1IQ7A

Ovotransferrin, c-terminal lobe, apo form
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
343
structure length
341
Chain Sequence
RIQWCAVGKDEKSKCDRWSVVSNGDVECTVVDETKDCIIKIMKGEADAVALDGGLVYTAGVCGLVPVMAERYDDESCSKDERPASYFAVAVARKDSNVNWNNLKGKKSCHTAVGRTAGWVIPMGLIHNRTGTCNFDEYFSEGCAPGSPPNSRLCQLCQGSGGIPPEKCVASSHEKYFGYTGALRCLVEKGDVAFIQHSTVEENTGGKNKADWAKNLQMDDFELLCTDGRRANVMDYRECNLAEVPTHAVVVRPEKANKIRDLLERQEKRFGVNGSEKSKFMMFESQNKDLLFKDLTKCLFKVREGTTYKEFLGDKFYTVISSLKTCNPSDILQMCSFLEGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ovotransferrin
publication title Anion-mediated Fe3+ release mechanism in ovotransferrin C-lobe: a structurally identified SO4(2-) binding site and its implications for the kinetic pathway.
pubmed doi rcsb
molecule tags Metal transport
total genus 102
structure length 341
sequence length 343
ec nomenclature
pdb deposition date 2001-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00405 Transferrin Transferrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1iq7A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1iq7A02
2PX1A 4OYVA 4NF5A 5I56A 5H8FB 3FV2A 1LBCA 2ZMBA 5FTHA 2PYYA 4G68C 4M1VA 3G3FA 5I84A 3FVNA 1FTOA 3TCFA 3Q29A 3TCHA 1FTKA 3HO7A 4NWDA 4YB6A 4EUOA 3UN6A 2FNCA 2DWIA 3S9MC 4P11A 3C32A 4EQBA 2FYIA 4QF9A 1LB8A 4LVQA 3A09A 3PPOA 3L6HA 3H6TA 1ZU0A 3S9EA 3OO7A 1JW4A 5L9MA 3V83A 2HZKA 3N26A 4ZECA 1SQYA 1PB9A 2DVCA 3PMWA 2VP1A 3FGSA 3O6IA 1QUKA 1S7YA 3O6HA 1MY3A 1B46A 1NKXA 3R6UA 4RXLA 5F7VA 3O2AA 1B3EA 4BDOA 1H76A 3K0VA 1JVYA 4LQ5A 3T9UA 1PB7A 2RCAA 2B65A 2XX8A 5DT6A 3PD8A 3G7WA 1TFAA 3KSJA 2Y84A 2UXAA 5I2NA 1LGBC 4LZ7A 3BBRA 2CMOA 4G8MA 2XD3A 5J1DA 1US4A 3FIRA 1USYH 4EXLA 3R26A 4DE8A 3CSBA 1MPCA 5I58B 1MXWA 2IA4A 3DLNA 1SDXA 3TMGA 1LFGA 1TWYA 1YAEA 2Z22A 4NWCA 2DQVA 3OO6A 5K2XA 1MH3A 3T93B 4GVOA 3DM0A 1UTBA 3MZ9A 4H5GA 3K6UA 1SW2A 4AQ4A 1A7LA 1LAFE 4YAHX 4L17A 4JWXA 4WEDA 1MXUA 2OZZA 1NH8A 4OMBA 4KPTA 3IB0A 3LSFB 3SEVA 1II5A 4JWYA 1NMUA 3BFUA 2AL5A 2F36A 2DWJA 4PFWA 1VFEA 3VXBA 3FATA 4XKQA 1RYXA 1MXXA 3BKIB 2A5TB 4U4XA 2ESNA 1IXCA 1GVCA 4JWOA 4F1UA 1JVXA 5CBSA 3CVGA 2UVGA 2W7YA 1LAGE 3VLVA 4G68A 4X1BA 1URSA 4OESA 2VHAA 5JTYB 3PPRA 3OD7A 5CC2A 4BDQA 2AYSA 1Y4TA 4OVJA 4R75A 1MPBA 3TTLA 4GQOA 4DXCA 3UGWA 3VXCA 1R9LA 1R1NA 3E3KA 1XOCA 5TPAA 4PFYA 2IEEA 3DELB 4I62A 3HSTA 1LCTA 5CMKA 4I9DA 3SEXA 4R9GA 3LUYA 4KD5A 1QKBA 3H4ZA 3FXQA 4U22A 2Z8DA 3SESA 3ILTB 4GL0A 2UVIA 4F3GA 3ODBA 5I57A 1B4ZA 1DMBA 3C9HA 3G3GA 4O3AA 4IY5A 2Y7WA 2O6AA 4BDRA 1P1OA 1N3WA 1NNTA 4MFIA 1M5EA 1HSEA 1B1XA 2XXVA 4MLVA 1HSJA 1D3KA 1SW1A 5AA2B 1IXGA 3TAJA 4POXA 4NF6A 5ICTA 3HHFA 1NL5A 2R71A 1B58A 4NE4A 2ALUA 2QS3A 4F3BA 3SDFA 1A55A 3S9NC 4FATA 4EF2A 4EDPA 1EU8A 2X7QA 2H9BA 2HQ0A 2UVJA 1BP5A 4R6YA 4P0IA 3RNNA 2FA7A 3KN3A 5HPQA 4U4SA 1IIWA 2XXQA 4H1XA 2XXTA 2HAUA 1B32A 3QXMA 2E1SA 1B0HA 3OEKA 1MXZA 1QVSA 3Q26A 5H8QA 3O66A 4RA1A 2QS1A 4THIA 4E0WA 2XXRA 3OSRA 2PBWA 3OELA 4R6KA 2ONKE 1IZ1A 3KG2A 4WEPA 5HM4B 1QUIA 3IB1A 4GIZA 1VSOA 1TXFA 3DP8A 4JXIA 4O3BA 3QIMA 2PVUA 2ABHA 3MPKA 2Y7KA 4HCYA 4TLMB 3MVZA 1LFIA 1FW0A 3CFLA 1QKAA 1LAXA 3OXNA 3W9WA 3Q28A 2I4BA 3KOTA 5DEXB 1SI1A 4ELOA 4GL8A 3O29A 3CSGA 1Y4CA 4HCWA 4GWOA 2QS2A 4IO2A 2DP8A 2LAOA 2DS9A 3M3FA 1Y3QA 2I48A 3PPNA 3EQ1A 4NF4A 3ONMA 1S50A 2OLBA 1PEBA 1M5CA 4I1DA 1O64A 5KCJA 4QFKA 4PETA 1A8FA 2RF1A 3CFZA 3C33A 1UTHB 1ZJLA 5AA4B 1DOTA 4IO6A 4RK9A 1T0KA 5KZTA 3TQWA 2HCAA 3K6VA 3VFJA 2O7UA 4N07A 3FV1A 2REGA 3WAEA 2YJPA 4DCXA 4PQJA 4C1UA 4LZ5A 3PD9A 3PU5A 3I3VA 1N84A 1O63A 4OTEA 4GLIA 3RT8A 3T9VA 4IO3A 1HSLA 3QUJA 2OJTA 3KN7A 4XIGQ 2NOOA 3RUMA 3IR1A 4YU0A 3FASA 1H43A 3IL1B 1DTZA 1SI0A 1FQEA 1BKAA 5HBCA 3U94A 5H8NB 2QPQA 4OHNA 4H67A 3MZ1A 2V3UA 3GXAA 3IB2A 3HV1A 2ZYMA 3ZS6A 4U23A 2Z23A 2ZNUA 4BLAA 1I6AA 1B7UA 1QUJA 3N6TA 3TCGA 1R6ZA 2B3BA 3E13X 2I0CA 2VOZA 3HN0A 4I8CA 4RY1A 2P2AA 1XHYA 1I6BA 1SYHA 4G2ZA 4GD5A 3IORA 5L9SA 3FVOA 4MLQA 4YKIA 4KYEA 4FORA 5I58A 1LFHA 4FECA 3I6VA 2Q2AA 1B51A 1XT8A 4X48A 4IO5A 4LA9A 2KLFA 1FTLA 1Q1KA 3EHTA 2HFBA 3H3GA 3S2VA 3OSQA 1FTJA 1MQJA 1LB9A 3MVYA 2GH9A 2HZLA 3C31A 3FUZA 5CMBA 3LR1A 2Q2CA 1EZPA 1GTKA 3CR9A 3VVEA 3SEYA 3A3UA 1N7XA 4U21A 2ZNSA 4UA8A 2ANJA 3OEMA 3T22A 5I56B 1XVYA 3B7DA 2A5TA 4F22A 1B3LA 3JYRA 3IO4A 4RYAA 5DVFA 2ZYNA 4LATA 4H8JA 4YKPA 3UP9A 1QJMA 2V93A 2OCUA 4GRKA 4PFTA 5DVJA 1A40A 4LUBA 4F2QA 5JTYA 1S9TA 4F29A 4BDMA 1MDQA 4RNSA 4JB7A 2F35A 1SD3A 1UQWA 5ITOA 4OERA 2QL3A 1OMPA 4IO7A 1SW5A 5AA3A 1P1NA 3S4UA 3MVWA 4KHZE 2B3FA 4RK2A 3S9LC 5EHSA 3KFMA 1MY4A 1P1QA 1Z7NE 1CB6A 2O51A 5I2KB 3QAXA 5H8HB 1MS7A 4F3SA 2WKYA 1M5FA 4MF3A 1B5HA 3SETA 2QS4A 1PC3A 4OETA 3TELA 3ZKLA 3FVGA 2F34A 2D21A 3JZJA 4OFLA 1N0TA 2G29A 4LONB 5M2VA 2R6GE 4ZEIA 1D9YA 2ZYKA 1DPPA 1JEVA 4DLDA 2X26A 4ISUA 1BTJA 3MW0A 3UORA 5EYFA 3UA8A 3KJ7A 5CM6A 2Q89A 3KJTA 4OWDA 3LBSA 3TEPA 3KGCA 4KYDA 2H99A 1UTBB 5AA2A 2UVHA 4FAJA 1POTA 2DYXA 3EPEA 3TQLA 2QRYA 1DTGA 3EHUA 3RT6B 5L8DA 1M5BA 1BLFA 4OENA 4N6PA 3KN8A 1B7ZA 3RGYA 5K2YA 2D3IA 3EF7A 4Q30B 3V8XB 4AB6A 3TUSA 1M5DA 2Q88A 1A99A 1P1WA 1FQDA 4IY6A 5JK4A 1B3HA 2F97A 4XTCQ 2XX9A 3M3KA 2F78A 3MAMA 2DOJA 4DDDA 1PDAA 1AH5A 4ZE9A 3O9PA 2XX7A 1ZMGA 3CG1A 2PMSA 3U93A 3H06B 3KEIA 1SBPA 4G4PA 3B6TA 4NF8B 4R73A 2O1LA 1USYE 1YPNA 3MP1A 3H6WA 3N6UA 3K1PA 4Z0IA 4QFNA 4QFOA 5A5XB 3JV9A 4KCDA 2O1MA 4TLLB 1FQAA 3H7MA 3RTFB 4DIGA 1FQCA 4YMAA 4ZEDA 1ATGA 3K4UA 3G3KA 4G8HA 3HPIA 3KSXA 4F1VA 1PB8A 3PV0E 1JETA 1B5IA 3ZSFA 4H65A 3PUYE 3PMXA 4GFRA 3O6GA 4M4GA 2E0SA 3KZGA 1OLCA 1XC1A 1JNFA 3MQ9A 4ZEBA 3UK4A 3W9VA 1EZ9A 4ONYA 2DE4A 5DEXA 4JBZA 4FIMA 4IB2A 3TTMA 1N76A 4Q8RA 2O69A 2CZLA 3PUVE 3EN3A 3TFLA 3MBPA 2H98A 1D4NA 3LSXA 2XHDA 1H3DA 4O3CA 3PMVA 4ZDMA 2BJJX 4ELRA 3VVDA 1ZIUA 2G93A 3ZKKA 1MH4A 1D9VA 4OXVA 3K1MA 5FHNA 4JSDA 5H8SA 2NWJA 2RCBA 2ONSA 3U72A 1UTHA 5AA4A 4OEVA 4TQUQ 3SEUA 3D4GA 2GHAA 3DP4A 1OQGA 3CFXA 2RKMA 4RJZA 4XKRA 4NEDA 4NMYA 4ZZEA 4QFLA 3MPLA 3C34A 3VDFA 4GXSB 1TT1A 4OQOA 4HTGA 3O28A 2AIXA 2YLNA 3MZBA 3I5OA 2UYEA 4ZS9A 2GRVA 1MQGA 1B4HA 4KI0E 4EQ9A 1IXIA 1LCFA 3H6VA 2F7BA 2I3VA 5H8NA 5I59B 5H8FA 3W15C 3VLWA 2P1SA 2V3TA 1WODA 3K6XA 2DSFA 1AIVA 2ZYOA 2I4CA 1B52A 4YZZA 5DVIA 4DXUA 2I0BA 4LQ2A 1US5A 3ILUB 1QW0A 1MM7A 3PPQA 3MP6A 1Y9UA 1VE4A 2F5XA 3CI8A 1OQHA 1N04A 3IOUA 4YICA 1POY1 1B6HA 3M3LA 3LSLA 5CRYA 5B7DA 3QK6A 2AL4A 1P99A 4R2FA 3GBAA 2DXYA 4K3FA 1AL3A 3OMBA 4C1TA 3PUXE 2X7PA 1OIBA 1GGGA 3L6GA 1YTVA 3PUZE 3Q25A 1MY1A 3P7IA 3IK6B 1VR5A 3RY3A 4Q5TA 4EQ7A 1DPEA 1EZOA 5KDTB 2I58A 1B40A 1B2HA 2ZXTA 4QHQA 1XS5A 2DE2A 1R9QA 4DCYA 2H4IA 4ZEKA 1Q35A 4U1ZA 3TYHA 5AE4A 1WDNA 3N94A 4ELQA 1MPDA 4FEBA 4LP2B 4WKMA 2PT1A 1RKMA 1JW5A 1P1UA 3IX1A 5JEIA 2RC8A 4UACA 4DXBA 4ELPA 3H03A 2XXWA 2GFEA 3CRBA 4KQPA 4ESXA 3K01A 2QMWA 1IITA 4G77A 3UIFA 1J1NA 3GLBA 2ZNTA 3IO6A 4H0WA 1B5JA 4YB7A 4YMBA 3IOVA 1LLSA 3A3CA 3M8UA 1XVXA 5FHOA 3VLUA 5TP9B 5F1QA 3FXRA 1H44A 5CI5A 4P0GA 2O84X 2D5WA 1A54A 2XXUA 5ISUA 3MVXA 2V84A 1MY0A 3GZGA 4NF5B 3EHSA 2XXXA 5I2KA 5CBRA 1OVTA 1I6QA 5H8HA 4IGRA 3E9XA 3Q27A 3FJ7A 3PUWE 1B1HA 2THIA 5CMCA 4XXUA 4ZEFA 4OFJA 4QSDA 5AA2D 4LZ8A 4IGTA 1URDA 5ELVA 4QFPA 2OK2A 1FQBA 3G3JA 4ZE8A 4QRZA 3TZAA 4MH5A 2REJA 1UIUA 4FE8A 4XKPA 1AOVA 1IUDA 1MRPA 1L5TA 3K1NA 1PBPA 1MQHA 4NTLA 2O68A 3QUFA 2QJEA 3H6UA 5BWJA 4XKNA 3PPPA 3V89B 1A8EA 3IOTA 4F3PA 2Q9TA 2O7IA 3IJXB 2F6PA 3E4RA 2I3WA 1Y1ZA 3RN8A 4U2RA 5AA1A 4KCCA 1NNFA 2DVZA 2Z8FA 5I2NB 2Y7RA 3QYTA 4YB5A 1YCJA 2OBGA 3LSWA 1MG1A 3OENA 3T66A 3BFTA 5IKBA 3SKPA 1Y1MA 4ZZAA 1TFDA 3THIA 3TTKA 2VGQA 1EH3A 3C35A 4GOTA 5LOMA 4R2BA 3B6WA 1OVBA 4R74A 2ONRA 2Y7PA 4NF8A 1B05A 3RQTA 4OFOA 4HW8A 4WXJA 3TKDA 1MDP1 1B3GA 4C0RA 2XXHA 1KWHA 1UIVA 3ECRA 2RC9A 5A5XA 2P0SA 4F1YA 2QMXA 3F11A 3K00A 3AXFA 4JSOA 4RPOA 1JW1A 1JQFA 2NUVA 4R6HA 3K2DA 1ZLQA 2DE3A 2RINA 3MP8A 3FZVA 4H5FA 2V25A 3SERA 4H8IA 1ZBMA 2Y7IA 4F18A 4F31B 3DP6A 1B3FA 3VVFA 1PBQA 1IEJA 5FTIA 3RLFE 3USDA 4MBPA 4R9FA 3B6QA 1ZTYA 3MJNA 3TPAA 4GXAA 1CE2A 5DTBA 1B7HA 5FHMA 4G68B 2HEUA 3VE1B 2VD2A 3V5AA 4E0XA 4PFUA 2XXYA 2HXWA 5ITPA 4AB5A 2GHBA 2XXPA 2I49A 3HHGA 3CG3A 1IXHA 4Q0CA 1MY2A 3FXUA 3TTNA 1URGA 1NFTA 3C4MA 4GF8A 4PP0A 5DYHA 5B70A 3RTWB 1IQ7A 1RYOA 3T96B 2F6GA 4BDNA 3MWBA 5TPAB 3RPWA 1B9JA 4FEDA 3QSLA 4N13A 1FQFA 4FJPA 3HCQA 3FJGA 3GBBA 4KR5A 5BUUA 1ZKBA 4YKKA 1BIYA 3CIJA 3K02A 2DWAA 2VD3A 3U8QA 4BDLA 1MM6A 5I57B 2PT2A 5ICQA 2F7AA 4ESWA 3LC8A 5IAIA 2DWHA 4KFQA 1LAHE 4F19A 4KYSA 4ND9A 3N5LA 4PE5B 1GV8A 3IOWA 3D4CA 3K6WA 4F2OA 1I69A 4NF6B 5I59A 3G3HA 3FJMA 1N3XA 2OWSA 3WAFA 3O97A 2RC7A 1NNPA 1DSNA 4YKJA 3C36A 1NNKA 4X1DA 4EF1A 4ECFA 1OLAA 4OEUA 4U1OA 1QULA 3VV5A 4JDFA 4QSEA 4POWA 1FTMA 2H25A 2OWTA 2I6EA 3OO8A 4H6DA 1NH7A 2M8CA 1MQDA 2Z8EA 3U1OA 1MXVA 5TU0A 3R7XA 3TTRA 1SVXB 1B0LA 3KBRA 1Z7ME 1VFDA 3FD3A 2A5SA 2V3QA 1LSTA 3MC2A 3TDJA 3OOAA 5H8QB 5KDTA 2YPNA 4HS7A 4OZ9A 4QSCA 2R9JA 4Z7EA 1MXYA 1N7WA 2Q8JA 2HAVA 4IO4A 4RPNA 1Y3PA 1SW4A 5EHMA 2UYFA 1AMFA 4F39A 4X9TA 2F7CA 5CMMA 1JEUA 3T9XB 3FVKA 2DXRA 1GR2A 1Y3NA 3PGFA 2F8DA 3KOSA 3IAZA 1F9BA 5L9OA 3OO9A 1O7TA 1FCKA 3MUQA 2H5YA 1MQIA 1WVJA 4DZ1A 4G8NA 1Y20A 4TOZA 4R72A 3U92A 3IJOB 2NXOA 1LBBA 1H45A 4EXKA 4NF4B 1SYIA 5TP9A 3SEWA 3TODA 1ANFA 2NVUB 2XXIA 3G3IA 3T9HB 1ELJA 2QSXA 2XD2A 5KCJB
chains in the Genus database with same CATH superfamily
2PX1A 4OYVA 4NF5A 5I56A 1SPIA 5H8FB 2V4CA 4KXPA 1FPJA 3FV2A 1LBCA 2ZMBA 5FTHA 2PYYA 4G68C 4M1VA 3G3FA 5I84A 3FVNA 1FTOA 3TCFA 3Q29A 1FPGA 3TCHA 1FTKA 3HO7A 4NWDA 4YB6A 4EUOA 3UN6A 2FNCA 2DWIA 1EYKA 1KA1A 3S9MC 4P11A 3C32A 2HHMA 4EQBA 2FYIA 4QF9A 1LB8A 4LVQA 2XWIA 3A09A 3PPOA 3L6HA 3H6TA 1ZU0A 3S9EA 3BIHA 3OO7A 1JW4A 5L9MA 3V83A 2CEYA 2HZKA 3N26A 4ZECA 1SQYA 1PB9A 2DVCA 3PMWA 2VP1A 3FGSA 1FPFA 3O6IA 1QUKA 1S7YA 3O6HA 1MY3A 1B46A 1NKXA 3R6UA 4RXLA 3E78A 5F7VA 3O2AA 1B3EA 2XWVA 2B4MA 4BDOA 1H76A 3K0VA 5ET5A 1JVYA 4LQ5A 3T9UA 1PB7A 2RCAA 2B65A 4QXDA 1LEVA 2XX8A 5DT6A 3PD8A 3MYUA 3G7WA 1TFAA 5J16A 3KSJA 2Y84A 2UXAA 5I2NA 1LGBC 4LZ7A 3BBRA 2CMOA 4G8MA 1BK4A 2XD3A 5J1DA 1US4A 3FIRA 1USYH 4EXLA 3R26A 1AWBA 4DE8A 2XXKA 3CSBA 1MPCA 5I58B 1MXWA 2IA4A 3DLNA 1SDXA 3TMGA 4P8BA 1LFGA 1TWYA 1YAEA 2Z22A 4NWCA 2DQVA 3OO6A 5K2XA 1MH3A 3T93B 4GVOA 3DM0A 1UTBA 3MZ9A 4H5GA 3K6UA 1SW2A 4AQ4A 1A7LA 1NV5A 1LAFE 4YAHX 4L17A 4JWXA 4WEDA 1MXUA 5I7IA 2OZZA 1FPKA 1NH8A 4OMBA 2PFZA 4KPTA 4P1LA 3IB0A 4I3YA 3LSFB 3SEVA 1II5A 4JWYA 2BJIA 1NMUA 3BFUA 2AL5A 2F36A 2DWJA 4PFWA 1RDYA 4PCDA 1VFEA 3VXBA 3FATA 4XKQA 5LTCA 1NUWA 1RYXA 1MXXA 3BKIB 2A5TB 4U4XA 2ESNA 4GX4A 4IR8A 2QVUA 4GWXA 1IXCA 1GVCA 2F3DA 4JWOA 1FJ6A 4F1UA 1JVXA 5CBSA 3CVGA 4G61A 3A29A 2UVGA 2W7YA 1LAGE 3VLVA 4G68A 4X1BA 1URSA 4OESA 2VHAA 5JTYB 3PPRA 3OD7A 4P47A 5CC2A 4BDQA 2AYSA 1Y4TA 4OVJA 1CNQA 4R75A 3RYDA 1MPBA 4P1EA 4PBQA 3TTLA 4GQOA 4DXCA 3UGWA 3VXCA 1R9LA 1R1NA 4PTKA 3E3KA 3T1BA 4PBHA 1XOCA 5TPAA 4PFYA 2IEEA 3DELB 4PDHA 4I62A 3HSTA 1LCTA 5CMKA 4OVSA 4I9DA 3MSTA 3SEXA 4R9GA 3LUYA 4KD5A 1QKBA 3H4ZA 3FXQA 4U22A 2Z8DA 3SESA 3ILTB 3KBZA 4GL0A 2UVIA 4F3GA 3ODBA 5I57A 1B4ZA 1DMBA 1IMFA 3C9HA 3G3GA 4O3AA 2FHYA 3KC0A 4IY5A 2Y7WA 2O6AA 4BDRA 1P1OA 1N3WA 1NNTA 4MFIA 1M5EA 1HSEA 1B1XA 2XXVA 4MLVA 1HSJA 1D3KA 1SW1A 4GBWA 5AA2B 1IXGA 3TAJA 4POXA 4NF6A 4GWSA 5ICTA 4HE0A 4PAIA 3HHFA 2WX9A 1NL5A 2R71A 1B58A 4NE4A 2ALUA 2QS3A 4F3BA 4MNCA 1IMCA 3SDFA 1A55A 3S9NC 5EQ9A 4FATA 4EF2A 4EDPA 4OVRA 1EU8A 2X7QA 2H9BA 4NF0A 5EQ7A 2HQ0A 2UVJA 1BP5A 4R6YA 4P0IA 3RNNA 2FA7A 3KN3A 5HPQA 4U4SA 1IIWA 1INPA 2XXQA 4H1XA 2XXTA 2HAUA 1B32A 3QXMA 2E1SA 1B0HA 3OEKA 1MXZA 1QVSA 3Q26A 5H8QA 3O66A 4RA1A 2QS1A 4THIA 4E0WA 2XXRA 3OSRA 2PCRA 2PBWA 3OELA 4R6KA 3D1RA 2VPNA 2ONKE 1IZ1A 2OX3A 3KG2A 4WEPA 5HM4B 1QUIA 3U65A 3IB1A 4GIZA 1VSOA 4XEQA 1TXFA 3DP8A 4JXIA 4O3BA 3QIMA 2PVUA 2ABHA 3MPKA 1NUYA 2Y7KA 2VT5A 4HCYA 4TLMB 3SZPA 3MVZA 1LFIA 1FW0A 3CFLA 1QKAA 1LAXA 3OXNA 3W9WA 3Q28A 2I4BA 3KOTA 5DEXB 1SI1A 4UABA 4ELOA 4GL8A 3O29A 3CSGA 1Y4CA 4HCWA 1NUXA 4GWOA 2QS2A 4IO2A 2DP8A 2LAOA 2DS9A 3M3FA 1Y3QA 2I48A 3PPNA 3EQ1A 4NF4A 3ONMA 1LBZA 4OVQA 1S50A 2KQZA 2OLBA 1PEBA 1M5CA 4I1DA 1O64A 5KCJA 4QFKA 4PETA 1LBWA 3E79A 1A8FA 4PAFA 2RF1A 3CFZA 3C33A 1UTHB 1ZJLA 5AA4B 1DOTA 4IO6A 4RK9A 1T0KA 5KZTA 2Q74A 3TQWA 2HCAA 3K6VA 3VFJA 2O7UA 4N07A 3FV1A 2REGA 3WAEA 2YJPA 4DCXA 4PQJA 4C1UA 4XFEA 4LZ5A 3PD9A 3PU5A 3I3VA 1FBDA 3PTYA 1N84A 1O63A 4OTEA 4GLIA 3RT8A 3T9VA 4IO3A 4MMPA 1Q9DA 1HSLA 1NV6A 3LV0A 3QUJA 4H45A 2OJTA 3KN7A 1NV7A 4XIGQ 2NOOA 3RUMA 3IR1A 4YU0A 3FASA 1H43A 3IL1B 1DTZA 1SI0A 3FXBA 1FQEA 1BKAA 5HBCA 3U94A 5H8NB 2QPQA 4OHNA 4H67A 3MZ1A 2V3UA 3GXAA 3IB2A 3HV1A 2ZYMA 3ZS6A 4U23A 2Z23A 2ZNUA 4BLAA 4MNIA 1I6AA 1B7UA 1QUJA 3N6TA 2QVVA 3TCGA 4JVCA 1R6ZA 1FSAA 2B3BA 3E13X 2I0CA 4AS5A 2VOZA 3HN0A 4I8CA 4RY1A 2P2AA 1XHYA 1I6BA 1SYHA 4G2ZA 4GD5A 3IORA 5L9SA 3FVOA 4MLQA 5ET6A 4YKIA 4KYEA 4FORA 5I58A 5IZZA 1LFHA 4FECA 3I6VA 2Q2AA 1YYZA 4LN5A 1B51A 1XT8A 4X48A 1FBGA 4IO5A 4LA9A 2KLFA 1FTLA 4MNPA 1Q1KA 3KC1A 3EHTA 2HFBA 3H3GA 3S2VA 3OSQA 1FTJA 1MQJA 1LB9A 3MVYA 2GH9A 2Y5LA 2HZLA 3C31A 3FUZA 5CMBA 3LR1A 4MEVA 2Q2CA 1EZPA 1IMAA 1GTKA 3CR9A 3VVEA 3SEYA 3A3UA 1N7XA 4N4UA 1KA0A 4U21A 2ZNSA 4UA8A 2ANJA 3OEMA 3T22A 4MIJA 5I56B 1XVYA 3B7DA 2A5TA 4F22A 1B3LA 1NV2A 1EYIA 1NV4A 3JYRA 3IO4A 4RYAA 5DVFA 4P3LA 2ZYNA 4LATA 2FBPA 4H8JA 2L5VA 4YKPA 3UP9A 1QJMA 2V93A 2WYKA 2OCUA 4QBAA 4GRKA 4PFTA 5DVJA 5I5PA 1A40A 4LUBA 4F2QA 5JTYA 4N6KA 1S9TA 4F29A 1RDZA 5FBPA 1XI6A 4BDMA 1MDQA 4RNSA 4JB7A 4JVDA 2F35A 1SD3A 1UQWA 5ITOA 4OERA 2QL3A 1OMPA 4IO7A 1SW5A 5IM2A 5AA3A 1P1NA 3S4UA 3MVWA 4KHZE 2B3FA 4RK2A 3S9LC 5EHSA 3KFMA 1MY4A 1P1QA 1Z7NE 1CB6A 2O51A 5I2KB 3QAXA 5H8HB 1MS7A 4F3SA 2WKYA 1M5FA 4MF3A 1B5HA 3SETA 2QS4A 1PC3A 4GWZA 4OETA 3TELA 3ZKLA 4DI4B 3FVGA 2F34A 2D21A 3JZJA 4OFLA 1N0TA 4GX6A 2G29A 4LONB 5A5LA 5M2VA 2R6GE 4ZEIA 1D9YA 2ZYKA 1DPPA 1JEVA 4DLDA 4N8GA 2FVZA 2X26A 3IFCA 4ISUA 1BTJA 3MW0A 3UORA 5EYFA 3UA8A 3KJ7A 2XWKA 5CM6A 2P3NA 2Q89A 3KJTA 4OWDA 3LBSA 3TEPA 3KGCA 4KYDA 2H99A 1UTBB 5AA2A 2UVHA 4FAJA 5LDZA 1POTA 2DYXA 3EPEA 5IZ3B 3TQLA 2QRYA 1DTGA 3NOHA 3EHUA 3RT6B 5L8DA 4PF8A 1M5BA 2XWOA 1BLFA 4OENA 4GWUA 4N6PA 3KN8A 1B7ZA 3RGYA 5K2YA 2D3IA 3EF7A 4Q30B 3V8XB 4AB6A 3TUSA 1M5DA 2Q88A 1A99A 1P1WA 1FQDA 4IY6A 5JK4A 1B3HA 2F97A 4XTCQ 2XX9A 3M3KA 2F78A 1FPBA 3MAMA 2DOJA 4DDDA 1PDAA 4I40A 1AH5A 4MHFA 4ZE9A 3O9PA 4PFIA 2XX7A 5EQ8A 4NGUA 1ZMGA 3CG1A 2PMSA 3U93A 3H06B 3KEIA 1SBPA 4G4PA 3B6TA 4NF8B 4R73A 2O1LA 1USYE 1YPNA 3MP1A 3H6WA 3N6UA 3K1PA 4Z0IA 4QFNA 4QFOA 5A5XB 3JV9A 4KCDA 4MAGA 2O1MA 4TLLB 1FQAA 3H7MA 1NV1A 3RTFB 4JVIA 1NV0A 4DIGA 4NHBA 1EYJA 1FQCA 5IGAA 4YMAA 4ZEDA 1ATGA 3K4UA 2HXRA 3G3KA 4G8HA 3HPIA 3KSXA 3GYYA 4F1VA 1PB8A 3PV0E 1JETA 4N17A 1B5IA 3ZSFA 4NX1A 4H65A 3PUYE 3PMXA 4GFRA 3O6GA 4M4GA 4OVTA 2E0SA 3KZGA 1OLCA 3CHGA 1XC1A 1JNFA 4GWWA 3MQ9A 4ZEBA 3UK4A 3W9VA 2MKZA 1EZ9A 4ONYA 2DE4A 5DEXA 4JBZA 4FIMA 1LBYA 4IB2A 3TTMA 1N76A 4XF5A 4Q8RA 2O69A 2CZLA 2CZHA 3PUVE 3EN3A 3TFLA 3MBPA 2H98A 1D4NA 3LSXA 2XHDA 1H3DA 4O3CA 3PMVA 1JP4A 4ZDMA 2BJJX 4ELRA 4O8MA 3VVDA 1K9YA 1ZIUA 5EYGA 2G93A 3ZKKA 1MH4A 1D9VA 4FBPA 4OXVA 3K1MA 5FHNA 4JSDA 5H8SA 2NWJA 2RCBA 2ONSA 3U72A 1UTHA 4PFRA 5AA4A 4OEVA 4TQUQ 3SEUA 3D4GA 2GHAA 3DP4A 1FRPA 2QVRA 1OQGA 2JJKA 3CFXA 2RKMA 2ZZVA 4NQ8A 4RJZA 3BIGA 4XKRA 4NEDA 4NMYA 4ZZEA 4QFLA 3RPLB 3MPLA 3C34A 3VDFA 4GXSB 1TT1A 4OQOA 4HTGA 3O28A 1K9ZA 4MJOA 2AIXA 2YLNA 1G0HA 3MZBA 3I5OA 2UYEA 3QMFA 4ZS9A 2GRVA 1MQGA 1LBVA 1B4HA 4KI0E 2R8TA 4EQ9A 1IXIA 1LCFA 3H6VA 2F7BA 2I3VA 5H8NA 5ET7A 5I59B 5H8FA 3W15C 3VLWA 2P1SA 2V3TA 1WODA 3K6XA 2DSFA 1AIVA 1FBFA 2ZYOA 2I4CA 1B52A 4YZZA 5DVIA 4DXUA 1FPLA 2I0BA 4LQ2A 1US5A 3ILUB 1QW0A 1MM7A 3PPQA 3MP6A 1Y9UA 1VE4A 2F5XA 4GBVA 3CI8A 4PC9A 1OQHA 1N04A 2CEXA 3IOUA 4YICA 1POY1 1B6HA 2WEFA 4P56A 3M3LA 3LSLA 5CRYA 5B7DA 3QK6A 2AL4A 1P99A 4R2FA 3GBAA 2DXYA 4K3FA 4H46A 1AL3A 1FBHA 3OMBA 4C1TA 3PUXE 2X7PA 1OIBA 1GGGA 3L6GA 1YTVA 3PUZE 3Q25A 1MY1A 3P7IA 3IK6B 1FPEA 1VR5A 1FBCA 3RY3A 4Q5TA 4EQ7A 1DPEA 1EZOA 5KDTB 2I58A 1B40A 1B2HA 2ZXTA 4QHQA 1XS5A 2DE2A 1R9QA 4MCOA 4DCYA 2Y5KA 2H4IA 4ZEKA 2KR0A 1Q35A 4U1ZA 3TYHA 5AE4A 1WDNA 3N94A 4ELQA 1MPDA 4FEBA 4LP2B 4WKMA 1IMBA 2PT1A 1RKMA 4GX3A 1JW5A 1P1UA 3IX1A 5I3SA 2WYPA 5JEIA 2RC8A 4UACA 4DXBA 4ELPA 3H03A 2XXWA 2GFEA 3CRBA 4KQPA 1KZ8A 4ESXA 3K01A 2QMWA 1IITA 4G77A 3UIFA 1J1NA 3GLBA 2ZNTA 3IO6A 4H0WA 1B5JA 3IFAA 4YB7A 4YMBA 3IOVA 1LLSA 3A3CA 3M8UA 1XVXA 5FHOA 3VLUA 5TP9B 5F1QA 3FXRA 1H44A 1FTAA 5CI5A 4P0GA 2O84X 2PFYA 2D5WA 4N81A 1A54A 3EKIA 2XXUA 5ISUA 4I3EA 3MVXA 2V84A 1MY0A 3GZGA 4NF5B 4PGNA 3EHSA 2XXXA 5I2KA 5CBRA 1OVTA 1I6QA 5H8HA 4HE1A 4N91A 4IGRA 3E9XA 3ROJA 3Q27A 2GQ1A 4DI3D 3FJ7A 3PUWE 1B1HA 2THIA 5CMCA 4XXUA 4ZEFA 4OFJA 4QSDA 5AA2D 4LZ8A 4IGTA 1URDA 4MX6A 5ELVA 4QFPA 2OK2A 1D9QA 1DBZA 1FQBA 3G3JA 4ZE8A 4QRZA 3TZAA 4MH5A 4O7MA 4NG7A 2REJA 1UIUA 4FE8A 4XKPA 1AOVA 1IUDA 1MRPA 3K1NA 1L5TA 1PBPA 1MQHA 4NTLA 2O68A 5IZ3A 3QUFA 4N15A 2QJEA 3H6UA 5BWJA 2QFLA 4XKNA 3PPPA 3V89B 1A8EA 4OVPA 3IOTA 4F3PA 5EQAA 2Q9TA 1FPIA 2O7IA 2P3VA 3IJXB 2F6PA 3E4RA 2I3WA 1Y1ZA 3RN8A 4O94A 4U2RA 5AA1A 4KCCA 1NI9A 1NNFA 4OANA 2DVZA 2Z8FA 1FJ9A 4PGPA 5I2NB 2Y7RA 3QYTA 4PDDA 4YB5A 1YCJA 2OBGA 3LSWA 1MG1A 3OENA 2HPGA 3T66A 1FBEA 3BFTA 5IKBA 3SKPA 1Y1MA 3T0JA 4ZZAA 1TFDA 3THIA 3TTKA 2VGQA 1EH3A 3C35A 4GOTA 5LOMA 4R2BA 3B6WA 1OVBA 4R74A 2ONRA 2Y7PA 4NF8A 1B05A 3RQTA 4OFOA 4HW8A 4WXJA 3TKDA 1MDP1 1B3GA 1YXIA 4C0RA 2XXHA 1KWHA 4HE2A 1UIVA 3ECRA 2RC9A 5A5XA 1QGXA 1DK4A 2P0SA 4F1YA 2CZIA 2QMXA 3F11A 3ISPA 3K00A 1FBPA 2DDKA 2ZZWA 4P9KA 3AXFA 4JSOA 4RPOA 4NAPA 1JW1A 1JQFA 2NUVA 5EYHA 4R6HA 3K2DA 2WBBA 1ZLQA 2DE3A 2RINA 3MP8A 3FZVA 4H5FA 2V25A 3SERA 4H8IA 1ZBMA 2Y7IA 4F18A 4F31B 3DP6A 1B3FA 3VVFA 1PBQA 1IEJA 5FTIA 2B4LA 3RLFE 3USDA 3LUZA 4MBPA 4R9FA 3B6QA 1ZTYA 3MJNA 2OWZA 3TPAA 4GXAA 1CE2A 5DTBA 1B7HA 5FHMA 4G68B 2HEUA 3VE1B 2VD2A 3V5AA 4PF6A 1DCUA 4E0XA 4PFUA 2XXYA 2HXWA 4N6DA 5ITPA 4AB5A 2GHBA 1VDWA 2XXPA 5T3JA 2I49A 3HHGA 3CG3A 1IXHA 4Q0CA 1MY2A 3FXUA 3TTNA 1URGA 1NFTA 3C4MA 4GF8A 4PP0A 5DYHA 5B70A 3RTWB 1IQ7A 1RYOA 3T96B 2F6GA 4BDNA 3MWBA 5TPAB 3RPWA 1B9JA 4FEDA 3QSLA 4N13A 1FQFA 4FJPA 3HCQA 3FJGA 3GBBA 4KR5A 5BUUA 4HXVA 1ZKBA 4YKKA 1BIYA 5F24A 2ZZXA 3CIJA 3RPLA 3K02A 2DWAA 3B8BA 2VD3A 3U8QA 4PFBA 4OA4A 4BDLA 1MM6A 5I57B 2PT2A 1RDXA 5ICQA 2F7AA 2WBDA 4ESWA 1G0IA 1NV3A 3LC8A 5IAIA 2DWHA 4KFQA 1LAHE 4F19A 4KYSA 4ND9A 3N5LA 4PE5B 1GV8A 3HFUA 4AS4A 3IOWA 3D4CA 3K6WA 4F2OA 5IZ1A 1I69A 4NF6B 5ET8A 1IMEA 5I59A 3G3HA 3FJMA 1N3XA 2OWSA 2XA5A 3WAFA 3O97A 4N8YA 2RC7A 1NNPA 1DSNA 4YKJA 3C36A 1FPDA 1NNKA 4X1DA 4EF1A 4ECFA 1OLAA 4OEUA 4U1OA 1IMDA 1QULA 3VV5A 4JDFA 4QSEA 4POWA 1FTMA 2H25A 2OWTA 2I6EA 3OO8A 4H6DA 1NH7A 2M8CA 1MQDA 2Z8EA 3U1OA 1MXVA 5TU0A 3R7XA 3TTRA 1SVXB 1LBXA 1B0LA 3KBRA 1Z7ME 1VFDA 3FD3A 4X04A 2A5SA 2V3QA 1LSTA 3MC2A 3TDJA 3OOAA 5H8QB 5KDTA 4PE3A 2YPNA 4HS7A 4OZ9A 4QSCA 2R9JA 4Z7EA 1MXYA 1N7WA 2Q8JA 2HAVA 4IO4A 4GWYA 4RPNA 2Q8MA 1Y3PA 4NN3A 1SW4A 5EHMA 2UYFA 1AMFA 4F39A 4X9TA 2F7CA 5CMMA 1JEUA 3T9XB 3FVKA 2DXRA 1GR2A 1YZ0A 1Y3NA 2CZKA 5ESYA 2VPOA 3PGFA 2F8DA 3KOSA 3IAZA 4PAKA 1F9BA 3FBPA 5L9OA 3OO9A 1O7TA 1FCKA 3MUQA 2H5YA 1MQIA 1WVJA 4DZ1A 4G8NA 1Y20A 4TOZA 4X8RA 5DW8A 1NUZA 4R72A 3U92A 3IJOB 2NXOA 1LBBA 1H45A 4EXKA 4NF4B 1SYIA 5TP9A 3SEWA 3TODA 2FIEA 1ANFA 2NVUB 4O7IA 2F3BA 2XXIA 3G3IA 3T9HB 1ELJA 2QSXA 2FIXA 2XD2A 3B50A 5KCJB
chains in the Genus database with same CATH topology
2PX1A 4OYVA 4NF5A 5I56A 5H8FB 3FV2A 1LBCA 2ZMBA 5FTHA 2PYYA 4G68C 4M1VA 3G3FA 5I84A 3FVNA 1FTOA 3TCFA 3Q29A 3TCHA 1FTKA 3HO7A 4NWDA 4YB6A 4EUOA 3UN6A 2FNCA 2DWIA 3S9MC 4P11A 3C32A 4EQBA 2FYIA 4QF9A 1LB8A 4LVQA 3A09A 3PPOA 3L6HA 3H6TA 1ZU0A 3S9EA 3OO7A 1JW4A 5L9MA 3V83A 2HZKA 3N26A 4ZECA 1SQYA 1PB9A 2DVCA 3PMWA 2VP1A 3FGSA 3O6IA 1QUKA 1S7YA 3O6HA 1MY3A 1B46A 1NKXA 3R6UA 4RXLA 5F7VA 3O2AA 1B3EA 4BDOA 1H76A 3K0VA 1JVYA 4LQ5A 3T9UA 1PB7A 2RCAA 2B65A 2XX8A 5DT6A 3PD8A 3G7WA 1TFAA 3KSJA 2Y84A 2UXAA 5I2NA 1LGBC 4LZ7A 3BBRA 2CMOA 4G8MA 2XD3A 5J1DA 1US4A 3FIRA 1USYH 4EXLA 3R26A 4DE8A 3CSBA 1MPCA 5I58B 1MXWA 2IA4A 3DLNA 1SDXA 3TMGA 1LFGA 1TWYA 1YAEA 2Z22A 4NWCA 2DQVA 3OO6A 5K2XA 1MH3A 3T93B 4GVOA 3DM0A 1UTBA 3MZ9A 4H5GA 3K6UA 1SW2A 4AQ4A 1A7LA 1LAFE 4YAHX 4L17A 4JWXA 4WEDA 1MXUA 2OZZA 1NH8A 4OMBA 4KPTA 3IB0A 3LSFB 3SEVA 1II5A 4JWYA 1NMUA 3BFUA 2AL5A 2F36A 2DWJA 4PFWA 1VFEA 3VXBA 3FATA 4XKQA 1RYXA 1MXXA 3BKIB 2A5TB 4U4XA 2ESNA 1IXCA 1GVCA 4JWOA 4F1UA 1JVXA 5CBSA 3CVGA 2UVGA 2W7YA 1LAGE 3VLVA 4G68A 4X1BA 1URSA 4OESA 2VHAA 5JTYB 3PPRA 3OD7A 5CC2A 4BDQA 2AYSA 1Y4TA 4OVJA 4R75A 1MPBA 3TTLA 4GQOA 4DXCA 3UGWA 3VXCA 1R9LA 1R1NA 3E3KA 1XOCA 5TPAA 4PFYA 2IEEA 3DELB 4I62A 3HSTA 1LCTA 5CMKA 4I9DA 3SEXA 4R9GA 3LUYA 4KD5A 1QKBA 3H4ZA 3FXQA 4U22A 2Z8DA 3SESA 3ILTB 4GL0A 2UVIA 4F3GA 3ODBA 5I57A 1B4ZA 1DMBA 3C9HA 3G3GA 4O3AA 4IY5A 2Y7WA 2O6AA 4BDRA 1P1OA 1N3WA 1NNTA 4MFIA 1M5EA 1HSEA 1B1XA 2XXVA 4MLVA 1HSJA 1D3KA 1SW1A 5AA2B 1IXGA 3TAJA 4POXA 4NF6A 5ICTA 3HHFA 1NL5A 2R71A 1B58A 4NE4A 2ALUA 2QS3A 4F3BA 3SDFA 1A55A 3S9NC 4FATA 4EF2A 4EDPA 1EU8A 2X7QA 2H9BA 2HQ0A 2UVJA 1BP5A 4R6YA 4P0IA 3RNNA 2FA7A 3KN3A 5HPQA 4U4SA 1IIWA 2XXQA 4H1XA 2XXTA 2HAUA 1B32A 3QXMA 2E1SA 1B0HA 3OEKA 1MXZA 1QVSA 3Q26A 5H8QA 3O66A 4RA1A 2QS1A 4THIA 4E0WA 2XXRA 3OSRA 2PBWA 3OELA 4R6KA 2ONKE 1IZ1A 3KG2A 4WEPA 5HM4B 1QUIA 3IB1A 4GIZA 1VSOA 1TXFA 3DP8A 4JXIA 4O3BA 3QIMA 2PVUA 2ABHA 3MPKA 2Y7KA 4HCYA 4TLMB 3MVZA 1LFIA 1FW0A 3CFLA 1QKAA 1LAXA 3OXNA 3W9WA 3Q28A 2I4BA 3KOTA 5DEXB 1SI1A 4ELOA 4GL8A 3O29A 3CSGA 1Y4CA 4HCWA 4GWOA 2QS2A 4IO2A 2DP8A 2LAOA 2DS9A 3M3FA 1Y3QA 2I48A 3PPNA 3EQ1A 4NF4A 3ONMA 1S50A 2OLBA 1PEBA 1M5CA 4I1DA 1O64A 5KCJA 4QFKA 4PETA 1A8FA 2RF1A 3CFZA 3C33A 1UTHB 1ZJLA 5AA4B 1DOTA 4IO6A 4RK9A 1T0KA 5KZTA 3TQWA 2HCAA 3K6VA 3VFJA 2O7UA 4N07A 3FV1A 2REGA 3WAEA 2YJPA 4DCXA 4PQJA 4C1UA 4LZ5A 3PD9A 3PU5A 3I3VA 1N84A 1O63A 4OTEA 4GLIA 3RT8A 3T9VA 4IO3A 1HSLA 3QUJA 2OJTA 3KN7A 4XIGQ 2NOOA 3RUMA 3IR1A 4YU0A 3FASA 1H43A 3IL1B 1DTZA 1SI0A 1FQEA 1BKAA 5HBCA 3U94A 5H8NB 2QPQA 4OHNA 4H67A 3MZ1A 2V3UA 3GXAA 3IB2A 3HV1A 2ZYMA 3ZS6A 4U23A 2Z23A 2ZNUA 4BLAA 1I6AA 1B7UA 1QUJA 3N6TA 3TCGA 1R6ZA 2B3BA 3E13X 2I0CA 2VOZA 3HN0A 4I8CA 4RY1A 2P2AA 1XHYA 1I6BA 1SYHA 4G2ZA 4GD5A 3IORA 5L9SA 3FVOA 4MLQA 4YKIA 4KYEA 4FORA 5I58A 1LFHA 4FECA 3I6VA 2Q2AA 1B51A 1XT8A 4X48A 4IO5A 4LA9A 2KLFA 1FTLA 1Q1KA 3EHTA 2HFBA 3H3GA 3S2VA 3OSQA 1FTJA 1MQJA 1LB9A 3MVYA 2GH9A 2HZLA 3C31A 3FUZA 5CMBA 3LR1A 2Q2CA 1EZPA 1GTKA 3CR9A 3VVEA 3SEYA 3A3UA 1N7XA 4U21A 2ZNSA 4UA8A 2ANJA 3OEMA 3T22A 5I56B 1XVYA 3B7DA 2A5TA 4F22A 1B3LA 3JYRA 3IO4A 4RYAA 5DVFA 2ZYNA 4LATA 4H8JA 4YKPA 3UP9A 1QJMA 2V93A 2OCUA 4GRKA 4PFTA 5DVJA 1A40A 4LUBA 4F2QA 5JTYA 1S9TA 4F29A 4BDMA 1MDQA 4RNSA 4JB7A 2F35A 1SD3A 1UQWA 5ITOA 4OERA 2QL3A 1OMPA 4IO7A 1SW5A 5AA3A 1P1NA 3S4UA 3MVWA 4KHZE 2B3FA 4RK2A 3S9LC 5EHSA 3KFMA 1MY4A 1P1QA 1Z7NE 1CB6A 2O51A 5I2KB 3QAXA 5H8HB 1MS7A 4F3SA 2WKYA 1M5FA 4MF3A 1B5HA 3SETA 2QS4A 1PC3A 4OETA 3TELA 3ZKLA 3FVGA 2F34A 2D21A 3JZJA 4OFLA 1N0TA 2G29A 4LONB 5M2VA 2R6GE 4ZEIA 1D9YA 2ZYKA 1DPPA 1JEVA 4DLDA 2X26A 4ISUA 1BTJA 3MW0A 3UORA 5EYFA 3UA8A 3KJ7A 5CM6A 2Q89A 3KJTA 4OWDA 3LBSA 3TEPA 3KGCA 4KYDA 2H99A 1UTBB 5AA2A 2UVHA 4FAJA 1POTA 2DYXA 3EPEA 3TQLA 2QRYA 1DTGA 3EHUA 3RT6B 5L8DA 1M5BA 1BLFA 4OENA 4N6PA 3KN8A 1B7ZA 3RGYA 5K2YA 2D3IA 3EF7A 4Q30B 3V8XB 4AB6A 3TUSA 1M5DA 2Q88A 1A99A 1P1WA 1FQDA 4IY6A 5JK4A 1B3HA 2F97A 4XTCQ 2XX9A 3M3KA 2F78A 3MAMA 2DOJA 4DDDA 1PDAA 1AH5A 4ZE9A 3O9PA 2XX7A 1ZMGA 3CG1A 2PMSA 3U93A 3H06B 3KEIA 1SBPA 4G4PA 3B6TA 4NF8B 4R73A 2O1LA 1USYE 1YPNA 3MP1A 3H6WA 3N6UA 3K1PA 4Z0IA 4QFNA 4QFOA 5A5XB 3JV9A 4KCDA 2O1MA 4TLLB 1FQAA 3H7MA 3RTFB 4DIGA 1FQCA 4YMAA 4ZEDA 1ATGA 3K4UA 3G3KA 4G8HA 3HPIA 3KSXA 4F1VA 1PB8A 3PV0E 1JETA 1B5IA 3ZSFA 4H65A 3PUYE 3PMXA 4GFRA 3O6GA 4M4GA 2E0SA 3KZGA 1OLCA 1XC1A 1JNFA 3MQ9A 4ZEBA 3UK4A 3W9VA 1EZ9A 4ONYA 2DE4A 5DEXA 4JBZA 4FIMA 4IB2A 3TTMA 1N76A 4Q8RA 2O69A 2CZLA 3PUVE 3EN3A 3TFLA 3MBPA 2H98A 1D4NA 3LSXA 2XHDA 1H3DA 4O3CA 3PMVA 4ZDMA 2BJJX 4ELRA 3VVDA 1ZIUA 2G93A 3ZKKA 1MH4A 1D9VA 4OXVA 3K1MA 5FHNA 4JSDA 5H8SA 2NWJA 2RCBA 2ONSA 3U72A 1UTHA 5AA4A 4OEVA 4TQUQ 3SEUA 3D4GA 2GHAA 3DP4A 1OQGA 3CFXA 2RKMA 4RJZA 4XKRA 4NEDA 4NMYA 4ZZEA 4QFLA 3MPLA 3C34A 3VDFA 4GXSB 1TT1A 4OQOA 4HTGA 3O28A 2AIXA 2YLNA 3MZBA 3I5OA 2UYEA 4ZS9A 2GRVA 1MQGA 1B4HA 4KI0E 4EQ9A 1IXIA 1LCFA 3H6VA 2F7BA 2I3VA 5H8NA 5I59B 5H8FA 3W15C 3VLWA 2P1SA 2V3TA 1WODA 3K6XA 2DSFA 1AIVA 2ZYOA 2I4CA 1B52A 4YZZA 5DVIA 4DXUA 2I0BA 4LQ2A 1US5A 3ILUB 1QW0A 1MM7A 3PPQA 3MP6A 1Y9UA 1VE4A 2F5XA 3CI8A 1OQHA 1N04A 3IOUA 4YICA 1POY1 1B6HA 3M3LA 3LSLA 5CRYA 5B7DA 3QK6A 2AL4A 1P99A 4R2FA 3GBAA 2DXYA 4K3FA 1AL3A 3OMBA 4C1TA 3PUXE 2X7PA 1OIBA 1GGGA 3L6GA 1YTVA 3PUZE 3Q25A 1MY1A 3P7IA 3IK6B 1VR5A 3RY3A 4Q5TA 4EQ7A 1DPEA 1EZOA 5KDTB 2I58A 1B40A 1B2HA 2ZXTA 4QHQA 1XS5A 2DE2A 1R9QA 4DCYA 2H4IA 4ZEKA 1Q35A 4U1ZA 3TYHA 5AE4A 1WDNA 3N94A 4ELQA 1MPDA 4FEBA 4LP2B 4WKMA 2PT1A 1RKMA 1JW5A 1P1UA 3IX1A 5JEIA 2RC8A 4UACA 4DXBA 4ELPA 3H03A 2XXWA 2GFEA 3CRBA 4KQPA 4ESXA 3K01A 2QMWA 1IITA 4G77A 3UIFA 1J1NA 3GLBA 2ZNTA 3IO6A 4H0WA 1B5JA 4YB7A 4YMBA 3IOVA 1LLSA 3A3CA 3M8UA 1XVXA 5FHOA 3VLUA 5TP9B 5F1QA 3FXRA 1H44A 5CI5A 4P0GA 2O84X 2D5WA 1A54A 2XXUA 5ISUA 3MVXA 2V84A 1MY0A 3GZGA 4NF5B 3EHSA 2XXXA 5I2KA 5CBRA 1OVTA 1I6QA 5H8HA 4IGRA 3E9XA 3Q27A 3FJ7A 3PUWE 1B1HA 2THIA 5CMCA 4XXUA 4ZEFA 4OFJA 4QSDA 5AA2D 4LZ8A 4IGTA 1URDA 5ELVA 4QFPA 2OK2A 1FQBA 3G3JA 4ZE8A 4QRZA 3TZAA 4MH5A 2REJA 1UIUA 4FE8A 4XKPA 1AOVA 1IUDA 1MRPA 1L5TA 3K1NA 1PBPA 1MQHA 4NTLA 2O68A 3QUFA 2QJEA 3H6UA 5BWJA 4XKNA 3PPPA 3V89B 1A8EA 3IOTA 4F3PA 2Q9TA 2O7IA 3IJXB 2F6PA 3E4RA 2I3WA 1Y1ZA 3RN8A 4U2RA 5AA1A 4KCCA 1NNFA 2DVZA 2Z8FA 5I2NB 2Y7RA 3QYTA 4YB5A 1YCJA 2OBGA 3LSWA 1MG1A 3OENA 3T66A 3BFTA 5IKBA 3SKPA 1Y1MA 4ZZAA 1TFDA 3THIA 3TTKA 2VGQA 1EH3A 3C35A 4GOTA 5LOMA 4R2BA 3B6WA 1OVBA 4R74A 2ONRA 2Y7PA 4NF8A 1B05A 3RQTA 4OFOA 4HW8A 4WXJA 3TKDA 1MDP1 1B3GA 4C0RA 2XXHA 1KWHA 1UIVA 3ECRA 2RC9A 5A5XA 2P0SA 4F1YA 2QMXA 3F11A 3K00A 3AXFA 4JSOA 4RPOA 1JW1A 1JQFA 2NUVA 4R6HA 3K2DA 1ZLQA 2DE3A 2RINA 3MP8A 3FZVA 4H5FA 2V25A 3SERA 4H8IA 1ZBMA 2Y7IA 4F18A 4F31B 3DP6A 1B3FA 3VVFA 1PBQA 1IEJA 5FTIA 3RLFE 3USDA 4MBPA 4R9FA 3B6QA 1ZTYA 3MJNA 3TPAA 4GXAA 1CE2A 5DTBA 1B7HA 5FHMA 4G68B 2HEUA 3VE1B 2VD2A 3V5AA 4E0XA 4PFUA 2XXYA 2HXWA 5ITPA 4AB5A 2GHBA 2XXPA 2I49A 3HHGA 3CG3A 1IXHA 4Q0CA 1MY2A 3FXUA 3TTNA 1URGA 1NFTA 3C4MA 4GF8A 4PP0A 5DYHA 5B70A 3RTWB 1IQ7A 1RYOA 3T96B 2F6GA 4BDNA 3MWBA 5TPAB 3RPWA 1B9JA 4FEDA 3QSLA 4N13A 1FQFA 4FJPA 3HCQA 3FJGA 3GBBA 4KR5A 5BUUA 1ZKBA 4YKKA 1BIYA 3CIJA 3K02A 2DWAA 2VD3A 3U8QA 4BDLA 1MM6A 5I57B 2PT2A 5ICQA 2F7AA 4ESWA 3LC8A 5IAIA 2DWHA 4KFQA 1LAHE 4F19A 4KYSA 4ND9A 3N5LA 4PE5B 1GV8A 3IOWA 3D4CA 3K6WA 4F2OA 1I69A 4NF6B 5I59A 3G3HA 3FJMA 1N3XA 2OWSA 3WAFA 3O97A 2RC7A 1NNPA 1DSNA 4YKJA 3C36A 1NNKA 4X1DA 4EF1A 4ECFA 1OLAA 4OEUA 4U1OA 1QULA 3VV5A 4JDFA 4QSEA 4POWA 1FTMA 2H25A 2OWTA 2I6EA 3OO8A 4H6DA 1NH7A 2M8CA 1MQDA 2Z8EA 3U1OA 1MXVA 5TU0A 3R7XA 3TTRA 1SVXB 1B0LA 3KBRA 1Z7ME 1VFDA 3FD3A 2A5SA 2V3QA 1LSTA 3MC2A 3TDJA 3OOAA 5H8QB 5KDTA 2YPNA 4HS7A 4OZ9A 4QSCA 2R9JA 4Z7EA 1MXYA 1N7WA 2Q8JA 2HAVA 4IO4A 4RPNA 1Y3PA 1SW4A 5EHMA 2UYFA 1AMFA 4F39A 4X9TA 2F7CA 5CMMA 1JEUA 3T9XB 3FVKA 2DXRA 1GR2A 1Y3NA 3PGFA 2F8DA 3KOSA 3IAZA 1F9BA 5L9OA 3OO9A 1O7TA 1FCKA 3MUQA 2H5YA 1MQIA 1WVJA 4DZ1A 4G8NA 1Y20A 4TOZA 4R72A 3U92A 3IJOB 2NXOA 1LBBA 1H45A 4EXKA 4NF4B 1SYIA 5TP9A 3SEWA 3TODA 1ANFA 2NVUB 2XXIA 3G3IA 3T9HB 1ELJA 2QSXA 2XD2A 5KCJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PX1 A;  4OYV A;  4NF5 A;  5I56 A;  5H8F B;  3FV2 A;  1LBC A;  2ZMB A;  5FTH A;  2PYY A;  4G68 C;  4M1V A;  3G3F A;  5I84 A;  3FVN A;  1FTO A;  3TCF A;  3Q29 A;  3TCH A;  1FTK A;  3HO7 A;  4NWD A;  4YB6 A;  4EUO A;  3UN6 A;  2FNC A;  2DWI A;  3S9M C;  4P11 A;  3C32 A;  4EQB A;  2FYI A;  4QF9 A;  1LB8 A;  4LVQ A;  3A09 A;  3PPO A;  3L6H A;  3H6T A;  1ZU0 A;  3S9E A;  3OO7 A;  1JW4 A;  5L9M A;  3V83 A;  2HZK A;  3N26 A;  4ZEC A;  1SQY A;  1PB9 A;  2DVC A;  3PMW A;  2VP1 A;  3FGS A;  3O6I A;  1QUK A;  1S7Y A;  3O6H A;  1MY3 A;  1B46 A;  1NKX A;  3R6U A;  4RXL A;  5F7V A;  3O2A A;  1B3E A;  4BDO A;  1H76 A;  3K0V A;  1JVY A;  4LQ5 A;  3T9U A;  1PB7 A;  2RCA A;  2B65 A;  2XX8 A;  5DT6 A;  3PD8 A;  3G7W A;  1TFA A;  3KSJ A;  2Y84 A;  2UXA A;  5I2N A;  1LGB C;  4LZ7 A;  3BBR A;  2CMO A;  4G8M A;  2XD3 A;  5J1D A;  1US4 A;  3FIR A;  1USY H;  4EXL A;  3R26 A;  4DE8 A;  3CSB A;  1MPC A;  5I58 B;  1MXW A;  2IA4 A;  3DLN A;  1SDX A;  3TMG A;  1LFG A;  1TWY A;  1YAE A;  2Z22 A;  4NWC A;  2DQV A;  3OO6 A;  5K2X A;  1MH3 A;  3T93 B;  4GVO A;  3DM0 A;  1UTB A;  3MZ9 A;  4H5G A;  3K6U A;  1SW2 A;  4AQ4 A;  1A7L A;  1LAF E;  4YAH X;  4L17 A;  4JWX A;  4WED A;  1MXU A;  2OZZ A;  1NH8 A;  4OMB A;  4KPT A;  3IB0 A;  3LSF B;  3SEV A;  1II5 A;  4JWY A;  1NMU A;  3BFU A;  2AL5 A;  2F36 A;  2DWJ A;  4PFW A;  1VFE A;  3VXB A;  3FAT A;  4XKQ A;  1RYX A;  1MXX A;  3BKI B;  2A5T B;  4U4X A;  2ESN A;  1IXC A;  1GVC A;  4JWO A;  4F1U A;  1JVX A;  5CBS A;  3CVG A;  2UVG A;  2W7Y A;  1LAG E;  3VLV A;  4G68 A;  4X1B A;  1URS A;  4OES A;  2VHA A;  5JTY B;  3PPR A;  3OD7 A;  5CC2 A;  4BDQ A;  2AYS A;  1Y4T A;  4OVJ A;  4R75 A;  1MPB A;  3TTL A;  4GQO A;  4DXC A;  3UGW A;  3VXC A;  1R9L A;  1R1N A;  3E3K A;  1XOC A;  5TPA A;  4PFY A;  2IEE A;  3DEL B;  4I62 A;  3HST A;  1LCT A;  5CMK A;  4I9D A;  3SEX A;  4R9G A;  3LUY A;  4KD5 A;  1QKB A;  3H4Z A;  3FXQ A;  4U22 A;  2Z8D A;  3SES A;  3ILT B;  4GL0 A;  2UVI A;  4F3G A;  3ODB A;  5I57 A;  1B4Z A;  1DMB A;  3C9H A;  3G3G A;  4O3A A;  4IY5 A;  2Y7W A;  2O6A A;  4BDR A;  1P1O A;  1N3W A;  1NNT A;  4MFI A;  1M5E A;  1HSE A;  1B1X A;  2XXV A;  4MLV A;  1HSJ A;  1D3K A;  1SW1 A;  5AA2 B;  1IXG A;  3TAJ A;  4POX A;  4NF6 A;  5ICT A;  3HHF A;  1NL5 A;  2R71 A;  1B58 A;  4NE4 A;  2ALU A;  2QS3 A;  4F3B A;  3SDF A;  1A55 A;  3S9N C;  4FAT A;  4EF2 A;  4EDP A;  1EU8 A;  2X7Q A;  2H9B A;  2HQ0 A;  2UVJ A;  1BP5 A;  4R6Y A;  4P0I A;  3RNN A;  2FA7 A;  3KN3 A;  5HPQ A;  4U4S A;  1IIW A;  2XXQ A;  4H1X A;  2XXT A;  2HAU A;  1B32 A;  3QXM A;  2E1S A;  1B0H A;  3OEK A;  1MXZ A;  1QVS A;  3Q26 A;  5H8Q A;  3O66 A;  4RA1 A;  2QS1 A;  4THI A;  4E0W A;  2XXR A;  3OSR A;  2PBW A;  3OEL A;  4R6K A;  2ONK E;  1IZ1 A;  3KG2 A;  4WEP A;  5HM4 B;  1QUI A;  3IB1 A;  4GIZ A;  1VSO A;  1TXF A;  3DP8 A;  4JXI A;  4O3B A;  3QIM A;  2PVU A;  2ABH A;  3MPK A;  2Y7K A;  4HCY A;  4TLM B;  3MVZ A;  1LFI A;  1FW0 A;  3CFL A;  1QKA A;  1LAX A;  3OXN A;  3W9W A;  3Q28 A;  2I4B A;  3KOT A;  5DEX B;  1SI1 A;  4ELO A;  4GL8 A;  3O29 A;  3CSG A;  1Y4C A;  4HCW A;  4GWO A;  2QS2 A;  4IO2 A;  2DP8 A;  2LAO A;  2DS9 A;  3M3F A;  1Y3Q A;  2I48 A;  3PPN A;  3EQ1 A;  4NF4 A;  3ONM A;  1S50 A;  2OLB A;  1PEB A;  1M5C A;  4I1D A;  1O64 A;  5KCJ A;  4QFK A;  4PET A;  1A8F A;  2RF1 A;  3CFZ A;  3C33 A;  1UTH B;  1ZJL A;  5AA4 B;  1DOT A;  4IO6 A;  4RK9 A;  1T0K A;  5KZT A;  3TQW A;  2HCA A;  3K6V A;  3VFJ A;  2O7U A;  4N07 A;  3FV1 A;  2REG A;  3WAE A;  2YJP A;  4DCX A;  4PQJ A;  4C1U A;  4LZ5 A;  3PD9 A;  3PU5 A;  3I3V A;  1N84 A;  1O63 A;  4OTE A;  4GLI A;  3RT8 A;  3T9V A;  4IO3 A;  1HSL A;  3QUJ A;  2OJT A;  3KN7 A;  4XIG Q;  2NOO A;  3RUM A;  3IR1 A;  4YU0 A;  3FAS A;  1H43 A;  3IL1 B;  1DTZ A;  1SI0 A;  1FQE A;  1BKA A;  5HBC A;  3U94 A;  5H8N B;  2QPQ A;  4OHN A;  4H67 A;  3MZ1 A;  2V3U A;  3GXA A;  3IB2 A;  3HV1 A;  2ZYM A;  3ZS6 A;  4U23 A;  2Z23 A;  2ZNU A;  4BLA A;  1I6A A;  1B7U A;  1QUJ A;  3N6T A;  3TCG A;  1R6Z A;  2B3B A;  3E13 X;  2I0C A;  2VOZ A;  3HN0 A;  4I8C A;  4RY1 A;  2P2A A;  1XHY A;  1I6B A;  1SYH A;  4G2Z A;  4GD5 A;  3IOR A;  5L9S A;  3FVO A;  4MLQ A;  4YKI A;  4KYE A;  4FOR A;  5I58 A;  1LFH A;  4FEC A;  3I6V A;  2Q2A A;  1B51 A;  1XT8 A;  4X48 A;  4IO5 A;  4LA9 A;  2KLF A;  1FTL A;  1Q1K A;  3EHT A;  2HFB A;  3H3G A;  3S2V A;  3OSQ A;  1FTJ A;  1MQJ A;  1LB9 A;  3MVY A;  2GH9 A;  2HZL A;  3C31 A;  3FUZ A;  5CMB A;  3LR1 A;  2Q2C A;  1EZP A;  1GTK A;  3CR9 A;  3VVE A;  3SEY A;  3A3U A;  1N7X A;  4U21 A;  2ZNS A;  4UA8 A;  2ANJ A;  3OEM A;  3T22 A;  5I56 B;  1XVY A;  3B7D A;  2A5T A;  4F22 A;  1B3L A;  3JYR A;  3IO4 A;  4RYA A;  5DVF A;  2ZYN A;  4LAT A;  4H8J A;  4YKP A;  3UP9 A;  1QJM A;  2V93 A;  2OCU A;  4GRK A;  4PFT A;  5DVJ A;  1A40 A;  4LUB A;  4F2Q A;  5JTY A;  1S9T A;  4F29 A;  4BDM A;  1MDQ A;  4RNS A;  4JB7 A;  2F35 A;  1SD3 A;  1UQW A;  5ITO A;  4OER A;  2QL3 A;  1OMP A;  4IO7 A;  1SW5 A;  5AA3 A;  1P1N A;  3S4U A;  3MVW A;  4KHZ E;  2B3F A;  4RK2 A;  3S9L C;  5EHS A;  3KFM A;  1MY4 A;  1P1Q A;  1Z7N E;  1CB6 A;  2O51 A;  5I2K B;  3QAX A;  5H8H B;  1MS7 A;  4F3S A;  2WKY A;  1M5F A;  4MF3 A;  1B5H A;  3SET A;  2QS4 A;  1PC3 A;  4OET A;  3TEL A;  3ZKL A;  3FVG A;  2F34 A;  2D21 A;  3JZJ A;  4OFL A;  1N0T A;  2G29 A;  4LON B;  5M2V A;  2R6G E;  4ZEI A;  1D9Y A;  2ZYK A;  1DPP A;  1JEV A;  4DLD A;  2X26 A;  4ISU A;  1BTJ A;  3MW0 A;  3UOR A;  5EYF A;  3UA8 A;  3KJ7 A;  5CM6 A;  2Q89 A;  3KJT A;  4OWD A;  3LBS A;  3TEP A;  3KGC A;  4KYD A;  2H99 A;  1UTB B;  5AA2 A;  2UVH A;  4FAJ A;  1POT A;  2DYX A;  3EPE A;  3TQL A;  2QRY A;  1DTG A;  3EHU A;  3RT6 B;  5L8D A;  1M5B A;  1BLF A;  4OEN A;  4N6P A;  3KN8 A;  1B7Z A;  3RGY A;  5K2Y A;  2D3I A;  3EF7 A;  4Q30 B;  3V8X B;  4AB6 A;  3TUS A;  1M5D A;  2Q88 A;  1A99 A;  1P1W A;  1FQD A;  4IY6 A;  5JK4 A;  1B3H A;  2F97 A;  4XTC Q;  2XX9 A;  3M3K A;  2F78 A;  3MAM A;  2DOJ A;  4DDD A;  1PDA A;  1AH5 A;  4ZE9 A;  3O9P A;  2XX7 A;  1ZMG A;  3CG1 A;  2PMS A;  3U93 A;  3H06 B;  3KEI A;  1SBP A;  4G4P A;  3B6T A;  4NF8 B;  4R73 A;  2O1L A;  1USY E;  1YPN A;  3MP1 A;  3H6W A;  3N6U A;  3K1P A;  4Z0I A;  4QFN A;  4QFO A;  5A5X B;  3JV9 A;  4KCD A;  2O1M A;  4TLL B;  1FQA A;  3H7M A;  3RTF B;  4DIG A;  1FQC A;  4YMA A;  4ZED A;  1ATG A;  3K4U A;  3G3K A;  4G8H A;  3HPI A;  3KSX A;  4F1V A;  1PB8 A;  3PV0 E;  1JET A;  1B5I A;  3ZSF A;  4H65 A;  3PUY E;  3PMX A;  4GFR A;  3O6G A;  4M4G A;  2E0S A;  3KZG A;  1OLC A;  1XC1 A;  1JNF A;  3MQ9 A;  4ZEB A;  3UK4 A;  3W9V A;  1EZ9 A;  4ONY A;  2DE4 A;  5DEX A;  4JBZ A;  4FIM A;  4IB2 A;  3TTM A;  1N76 A;  4Q8R A;  2O69 A;  2CZL A;  3PUV E;  3EN3 A;  3TFL A;  3MBP A;  2H98 A;  1D4N A;  3LSX A;  2XHD A;  1H3D A;  4O3C A;  3PMV A;  4ZDM A;  2BJJ X;  4ELR A;  3VVD A;  1ZIU A;  2G93 A;  3ZKK A;  1MH4 A;  1D9V A;  4OXV A;  3K1M A;  5FHN A;  4JSD A;  5H8S A;  2NWJ A;  2RCB A;  2ONS A;  3U72 A;  1UTH A;  5AA4 A;  4OEV A;  4TQU Q;  3SEU A;  3D4G A;  2GHA A;  3DP4 A;  1OQG A;  3CFX A;  2RKM A;  4RJZ A;  4XKR A;  4NED A;  4NMY A;  4ZZE A;  4QFL A;  3MPL A;  3C34 A;  3VDF A;  4GXS B;  1TT1 A;  4OQO A;  4HTG A;  3O28 A;  2AIX A;  2YLN A;  3MZB A;  3I5O A;  2UYE A;  4ZS9 A;  2GRV A;  1MQG A;  1B4H A;  4KI0 E;  4EQ9 A;  1IXI A;  1LCF A;  3H6V A;  2F7B A;  2I3V A;  5H8N A;  5I59 B;  5H8F A;  3W15 C;  3VLW A;  2P1S A;  2V3T A;  1WOD A;  3K6X A;  2DSF A;  1AIV A;  2ZYO A;  2I4C A;  1B52 A;  4YZZ A;  5DVI A;  4DXU A;  2I0B A;  4LQ2 A;  1US5 A;  3ILU B;  1QW0 A;  1MM7 A;  3PPQ A;  3MP6 A;  1Y9U A;  1VE4 A;  2F5X A;  3CI8 A;  1OQH A;  1N04 A;  3IOU A;  4YIC A;  1POY 1;  1B6H A;  3M3L A;  3LSL A;  5CRY A;  5B7D A;  3QK6 A;  2AL4 A;  1P99 A;  4R2F A;  3GBA A;  2DXY A;  4K3F A;  1AL3 A;  3OMB A;  4C1T A;  3PUX E;  2X7P A;  1OIB A;  1GGG A;  3L6G A;  1YTV A;  3PUZ E;  3Q25 A;  1MY1 A;  3P7I A;  3IK6 B;  1VR5 A;  3RY3 A;  4Q5T A;  4EQ7 A;  1DPE A;  1EZO A;  5KDT B;  2I58 A;  1B40 A;  1B2H A;  2ZXT A;  4QHQ A;  1XS5 A;  2DE2 A;  1R9Q A;  4DCY A;  2H4I A;  4ZEK A;  1Q35 A;  4U1Z A;  3TYH A;  5AE4 A;  1WDN A;  3N94 A;  4ELQ A;  1MPD A;  4FEB A;  4LP2 B;  4WKM A;  2PT1 A;  1RKM A;  1JW5 A;  1P1U A;  3IX1 A;  5JEI A;  2RC8 A;  4UAC A;  4DXB A;  4ELP A;  3H03 A;  2XXW A;  2GFE A;  3CRB A;  4KQP A;  4ESX A;  3K01 A;  2QMW A;  1IIT A;  4G77 A;  3UIF A;  1J1N A;  3GLB A;  2ZNT A;  3IO6 A;  4H0W A;  1B5J A;  4YB7 A;  4YMB A;  3IOV A;  1LLS A;  3A3C A;  3M8U A;  1XVX A;  5FHO A;  3VLU A;  5TP9 B;  5F1Q A;  3FXR A;  1H44 A;  5CI5 A;  4P0G A;  2O84 X;  2D5W A;  1A54 A;  2XXU A;  5ISU A;  3MVX A;  2V84 A;  1MY0 A;  3GZG A;  4NF5 B;  3EHS A;  2XXX A;  5I2K A;  5CBR A;  1OVT A;  1I6Q A;  5H8H A;  4IGR A;  3E9X A;  3Q27 A;  3FJ7 A;  3PUW E;  1B1H A;  2THI A;  5CMC A;  4XXU A;  4ZEF A;  4OFJ A;  4QSD A;  5AA2 D;  4LZ8 A;  4IGT A;  1URD A;  5ELV A;  4QFP A;  2OK2 A;  1FQB A;  3G3J A;  4ZE8 A;  4QRZ A;  3TZA A;  4MH5 A;  2REJ A;  1UIU A;  4FE8 A;  4XKP A;  1AOV A;  1IUD A;  1MRP A;  1L5T A;  3K1N A;  1PBP A;  1MQH A;  4NTL A;  2O68 A;  3QUF A;  2QJE A;  3H6U A;  5BWJ A;  4XKN A;  3PPP A;  3V89 B;  1A8E A;  3IOT A;  4F3P A;  2Q9T A;  2O7I A;  3IJX B;  2F6P A;  3E4R A;  2I3W A;  1Y1Z A;  3RN8 A;  4U2R A;  5AA1 A;  4KCC A;  1NNF A;  2DVZ A;  2Z8F A;  5I2N B;  2Y7R A;  3QYT A;  4YB5 A;  1YCJ A;  2OBG A;  3LSW A;  1MG1 A;  3OEN A;  3T66 A;  3BFT A;  5IKB A;  3SKP A;  1Y1M A;  4ZZA A;  1TFD A;  3THI A;  3TTK A;  2VGQ A;  1EH3 A;  3C35 A;  4GOT A;  5LOM A;  4R2B A;  3B6W A;  1OVB A;  4R74 A;  2ONR A;  2Y7P A;  4NF8 A;  1B05 A;  3RQT A;  4OFO A;  4HW8 A;  4WXJ A;  3TKD A;  1MDP 1;  1B3G A;  4C0R A;  2XXH A;  1KWH A;  1UIV A;  3ECR A;  2RC9 A;  5A5X A;  2P0S A;  4F1Y A;  2QMX A;  3F11 A;  3K00 A;  3AXF A;  4JSO A;  4RPO A;  1JW1 A;  1JQF A;  2NUV A;  4R6H A;  3K2D A;  1ZLQ A;  2DE3 A;  2RIN A;  3MP8 A;  3FZV A;  4H5F A;  2V25 A;  3SER A;  4H8I A;  1ZBM A;  2Y7I A;  4F18 A;  4F31 B;  3DP6 A;  1B3F A;  3VVF A;  1PBQ A;  1IEJ A;  5FTI A;  3RLF E;  3USD A;  4MBP A;  4R9F A;  3B6Q A;  1ZTY A;  3MJN A;  3TPA A;  4GXA A;  1CE2 A;  5DTB A;  1B7H A;  5FHM A;  4G68 B;  2HEU A;  3VE1 B;  2VD2 A;  3V5A A;  4E0X A;  4PFU A;  2XXY A;  2HXW A;  5ITP A;  4AB5 A;  2GHB A;  2XXP A;  2I49 A;  3HHG A;  3CG3 A;  1IXH A;  4Q0C A;  1MY2 A;  3FXU A;  3TTN A;  1URG A;  1NFT A;  3C4M A;  4GF8 A;  4PP0 A;  5DYH A;  5B70 A;  3RTW B;  1IQ7 A;  1RYO A;  3T96 B;  2F6G A;  4BDN A;  3MWB A;  5TPA B;  3RPW A;  1B9J A;  4FED A;  3QSL A;  4N13 A;  1FQF A;  4FJP A;  3HCQ A;  3FJG A;  3GBB A;  4KR5 A;  5BUU A;  1ZKB A;  4YKK A;  1BIY A;  3CIJ A;  3K02 A;  2DWA A;  2VD3 A;  3U8Q A;  4BDL A;  1MM6 A;  5I57 B;  2PT2 A;  5ICQ A;  2F7A A;  4ESW A;  3LC8 A;  5IAI A;  2DWH A;  4KFQ A;  1LAH E;  4F19 A;  4KYS A;  4ND9 A;  3N5L A;  4PE5 B;  1GV8 A;  3IOW A;  3D4C A;  3K6W A;  4F2O A;  1I69 A;  4NF6 B;  5I59 A;  3G3H A;  3FJM A;  1N3X A;  2OWS A;  3WAF A;  3O97 A;  2RC7 A;  1NNP A;  1DSN A;  4YKJ A;  3C36 A;  1NNK A;  4X1D A;  4EF1 A;  4ECF A;  1OLA A;  4OEU A;  4U1O A;  1QUL A;  3VV5 A;  4JDF A;  4QSE A;  4POW A;  1FTM A;  2H25 A;  2OWT A;  2I6E A;  3OO8 A;  4H6D A;  1NH7 A;  2M8C A;  1MQD A;  2Z8E A;  3U1O A;  1MXV A;  5TU0 A;  3R7X A;  3TTR A;  1SVX B;  1B0L A;  3KBR A;  1Z7M E;  1VFD A;  3FD3 A;  2A5S A;  2V3Q A;  1LST A;  3MC2 A;  3TDJ A;  3OOA A;  5H8Q B;  5KDT A;  2YPN A;  4HS7 A;  4OZ9 A;  4QSC A;  2R9J A;  4Z7E A;  1MXY A;  1N7W A;  2Q8J A;  2HAV A;  4IO4 A;  4RPN A;  1Y3P A;  1SW4 A;  5EHM A;  2UYF A;  1AMF A;  4F39 A;  4X9T A;  2F7C A;  5CMM A;  1JEU A;  3T9X B;  3FVK A;  2DXR A;  1GR2 A;  1Y3N A;  3PGF A;  2F8D A;  3KOS A;  3IAZ A;  1F9B A;  5L9O A;  3OO9 A;  1O7T A;  1FCK A;  3MUQ A;  2H5Y A;  1MQI A;  1WVJ A;  4DZ1 A;  4G8N A;  1Y20 A;  4TOZ A;  4R72 A;  3U92 A;  3IJO B;  2NXO A;  1LBB A;  1H45 A;  4EXK A;  4NF4 B;  1SYI A;  5TP9 A;  3SEW A;  3TOD A;  1ANF A;  2NVU B;  2XXI A;  3G3I A;  3T9H B;  1ELJ A;  2QSX A;  2XD2 A;  5KCJ B; 
#chains in the Genus database with same CATH topology
 2PX1 A;  4OYV A;  4NF5 A;  5I56 A;  1SPI A;  5H8F B;  2V4C A;  4KXP A;  1FPJ A;  3FV2 A;  1LBC A;  2ZMB A;  5FTH A;  2PYY A;  4G68 C;  4M1V A;  3G3F A;  5I84 A;  3FVN A;  1FTO A;  3TCF A;  3Q29 A;  1FPG A;  3TCH A;  1FTK A;  3HO7 A;  4NWD A;  4YB6 A;  4EUO A;  3UN6 A;  2FNC A;  2DWI A;  1EYK A;  1KA1 A;  3S9M C;  4P11 A;  3C32 A;  2HHM A;  4EQB A;  2FYI A;  4QF9 A;  1LB8 A;  4LVQ A;  2XWI A;  3A09 A;  3PPO A;  3L6H A;  3H6T A;  1ZU0 A;  3S9E A;  3BIH A;  3OO7 A;  1JW4 A;  5L9M A;  3V83 A;  2CEY A;  2HZK A;  3N26 A;  4ZEC A;  1SQY A;  1PB9 A;  2DVC A;  3PMW A;  2VP1 A;  3FGS A;  1FPF A;  3O6I A;  1QUK A;  1S7Y A;  3O6H A;  1MY3 A;  1B46 A;  1NKX A;  3R6U A;  4RXL A;  3E78 A;  5F7V A;  3O2A A;  1B3E A;  2XWV A;  2B4M A;  4BDO A;  1H76 A;  3K0V A;  5ET5 A;  1JVY A;  4LQ5 A;  3T9U A;  1PB7 A;  2RCA A;  2B65 A;  4QXD A;  1LEV A;  2XX8 A;  5DT6 A;  3PD8 A;  3MYU A;  3G7W A;  1TFA A;  5J16 A;  3KSJ A;  2Y84 A;  2UXA A;  5I2N A;  1LGB C;  4LZ7 A;  3BBR A;  2CMO A;  4G8M A;  1BK4 A;  2XD3 A;  5J1D A;  1US4 A;  3FIR A;  1USY H;  4EXL A;  3R26 A;  1AWB A;  4DE8 A;  2XXK A;  3CSB A;  1MPC A;  5I58 B;  1MXW A;  2IA4 A;  3DLN A;  1SDX A;  3TMG A;  4P8B A;  1LFG A;  1TWY A;  1YAE A;  2Z22 A;  4NWC A;  2DQV A;  3OO6 A;  5K2X A;  1MH3 A;  3T93 B;  4GVO A;  3DM0 A;  1UTB A;  3MZ9 A;  4H5G A;  3K6U A;  1SW2 A;  4AQ4 A;  1A7L A;  1NV5 A;  1LAF E;  4YAH X;  4L17 A;  4JWX A;  4WED A;  1MXU A;  5I7I A;  2OZZ A;  1FPK A;  1NH8 A;  4OMB A;  2PFZ A;  4KPT A;  4P1L A;  3IB0 A;  4I3Y A;  3LSF B;  3SEV A;  1II5 A;  4JWY A;  2BJI A;  1NMU A;  3BFU A;  2AL5 A;  2F36 A;  2DWJ A;  4PFW A;  1RDY A;  4PCD A;  1VFE A;  3VXB A;  3FAT A;  4XKQ A;  5LTC A;  1NUW A;  1RYX A;  1MXX A;  3BKI B;  2A5T B;  4U4X A;  2ESN A;  4GX4 A;  4IR8 A;  2QVU A;  4GWX A;  1IXC A;  1GVC A;  2F3D A;  4JWO A;  1FJ6 A;  4F1U A;  1JVX A;  5CBS A;  3CVG A;  4G61 A;  3A29 A;  2UVG A;  2W7Y A;  1LAG E;  3VLV A;  4G68 A;  4X1B A;  1URS A;  4OES A;  2VHA A;  5JTY B;  3PPR A;  3OD7 A;  4P47 A;  5CC2 A;  4BDQ A;  2AYS A;  1Y4T A;  4OVJ A;  1CNQ A;  4R75 A;  3RYD A;  1MPB A;  4P1E A;  4PBQ A;  3TTL A;  4GQO A;  4DXC A;  3UGW A;  3VXC A;  1R9L A;  1R1N A;  4PTK A;  3E3K A;  3T1B A;  4PBH A;  1XOC A;  5TPA A;  4PFY A;  2IEE A;  3DEL B;  4PDH A;  4I62 A;  3HST A;  1LCT A;  5CMK A;  4OVS A;  4I9D A;  3MST A;  3SEX A;  4R9G A;  3LUY A;  4KD5 A;  1QKB A;  3H4Z A;  3FXQ A;  4U22 A;  2Z8D A;  3SES A;  3ILT B;  3KBZ A;  4GL0 A;  2UVI A;  4F3G A;  3ODB A;  5I57 A;  1B4Z A;  1DMB A;  1IMF A;  3C9H A;  3G3G A;  4O3A A;  2FHY A;  3KC0 A;  4IY5 A;  2Y7W A;  2O6A A;  4BDR A;  1P1O A;  1N3W A;  1NNT A;  4MFI A;  1M5E A;  1HSE A;  1B1X A;  2XXV A;  4MLV A;  1HSJ A;  1D3K A;  1SW1 A;  4GBW A;  5AA2 B;  1IXG A;  3TAJ A;  4POX A;  4NF6 A;  4GWS A;  5ICT A;  4HE0 A;  4PAI A;  3HHF A;  2WX9 A;  1NL5 A;  2R71 A;  1B58 A;  4NE4 A;  2ALU A;  2QS3 A;  4F3B A;  4MNC A;  1IMC A;  3SDF A;  1A55 A;  3S9N C;  5EQ9 A;  4FAT A;  4EF2 A;  4EDP A;  4OVR A;  1EU8 A;  2X7Q A;  2H9B A;  4NF0 A;  5EQ7 A;  2HQ0 A;  2UVJ A;  1BP5 A;  4R6Y A;  4P0I A;  3RNN A;  2FA7 A;  3KN3 A;  5HPQ A;  4U4S A;  1IIW A;  1INP A;  2XXQ A;  4H1X A;  2XXT A;  2HAU A;  1B32 A;  3QXM A;  2E1S A;  1B0H A;  3OEK A;  1MXZ A;  1QVS A;  3Q26 A;  5H8Q A;  3O66 A;  4RA1 A;  2QS1 A;  4THI A;  4E0W A;  2XXR A;  3OSR A;  2PCR A;  2PBW A;  3OEL A;  4R6K A;  3D1R A;  2VPN A;  2ONK E;  1IZ1 A;  2OX3 A;  3KG2 A;  4WEP A;  5HM4 B;  1QUI A;  3U65 A;  3IB1 A;  4GIZ A;  1VSO A;  4XEQ A;  1TXF A;  3DP8 A;  4JXI A;  4O3B A;  3QIM A;  2PVU A;  2ABH A;  3MPK A;  1NUY A;  2Y7K A;  2VT5 A;  4HCY A;  4TLM B;  3SZP A;  3MVZ A;  1LFI A;  1FW0 A;  3CFL A;  1QKA A;  1LAX A;  3OXN A;  3W9W A;  3Q28 A;  2I4B A;  3KOT A;  5DEX B;  1SI1 A;  4UAB A;  4ELO A;  4GL8 A;  3O29 A;  3CSG A;  1Y4C A;  4HCW A;  1NUX A;  4GWO A;  2QS2 A;  4IO2 A;  2DP8 A;  2LAO A;  2DS9 A;  3M3F A;  1Y3Q A;  2I48 A;  3PPN A;  3EQ1 A;  4NF4 A;  3ONM A;  1LBZ A;  4OVQ A;  1S50 A;  2KQZ A;  2OLB A;  1PEB A;  1M5C A;  4I1D A;  1O64 A;  5KCJ A;  4QFK A;  4PET A;  1LBW A;  3E79 A;  1A8F A;  4PAF A;  2RF1 A;  3CFZ A;  3C33 A;  1UTH B;  1ZJL A;  5AA4 B;  1DOT A;  4IO6 A;  4RK9 A;  1T0K A;  5KZT A;  2Q74 A;  3TQW A;  2HCA A;  3K6V A;  3VFJ A;  2O7U A;  4N07 A;  3FV1 A;  2REG A;  3WAE A;  2YJP A;  4DCX A;  4PQJ A;  4C1U A;  4XFE A;  4LZ5 A;  3PD9 A;  3PU5 A;  3I3V A;  1FBD A;  3PTY A;  1N84 A;  1O63 A;  4OTE A;  4GLI A;  3RT8 A;  3T9V A;  4IO3 A;  4MMP A;  1Q9D A;  1HSL A;  1NV6 A;  3LV0 A;  3QUJ A;  4H45 A;  2OJT A;  3KN7 A;  1NV7 A;  4XIG Q;  2NOO A;  3RUM A;  3IR1 A;  4YU0 A;  3FAS A;  1H43 A;  3IL1 B;  1DTZ A;  1SI0 A;  3FXB A;  1FQE A;  1BKA A;  5HBC A;  3U94 A;  5H8N B;  2QPQ A;  4OHN A;  4H67 A;  3MZ1 A;  2V3U A;  3GXA A;  3IB2 A;  3HV1 A;  2ZYM A;  3ZS6 A;  4U23 A;  2Z23 A;  2ZNU A;  4BLA A;  4MNI A;  1I6A A;  1B7U A;  1QUJ A;  3N6T A;  2QVV A;  3TCG A;  4JVC A;  1R6Z A;  1FSA A;  2B3B A;  3E13 X;  2I0C A;  4AS5 A;  2VOZ A;  3HN0 A;  4I8C A;  4RY1 A;  2P2A A;  1XHY A;  1I6B A;  1SYH A;  4G2Z A;  4GD5 A;  3IOR A;  5L9S A;  3FVO A;  4MLQ A;  5ET6 A;  4YKI A;  4KYE A;  4FOR A;  5I58 A;  5IZZ A;  1LFH A;  4FEC A;  3I6V A;  2Q2A A;  1YYZ A;  4LN5 A;  1B51 A;  1XT8 A;  4X48 A;  1FBG A;  4IO5 A;  4LA9 A;  2KLF A;  1FTL A;  4MNP A;  1Q1K A;  3KC1 A;  3EHT A;  2HFB A;  3H3G A;  3S2V A;  3OSQ A;  1FTJ A;  1MQJ A;  1LB9 A;  3MVY A;  2GH9 A;  2Y5L A;  2HZL A;  3C31 A;  3FUZ A;  5CMB A;  3LR1 A;  4MEV A;  2Q2C A;  1EZP A;  1IMA A;  1GTK A;  3CR9 A;  3VVE A;  3SEY A;  3A3U A;  1N7X A;  4N4U A;  1KA0 A;  4U21 A;  2ZNS A;  4UA8 A;  2ANJ A;  3OEM A;  3T22 A;  4MIJ A;  5I56 B;  1XVY A;  3B7D A;  2A5T A;  4F22 A;  1B3L A;  1NV2 A;  1EYI A;  1NV4 A;  3JYR A;  3IO4 A;  4RYA A;  5DVF A;  4P3L A;  2ZYN A;  4LAT A;  2FBP A;  4H8J A;  2L5V A;  4YKP A;  3UP9 A;  1QJM A;  2V93 A;  2WYK A;  2OCU A;  4QBA A;  4GRK A;  4PFT A;  5DVJ A;  5I5P A;  1A40 A;  4LUB A;  4F2Q A;  5JTY A;  4N6K A;  1S9T A;  4F29 A;  1RDZ A;  5FBP A;  1XI6 A;  4BDM A;  1MDQ A;  4RNS A;  4JB7 A;  4JVD A;  2F35 A;  1SD3 A;  1UQW A;  5ITO A;  4OER A;  2QL3 A;  1OMP A;  4IO7 A;  1SW5 A;  5IM2 A;  5AA3 A;  1P1N A;  3S4U A;  3MVW A;  4KHZ E;  2B3F A;  4RK2 A;  3S9L C;  5EHS A;  3KFM A;  1MY4 A;  1P1Q A;  1Z7N E;  1CB6 A;  2O51 A;  5I2K B;  3QAX A;  5H8H B;  1MS7 A;  4F3S A;  2WKY A;  1M5F A;  4MF3 A;  1B5H A;  3SET A;  2QS4 A;  1PC3 A;  4GWZ A;  4OET A;  3TEL A;  3ZKL A;  4DI4 B;  3FVG A;  2F34 A;  2D21 A;  3JZJ A;  4OFL A;  1N0T A;  4GX6 A;  2G29 A;  4LON B;  5A5L A;  5M2V A;  2R6G E;  4ZEI A;  1D9Y A;  2ZYK A;  1DPP A;  1JEV A;  4DLD A;  4N8G A;  2FVZ A;  2X26 A;  3IFC A;  4ISU A;  1BTJ A;  3MW0 A;  3UOR A;  5EYF A;  3UA8 A;  3KJ7 A;  2XWK A;  5CM6 A;  2P3N A;  2Q89 A;  3KJT A;  4OWD A;  3LBS A;  3TEP A;  3KGC A;  4KYD A;  2H99 A;  1UTB B;  5AA2 A;  2UVH A;  4FAJ A;  5LDZ A;  1POT A;  2DYX A;  3EPE A;  5IZ3 B;  3TQL A;  2QRY A;  1DTG A;  3NOH A;  3EHU A;  3RT6 B;  5L8D A;  4PF8 A;  1M5B A;  2XWO A;  1BLF A;  4OEN A;  4GWU A;  4N6P A;  3KN8 A;  1B7Z A;  3RGY A;  5K2Y A;  2D3I A;  3EF7 A;  4Q30 B;  3V8X B;  4AB6 A;  3TUS A;  1M5D A;  2Q88 A;  1A99 A;  1P1W A;  1FQD A;  4IY6 A;  5JK4 A;  1B3H A;  2F97 A;  4XTC Q;  2XX9 A;  3M3K A;  2F78 A;  1FPB A;  3MAM A;  2DOJ A;  4DDD A;  1PDA A;  4I40 A;  1AH5 A;  4MHF A;  4ZE9 A;  3O9P A;  4PFI A;  2XX7 A;  5EQ8 A;  4NGU A;  1ZMG A;  3CG1 A;  2PMS A;  3U93 A;  3H06 B;  3KEI A;  1SBP A;  4G4P A;  3B6T A;  4NF8 B;  4R73 A;  2O1L A;  1USY E;  1YPN A;  3MP1 A;  3H6W A;  3N6U A;  3K1P A;  4Z0I A;  4QFN A;  4QFO A;  5A5X B;  3JV9 A;  4KCD A;  4MAG A;  2O1M A;  4TLL B;  1FQA A;  3H7M A;  1NV1 A;  3RTF B;  4JVI A;  1NV0 A;  4DIG A;  4NHB A;  1EYJ A;  1FQC A;  5IGA A;  4YMA A;  4ZED A;  1ATG A;  3K4U A;  2HXR A;  3G3K A;  4G8H A;  3HPI A;  3KSX A;  3GYY A;  4F1V A;  1PB8 A;  3PV0 E;  1JET A;  4N17 A;  1B5I A;  3ZSF A;  4NX1 A;  4H65 A;  3PUY E;  3PMX A;  4GFR A;  3O6G A;  4M4G A;  4OVT A;  2E0S A;  3KZG A;  1OLC A;  3CHG A;  1XC1 A;  1JNF A;  4GWW A;  3MQ9 A;  4ZEB A;  3UK4 A;  3W9V A;  2MKZ A;  1EZ9 A;  4ONY A;  2DE4 A;  5DEX A;  4JBZ A;  4FIM A;  1LBY A;  4IB2 A;  3TTM A;  1N76 A;  4XF5 A;  4Q8R A;  2O69 A;  2CZL A;  2CZH A;  3PUV E;  3EN3 A;  3TFL A;  3MBP A;  2H98 A;  1D4N A;  3LSX A;  2XHD A;  1H3D A;  4O3C A;  3PMV A;  1JP4 A;  4ZDM A;  2BJJ X;  4ELR A;  4O8M A;  3VVD A;  1K9Y A;  1ZIU A;  5EYG A;  2G93 A;  3ZKK A;  1MH4 A;  1D9V A;  4FBP A;  4OXV A;  3K1M A;  5FHN A;  4JSD A;  5H8S A;  2NWJ A;  2RCB A;  2ONS A;  3U72 A;  1UTH A;  4PFR A;  5AA4 A;  4OEV A;  4TQU Q;  3SEU A;  3D4G A;  2GHA A;  3DP4 A;  1FRP A;  2QVR A;  1OQG A;  2JJK A;  3CFX A;  2RKM A;  2ZZV A;  4NQ8 A;  4RJZ A;  3BIG A;  4XKR A;  4NED A;  4NMY A;  4ZZE A;  4QFL A;  3RPL B;  3MPL A;  3C34 A;  3VDF A;  4GXS B;  1TT1 A;  4OQO A;  4HTG A;  3O28 A;  1K9Z A;  4MJO A;  2AIX A;  2YLN A;  1G0H A;  3MZB A;  3I5O A;  2UYE A;  3QMF A;  4ZS9 A;  2GRV A;  1MQG A;  1LBV A;  1B4H A;  4KI0 E;  2R8T A;  4EQ9 A;  1IXI A;  1LCF A;  3H6V A;  2F7B A;  2I3V A;  5H8N A;  5ET7 A;  5I59 B;  5H8F A;  3W15 C;  3VLW A;  2P1S A;  2V3T A;  1WOD A;  3K6X A;  2DSF A;  1AIV A;  1FBF A;  2ZYO A;  2I4C A;  1B52 A;  4YZZ A;  5DVI A;  4DXU A;  1FPL A;  2I0B A;  4LQ2 A;  1US5 A;  3ILU B;  1QW0 A;  1MM7 A;  3PPQ A;  3MP6 A;  1Y9U A;  1VE4 A;  2F5X A;  4GBV A;  3CI8 A;  4PC9 A;  1OQH A;  1N04 A;  2CEX A;  3IOU A;  4YIC A;  1POY 1;  1B6H A;  2WEF A;  4P56 A;  3M3L A;  3LSL A;  5CRY A;  5B7D A;  3QK6 A;  2AL4 A;  1P99 A;  4R2F A;  3GBA A;  2DXY A;  4K3F A;  4H46 A;  1AL3 A;  1FBH A;  3OMB A;  4C1T A;  3PUX E;  2X7P A;  1OIB A;  1GGG A;  3L6G A;  1YTV A;  3PUZ E;  3Q25 A;  1MY1 A;  3P7I A;  3IK6 B;  1FPE A;  1VR5 A;  1FBC A;  3RY3 A;  4Q5T A;  4EQ7 A;  1DPE A;  1EZO A;  5KDT B;  2I58 A;  1B40 A;  1B2H A;  2ZXT A;  4QHQ A;  1XS5 A;  2DE2 A;  1R9Q A;  4MCO A;  4DCY A;  2Y5K A;  2H4I A;  4ZEK A;  2KR0 A;  1Q35 A;  4U1Z A;  3TYH A;  5AE4 A;  1WDN A;  3N94 A;  4ELQ A;  1MPD A;  4FEB A;  4LP2 B;  4WKM A;  1IMB A;  2PT1 A;  1RKM A;  4GX3 A;  1JW5 A;  1P1U A;  3IX1 A;  5I3S A;  2WYP A;  5JEI A;  2RC8 A;  4UAC A;  4DXB A;  4ELP A;  3H03 A;  2XXW A;  2GFE A;  3CRB A;  4KQP A;  1KZ8 A;  4ESX A;  3K01 A;  2QMW A;  1IIT A;  4G77 A;  3UIF A;  1J1N A;  3GLB A;  2ZNT A;  3IO6 A;  4H0W A;  1B5J A;  3IFA A;  4YB7 A;  4YMB A;  3IOV A;  1LLS A;  3A3C A;  3M8U A;  1XVX A;  5FHO A;  3VLU A;  5TP9 B;  5F1Q A;  3FXR A;  1H44 A;  1FTA A;  5CI5 A;  4P0G A;  2O84 X;  2PFY A;  2D5W A;  4N81 A;  1A54 A;  3EKI A;  2XXU A;  5ISU A;  4I3E A;  3MVX A;  2V84 A;  1MY0 A;  3GZG A;  4NF5 B;  4PGN A;  3EHS A;  2XXX A;  5I2K A;  5CBR A;  1OVT A;  1I6Q A;  5H8H A;  4HE1 A;  4N91 A;  4IGR A;  3E9X A;  3ROJ A;  3Q27 A;  2GQ1 A;  4DI3 D;  3FJ7 A;  3PUW E;  1B1H A;  2THI A;  5CMC A;  4XXU A;  4ZEF A;  4OFJ A;  4QSD A;  5AA2 D;  4LZ8 A;  4IGT A;  1URD A;  4MX6 A;  5ELV A;  4QFP A;  2OK2 A;  1D9Q A;  1DBZ A;  1FQB A;  3G3J A;  4ZE8 A;  4QRZ A;  3TZA A;  4MH5 A;  4O7M A;  4NG7 A;  2REJ A;  1UIU A;  4FE8 A;  4XKP A;  1AOV A;  1IUD A;  1MRP A;  3K1N A;  1L5T A;  1PBP A;  1MQH A;  4NTL A;  2O68 A;  5IZ3 A;  3QUF A;  4N15 A;  2QJE A;  3H6U A;  5BWJ A;  2QFL A;  4XKN A;  3PPP A;  3V89 B;  1A8E A;  4OVP A;  3IOT A;  4F3P A;  5EQA A;  2Q9T A;  1FPI A;  2O7I A;  2P3V A;  3IJX B;  2F6P A;  3E4R A;  2I3W A;  1Y1Z A;  3RN8 A;  4O94 A;  4U2R A;  5AA1 A;  4KCC A;  1NI9 A;  1NNF A;  4OAN A;  2DVZ A;  2Z8F A;  1FJ9 A;  4PGP A;  5I2N B;  2Y7R A;  3QYT A;  4PDD A;  4YB5 A;  1YCJ A;  2OBG A;  3LSW A;  1MG1 A;  3OEN A;  2HPG A;  3T66 A;  1FBE A;  3BFT A;  5IKB A;  3SKP A;  1Y1M A;  3T0J A;  4ZZA A;  1TFD A;  3THI A;  3TTK A;  2VGQ A;  1EH3 A;  3C35 A;  4GOT A;  5LOM A;  4R2B A;  3B6W A;  1OVB A;  4R74 A;  2ONR A;  2Y7P A;  4NF8 A;  1B05 A;  3RQT A;  4OFO A;  4HW8 A;  4WXJ A;  3TKD A;  1MDP 1;  1B3G A;  1YXI A;  4C0R A;  2XXH A;  1KWH A;  4HE2 A;  1UIV A;  3ECR A;  2RC9 A;  5A5X A;  1QGX A;  1DK4 A;  2P0S A;  4F1Y A;  2CZI A;  2QMX A;  3F11 A;  3ISP A;  3K00 A;  1FBP A;  2DDK A;  2ZZW A;  4P9K A;  3AXF A;  4JSO A;  4RPO A;  4NAP A;  1JW1 A;  1JQF A;  2NUV A;  5EYH A;  4R6H A;  3K2D A;  2WBB A;  1ZLQ A;  2DE3 A;  2RIN A;  3MP8 A;  3FZV A;  4H5F A;  2V25 A;  3SER A;  4H8I A;  1ZBM A;  2Y7I A;  4F18 A;  4F31 B;  3DP6 A;  1B3F A;  3VVF A;  1PBQ A;  1IEJ A;  5FTI A;  2B4L A;  3RLF E;  3USD A;  3LUZ A;  4MBP A;  4R9F A;  3B6Q A;  1ZTY A;  3MJN A;  2OWZ A;  3TPA A;  4GXA A;  1CE2 A;  5DTB A;  1B7H A;  5FHM A;  4G68 B;  2HEU A;  3VE1 B;  2VD2 A;  3V5A A;  4PF6 A;  1DCU A;  4E0X A;  4PFU A;  2XXY A;  2HXW A;  4N6D A;  5ITP A;  4AB5 A;  2GHB A;  1VDW A;  2XXP A;  5T3J A;  2I49 A;  3HHG A;  3CG3 A;  1IXH A;  4Q0C A;  1MY2 A;  3FXU A;  3TTN A;  1URG A;  1NFT A;  3C4M A;  4GF8 A;  4PP0 A;  5DYH A;  5B70 A;  3RTW B;  1IQ7 A;  1RYO A;  3T96 B;  2F6G A;  4BDN A;  3MWB A;  5TPA B;  3RPW A;  1B9J A;  4FED A;  3QSL A;  4N13 A;  1FQF A;  4FJP A;  3HCQ A;  3FJG A;  3GBB A;  4KR5 A;  5BUU A;  4HXV A;  1ZKB A;  4YKK A;  1BIY A;  5F24 A;  2ZZX A;  3CIJ A;  3RPL A;  3K02 A;  2DWA A;  3B8B A;  2VD3 A;  3U8Q A;  4PFB A;  4OA4 A;  4BDL A;  1MM6 A;  5I57 B;  2PT2 A;  1RDX A;  5ICQ A;  2F7A A;  2WBD A;  4ESW A;  1G0I A;  1NV3 A;  3LC8 A;  5IAI A;  2DWH A;  4KFQ A;  1LAH E;  4F19 A;  4KYS A;  4ND9 A;  3N5L A;  4PE5 B;  1GV8 A;  3HFU A;  4AS4 A;  3IOW A;  3D4C A;  3K6W A;  4F2O A;  5IZ1 A;  1I69 A;  4NF6 B;  5ET8 A;  1IME A;  5I59 A;  3G3H A;  3FJM A;  1N3X A;  2OWS A;  2XA5 A;  3WAF A;  3O97 A;  4N8Y A;  2RC7 A;  1NNP A;  1DSN A;  4YKJ A;  3C36 A;  1FPD A;  1NNK A;  4X1D A;  4EF1 A;  4ECF A;  1OLA A;  4OEU A;  4U1O A;  1IMD A;  1QUL A;  3VV5 A;  4JDF A;  4QSE A;  4POW A;  1FTM A;  2H25 A;  2OWT A;  2I6E A;  3OO8 A;  4H6D A;  1NH7 A;  2M8C A;  1MQD A;  2Z8E A;  3U1O A;  1MXV A;  5TU0 A;  3R7X A;  3TTR A;  1SVX B;  1LBX A;  1B0L A;  3KBR A;  1Z7M E;  1VFD A;  3FD3 A;  4X04 A;  2A5S A;  2V3Q A;  1LST A;  3MC2 A;  3TDJ A;  3OOA A;  5H8Q B;  5KDT A;  4PE3 A;  2YPN A;  4HS7 A;  4OZ9 A;  4QSC A;  2R9J A;  4Z7E A;  1MXY A;  1N7W A;  2Q8J A;  2HAV A;  4IO4 A;  4GWY A;  4RPN A;  2Q8M A;  1Y3P A;  4NN3 A;  1SW4 A;  5EHM A;  2UYF A;  1AMF A;  4F39 A;  4X9T A;  2F7C A;  5CMM A;  1JEU A;  3T9X B;  3FVK A;  2DXR A;  1GR2 A;  1YZ0 A;  1Y3N A;  2CZK A;  5ESY A;  2VPO A;  3PGF A;  2F8D A;  3KOS A;  3IAZ A;  4PAK A;  1F9B A;  3FBP A;  5L9O A;  3OO9 A;  1O7T A;  1FCK A;  3MUQ A;  2H5Y A;  1MQI A;  1WVJ A;  4DZ1 A;  4G8N A;  1Y20 A;  4TOZ A;  4X8R A;  5DW8 A;  1NUZ A;  4R72 A;  3U92 A;  3IJO B;  2NXO A;  1LBB A;  1H45 A;  4EXK A;  4NF4 B;  1SYI A;  5TP9 A;  3SEW A;  3TOD A;  2FIE A;  1ANF A;  2NVU B;  4O7I A;  2F3B A;  2XXI A;  3G3I A;  3T9H B;  1ELJ A;  2QSX A;  2FIX A;  2XD2 A;  3B50 A;  5KCJ B; 
#chains in the Genus database with same CATH homology
 2PX1 A;  4OYV A;  4NF5 A;  5I56 A;  5H8F B;  3FV2 A;  1LBC A;  2ZMB A;  5FTH A;  2PYY A;  4G68 C;  4M1V A;  3G3F A;  5I84 A;  3FVN A;  1FTO A;  3TCF A;  3Q29 A;  3TCH A;  1FTK A;  3HO7 A;  4NWD A;  4YB6 A;  4EUO A;  3UN6 A;  2FNC A;  2DWI A;  3S9M C;  4P11 A;  3C32 A;  4EQB A;  2FYI A;  4QF9 A;  1LB8 A;  4LVQ A;  3A09 A;  3PPO A;  3L6H A;  3H6T A;  1ZU0 A;  3S9E A;  3OO7 A;  1JW4 A;  5L9M A;  3V83 A;  2HZK A;  3N26 A;  4ZEC A;  1SQY A;  1PB9 A;  2DVC A;  3PMW A;  2VP1 A;  3FGS A;  3O6I A;  1QUK A;  1S7Y A;  3O6H A;  1MY3 A;  1B46 A;  1NKX A;  3R6U A;  4RXL A;  5F7V A;  3O2A A;  1B3E A;  4BDO A;  1H76 A;  3K0V A;  1JVY A;  4LQ5 A;  3T9U A;  1PB7 A;  2RCA A;  2B65 A;  2XX8 A;  5DT6 A;  3PD8 A;  3G7W A;  1TFA A;  3KSJ A;  2Y84 A;  2UXA A;  5I2N A;  1LGB C;  4LZ7 A;  3BBR A;  2CMO A;  4G8M A;  2XD3 A;  5J1D A;  1US4 A;  3FIR A;  1USY H;  4EXL A;  3R26 A;  4DE8 A;  3CSB A;  1MPC A;  5I58 B;  1MXW A;  2IA4 A;  3DLN A;  1SDX A;  3TMG A;  1LFG A;  1TWY A;  1YAE A;  2Z22 A;  4NWC A;  2DQV A;  3OO6 A;  5K2X A;  1MH3 A;  3T93 B;  4GVO A;  3DM0 A;  1UTB A;  3MZ9 A;  4H5G A;  3K6U A;  1SW2 A;  4AQ4 A;  1A7L A;  1LAF E;  4YAH X;  4L17 A;  4JWX A;  4WED A;  1MXU A;  2OZZ A;  1NH8 A;  4OMB A;  4KPT A;  3IB0 A;  3LSF B;  3SEV A;  1II5 A;  4JWY A;  1NMU A;  3BFU A;  2AL5 A;  2F36 A;  2DWJ A;  4PFW A;  1VFE A;  3VXB A;  3FAT A;  4XKQ A;  1RYX A;  1MXX A;  3BKI B;  2A5T B;  4U4X A;  2ESN A;  1IXC A;  1GVC A;  4JWO A;  4F1U A;  1JVX A;  5CBS A;  3CVG A;  2UVG A;  2W7Y A;  1LAG E;  3VLV A;  4G68 A;  4X1B A;  1URS A;  4OES A;  2VHA A;  5JTY B;  3PPR A;  3OD7 A;  5CC2 A;  4BDQ A;  2AYS A;  1Y4T A;  4OVJ A;  4R75 A;  1MPB A;  3TTL A;  4GQO A;  4DXC A;  3UGW A;  3VXC A;  1R9L A;  1R1N A;  3E3K A;  1XOC A;  5TPA A;  4PFY A;  2IEE A;  3DEL B;  4I62 A;  3HST A;  1LCT A;  5CMK A;  4I9D A;  3SEX A;  4R9G A;  3LUY A;  4KD5 A;  1QKB A;  3H4Z A;  3FXQ A;  4U22 A;  2Z8D A;  3SES A;  3ILT B;  4GL0 A;  2UVI A;  4F3G A;  3ODB A;  5I57 A;  1B4Z A;  1DMB A;  3C9H A;  3G3G A;  4O3A A;  4IY5 A;  2Y7W A;  2O6A A;  4BDR A;  1P1O A;  1N3W A;  1NNT A;  4MFI A;  1M5E A;  1HSE A;  1B1X A;  2XXV A;  4MLV A;  1HSJ A;  1D3K A;  1SW1 A;  5AA2 B;  1IXG A;  3TAJ A;  4POX A;  4NF6 A;  5ICT A;  3HHF A;  1NL5 A;  2R71 A;  1B58 A;  4NE4 A;  2ALU A;  2QS3 A;  4F3B A;  3SDF A;  1A55 A;  3S9N C;  4FAT A;  4EF2 A;  4EDP A;  1EU8 A;  2X7Q A;  2H9B A;  2HQ0 A;  2UVJ A;  1BP5 A;  4R6Y A;  4P0I A;  3RNN A;  2FA7 A;  3KN3 A;  5HPQ A;  4U4S A;  1IIW A;  2XXQ A;  4H1X A;  2XXT A;  2HAU A;  1B32 A;  3QXM A;  2E1S A;  1B0H A;  3OEK A;  1MXZ A;  1QVS A;  3Q26 A;  5H8Q A;  3O66 A;  4RA1 A;  2QS1 A;  4THI A;  4E0W A;  2XXR A;  3OSR A;  2PBW A;  3OEL A;  4R6K A;  2ONK E;  1IZ1 A;  3KG2 A;  4WEP A;  5HM4 B;  1QUI A;  3IB1 A;  4GIZ A;  1VSO A;  1TXF A;  3DP8 A;  4JXI A;  4O3B A;  3QIM A;  2PVU A;  2ABH A;  3MPK A;  2Y7K A;  4HCY A;  4TLM B;  3MVZ A;  1LFI A;  1FW0 A;  3CFL A;  1QKA A;  1LAX A;  3OXN A;  3W9W A;  3Q28 A;  2I4B A;  3KOT A;  5DEX B;  1SI1 A;  4ELO A;  4GL8 A;  3O29 A;  3CSG A;  1Y4C A;  4HCW A;  4GWO A;  2QS2 A;  4IO2 A;  2DP8 A;  2LAO A;  2DS9 A;  3M3F A;  1Y3Q A;  2I48 A;  3PPN A;  3EQ1 A;  4NF4 A;  3ONM A;  1S50 A;  2OLB A;  1PEB A;  1M5C A;  4I1D A;  1O64 A;  5KCJ A;  4QFK A;  4PET A;  1A8F A;  2RF1 A;  3CFZ A;  3C33 A;  1UTH B;  1ZJL A;  5AA4 B;  1DOT A;  4IO6 A;  4RK9 A;  1T0K A;  5KZT A;  3TQW A;  2HCA A;  3K6V A;  3VFJ A;  2O7U A;  4N07 A;  3FV1 A;  2REG A;  3WAE A;  2YJP A;  4DCX A;  4PQJ A;  4C1U A;  4LZ5 A;  3PD9 A;  3PU5 A;  3I3V A;  1N84 A;  1O63 A;  4OTE A;  4GLI A;  3RT8 A;  3T9V A;  4IO3 A;  1HSL A;  3QUJ A;  2OJT A;  3KN7 A;  4XIG Q;  2NOO A;  3RUM A;  3IR1 A;  4YU0 A;  3FAS A;  1H43 A;  3IL1 B;  1DTZ A;  1SI0 A;  1FQE A;  1BKA A;  5HBC A;  3U94 A;  5H8N B;  2QPQ A;  4OHN A;  4H67 A;  3MZ1 A;  2V3U A;  3GXA A;  3IB2 A;  3HV1 A;  2ZYM A;  3ZS6 A;  4U23 A;  2Z23 A;  2ZNU A;  4BLA A;  1I6A A;  1B7U A;  1QUJ A;  3N6T A;  3TCG A;  1R6Z A;  2B3B A;  3E13 X;  2I0C A;  2VOZ A;  3HN0 A;  4I8C A;  4RY1 A;  2P2A A;  1XHY A;  1I6B A;  1SYH A;  4G2Z A;  4GD5 A;  3IOR A;  5L9S A;  3FVO A;  4MLQ A;  4YKI A;  4KYE A;  4FOR A;  5I58 A;  1LFH A;  4FEC A;  3I6V A;  2Q2A A;  1B51 A;  1XT8 A;  4X48 A;  4IO5 A;  4LA9 A;  2KLF A;  1FTL A;  1Q1K A;  3EHT A;  2HFB A;  3H3G A;  3S2V A;  3OSQ A;  1FTJ A;  1MQJ A;  1LB9 A;  3MVY A;  2GH9 A;  2HZL A;  3C31 A;  3FUZ A;  5CMB A;  3LR1 A;  2Q2C A;  1EZP A;  1GTK A;  3CR9 A;  3VVE A;  3SEY A;  3A3U A;  1N7X A;  4U21 A;  2ZNS A;  4UA8 A;  2ANJ A;  3OEM A;  3T22 A;  5I56 B;  1XVY A;  3B7D A;  2A5T A;  4F22 A;  1B3L A;  3JYR A;  3IO4 A;  4RYA A;  5DVF A;  2ZYN A;  4LAT A;  4H8J A;  4YKP A;  3UP9 A;  1QJM A;  2V93 A;  2OCU A;  4GRK A;  4PFT A;  5DVJ A;  1A40 A;  4LUB A;  4F2Q A;  5JTY A;  1S9T A;  4F29 A;  4BDM A;  1MDQ A;  4RNS A;  4JB7 A;  2F35 A;  1SD3 A;  1UQW A;  5ITO A;  4OER A;  2QL3 A;  1OMP A;  4IO7 A;  1SW5 A;  5AA3 A;  1P1N A;  3S4U A;  3MVW A;  4KHZ E;  2B3F A;  4RK2 A;  3S9L C;  5EHS A;  3KFM A;  1MY4 A;  1P1Q A;  1Z7N E;  1CB6 A;  2O51 A;  5I2K B;  3QAX A;  5H8H B;  1MS7 A;  4F3S A;  2WKY A;  1M5F A;  4MF3 A;  1B5H A;  3SET A;  2QS4 A;  1PC3 A;  4OET A;  3TEL A;  3ZKL A;  3FVG A;  2F34 A;  2D21 A;  3JZJ A;  4OFL A;  1N0T A;  2G29 A;  4LON B;  5M2V A;  2R6G E;  4ZEI A;  1D9Y A;  2ZYK A;  1DPP A;  1JEV A;  4DLD A;  2X26 A;  4ISU A;  1BTJ A;  3MW0 A;  3UOR A;  5EYF A;  3UA8 A;  3KJ7 A;  5CM6 A;  2Q89 A;  3KJT A;  4OWD A;  3LBS A;  3TEP A;  3KGC A;  4KYD A;  2H99 A;  1UTB B;  5AA2 A;  2UVH A;  4FAJ A;  1POT A;  2DYX A;  3EPE A;  3TQL A;  2QRY A;  1DTG A;  3EHU A;  3RT6 B;  5L8D A;  1M5B A;  1BLF A;  4OEN A;  4N6P A;  3KN8 A;  1B7Z A;  3RGY A;  5K2Y A;  2D3I A;  3EF7 A;  4Q30 B;  3V8X B;  4AB6 A;  3TUS A;  1M5D A;  2Q88 A;  1A99 A;  1P1W A;  1FQD A;  4IY6 A;  5JK4 A;  1B3H A;  2F97 A;  4XTC Q;  2XX9 A;  3M3K A;  2F78 A;  3MAM A;  2DOJ A;  4DDD A;  1PDA A;  1AH5 A;  4ZE9 A;  3O9P A;  2XX7 A;  1ZMG A;  3CG1 A;  2PMS A;  3U93 A;  3H06 B;  3KEI A;  1SBP A;  4G4P A;  3B6T A;  4NF8 B;  4R73 A;  2O1L A;  1USY E;  1YPN A;  3MP1 A;  3H6W A;  3N6U A;  3K1P A;  4Z0I A;  4QFN A;  4QFO A;  5A5X B;  3JV9 A;  4KCD A;  2O1M A;  4TLL B;  1FQA A;  3H7M A;  3RTF B;  4DIG A;  1FQC A;  4YMA A;  4ZED A;  1ATG A;  3K4U A;  3G3K A;  4G8H A;  3HPI A;  3KSX A;  4F1V A;  1PB8 A;  3PV0 E;  1JET A;  1B5I A;  3ZSF A;  4H65 A;  3PUY E;  3PMX A;  4GFR A;  3O6G A;  4M4G A;  2E0S A;  3KZG A;  1OLC A;  1XC1 A;  1JNF A;  3MQ9 A;  4ZEB A;  3UK4 A;  3W9V A;  1EZ9 A;  4ONY A;  2DE4 A;  5DEX A;  4JBZ A;  4FIM A;  4IB2 A;  3TTM A;  1N76 A;  4Q8R A;  2O69 A;  2CZL A;  3PUV E;  3EN3 A;  3TFL A;  3MBP A;  2H98 A;  1D4N A;  3LSX A;  2XHD A;  1H3D A;  4O3C A;  3PMV A;  4ZDM A;  2BJJ X;  4ELR A;  3VVD A;  1ZIU A;  2G93 A;  3ZKK A;  1MH4 A;  1D9V A;  4OXV A;  3K1M A;  5FHN A;  4JSD A;  5H8S A;  2NWJ A;  2RCB A;  2ONS A;  3U72 A;  1UTH A;  5AA4 A;  4OEV A;  4TQU Q;  3SEU A;  3D4G A;  2GHA A;  3DP4 A;  1OQG A;  3CFX A;  2RKM A;  4RJZ A;  4XKR A;  4NED A;  4NMY A;  4ZZE A;  4QFL A;  3MPL A;  3C34 A;  3VDF A;  4GXS B;  1TT1 A;  4OQO A;  4HTG A;  3O28 A;  2AIX A;  2YLN A;  3MZB A;  3I5O A;  2UYE A;  4ZS9 A;  2GRV A;  1MQG A;  1B4H A;  4KI0 E;  4EQ9 A;  1IXI A;  1LCF A;  3H6V A;  2F7B A;  2I3V A;  5H8N A;  5I59 B;  5H8F A;  3W15 C;  3VLW A;  2P1S A;  2V3T A;  1WOD A;  3K6X A;  2DSF A;  1AIV A;  2ZYO A;  2I4C A;  1B52 A;  4YZZ A;  5DVI A;  4DXU A;  2I0B A;  4LQ2 A;  1US5 A;  3ILU B;  1QW0 A;  1MM7 A;  3PPQ A;  3MP6 A;  1Y9U A;  1VE4 A;  2F5X A;  3CI8 A;  1OQH A;  1N04 A;  3IOU A;  4YIC A;  1POY 1;  1B6H A;  3M3L A;  3LSL A;  5CRY A;  5B7D A;  3QK6 A;  2AL4 A;  1P99 A;  4R2F A;  3GBA A;  2DXY A;  4K3F A;  1AL3 A;  3OMB A;  4C1T A;  3PUX E;  2X7P A;  1OIB A;  1GGG A;  3L6G A;  1YTV A;  3PUZ E;  3Q25 A;  1MY1 A;  3P7I A;  3IK6 B;  1VR5 A;  3RY3 A;  4Q5T A;  4EQ7 A;  1DPE A;  1EZO A;  5KDT B;  2I58 A;  1B40 A;  1B2H A;  2ZXT A;  4QHQ A;  1XS5 A;  2DE2 A;  1R9Q A;  4DCY A;  2H4I A;  4ZEK A;  1Q35 A;  4U1Z A;  3TYH A;  5AE4 A;  1WDN A;  3N94 A;  4ELQ A;  1MPD A;  4FEB A;  4LP2 B;  4WKM A;  2PT1 A;  1RKM A;  1JW5 A;  1P1U A;  3IX1 A;  5JEI A;  2RC8 A;  4UAC A;  4DXB A;  4ELP A;  3H03 A;  2XXW A;  2GFE A;  3CRB A;  4KQP A;  4ESX A;  3K01 A;  2QMW A;  1IIT A;  4G77 A;  3UIF A;  1J1N A;  3GLB A;  2ZNT A;  3IO6 A;  4H0W A;  1B5J A;  4YB7 A;  4YMB A;  3IOV A;  1LLS A;  3A3C A;  3M8U A;  1XVX A;  5FHO A;  3VLU A;  5TP9 B;  5F1Q A;  3FXR A;  1H44 A;  5CI5 A;  4P0G A;  2O84 X;  2D5W A;  1A54 A;  2XXU A;  5ISU A;  3MVX A;  2V84 A;  1MY0 A;  3GZG A;  4NF5 B;  3EHS A;  2XXX A;  5I2K A;  5CBR A;  1OVT A;  1I6Q A;  5H8H A;  4IGR A;  3E9X A;  3Q27 A;  3FJ7 A;  3PUW E;  1B1H A;  2THI A;  5CMC A;  4XXU A;  4ZEF A;  4OFJ A;  4QSD A;  5AA2 D;  4LZ8 A;  4IGT A;  1URD A;  5ELV A;  4QFP A;  2OK2 A;  1FQB A;  3G3J A;  4ZE8 A;  4QRZ A;  3TZA A;  4MH5 A;  2REJ A;  1UIU A;  4FE8 A;  4XKP A;  1AOV A;  1IUD A;  1MRP A;  1L5T A;  3K1N A;  1PBP A;  1MQH A;  4NTL A;  2O68 A;  3QUF A;  2QJE A;  3H6U A;  5BWJ A;  4XKN A;  3PPP A;  3V89 B;  1A8E A;  3IOT A;  4F3P A;  2Q9T A;  2O7I A;  3IJX B;  2F6P A;  3E4R A;  2I3W A;  1Y1Z A;  3RN8 A;  4U2R A;  5AA1 A;  4KCC A;  1NNF A;  2DVZ A;  2Z8F A;  5I2N B;  2Y7R A;  3QYT A;  4YB5 A;  1YCJ A;  2OBG A;  3LSW A;  1MG1 A;  3OEN A;  3T66 A;  3BFT A;  5IKB A;  3SKP A;  1Y1M A;  4ZZA A;  1TFD A;  3THI A;  3TTK A;  2VGQ A;  1EH3 A;  3C35 A;  4GOT A;  5LOM A;  4R2B A;  3B6W A;  1OVB A;  4R74 A;  2ONR A;  2Y7P A;  4NF8 A;  1B05 A;  3RQT A;  4OFO A;  4HW8 A;  4WXJ A;  3TKD A;  1MDP 1;  1B3G A;  4C0R A;  2XXH A;  1KWH A;  1UIV A;  3ECR A;  2RC9 A;  5A5X A;  2P0S A;  4F1Y A;  2QMX A;  3F11 A;  3K00 A;  3AXF A;  4JSO A;  4RPO A;  1JW1 A;  1JQF A;  2NUV A;  4R6H A;  3K2D A;  1ZLQ A;  2DE3 A;  2RIN A;  3MP8 A;  3FZV A;  4H5F A;  2V25 A;  3SER A;  4H8I A;  1ZBM A;  2Y7I A;  4F18 A;  4F31 B;  3DP6 A;  1B3F A;  3VVF A;  1PBQ A;  1IEJ A;  5FTI A;  3RLF E;  3USD A;  4MBP A;  4R9F A;  3B6Q A;  1ZTY A;  3MJN A;  3TPA A;  4GXA A;  1CE2 A;  5DTB A;  1B7H A;  5FHM A;  4G68 B;  2HEU A;  3VE1 B;  2VD2 A;  3V5A A;  4E0X A;  4PFU A;  2XXY A;  2HXW A;  5ITP A;  4AB5 A;  2GHB A;  2XXP A;  2I49 A;  3HHG A;  3CG3 A;  1IXH A;  4Q0C A;  1MY2 A;  3FXU A;  3TTN A;  1URG A;  1NFT A;  3C4M A;  4GF8 A;  4PP0 A;  5DYH A;  5B70 A;  3RTW B;  1IQ7 A;  1RYO A;  3T96 B;  2F6G A;  4BDN A;  3MWB A;  5TPA B;  3RPW A;  1B9J A;  4FED A;  3QSL A;  4N13 A;  1FQF A;  4FJP A;  3HCQ A;  3FJG A;  3GBB A;  4KR5 A;  5BUU A;  1ZKB A;  4YKK A;  1BIY A;  3CIJ A;  3K02 A;  2DWA A;  2VD3 A;  3U8Q A;  4BDL A;  1MM6 A;  5I57 B;  2PT2 A;  5ICQ A;  2F7A A;  4ESW A;  3LC8 A;  5IAI A;  2DWH A;  4KFQ A;  1LAH E;  4F19 A;  4KYS A;  4ND9 A;  3N5L A;  4PE5 B;  1GV8 A;  3IOW A;  3D4C A;  3K6W A;  4F2O A;  1I69 A;  4NF6 B;  5I59 A;  3G3H A;  3FJM A;  1N3X A;  2OWS A;  3WAF A;  3O97 A;  2RC7 A;  1NNP A;  1DSN A;  4YKJ A;  3C36 A;  1NNK A;  4X1D A;  4EF1 A;  4ECF A;  1OLA A;  4OEU A;  4U1O A;  1QUL A;  3VV5 A;  4JDF A;  4QSE A;  4POW A;  1FTM A;  2H25 A;  2OWT A;  2I6E A;  3OO8 A;  4H6D A;  1NH7 A;  2M8C A;  1MQD A;  2Z8E A;  3U1O A;  1MXV A;  5TU0 A;  3R7X A;  3TTR A;  1SVX B;  1B0L A;  3KBR A;  1Z7M E;  1VFD A;  3FD3 A;  2A5S A;  2V3Q A;  1LST A;  3MC2 A;  3TDJ A;  3OOA A;  5H8Q B;  5KDT A;  2YPN A;  4HS7 A;  4OZ9 A;  4QSC A;  2R9J A;  4Z7E A;  1MXY A;  1N7W A;  2Q8J A;  2HAV A;  4IO4 A;  4RPN A;  1Y3P A;  1SW4 A;  5EHM A;  2UYF A;  1AMF A;  4F39 A;  4X9T A;  2F7C A;  5CMM A;  1JEU A;  3T9X B;  3FVK A;  2DXR A;  1GR2 A;  1Y3N A;  3PGF A;  2F8D A;  3KOS A;  3IAZ A;  1F9B A;  5L9O A;  3OO9 A;  1O7T A;  1FCK A;  3MUQ A;  2H5Y A;  1MQI A;  1WVJ A;  4DZ1 A;  4G8N A;  1Y20 A;  4TOZ A;  4R72 A;  3U92 A;  3IJO B;  2NXO A;  1LBB A;  1H45 A;  4EXK A;  4NF4 B;  1SYI A;  5TP9 A;  3SEW A;  3TOD A;  1ANF A;  2NVU B;  2XXI A;  3G3I A;  3T9H B;  1ELJ A;  2QSX A;  2XD2 A;  5KCJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...