D1VA 3MP1A 4XRMA 2LREA 2WA0A 3D1RA 3UK4A 3TEDA 2XIGA 1YLFA 1SC7A 5F24A 1VQ4I 3DP8A 3KEIA 1ZELA 3IX1A 1RUOA 3B6QA 4I8CA 1KONA 1EA3A 1FMVA 3I3LA 4P9KA 3A1YA 3M1CA 3RCOA 2XGDA 4B3XA 4L5JA 3HOUJ 3LV0A 1DU6A 2XB0X 3SERA 4A3EJ 2CQKA 2E1MC 4JVIA 5K2YA 4XLAA 4RB0A 1D3YA 4AU7A 2OWTA 2HTSA 3EYYA 1FPEA 2JA7J 1BC7C 4AM3A 2B4MA 2H5YA 3HKZA 2E5ZA 5I84A 4L0ZB 4P1EA 3WG9A 3EHSA 2F48A 1B51A 3MMYB 4WK8F 3F8NA 1WCMJ 4JP0A 1SYIA 2DE2A 4K2EA 4XKVA 1B5JA 2V84A 4GX6A 4HDUA 2OUMA 1WGXA 1Y1WJ 4LB6B 1YE9A 1GXPA 1FBFA 1V5GA 3M3YJ 1P92A 4C3IJ 5LTCA 4PJLA 2V4JC 1VQPI 3IO4A 3O66A 2ZNYA 1Q1HA 4HW0A 4G68C 3AG4H 3W6KB 1XB4A 5BQTA 1BOAA 1UTHB 2ONKE 3KZIC 2ADUA 4R2FA 5DVIA 2YX7A 2CMPA 1DGWY 2DA1A 3SEQA 1QPMA 1IMAA 2HHMA 3F72A 2Y0SN 3SFIA 4DJAA 4QLCU 4ZE9A 1MZBA 2FYIA 3T9XB 2A68F 3ABTA 3PD9A 1MBKA 3SETA 1HQCA 3EYIA 1O63A 4QSDA 4BDMA 1DPRA 2MKZA 1W5CC 2CQXA 1A36A 1PB8A 4KYDA 2DDAA 2UUZA 2ZMEB 1IMCA 3TTMA 5JTYB 2PMZA 2UXNA 4OIRF 4ZYEA 3CC7I 3WGHA 4EJWA 4ESFA 2Z8EA 4LZ8A 3VYTB 4L18B 5JK4A 4D5FA 1W36C 3T1BA 2X6WA 4IO9F 2MD5A 3FM5A 5L3FA 1YX3A 1U9NA 4OYVA 4PTKA 4EATA 4UACA 1Z6RA 1YITI 3LSGA 3CUQC 1I3AA 4G6QA 1OCPA 3ABKH 1OCTC 1GR2A 3PPQA 3BP8A 4B4CA 4MF3A 3S9MC 2M0CA 3JRBA 4BBRJ 3BJ6A 2O03A 4ITVA 2V6EA 5J1RA 4AIHA 3HN0A 2JSCA 1S9TA 5J1UA 2TCTA 2ZYOA 5JEIA 1J9IA 4WX9A 3K4UA 3KFWX 1MW7A 1JJ8C 1BA5A 4N6DA 1F9NA 4XRSG 5J3LA 3HSEA 1LQ1A 1K4SA 3E5QA 2BJIA 2QSGX 2O7IA 3D4CA 4G8HA 2ZJQF 5J1DA 4MHGA 2G9WA 4A3LJ 4A3JJ 1UIVA 3CSBA 1Z0XA 2EIKH 2FOKA 2O84X 2XF5A 4MTDA 1YTVA 3QAXA 1X2NA 4G68A 1WI9A 4GGGA 2VKVA 4YRVA 5IT9Z 2M8CA 3W6JB 3K4KA 4BJ6C 4O3BA 4OAYA 4ESJA 2BY0A 4FAJA 4EDPA 3RYRA 3A0HC 1S7AA 2PN6A 2EA4A 2DFEA 4BDNA 1FPDA 1PB9A 2HZKA 3F22A 2ISZA 1YRNA 2COMA 4CDGA 5HLGA 2R0QC 2FIEA 1MJBA 2BV6A 3RY3A 3LUZA 2I4CA 4RGXA 1YIJI 4LG3A 3I54A 2K86A 5DCMB 4CCKA 4LFUA 3MJNA 1O64A 1HCRA 4U1OA 5FHMA 3S4UA 2RAEA 5LHGA 4WEPA 5CM6A 1NUXA 2E2HJ 2FA7A 5CRYA 5KHDA 3V8KA 5EHMA 4AD9A 3RKQA 3FUZA 1SQYA 3FXMA 1JP4A 3OD7A 2VBXA 4ESWA 3I64A 4Q47A 5B1BH 1S7OA 2KDZA 4NB5A 1BK4A 2AL5A 3OOAA 4N13A 1IGNA 5ITOA 5EEGA 4YEJA 1YI2I 4ENKA 1P4AA 4LIVA 4P5OA 1J59A 1H44A 2GQ1A 2GIZA 5ILVA 3P9IA 5D4RA 4RJZA 2AXTC 1RPWA 5HLIA 2IJLA 1B4ZA 3A01B 2DA2A 1LBBA 5LLQA 2ZNTA 1JT0A 3FBNB 2B0LA 2K4BA 3I9V2 2RQQA 2O8KA 3CFZA 3VLUA 2JT1A 4GDFA 3E7LA 3M8JA 1PUFA 4BYYA 5EQ7A 2L2OA 2MD0A 2JA8J 4AC0A 1RR7A 1QPIA 2IP2A 2QZ8A 4ZEFA 3K4MA 4C30A 1SW2A 4IHXA 3VXBA 4IHVA 1Y3QA 2XXXA 3FX3A 4XKQA 1JHHA 2BY2A 4OVQA 3ZOBA 4UVBA 1FLIA 4HTGA 3CJRB 2ZNZA 2V3QA 3TP3A 1FTKA 3U72A 1K78B 4HQEA 3JZJA 5I57B 3DEEA 3UKGA 5I2KA 1B6AA 1Z77A 1AU7A 4EJTA 2GBYA 3QP5A 3V89B 1E3PA 3K70D 3HG9A 1Q1KA 4A12A 1ZQ3P 2EPFA 2Y0MA 4FQGA 2ME6A 2FNCA 5JHFA 4XKNA 1WJEA 5TRDA 3TL4X 1BC8C 4U2RA 5LFAA 3BR6A 3S14J 4N8GA 2ZYKA 3PUWE 2QKLB 1Z9CA 2ECCA 1UG0A 2Z3YA 2NWJA 4ON0A 2LYCA 2GAUA 4BE1A 2Q2EB 3A09A 2H8RA 1O3TA 2Z9OA 3DQVC 2Z2SB 4NNJA 1FPGA 1HSJA 2YR2A 1BJZA 3K0VA 3VXCA 4BL0B 2F97A 2WB1A 1LEVA 2GOXB 3BG6A 2H1KA 2PT2A 5CVIA 2EJRA 4X1DA 2KFDA 5HLTA 2GQQA 3H5RA 1JGSA 2P7VB 1B6HA 4YKKA 1MMSA 1R9TJ 1B4AA 1FJ9A 2ZSIB 1I39A 2EZKA 3BR0A 2HQAA 1VFEA 2F6CA 4XK4A 2Q2AA 4PGPA 4JOMA 3CC4I 4IY6A 2JRMA 3BG5A 5EGOB 4F1UA 2HVQA 4TV7A 5FB2A 3MZ1A 4EQ7A 2DVCA 2CFOA 2QQBA 3C2GA 1SANA 4HQMA 3LQRA 4XM3A 1VTNC 1ZRFA 2P3NA 3FKJA 3S16J 1S5LC 5DS9A 3HUGB 3LSRA 1NNTA 5IY5H 4HE1A 2ZCWA 1KGSA 1ZLKA 4J19A 1QUIA 2Z22A 3GLBA 2DPDA 1Y6IA 2EA2A 2XAJA 3ZPLA 3F11A 1MXVA 1FPQA 1GTKA 1B40A 4I3YA 5IZ3B 5ILSA 2H6BA 4XXUA 1HLVA 2HAUA 2VKHA 4GYGA 1D1AA 4M4GA 3IWFA 2DYRH 3MWBA 2ZZVA 3FXBA 4GCVA 3RQTA 1IW7F 2M4GA 3KN8A 4DQ2A 3T9UA 3VVDA 4CGZA 3ZKKA 1YFHA 3OSQA 5IP9J 4R6YA 5IYCJ 1GGGA 1SMYF 4KXPA 1LBVA 4G61A 3I3VA 1P99A 2MW8A 2HAVA 3TFLA 5F64A 3SEZA 4A3CJ 1TP4A 2KIUA 3N94A 3VWBA 2VD2A 3ZRGA 1RC9A 2EZHA 3FDYA 3K1NA 1ETQA 3IOWA 2CQQA 5FHNA 2R8TA 4JXIA 1PB7A 2BXYA 4A3MJ 3M8FA 1UIUA 2XWKA 4P1LA 3E0JB 1CE2A 3SYTA 4R1HA 1O3SA 4EXKA 2VBWA 5CVVA 3TOAA 1IUYA 4B43A 3FATA 5GTHC 2VPLA 2H98A 4XMYA 1VSOA 5ICEA 3CZ6A 3JCUC 5F0HA 1N3WA 4X04A 1CNQA 2KPMA 4LLGF 4E6KG 1Y1ZA 3UN6A 5IP7J 2VJ4A 2CSOA 3IOVA 2FQ3A 1LFUP 1USTA 1ZG5A 1QVUA 1IMEA 2V1NA 4Y7NJ 5AA4B 1IUFA 3T9VA 3VV5A 1VQ7I 2EV0A 1VQOI 5CMCA 3ZP5A 5KCJB 3WTVC 2OTJI 4UB8C 2L7MP 1EZOA 1IO2A 4L0YB 3H6TA 4R73A 3PSIA 4BE0A 1REPC 4XRSA 3ZQQA 3PMVA 2ZXHA 3GEZA 5IOZA 2Q8MA 2X1EA 4IOCF 1SYHA 3U65A 5J47A 4UA8A 1T2KA 3H06B 2X85A 4Y52J 5DEXA 3CUQB 3J7AO 3C32A 4NF0A 4E0XA 4PGHA 3QUFA 4BLAA 2OK2A 2MH2A 3KJ7A 1ETXA 2JRTA 2I0CA 3G3JA 1FIAA 3J7YJ 3IJOB 4YFKF 1DMBA 3WG7H 3ILTB 2ME0A 1QZEA 1HW1A 1HSEA 3MZ9A 5A5XB 3LSLA 1ENHA 3HXLA 1X2MA 3Q25A 4LATA 2K85A 2HS5A 2F5CA 2XGCA 5F0FA 4IGRA 4IO7A 3LSMA 4BXUA 1FPFA 4IO3A 4ZDMA 2W1OA 3PPNA 1B58A 1Y0NA 4I98B 4M6VA 4FTHA 5FLXZ 1VDWA 3TPAA 2MC3A 2TDXA 1U5TB 5IYBJ 1PDNC 1O7TA 5F27A 4PFTA 1HKTA 3LSKA 4RAYA 2EIJH 4AIKA 5H6RA 1Y1VJ 3K10A 3ZMUA 1NUWA 3RPLB 4ENMA 3UA8A 3H3VK 3DP7A 3KIOA 4FE7A 4NF8A 1G8XA 1EH8A 1ZN2A 2VONA 3PO3J 4HV5A 3H0GJ 1FQBA 4PDKA 4I76A 1FBUA 3VDXA 1P1NA 1AOYA 2ZC2A 2M5WA 4LIUA 3PNTA 4BH9A 5FGMA 4KCDA 1TWYA 4QFLA 3CHGA 1USSA 2HYFA 1ODDA 4RNSA 4YELA 3HRSA 3G6EI 1B3GA 4MIJA 1QGPA 3ROJA 1LDKB 5HDGA 4IL6C 2KJCA 5ICCA 2JZYA 2WEFA 3VSKA 4ENJA 2W24A 3ULQB 2DTRA 3IP4B 3OS2A 3B50A 3IWZA 3WTTC 2FHYA 4MLQA 3IRRA 4O3AA 3FBIB 4IO5A 2F78A 3V7CA 3CLOA 1IXRC 2M4KA 3IL2A 4NTLA 4XRFA 3WE3A 3K6GA 3KZZA 1B3HA 2B3FA 3HHFA 1II5A 3FVKA 2DT6A 1TBXA 4F39A 2ESHA 1ETOA 1T56A 4RAGA 4QBAA 2ID3A 2K3PA 3PU5A 4BDLA 4F55A 2XWIA 4RAFA 4WXDA 1D4NA 1QBJA 1TL8A 1GHCA 4I3EA 2QENA 1VNDA 3BWGA 4U22A 2CUEA 4PFWA 3JRCA 4U0VA 1KQ8A 2VI6A 1ZBMA 4XLEA 2BJJX 3BFTA 3MVWA 3OYNA 4RK2A 5HM4B 3BCBA 4C2UA 2K5CA 2O6GE 3DBRB 3JRIA 4POWA 1ZTYA 1Y0UA 3MZ8A 4U0YA 5EHSA 4XBFA 3SZGA 2NNNA 1U8BA 3VLWA 4M9XA 1WVRA 3K4LA 1QW0A 3H36A 3U8QA 3TW6A 2XF6A 4UUVA 1LBWA 2RC7A 3RT8A 1X3UA 2QUFA 1G0IA 4S0HB 3VLVA 2XV4S 4LK1F 3C35A 5HNHA 4IJAA 4PFOA 3JV9A 3OELA 4OHNA 3SDFA 3QOEA 5FJ8J 3IH4A 4LJZF 3FXKA 4LD5A 1N84A 1D5YA 1Y1MA 2VGQA 3W9WA 4DXCA 5DVFA 4HS7A 1O3RA 3FVOA 4WXCA 2L0KA 4O8MA 5JLXA 3ZMSA 2GFEA 3K6WA 2VBZA 3FASA 3T9HB 4JWOA 2V6CA 1B9NA 1NV0A 3LSIA 4F1YA 2LH9A 2DT7B 2R7SA 2EIMH 2KIQA 4KMFA 3JAMZ 1ZHFA 5CVJA 1NK2P 1M5DA 5JR3A 3DTEA 3SDBA 2I48A 2UVHA 3QMFA 2HOTA 2WB1N 3C34A 5FTHA 4EQBA 2LRDA 5ICGA 4RAZA 2VLAA 4BNCA 3BIHA 3S93A 1PJRA 3MVXA 4G12A 3RKXA 4GLIA 1MSFC 3TEPA 2XAGA 3IH2A 3OOPA 5AA1A 5J40A 4CICA 3H9GA 2Y75A 3V8XB 4N4UA 3DKWA 1IF1A 1SFEA 2WYPA 3QYBA 3K02A 5TPAA 3ZQ7A 3OYHA 4HA8A 4RS8A 3MP8A 4NF5B 5JI6A 3BCAA 4R72A 3NQOA 1NHAA 2CO5A 1KQ9A 1FOKA 3FBPA 1BI0A 1LFBA 4GQOA 4OEUA 4DGWB 4IGTA 4Z2YA 2GHAA 4GWWA 4BDYA 3K69A 4KIFA 2EV5A 2DMNA 1B0HA 2F36A 3A3UA 1AWCA 2E2IJ 2I4BA 2EINH 2VP1A 4DOZA 1WVJA 1S9HA 2ELJA 3DKXA 1QKAA 1FBHA 1WQ2A 2LDUA 2AQEA 2RREA 3JRGA 5FRNA 4ELQA 1UTBA 3RQIA 4BEHB 3E3KA 2DXYA 2HEOA 2KIMA 2YU9J 1FWZA 1MMNA 3T8RA 1BW5A 3N4MA 1U0JA 1XPXA 4R9FA 2AQFA 2Z1DA 1FBSA 3BDDA 3LOCA 5FKLA 4EGZA 2AHQA 3EQLF 4Z0IA 1B5HA 3P7IA 4YB7A 1P4WA 2VASA 3GBGA 4BHBA 1XSVA 3TO6A 3DTIA 1FPBA 2QS4A 2JWTA 2DSFA 3CFLA 1TT0A 2E0SA 1A8FA 4E7ZA 5BPDA 1JEVA 2VQLA 2DOAA 4HX8A 2VKEA 4ESBA 4GXAA 4ZDPA 4H5GA 2L4AA 1S8NA 5E20A 2XKOA 3TTNA 4YMBA 3HGGA 2VQGA 1FNNA 2EB7A 4OETA 5HPQA 1N25A 4UVAA 1YXIA 3HSFA 1XVXA 3GBBA 1WJDA 4U87A 2R5YB 5M5YJ 4F7ZA 2Y7KA 1V55H 1IN5A 3CJNA 3R6UA 3PUZE 3CDIA 4PJJA 3IUOA 1AMFA 2KRHA 1OVBA 1Z3XA 1CB6A 2L3DA 1TT5B 1DU0A 3I59B 5HDNA 2JA5J 5C44J 2KQRA 3OIPA 1EJ9A 3TMOA 1FTOA 2VODA 2P6SA 3F8MA 3QPHA 2O7OA 1UELB 3PO2J 1SD4A 1XGOA 3T0YA 4P96A 2B9SA 2PFYA 1MS7A 3PV0E 3LA7A 4MJOA 4P11A 3TBIA 4S05A 3I0TA 3SESA 1YYVA 4G77A 4UABA 3QQAA 3KEYA 4KYSA 4YFXF 2R7VA 1FBGA 3K1PA 1FY7A 3HOTA 4DBQA 2A5SA 4OEVA 3T66A 1XMXA 1OYIA 3DPUA 3F23A 5HBCA 3OYCA 1B52A 1IXIA 4OVPA 2Y30A 3VYRB 4QF9A 4HNVA 2L4MA 2NVQJ 3CCVI 2ABHA 3U93A 2QF7A 4E7JA 2HZDA 3LSJA 1J0RA 1SD6A 1P7IA 4BS9A 3QODA 2ELHA 2EZLA 2OCUA 4JVDA 4CCLA 4PFRA 1B59A 2N8GA 2M7AA 2WC2A 1IZ1A 1MQJA 2HQ5A 4GWSA 4OFOA 1MMDA 5E8GA 5K5QA 4O3CA 1E2XA 2DA3A 4NWDA 3IRQA 3KN3A 3PM1A 1OCCH 2B63J 3MN2A 5LHIA 3S2DJ 4GWXA 3CCLI 4O5VA 2I8DA 2XWVA 3M07A 5KAFC 1PC3A 1XC1A 2K9LA 3CO6C 1O7FA 1KA0A 1QNTA 2F7CA 5I5PA 4U7DA 2LMDA 1MPDA 1DK4A 4K3FA 2RKMA 2P4WA 1Z7NE 4WXHA 4DDDA 3AL0B 1D8KA 1OMPA 3FIRA 3H6WA 5CMMA 4CH7A 2X6XA 3S17J 3MPLA 3WGGA 3BZ6A 4MMPA 3BFUA 4OMYA 1OLTA 3T5XA 4Y33A 4BDZA 1NNPA 4F1VA 4F3PA 3LL7A 5ICFA 2GXAA 3GZNB 2PMSA 2EILH 2ZXWH 1QZZA 4BGDA 5LHHA 1BIYA 1EYJA 2DU9A 3G71I 2GH9A 2NS0A 3RGYA 2FMYA 2XXYA 3CQZJ 5DUKA 3U21A 3BPXA 3L2VA 3CMYA 3LSHA 3R0JA 1DDNA 3V8JA 4Q5SF 4ZYGA 4F2QA 1D1CA 4IHYA 3KSXA 3LSXA 5H8HA 3RN8A 3VVFA 1JUSA 3LSWA 2OCCH 2EFQA 3JR9A 3GZGA 4ZECA 1E0EA 4YFNF 4D1QA 2MBFA 1MXWA 3F6OA 2HDDA 2WY8Q 3PNVA 2UYFA 2FD5A 2AXLA 1P1UA 2K4JA 4RA2A 1ZARA 4G8MA 2VC1A 3IB2A 1B72B 1N3XA 2KT0A 4GFRA 4DYQA 3I53A 3K1MA 3G1MA 2XXIA 3CR9A 2CV0A 4QFNA 1FPJA 2XRLA 2D21A 2LOOA 2UV1A 2BVLA 1FJLA 1MNMC 2QVRA 3KETA 2Y48A 1PYVA 1JEUA 3GBAA 2DMPA 5EF6A 3CD6I 1AKHA 4GWYA 3LQQA 4JX5A 1ZH5A 1MQIA 2MYSA 1XDUA 3Q27A 4DIQA 4YB5A 4YIRX 3KC0A 2G0EA 3OR1C 2XXUA 5B70A 1BI2A 1TNTA 5KK1A 2QRYA 3LFUA 3O28A 1I6BA 2F5DA 1Y3PA 4MFDA 3EHTA 5I2NB 5LBQA 4LONB 1R23A 1I3QJ 3H4ZA 3OO8A 1L3LA 3MKLA 2CH0A 3VOEA 2OJTA 2BEOA 1Z7ME 4DXUA 2R7XA 4G7OF 1URGA 2P1SA 4XN0A 2D45A 1BM9A 4LUBA 4LOCA 4Q30B 5CI5A 2V9VA 1OFCX 2F35A 1YTYA 4NMYA 1LBXA 4N9HA 1SI0A 1IDYA 2QVOA 4H46A 3LR1A 2UVGA 4PE3A 3HPGA 5EG0A 1WFXA 1MDMA 2X9DA 2JUCA 1M5EA 4MAGA 2CQNA 2R5YA 3QAHA 4I62A 5TP9B 3PUVE 4X0GA 5CVUA 1YZ0A 1PUEE 1WZ2A 4HCWA 2O0YA 2V9KA 5FROA 3S2HJ 1PVEA 2ZFWA 4H6DA 1E3OC 3MAJA 4PFYA 2DN0A 3LWFA 2P2AA 1Z3YA 4R74A 1KYWA 1GXQA 1HBXG 1O57A 1E17A 2NOOA 3E78A 1TWFJ 4RLFA 5D6FA 1R4MB 3O8HA 5EJCA 3MCZA 5EZGA 1D0YA 4NQWA 1ZYRF 3KBZA 1LDDA 2MGQA 2CJJA 5FHOA 5H6QA 1FRPA 4V2FA 4ABZA 2ZJ2A 1MMGA 2CW8A 2NVXJ 4OANA 3OYAA 1GV8A 3UR3C 5FD6A 2JN6A 4KT5C 1H8AC 1B8IB 3KOSA 4TLLB 1B9MA 1FC3A 2HGCA 2J5OA 4GBVA 3QU3A 4MBPA 3S8PA 2Y31A 4NBQA 3ZQCA 4IY5A 4HSRA 1UTBB 3HRTA 2FVZA 1U3EM 2G7HA 3S9EA 1L0OC 2K3FA 4PK4A 4R8HA 3S3NA 4RK9A 3O8GA 1SFKA 4OFLA 4BQAA 4BJTA 2DFIA 2XXPA 5GP9A 2X26A 3AKZA 1MD0A 2QGUA 1I5ZA 3B8BA 2GA1A 5DEQA 3RZDJ 2H27A 3HFUA 3OO9A 3MP6A 1GVDA 4EF2A 3OOUA 2L9SA 2VOPA 4NF5A 3PMXA 2RGVA 3FXLA 4M6YA 2LG4A 2HEUA 4JB7A 3ASOH 3QPSA 4O6JA 3DLLF 2OWSA 1R6RA 3J80Z 4CUGA 1MXYA 5H8NB 3OR2C 2CZLA 2GA2A 1VZ0A 2LY1A 2BE5F 5M3FJ 4ZS9A 2VQCA 4XONA 1VFDA 1IITA 1NI9A 4I6ZA 5E1WA 2X0LA 1JTXA 4KYWA