1Y4TA

Ferric binding protein from campylobacter jejuni
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
317
structure length
317
Chain Sequence
SELNIYSARHYNADFEIIKKFEEKTGIKVNHTQAKASELIKRLSLEGSNSPADIFITADISNLTEAKNLGLLSPVSSKYLEEFIPAHLRDKDKEWFAITKRARIIAYNKNTNIDISKMKNYEDLAKAEFKGEIVMRSATAPYSKTLLASIIANDGNKEAKAWAKGVLENLATNPKGGDRDQARQVFAGEAKFAVMNTYYIGLLKNSKNPKDVEVGNSLGIIFPNQDNRGTHINISGIAMTKSSKNQDAAKKFMEFMLSPEIQKILTDSNYEFPIRNDVELSQTVKDFGTFKEDQIPVSKIAENIKEAVKIYDEVGFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords putative iron-uptake ABC transport system periplasmic iron-b
publication title Anion-independent iron coordination by the Campylobacter jejuni ferric binding protein
pubmed doi rcsb
source organism Campylobacter jejuni
total genus 123
structure length 317
sequence length 317
chains with identical sequence D
ec nomenclature
pdb deposition date 2004-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13343 SBP_bac_6 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1y4tA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1y4tA02
3V83A 5L9MA 3C36A 4G68A 1RYOA 5L9OA 1GVCA 5F7VA 4U23A 1AMFA 3UK4A 4DXBA 5ISUA 3FIRA 3QYTA 4KHZE 3T9VA 3IOUA 2OCUA 3HCQA 4F3SA 3KZGA 2I49A 5CI5A 1QKAA 5DYHA 4G4PA 5H8QB 1B3FA 4DIGA 4F1VA 3USDA 2PT2A 4JB7A 1FW0A 4L17A 4OTEA 4NTLA 4ELRA 2DE3A 2XXRA 3N6TA 3UGWA 3T9XB 5DVIA 5ITOA 4AB6A 1OIBA 4ESXA 3TTKA 3QK6A 4E0WA 2XXPA 3RGYA 1URDA 2O84X 2E0SA 4I62A 5I58A 2QS4A 2Y7KA 2PBWA 2PT1A 2F8DA 3Q28A 4KYSA 4BDNA 5TP9B 3OD7A 1LFIA 1TFDA 5ICQA 4JWYA 3KN3A 4UACA 4R6YA 3IB1A 4ZE8A 5L8DA 2Y7WA 2DSFA 1EU8A 1QUKA 4MF3A 1GTKA 4OETA 3MVYA 2BJJX 3I5OA 3G3JA 1BIYA 4X1BA 1B3LA 3S4UA 3ONMA 1QULA 4GVOA 1S7YA 1N3WA 4DCXA 1PB9A 1ZLQA 1USYE 3T22A 3SEWA 2F6GA 5TPAB 2ZNUA 3B6WA 3GBBA 3K2DA 2RINA 4EXLA 2DWHA 2R71A 4BDQA 1PB7A 1PBQA 2H99A 1OQGA 4P11A 2OWTA 5EHSA 3I3VA 1B40A 3R26A 4LATA 4H5GA 2Y7RA 1DTZA 4QSCA 4ZEIA 2HAVA 3VLWA 2X7PA 3N6UA 3IX1A 4RA1A 4DE8A 5M2VA 4Z0IA 2I6EA 1B5HA 2NOOA 4ELPA 1HSEA 4YU0A 3UIFA 1Z7ME 3PUYE 2VD2A 1QUIA 3MP6A 5I2NB 3OSRA 2ZYOA 5ITPA 2I4CA 5ICTA 2Z8DA 3HSTA 3PUVE 5AE4A 2Z23A 3G3FA 1MQHA 3FVNA 3CVGA 4F1UA 1XOCA 4R72A 1B2HA 2RC9A 4N6PA 1KWHA 1YTVA 3DLNA 1H44A 3KOTA 4ZE9A 3B7DA 2F7BA 1B05A 3F11A 5A5XB 3FVKA 3MZ1A 4QFKA 2Q2AA 3MJNA 2DOJA 3G7WA 3H03A 2A5SA 1NMUA 4F3BA 2AL5A 2O51A 2QMXA 1FCKA 1MH3A 3JV9A 1QKBA 4XTCQ 1Y3NA 4OEVA 4QSEA 5H8FB 4F18A 1NFTA 1MM7A 2I3WA 1YCJA 2F6PA 2B65A 3KGCA 3RTFB 3OO8A 3EHTA 4YB6A 1B52A 4HS7A 2I3VA 2ESNA 4OYVA 1FTLA 1Y3PA 3VXCA 4OMBA 4YKKA 3BKIB 4MBPA 3V89B 3K1MA 1B46A 2IEEA 2H9BA 3ZKLA 1IIWA 1DSNA 1LAFE 2VGQA 4JXIA 3S9LC 4ZEKA 2HFBA 3DM0A 3CFLA 4ELQA 2UYEA 3IL1B 5H8HB 4JWOA 3S2VA 1LFGA 2XXQA 1SQYA 4F1YA 2REJA 3G3GA 4THIA 5KZTA 5I84A 1H43A 3UN6A 4HCYA 1QW0A 1URGA 5CBRA 1R1NA 1MY4A 4IGRA 4F31B 1B9JA 2G93A 3B6QA 4FEDA 1NNTA 4RJZA 2CMOA 1LLSA 3PMWA 4NF4A 3IOWA 3OO7A 4ESWA 2HQ0A 1NH7A 2OWSA 3IB2A 3TMGA 4X48A 3C9HA 1UIVA 1VSOA 4WEDA 3S9MC 1XHYA 2THIA 1MXVA 5L9SA 4KCCA 3SEUA 3TTNA 4RXLA 4RPNA 1MY3A 3IB0A 1IQ7A 1LB8A 3U1OA 1H45A 1IXCA 1MM6A 1BLFA 2HAUA 4R9GA 3N26A 4OZ9A 3PUWE 4R73A 3B6TA 3KN7A 3MP8A 3C31A 3MC2A 3Q27A 1B6HA 3C33A 3M8UA 3KSJA 3V5AA 3LSFB 2Q8JA 4Z7EA 3Q25A 3PPPA 4PE5B 2V25A 5I2KA 5CMCA 2W7YA 1IUDA 3HO7A 4F19A 4LP2B 2AL4A 5AA3A 4BDOA 1MXUA 4G2ZA 5TP9A 3OSQA 1Z7NE 3K02A 3FVGA 2R9JA 4N07A 1URSA 5DEXB 4TLLB 1A7LA 1MPCA 4PFUA 2XXYA 3IOTA 4H6DA 2Q2CA 1SI0A 4MLQA 2XX8A 3BBRA 3LBSA 3ILTB 4GLIA 4LQ2A 4ZZAA 3H4ZA 4BDRA 4NF8A 1GV8A 4OERA 2DVZA 1A8FA 2GHAA 1B7UA 1SW4A 4OEUA 2YLNA 1JW4A 4KCDA 3K4UA 4YMAA 4NF5B 3QUFA 2R6GE 4KFQA 1R6ZA 4O3AA 4JWXA 1IXGA 1NNPA 2E1SA 1ZTYA 1LCTA 3KG2A 2NUVA 3VVFA 5H8NB 1EZ9A 4F3PA 3CFXA 3BFUA 1CB6A 4K3FA 3K1NA 3O97A 5AA2A 1JEUA 5TU0A 4EQ9A 4ZZEA 4F2OA 4QFPA 4U1OA 4DZ1A 2F97A 3N94A 4IO6A 4Q5TA 5EHMA 1MY2A 3KBRA 4EXKA 3U92A 1B5IA 2AYSA 3IO4A 1R9LA 1P1NA 5JK4A 1A99A 4QSDA 3KOSA 3IAZA 4ZEDA 4WEPA 1MXYA 1S9TA 1SVXB 3TAJA 2V84A 4NE4A 3HHGA 3TEPA 3VDFA 1N3XA 4BDMA 2A5TB 4LVQA 3PD8A 1SYIA 2YJPA 1EH3A 3ODBA 1B4HA 4NEDA 3C32A 5CMBA 4POWA 2Y7IA 1LAXA 2I4BA 1JW1A 3U72A 1T0KA 2D3IA 2RCAA 2UVGA 4X9TA 3OOAA 4RNSA 4R6KA 1WODA 3FUZA 3LUYA 3EHSA 2GRVA 5DTBA 1JVXA 3TTRA 3JZJA 2HZKA 3H3GA 2DP8A 4IO2A 1LGBC 5DVJA 2VD3A 3MP1A 4GOTA 4GL0A 4F22A 5JTYB 4G77A 3TCHA 4ND9A 3UA8A 4RK9A 3O2AA 4FIMA 3MZBA 4OFOA 4FE8A 1Y4TA 4YMBA 1MQDA 1MQIA 2NXOA 1EZPA 1OVBA 2ZXTA 2GHBA 2Q88A 2F34A 1JQFA 1PDAA 3T66A 1AIVA 1USYH 4DXCA 3O66A 5B7DA 2XXHA 2H25A 2PX1A 4I9DA 1QJMA 2PVUA 3GLBA 2B3BA 5LOMA 5KCJB 1SYHA 3WAEA 3TYHA 3PUZE 2RC8A 3IOVA 3EQ1A 4KYEA 3T9UA 4DCYA 2DQVA 2V93A 4TQUQ 5I56B 1DPEA 1DMBA 2QSXA 4RPOA 2M8CA 5CMKA 1J1NA 3VVDA 3FJMA 4F3GA 1OMPA 4KI0E 3RTWB 1MY1A 3OENA 3TTLA 3T96B 3OEMA 5EYFA 2X26A 3KJTA 1SDXA 3N5LA 4ZS9A 1NNFA 3SESA 1ZBMA 5J1DA 3FZVA 1MG1A 3DP4A 3MVWA 4OFLA 1UTHA 4JDFA 3E13X 4G8NA 4OESA 4WXJA 1L5TA 4O3CA 4YB7A 4R75A 3R6UA 4QFLA 3EF7A 3RT8A 4G68B 1SBPA 2UXAA 2REGA 5HM4B 3LSWA 1GR2A 4C1UA 4YAHX 3O28A 3TODA 3ZS6A 1MS7A 3TKDA 2QS2A 5AA4A 1LAHE 2O68A 1ZMGA 3OXNA 3A09A 4XXUA 1B5JA 3HV1A 3FGSA 2XD3A 3G3KA 2DYXA 4H65A 1VE4A 4GL8A 4OWDA 4R2FA 3VFJA 1B32A 1IITA 3E9XA 2DE2A 1BP5A 3H7MA 4PFWA 1ZKBA 3MBPA 4XKRA 4EF1A 3TELA 4XKPA 4KYDA 3R7XA 2D21A 1VFDA 1M5CA 1N76A 3FD3A 1OLCA 4GXAA 2O69A 4DLDA 1US5A 4KQPA 3CG1A 4U22A 2HXWA 2V3QA 3H6VA 2P0SA 2XXVA 3HHFA 1UQWA 1O7TA 1FQAA 5H8NA 3KEIA 2I0BA 3SKPA 1PBPA 5I59A 1TWYA 4NF6A 4LZ7A 5HPQA 1P1UA 1IXHA 3O6IA 2ZYMA 4F29A 3SETA 3RQTA 3PPQA 3O6HA 4H1XA 5BUUA 3K1PA 3QSLA 2F5XA 5CBSA 3TPAA 1BKAA 1I6BA 2G29A 1FTJA 4ZEFA 3MPLA 1ZU0A 2XD2A 2NVUB 3A3UA 4G8HA 4Q0CA 4H5FA 3FATA 2QRYA 3PMXA 1ZIUA 1AL3A 4EQBA 1Y4CA 5F1QA 2H98A 4I1DA 5H8QA 4IGTA 2O7UA 3BFTA 1R9QA 2UVHA 2A5TA 1OQHA 2PMSA 2DS9A 2ZYNA 3RNNA 2B3FA 2ABHA 5FHMA 3Q26A 5FTHA 1SW1A 4FECA 3GBAA 4IO3A 1FQBA 4BLAA 3GZGA 3CFZA 3M3KA 4FORA 1LBCA 1ZJLA 3THIA 2QS1A 5I57B 2DVCA 4QF9A 1BTJA 2DE4A 3TQLA 4U2RA 3M3LA 3KN8A 2Z8FA 4I8CA 3S9EA 4OQOA 3UORA 3H06B 2FNCA 4IY6A 3FXRA 5JTYA 3H6TA 4MLVA 1D4NA 1XC1A 3TTMA 5KDTB 1POY1 2P1SA 4IO4A 1O64A 4H0WA 3E3KA 2OJTA 5TPAA 4RK2A 1RYXA 3IORA 3O29A 1Q35A 3LSXA 3VVEA 3PD9A 3AXFA 2Z8EA 5KCJA 1LB9A 4XIGQ 2ZNSA 2KLFA 1F9BA 4OVJA 5FHNA 1I6AA 2QS3A 1FQFA 3K6XA 3MAMA 5I2NA 1N7XA 3HPIA 2F78A 1A55A 4E0XA 3VLVA 2XHDA 3I6VA 4LA9A 1PEBA 2RKMA 3DP8A 4U4XA 5AA1A 4NF4B 1UIUA 1Y1ZA 1FQDA 4QHQA 4FJPA 1B4ZA 1RKMA 3CRBA 4U1ZA 2ZNTA 4OENA 3LR1A 2CZLA 5A5XA 5CMMA 4N13A 3FV1A 2ANJA 2HEUA 4DXUA 3LC8A 3TZAA 1QVSA 1HSLA 3ILUB 3FXQA 5CC2A 4YZZA 3Q29A 2XXWA 3W9WA 3IR1A 2I48A 2ONRA 1MDP1 1B3EA 2OK2A 5H8FA 3L6GA 1NNKA 3RLFE 4QFNA 1SW2A 2RF1A 1S50A 4H8JA 3PU5A 3DP6A 2O1LA 4RYAA 1JNFA 3CSBA 2DWIA 1MXWA 2F36A 2NWJA 4UA8A 4GXSB 1Y20A 2ONSA 1I69A 4KPTA 5I2KB 3T9HB 1DPPA 4GFRA 1FTOA 3ECRA 2VP1A 2AIXA 5BWJA 2XXUA 3IJXB 5DT6A 4IO7A 3UP9A 1EZOA 5H8HA 3VE1B 3VV5A 4TOZA 1I6QA 4PFYA 1D9VA 3U93A 1LFHA 4TLMB 2LAOA 2YPNA 4FATA 4LONB 2V3TA 4G68C 4R2BA 4YICA 3DELB 3OELA 5B70A 3D4GA 2VHAA 1XT8A 1UTBB 3K6UA 4LUBA 1D3KA 1MDQA 2ZMBA 3QUJA 3K6VA 4KR5A 4NF8B 1FQEA 4GWOA 2O6AA 3P7IA 1MY0A 3ZSFA 1IZ1A 4XKQA 4R74A 1JVYA 3TCFA 1IEJA 3VXBA 2Y7PA 3RN8A 1Y3QA 5IKBA 1NL5A 3K00A 4NMYA 2RCBA 1WDNA 3SERA 3U94A 1LAGE 4NWCA 3KJ7A 4H67A 2Y84A 2XXXA 4JBZA 2WKYA 3TQWA 3O6GA 2Z22A 1QUJA 1O63A 1US4A 2XXIA 1ELJA 1XVYA 3QXMA 4C0RA 5AA2B 3CIJA 4BDLA 3MQ9A 3IK6B 2DXRA 4XKNA 2F7CA 2DWAA 4JSOA 2GFEA 3SDFA 1P1QA 4C1TA 2XX9A 5I57A 1XS5A 3IJOB 2XXTA 1Y9UA 4LZ8A 3JYRA 3WAFA 1FQCA 4EDPA 4LQ5A 3EHUA 5DVFA 5FTIA 2QMWA 1MRPA 2QJEA 2DXYA 3MW0A 3FASA 3CR9A 4U4SA 1D9YA 5DEXA 1M5BA 1LCFA 1M5FA 4ZEBA 5KDTA 3CI8A 1Y1MA 4ELOA 1JETA 4YKJA 1SI1A 2F35A 3T93B 1FTMA 3RUMA 3W9VA 2QL3A 3G3IA 4EQ7A 4X1DA 5CM6A 2HZLA 4GRKA 5H8SA 5HBCA 2OZZA 4U21A 5I58B 4Q30B 4PETA 4NF5A 2F7AA 1Q1KA 1GGGA 1AOVA 5K2XA 3K01A 4EF2A 2Q89A 2V3UA 3C35A 4KD5A 4HCWA 1TFAA 2I0CA 4YKPA 1JEVA 4YB5A 1A8EA 3D4CA 3HN0A 4YKIA 3OEKA 1MH4A 4MH5A 1P99A 2PYYA 1YAEA 1P1OA 3O9PA 4DDDA 1VFEA 2ALUA 3S9NC 4QFOA 3M3FA 1PB8A 3A3CA 1MXXA 3TCGA 1B3GA 3MWBA 1N0TA 4PFTA 3K0VA 1NKXA 3PMVA 2I58A 5IAIA 3RT6B 1SD3A 4QRZA 3W15C 3CG3A 4GIZA 3GXAA 3MPKA 1B1XA 1A40A 3OMBA 4ISUA 1MXZA 2QPQA 3CSGA 3KSXA 4HTGA 3E4RA 4IY5A 1MQJA 3C34A 2IA4A 1N04A 1B0HA 3MUQA 3PUXE 4LZ5A 4ZECA 1LSTA 1B7ZA 3V8XB 3SEXA 3PPOA 1P1WA 3ZKKA 4FEBA 1PC3A 3PPNA 1LBBA 3PGFA 2UYFA 2GH9A 1UTHB 4AB5A 4P0IA 2OBGA 4M4GA 2Q9TA 3C4MA 4OFJA 1DOTA 3RY3A 1II5A 3FXUA 4H8IA 2XX7A 4F2QA 2ONKE 4OXVA 4RY1A 1SW5A 1M5EA 5AA4B 2X7QA 1B51A 4O3BA 4IB2A 1H3DA 1OVTA 3MVZA 2H5YA 1YPNA 2H4IA 3U8QA 1HSJA 3H6UA 1TXFA 4JSDA 1AH5A 1JW5A 4ZDMA 3PV0E 3QAXA 2DWJA 2O1MA 2D5WA 1NH8A 3K6WA 1FTKA 3G3HA 1CE2A 4POXA 3EPEA 4PP0A 4OHNA 1H76A 1B7HA 4F39A 1UTBA 1N7WA 3IO6A 3TUSA 3SEYA 3TFLA 4Q8RA 5ELVA 4R9FA 2VOZA 1B3HA 2ZYKA 2FA7A 4GD5A 4R6HA 3KFMA 2O7IA 4MFIA 4M1VA 1MQGA 4NWDA 4EUOA 3L6HA 5FHOA 3FJGA 1A54A 3FJ7A 4ECFA 1WVJA 1ANFA 3OO9A 1IXIA 4AQ4A 3H6WA 1B0LA 1OLAA 3MVXA 3MZ9A 2UVIA 2FYIA 3FVOA 4GF8A 5I56A 3LSLA 1B1HA 1POTA 3VLUA 2RC7A 4WKMA 2P2AA 4G8MA 4GQOA 3QIMA 1TT1A 3RPWA 3FV2A 1ATGA 3EN3A 3SEVA 4IO5A 3TDJA 4HW8A 2UVJA 4PQJA 5K2YA 4P0GA 5AA2D 3OO6A 5I59B 5CRYA 1MPBA 1B58A 5JEIA 1VR5A 1DTGA 4NF6B 4ONYA 1M5DA 2HCAA 3PPRA 1N84A 4FAJA 2OLBA 1MPDA 1XVXA
chains in the Genus database with same CATH superfamily
3V83A 4O7IA 5L9MA 3C36A 1CNQA 4G68A 1RYOA 4GBWA 5L9OA 1D9QA 1GVCA 5F7VA 4U23A 1AMFA 3UK4A 4DXBA 5ISUA 3FIRA 3QYTA 4KHZE 3T9VA 2DDKA 3IOUA 2HHMA 2OCUA 3HCQA 4F3SA 3KZGA 2I49A 5CI5A 4X8RA 1QKAA 5DYHA 4G4PA 4N17A 4MJOA 5H8QB 1B3FA 4DIGA 1FPKA 4F1VA 3USDA 4HE2A 2PT2A 4JB7A 1FW0A 4L17A 1FPEA 1FPGA 4OTEA 4NTLA 4ELRA 2DE3A 2XXRA 3N6TA 3UGWA 3T9XB 5DVIA 5ITOA 4AB6A 1OIBA 4ESXA 3TTKA 4OA4A 3QK6A 4E0WA 2XXPA 3RGYA 1URDA 2O84X 2E0SA 4I62A 5LTCA 5I58A 2QS4A 2Y7KA 4N8GA 2PBWA 2PT1A 2F8DA 3Q28A 4KYSA 5ESYA 4BDNA 5TP9B 3OD7A 1LFIA 1TFDA 5ICQA 4JWYA 3KN3A 4UACA 4R6YA 3IB1A 4ZE8A 5L8DA 2Y7WA 1NV5A 2DSFA 1EU8A 1QUKA 4MF3A 1GTKA 4OETA 3MVYA 2CZHA 2BJJX 3I5OA 3G3JA 1G0IA 1BIYA 4X1BA 2FVZA 1B3LA 3S4UA 3ONMA 1QULA 4GVOA 1S7YA 1N3WA 4DCXA 1PB9A 1ZLQA 1USYE 3T22A 3SEWA 4MAGA 5EYHA 2F6GA 5TPAB 2ZNUA 3B6WA 3GBBA 3K2DA 2RINA 3KC0A 4EXLA 2DWHA 2R71A 4BDQA 1PB7A 2R8TA 1PBQA 3HFUA 2H99A 1OQGA 4P11A 2OWTA 5EHSA 3I3VA 1B40A 3R26A 4LATA 4H5GA 2Y7RA 2V4CA 1DTZA 4QSCA 4ZEIA 2HAVA 3VLWA 2X7PA 1FJ9A 3N6UA 3IX1A 4RA1A 4DE8A 5M2VA 4Z0IA 2I6EA 1B5HA 2NOOA 4ELPA 1HSEA 1KZ8A 4YU0A 3UIFA 3PUYE 1Z7ME 2VD2A 1QUIA 1LBYA 3MP6A 5I2NB 3OSRA 2ZYOA 5EYGA 5ITPA 2I4CA 5ICTA 2Z8DA 4NAPA 3HSTA 3PUVE 5AE4A 2Z23A 3G3FA 1MQHA 3FVNA 3CVGA 4F1UA 1XOCA 4R72A 1B2HA 2RC9A 4N6PA 1KWHA 1YTVA 3DLNA 1H44A 3KOTA 4ZE9A 3B7DA 2F7BA 4PTKA 1B05A 3F11A 5A5XB 3FVKA 3MZ1A 3B50A 5I3SA 4OVTA 4QFKA 2Q2AA 3MJNA 2DOJA 3G7WA 3H03A 2A5SA 1NMUA 4F3BA 2AL5A 2O51A 2QMXA 1FCKA 1MH3A 3JV9A 1QKBA 4XTCQ 1Y3NA 4OEVA 2F3DA 4QSEA 4PAIA 5H8FB 1NV3A 4F18A 1NFTA 1MM7A 1IMFA 2I3WA 1YCJA 2F6PA 4MHFA 2B65A 3KGCA 3RTFB 3OO8A 3EHTA 4YB6A 1B52A 4HS7A 2I3VA 2ESNA 4OYVA 1FTLA 1Y3PA 1NUYA 2JJKA 3VXCA 4OMBA 4YKKA 3BKIB 4MBPA 3V89B 3K1MA 1B46A 2PFYA 2IEEA 2H9BA 3ZKLA 1IIWA 4QXDA 1DSNA 1LAFE 2VGQA 4HE0A 4JXIA 3S9LC 1BK4A 4ZEKA 2OWZA 2HFBA 3DM0A 4XF5A 3CFLA 4ELQA 2UYEA 3IL1B 4QBAA 5H8HB 4PF8A 4JWOA 4LN5A 3S2VA 1LFGA 2XXQA 1SQYA 4F1YA 2REJA 3G3GA 4THIA 5KZTA 5I84A 1H43A 3UN6A 4HCYA 1QW0A 1URGA 5CBRA 1R1NA 1MY4A 4IGRA 4F31B 3U65A 1B9JA 2G93A 3B6QA 4FEDA 1NNTA 4PBQA 4RJZA 2CMOA 1LLSA 3PMWA 4NF4A 1FBFA 2F3BA 3IOWA 3OO7A 4ESWA 2HQ0A 1NH7A 2OWSA 3IB2A 4UABA 3TMGA 4X48A 3C9HA 1UIVA 1VSOA 4WEDA 3S9MC 1XHYA 2THIA 1MXVA 5L9SA 4KCCA 3SEUA 3MSTA 3TTNA 2WBBA 1FTAA 2WYPA 3E79A 4RXLA 4RPNA 1MY3A 3IB0A 1IQ7A 1LB8A 3U1OA 4HE1A 1H45A 1IXCA 1MM6A 1BLFA 2HAUA 4R9GA 3N26A 4OZ9A 3PUWE 4R73A 1FRPA 3B6TA 3KN7A 3MP8A 3C31A 1NV2A 4H45A 3MC2A 1LBVA 3Q27A 1B6HA 1FBCA 3C33A 3M8UA 3KSJA 3V5AA 1FBHA 3LSFB 2Q8JA 4Z7EA 3Q25A 3PPPA 4PE5B 2V25A 5I2KA 5CMCA 2W7YA 1IUDA 3HO7A 4F19A 4LP2B 2AL4A 5AA3A 1VDWA 4BDOA 1MXUA 4G2ZA 2HXRA 5TP9A 3OSQA 1Z7NE 3K02A 3FVGA 2R9JA 4N07A 2XXKA 1URSA 5DEXB 4TLLB 1A7LA 1MPCA 4PFUA 2XXYA 3IOTA 3RPLA 4N15A 4H6DA 2Q2CA 4JVIA 1SI0A 4MLQA 2XX8A 1NV4A 3BBRA 3LBSA 3ILTB 4GLIA 4LQ2A 4ZZAA 3H4ZA 4BDRA 4NF8A 1GV8A 4OERA 2DVZA 1A8FA 4NN3A 2GHAA 4PDDA 1B7UA 3FBPA 1SW4A 4OEUA 1FBPA 2YLNA 1JW4A 4KCDA 3K4UA 2FIXA 4YMAA 4NF5B 4PE3A 3QUFA 5DW8A 2R6GE 4KFQA 1R6ZA 4O3AA 4JWXA 1IXGA 1NNPA 2E1SA 1ZTYA 1QGXA 1LCTA 1LBWA 1FSAA 3KG2A 2NUVA 3VVFA 5H8NB 1EZ9A 4F3PA 3CFXA 4GX3A 3BFUA 1CB6A 4P3LA 4K3FA 3K1NA 3O97A 5AA2A 1JEUA 5TU0A 4EQ9A 4ZZEA 4X04A 4F2OA 4QFPA 4U1OA 4DZ1A 2F97A 1RDZA 3N94A 2XA5A 4IO6A 4PFRA 4P8BA 4Q5TA 5EHMA 1MY2A 3KBRA 4EXKA 3U92A 1B5IA 2AYSA 3IO4A 1G0HA 1AWBA 3FXBA 1R9LA 1P1NA 5JK4A 1A99A 4QSDA 3KOSA 3IAZA 4ZEDA 4WEPA 1MXYA 1S9TA 1SVXB 3TAJA 2V84A 4NE4A 3HHGA 3TEPA 3VDFA 1N3XA 4BDMA 2A5TB 4LVQA 3PD8A 1SYIA 2YJPA 1EH3A 3ODBA 1B4HA 4NEDA 3C32A 5CMBA 4POWA 2Y7IA 1EYJA 1LAXA 2I4BA 1JW1A 3U72A 1NV0A 1T0KA 2D3IA 2RCAA 4MCOA 2UVGA 4X9TA 3NOHA 3OOAA 4RNSA 4R6KA 1NI9A 1WODA 3FUZA 3LUYA 3EHSA 2GRVA 5DTBA 1JVXA 4OANA 3TTRA 3JZJA 2HZKA 4PBHA 3H3GA 2DP8A 4O7MA 5ET7A 4IO2A 1FBGA 1LGBC 4MNCA 5IZ3B 4NQ8A 1YZ0A 2VD3A 5DVJA 3MP1A 4GOTA 4GL0A 1YYZA 5ET8A 4F22A 3A29A 5JTYB 4G77A 3TCHA 4PGPA 4ND9A 3UA8A 4RK9A 3O2AA 4FIMA 3MZBA 4OFOA 4FE8A 1Y4TA 4YMBA 1MQDA 4PAFA 1MQIA 2NXOA 1EZPA 1OVBA 2ZXTA 2GHBA 2Q88A 2F34A 1JQFA 1PDAA 3T66A 1AIVA 1USYH 4DXCA 3O66A 5B7DA 4MNPA 4P56A 2XXHA 2H25A 2PX1A 4I9DA 1NV7A 1QJMA 2PVUA 3GLBA 2B3BA 5LOMA 5KCJB 1SYHA 3WAEA 3TYHA 4OVSA 2QVUA 3PUZE 2RC8A 3IOVA 4PAKA 3EQ1A 4KYEA 2QVVA 3T9UA 1XI6A 4DCYA 2DQVA 1EYIA 2V93A 4TQUQ 1NUXA 5I56B 1DPEA 1DMBA 1EYKA 2QSXA 2M8CA 4RPOA 4DI4B 5CMKA 1J1NA 3VVDA 3FJMA 4F3GA 1NV1A 1OMPA 1YXIA 4KI0E 3RTWB 1MY1A 3OENA 4I3YA 3TTLA 3T96B 3OEMA 5EYFA 2X26A 3KJTA 1SDXA 2XWOA 3N5LA 4ZS9A 1NNFA 3SESA 1ZBMA 5J1DA 3FZVA 1MG1A 3DP4A 3MVWA 4OFLA 1UTHA 4JDFA 3E13X 4G8NA 4OESA 1JP4A 4WXJA 1L5TA 4O3CA 4YB7A 4R75A 1INPA 3R6UA 4QFLA 3EF7A 3RT8A 4G68B 1SBPA 2UXAA 2REGA 5HM4B 3LSWA 1GR2A 4GWXA 4C1UA 4YAHX 5IZZA 3O28A 3TODA 3ZS6A 1MS7A 3TKDA 2QS2A 5AA4A 1LAHE 1FJ6A 2O68A 1ZMGA 3OXNA 3A09A 4XXUA 4JVCA 1B5JA 3HV1A 3FGSA 5FBPA 2XD3A 4I40A 3G3KA 2DYXA 4H65A 1VE4A 4GL8A 4OWDA 4O94A 4R2FA 3VFJA 1B32A 1IITA 3E9XA 2DE2A 1BP5A 2ZZXA 3T1BA 1FBEA 3H7MA 2B4LA 4PFWA 2B4MA 1ZKBA 3ISPA 3MBPA 4XKRA 4EF1A 3TELA 4XKPA 4KYDA 3R7XA 2D21A 1VFDA 1M5CA 1N76A 4N91A 3IFAA 3FD3A 5EQ8A 1OLCA 4GXAA 2O69A 1FPBA 4DLDA 1US5A 4KQPA 3CG1A 4U22A 2HXWA 2VPOA 2V3QA 5IM2A 1IMDA 3H6VA 2P0SA 2XXVA 3HHFA 1UQWA 1O7TA 1FQAA 5H8NA 1K9YA 4IR8A 3KEIA 2I0BA 3SKPA 1PBPA 5I59A 1TWYA 4NF6A 4LZ7A 5HPQA 1P1UA 1IXHA 3O6IA 3CHGA 2ZZVA 2ZYMA 4F29A 3SETA 1RDXA 3RQTA 3PPQA 2FBPA 2OX3A 3O6HA 4H1XA 5BUUA 3K1PA 1SPIA 3QSLA 2F5XA 4N81A 1RDYA 5CBSA 3TPAA 1BKAA 2PCRA 1I6BA 2G29A 1FTJA 4ZEFA 4KXPA 3MPLA 1ZU0A 2XD2A 2NVUB 3A3UA 4G8HA 4Q0CA 4H5FA 3FATA 2QRYA 3PMXA 3PTYA 1AL3A 1ZIUA 4EQBA 1Y4CA 5F1QA 2H98A 2ZZWA 4I1DA 5H8QA 4IGTA 2O7UA 3BFTA 1R9QA 2UVHA 2A5TA 1DCUA 1OQHA 4OVQA 4PF6A 2PMSA 2DS9A 2ZYNA 3RNNA 2B3FA 4N6DA 4GX4A 2ABHA 5FHMA 1NUZA 3Q26A 5FTHA 1SW1A 4FECA 3GBAA 4IO3A 1FQBA 4BLAA 2WBDA 3GZGA 3CFZA 3M3KA 4FORA 1LBCA 1ZJLA 3THIA 2QS1A 5I57B 2DVCA 4QF9A 1BTJA 2DE4A 3T0JA 3TQLA 4U2RA 2WYKA 3M3LA 3KN8A 3KC1A 2Z8FA 4HXVA 4I8CA 3MYUA 3S9EA 4OQOA 3UORA 3H06B 2FNCA 4IY6A 3FXRA 5JTYA 3H6TA 4MLVA 1D4NA 1XC1A 3TTMA 5KDTB 1POY1 2P1SA 4IO4A 3IFCA 1O64A 4H0WA 3E3KA 2OJTA 5TPAA 4RK2A 4MIJA 1RYXA 3IORA 3O29A 1Q35A 4GWWA 3LSXA 5EQAA 3VVEA 3PD9A 5T3JA 2P3NA 3AXFA 2Z8EA 2VPNA 5KCJA 4DI3D 1LB9A 4XIGQ 2ZNSA 2KLFA 1F9BA 4OVJA 5FHNA 2BJIA 5IZ1A 1I6AA 2QS3A 1FQFA 3K6XA 3BIHA 3MAMA 5I2NA 1N7XA 1IMBA 3HPIA 2F78A 1A55A 4E0XA 3VLVA 2XHDA 3I6VA 4LA9A 1PEBA 2RKMA 3DP8A 4U4XA 5AA1A 4NF4B 1UIUA 4GWSA 1Y1ZA 1FQDA 4QHQA 4FJPA 2WEFA 1B4ZA 1RKMA 3CRBA 1DBZA 4U1ZA 2ZNTA 4OENA 3LR1A 2L5VA 4P9KA 2CZLA 5A5XA 2CEYA 4N13A 5CMMA 3FV1A 2ANJA 2HEUA 4DXUA 3LC8A 3TZAA 1FPDA 1QVSA 1HSLA 3ILUB 3FXQA 3ROJA 5CC2A 4YZZA 3Q29A 2XXWA 3W9WA 3IR1A 2I48A 5LDZA 2ONRA 1MDP1 1B3EA 2OK2A 5H8FA 4GWYA 3L6GA 2KR0A 1NNKA 3RLFE 4QFNA 1SW2A 2RF1A 1S50A 4H8JA 3PU5A 3LUZA 3DP6A 2O1LA 4RYAA 1JNFA 3CSBA 2DWIA 2CZKA 1MXWA 2F36A 2NWJA 4UA8A 4GXSB 1Y20A 4PFBA 4NG7A 2ONSA 4H46A 1I69A 4KPTA 5I5PA 5I2KB 3T9HB 1DPPA 4GFRA 1FTOA 3ECRA 2VP1A 2AIXA 5BWJA 2XXUA 3IJXB 4OVPA 5DT6A 4IO7A 3UP9A 1EZOA 4O8MA 5H8HA 3VE1B 3VV5A 4TOZA 1I6QA 4PFYA 1D9VA 3U93A 1LFHA 4TLMB 2PFZA 1FPJA 2LAOA 2YPNA 4FATA 4LONB 2V3TA 3E78A 4G68C 4R2BA 4YICA 3DELB 3OELA 5B70A 3D4GA 3RPLB 2VHAA 1XT8A 4MNIA 1UTBB 3K6UA 4LUBA 1FPLA 2GQ1A 1D3KA 1MDQA 2ZMBA 3QUJA 5J16A 3K6VA 4KR5A 4NF8B 1FQEA 4GWOA 2O6AA 3P7IA 1MY0A 1FPIA 3ZSFA 1IZ1A 4AS4A 4XKQA 4R74A 1JVYA 3TCFA 1IEJA 3VXBA 2Y7PA 4NX1A 3RN8A 1Y3QA 5IKBA 1NL5A 3BIGA 3K00A 4NMYA 2Y5KA 2RCBA 4P1EA 4NHBA 1WDNA 2FIEA 3SERA 3U94A 1LAGE 4NWCA 3KJ7A 4H67A 2Y84A 2XXXA 4JBZA 2WKYA 3TQWA 3O6GA 2Z22A 2XWKA 1QUJA 1O63A 5ET5A 1US4A 4PDHA 2XXIA 1ELJA 1XVYA 3QXMA 4C0RA 4NGUA 5AA2B 3CIJA 4BDLA 4PCDA 3MQ9A 3IK6B 2DXRA 4XKNA 2F7CA 2DWAA 4MX6A 4JSOA 2GFEA 3SDFA 1P1QA 1NUWA 4C1TA 2XX9A 5I57A 1XS5A 3IJOB 2XXTA 1FPFA 5EQ9A 1Y9UA 4N6KA 4LZ8A 3JYRA 3WAFA 1FQCA 4EDPA 4LQ5A 3EHUA 5DVFA 5FTIA 2QMWA 1MRPA 2QJEA 5ET6A 2DXYA 3MW0A 3FASA 4NF0A 3CR9A 4U4SA 1D9YA 5DEXA 4GX6A 1M5BA 1LCFA 1M5FA 4ZEBA 5KDTA 3CI8A 1Y1MA 4ELOA 1JETA 4YKJA 1SI1A 2F35A 1KA0A 3T93B 5EQ7A 1FTMA 4JVDA 4P1LA 3RUMA 3W9VA 2QL3A 3SZPA 3G3IA 4EQ7A 4AS5A 4X1DA 5CM6A 2HZLA 4GRKA 5H8SA 5HBCA 2OZZA 4U21A 4PGNA 5I58B 4Q30B 4PETA 4NF5A 2F7AA 3KBZA 1Q1KA 1GGGA 1AOVA 4XEQA 4P47A 5K2XA 1IMEA 3K01A 4EF2A 2Q89A 2V3UA 3C35A 2XWVA 4KD5A 4XFEA 4HCWA 1TFAA 2I0CA 4YKPA 1JEVA 4YB5A 5IGAA 4FBPA 4I3EA 1A8EA 3D4CA 3HN0A 4YKIA 2Q74A 3OEKA 1MH4A 4MH5A 1P99A 2PYYA 1YAEA 1P1OA 3O9PA 4DDDA 1VFEA 2ALUA 1FBDA 3S9NC 4QFOA 3M3FA 1PB8A 1IMAA 3A3CA 1MXXA 3TCGA 1B3GA 3MWBA 1N0TA 4PFTA 2CEXA 3K0VA 1NKXA 3PMVA 2I58A 5IAIA 2Q8MA 3RT6B 1SD3A 5F24A 4QRZA 3W15C 3CG3A 4GIZA 3GXAA 3MPKA 2XWIA 2P3VA 1B1XA 4PFIA 1A40A 3OMBA 4ISUA 1NV6A 3B8BA 1MXZA 2QPQA 3CSGA 3KSXA 4HTGA 2KQZA 3E4RA 4IY5A 1MQJA 3C34A 2IA4A 1N04A 1B0HA 3MUQA 4GBVA 2HPGA 3PUXE 4LZ5A 4ZECA 1LSTA 2QVRA 1B7ZA 2WX9A 3V8XB 3SEXA 4OVRA 3PPOA 1P1WA 4MEVA 1Q9DA 3ZKKA 4FEBA 1PC3A 3PPNA 1LBBA 3PGFA 2UYFA 3GYYA 2GH9A 1UTHB 4AB5A 4N4UA 5I7IA 4P0IA 2OBGA 2MKZA 3EKIA 4M4GA 2Q9TA 3C4MA 4OFJA 1DOTA 3RY3A 2CZIA 1II5A 1LBZA 3FXUA 4H8IA 2XX7A 4F2QA 3D1RA 2ONKE 5IZ3A 4PC9A 4OXVA 4RY1A 1K9ZA 1SW5A 1M5EA 5AA4B 2X7QA 1B51A 4O3BA 4IB2A 1H3DA 1OVTA 3MVZA 4GWZA 2H5YA 1YPNA 2H4IA 3U8QA 1HSJA 3H6UA 3QMFA 1TXFA 4JSDA 1AH5A 1JW5A 4ZDMA 3PV0E 3QAXA 2DWJA 3LV0A 2O1MA 2D5WA 1NH8A 4GWUA 2FHYA 4G61A 3K6WA 1FTKA 3G3HA 1CE2A 4POXA 3EPEA 4PP0A 4OHNA 1H76A 1B7HA 4F39A 1UTBA 2QFLA 1N7WA 3IO6A 3TUSA 3SEYA 1KA1A 4MMPA 3TFLA 4Q8RA 5A5LA 5ELVA 4R9FA 2VOZA 1B3HA 2ZYKA 3RYDA 2FA7A 4GD5A 4R6HA 3KFMA 2Y5LA 2O7IA 4MFIA 4M1VA 1MQGA 4NWDA 4EUOA 3L6HA 5FHOA 1IMCA 3FJGA 4N8YA 1A54A 3FJ7A 4ECFA 1WVJA 1ANFA 3OO9A 1IXIA 4AQ4A 3H6WA 1B0LA 1LBXA 1OLAA 2VT5A 3MVXA 3MZ9A 2UVIA 2FYIA 3FVOA 4GF8A 5I56A 3LSLA 1B1HA 1POTA 3VLUA 2RC7A 4WKMA 2P2AA 4G8MA 4GQOA 3QIMA 1TT1A 3RPWA 3FV2A 1LEVA 1ATGA 3EN3A 3SEVA 4IO5A 3TDJA 4HW8A 2UVJA 4PQJA 5K2YA 4P0GA 5AA2D 3OO6A 5I59B 5CRYA 1MPBA 1B58A 1DK4A 5JEIA 1VR5A 1DTGA 4NF6B 4ONYA 1M5DA 2HCAA 3PPRA 1N84A 4FAJA 2OLBA 1MPDA 1XVXA
chains in the Genus database with same CATH topology
3V83A 5L9MA 3C36A 4G68A 1RYOA 5L9OA 1GVCA 5F7VA 4U23A 1AMFA 3UK4A 4DXBA 5ISUA 3FIRA 3QYTA 4KHZE 3T9VA 3IOUA 2OCUA 3HCQA 4F3SA 3KZGA 2I49A 5CI5A 1QKAA 5DYHA 4G4PA 5H8QB 1B3FA 4DIGA 4F1VA 3USDA 2PT2A 4JB7A 1FW0A 4L17A 4OTEA 4NTLA 4ELRA 2DE3A 2XXRA 3N6TA 3UGWA 3T9XB 5DVIA 5ITOA 4AB6A 1OIBA 4ESXA 3TTKA 3QK6A 4E0WA 2XXPA 3RGYA 1URDA 2O84X 2E0SA 4I62A 5I58A 2QS4A 2Y7KA 2PBWA 2PT1A 2F8DA 3Q28A 4KYSA 4BDNA 5TP9B 3OD7A 1LFIA 1TFDA 5ICQA 4JWYA 3KN3A 4UACA 4R6YA 3IB1A 4ZE8A 5L8DA 2Y7WA 2DSFA 1EU8A 1QUKA 4MF3A 1GTKA 4OETA 3MVYA 2BJJX 3I5OA 3G3JA 1BIYA 4X1BA 1B3LA 3S4UA 3ONMA 1QULA 4GVOA 1S7YA 1N3WA 4DCXA 1PB9A 1ZLQA 1USYE 3T22A 3SEWA 2F6GA 5TPAB 2ZNUA 3B6WA 3GBBA 3K2DA 2RINA 4EXLA 2DWHA 2R71A 4BDQA 1PB7A 1PBQA 2H99A 1OQGA 4P11A 2OWTA 5EHSA 3I3VA 1B40A 3R26A 4LATA 4H5GA 2Y7RA 1DTZA 4QSCA 4ZEIA 2HAVA 3VLWA 2X7PA 3N6UA 3IX1A 4RA1A 4DE8A 5M2VA 4Z0IA 2I6EA 1B5HA 2NOOA 4ELPA 1HSEA 4YU0A 3UIFA 1Z7ME 3PUYE 2VD2A 1QUIA 3MP6A 5I2NB 3OSRA 2ZYOA 5ITPA 2I4CA 5ICTA 2Z8DA 3HSTA 3PUVE 5AE4A 2Z23A 3G3FA 1MQHA 3FVNA 3CVGA 4F1UA 1XOCA 4R72A 1B2HA 2RC9A 4N6PA 1KWHA 1YTVA 3DLNA 1H44A 3KOTA 4ZE9A 3B7DA 2F7BA 1B05A 3F11A 5A5XB 3FVKA 3MZ1A 4QFKA 2Q2AA 3MJNA 2DOJA 3G7WA 3H03A 2A5SA 1NMUA 4F3BA 2AL5A 2O51A 2QMXA 1FCKA 1MH3A 3JV9A 1QKBA 4XTCQ 1Y3NA 4OEVA 4QSEA 5H8FB 4F18A 1NFTA 1MM7A 2I3WA 1YCJA 2F6PA 2B65A 3KGCA 3RTFB 3OO8A 3EHTA 4YB6A 1B52A 4HS7A 2I3VA 2ESNA 4OYVA 1FTLA 1Y3PA 3VXCA 4OMBA 4YKKA 3BKIB 4MBPA 3V89B 3K1MA 1B46A 2IEEA 2H9BA 3ZKLA 1IIWA 1DSNA 1LAFE 2VGQA 4JXIA 3S9LC 4ZEKA 2HFBA 3DM0A 3CFLA 4ELQA 2UYEA 3IL1B 5H8HB 4JWOA 3S2VA 1LFGA 2XXQA 1SQYA 4F1YA 2REJA 3G3GA 4THIA 5KZTA 5I84A 1H43A 3UN6A 4HCYA 1QW0A 1URGA 5CBRA 1R1NA 1MY4A 4IGRA 4F31B 1B9JA 2G93A 3B6QA 4FEDA 1NNTA 4RJZA 2CMOA 1LLSA 3PMWA 4NF4A 3IOWA 3OO7A 4ESWA 2HQ0A 1NH7A 2OWSA 3IB2A 3TMGA 4X48A 3C9HA 1UIVA 1VSOA 4WEDA 3S9MC 1XHYA 2THIA 1MXVA 5L9SA 4KCCA 3SEUA 3TTNA 4RXLA 4RPNA 1MY3A 3IB0A 1IQ7A 1LB8A 3U1OA 1H45A 1IXCA 1MM6A 1BLFA 2HAUA 4R9GA 3N26A 4OZ9A 3PUWE 4R73A 3B6TA 3KN7A 3MP8A 3C31A 3MC2A 3Q27A 1B6HA 3C33A 3M8UA 3KSJA 3V5AA 3LSFB 2Q8JA 4Z7EA 3Q25A 3PPPA 4PE5B 2V25A 5I2KA 5CMCA 2W7YA 1IUDA 3HO7A 4F19A 4LP2B 2AL4A 5AA3A 4BDOA 1MXUA 4G2ZA 5TP9A 3OSQA 1Z7NE 3K02A 3FVGA 2R9JA 4N07A 1URSA 5DEXB 4TLLB 1A7LA 1MPCA 4PFUA 2XXYA 3IOTA 4H6DA 2Q2CA 1SI0A 4MLQA 2XX8A 3BBRA 3LBSA 3ILTB 4GLIA 4LQ2A 4ZZAA 3H4ZA 4BDRA 4NF8A 1GV8A 4OERA 2DVZA 1A8FA 2GHAA 1B7UA 1SW4A 4OEUA 2YLNA 1JW4A 4KCDA 3K4UA 4YMAA 4NF5B 3QUFA 2R6GE 4KFQA 1R6ZA 4O3AA 4JWXA 1IXGA 1NNPA 2E1SA 1ZTYA 1LCTA 3KG2A 2NUVA 3VVFA 5H8NB 1EZ9A 4F3PA 3CFXA 3BFUA 1CB6A 4K3FA 3K1NA 3O97A 5AA2A 1JEUA 5TU0A 4EQ9A 4ZZEA 4F2OA 4QFPA 4U1OA 4DZ1A 2F97A 3N94A 4IO6A 4Q5TA 5EHMA 1MY2A 3KBRA 4EXKA 3U92A 1B5IA 2AYSA 3IO4A 1R9LA 1P1NA 5JK4A 1A99A 4QSDA 3KOSA 3IAZA 4ZEDA 4WEPA 1MXYA 1S9TA 1SVXB 3TAJA 2V84A 4NE4A 3HHGA 3TEPA 3VDFA 1N3XA 4BDMA 2A5TB 4LVQA 3PD8A 1SYIA 2YJPA 1EH3A 3ODBA 1B4HA 4NEDA 3C32A 5CMBA 4POWA 2Y7IA 1LAXA 2I4BA 1JW1A 3U72A 1T0KA 2D3IA 2RCAA 2UVGA 4X9TA 3OOAA 4RNSA 4R6KA 1WODA 3FUZA 3LUYA 3EHSA 2GRVA 5DTBA 1JVXA 3TTRA 3JZJA 2HZKA 3H3GA 2DP8A 4IO2A 1LGBC 5DVJA 2VD3A 3MP1A 4GOTA 4GL0A 4F22A 5JTYB 4G77A 3TCHA 4ND9A 3UA8A 4RK9A 3O2AA 4FIMA 3MZBA 4OFOA 4FE8A 1Y4TA 4YMBA 1MQDA 1MQIA 2NXOA 1EZPA 1OVBA 2ZXTA 2GHBA 2Q88A 2F34A 1JQFA 1PDAA 3T66A 1AIVA 1USYH 4DXCA 3O66A 5B7DA 2XXHA 2H25A 2PX1A 4I9DA 1QJMA 2PVUA 3GLBA 2B3BA 5LOMA 5KCJB 1SYHA 3WAEA 3TYHA 3PUZE 2RC8A 3IOVA 3EQ1A 4KYEA 3T9UA 4DCYA 2DQVA 2V93A 4TQUQ 5I56B 1DPEA 1DMBA 2QSXA 4RPOA 2M8CA 5CMKA 1J1NA 3VVDA 3FJMA 4F3GA 1OMPA 4KI0E 3RTWB 1MY1A 3OENA 3TTLA 3T96B 3OEMA 5EYFA 2X26A 3KJTA 1SDXA 3N5LA 4ZS9A 1NNFA 3SESA 1ZBMA 5J1DA 3FZVA 1MG1A 3DP4A 3MVWA 4OFLA 1UTHA 4JDFA 3E13X 4G8NA 4OESA 4WXJA 1L5TA 4O3CA 4YB7A 4R75A 3R6UA 4QFLA 3EF7A 3RT8A 4G68B 1SBPA 2UXAA 2REGA 5HM4B 3LSWA 1GR2A 4C1UA 4YAHX 3O28A 3TODA 3ZS6A 1MS7A 3TKDA 2QS2A 5AA4A 1LAHE 2O68A 1ZMGA 3OXNA 3A09A 4XXUA 1B5JA 3HV1A 3FGSA 2XD3A 3G3KA 2DYXA 4H65A 1VE4A 4GL8A 4OWDA 4R2FA 3VFJA 1B32A 1IITA 3E9XA 2DE2A 1BP5A 3H7MA 4PFWA 1ZKBA 3MBPA 4XKRA 4EF1A 3TELA 4XKPA 4KYDA 3R7XA 2D21A 1VFDA 1M5CA 1N76A 3FD3A 1OLCA 4GXAA 2O69A 4DLDA 1US5A 4KQPA 3CG1A 4U22A 2HXWA 2V3QA 3H6VA 2P0SA 2XXVA 3HHFA 1UQWA 1O7TA 1FQAA 5H8NA 3KEIA 2I0BA 3SKPA 1PBPA 5I59A 1TWYA 4NF6A 4LZ7A 5HPQA 1P1UA 1IXHA 3O6IA 2ZYMA 4F29A 3SETA 3RQTA 3PPQA 3O6HA 4H1XA 5BUUA 3K1PA 3QSLA 2F5XA 5CBSA 3TPAA 1BKAA 1I6BA 2G29A 1FTJA 4ZEFA 3MPLA 1ZU0A 2XD2A 2NVUB 3A3UA 4G8HA 4Q0CA 4H5FA 3FATA 2QRYA 3PMXA 1ZIUA 1AL3A 4EQBA 1Y4CA 5F1QA 2H98A 4I1DA 5H8QA 4IGTA 2O7UA 3BFTA 1R9QA 2UVHA 2A5TA 1OQHA 2PMSA 2DS9A 2ZYNA 3RNNA 2B3FA 2ABHA 5FHMA 3Q26A 5FTHA 1SW1A 4FECA 3GBAA 4IO3A 1FQBA 4BLAA 3GZGA 3CFZA 3M3KA 4FORA 1LBCA 1ZJLA 3THIA 2QS1A 5I57B 2DVCA 4QF9A 1BTJA 2DE4A 3TQLA 4U2RA 3M3LA 3KN8A 2Z8FA 4I8CA 3S9EA 4OQOA 3UORA 3H06B 2FNCA 4IY6A 3FXRA 5JTYA 3H6TA 4MLVA 1D4NA 1XC1A 3TTMA 5KDTB 1POY1 2P1SA 4IO4A 1O64A 4H0WA 3E3KA 2OJTA 5TPAA 4RK2A 1RYXA 3IORA 3O29A 1Q35A 3LSXA 3VVEA 3PD9A 3AXFA 2Z8EA 5KCJA 1LB9A 4XIGQ 2ZNSA 2KLFA 1F9BA 4OVJA 5FHNA 1I6AA 2QS3A 1FQFA 3K6XA 3MAMA 5I2NA 1N7XA 3HPIA 2F78A 1A55A 4E0XA 3VLVA 2XHDA 3I6VA 4LA9A 1PEBA 2RKMA 3DP8A 4U4XA 5AA1A 4NF4B 1UIUA 1Y1ZA 1FQDA 4QHQA 4FJPA 1B4ZA 1RKMA 3CRBA 4U1ZA 2ZNTA 4OENA 3LR1A 2CZLA 5A5XA 5CMMA 4N13A 3FV1A 2ANJA 2HEUA 4DXUA 3LC8A 3TZAA 1QVSA 1HSLA 3ILUB 3FXQA 5CC2A 4YZZA 3Q29A 2XXWA 3W9WA 3IR1A 2I48A 2ONRA 1MDP1 1B3EA 2OK2A 5H8FA 3L6GA 1NNKA 3RLFE 4QFNA 1SW2A 2RF1A 1S50A 4H8JA 3PU5A 3DP6A 2O1LA 4RYAA 1JNFA 3CSBA 2DWIA 1MXWA 2F36A 2NWJA 4UA8A 4GXSB 1Y20A 2ONSA 1I69A 4KPTA 5I2KB 3T9HB 1DPPA 4GFRA 1FTOA 3ECRA 2VP1A 2AIXA 5BWJA 2XXUA 3IJXB 5DT6A 4IO7A 3UP9A 1EZOA 5H8HA 3VE1B 3VV5A 4TOZA 1I6QA 4PFYA 1D9VA 3U93A 1LFHA 4TLMB 2LAOA 2YPNA 4FATA 4LONB 2V3TA 4G68C 4R2BA 4YICA 3DELB 3OELA 5B70A 3D4GA 2VHAA 1XT8A 1UTBB 3K6UA 4LUBA 1D3KA 1MDQA 2ZMBA 3QUJA 3K6VA 4KR5A 4NF8B 1FQEA 4GWOA 2O6AA 3P7IA 1MY0A 3ZSFA 1IZ1A 4XKQA 4R74A 1JVYA 3TCFA 1IEJA 3VXBA 2Y7PA 3RN8A 1Y3QA 5IKBA 1NL5A 3K00A 4NMYA 2RCBA 1WDNA 3SERA 3U94A 1LAGE 4NWCA 3KJ7A 4H67A 2Y84A 2XXXA 4JBZA 2WKYA 3TQWA 3O6GA 2Z22A 1QUJA 1O63A 1US4A 2XXIA 1ELJA 1XVYA 3QXMA 4C0RA 5AA2B 3CIJA 4BDLA 3MQ9A 3IK6B 2DXRA 4XKNA 2F7CA 2DWAA 4JSOA 2GFEA 3SDFA 1P1QA 4C1TA 2XX9A 5I57A 1XS5A 3IJOB 2XXTA 1Y9UA 4LZ8A 3JYRA 3WAFA 1FQCA 4EDPA 4LQ5A 3EHUA 5DVFA 5FTIA 2QMWA 1MRPA 2QJEA 2DXYA 3MW0A 3FASA 3CR9A 4U4SA 1D9YA 5DEXA 1M5BA 1LCFA 1M5FA 4ZEBA 5KDTA 3CI8A 1Y1MA 4ELOA 1JETA 4YKJA 1SI1A 2F35A 3T93B 1FTMA 3RUMA 3W9VA 2QL3A 3G3IA 4EQ7A 4X1DA 5CM6A 2HZLA 4GRKA 5H8SA 5HBCA 2OZZA 4U21A 5I58B 4Q30B 4PETA 4NF5A 2F7AA 1Q1KA 1GGGA 1AOVA 5K2XA 3K01A 4EF2A 2Q89A 2V3UA 3C35A 4KD5A 4HCWA 1TFAA 2I0CA 4YKPA 1JEVA 4YB5A 1A8EA 3D4CA 3HN0A 4YKIA 3OEKA 1MH4A 4MH5A 1P99A 2PYYA 1YAEA 1P1OA 3O9PA 4DDDA 1VFEA 2ALUA 3S9NC 4QFOA 3M3FA 1PB8A 3A3CA 1MXXA 3TCGA 1B3GA 3MWBA 1N0TA 4PFTA 3K0VA 1NKXA 3PMVA 2I58A 5IAIA 3RT6B 1SD3A 4QRZA 3W15C 3CG3A 4GIZA 3GXAA 3MPKA 1B1XA 1A40A 3OMBA 4ISUA 1MXZA 2QPQA 3CSGA 3KSXA 4HTGA 3E4RA 4IY5A 1MQJA 3C34A 2IA4A 1N04A 1B0HA 3MUQA 3PUXE 4LZ5A 4ZECA 1LSTA 1B7ZA 3V8XB 3SEXA 3PPOA 1P1WA 3ZKKA 4FEBA 1PC3A 3PPNA 1LBBA 3PGFA 2UYFA 2GH9A 1UTHB 4AB5A 4P0IA 2OBGA 4M4GA 2Q9TA 3C4MA 4OFJA 1DOTA 3RY3A 1II5A 3FXUA 4H8IA 2XX7A 4F2QA 2ONKE 4OXVA 4RY1A 1SW5A 1M5EA 5AA4B 2X7QA 1B51A 4O3BA 4IB2A 1H3DA 1OVTA 3MVZA 2H5YA 1YPNA 2H4IA 3U8QA 1HSJA 3H6UA 1TXFA 4JSDA 1AH5A 1JW5A 4ZDMA 3PV0E 3QAXA 2DWJA 2O1MA 2D5WA 1NH8A 3K6WA 1FTKA 3G3HA 1CE2A 4POXA 3EPEA 4PP0A 4OHNA 1H76A 1B7HA 4F39A 1UTBA 1N7WA 3IO6A 3TUSA 3SEYA 3TFLA 4Q8RA 5ELVA 4R9FA 2VOZA 1B3HA 2ZYKA 2FA7A 4GD5A 4R6HA 3KFMA 2O7IA 4MFIA 4M1VA 1MQGA 4NWDA 4EUOA 3L6HA 5FHOA 3FJGA 1A54A 3FJ7A 4ECFA 1WVJA 1ANFA 3OO9A 1IXIA 4AQ4A 3H6WA 1B0LA 1OLAA 3MVXA 3MZ9A 2UVIA 2FYIA 3FVOA 4GF8A 5I56A 3LSLA 1B1HA 1POTA 3VLUA 2RC7A 4WKMA 2P2AA 4G8MA 4GQOA 3QIMA 1TT1A 3RPWA 3FV2A 1ATGA 3EN3A 3SEVA 4IO5A 3TDJA 4HW8A 2UVJA 4PQJA 5K2YA 4P0GA 5AA2D 3OO6A 5I59B 5CRYA 1MPBA 1B58A 5JEIA 1VR5A 1DTGA 4NF6B 4ONYA 1M5DA 2HCAA 3PPRA 1N84A 4FAJA 2OLBA 1MPDA 1XVXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V83 A;  5L9M A;  3C36 A;  4G68 A;  1RYO A;  5L9O A;  1GVC A;  5F7V A;  4U23 A;  1AMF A;  3UK4 A;  4DXB A;  5ISU A;  3FIR A;  3QYT A;  4KHZ E;  3T9V A;  3IOU A;  2OCU A;  3HCQ A;  4F3S A;  3KZG A;  2I49 A;  5CI5 A;  1QKA A;  5DYH A;  4G4P A;  5H8Q B;  1B3F A;  4DIG A;  4F1V A;  3USD A;  2PT2 A;  4JB7 A;  1FW0 A;  4L17 A;  4OTE A;  4NTL A;  4ELR A;  2DE3 A;  2XXR A;  3N6T A;  3UGW A;  3T9X B;  5DVI A;  5ITO A;  4AB6 A;  1OIB A;  4ESX A;  3TTK A;  3QK6 A;  4E0W A;  2XXP A;  3RGY A;  1URD A;  2O84 X;  2E0S A;  4I62 A;  5I58 A;  2QS4 A;  2Y7K A;  2PBW A;  2PT1 A;  2F8D A;  3Q28 A;  4KYS A;  4BDN A;  5TP9 B;  3OD7 A;  1LFI A;  1TFD A;  5ICQ A;  4JWY A;  3KN3 A;  4UAC A;  4R6Y A;  3IB1 A;  4ZE8 A;  5L8D A;  2Y7W A;  2DSF A;  1EU8 A;  1QUK A;  4MF3 A;  1GTK A;  4OET A;  3MVY A;  2BJJ X;  3I5O A;  3G3J A;  1BIY A;  4X1B A;  1B3L A;  3S4U A;  3ONM A;  1QUL A;  4GVO A;  1S7Y A;  1N3W A;  4DCX A;  1PB9 A;  1ZLQ A;  1USY E;  3T22 A;  3SEW A;  2F6G A;  5TPA B;  2ZNU A;  3B6W A;  3GBB A;  3K2D A;  2RIN A;  4EXL A;  2DWH A;  2R71 A;  4BDQ A;  1PB7 A;  1PBQ A;  2H99 A;  1OQG A;  4P11 A;  2OWT A;  5EHS A;  3I3V A;  1B40 A;  3R26 A;  4LAT A;  4H5G A;  2Y7R A;  1DTZ A;  4QSC A;  4ZEI A;  2HAV A;  3VLW A;  2X7P A;  3N6U A;  3IX1 A;  4RA1 A;  4DE8 A;  5M2V A;  4Z0I A;  2I6E A;  1B5H A;  2NOO A;  4ELP A;  1HSE A;  4YU0 A;  3UIF A;  1Z7M E;  3PUY E;  2VD2 A;  1QUI A;  3MP6 A;  5I2N B;  3OSR A;  2ZYO A;  5ITP A;  2I4C A;  5ICT A;  2Z8D A;  3HST A;  3PUV E;  5AE4 A;  2Z23 A;  3G3F A;  1MQH A;  3FVN A;  3CVG A;  4F1U A;  1XOC A;  4R72 A;  1B2H A;  2RC9 A;  4N6P A;  1KWH A;  1YTV A;  3DLN A;  1H44 A;  3KOT A;  4ZE9 A;  3B7D A;  2F7B A;  1B05 A;  3F11 A;  5A5X B;  3FVK A;  3MZ1 A;  4QFK A;  2Q2A A;  3MJN A;  2DOJ A;  3G7W A;  3H03 A;  2A5S A;  1NMU A;  4F3B A;  2AL5 A;  2O51 A;  2QMX A;  1FCK A;  1MH3 A;  3JV9 A;  1QKB A;  4XTC Q;  1Y3N A;  4OEV A;  4QSE A;  5H8F B;  4F18 A;  1NFT A;  1MM7 A;  2I3W A;  1YCJ A;  2F6P A;  2B65 A;  3KGC A;  3RTF B;  3OO8 A;  3EHT A;  4YB6 A;  1B52 A;  4HS7 A;  2I3V A;  2ESN A;  4OYV A;  1FTL A;  1Y3P A;  3VXC A;  4OMB A;  4YKK A;  3BKI B;  4MBP A;  3V89 B;  3K1M A;  1B46 A;  2IEE A;  2H9B A;  3ZKL A;  1IIW A;  1DSN A;  1LAF E;  2VGQ A;  4JXI A;  3S9L C;  4ZEK A;  2HFB A;  3DM0 A;  3CFL A;  4ELQ A;  2UYE A;  3IL1 B;  5H8H B;  4JWO A;  3S2V A;  1LFG A;  2XXQ A;  1SQY A;  4F1Y A;  2REJ A;  3G3G A;  4THI A;  5KZT A;  5I84 A;  1H43 A;  3UN6 A;  4HCY A;  1QW0 A;  1URG A;  5CBR A;  1R1N A;  1MY4 A;  4IGR A;  4F31 B;  1B9J A;  2G93 A;  3B6Q A;  4FED A;  1NNT A;  4RJZ A;  2CMO A;  1LLS A;  3PMW A;  4NF4 A;  3IOW A;  3OO7 A;  4ESW A;  2HQ0 A;  1NH7 A;  2OWS A;  3IB2 A;  3TMG A;  4X48 A;  3C9H A;  1UIV A;  1VSO A;  4WED A;  3S9M C;  1XHY A;  2THI A;  1MXV A;  5L9S A;  4KCC A;  3SEU A;  3TTN A;  4RXL A;  4RPN A;  1MY3 A;  3IB0 A;  1IQ7 A;  1LB8 A;  3U1O A;  1H45 A;  1IXC A;  1MM6 A;  1BLF A;  2HAU A;  4R9G A;  3N26 A;  4OZ9 A;  3PUW E;  4R73 A;  3B6T A;  3KN7 A;  3MP8 A;  3C31 A;  3MC2 A;  3Q27 A;  1B6H A;  3C33 A;  3M8U A;  3KSJ A;  3V5A A;  3LSF B;  2Q8J A;  4Z7E A;  3Q25 A;  3PPP A;  4PE5 B;  2V25 A;  5I2K A;  5CMC A;  2W7Y A;  1IUD A;  3HO7 A;  4F19 A;  4LP2 B;  2AL4 A;  5AA3 A;  4BDO A;  1MXU A;  4G2Z A;  5TP9 A;  3OSQ A;  1Z7N E;  3K02 A;  3FVG A;  2R9J A;  4N07 A;  1URS A;  5DEX B;  4TLL B;  1A7L A;  1MPC A;  4PFU A;  2XXY A;  3IOT A;  4H6D A;  2Q2C A;  1SI0 A;  4MLQ A;  2XX8 A;  3BBR A;  3LBS A;  3ILT B;  4GLI A;  4LQ2 A;  4ZZA A;  3H4Z A;  4BDR A;  4NF8 A;  1GV8 A;  4OER A;  2DVZ A;  1A8F A;  2GHA A;  1B7U A;  1SW4 A;  4OEU A;  2YLN A;  1JW4 A;  4KCD A;  3K4U A;  4YMA A;  4NF5 B;  3QUF A;  2R6G E;  4KFQ A;  1R6Z A;  4O3A A;  4JWX A;  1IXG A;  1NNP A;  2E1S A;  1ZTY A;  1LCT A;  3KG2 A;  2NUV A;  3VVF A;  5H8N B;  1EZ9 A;  4F3P A;  3CFX A;  3BFU A;  1CB6 A;  4K3F A;  3K1N A;  3O97 A;  5AA2 A;  1JEU A;  5TU0 A;  4EQ9 A;  4ZZE A;  4F2O A;  4QFP A;  4U1O A;  4DZ1 A;  2F97 A;  3N94 A;  4IO6 A;  4Q5T A;  5EHM A;  1MY2 A;  3KBR A;  4EXK A;  3U92 A;  1B5I A;  2AYS A;  3IO4 A;  1R9L A;  1P1N A;  5JK4 A;  1A99 A;  4QSD A;  3KOS A;  3IAZ A;  4ZED A;  4WEP A;  1MXY A;  1S9T A;  1SVX B;  3TAJ A;  2V84 A;  4NE4 A;  3HHG A;  3TEP A;  3VDF A;  1N3X A;  4BDM A;  2A5T B;  4LVQ A;  3PD8 A;  1SYI A;  2YJP A;  1EH3 A;  3ODB A;  1B4H A;  4NED A;  3C32 A;  5CMB A;  4POW A;  2Y7I A;  1LAX A;  2I4B A;  1JW1 A;  3U72 A;  1T0K A;  2D3I A;  2RCA A;  2UVG A;  4X9T A;  3OOA A;  4RNS A;  4R6K A;  1WOD A;  3FUZ A;  3LUY A;  3EHS A;  2GRV A;  5DTB A;  1JVX A;  3TTR A;  3JZJ A;  2HZK A;  3H3G A;  2DP8 A;  4IO2 A;  1LGB C;  5DVJ A;  2VD3 A;  3MP1 A;  4GOT A;  4GL0 A;  4F22 A;  5JTY B;  4G77 A;  3TCH A;  4ND9 A;  3UA8 A;  4RK9 A;  3O2A A;  4FIM A;  3MZB A;  4OFO A;  4FE8 A;  1Y4T A;  4YMB A;  1MQD A;  1MQI A;  2NXO A;  1EZP A;  1OVB A;  2ZXT A;  2GHB A;  2Q88 A;  2F34 A;  1JQF A;  1PDA A;  3T66 A;  1AIV A;  1USY H;  4DXC A;  3O66 A;  5B7D A;  2XXH A;  2H25 A;  2PX1 A;  4I9D A;  1QJM A;  2PVU A;  3GLB A;  2B3B A;  5LOM A;  5KCJ B;  1SYH A;  3WAE A;  3TYH A;  3PUZ E;  2RC8 A;  3IOV A;  3EQ1 A;  4KYE A;  3T9U A;  4DCY A;  2DQV A;  2V93 A;  4TQU Q;  5I56 B;  1DPE A;  1DMB A;  2QSX A;  4RPO A;  2M8C A;  5CMK A;  1J1N A;  3VVD A;  3FJM A;  4F3G A;  1OMP A;  4KI0 E;  3RTW B;  1MY1 A;  3OEN A;  3TTL A;  3T96 B;  3OEM A;  5EYF A;  2X26 A;  3KJT A;  1SDX A;  3N5L A;  4ZS9 A;  1NNF A;  3SES A;  1ZBM A;  5J1D A;  3FZV A;  1MG1 A;  3DP4 A;  3MVW A;  4OFL A;  1UTH A;  4JDF A;  3E13 X;  4G8N A;  4OES A;  4WXJ A;  1L5T A;  4O3C A;  4YB7 A;  4R75 A;  3R6U A;  4QFL A;  3EF7 A;  3RT8 A;  4G68 B;  1SBP A;  2UXA A;  2REG A;  5HM4 B;  3LSW A;  1GR2 A;  4C1U A;  4YAH X;  3O28 A;  3TOD A;  3ZS6 A;  1MS7 A;  3TKD A;  2QS2 A;  5AA4 A;  1LAH E;  2O68 A;  1ZMG A;  3OXN A;  3A09 A;  4XXU A;  1B5J A;  3HV1 A;  3FGS A;  2XD3 A;  3G3K A;  2DYX A;  4H65 A;  1VE4 A;  4GL8 A;  4OWD A;  4R2F A;  3VFJ A;  1B32 A;  1IIT A;  3E9X A;  2DE2 A;  1BP5 A;  3H7M A;  4PFW A;  1ZKB A;  3MBP A;  4XKR A;  4EF1 A;  3TEL A;  4XKP A;  4KYD A;  3R7X A;  2D21 A;  1VFD A;  1M5C A;  1N76 A;  3FD3 A;  1OLC A;  4GXA A;  2O69 A;  4DLD A;  1US5 A;  4KQP A;  3CG1 A;  4U22 A;  2HXW A;  2V3Q A;  3H6V A;  2P0S A;  2XXV A;  3HHF A;  1UQW A;  1O7T A;  1FQA A;  5H8N A;  3KEI A;  2I0B A;  3SKP A;  1PBP A;  5I59 A;  1TWY A;  4NF6 A;  4LZ7 A;  5HPQ A;  1P1U A;  1IXH A;  3O6I A;  2ZYM A;  4F29 A;  3SET A;  3RQT A;  3PPQ A;  3O6H A;  4H1X A;  5BUU A;  3K1P A;  3QSL A;  2F5X A;  5CBS A;  3TPA A;  1BKA A;  1I6B A;  2G29 A;  1FTJ A;  4ZEF A;  3MPL A;  1ZU0 A;  2XD2 A;  2NVU B;  3A3U A;  4G8H A;  4Q0C A;  4H5F A;  3FAT A;  2QRY A;  3PMX A;  1ZIU A;  1AL3 A;  4EQB A;  1Y4C A;  5F1Q A;  2H98 A;  4I1D A;  5H8Q A;  4IGT A;  2O7U A;  3BFT A;  1R9Q A;  2UVH A;  2A5T A;  1OQH A;  2PMS A;  2DS9 A;  2ZYN A;  3RNN A;  2B3F A;  2ABH A;  5FHM A;  3Q26 A;  5FTH A;  1SW1 A;  4FEC A;  3GBA A;  4IO3 A;  1FQB A;  4BLA A;  3GZG A;  3CFZ A;  3M3K A;  4FOR A;  1LBC A;  1ZJL A;  3THI A;  2QS1 A;  5I57 B;  2DVC A;  4QF9 A;  1BTJ A;  2DE4 A;  3TQL A;  4U2R A;  3M3L A;  3KN8 A;  2Z8F A;  4I8C A;  3S9E A;  4OQO A;  3UOR A;  3H06 B;  2FNC A;  4IY6 A;  3FXR A;  5JTY A;  3H6T A;  4MLV A;  1D4N A;  1XC1 A;  3TTM A;  5KDT B;  1POY 1;  2P1S A;  4IO4 A;  1O64 A;  4H0W A;  3E3K A;  2OJT A;  5TPA A;  4RK2 A;  1RYX A;  3IOR A;  3O29 A;  1Q35 A;  3LSX A;  3VVE A;  3PD9 A;  3AXF A;  2Z8E A;  5KCJ A;  1LB9 A;  4XIG Q;  2ZNS A;  2KLF A;  1F9B A;  4OVJ A;  5FHN A;  1I6A A;  2QS3 A;  1FQF A;  3K6X A;  3MAM A;  5I2N A;  1N7X A;  3HPI A;  2F78 A;  1A55 A;  4E0X A;  3VLV A;  2XHD A;  3I6V A;  4LA9 A;  1PEB A;  2RKM A;  3DP8 A;  4U4X A;  5AA1 A;  4NF4 B;  1UIU A;  1Y1Z A;  1FQD A;  4QHQ A;  4FJP A;  1B4Z A;  1RKM A;  3CRB A;  4U1Z A;  2ZNT A;  4OEN A;  3LR1 A;  2CZL A;  5A5X A;  5CMM A;  4N13 A;  3FV1 A;  2ANJ A;  2HEU A;  4DXU A;  3LC8 A;  3TZA A;  1QVS A;  1HSL A;  3ILU B;  3FXQ A;  5CC2 A;  4YZZ A;  3Q29 A;  2XXW A;  3W9W A;  3IR1 A;  2I48 A;  2ONR A;  1MDP 1;  1B3E A;  2OK2 A;  5H8F A;  3L6G A;  1NNK A;  3RLF E;  4QFN A;  1SW2 A;  2RF1 A;  1S50 A;  4H8J A;  3PU5 A;  3DP6 A;  2O1L A;  4RYA A;  1JNF A;  3CSB A;  2DWI A;  1MXW A;  2F36 A;  2NWJ A;  4UA8 A;  4GXS B;  1Y20 A;  2ONS A;  1I69 A;  4KPT A;  5I2K B;  3T9H B;  1DPP A;  4GFR A;  1FTO A;  3ECR A;  2VP1 A;  2AIX A;  5BWJ A;  2XXU A;  3IJX B;  5DT6 A;  4IO7 A;  3UP9 A;  1EZO A;  5H8H A;  3VE1 B;  3VV5 A;  4TOZ A;  1I6Q A;  4PFY A;  1D9V A;  3U93 A;  1LFH A;  4TLM B;  2LAO A;  2YPN A;  4FAT A;  4LON B;  2V3T A;  4G68 C;  4R2B A;  4YIC A;  3DEL B;  3OEL A;  5B70 A;  3D4G A;  2VHA A;  1XT8 A;  1UTB B;  3K6U A;  4LUB A;  1D3K A;  1MDQ A;  2ZMB A;  3QUJ A;  3K6V A;  4KR5 A;  4NF8 B;  1FQE A;  4GWO A;  2O6A A;  3P7I A;  1MY0 A;  3ZSF A;  1IZ1 A;  4XKQ A;  4R74 A;  1JVY A;  3TCF A;  1IEJ A;  3VXB A;  2Y7P A;  3RN8 A;  1Y3Q A;  5IKB A;  1NL5 A;  3K00 A;  4NMY A;  2RCB A;  1WDN A;  3SER A;  3U94 A;  1LAG E;  4NWC A;  3KJ7 A;  4H67 A;  2Y84 A;  2XXX A;  4JBZ A;  2WKY A;  3TQW A;  3O6G A;  2Z22 A;  1QUJ A;  1O63 A;  1US4 A;  2XXI A;  1ELJ A;  1XVY A;  3QXM A;  4C0R A;  5AA2 B;  3CIJ A;  4BDL A;  3MQ9 A;  3IK6 B;  2DXR A;  4XKN A;  2F7C A;  2DWA A;  4JSO A;  2GFE A;  3SDF A;  1P1Q A;  4C1T A;  2XX9 A;  5I57 A;  1XS5 A;  3IJO B;  2XXT A;  1Y9U A;  4LZ8 A;  3JYR A;  3WAF A;  1FQC A;  4EDP A;  4LQ5 A;  3EHU A;  5DVF A;  5FTI A;  2QMW A;  1MRP A;  2QJE A;  2DXY A;  3MW0 A;  3FAS A;  3CR9 A;  4U4S A;  1D9Y A;  5DEX A;  1M5B A;  1LCF A;  1M5F A;  4ZEB A;  5KDT A;  3CI8 A;  1Y1M A;  4ELO A;  1JET A;  4YKJ A;  1SI1 A;  2F35 A;  3T93 B;  1FTM A;  3RUM A;  3W9V A;  2QL3 A;  3G3I A;  4EQ7 A;  4X1D A;  5CM6 A;  2HZL A;  4GRK A;  5H8S A;  5HBC A;  2OZZ A;  4U21 A;  5I58 B;  4Q30 B;  4PET A;  4NF5 A;  2F7A A;  1Q1K A;  1GGG A;  1AOV A;  5K2X A;  3K01 A;  4EF2 A;  2Q89 A;  2V3U A;  3C35 A;  4KD5 A;  4HCW A;  1TFA A;  2I0C A;  4YKP A;  1JEV A;  4YB5 A;  1A8E A;  3D4C A;  3HN0 A;  4YKI A;  3OEK A;  1MH4 A;  4MH5 A;  1P99 A;  2PYY A;  1YAE A;  1P1O A;  3O9P A;  4DDD A;  1VFE A;  2ALU A;  3S9N C;  4QFO A;  3M3F A;  1PB8 A;  3A3C A;  1MXX A;  3TCG A;  1B3G A;  3MWB A;  1N0T A;  4PFT A;  3K0V A;  1NKX A;  3PMV A;  2I58 A;  5IAI A;  3RT6 B;  1SD3 A;  4QRZ A;  3W15 C;  3CG3 A;  4GIZ A;  3GXA A;  3MPK A;  1B1X A;  1A40 A;  3OMB A;  4ISU A;  1MXZ A;  2QPQ A;  3CSG A;  3KSX A;  4HTG A;  3E4R A;  4IY5 A;  1MQJ A;  3C34 A;  2IA4 A;  1N04 A;  1B0H A;  3MUQ A;  3PUX E;  4LZ5 A;  4ZEC A;  1LST A;  1B7Z A;  3V8X B;  3SEX A;  3PPO A;  1P1W A;  3ZKK A;  4FEB A;  1PC3 A;  3PPN A;  1LBB A;  3PGF A;  2UYF A;  2GH9 A;  1UTH B;  4AB5 A;  4P0I A;  2OBG A;  4M4G A;  2Q9T A;  3C4M A;  4OFJ A;  1DOT A;  3RY3 A;  1II5 A;  3FXU A;  4H8I A;  2XX7 A;  4F2Q A;  2ONK E;  4OXV A;  4RY1 A;  1SW5 A;  1M5E A;  5AA4 B;  2X7Q A;  1B51 A;  4O3B A;  4IB2 A;  1H3D A;  1OVT A;  3MVZ A;  2H5Y A;  1YPN A;  2H4I A;  3U8Q A;  1HSJ A;  3H6U A;  1TXF A;  4JSD A;  1AH5 A;  1JW5 A;  4ZDM A;  3PV0 E;  3QAX A;  2DWJ A;  2O1M A;  2D5W A;  1NH8 A;  3K6W A;  1FTK A;  3G3H A;  1CE2 A;  4POX A;  3EPE A;  4PP0 A;  4OHN A;  1H76 A;  1B7H A;  4F39 A;  1UTB A;  1N7W A;  3IO6 A;  3TUS A;  3SEY A;  3TFL A;  4Q8R A;  5ELV A;  4R9F A;  2VOZ A;  1B3H A;  2ZYK A;  2FA7 A;  4GD5 A;  4R6H A;  3KFM A;  2O7I A;  4MFI A;  4M1V A;  1MQG A;  4NWD A;  4EUO A;  3L6H A;  5FHO A;  3FJG A;  1A54 A;  3FJ7 A;  4ECF A;  1WVJ A;  1ANF A;  3OO9 A;  1IXI A;  4AQ4 A;  3H6W A;  1B0L A;  1OLA A;  3MVX A;  3MZ9 A;  2UVI A;  2FYI A;  3FVO A;  4GF8 A;  5I56 A;  3LSL A;  1B1H A;  1POT A;  3VLU A;  2RC7 A;  4WKM A;  2P2A A;  4G8M A;  4GQO A;  3QIM A;  1TT1 A;  3RPW A;  3FV2 A;  1ATG A;  3EN3 A;  3SEV A;  4IO5 A;  3TDJ A;  4HW8 A;  2UVJ A;  4PQJ A;  5K2Y A;  4P0G A;  5AA2 D;  3OO6 A;  5I59 B;  5CRY A;  1MPB A;  1B58 A;  5JEI A;  1VR5 A;  1DTG A;  4NF6 B;  4ONY A;  1M5D A;  2HCA A;  3PPR A;  1N84 A;  4FAJ A;  2OLB A;  1MPD A;  1XVX A; 
#chains in the Genus database with same CATH topology
 3V83 A;  4O7I A;  5L9M A;  3C36 A;  1CNQ A;  4G68 A;  1RYO A;  4GBW A;  5L9O A;  1D9Q A;  1GVC A;  5F7V A;  4U23 A;  1AMF A;  3UK4 A;  4DXB A;  5ISU A;  3FIR A;  3QYT A;  4KHZ E;  3T9V A;  2DDK A;  3IOU A;  2HHM A;  2OCU A;  3HCQ A;  4F3S A;  3KZG A;  2I49 A;  5CI5 A;  4X8R A;  1QKA A;  5DYH A;  4G4P A;  4N17 A;  4MJO A;  5H8Q B;  1B3F A;  4DIG A;  1FPK A;  4F1V A;  3USD A;  4HE2 A;  2PT2 A;  4JB7 A;  1FW0 A;  4L17 A;  1FPE A;  1FPG A;  4OTE A;  4NTL A;  4ELR A;  2DE3 A;  2XXR A;  3N6T A;  3UGW A;  3T9X B;  5DVI A;  5ITO A;  4AB6 A;  1OIB A;  4ESX A;  3TTK A;  4OA4 A;  3QK6 A;  4E0W A;  2XXP A;  3RGY A;  1URD A;  2O84 X;  2E0S A;  4I62 A;  5LTC A;  5I58 A;  2QS4 A;  2Y7K A;  4N8G A;  2PBW A;  2PT1 A;  2F8D A;  3Q28 A;  4KYS A;  5ESY A;  4BDN A;  5TP9 B;  3OD7 A;  1LFI A;  1TFD A;  5ICQ A;  4JWY A;  3KN3 A;  4UAC A;  4R6Y A;  3IB1 A;  4ZE8 A;  5L8D A;  2Y7W A;  1NV5 A;  2DSF A;  1EU8 A;  1QUK A;  4MF3 A;  1GTK A;  4OET A;  3MVY A;  2CZH A;  2BJJ X;  3I5O A;  3G3J A;  1G0I A;  1BIY A;  4X1B A;  2FVZ A;  1B3L A;  3S4U A;  3ONM A;  1QUL A;  4GVO A;  1S7Y A;  1N3W A;  4DCX A;  1PB9 A;  1ZLQ A;  1USY E;  3T22 A;  3SEW A;  4MAG A;  5EYH A;  2F6G A;  5TPA B;  2ZNU A;  3B6W A;  3GBB A;  3K2D A;  2RIN A;  3KC0 A;  4EXL A;  2DWH A;  2R71 A;  4BDQ A;  1PB7 A;  2R8T A;  1PBQ A;  3HFU A;  2H99 A;  1OQG A;  4P11 A;  2OWT A;  5EHS A;  3I3V A;  1B40 A;  3R26 A;  4LAT A;  4H5G A;  2Y7R A;  2V4C A;  1DTZ A;  4QSC A;  4ZEI A;  2HAV A;  3VLW A;  2X7P A;  1FJ9 A;  3N6U A;  3IX1 A;  4RA1 A;  4DE8 A;  5M2V A;  4Z0I A;  2I6E A;  1B5H A;  2NOO A;  4ELP A;  1HSE A;  1KZ8 A;  4YU0 A;  3UIF A;  3PUY E;  1Z7M E;  2VD2 A;  1QUI A;  1LBY A;  3MP6 A;  5I2N B;  3OSR A;  2ZYO A;  5EYG A;  5ITP A;  2I4C A;  5ICT A;  2Z8D A;  4NAP A;  3HST A;  3PUV E;  5AE4 A;  2Z23 A;  3G3F A;  1MQH A;  3FVN A;  3CVG A;  4F1U A;  1XOC A;  4R72 A;  1B2H A;  2RC9 A;  4N6P A;  1KWH A;  1YTV A;  3DLN A;  1H44 A;  3KOT A;  4ZE9 A;  3B7D A;  2F7B A;  4PTK A;  1B05 A;  3F11 A;  5A5X B;  3FVK A;  3MZ1 A;  3B50 A;  5I3S A;  4OVT A;  4QFK A;  2Q2A A;  3MJN A;  2DOJ A;  3G7W A;  3H03 A;  2A5S A;  1NMU A;  4F3B A;  2AL5 A;  2O51 A;  2QMX A;  1FCK A;  1MH3 A;  3JV9 A;  1QKB A;  4XTC Q;  1Y3N A;  4OEV A;  2F3D A;  4QSE A;  4PAI A;  5H8F B;  1NV3 A;  4F18 A;  1NFT A;  1MM7 A;  1IMF A;  2I3W A;  1YCJ A;  2F6P A;  4MHF A;  2B65 A;  3KGC A;  3RTF B;  3OO8 A;  3EHT A;  4YB6 A;  1B52 A;  4HS7 A;  2I3V A;  2ESN A;  4OYV A;  1FTL A;  1Y3P A;  1NUY A;  2JJK A;  3VXC A;  4OMB A;  4YKK A;  3BKI B;  4MBP A;  3V89 B;  3K1M A;  1B46 A;  2PFY A;  2IEE A;  2H9B A;  3ZKL A;  1IIW A;  4QXD A;  1DSN A;  1LAF E;  2VGQ A;  4HE0 A;  4JXI A;  3S9L C;  1BK4 A;  4ZEK A;  2OWZ A;  2HFB A;  3DM0 A;  4XF5 A;  3CFL A;  4ELQ A;  2UYE A;  3IL1 B;  4QBA A;  5H8H B;  4PF8 A;  4JWO A;  4LN5 A;  3S2V A;  1LFG A;  2XXQ A;  1SQY A;  4F1Y A;  2REJ A;  3G3G A;  4THI A;  5KZT A;  5I84 A;  1H43 A;  3UN6 A;  4HCY A;  1QW0 A;  1URG A;  5CBR A;  1R1N A;  1MY4 A;  4IGR A;  4F31 B;  3U65 A;  1B9J A;  2G93 A;  3B6Q A;  4FED A;  1NNT A;  4PBQ A;  4RJZ A;  2CMO A;  1LLS A;  3PMW A;  4NF4 A;  1FBF A;  2F3B A;  3IOW A;  3OO7 A;  4ESW A;  2HQ0 A;  1NH7 A;  2OWS A;  3IB2 A;  4UAB A;  3TMG A;  4X48 A;  3C9H A;  1UIV A;  1VSO A;  4WED A;  3S9M C;  1XHY A;  2THI A;  1MXV A;  5L9S A;  4KCC A;  3SEU A;  3MST A;  3TTN A;  2WBB A;  1FTA A;  2WYP A;  3E79 A;  4RXL A;  4RPN A;  1MY3 A;  3IB0 A;  1IQ7 A;  1LB8 A;  3U1O A;  4HE1 A;  1H45 A;  1IXC A;  1MM6 A;  1BLF A;  2HAU A;  4R9G A;  3N26 A;  4OZ9 A;  3PUW E;  4R73 A;  1FRP A;  3B6T A;  3KN7 A;  3MP8 A;  3C31 A;  1NV2 A;  4H45 A;  3MC2 A;  1LBV A;  3Q27 A;  1B6H A;  1FBC A;  3C33 A;  3M8U A;  3KSJ A;  3V5A A;  1FBH A;  3LSF B;  2Q8J A;  4Z7E A;  3Q25 A;  3PPP A;  4PE5 B;  2V25 A;  5I2K A;  5CMC A;  2W7Y A;  1IUD A;  3HO7 A;  4F19 A;  4LP2 B;  2AL4 A;  5AA3 A;  1VDW A;  4BDO A;  1MXU A;  4G2Z A;  2HXR A;  5TP9 A;  3OSQ A;  1Z7N E;  3K02 A;  3FVG A;  2R9J A;  4N07 A;  2XXK A;  1URS A;  5DEX B;  4TLL B;  1A7L A;  1MPC A;  4PFU A;  2XXY A;  3IOT A;  3RPL A;  4N15 A;  4H6D A;  2Q2C A;  4JVI A;  1SI0 A;  4MLQ A;  2XX8 A;  1NV4 A;  3BBR A;  3LBS A;  3ILT B;  4GLI A;  4LQ2 A;  4ZZA A;  3H4Z A;  4BDR A;  4NF8 A;  1GV8 A;  4OER A;  2DVZ A;  1A8F A;  4NN3 A;  2GHA A;  4PDD A;  1B7U A;  3FBP A;  1SW4 A;  4OEU A;  1FBP A;  2YLN A;  1JW4 A;  4KCD A;  3K4U A;  2FIX A;  4YMA A;  4NF5 B;  4PE3 A;  3QUF A;  5DW8 A;  2R6G E;  4KFQ A;  1R6Z A;  4O3A A;  4JWX A;  1IXG A;  1NNP A;  2E1S A;  1ZTY A;  1QGX A;  1LCT A;  1LBW A;  1FSA A;  3KG2 A;  2NUV A;  3VVF A;  5H8N B;  1EZ9 A;  4F3P A;  3CFX A;  4GX3 A;  3BFU A;  1CB6 A;  4P3L A;  4K3F A;  3K1N A;  3O97 A;  5AA2 A;  1JEU A;  5TU0 A;  4EQ9 A;  4ZZE A;  4X04 A;  4F2O A;  4QFP A;  4U1O A;  4DZ1 A;  2F97 A;  1RDZ A;  3N94 A;  2XA5 A;  4IO6 A;  4PFR A;  4P8B A;  4Q5T A;  5EHM A;  1MY2 A;  3KBR A;  4EXK A;  3U92 A;  1B5I A;  2AYS A;  3IO4 A;  1G0H A;  1AWB A;  3FXB A;  1R9L A;  1P1N A;  5JK4 A;  1A99 A;  4QSD A;  3KOS A;  3IAZ A;  4ZED A;  4WEP A;  1MXY A;  1S9T A;  1SVX B;  3TAJ A;  2V84 A;  4NE4 A;  3HHG A;  3TEP A;  3VDF A;  1N3X A;  4BDM A;  2A5T B;  4LVQ A;  3PD8 A;  1SYI A;  2YJP A;  1EH3 A;  3ODB A;  1B4H A;  4NED A;  3C32 A;  5CMB A;  4POW A;  2Y7I A;  1EYJ A;  1LAX A;  2I4B A;  1JW1 A;  3U72 A;  1NV0 A;  1T0K A;  2D3I A;  2RCA A;  4MCO A;  2UVG A;  4X9T A;  3NOH A;  3OOA A;  4RNS A;  4R6K A;  1NI9 A;  1WOD A;  3FUZ A;  3LUY A;  3EHS A;  2GRV A;  5DTB A;  1JVX A;  4OAN A;  3TTR A;  3JZJ A;  2HZK A;  4PBH A;  3H3G A;  2DP8 A;  4O7M A;  5ET7 A;  4IO2 A;  1FBG A;  1LGB C;  4MNC A;  5IZ3 B;  4NQ8 A;  1YZ0 A;  2VD3 A;  5DVJ A;  3MP1 A;  4GOT A;  4GL0 A;  1YYZ A;  5ET8 A;  4F22 A;  3A29 A;  5JTY B;  4G77 A;  3TCH A;  4PGP A;  4ND9 A;  3UA8 A;  4RK9 A;  3O2A A;  4FIM A;  3MZB A;  4OFO A;  4FE8 A;  1Y4T A;  4YMB A;  1MQD A;  4PAF A;  1MQI A;  2NXO A;  1EZP A;  1OVB A;  2ZXT A;  2GHB A;  2Q88 A;  2F34 A;  1JQF A;  1PDA A;  3T66 A;  1AIV A;  1USY H;  4DXC A;  3O66 A;  5B7D A;  4MNP A;  4P56 A;  2XXH A;  2H25 A;  2PX1 A;  4I9D A;  1NV7 A;  1QJM A;  2PVU A;  3GLB A;  2B3B A;  5LOM A;  5KCJ B;  1SYH A;  3WAE A;  3TYH A;  4OVS A;  2QVU A;  3PUZ E;  2RC8 A;  3IOV A;  4PAK A;  3EQ1 A;  4KYE A;  2QVV A;  3T9U A;  1XI6 A;  4DCY A;  2DQV A;  1EYI A;  2V93 A;  4TQU Q;  1NUX A;  5I56 B;  1DPE A;  1DMB A;  1EYK A;  2QSX A;  2M8C A;  4RPO A;  4DI4 B;  5CMK A;  1J1N A;  3VVD A;  3FJM A;  4F3G A;  1NV1 A;  1OMP A;  1YXI A;  4KI0 E;  3RTW B;  1MY1 A;  3OEN A;  4I3Y A;  3TTL A;  3T96 B;  3OEM A;  5EYF A;  2X26 A;  3KJT A;  1SDX A;  2XWO A;  3N5L A;  4ZS9 A;  1NNF A;  3SES A;  1ZBM A;  5J1D A;  3FZV A;  1MG1 A;  3DP4 A;  3MVW A;  4OFL A;  1UTH A;  4JDF A;  3E13 X;  4G8N A;  4OES A;  1JP4 A;  4WXJ A;  1L5T A;  4O3C A;  4YB7 A;  4R75 A;  1INP A;  3R6U A;  4QFL A;  3EF7 A;  3RT8 A;  4G68 B;  1SBP A;  2UXA A;  2REG A;  5HM4 B;  3LSW A;  1GR2 A;  4GWX A;  4C1U A;  4YAH X;  5IZZ A;  3O28 A;  3TOD A;  3ZS6 A;  1MS7 A;  3TKD A;  2QS2 A;  5AA4 A;  1LAH E;  1FJ6 A;  2O68 A;  1ZMG A;  3OXN A;  3A09 A;  4XXU A;  4JVC A;  1B5J A;  3HV1 A;  3FGS A;  5FBP A;  2XD3 A;  4I40 A;  3G3K A;  2DYX A;  4H65 A;  1VE4 A;  4GL8 A;  4OWD A;  4O94 A;  4R2F A;  3VFJ A;  1B32 A;  1IIT A;  3E9X A;  2DE2 A;  1BP5 A;  2ZZX A;  3T1B A;  1FBE A;  3H7M A;  2B4L A;  4PFW A;  2B4M A;  1ZKB A;  3ISP A;  3MBP A;  4XKR A;  4EF1 A;  3TEL A;  4XKP A;  4KYD A;  3R7X A;  2D21 A;  1VFD A;  1M5C A;  1N76 A;  4N91 A;  3IFA A;  3FD3 A;  5EQ8 A;  1OLC A;  4GXA A;  2O69 A;  1FPB A;  4DLD A;  1US5 A;  4KQP A;  3CG1 A;  4U22 A;  2HXW A;  2VPO A;  2V3Q A;  5IM2 A;  1IMD A;  3H6V A;  2P0S A;  2XXV A;  3HHF A;  1UQW A;  1O7T A;  1FQA A;  5H8N A;  1K9Y A;  4IR8 A;  3KEI A;  2I0B A;  3SKP A;  1PBP A;  5I59 A;  1TWY A;  4NF6 A;  4LZ7 A;  5HPQ A;  1P1U A;  1IXH A;  3O6I A;  3CHG A;  2ZZV A;  2ZYM A;  4F29 A;  3SET A;  1RDX A;  3RQT A;  3PPQ A;  2FBP A;  2OX3 A;  3O6H A;  4H1X A;  5BUU A;  3K1P A;  1SPI A;  3QSL A;  2F5X A;  4N81 A;  1RDY A;  5CBS A;  3TPA A;  1BKA A;  2PCR A;  1I6B A;  2G29 A;  1FTJ A;  4ZEF A;  4KXP A;  3MPL A;  1ZU0 A;  2XD2 A;  2NVU B;  3A3U A;  4G8H A;  4Q0C A;  4H5F A;  3FAT A;  2QRY A;  3PMX A;  3PTY A;  1AL3 A;  1ZIU A;  4EQB A;  1Y4C A;  5F1Q A;  2H98 A;  2ZZW A;  4I1D A;  5H8Q A;  4IGT A;  2O7U A;  3BFT A;  1R9Q A;  2UVH A;  2A5T A;  1DCU A;  1OQH A;  4OVQ A;  4PF6 A;  2PMS A;  2DS9 A;  2ZYN A;  3RNN A;  2B3F A;  4N6D A;  4GX4 A;  2ABH A;  5FHM A;  1NUZ A;  3Q26 A;  5FTH A;  1SW1 A;  4FEC A;  3GBA A;  4IO3 A;  1FQB A;  4BLA A;  2WBD A;  3GZG A;  3CFZ A;  3M3K A;  4FOR A;  1LBC A;  1ZJL A;  3THI A;  2QS1 A;  5I57 B;  2DVC A;  4QF9 A;  1BTJ A;  2DE4 A;  3T0J A;  3TQL A;  4U2R A;  2WYK A;  3M3L A;  3KN8 A;  3KC1 A;  2Z8F A;  4HXV A;  4I8C A;  3MYU A;  3S9E A;  4OQO A;  3UOR A;  3H06 B;  2FNC A;  4IY6 A;  3FXR A;  5JTY A;  3H6T A;  4MLV A;  1D4N A;  1XC1 A;  3TTM A;  5KDT B;  1POY 1;  2P1S A;  4IO4 A;  3IFC A;  1O64 A;  4H0W A;  3E3K A;  2OJT A;  5TPA A;  4RK2 A;  4MIJ A;  1RYX A;  3IOR A;  3O29 A;  1Q35 A;  4GWW A;  3LSX A;  5EQA A;  3VVE A;  3PD9 A;  5T3J A;  2P3N A;  3AXF A;  2Z8E A;  2VPN A;  5KCJ A;  4DI3 D;  1LB9 A;  4XIG Q;  2ZNS A;  2KLF A;  1F9B A;  4OVJ A;  5FHN A;  2BJI A;  5IZ1 A;  1I6A A;  2QS3 A;  1FQF A;  3K6X A;  3BIH A;  3MAM A;  5I2N A;  1N7X A;  1IMB A;  3HPI A;  2F78 A;  1A55 A;  4E0X A;  3VLV A;  2XHD A;  3I6V A;  4LA9 A;  1PEB A;  2RKM A;  3DP8 A;  4U4X A;  5AA1 A;  4NF4 B;  1UIU A;  4GWS A;  1Y1Z A;  1FQD A;  4QHQ A;  4FJP A;  2WEF A;  1B4Z A;  1RKM A;  3CRB A;  1DBZ A;  4U1Z A;  2ZNT A;  4OEN A;  3LR1 A;  2L5V A;  4P9K A;  2CZL A;  5A5X A;  2CEY A;  4N13 A;  5CMM A;  3FV1 A;  2ANJ A;  2HEU A;  4DXU A;  3LC8 A;  3TZA A;  1FPD A;  1QVS A;  1HSL A;  3ILU B;  3FXQ A;  3ROJ A;  5CC2 A;  4YZZ A;  3Q29 A;  2XXW A;  3W9W A;  3IR1 A;  2I48 A;  5LDZ A;  2ONR A;  1MDP 1;  1B3E A;  2OK2 A;  5H8F A;  4GWY A;  3L6G A;  2KR0 A;  1NNK A;  3RLF E;  4QFN A;  1SW2 A;  2RF1 A;  1S50 A;  4H8J A;  3PU5 A;  3LUZ A;  3DP6 A;  2O1L A;  4RYA A;  1JNF A;  3CSB A;  2DWI A;  2CZK A;  1MXW A;  2F36 A;  2NWJ A;  4UA8 A;  4GXS B;  1Y20 A;  4PFB A;  4NG7 A;  2ONS A;  4H46 A;  1I69 A;  4KPT A;  5I5P A;  5I2K B;  3T9H B;  1DPP A;  4GFR A;  1FTO A;  3ECR A;  2VP1 A;  2AIX A;  5BWJ A;  2XXU A;  3IJX B;  4OVP A;  5DT6 A;  4IO7 A;  3UP9 A;  1EZO A;  4O8M A;  5H8H A;  3VE1 B;  3VV5 A;  4TOZ A;  1I6Q A;  4PFY A;  1D9V A;  3U93 A;  1LFH A;  4TLM B;  2PFZ A;  1FPJ A;  2LAO A;  2YPN A;  4FAT A;  4LON B;  2V3T A;  3E78 A;  4G68 C;  4R2B A;  4YIC A;  3DEL B;  3OEL A;  5B70 A;  3D4G A;  3RPL B;  2VHA A;  1XT8 A;  4MNI A;  1UTB B;  3K6U A;  4LUB A;  1FPL A;  2GQ1 A;  1D3K A;  1MDQ A;  2ZMB A;  3QUJ A;  5J16 A;  3K6V A;  4KR5 A;  4NF8 B;  1FQE A;  4GWO A;  2O6A A;  3P7I A;  1MY0 A;  1FPI A;  3ZSF A;  1IZ1 A;  4AS4 A;  4XKQ A;  4R74 A;  1JVY A;  3TCF A;  1IEJ A;  3VXB A;  2Y7P A;  4NX1 A;  3RN8 A;  1Y3Q A;  5IKB A;  1NL5 A;  3BIG A;  3K00 A;  4NMY A;  2Y5K A;  2RCB A;  4P1E A;  4NHB A;  1WDN A;  2FIE A;  3SER A;  3U94 A;  1LAG E;  4NWC A;  3KJ7 A;  4H67 A;  2Y84 A;  2XXX A;  4JBZ A;  2WKY A;  3TQW A;  3O6G A;  2Z22 A;  2XWK A;  1QUJ A;  1O63 A;  5ET5 A;  1US4 A;  4PDH A;  2XXI A;  1ELJ A;  1XVY A;  3QXM A;  4C0R A;  4NGU A;  5AA2 B;  3CIJ A;  4BDL A;  4PCD A;  3MQ9 A;  3IK6 B;  2DXR A;  4XKN A;  2F7C A;  2DWA A;  4MX6 A;  4JSO A;  2GFE A;  3SDF A;  1P1Q A;  1NUW A;  4C1T A;  2XX9 A;  5I57 A;  1XS5 A;  3IJO B;  2XXT A;  1FPF A;  5EQ9 A;  1Y9U A;  4N6K A;  4LZ8 A;  3JYR A;  3WAF A;  1FQC A;  4EDP A;  4LQ5 A;  3EHU A;  5DVF A;  5FTI A;  2QMW A;  1MRP A;  2QJE A;  5ET6 A;  2DXY A;  3MW0 A;  3FAS A;  4NF0 A;  3CR9 A;  4U4S A;  1D9Y A;  5DEX A;  4GX6 A;  1M5B A;  1LCF A;  1M5F A;  4ZEB A;  5KDT A;  3CI8 A;  1Y1M A;  4ELO A;  1JET A;  4YKJ A;  1SI1 A;  2F35 A;  1KA0 A;  3T93 B;  5EQ7 A;  1FTM A;  4JVD A;  4P1L A;  3RUM A;  3W9V A;  2QL3 A;  3SZP A;  3G3I A;  4EQ7 A;  4AS5 A;  4X1D A;  5CM6 A;  2HZL A;  4GRK A;  5H8S A;  5HBC A;  2OZZ A;  4U21 A;  4PGN A;  5I58 B;  4Q30 B;  4PET A;  4NF5 A;  2F7A A;  3KBZ A;  1Q1K A;  1GGG A;  1AOV A;  4XEQ A;  4P47 A;  5K2X A;  1IME A;  3K01 A;  4EF2 A;  2Q89 A;  2V3U A;  3C35 A;  2XWV A;  4KD5 A;  4XFE A;  4HCW A;  1TFA A;  2I0C A;  4YKP A;  1JEV A;  4YB5 A;  5IGA A;  4FBP A;  4I3E A;  1A8E A;  3D4C A;  3HN0 A;  4YKI A;  2Q74 A;  3OEK A;  1MH4 A;  4MH5 A;  1P99 A;  2PYY A;  1YAE A;  1P1O A;  3O9P A;  4DDD A;  1VFE A;  2ALU A;  1FBD A;  3S9N C;  4QFO A;  3M3F A;  1PB8 A;  1IMA A;  3A3C A;  1MXX A;  3TCG A;  1B3G A;  3MWB A;  1N0T A;  4PFT A;  2CEX A;  3K0V A;  1NKX A;  3PMV A;  2I58 A;  5IAI A;  2Q8M A;  3RT6 B;  1SD3 A;  5F24 A;  4QRZ A;  3W15 C;  3CG3 A;  4GIZ A;  3GXA A;  3MPK A;  2XWI A;  2P3V A;  1B1X A;  4PFI A;  1A40 A;  3OMB A;  4ISU A;  1NV6 A;  3B8B A;  1MXZ A;  2QPQ A;  3CSG A;  3KSX A;  4HTG A;  2KQZ A;  3E4R A;  4IY5 A;  1MQJ A;  3C34 A;  2IA4 A;  1N04 A;  1B0H A;  3MUQ A;  4GBV A;  2HPG A;  3PUX E;  4LZ5 A;  4ZEC A;  1LST A;  2QVR A;  1B7Z A;  2WX9 A;  3V8X B;  3SEX A;  4OVR A;  3PPO A;  1P1W A;  4MEV A;  1Q9D A;  3ZKK A;  4FEB A;  1PC3 A;  3PPN A;  1LBB A;  3PGF A;  2UYF A;  3GYY A;  2GH9 A;  1UTH B;  4AB5 A;  4N4U A;  5I7I A;  4P0I A;  2OBG A;  2MKZ A;  3EKI A;  4M4G A;  2Q9T A;  3C4M A;  4OFJ A;  1DOT A;  3RY3 A;  2CZI A;  1II5 A;  1LBZ A;  3FXU A;  4H8I A;  2XX7 A;  4F2Q A;  3D1R A;  2ONK E;  5IZ3 A;  4PC9 A;  4OXV A;  4RY1 A;  1K9Z A;  1SW5 A;  1M5E A;  5AA4 B;  2X7Q A;  1B51 A;  4O3B A;  4IB2 A;  1H3D A;  1OVT A;  3MVZ A;  4GWZ A;  2H5Y A;  1YPN A;  2H4I A;  3U8Q A;  1HSJ A;  3H6U A;  3QMF A;  1TXF A;  4JSD A;  1AH5 A;  1JW5 A;  4ZDM A;  3PV0 E;  3QAX A;  2DWJ A;  3LV0 A;  2O1M A;  2D5W A;  1NH8 A;  4GWU A;  2FHY A;  4G61 A;  3K6W A;  1FTK A;  3G3H A;  1CE2 A;  4POX A;  3EPE A;  4PP0 A;  4OHN A;  1H76 A;  1B7H A;  4F39 A;  1UTB A;  2QFL A;  1N7W A;  3IO6 A;  3TUS A;  3SEY A;  1KA1 A;  4MMP A;  3TFL A;  4Q8R A;  5A5L A;  5ELV A;  4R9F A;  2VOZ A;  1B3H A;  2ZYK A;  3RYD A;  2FA7 A;  4GD5 A;  4R6H A;  3KFM A;  2Y5L A;  2O7I A;  4MFI A;  4M1V A;  1MQG A;  4NWD A;  4EUO A;  3L6H A;  5FHO A;  1IMC A;  3FJG A;  4N8Y A;  1A54 A;  3FJ7 A;  4ECF A;  1WVJ A;  1ANF A;  3OO9 A;  1IXI A;  4AQ4 A;  3H6W A;  1B0L A;  1LBX A;  1OLA A;  2VT5 A;  3MVX A;  3MZ9 A;  2UVI A;  2FYI A;  3FVO A;  4GF8 A;  5I56 A;  3LSL A;  1B1H A;  1POT A;  3VLU A;  2RC7 A;  4WKM A;  2P2A A;  4G8M A;  4GQO A;  3QIM A;  1TT1 A;  3RPW A;  3FV2 A;  1LEV A;  1ATG A;  3EN3 A;  3SEV A;  4IO5 A;  3TDJ A;  4HW8 A;  2UVJ A;  4PQJ A;  5K2Y A;  4P0G A;  5AA2 D;  3OO6 A;  5I59 B;  5CRY A;  1MPB A;  1B58 A;  1DK4 A;  5JEI A;  1VR5 A;  1DTG A;  4NF6 B;  4ONY A;  1M5D A;  2HCA A;  3PPR A;  1N84 A;  4FAJ A;  2OLB A;  1MPD A;  1XVX A; 
#chains in the Genus database with same CATH homology
 3V83 A;  5L9M A;  3C36 A;  4G68 A;  1RYO A;  5L9O A;  1GVC A;  5F7V A;  4U23 A;  1AMF A;  3UK4 A;  4DXB A;  5ISU A;  3FIR A;  3QYT A;  4KHZ E;  3T9V A;  3IOU A;  2OCU A;  3HCQ A;  4F3S A;  3KZG A;  2I49 A;  5CI5 A;  1QKA A;  5DYH A;  4G4P A;  5H8Q B;  1B3F A;  4DIG A;  4F1V A;  3USD A;  2PT2 A;  4JB7 A;  1FW0 A;  4L17 A;  4OTE A;  4NTL A;  4ELR A;  2DE3 A;  2XXR A;  3N6T A;  3UGW A;  3T9X B;  5DVI A;  5ITO A;  4AB6 A;  1OIB A;  4ESX A;  3TTK A;  3QK6 A;  4E0W A;  2XXP A;  3RGY A;  1URD A;  2O84 X;  2E0S A;  4I62 A;  5I58 A;  2QS4 A;  2Y7K A;  2PBW A;  2PT1 A;  2F8D A;  3Q28 A;  4KYS A;  4BDN A;  5TP9 B;  3OD7 A;  1LFI A;  1TFD A;  5ICQ A;  4JWY A;  3KN3 A;  4UAC A;  4R6Y A;  3IB1 A;  4ZE8 A;  5L8D A;  2Y7W A;  2DSF A;  1EU8 A;  1QUK A;  4MF3 A;  1GTK A;  4OET A;  3MVY A;  2BJJ X;  3I5O A;  3G3J A;  1BIY A;  4X1B A;  1B3L A;  3S4U A;  3ONM A;  1QUL A;  4GVO A;  1S7Y A;  1N3W A;  4DCX A;  1PB9 A;  1ZLQ A;  1USY E;  3T22 A;  3SEW A;  2F6G A;  5TPA B;  2ZNU A;  3B6W A;  3GBB A;  3K2D A;  2RIN A;  4EXL A;  2DWH A;  2R71 A;  4BDQ A;  1PB7 A;  1PBQ A;  2H99 A;  1OQG A;  4P11 A;  2OWT A;  5EHS A;  3I3V A;  1B40 A;  3R26 A;  4LAT A;  4H5G A;  2Y7R A;  1DTZ A;  4QSC A;  4ZEI A;  2HAV A;  3VLW A;  2X7P A;  3N6U A;  3IX1 A;  4RA1 A;  4DE8 A;  5M2V A;  4Z0I A;  2I6E A;  1B5H A;  2NOO A;  4ELP A;  1HSE A;  4YU0 A;  3UIF A;  1Z7M E;  3PUY E;  2VD2 A;  1QUI A;  3MP6 A;  5I2N B;  3OSR A;  2ZYO A;  5ITP A;  2I4C A;  5ICT A;  2Z8D A;  3HST A;  3PUV E;  5AE4 A;  2Z23 A;  3G3F A;  1MQH A;  3FVN A;  3CVG A;  4F1U A;  1XOC A;  4R72 A;  1B2H A;  2RC9 A;  4N6P A;  1KWH A;  1YTV A;  3DLN A;  1H44 A;  3KOT A;  4ZE9 A;  3B7D A;  2F7B A;  1B05 A;  3F11 A;  5A5X B;  3FVK A;  3MZ1 A;  4QFK A;  2Q2A A;  3MJN A;  2DOJ A;  3G7W A;  3H03 A;  2A5S A;  1NMU A;  4F3B A;  2AL5 A;  2O51 A;  2QMX A;  1FCK A;  1MH3 A;  3JV9 A;  1QKB A;  4XTC Q;  1Y3N A;  4OEV A;  4QSE A;  5H8F B;  4F18 A;  1NFT A;  1MM7 A;  2I3W A;  1YCJ A;  2F6P A;  2B65 A;  3KGC A;  3RTF B;  3OO8 A;  3EHT A;  4YB6 A;  1B52 A;  4HS7 A;  2I3V A;  2ESN A;  4OYV A;  1FTL A;  1Y3P A;  3VXC A;  4OMB A;  4YKK A;  3BKI B;  4MBP A;  3V89 B;  3K1M A;  1B46 A;  2IEE A;  2H9B A;  3ZKL A;  1IIW A;  1DSN A;  1LAF E;  2VGQ A;  4JXI A;  3S9L C;  4ZEK A;  2HFB A;  3DM0 A;  3CFL A;  4ELQ A;  2UYE A;  3IL1 B;  5H8H B;  4JWO A;  3S2V A;  1LFG A;  2XXQ A;  1SQY A;  4F1Y A;  2REJ A;  3G3G A;  4THI A;  5KZT A;  5I84 A;  1H43 A;  3UN6 A;  4HCY A;  1QW0 A;  1URG A;  5CBR A;  1R1N A;  1MY4 A;  4IGR A;  4F31 B;  1B9J A;  2G93 A;  3B6Q A;  4FED A;  1NNT A;  4RJZ A;  2CMO A;  1LLS A;  3PMW A;  4NF4 A;  3IOW A;  3OO7 A;  4ESW A;  2HQ0 A;  1NH7 A;  2OWS A;  3IB2 A;  3TMG A;  4X48 A;  3C9H A;  1UIV A;  1VSO A;  4WED A;  3S9M C;  1XHY A;  2THI A;  1MXV A;  5L9S A;  4KCC A;  3SEU A;  3TTN A;  4RXL A;  4RPN A;  1MY3 A;  3IB0 A;  1IQ7 A;  1LB8 A;  3U1O A;  1H45 A;  1IXC A;  1MM6 A;  1BLF A;  2HAU A;  4R9G A;  3N26 A;  4OZ9 A;  3PUW E;  4R73 A;  3B6T A;  3KN7 A;  3MP8 A;  3C31 A;  3MC2 A;  3Q27 A;  1B6H A;  3C33 A;  3M8U A;  3KSJ A;  3V5A A;  3LSF B;  2Q8J A;  4Z7E A;  3Q25 A;  3PPP A;  4PE5 B;  2V25 A;  5I2K A;  5CMC A;  2W7Y A;  1IUD A;  3HO7 A;  4F19 A;  4LP2 B;  2AL4 A;  5AA3 A;  4BDO A;  1MXU A;  4G2Z A;  5TP9 A;  3OSQ A;  1Z7N E;  3K02 A;  3FVG A;  2R9J A;  4N07 A;  1URS A;  5DEX B;  4TLL B;  1A7L A;  1MPC A;  4PFU A;  2XXY A;  3IOT A;  4H6D A;  2Q2C A;  1SI0 A;  4MLQ A;  2XX8 A;  3BBR A;  3LBS A;  3ILT B;  4GLI A;  4LQ2 A;  4ZZA A;  3H4Z A;  4BDR A;  4NF8 A;  1GV8 A;  4OER A;  2DVZ A;  1A8F A;  2GHA A;  1B7U A;  1SW4 A;  4OEU A;  2YLN A;  1JW4 A;  4KCD A;  3K4U A;  4YMA A;  4NF5 B;  3QUF A;  2R6G E;  4KFQ A;  1R6Z A;  4O3A A;  4JWX A;  1IXG A;  1NNP A;  2E1S A;  1ZTY A;  1LCT A;  3KG2 A;  2NUV A;  3VVF A;  5H8N B;  1EZ9 A;  4F3P A;  3CFX A;  3BFU A;  1CB6 A;  4K3F A;  3K1N A;  3O97 A;  5AA2 A;  1JEU A;  5TU0 A;  4EQ9 A;  4ZZE A;  4F2O A;  4QFP A;  4U1O A;  4DZ1 A;  2F97 A;  3N94 A;  4IO6 A;  4Q5T A;  5EHM A;  1MY2 A;  3KBR A;  4EXK A;  3U92 A;  1B5I A;  2AYS A;  3IO4 A;  1R9L A;  1P1N A;  5JK4 A;  1A99 A;  4QSD A;  3KOS A;  3IAZ A;  4ZED A;  4WEP A;  1MXY A;  1S9T A;  1SVX B;  3TAJ A;  2V84 A;  4NE4 A;  3HHG A;  3TEP A;  3VDF A;  1N3X A;  4BDM A;  2A5T B;  4LVQ A;  3PD8 A;  1SYI A;  2YJP A;  1EH3 A;  3ODB A;  1B4H A;  4NED A;  3C32 A;  5CMB A;  4POW A;  2Y7I A;  1LAX A;  2I4B A;  1JW1 A;  3U72 A;  1T0K A;  2D3I A;  2RCA A;  2UVG A;  4X9T A;  3OOA A;  4RNS A;  4R6K A;  1WOD A;  3FUZ A;  3LUY A;  3EHS A;  2GRV A;  5DTB A;  1JVX A;  3TTR A;  3JZJ A;  2HZK A;  3H3G A;  2DP8 A;  4IO2 A;  1LGB C;  5DVJ A;  2VD3 A;  3MP1 A;  4GOT A;  4GL0 A;  4F22 A;  5JTY B;  4G77 A;  3TCH A;  4ND9 A;  3UA8 A;  4RK9 A;  3O2A A;  4FIM A;  3MZB A;  4OFO A;  4FE8 A;  1Y4T A;  4YMB A;  1MQD A;  1MQI A;  2NXO A;  1EZP A;  1OVB A;  2ZXT A;  2GHB A;  2Q88 A;  2F34 A;  1JQF A;  1PDA A;  3T66 A;  1AIV A;  1USY H;  4DXC A;  3O66 A;  5B7D A;  2XXH A;  2H25 A;  2PX1 A;  4I9D A;  1QJM A;  2PVU A;  3GLB A;  2B3B A;  5LOM A;  5KCJ B;  1SYH A;  3WAE A;  3TYH A;  3PUZ E;  2RC8 A;  3IOV A;  3EQ1 A;  4KYE A;  3T9U A;  4DCY A;  2DQV A;  2V93 A;  4TQU Q;  5I56 B;  1DPE A;  1DMB A;  2QSX A;  4RPO A;  2M8C A;  5CMK A;  1J1N A;  3VVD A;  3FJM A;  4F3G A;  1OMP A;  4KI0 E;  3RTW B;  1MY1 A;  3OEN A;  3TTL A;  3T96 B;  3OEM A;  5EYF A;  2X26 A;  3KJT A;  1SDX A;  3N5L A;  4ZS9 A;  1NNF A;  3SES A;  1ZBM A;  5J1D A;  3FZV A;  1MG1 A;  3DP4 A;  3MVW A;  4OFL A;  1UTH A;  4JDF A;  3E13 X;  4G8N A;  4OES A;  4WXJ A;  1L5T A;  4O3C A;  4YB7 A;  4R75 A;  3R6U A;  4QFL A;  3EF7 A;  3RT8 A;  4G68 B;  1SBP A;  2UXA A;  2REG A;  5HM4 B;  3LSW A;  1GR2 A;  4C1U A;  4YAH X;  3O28 A;  3TOD A;  3ZS6 A;  1MS7 A;  3TKD A;  2QS2 A;  5AA4 A;  1LAH E;  2O68 A;  1ZMG A;  3OXN A;  3A09 A;  4XXU A;  1B5J A;  3HV1 A;  3FGS A;  2XD3 A;  3G3K A;  2DYX A;  4H65 A;  1VE4 A;  4GL8 A;  4OWD A;  4R2F A;  3VFJ A;  1B32 A;  1IIT A;  3E9X A;  2DE2 A;  1BP5 A;  3H7M A;  4PFW A;  1ZKB A;  3MBP A;  4XKR A;  4EF1 A;  3TEL A;  4XKP A;  4KYD A;  3R7X A;  2D21 A;  1VFD A;  1M5C A;  1N76 A;  3FD3 A;  1OLC A;  4GXA A;  2O69 A;  4DLD A;  1US5 A;  4KQP A;  3CG1 A;  4U22 A;  2HXW A;  2V3Q A;  3H6V A;  2P0S A;  2XXV A;  3HHF A;  1UQW A;  1O7T A;  1FQA A;  5H8N A;  3KEI A;  2I0B A;  3SKP A;  1PBP A;  5I59 A;  1TWY A;  4NF6 A;  4LZ7 A;  5HPQ A;  1P1U A;  1IXH A;  3O6I A;  2ZYM A;  4F29 A;  3SET A;  3RQT A;  3PPQ A;  3O6H A;  4H1X A;  5BUU A;  3K1P A;  3QSL A;  2F5X A;  5CBS A;  3TPA A;  1BKA A;  1I6B A;  2G29 A;  1FTJ A;  4ZEF A;  3MPL A;  1ZU0 A;  2XD2 A;  2NVU B;  3A3U A;  4G8H A;  4Q0C A;  4H5F A;  3FAT A;  2QRY A;  3PMX A;  1ZIU A;  1AL3 A;  4EQB A;  1Y4C A;  5F1Q A;  2H98 A;  4I1D A;  5H8Q A;  4IGT A;  2O7U A;  3BFT A;  1R9Q A;  2UVH A;  2A5T A;  1OQH A;  2PMS A;  2DS9 A;  2ZYN A;  3RNN A;  2B3F A;  2ABH A;  5FHM A;  3Q26 A;  5FTH A;  1SW1 A;  4FEC A;  3GBA A;  4IO3 A;  1FQB A;  4BLA A;  3GZG A;  3CFZ A;  3M3K A;  4FOR A;  1LBC A;  1ZJL A;  3THI A;  2QS1 A;  5I57 B;  2DVC A;  4QF9 A;  1BTJ A;  2DE4 A;  3TQL A;  4U2R A;  3M3L A;  3KN8 A;  2Z8F A;  4I8C A;  3S9E A;  4OQO A;  3UOR A;  3H06 B;  2FNC A;  4IY6 A;  3FXR A;  5JTY A;  3H6T A;  4MLV A;  1D4N A;  1XC1 A;  3TTM A;  5KDT B;  1POY 1;  2P1S A;  4IO4 A;  1O64 A;  4H0W A;  3E3K A;  2OJT A;  5TPA A;  4RK2 A;  1RYX A;  3IOR A;  3O29 A;  1Q35 A;  3LSX A;  3VVE A;  3PD9 A;  3AXF A;  2Z8E A;  5KCJ A;  1LB9 A;  4XIG Q;  2ZNS A;  2KLF A;  1F9B A;  4OVJ A;  5FHN A;  1I6A A;  2QS3 A;  1FQF A;  3K6X A;  3MAM A;  5I2N A;  1N7X A;  3HPI A;  2F78 A;  1A55 A;  4E0X A;  3VLV A;  2XHD A;  3I6V A;  4LA9 A;  1PEB A;  2RKM A;  3DP8 A;  4U4X A;  5AA1 A;  4NF4 B;  1UIU A;  1Y1Z A;  1FQD A;  4QHQ A;  4FJP A;  1B4Z A;  1RKM A;  3CRB A;  4U1Z A;  2ZNT A;  4OEN A;  3LR1 A;  2CZL A;  5A5X A;  5CMM A;  4N13 A;  3FV1 A;  2ANJ A;  2HEU A;  4DXU A;  3LC8 A;  3TZA A;  1QVS A;  1HSL A;  3ILU B;  3FXQ A;  5CC2 A;  4YZZ A;  3Q29 A;  2XXW A;  3W9W A;  3IR1 A;  2I48 A;  2ONR A;  1MDP 1;  1B3E A;  2OK2 A;  5H8F A;  3L6G A;  1NNK A;  3RLF E;  4QFN A;  1SW2 A;  2RF1 A;  1S50 A;  4H8J A;  3PU5 A;  3DP6 A;  2O1L A;  4RYA A;  1JNF A;  3CSB A;  2DWI A;  1MXW A;  2F36 A;  2NWJ A;  4UA8 A;  4GXS B;  1Y20 A;  2ONS A;  1I69 A;  4KPT A;  5I2K B;  3T9H B;  1DPP A;  4GFR A;  1FTO A;  3ECR A;  2VP1 A;  2AIX A;  5BWJ A;  2XXU A;  3IJX B;  5DT6 A;  4IO7 A;  3UP9 A;  1EZO A;  5H8H A;  3VE1 B;  3VV5 A;  4TOZ A;  1I6Q A;  4PFY A;  1D9V A;  3U93 A;  1LFH A;  4TLM B;  2LAO A;  2YPN A;  4FAT A;  4LON B;  2V3T A;  4G68 C;  4R2B A;  4YIC A;  3DEL B;  3OEL A;  5B70 A;  3D4G A;  2VHA A;  1XT8 A;  1UTB B;  3K6U A;  4LUB A;  1D3K A;  1MDQ A;  2ZMB A;  3QUJ A;  3K6V A;  4KR5 A;  4NF8 B;  1FQE A;  4GWO A;  2O6A A;  3P7I A;  1MY0 A;  3ZSF A;  1IZ1 A;  4XKQ A;  4R74 A;  1JVY A;  3TCF A;  1IEJ A;  3VXB A;  2Y7P A;  3RN8 A;  1Y3Q A;  5IKB A;  1NL5 A;  3K00 A;  4NMY A;  2RCB A;  1WDN A;  3SER A;  3U94 A;  1LAG E;  4NWC A;  3KJ7 A;  4H67 A;  2Y84 A;  2XXX A;  4JBZ A;  2WKY A;  3TQW A;  3O6G A;  2Z22 A;  1QUJ A;  1O63 A;  1US4 A;  2XXI A;  1ELJ A;  1XVY A;  3QXM A;  4C0R A;  5AA2 B;  3CIJ A;  4BDL A;  3MQ9 A;  3IK6 B;  2DXR A;  4XKN A;  2F7C A;  2DWA A;  4JSO A;  2GFE A;  3SDF A;  1P1Q A;  4C1T A;  2XX9 A;  5I57 A;  1XS5 A;  3IJO B;  2XXT A;  1Y9U A;  4LZ8 A;  3JYR A;  3WAF A;  1FQC A;  4EDP A;  4LQ5 A;  3EHU A;  5DVF A;  5FTI A;  2QMW A;  1MRP A;  2QJE A;  2DXY A;  3MW0 A;  3FAS A;  3CR9 A;  4U4S A;  1D9Y A;  5DEX A;  1M5B A;  1LCF A;  1M5F A;  4ZEB A;  5KDT A;  3CI8 A;  1Y1M A;  4ELO A;  1JET A;  4YKJ A;  1SI1 A;  2F35 A;  3T93 B;  1FTM A;  3RUM A;  3W9V A;  2QL3 A;  3G3I A;  4EQ7 A;  4X1D A;  5CM6 A;  2HZL A;  4GRK A;  5H8S A;  5HBC A;  2OZZ A;  4U21 A;  5I58 B;  4Q30 B;  4PET A;  4NF5 A;  2F7A A;  1Q1K A;  1GGG A;  1AOV A;  5K2X A;  3K01 A;  4EF2 A;  2Q89 A;  2V3U A;  3C35 A;  4KD5 A;  4HCW A;  1TFA A;  2I0C A;  4YKP A;  1JEV A;  4YB5 A;  1A8E A;  3D4C A;  3HN0 A;  4YKI A;  3OEK A;  1MH4 A;  4MH5 A;  1P99 A;  2PYY A;  1YAE A;  1P1O A;  3O9P A;  4DDD A;  1VFE A;  2ALU A;  3S9N C;  4QFO A;  3M3F A;  1PB8 A;  3A3C A;  1MXX A;  3TCG A;  1B3G A;  3MWB A;  1N0T A;  4PFT A;  3K0V A;  1NKX A;  3PMV A;  2I58 A;  5IAI A;  3RT6 B;  1SD3 A;  4QRZ A;  3W15 C;  3CG3 A;  4GIZ A;  3GXA A;  3MPK A;  1B1X A;  1A40 A;  3OMB A;  4ISU A;  1MXZ A;  2QPQ A;  3CSG A;  3KSX A;  4HTG A;  3E4R A;  4IY5 A;  1MQJ A;  3C34 A;  2IA4 A;  1N04 A;  1B0H A;  3MUQ A;  3PUX E;  4LZ5 A;  4ZEC A;  1LST A;  1B7Z A;  3V8X B;  3SEX A;  3PPO A;  1P1W A;  3ZKK A;  4FEB A;  1PC3 A;  3PPN A;  1LBB A;  3PGF A;  2UYF A;  2GH9 A;  1UTH B;  4AB5 A;  4P0I A;  2OBG A;  4M4G A;  2Q9T A;  3C4M A;  4OFJ A;  1DOT A;  3RY3 A;  1II5 A;  3FXU A;  4H8I A;  2XX7 A;  4F2Q A;  2ONK E;  4OXV A;  4RY1 A;  1SW5 A;  1M5E A;  5AA4 B;  2X7Q A;  1B51 A;  4O3B A;  4IB2 A;  1H3D A;  1OVT A;  3MVZ A;  2H5Y A;  1YPN A;  2H4I A;  3U8Q A;  1HSJ A;  3H6U A;  1TXF A;  4JSD A;  1AH5 A;  1JW5 A;  4ZDM A;  3PV0 E;  3QAX A;  2DWJ A;  2O1M A;  2D5W A;  1NH8 A;  3K6W A;  1FTK A;  3G3H A;  1CE2 A;  4POX A;  3EPE A;  4PP0 A;  4OHN A;  1H76 A;  1B7H A;  4F39 A;  1UTB A;  1N7W A;  3IO6 A;  3TUS A;  3SEY A;  3TFL A;  4Q8R A;  5ELV A;  4R9F A;  2VOZ A;  1B3H A;  2ZYK A;  2FA7 A;  4GD5 A;  4R6H A;  3KFM A;  2O7I A;  4MFI A;  4M1V A;  1MQG A;  4NWD A;  4EUO A;  3L6H A;  5FHO A;  3FJG A;  1A54 A;  3FJ7 A;  4ECF A;  1WVJ A;  1ANF A;  3OO9 A;  1IXI A;  4AQ4 A;  3H6W A;  1B0L A;  1OLA A;  3MVX A;  3MZ9 A;  2UVI A;  2FYI A;  3FVO A;  4GF8 A;  5I56 A;  3LSL A;  1B1H A;  1POT A;  3VLU A;  2RC7 A;  4WKM A;  2P2A A;  4G8M A;  4GQO A;  3QIM A;  1TT1 A;  3RPW A;  3FV2 A;  1ATG A;  3EN3 A;  3SEV A;  4IO5 A;  3TDJ A;  4HW8 A;  2UVJ A;  4PQJ A;  5K2Y A;  4P0G A;  5AA2 D;  3OO6 A;  5I59 B;  5CRY A;  1MPB A;  1B58 A;  5JEI A;  1VR5 A;  1DTG A;  4NF6 B;  4ONY A;  1M5D A;  2HCA A;  3PPR A;  1N84 A;  4FAJ A;  2OLB A;  1MPD A;  1XVX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...