1IQ7A

Ovotransferrin, c-terminal lobe, apo form
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
343
structure length
341
Chain Sequence
RIQWCAVGKDEKSKCDRWSVVSNGDVECTVVDETKDCIIKIMKGEADAVALDGGLVYTAGVCGLVPVMAERYDDESCSKDERPASYFAVAVARKDSNVNWNNLKGKKSCHTAVGRTAGWVIPMGLIHNRTGTCNFDEYFSEGCAPGSPPNSRLCQLCQGSGGIPPEKCVASSHEKYFGYTGALRCLVEKGDVAFIQHSTVEENTGGKNKADWAKNLQMDDFELLCTDGRRANVMDYRECNLAEVPTHAVVVRPEKANKIRDLLERQEKRFGVNGSEKSKFMMFESQNKDLLFKDLTKCLFKVREGTTYKEFLGDKFYTVISSLKTCNPSDILQMCSFLEGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ovotransferrin
publication title Anion-mediated Fe3+ release mechanism in ovotransferrin C-lobe: a structurally identified SO4(2-) binding site and its implications for the kinetic pathway.
pubmed doi rcsb
molecule tags Metal transport
total genus 102
structure length 341
sequence length 343
ec nomenclature
pdb deposition date 2001-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00405 Transferrin Transferrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1iq7A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1iq7A02
2HQ0A 4U22A 4DXBA 4EF1A 4JSDA 4G4PA 3O29A 1P1QA 4TLMB 3IO4A 2CZLA 3K1NA 3TFLA 4PFWA 4LA9A 1MXZA 4GL0A 4F22A 3MQ9A 3KSXA 1URDA 2KLFA 3LSWA 3VVDA 1VFDA 1OVBA 3CR9A 3GBAA 3M3LA 3MZBA 3EF7A 1SW1A 1II5A 4G8MA 1IXCA 5H8QB 3C31A 5I58B 3A3UA 4JWOA 4GL8A 2DOJA 3GLBA 5AA4A 4THIA 2QMWA 3BBRA 1YCJA 3ZKKA 2XHDA 4LQ2A 2F7AA 1L5TA 3LBSA 3SETA 4Z7EA 1UQWA 2F36A 4NF6B 1QKAA 4Q5TA 2XD2A 1B3EA 3C4MA 4HTGA 2A5TB 3KZGA 2REGA 1BLFA 3N94A 3UIFA 4DXUA 4Z0IA 1FQEA 3HHGA 4ND9A 5CMMA 3RT6B 4KCDA 1P1NA 1DOTA 1DPEA 4R6YA 1B32A 1BKAA 3IOUA 4GVOA 3K4UA 1XC1A 1US5A 4QHQA 4X1BA 2H9BA 3HSTA 4OESA 3KN7A 3TTMA 3T9XB 3QSLA 4GFRA 1FTOA 4O3CA 1N0TA 4TOZA 3T22A 1FCKA 2DWHA 3CG1A 1USYH 2QL3A 1MQDA 4E0WA 4OENA 3I5OA 1B2HA 3FZVA 4MFIA 3FV2A 1AOVA 5AA2A 1I6AA 1S9TA 2I4BA 3TTKA 1P99A 4QFNA 4XKNA 4OERA 3VXBA 1IXIA 4BDNA 3CRBA 3ZKLA 4WXJA 2THIA 4IY5A 2B65A 5LOMA 1GVCA 1P1UA 4OFLA 1B0HA 5KDTB 1POTA 2FNCA 2H99A 5H8SA 3Q26A 2PVUA 1MQJA 4YB5A 3UA8A 1H3DA 4RPOA 4P0IA 4KYDA 3MVZA 1OQGA 3RTWB 2V84A 2XX9A 4GLIA 1A40A 3VE1B 1TFAA 3T93B 1VR5A 1MDQA 3RQTA 4IO6A 5DTBA 3EHTA 3L6GA 2B3FA 3L6HA 4FATA 2QRYA 3G7WA 2GH9A 2RC9A 5FHMA 5ITOA 1VFEA 1LLSA 4HCWA 3K1MA 5I2NA 3FJMA 4OXVA 1H45A 2ZXTA 2VP1A 1QULA 3DM0A 4NMYA 2P1SA 1N84A 3K6UA 3H3GA 3QIMA 3VLUA 4YB7A 4RA1A 3PUVE 2RCBA 2VD3A 3HHFA 1JNFA 4RYAA 3IOVA 3TUSA 2ZYNA 3QUFA 1ZMGA 3G3JA 1MS7A 4AB5A 4YZZA 1B4HA 2QS4A 3VLWA 4ESXA 3H6WA 4KHZE 3PU5A 2BJJX 5JTYB 1NNTA 4OZ9A 2P0SA 2AYSA 5I58A 5TPAB 1B52A 1IXGA 2RCAA 3D4GA 3N6TA 4EXKA 1Y1ZA 2F7BA 5HM4B 1M5DA 1JEUA 4LUBA 1JVYA 4ZS9A 4IO4A 3T9VA 1SW2A 1LSTA 1SQYA 3FVOA 5I56B 1O64A 4XIGQ 2YJPA 1XVYA 3I6VA 4NF5A 4H67A 4G8HA 5F1QA 2Q8JA 3M3KA 4ZZEA 4XXUA 2X7PA 2ZNSA 3TKDA 1PB7A 3RGYA 1A99A 1LAHE 3PMWA 4XTCQ 2H4IA 4H65A 5DVFA 2XXIA 5AA4B 3OO9A 4YB6A 3O2AA 4WEPA 4X1DA 1FQDA 1R1NA 1Z7ME 2F97A 1SI1A 3KN3A 3K2DA 2O51A 3KN8A 1EZ9A 2IEEA 4U2RA 2REJA 1B46A 3O6IA 2X7QA 3ECRA 1NKXA 2O1MA 3MZ9A 3MC2A 3IR1A 3HN0A 2AL5A 4QF9A 1UTBA 4RXLA 2QSXA 2Q2CA 5AE4A 5CC2A 5KDTA 3EQ1A 1Y3QA 1B7HA 1MRPA 4I62A 5DVIA 2D21A 2HEUA 3KOSA 4LATA 2G93A 2DE4A 2F78A 3FD3A 3RY3A 1LCTA 3IX1A 2Q2AA 1Y4TA 1HSJA 1NH7A 2IA4A 3B6QA 3GBBA 2Q9TA 4ELQA 3PGFA 3PUZE 3VV5A 1M5CA 3IL1B 1FQAA 1H76A 4P11A 4AB6A 2VD2A 3R7XA 1B7ZA 2OWSA 2ZNUA 1PEBA 1B51A 3PMVA 3EHUA 3DELB 4H1XA 5KZTA 1MXUA 1MM6A 4ESWA 5EHMA 4RJZA 4GXSB 1XVXA 4N07A 4KCCA 3MBPA 1RKMA 2UVJA 1M5FA 3T66A 4GOTA 5CBRA 5FTHA 1N76A 5CMCA 3SESA 3OEMA 4IO3A 3B6TA 1NNPA 2PMSA 4OETA 4TLLB 5K2XA 3TZAA 4C1UA 3LSXA 1Y9UA 3B6WA 4XKPA 4C1TA 1MXWA 1PB8A 3WAEA 1EU8A 4YKPA 4U1ZA 2Z8EA 1B3FA 5I2NB 4LP2B 4EQ7A 2ZYKA 1AL3A 4F18A 1FQBA 2I48A 1ATGA 4JSOA 4JWYA 2ABHA 2XXVA 3K00A 3N26A 1CE2A 2GRVA 1LFGA 4MLVA 2OBGA 1MY1A 1B7UA 4QFLA 3LSLA 5TP9B 3K6XA 3JV9A 4N6PA 4YKJA 4NF8B 1PDAA 3SKPA 4H0WA 3SEYA 5I56A 2O69A 3O6HA 3G3IA 3E9XA 3VLVA 4UA8A 1LB9A 3ONMA 2OK2A 4BDLA 3W15C 3G3GA 2ANJA 4DE8A 2FA7A 1O63A 4PETA 1SW4A 4BDMA 4XKQA 3MZ1A 1H44A 3PPPA 2O7IA 2F7CA 4LONB 2ONRA 1MPDA 3SERA 1FQCA 4O3AA 3RNNA 4HS7A 1LBBA 3K02A 1LFIA 3S9EA 2QPQA 2ZMBA 1BP5A 1Y3NA 3TCGA 3S9NC 3PUXE 1NMUA 4NF5B 3QXMA 3RUMA 4F29A 4F31B 2DQVA 4BLAA 1R9QA 2R9JA 4KYSA 4OEUA 1SBPA 5K2YA 1JW5A 4R9GA 2R71A 4KI0E 4F3PA 3QYTA 4ZEBA 3EHSA 4Q8RA 1AH5A 4LVQA 2F35A 3TELA 4R6HA 3TTNA 5I57A 3R26A 3HPIA 4DCXA 4GXAA 3ODBA 4RK9A 3RTFB 4DLDA 3U72A 3HV1A 4FIMA 4F2OA 3W9VA 3O97A 5CBSA 3GZGA 3DP8A 4QSEA 1UTBB 2D3IA 1D9YA 4U23A 4HW8A 3CSGA 1GV8A 1EZPA 5ITPA 5EYFA 2H25A 3E4RA 1FQFA 3HO7A 3H4ZA 1MY0A 3TDJA 1AIVA 1H43A 4ZZAA 4ZEDA 3OENA 3CFXA 4GF8A 2RINA 1OIBA 1IXHA 4JWXA 2CMOA 4YAHX 4TQUQ 5ISUA 5DT6A 5DEXB 3C34A 4I1DA 4OWDA 3UP9A 2HZLA 4Q0CA 1MPCA 5DVJA 2F6GA 4BDOA 4NEDA 3PMXA 4JDFA 4KR5A 4ECFA 2Z22A 3CFLA 4MH5A 3TQWA 3USDA 3LSFB 3PPOA 4KFQA 4GRKA 2HFBA 3THIA 3PPQA 4R72A 1SDXA 4PFYA 2OZZA 2VOZA 1OVTA 3MPLA 3OOAA 4FE8A 3FUZA 5HPQA 1B5HA 4HCYA 1M5BA 5H8FA 3OSQA 5TP9A 2Z8DA 4OMBA 1B58A 3FV1A 1GGGA 4F3GA 4NWDA 1MQIA 2Y7PA 1MXYA 3KOTA 4NF8A 1D9VA 2UXAA 3DP4A 1ZLQA 3N5LA 3Q27A 4F39A 3PV0E 1F9BA 1TXFA 1NFTA 2P2AA 2OLBA 1DSNA 2AL4A 2PT1A 4YMBA 1MY4A 1B4ZA 1JVXA 4H8JA 1POY1 1AMFA 1LB8A 4G68C 4NWCA 2QS3A 3K6WA 1LBCA 1WVJA 1QVSA 2Z23A 1NNFA 1MDP1 4QRZA 2Y7WA 4KQPA 2UYEA 3MUQA 3CSBA 4ISUA 4U4XA 3TEPA 3TCHA 4LZ7A 2DXYA 5L8DA 3FXRA 3MP1A 2NVUB 2UVGA 4YICA 2XXWA 1DPPA 1RYOA 3SEVA 5I84A 2DYXA 3KBRA 2M8CA 3K1PA 3V83A 1PC3A 5CI5A 1JW4A 4F3SA 3VXCA 1B3GA 5L9OA 1I69A 2QS2A 3IO6A 1LGBC 3BFTA 3S9LC 1A8FA 1IEJA 2NXOA 2ZNTA 3V5AA 3CI8A 2XXXA 4KYEA 1XOCA 2XXRA 3UN6A 3IOTA 5TU0A 4K3FA 1KWHA 4GIZA 2RC7A 2O84X 1IITA 2YLNA 3IJXB 3SDFA 2DWJA 1JW1A 3S4UA 2Z8FA 3JZJA 3VVEA 2E1SA 3FVKA 3FASA 4R75A 4BDRA 2F5XA 4QFOA 2Y7KA 3C33A 1FTLA 2LAOA 4POXA 3MVWA 4MBPA 4N13A 3PPRA 1NL5A 2Y7RA 4OFJA 3OEKA 3JYRA 3KGCA 2Y7IA 1S50A 3QK6A 2V3QA 5CRYA 3G3HA 3MPKA 3U92A 2F8DA 2XXUA 1MXXA 5I57B 5BWJA 3C35A 2PBWA 4DZ1A 5I2KB 2O68A 2PX1A 2A5SA 3OD7A 5DEXA 2VGQA 1SYHA 3R6UA 3SEXA 1B6HA 1FTMA 5JK4A 1US4A 1TT1A 1QW0A 4NF4A 1MY2A 2UYFA 1B3LA 3ZS6A 3U1OA 1ZBMA 1Y1MA 3F11A 4G2ZA 3C36A 3OELA 2RC8A 1N3XA 1TWYA 5AA1A 4ZE8A 1N7XA 3SEUA 1I6QA 1JEVA 3D4CA 3UGWA 3H03A 3T9HB 4E0XA 1NNKA 1Y3PA 4QSCA 2DE2A 4LZ8A 2I3WA 5IKBA 2F6PA 3ILUB 1YAEA 1I6BA 1WODA 4R2FA 3Q29A 3T96B 2I49A 1LAFE 3HCQA 5I59A 4KPTA 3FIRA 2PYYA 3CG3A 1LFHA 5ICTA 2Y84A 1JETA 4PE5B 1MH3A 1BIYA 2V93A 5H8FB 2GHAA 2YPNA 2XXQA 1XHYA 4OFOA 3FXQA 4YMAA 3A3CA 2DVCA 4X9TA 4EQBA 4PFUA 4ONYA 1D3KA 1ELJA 2NWJA 2X26A 2FYIA 5KCJB 1MY3A 2HAVA 1O7TA 5AA3A 4RPNA 3PD8A 2OCUA 2XD3A 1XS5A 3ILTB 4R6KA 2H5YA 4G77A 3UK4A 3FGSA 1PB9A 3PD9A 4IO2A 3IOWA 1MG1A 3MP8A 5H8HB 5ELVA 3SEWA 1B3HA 2HAUA 2O6AA 3CIJA 3M3FA 1J1NA 5JEIA 3TTRA 4QSDA 3ZSFA 2V3UA 4R9FA 4OVJA 5L9MA 4H5FA 4ELRA 3MP6A 4YKKA 2XXYA 2ONKE 4BDQA 1P1OA 3QAXA 2I58A 3K0VA 1USYE 2I6EA 1JQFA 2I0CA 3WAFA 1WDNA 1SD3A 3TQLA 3N6UA 1R6ZA 4G68A 1SW5A 3C32A 4AQ4A 3OO6A 1T0KA 4ZEKA 3H6TA 3O6GA 3O9PA 3G3FA 1B5IA 1B1XA 3PUWE 1ANFA 3Q25A 1A55A 2UVIA 3IB1A 4IGTA 4DIGA 4NTLA 1TFDA 1S7YA 1B5JA 4IY6A 5I2KA 3G3KA 2E0SA 4IO5A 4OEVA 4FORA 1CB6A 3TYHA 3IAZA 2I3VA 2DSFA 1QUJA 1Q35A 3PUYE 4LQ5A 2GFEA 1B05A 1PBQA 4C0RA 3BFUA 5FTIA 3EN3A 4R2BA 5FHOA 2RKMA 2HZKA 5CM6A 1IIWA 4OHNA 4XKRA 3KFMA 3DLNA 2H98A 2WKYA 3IORA 4RK2A 1M5EA 1NH8A 1B1HA 1IZ1A 4ELPA 3CFZA 1B0LA 4F3BA 2W7YA 2G29A 4WKMA 2F34A 4F19A 5B7DA 4UACA 3MW0A 3MAMA 3TAJA 4JB7A 1SI0A 1QKBA 2ZYMA 3TTLA 1UTHA 4NF4B 3FVNA 4F2QA 5A5XA 4H6DA 3TMGA 4WEDA 2R6GE 4LZ5A 4DXCA 5H8NA 4MLQA 2V25A 5F7VA 3OO8A 3P7IA 3KSJA 1OMPA 1VE4A 1LAGE 4DCYA 2RF1A 2DXRA 3VDFA 3GXAA 4ZEFA 4FEDA 1ZTYA 2I4CA 4QFKA 1SVXB 4YKIA 3RN8A 3VVFA 2DWAA 3V8XB 3EPEA 4RY1A 2XXHA 5IAIA 5M2VA 5KCJA 5J1DA 2I0BA 3S9MC 1MQGA 1YTVA 1Y4CA 5CMBA 3U93A 4FJPA 5I59B 3K01A 5B70A 1HSEA 1DTZA 3TPAA 4GD5A 1Z7NE 3QUJA 1EZOA 5ICQA 1OQHA 4R74A 1VSOA 2XX8A 2NOOA 4OTEA 1N3WA 5H8HA 1QUKA 3E13X 5H8QA 1N7WA 3U94A 3Q28A 1D4NA 3FXUA 1IQ7A 4U4SA 3MVXA 1BTJA 4O3BA 1YPNA 5L9SA 2B3BA 3KJ7A 3FJGA 1UIVA 1URGA 4PQJA 4PFTA 3U8QA 3V89B 3RLFE 4NF6A 4JBZA 4IB2A 2OWTA 2DWIA 3S2VA 4X48A 1FTJA 1FW0A 4M4GA 3T9UA 2OJTA 2A5TA 1GR2A 3W9WA 2HXWA 3H6VA 1DTGA 2VHAA 4L17A 1MM7A 3O28A 2ESNA 3H7MA 5DYHA 1MPBA 3LC8A 2UVHA 2AIXA 2XXPA 4EUOA 3KEIA 4EQ9A 1GTKA 3DP6A 2D5WA 4ELOA 3RT8A 1B40A 3OSRA 2DP8A 1URSA 4EF2A 5FHNA 1MQHA 1P1WA 1LCFA 5CMKA 4U21A 1OLCA 4F1YA 3AXFA 2DVZA 2O1LA 4ZEIA 4DDDA 1N04A 4GQOA 3H6UA 3FVGA 4QFPA 2QS1A 4G68B 1ZU0A 4RNSA 4EXLA 4FECA 3MJNA 1HSLA 3C9HA 3PPNA 2GHBA 3M8UA 1LAXA 4H5GA 4IO7A 2ALUA 5HBCA 2ONSA 4H8IA 4OYVA 4IGRA 1A7LA 4F1VA 2NUVA 1QJMA 3B7DA 4GWOA 1A54A 1QUIA 2O7UA 2Q88A 3FJ7A 1UIUA 3MWBA 4R73A 4POWA 1Y20A 2QJEA 3OO7A 3TCFA 3OXNA 5AA2B 2XX7A 3CVGA 1EH3A 4ZECA 3BKIB 1MXVA 3VFJA 2ZYOA 3A09A 4FAJA 1PBPA 4F1UA 3IK6B 4FEBA 2QMXA 2Q89A 3FATA 1A8EA 4G8NA 4Q30B 2V3TA 4EDPA 4JXIA 1ZJLA 2HCAA 4NE4A 3TODA 4MF3A 2DE3A 3O66A 3KJTA 5AA2D 1UTHB 1ZKBA 1ZIUA 3KG2A 5A5XB 3LUYA 5EHSA 1Q1KA 1IUDA 1OLAA 3I3VA 5H8NB 4YU0A 3MVYA 4I9DA 3K6VA 2XXTA 1DMBA 3IB2A 3OMBA 3LR1A 1B9JA 1MH4A 5BUUA 3IB0A 4U1OA 4OQOA 3H06B 4I8CA 1SYIA 5JTYA 4M1VA 4P0GA 3IJOB 5TPAA 1RYXA 1FTKA 3E3KA 4PP0A 2PT2A 4KD5A 4ZDMA 1XT8A 3RPWA 4ZE9A 1R9LA 3UORA 2DS9A
chains in the Genus database with same CATH superfamily
2HQ0A 4N81A 4U22A 4DXBA 4EF1A 4JVCA 4JSDA 4G4PA 4NGUA 3O29A 1P1QA 5A5LA 4TLMB 3IO4A 2CZLA 3K1NA 3ISPA 3TFLA 4PFWA 1FPJA 4LA9A 1FPBA 1MXZA 4GL0A 4F22A 3MQ9A 3KSXA 1URDA 2KLFA 3LSWA 3VVDA 1VFDA 1OVBA 4GX6A 3CR9A 3GBAA 3M3LA 3MZBA 3EF7A 1SW1A 1II5A 4G8MA 1IXCA 5H8QB 3C31A 5I58B 1IMCA 3A3UA 4JWOA 2Q8MA 4GL8A 2DOJA 3GLBA 5AA4A 2MKZA 4XEQA 4THIA 2QMWA 3BBRA 1YCJA 3ZKKA 2XHDA 4LQ2A 2F7AA 1L5TA 3LBSA 3SETA 4Z7EA 1UQWA 4O7IA 2F36A 4GX4A 4NF6B 1QKAA 4Q5TA 2XD2A 1B3EA 1DBZA 3C4MA 4HTGA 2A5TB 3KZGA 2REGA 1BLFA 3N94A 1EYIA 5I3SA 3UIFA 3QMFA 4DXUA 4Z0IA 4GWUA 1FQEA 2WX9A 3HHGA 4ND9A 5CMMA 2PFZA 4KCDA 3RT6B 1P1NA 1DOTA 1DPEA 4R6YA 1B32A 1BKAA 1NI9A 3IOUA 1NV1A 4GVOA 3K4UA 2QFLA 4QBAA 1XC1A 1RDXA 1US5A 4QHQA 4X1BA 2H9BA 3A29A 3HSTA 4OESA 3KN7A 3TTMA 3T9XB 3QSLA 4GFRA 1FTOA 1JP4A 4O3CA 1N0TA 4P56A 4TOZA 3T22A 1FCKA 2DWHA 3CG1A 1USYH 2QL3A 3LV0A 1MQDA 4E0WA 4OENA 3I5OA 1B2HA 3FZVA 4MFIA 3FV2A 1AOVA 5AA2A 1I6AA 1S9TA 2I4BA 3TTKA 1P99A 4QFNA 1SPIA 4XKNA 4OERA 3VXBA 1IXIA 4BDNA 3CRBA 3ZKLA 4UABA 4WXJA 4PAFA 2THIA 4IY5A 2B65A 4GWWA 5LOMA 1GVCA 4GWZA 1P1UA 4OFLA 1B0HA 5KDTB 1POTA 2FNCA 2H99A 5H8SA 3Q26A 1NV5A 2PVUA 1MQJA 1VDWA 4YB5A 2XWKA 1FJ6A 2Y5KA 3UA8A 3NOHA 1H3DA 4RPOA 4P0IA 4KYDA 3MVZA 1OQGA 3RTWB 2V84A 2XX9A 4GLIA 1A40A 3VE1B 1TFAA 3T93B 1VR5A 1MDQA 3RQTA 4IO6A 5DTBA 3EHTA 1FPEA 3L6GA 2B3FA 4NN3A 3L6HA 4FATA 2XWIA 2QRYA 3G7WA 4P9KA 2GH9A 4GWYA 2RC9A 5FHMA 4OVSA 5ITOA 4N17A 1VFEA 1LLSA 4HCWA 3K1MA 5I2NA 3FJMA 4OXVA 1H45A 4OANA 3KBZA 2ZXTA 2VP1A 1QULA 3DM0A 4NMYA 2P1SA 1N84A 3K6UA 3H3GA 1K9YA 3QIMA 2CZIA 3VLUA 4YB7A 4RA1A 3PUVE 2RCBA 2VD3A 3HHFA 1JNFA 4RYAA 3IOVA 3TUSA 2ZYNA 3QUFA 1NUZA 1ZMGA 3G3JA 5ESYA 1MS7A 4AB5A 4YZZA 3CHGA 1B4HA 2QVUA 2QS4A 3VLWA 4ESXA 3H6WA 4KHZE 3PU5A 2BJJX 3E78A 5JTYB 1NNTA 2OX3A 4OZ9A 2P0SA 2AYSA 5I58A 5TPAB 1B52A 1IXGA 2RCAA 3T0JA 3D4GA 2BJIA 3N6TA 4EXKA 1FSAA 4X04A 1Y1ZA 2F7BA 4MAGA 5HM4B 1M5DA 1NV7A 2QVVA 1JEUA 4LUBA 1JVYA 4ZS9A 4IO4A 3T9VA 1SW2A 2FBPA 1LSTA 2ZZXA 1SQYA 3FVOA 5I56B 1O64A 4XIGQ 2YJPA 3BIGA 1XVYA 3I6VA 4NF5A 1AWBA 4H67A 4G8HA 5F1QA 2Q8JA 3M3KA 4ZZEA 4XXUA 2X7PA 2ZNSA 3TKDA 5ET7A 1PB7A 3RGYA 1A99A 1LAHE 3PMWA 4XTCQ 1LBVA 2H4IA 4H65A 5DVFA 1NV3A 4H46A 2XXIA 2XA5A 5AA4B 3OO9A 4YB6A 3O2AA 4WEPA 4X1DA 1FQDA 1R1NA 1Z7ME 2F97A 1SI1A 3KN3A 3K2DA 1RDYA 2O51A 3KN8A 1EZ9A 2IEEA 4U2RA 4PF6A 2REJA 1B46A 3O6IA 2X7QA 3ECRA 1LBYA 1NKXA 2JJKA 2O1MA 4O8MA 3MZ9A 3MC2A 2VPOA 3IR1A 3IFCA 3HN0A 1Q9DA 2AL5A 4IR8A 2FIXA 4QF9A 1UTBA 4RXLA 2QSXA 2Q2CA 5AE4A 5CC2A 5KDTA 3EQ1A 1Y3QA 1B7HA 1MRPA 4I62A 5DVIA 2D21A 2HEUA 3KC1A 4G61A 3KOSA 4LATA 2G93A 2DE4A 2F78A 3FD3A 3RY3A 2WBBA 1FBGA 1LCTA 3IX1A 2Q2AA 1Y4TA 1HSJA 1NH7A 2IA4A 3B6QA 3GBBA 2Q9TA 4HE0A 4I3YA 4ELQA 3PGFA 3PUZE 3VV5A 1M5CA 3LUZA 3IL1B 1FQAA 1H76A 4P11A 1FBCA 4AB6A 1EYJA 2VD2A 3R7XA 5FBPA 1B7ZA 3IFAA 2OWSA 2ZNUA 1PEBA 1B51A 3PMVA 2WBDA 3EHUA 3DELB 4H1XA 5KZTA 1MXUA 1MM6A 4ESWA 5EHMA 4RJZA 4GXSB 1XVXA 5EQ7A 4N07A 4KCCA 3MBPA 1RKMA 2UVJA 1M5FA 3T66A 4GOTA 5CBRA 5FTHA 1N76A 5CMCA 3SESA 3OEMA 4IO3A 3B6TA 1NNPA 2PMSA 4OETA 4TLLB 5K2XA 3TZAA 4C1UA 3LSXA 1Y9UA 3B6WA 4XKPA 3BIHA 1MXWA 4C1TA 4PBHA 1PB8A 3WAEA 1EU8A 4YKPA 4U1ZA 2Z8EA 1B3FA 5I2NB 1NV6A 4LP2B 4EQ7A 2ZYKA 1AL3A 4F18A 1FQBA 2I48A 1ATGA 4JSOA 4JWYA 2ABHA 2XXVA 5T3JA 3K00A 3N26A 1CE2A 2GRVA 4PCDA 1LFGA 4MLVA 2OBGA 4MEVA 1MY1A 1B7UA 4QFLA 3LSLA 5TP9B 3K6XA 3JV9A 4N6PA 4YKJA 1FPFA 4NF8B 1PDAA 3SKPA 4H0WA 3SEYA 5I56A 2O69A 3O6HA 3G3IA 3E9XA 3VLVA 4UA8A 4HE2A 1LB9A 3ONMA 2OK2A 4BDLA 2FVZA 3W15C 3G3GA 5F24A 2KR0A 2ANJA 4DE8A 2FA7A 5ET5A 1O63A 4PETA 1SW4A 4BDMA 4PAIA 2FHYA 2FIEA 4XKQA 3MZ1A 1H44A 3PPPA 2O7IA 2F7CA 4LONB 2ONRA 1MPDA 3SERA 1FQCA 4HXVA 4O3AA 3RNNA 4HS7A 1LBBA 2XWOA 3K02A 1LFIA 3S9EA 2QPQA 2ZMBA 1BP5A 1Y3NA 3TCGA 3S9NC 1NV2A 3PUXE 1NMUA 4NF5B 3QXMA 3RUMA 5DW8A 4F29A 4I3EA 4F31B 1G0IA 2DQVA 4BLAA 1R9QA 1IMDA 2R9JA 4KYSA 4OEUA 1SBPA 5K2YA 1KZ8A 3KC0A 1JW5A 4R9GA 2R71A 4KI0E 4F3PA 1XI6A 3QYTA 4ZEBA 3EHSA 4Q8RA 1AH5A 4LVQA 4QXDA 2F35A 1FRPA 3TELA 3U65A 4R6HA 4NAPA 3TTNA 5I57A 3R26A 3HPIA 4DCXA 4GXAA 3ODBA 4RK9A 1LBXA 3RTFB 4DLDA 3U72A 3HV1A 4FIMA 4F2OA 3W9VA 3O97A 5CBSA 3GZGA 3DP8A 4QSEA 4NG7A 1UTBB 2L5VA 2D3IA 1D9YA 4U23A 1LBZA 4HW8A 3CSGA 1GV8A 1EZPA 5ITPA 5EYFA 2H25A 3E4RA 1FQFA 3HO7A 3H4ZA 1MY0A 3TDJA 1AIVA 1H43A 4ZZAA 4ZEDA 3OENA 3CFXA 4GF8A 2RINA 1OIBA 1FPIA 1IXHA 4JWXA 2CMOA 4P8BA 4YAHX 4TQUQ 5ISUA 5DT6A 5DEXB 3C34A 4I1DA 4KXPA 4OWDA 3UP9A 2HZLA 4Q0CA 1MPCA 5DVJA 2F6GA 4BDOA 4NEDA 3PMXA 3B50A 4JDFA 4MX6A 4KR5A 4ECFA 2Z22A 3CFLA 4MH5A 3TQWA 3USDA 3LSFB 3PPOA 3SZPA 4KFQA 5EYHA 4GRKA 3RYDA 2HFBA 3THIA 1NUWA 3PPQA 4R72A 1SDXA 5EQ8A 4PFYA 2OZZA 2VOZA 1OVTA 3MPLA 5IZ3B 3MYUA 3OOAA 4FE8A 3FUZA 5HPQA 4OA4A 1B5HA 4HCYA 1M5BA 5H8FA 3OSQA 5TP9A 2Z8DA 4OMBA 1B58A 3FV1A 1GGGA 4F3GA 4NWDA 2CEXA 1MQIA 2Y7PA 1MXYA 1FBHA 3KOTA 4NF8A 1D9VA 2ZZWA 2UXAA 3DP4A 1ZLQA 3N5LA 3Q27A 4F39A 3PV0E 1NUYA 1F9BA 1TXFA 1G0HA 1NFTA 4PDHA 2P2AA 2OLBA 1DSNA 2AL4A 2PT1A 4YMBA 1MY4A 4P1LA 3B8BA 1B4ZA 1JVXA 4H8JA 1POY1 1AMFA 1LB8A 4G68C 4NWCA 1QGXA 1K9ZA 2QS3A 3K6WA 1LBCA 1WVJA 4XFEA 1QVSA 2Z23A 1NNFA 1MDP1 4QRZA 2Y7WA 4KQPA 2UYEA 3MUQA 3CSBA 4ISUA 4U4XA 4I40A 4MCOA 4PAKA 3TEPA 3TCHA 4LZ7A 2P3VA 5ET8A 2DXYA 5L8DA 3FXRA 3MP1A 1NV0A 2NVUB 2UVGA 4YICA 2XXWA 1DPPA 1RYOA 3SEVA 5I84A 2DYXA 2DDKA 3KBRA 2M8CA 3K1PA 3V83A 1PC3A 5CI5A 1JW4A 4F3SA 3VXCA 1B3GA 5L9OA 1I69A 2QS2A 3IO6A 1LGBC 3EKIA 3BFTA 3S9LC 1A8FA 1IEJA 2NXOA 2ZNTA 3V5AA 2XXKA 3CI8A 2XXXA 4KYEA 1XOCA 2XXRA 3UN6A 3IOTA 5TU0A 4K3FA 1KWHA 4HE1A 4GIZA 2RC7A 2O84X 1IITA 2YLNA 3IJXB 3SDFA 2DWJA 4OVPA 1JW1A 3S4UA 2Z8FA 5IGAA 1FBFA 3JZJA 3VVEA 2ZZVA 2E1SA 3FVKA 3FASA 4R75A 4N15A 4BDRA 2F5XA 4QFOA 2Y7KA 3C33A 1FTLA 2LAOA 4POXA 3MVWA 4MBPA 4N13A 3PPRA 1NL5A 2Y7RA 4OFJA 3OEKA 3JYRA 3KGCA 2Y7IA 1S50A 3QK6A 2V3QA 5CRYA 3G3HA 3MPKA 3U92A 2F8DA 2XXUA 4N6DA 1MXXA 4P3LA 5I57B 5BWJA 3C35A 2PBWA 4DZ1A 5I2KB 2O68A 2PX1A 2A5SA 3OD7A 5DEXA 2VGQA 1KA1A 1FTAA 1SYHA 3R6UA 3SEXA 1B6HA 1FTMA 5I5PA 5JK4A 1US4A 4AS5A 1TT1A 1QW0A 2KQZA 4NF4A 1MY2A 2UYFA 1B3LA 2WYPA 3ZS6A 3U1OA 1ZBMA 3HFUA 1Y1MA 3F11A 4G2ZA 3C36A 3OELA 1INPA 2RC8A 1N3XA 1TWYA 2F3DA 5IZ3A 5AA1A 4ZE8A 1N7XA 4PF8A 3SEUA 1I6QA 1JEVA 3D4CA 3UGWA 3H03A 3T9HB 3E79A 1NUXA 4E0XA 1NNKA 1Y3PA 4QSCA 2DE2A 4O7MA 4LZ8A 2I3WA 4O94A 5IKBA 2F6PA 3ILUB 1YAEA 1FPKA 1I6BA 3FBPA 1WODA 4R2FA 3Q29A 1IMFA 3T96B 2I49A 1LAFE 3HCQA 5I59A 4KPTA 3FIRA 2PYYA 3CG3A 4FBPA 1LFHA 5ICTA 2Y84A 1JETA 1KA0A 4PE5B 1FPLA 1MH3A 1BIYA 2VT5A 2V93A 5H8FB 2GHAA 2YPNA 2XXQA 2F3BA 1XHYA 4OFOA 3FXQA 4YMAA 3A3CA 2DVCA 4DI4B 4X9TA 4EQBA 4PFUA 4ONYA 1D3KA 1ELJA 2NWJA 2X26A 2FYIA 5KCJB 1MY3A 2HAVA 1O7TA 4LN5A 5AA3A 4RPNA 3PD8A 2OCUA 2XD3A 1XS5A 3ILTB 4R6KA 1D9QA 2H5YA 4G77A 3UK4A 3FGSA 1PB9A 3PD9A 4IO2A 3IOWA 1MG1A 3MP8A 1IMEA 5H8HB 4MNIA 5ELVA 3SEWA 1B3HA 2HAUA 2O6AA 3CIJA 3M3FA 1J1NA 2HPGA 5JEIA 3TTRA 4QSDA 2VPNA 2WYKA 3RPLB 3ZSFA 2V3UA 5LDZA 4OVTA 4R9FA 4OVJA 5L9MA 4H5FA 4ELRA 3MP6A 4YKKA 3GYYA 2XXYA 2ONKE 4BDQA 1FJ9A 1P1OA 1IMAA 3QAXA 1DCUA 2I58A 3K0VA 1USYE 2I6EA 1JQFA 2I0CA 3ROJA 3WAFA 1WDNA 1SD3A 2HHMA 3TQLA 3N6UA 1R6ZA 4G68A 1SW5A 3C32A 4AQ4A 3OO6A 1T0KA 4ZEKA 5EYGA 3H6TA 3O6GA 3O9PA 3G3FA 1B5IA 1B1XA 3PUWE 1ANFA 1EYKA 3Q25A 1A55A 2UVIA 3IB1A 1YZ0A 4IGTA 4DIGA 4NTLA 2CEYA 1TFDA 1S7YA 1B5JA 4GWXA 4MNPA 4IY6A 5I2KA 5IM2A 3G3KA 2E0SA 4IO5A 4OEVA 4FORA 1CB6A 3TYHA 3IAZA 2I3VA 2DSFA 2OWZA 1QUJA 1Q35A 3PUYE 4MIJA 4LQ5A 2GFEA 2GQ1A 1B05A 1PBQA 3MSTA 4C0RA 4H45A 1RDZA 3BFUA 1FBPA 5FTIA 3EN3A 4R2BA 5FHOA 2RKMA 2HZKA 5CM6A 1IIWA 4OHNA 4XKRA 5EQ9A 3KFMA 3DLNA 4GWSA 4N8GA 2H98A 2WKYA 3IORA 4RK2A 1M5EA 2PFYA 1NH8A 1B1HA 1IZ1A 1CNQA 4ELPA 3CFZA 1B0LA 4F3BA 2W7YA 2G29A 4WKMA 2F34A 4F19A 5B7DA 2WEFA 3MW0A 4UACA 3MAMA 1FPGA 3TAJA 4JB7A 1SI0A 4OVRA 1QKBA 2ZYMA 3TTLA 1UTHA 4NQ8A 4NF4B 3FVNA 4F2QA 1NV4A 5A5XA 4H6DA 3TMGA 4WEDA 2R6GE 4LZ5A 4DXCA 5H8NA 4MLQA 2V25A 5F7VA 4JVIA 3OO8A 3P7IA 3KSJA 1OMPA 1VE4A 1LAGE 2Q74A 4DCYA 4JVDA 4MNCA 4P47A 2RF1A 2DXRA 3VDFA 2Y5LA 3GXAA 4GX3A 4ZEFA 4FEDA 1ZTYA 2I4CA 4QFKA 4PFRA 1SVXB 4YKIA 3RN8A 3VVFA 2DWAA 3V8XB 3EPEA 4PDDA 4PFIA 4RY1A 2XXHA 5IAIA 5M2VA 5KCJA 5J1DA 1YXIA 2I0BA 2PCRA 3S9MC 1MQGA 1YTVA 1Y4CA 4PFBA 4NHBA 5CMBA 3U93A 4FJPA 5I59B 3K01A 5B70A 1HSEA 1IMBA 1DTZA 3TPAA 4GD5A 1Z7NE 3QUJA 1EZOA 5ICQA 1OQHA 4R74A 1VSOA 2XX8A 4PC9A 2NOOA 4OTEA 1N3WA 5H8HA 1QUKA 3E13X 5H8QA 1N7WA 3U94A 3Q28A 1D4NA 3FXUA 1IQ7A 4U4SA 3MVXA 1BTJA 4O3BA 1YPNA 3RPLA 2B3BA 5L9SA 5IZ1A 3KJ7A 3FJGA 1UIVA 1URGA 4PQJA 4AS4A 4PFTA 3U8QA 3V89B 3RLFE 2B4MA 4NF6A 4JBZA 4IB2A 2OWTA 2DWIA 3S2VA 4X48A 1FTJA 1FW0A 4M4GA 2CZKA 3T9UA 2OJTA 2A5TA 1GR2A 3W9WA 2HXWA 3H6VA 1DTGA 4NF0A 2VHAA 4L17A 1MM7A 4MJOA 3O28A 2ESNA 4NX1A 4MHFA 3H7MA 4GBVA 4MMPA 5DYHA 1MPBA 3LC8A 2UVHA 2AIXA 1DK4A 2XXPA 4EUOA 3KEIA 4EQ9A 4PBQA 1GTKA 3DP6A 2D5WA 1B40A 3RT8A 4ELOA 3OSRA 2DP8A 1URSA 4EF2A 5FHNA 1MQHA 4P1EA 1P1WA 1LCFA 5CMKA 1FBEA 4PGNA 4U21A 1OLCA 4F1YA 3AXFA 4X8RA 4N4UA 5EQAA 2DVZA 2O1LA 4ZEIA 4DDDA 1N04A 4GQOA 3H6UA 2XWVA 3FVGA 4QFPA 2QS1A 4G68B 4RNSA 1ZU0A 4EXLA 4FECA 3MJNA 1LBWA 4GBWA 3PTYA 1HSLA 3C9HA 5I7IA 1YYZA 3PPNA 2GHBA 3M8UA 1LAXA 4H5GA 4IO7A 2ALUA 5HBCA 2ONSA 4H8IA 4OYVA 4IGRA 1A7LA 4F1VA 2NUVA 1QJMA 3B7DA 1BK4A 5J16A 4N8YA 4GWOA 1A54A 2HXRA 1QUIA 2O7UA 2Q88A 3FJ7A 1UIUA 3MWBA 4R73A 4POWA 1Y20A 4N91A 2QJEA 3OO7A 3TCFA 3OXNA 5AA2B 1LEVA 2XX7A 3CVGA 1EH3A 4ZECA 3BKIB 1MXVA 1FPDA 2QVRA 3VFJA 5IZZA 2ZYOA 3A09A 4FAJA 1PBPA 4F1UA 3IK6B 4PGPA 4PE3A 4FEBA 2QMXA 2Q89A 3FATA 1A8EA 3FXBA 4G8NA 4Q30B 2V3TA 4EDPA 2R8TA 4JXIA 2P3NA 1ZJLA 2HCAA 1FBDA 4NE4A 3TODA 4MF3A 2DE3A 3O66A 3KJTA 5AA2D 2B4LA 1UTHB 5LTCA 1ZKBA 4N6KA 1ZIUA 3KG2A 5A5XB 3LUYA 5EHSA 1Q1KA 1IUDA 3T1BA 1OLAA 3I3VA 5H8NB 3MVYA 4I9DA 4YU0A 3K6VA 2XXTA 2CZHA 1DMBA 3D1RA 3IB2A 3OMBA 3LR1A 1B9JA 4DI3D 1MH4A 5BUUA 3IB0A 4U1OA 4OQOA 3H06B 4I8CA 2V4CA 1SYIA 5JTYA 4M1VA 4P0GA 3IJOB 5TPAA 1RYXA 1FTKA 3E3KA 4OVQA 4PP0A 2PT2A 4PTKA 4KD5A 4ZDMA 1XT8A 3RPWA 4ZE9A 1R9LA 3UORA 2DS9A 4XF5A 5ET6A
chains in the Genus database with same CATH topology
2HQ0A 4U22A 4DXBA 4EF1A 4JSDA 4G4PA 3O29A 1P1QA 4TLMB 3IO4A 2CZLA 3K1NA 3TFLA 4PFWA 4LA9A 1MXZA 4GL0A 4F22A 3MQ9A 3KSXA 1URDA 2KLFA 3LSWA 3VVDA 1VFDA 1OVBA 3CR9A 3GBAA 3M3LA 3MZBA 3EF7A 1SW1A 1II5A 4G8MA 1IXCA 5H8QB 3C31A 5I58B 3A3UA 4JWOA 4GL8A 2DOJA 3GLBA 5AA4A 4THIA 2QMWA 3BBRA 1YCJA 3ZKKA 2XHDA 4LQ2A 2F7AA 1L5TA 3LBSA 3SETA 4Z7EA 1UQWA 2F36A 4NF6B 1QKAA 4Q5TA 2XD2A 1B3EA 3C4MA 4HTGA 2A5TB 3KZGA 2REGA 1BLFA 3N94A 3UIFA 4DXUA 4Z0IA 1FQEA 3HHGA 4ND9A 5CMMA 3RT6B 4KCDA 1P1NA 1DOTA 1DPEA 4R6YA 1B32A 1BKAA 3IOUA 4GVOA 3K4UA 1XC1A 1US5A 4QHQA 4X1BA 2H9BA 3HSTA 4OESA 3KN7A 3TTMA 3T9XB 3QSLA 4GFRA 1FTOA 4O3CA 1N0TA 4TOZA 3T22A 1FCKA 2DWHA 3CG1A 1USYH 2QL3A 1MQDA 4E0WA 4OENA 3I5OA 1B2HA 3FZVA 4MFIA 3FV2A 1AOVA 5AA2A 1I6AA 1S9TA 2I4BA 3TTKA 1P99A 4QFNA 4XKNA 4OERA 3VXBA 1IXIA 4BDNA 3CRBA 3ZKLA 4WXJA 2THIA 4IY5A 2B65A 5LOMA 1GVCA 1P1UA 4OFLA 1B0HA 5KDTB 1POTA 2FNCA 2H99A 5H8SA 3Q26A 2PVUA 1MQJA 4YB5A 3UA8A 1H3DA 4RPOA 4P0IA 4KYDA 3MVZA 1OQGA 3RTWB 2V84A 2XX9A 4GLIA 1A40A 3VE1B 1TFAA 3T93B 1VR5A 1MDQA 3RQTA 4IO6A 5DTBA 3EHTA 3L6GA 2B3FA 3L6HA 4FATA 2QRYA 3G7WA 2GH9A 2RC9A 5FHMA 5ITOA 1VFEA 1LLSA 4HCWA 3K1MA 5I2NA 3FJMA 4OXVA 1H45A 2ZXTA 2VP1A 1QULA 3DM0A 4NMYA 2P1SA 1N84A 3K6UA 3H3GA 3QIMA 3VLUA 4YB7A 4RA1A 3PUVE 2RCBA 2VD3A 3HHFA 1JNFA 4RYAA 3IOVA 3TUSA 2ZYNA 3QUFA 1ZMGA 3G3JA 1MS7A 4AB5A 4YZZA 1B4HA 2QS4A 3VLWA 4ESXA 3H6WA 4KHZE 3PU5A 2BJJX 5JTYB 1NNTA 4OZ9A 2P0SA 2AYSA 5I58A 5TPAB 1B52A 1IXGA 2RCAA 3D4GA 3N6TA 4EXKA 1Y1ZA 2F7BA 5HM4B 1M5DA 1JEUA 4LUBA 1JVYA 4ZS9A 4IO4A 3T9VA 1SW2A 1LSTA 1SQYA 3FVOA 5I56B 1O64A 4XIGQ 2YJPA 1XVYA 3I6VA 4NF5A 4H67A 4G8HA 5F1QA 2Q8JA 3M3KA 4ZZEA 4XXUA 2X7PA 2ZNSA 3TKDA 1PB7A 3RGYA 1A99A 1LAHE 3PMWA 4XTCQ 2H4IA 4H65A 5DVFA 2XXIA 5AA4B 3OO9A 4YB6A 3O2AA 4WEPA 4X1DA 1FQDA 1R1NA 1Z7ME 2F97A 1SI1A 3KN3A 3K2DA 2O51A 3KN8A 1EZ9A 2IEEA 4U2RA 2REJA 1B46A 3O6IA 2X7QA 3ECRA 1NKXA 2O1MA 3MZ9A 3MC2A 3IR1A 3HN0A 2AL5A 4QF9A 1UTBA 4RXLA 2QSXA 2Q2CA 5AE4A 5CC2A 5KDTA 3EQ1A 1Y3QA 1B7HA 1MRPA 4I62A 5DVIA 2D21A 2HEUA 3KOSA 4LATA 2G93A 2DE4A 2F78A 3FD3A 3RY3A 1LCTA 3IX1A 2Q2AA 1Y4TA 1HSJA 1NH7A 2IA4A 3B6QA 3GBBA 2Q9TA 4ELQA 3PGFA 3PUZE 3VV5A 1M5CA 3IL1B 1FQAA 1H76A 4P11A 4AB6A 2VD2A 3R7XA 1B7ZA 2OWSA 2ZNUA 1PEBA 1B51A 3PMVA 3EHUA 3DELB 4H1XA 5KZTA 1MXUA 1MM6A 4ESWA 5EHMA 4RJZA 4GXSB 1XVXA 4N07A 4KCCA 3MBPA 1RKMA 2UVJA 1M5FA 3T66A 4GOTA 5CBRA 5FTHA 1N76A 5CMCA 3SESA 3OEMA 4IO3A 3B6TA 1NNPA 2PMSA 4OETA 4TLLB 5K2XA 3TZAA 4C1UA 3LSXA 1Y9UA 3B6WA 4XKPA 4C1TA 1MXWA 1PB8A 3WAEA 1EU8A 4YKPA 4U1ZA 2Z8EA 1B3FA 5I2NB 4LP2B 4EQ7A 2ZYKA 1AL3A 4F18A 1FQBA 2I48A 1ATGA 4JSOA 4JWYA 2ABHA 2XXVA 3K00A 3N26A 1CE2A 2GRVA 1LFGA 4MLVA 2OBGA 1MY1A 1B7UA 4QFLA 3LSLA 5TP9B 3K6XA 3JV9A 4N6PA 4YKJA 4NF8B 1PDAA 3SKPA 4H0WA 3SEYA 5I56A 2O69A 3O6HA 3G3IA 3E9XA 3VLVA 4UA8A 1LB9A 3ONMA 2OK2A 4BDLA 3W15C 3G3GA 2ANJA 4DE8A 2FA7A 1O63A 4PETA 1SW4A 4BDMA 4XKQA 3MZ1A 1H44A 3PPPA 2O7IA 2F7CA 4LONB 2ONRA 1MPDA 3SERA 1FQCA 4O3AA 3RNNA 4HS7A 1LBBA 3K02A 1LFIA 3S9EA 2QPQA 2ZMBA 1BP5A 1Y3NA 3TCGA 3S9NC 3PUXE 1NMUA 4NF5B 3QXMA 3RUMA 4F29A 4F31B 2DQVA 4BLAA 1R9QA 2R9JA 4KYSA 4OEUA 1SBPA 5K2YA 1JW5A 4R9GA 2R71A 4KI0E 4F3PA 3QYTA 4ZEBA 3EHSA 4Q8RA 1AH5A 4LVQA 2F35A 3TELA 4R6HA 3TTNA 5I57A 3R26A 3HPIA 4DCXA 4GXAA 3ODBA 4RK9A 3RTFB 4DLDA 3U72A 3HV1A 4FIMA 4F2OA 3W9VA 3O97A 5CBSA 3GZGA 3DP8A 4QSEA 1UTBB 2D3IA 1D9YA 4U23A 4HW8A 3CSGA 1GV8A 1EZPA 5ITPA 5EYFA 2H25A 3E4RA 1FQFA 3HO7A 3H4ZA 1MY0A 3TDJA 1AIVA 1H43A 4ZZAA 4ZEDA 3OENA 3CFXA 4GF8A 2RINA 1OIBA 1IXHA 4JWXA 2CMOA 4YAHX 4TQUQ 5ISUA 5DT6A 5DEXB 3C34A 4I1DA 4OWDA 3UP9A 2HZLA 4Q0CA 1MPCA 5DVJA 2F6GA 4BDOA 4NEDA 3PMXA 4JDFA 4KR5A 4ECFA 2Z22A 3CFLA 4MH5A 3TQWA 3USDA 3LSFB 3PPOA 4KFQA 4GRKA 2HFBA 3THIA 3PPQA 4R72A 1SDXA 4PFYA 2OZZA 2VOZA 1OVTA 3MPLA 3OOAA 4FE8A 3FUZA 5HPQA 1B5HA 4HCYA 1M5BA 5H8FA 3OSQA 5TP9A 2Z8DA 4OMBA 1B58A 3FV1A 1GGGA 4F3GA 4NWDA 1MQIA 2Y7PA 1MXYA 3KOTA 4NF8A 1D9VA 2UXAA 3DP4A 1ZLQA 3N5LA 3Q27A 4F39A 3PV0E 1F9BA 1TXFA 1NFTA 2P2AA 2OLBA 1DSNA 2AL4A 2PT1A 4YMBA 1MY4A 1B4ZA 1JVXA 4H8JA 1POY1 1AMFA 1LB8A 4G68C 4NWCA 2QS3A 3K6WA 1LBCA 1WVJA 1QVSA 2Z23A 1NNFA 1MDP1 4QRZA 2Y7WA 4KQPA 2UYEA 3MUQA 3CSBA 4ISUA 4U4XA 3TEPA 3TCHA 4LZ7A 2DXYA 5L8DA 3FXRA 3MP1A 2NVUB 2UVGA 4YICA 2XXWA 1DPPA 1RYOA 3SEVA 5I84A 2DYXA 3KBRA 2M8CA 3K1PA 3V83A 1PC3A 5CI5A 1JW4A 4F3SA 3VXCA 1B3GA 5L9OA 1I69A 2QS2A 3IO6A 1LGBC 3BFTA 3S9LC 1A8FA 1IEJA 2NXOA 2ZNTA 3V5AA 3CI8A 2XXXA 4KYEA 1XOCA 2XXRA 3UN6A 3IOTA 5TU0A 4K3FA 1KWHA 4GIZA 2RC7A 2O84X 1IITA 2YLNA 3IJXB 3SDFA 2DWJA 1JW1A 3S4UA 2Z8FA 3JZJA 3VVEA 2E1SA 3FVKA 3FASA 4R75A 4BDRA 2F5XA 4QFOA 2Y7KA 3C33A 1FTLA 2LAOA 4POXA 3MVWA 4MBPA 4N13A 3PPRA 1NL5A 2Y7RA 4OFJA 3OEKA 3JYRA 3KGCA 2Y7IA 1S50A 3QK6A 2V3QA 5CRYA 3G3HA 3MPKA 3U92A 2F8DA 2XXUA 1MXXA 5I57B 5BWJA 3C35A 2PBWA 4DZ1A 5I2KB 2O68A 2PX1A 2A5SA 3OD7A 5DEXA 2VGQA 1SYHA 3R6UA 3SEXA 1B6HA 1FTMA 5JK4A 1US4A 1TT1A 1QW0A 4NF4A 1MY2A 2UYFA 1B3LA 3ZS6A 3U1OA 1ZBMA 1Y1MA 3F11A 4G2ZA 3C36A 3OELA 2RC8A 1N3XA 1TWYA 5AA1A 4ZE8A 1N7XA 3SEUA 1I6QA 1JEVA 3D4CA 3UGWA 3H03A 3T9HB 4E0XA 1NNKA 1Y3PA 4QSCA 2DE2A 4LZ8A 2I3WA 5IKBA 2F6PA 3ILUB 1YAEA 1I6BA 1WODA 4R2FA 3Q29A 3T96B 2I49A 1LAFE 3HCQA 5I59A 4KPTA 3FIRA 2PYYA 3CG3A 1LFHA 5ICTA 2Y84A 1JETA 4PE5B 1MH3A 1BIYA 2V93A 5H8FB 2GHAA 2YPNA 2XXQA 1XHYA 4OFOA 3FXQA 4YMAA 3A3CA 2DVCA 4X9TA 4EQBA 4PFUA 4ONYA 1D3KA 1ELJA 2NWJA 2X26A 2FYIA 5KCJB 1MY3A 2HAVA 1O7TA 5AA3A 4RPNA 3PD8A 2OCUA 2XD3A 1XS5A 3ILTB 4R6KA 2H5YA 4G77A 3UK4A 3FGSA 1PB9A 3PD9A 4IO2A 3IOWA 1MG1A 3MP8A 5H8HB 5ELVA 3SEWA 1B3HA 2HAUA 2O6AA 3CIJA 3M3FA 1J1NA 5JEIA 3TTRA 4QSDA 3ZSFA 2V3UA 4R9FA 4OVJA 5L9MA 4H5FA 4ELRA 3MP6A 4YKKA 2XXYA 2ONKE 4BDQA 1P1OA 3QAXA 2I58A 3K0VA 1USYE 2I6EA 1JQFA 2I0CA 3WAFA 1WDNA 1SD3A 3TQLA 3N6UA 1R6ZA 4G68A 1SW5A 3C32A 4AQ4A 3OO6A 1T0KA 4ZEKA 3H6TA 3O6GA 3O9PA 3G3FA 1B5IA 1B1XA 3PUWE 1ANFA 3Q25A 1A55A 2UVIA 3IB1A 4IGTA 4DIGA 4NTLA 1TFDA 1S7YA 1B5JA 4IY6A 5I2KA 3G3KA 2E0SA 4IO5A 4OEVA 4FORA 1CB6A 3TYHA 3IAZA 2I3VA 2DSFA 1QUJA 1Q35A 3PUYE 4LQ5A 2GFEA 1B05A 1PBQA 4C0RA 3BFUA 5FTIA 3EN3A 4R2BA 5FHOA 2RKMA 2HZKA 5CM6A 1IIWA 4OHNA 4XKRA 3KFMA 3DLNA 2H98A 2WKYA 3IORA 4RK2A 1M5EA 1NH8A 1B1HA 1IZ1A 4ELPA 3CFZA 1B0LA 4F3BA 2W7YA 2G29A 4WKMA 2F34A 4F19A 5B7DA 4UACA 3MW0A 3MAMA 3TAJA 4JB7A 1SI0A 1QKBA 2ZYMA 3TTLA 1UTHA 4NF4B 3FVNA 4F2QA 5A5XA 4H6DA 3TMGA 4WEDA 2R6GE 4LZ5A 4DXCA 5H8NA 4MLQA 2V25A 5F7VA 3OO8A 3P7IA 3KSJA 1OMPA 1VE4A 1LAGE 4DCYA 2RF1A 2DXRA 3VDFA 3GXAA 4ZEFA 4FEDA 1ZTYA 2I4CA 4QFKA 1SVXB 4YKIA 3RN8A 3VVFA 2DWAA 3V8XB 3EPEA 4RY1A 2XXHA 5IAIA 5M2VA 5KCJA 5J1DA 2I0BA 3S9MC 1MQGA 1YTVA 1Y4CA 5CMBA 3U93A 4FJPA 5I59B 3K01A 5B70A 1HSEA 1DTZA 3TPAA 4GD5A 1Z7NE 3QUJA 1EZOA 5ICQA 1OQHA 4R74A 1VSOA 2XX8A 2NOOA 4OTEA 1N3WA 5H8HA 1QUKA 3E13X 5H8QA 1N7WA 3U94A 3Q28A 1D4NA 3FXUA 1IQ7A 4U4SA 3MVXA 1BTJA 4O3BA 1YPNA 5L9SA 2B3BA 3KJ7A 3FJGA 1UIVA 1URGA 4PQJA 4PFTA 3U8QA 3V89B 3RLFE 4NF6A 4JBZA 4IB2A 2OWTA 2DWIA 3S2VA 4X48A 1FTJA 1FW0A 4M4GA 3T9UA 2OJTA 2A5TA 1GR2A 3W9WA 2HXWA 3H6VA 1DTGA 2VHAA 4L17A 1MM7A 3O28A 2ESNA 3H7MA 5DYHA 1MPBA 3LC8A 2UVHA 2AIXA 2XXPA 4EUOA 3KEIA 4EQ9A 1GTKA 3DP6A 2D5WA 4ELOA 3RT8A 1B40A 3OSRA 2DP8A 1URSA 4EF2A 5FHNA 1MQHA 1P1WA 1LCFA 5CMKA 4U21A 1OLCA 4F1YA 3AXFA 2DVZA 2O1LA 4ZEIA 4DDDA 1N04A 4GQOA 3H6UA 3FVGA 4QFPA 2QS1A 4G68B 1ZU0A 4RNSA 4EXLA 4FECA 3MJNA 1HSLA 3C9HA 3PPNA 2GHBA 3M8UA 1LAXA 4H5GA 4IO7A 2ALUA 5HBCA 2ONSA 4H8IA 4OYVA 4IGRA 1A7LA 4F1VA 2NUVA 1QJMA 3B7DA 4GWOA 1A54A 1QUIA 2O7UA 2Q88A 3FJ7A 1UIUA 3MWBA 4R73A 4POWA 1Y20A 2QJEA 3OO7A 3TCFA 3OXNA 5AA2B 2XX7A 3CVGA 1EH3A 4ZECA 3BKIB 1MXVA 3VFJA 2ZYOA 3A09A 4FAJA 1PBPA 4F1UA 3IK6B 4FEBA 2QMXA 2Q89A 3FATA 1A8EA 4G8NA 4Q30B 2V3TA 4EDPA 4JXIA 1ZJLA 2HCAA 4NE4A 3TODA 4MF3A 2DE3A 3O66A 3KJTA 5AA2D 1UTHB 1ZKBA 1ZIUA 3KG2A 5A5XB 3LUYA 5EHSA 1Q1KA 1IUDA 1OLAA 3I3VA 5H8NB 4YU0A 3MVYA 4I9DA 3K6VA 2XXTA 1DMBA 3IB2A 3OMBA 3LR1A 1B9JA 1MH4A 5BUUA 3IB0A 4U1OA 4OQOA 3H06B 4I8CA 1SYIA 5JTYA 4M1VA 4P0GA 3IJOB 5TPAA 1RYXA 1FTKA 3E3KA 4PP0A 2PT2A 4KD5A 4ZDMA 1XT8A 3RPWA 4ZE9A 1R9LA 3UORA 2DS9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HQ0 A;  4U22 A;  4DXB A;  4EF1 A;  4JSD A;  4G4P A;  3O29 A;  1P1Q A;  4TLM B;  3IO4 A;  2CZL A;  3K1N A;  3TFL A;  4PFW A;  4LA9 A;  1MXZ A;  4GL0 A;  4F22 A;  3MQ9 A;  3KSX A;  1URD A;  2KLF A;  3LSW A;  3VVD A;  1VFD A;  1OVB A;  3CR9 A;  3GBA A;  3M3L A;  3MZB A;  3EF7 A;  1SW1 A;  1II5 A;  4G8M A;  1IXC A;  5H8Q B;  3C31 A;  5I58 B;  3A3U A;  4JWO A;  4GL8 A;  2DOJ A;  3GLB A;  5AA4 A;  4THI A;  2QMW A;  3BBR A;  1YCJ A;  3ZKK A;  2XHD A;  4LQ2 A;  2F7A A;  1L5T A;  3LBS A;  3SET A;  4Z7E A;  1UQW A;  2F36 A;  4NF6 B;  1QKA A;  4Q5T A;  2XD2 A;  1B3E A;  3C4M A;  4HTG A;  2A5T B;  3KZG A;  2REG A;  1BLF A;  3N94 A;  3UIF A;  4DXU A;  4Z0I A;  1FQE A;  3HHG A;  4ND9 A;  5CMM A;  3RT6 B;  4KCD A;  1P1N A;  1DOT A;  1DPE A;  4R6Y A;  1B32 A;  1BKA A;  3IOU A;  4GVO A;  3K4U A;  1XC1 A;  1US5 A;  4QHQ A;  4X1B A;  2H9B A;  3HST A;  4OES A;  3KN7 A;  3TTM A;  3T9X B;  3QSL A;  4GFR A;  1FTO A;  4O3C A;  1N0T A;  4TOZ A;  3T22 A;  1FCK A;  2DWH A;  3CG1 A;  1USY H;  2QL3 A;  1MQD A;  4E0W A;  4OEN A;  3I5O A;  1B2H A;  3FZV A;  4MFI A;  3FV2 A;  1AOV A;  5AA2 A;  1I6A A;  1S9T A;  2I4B A;  3TTK A;  1P99 A;  4QFN A;  4XKN A;  4OER A;  3VXB A;  1IXI A;  4BDN A;  3CRB A;  3ZKL A;  4WXJ A;  2THI A;  4IY5 A;  2B65 A;  5LOM A;  1GVC A;  1P1U A;  4OFL A;  1B0H A;  5KDT B;  1POT A;  2FNC A;  2H99 A;  5H8S A;  3Q26 A;  2PVU A;  1MQJ A;  4YB5 A;  3UA8 A;  1H3D A;  4RPO A;  4P0I A;  4KYD A;  3MVZ A;  1OQG A;  3RTW B;  2V84 A;  2XX9 A;  4GLI A;  1A40 A;  3VE1 B;  1TFA A;  3T93 B;  1VR5 A;  1MDQ A;  3RQT A;  4IO6 A;  5DTB A;  3EHT A;  3L6G A;  2B3F A;  3L6H A;  4FAT A;  2QRY A;  3G7W A;  2GH9 A;  2RC9 A;  5FHM A;  5ITO A;  1VFE A;  1LLS A;  4HCW A;  3K1M A;  5I2N A;  3FJM A;  4OXV A;  1H45 A;  2ZXT A;  2VP1 A;  1QUL A;  3DM0 A;  4NMY A;  2P1S A;  1N84 A;  3K6U A;  3H3G A;  3QIM A;  3VLU A;  4YB7 A;  4RA1 A;  3PUV E;  2RCB A;  2VD3 A;  3HHF A;  1JNF A;  4RYA A;  3IOV A;  3TUS A;  2ZYN A;  3QUF A;  1ZMG A;  3G3J A;  1MS7 A;  4AB5 A;  4YZZ A;  1B4H A;  2QS4 A;  3VLW A;  4ESX A;  3H6W A;  4KHZ E;  3PU5 A;  2BJJ X;  5JTY B;  1NNT A;  4OZ9 A;  2P0S A;  2AYS A;  5I58 A;  5TPA B;  1B52 A;  1IXG A;  2RCA A;  3D4G A;  3N6T A;  4EXK A;  1Y1Z A;  2F7B A;  5HM4 B;  1M5D A;  1JEU A;  4LUB A;  1JVY A;  4ZS9 A;  4IO4 A;  3T9V A;  1SW2 A;  1LST A;  1SQY A;  3FVO A;  5I56 B;  1O64 A;  4XIG Q;  2YJP A;  1XVY A;  3I6V A;  4NF5 A;  4H67 A;  4G8H A;  5F1Q A;  2Q8J A;  3M3K A;  4ZZE A;  4XXU A;  2X7P A;  2ZNS A;  3TKD A;  1PB7 A;  3RGY A;  1A99 A;  1LAH E;  3PMW A;  4XTC Q;  2H4I A;  4H65 A;  5DVF A;  2XXI A;  5AA4 B;  3OO9 A;  4YB6 A;  3O2A A;  4WEP A;  4X1D A;  1FQD A;  1R1N A;  1Z7M E;  2F97 A;  1SI1 A;  3KN3 A;  3K2D A;  2O51 A;  3KN8 A;  1EZ9 A;  2IEE A;  4U2R A;  2REJ A;  1B46 A;  3O6I A;  2X7Q A;  3ECR A;  1NKX A;  2O1M A;  3MZ9 A;  3MC2 A;  3IR1 A;  3HN0 A;  2AL5 A;  4QF9 A;  1UTB A;  4RXL A;  2QSX A;  2Q2C A;  5AE4 A;  5CC2 A;  5KDT A;  3EQ1 A;  1Y3Q A;  1B7H A;  1MRP A;  4I62 A;  5DVI A;  2D21 A;  2HEU A;  3KOS A;  4LAT A;  2G93 A;  2DE4 A;  2F78 A;  3FD3 A;  3RY3 A;  1LCT A;  3IX1 A;  2Q2A A;  1Y4T A;  1HSJ A;  1NH7 A;  2IA4 A;  3B6Q A;  3GBB A;  2Q9T A;  4ELQ A;  3PGF A;  3PUZ E;  3VV5 A;  1M5C A;  3IL1 B;  1FQA A;  1H76 A;  4P11 A;  4AB6 A;  2VD2 A;  3R7X A;  1B7Z A;  2OWS A;  2ZNU A;  1PEB A;  1B51 A;  3PMV A;  3EHU A;  3DEL B;  4H1X A;  5KZT A;  1MXU A;  1MM6 A;  4ESW A;  5EHM A;  4RJZ A;  4GXS B;  1XVX A;  4N07 A;  4KCC A;  3MBP A;  1RKM A;  2UVJ A;  1M5F A;  3T66 A;  4GOT A;  5CBR A;  5FTH A;  1N76 A;  5CMC A;  3SES A;  3OEM A;  4IO3 A;  3B6T A;  1NNP A;  2PMS A;  4OET A;  4TLL B;  5K2X A;  3TZA A;  4C1U A;  3LSX A;  1Y9U A;  3B6W A;  4XKP A;  4C1T A;  1MXW A;  1PB8 A;  3WAE A;  1EU8 A;  4YKP A;  4U1Z A;  2Z8E A;  1B3F A;  5I2N B;  4LP2 B;  4EQ7 A;  2ZYK A;  1AL3 A;  4F18 A;  1FQB A;  2I48 A;  1ATG A;  4JSO A;  4JWY A;  2ABH A;  2XXV A;  3K00 A;  3N26 A;  1CE2 A;  2GRV A;  1LFG A;  4MLV A;  2OBG A;  1MY1 A;  1B7U A;  4QFL A;  3LSL A;  5TP9 B;  3K6X A;  3JV9 A;  4N6P A;  4YKJ A;  4NF8 B;  1PDA A;  3SKP A;  4H0W A;  3SEY A;  5I56 A;  2O69 A;  3O6H A;  3G3I A;  3E9X A;  3VLV A;  4UA8 A;  1LB9 A;  3ONM A;  2OK2 A;  4BDL A;  3W15 C;  3G3G A;  2ANJ A;  4DE8 A;  2FA7 A;  1O63 A;  4PET A;  1SW4 A;  4BDM A;  4XKQ A;  3MZ1 A;  1H44 A;  3PPP A;  2O7I A;  2F7C A;  4LON B;  2ONR A;  1MPD A;  3SER A;  1FQC A;  4O3A A;  3RNN A;  4HS7 A;  1LBB A;  3K02 A;  1LFI A;  3S9E A;  2QPQ A;  2ZMB A;  1BP5 A;  1Y3N A;  3TCG A;  3S9N C;  3PUX E;  1NMU A;  4NF5 B;  3QXM A;  3RUM A;  4F29 A;  4F31 B;  2DQV A;  4BLA A;  1R9Q A;  2R9J A;  4KYS A;  4OEU A;  1SBP A;  5K2Y A;  1JW5 A;  4R9G A;  2R71 A;  4KI0 E;  4F3P A;  3QYT A;  4ZEB A;  3EHS A;  4Q8R A;  1AH5 A;  4LVQ A;  2F35 A;  3TEL A;  4R6H A;  3TTN A;  5I57 A;  3R26 A;  3HPI A;  4DCX A;  4GXA A;  3ODB A;  4RK9 A;  3RTF B;  4DLD A;  3U72 A;  3HV1 A;  4FIM A;  4F2O A;  3W9V A;  3O97 A;  5CBS A;  3GZG A;  3DP8 A;  4QSE A;  1UTB B;  2D3I A;  1D9Y A;  4U23 A;  4HW8 A;  3CSG A;  1GV8 A;  1EZP A;  5ITP A;  5EYF A;  2H25 A;  3E4R A;  1FQF A;  3HO7 A;  3H4Z A;  1MY0 A;  3TDJ A;  1AIV A;  1H43 A;  4ZZA A;  4ZED A;  3OEN A;  3CFX A;  4GF8 A;  2RIN A;  1OIB A;  1IXH A;  4JWX A;  2CMO A;  4YAH X;  4TQU Q;  5ISU A;  5DT6 A;  5DEX B;  3C34 A;  4I1D A;  4OWD A;  3UP9 A;  2HZL A;  4Q0C A;  1MPC A;  5DVJ A;  2F6G A;  4BDO A;  4NED A;  3PMX A;  4JDF A;  4KR5 A;  4ECF A;  2Z22 A;  3CFL A;  4MH5 A;  3TQW A;  3USD A;  3LSF B;  3PPO A;  4KFQ A;  4GRK A;  2HFB A;  3THI A;  3PPQ A;  4R72 A;  1SDX A;  4PFY A;  2OZZ A;  2VOZ A;  1OVT A;  3MPL A;  3OOA A;  4FE8 A;  3FUZ A;  5HPQ A;  1B5H A;  4HCY A;  1M5B A;  5H8F A;  3OSQ A;  5TP9 A;  2Z8D A;  4OMB A;  1B58 A;  3FV1 A;  1GGG A;  4F3G A;  4NWD A;  1MQI A;  2Y7P A;  1MXY A;  3KOT A;  4NF8 A;  1D9V A;  2UXA A;  3DP4 A;  1ZLQ A;  3N5L A;  3Q27 A;  4F39 A;  3PV0 E;  1F9B A;  1TXF A;  1NFT A;  2P2A A;  2OLB A;  1DSN A;  2AL4 A;  2PT1 A;  4YMB A;  1MY4 A;  1B4Z A;  1JVX A;  4H8J A;  1POY 1;  1AMF A;  1LB8 A;  4G68 C;  4NWC A;  2QS3 A;  3K6W A;  1LBC A;  1WVJ A;  1QVS A;  2Z23 A;  1NNF A;  1MDP 1;  4QRZ A;  2Y7W A;  4KQP A;  2UYE A;  3MUQ A;  3CSB A;  4ISU A;  4U4X A;  3TEP A;  3TCH A;  4LZ7 A;  2DXY A;  5L8D A;  3FXR A;  3MP1 A;  2NVU B;  2UVG A;  4YIC A;  2XXW A;  1DPP A;  1RYO A;  3SEV A;  5I84 A;  2DYX A;  3KBR A;  2M8C A;  3K1P A;  3V83 A;  1PC3 A;  5CI5 A;  1JW4 A;  4F3S A;  3VXC A;  1B3G A;  5L9O A;  1I69 A;  2QS2 A;  3IO6 A;  1LGB C;  3BFT A;  3S9L C;  1A8F A;  1IEJ A;  2NXO A;  2ZNT A;  3V5A A;  3CI8 A;  2XXX A;  4KYE A;  1XOC A;  2XXR A;  3UN6 A;  3IOT A;  5TU0 A;  4K3F A;  1KWH A;  4GIZ A;  2RC7 A;  2O84 X;  1IIT A;  2YLN A;  3IJX B;  3SDF A;  2DWJ A;  1JW1 A;  3S4U A;  2Z8F A;  3JZJ A;  3VVE A;  2E1S A;  3FVK A;  3FAS A;  4R75 A;  4BDR A;  2F5X A;  4QFO A;  2Y7K A;  3C33 A;  1FTL A;  2LAO A;  4POX A;  3MVW A;  4MBP A;  4N13 A;  3PPR A;  1NL5 A;  2Y7R A;  4OFJ A;  3OEK A;  3JYR A;  3KGC A;  2Y7I A;  1S50 A;  3QK6 A;  2V3Q A;  5CRY A;  3G3H A;  3MPK A;  3U92 A;  2F8D A;  2XXU A;  1MXX A;  5I57 B;  5BWJ A;  3C35 A;  2PBW A;  4DZ1 A;  5I2K B;  2O68 A;  2PX1 A;  2A5S A;  3OD7 A;  5DEX A;  2VGQ A;  1SYH A;  3R6U A;  3SEX A;  1B6H A;  1FTM A;  5JK4 A;  1US4 A;  1TT1 A;  1QW0 A;  4NF4 A;  1MY2 A;  2UYF A;  1B3L A;  3ZS6 A;  3U1O A;  1ZBM A;  1Y1M A;  3F11 A;  4G2Z A;  3C36 A;  3OEL A;  2RC8 A;  1N3X A;  1TWY A;  5AA1 A;  4ZE8 A;  1N7X A;  3SEU A;  1I6Q A;  1JEV A;  3D4C A;  3UGW A;  3H03 A;  3T9H B;  4E0X A;  1NNK A;  1Y3P A;  4QSC A;  2DE2 A;  4LZ8 A;  2I3W A;  5IKB A;  2F6P A;  3ILU B;  1YAE A;  1I6B A;  1WOD A;  4R2F A;  3Q29 A;  3T96 B;  2I49 A;  1LAF E;  3HCQ A;  5I59 A;  4KPT A;  3FIR A;  2PYY A;  3CG3 A;  1LFH A;  5ICT A;  2Y84 A;  1JET A;  4PE5 B;  1MH3 A;  1BIY A;  2V93 A;  5H8F B;  2GHA A;  2YPN A;  2XXQ A;  1XHY A;  4OFO A;  3FXQ A;  4YMA A;  3A3C A;  2DVC A;  4X9T A;  4EQB A;  4PFU A;  4ONY A;  1D3K A;  1ELJ A;  2NWJ A;  2X26 A;  2FYI A;  5KCJ B;  1MY3 A;  2HAV A;  1O7T A;  5AA3 A;  4RPN A;  3PD8 A;  2OCU A;  2XD3 A;  1XS5 A;  3ILT B;  4R6K A;  2H5Y A;  4G77 A;  3UK4 A;  3FGS A;  1PB9 A;  3PD9 A;  4IO2 A;  3IOW A;  1MG1 A;  3MP8 A;  5H8H B;  5ELV A;  3SEW A;  1B3H A;  2HAU A;  2O6A A;  3CIJ A;  3M3F A;  1J1N A;  5JEI A;  3TTR A;  4QSD A;  3ZSF A;  2V3U A;  4R9F A;  4OVJ A;  5L9M A;  4H5F A;  4ELR A;  3MP6 A;  4YKK A;  2XXY A;  2ONK E;  4BDQ A;  1P1O A;  3QAX A;  2I58 A;  3K0V A;  1USY E;  2I6E A;  1JQF A;  2I0C A;  3WAF A;  1WDN A;  1SD3 A;  3TQL A;  3N6U A;  1R6Z A;  4G68 A;  1SW5 A;  3C32 A;  4AQ4 A;  3OO6 A;  1T0K A;  4ZEK A;  3H6T A;  3O6G A;  3O9P A;  3G3F A;  1B5I A;  1B1X A;  3PUW E;  1ANF A;  3Q25 A;  1A55 A;  2UVI A;  3IB1 A;  4IGT A;  4DIG A;  4NTL A;  1TFD A;  1S7Y A;  1B5J A;  4IY6 A;  5I2K A;  3G3K A;  2E0S A;  4IO5 A;  4OEV A;  4FOR A;  1CB6 A;  3TYH A;  3IAZ A;  2I3V A;  2DSF A;  1QUJ A;  1Q35 A;  3PUY E;  4LQ5 A;  2GFE A;  1B05 A;  1PBQ A;  4C0R A;  3BFU A;  5FTI A;  3EN3 A;  4R2B A;  5FHO A;  2RKM A;  2HZK A;  5CM6 A;  1IIW A;  4OHN A;  4XKR A;  3KFM A;  3DLN A;  2H98 A;  2WKY A;  3IOR A;  4RK2 A;  1M5E A;  1NH8 A;  1B1H A;  1IZ1 A;  4ELP A;  3CFZ A;  1B0L A;  4F3B A;  2W7Y A;  2G29 A;  4WKM A;  2F34 A;  4F19 A;  5B7D A;  4UAC A;  3MW0 A;  3MAM A;  3TAJ A;  4JB7 A;  1SI0 A;  1QKB A;  2ZYM A;  3TTL A;  1UTH A;  4NF4 B;  3FVN A;  4F2Q A;  5A5X A;  4H6D A;  3TMG A;  4WED A;  2R6G E;  4LZ5 A;  4DXC A;  5H8N A;  4MLQ A;  2V25 A;  5F7V A;  3OO8 A;  3P7I A;  3KSJ A;  1OMP A;  1VE4 A;  1LAG E;  4DCY A;  2RF1 A;  2DXR A;  3VDF A;  3GXA A;  4ZEF A;  4FED A;  1ZTY A;  2I4C A;  4QFK A;  1SVX B;  4YKI A;  3RN8 A;  3VVF A;  2DWA A;  3V8X B;  3EPE A;  4RY1 A;  2XXH A;  5IAI A;  5M2V A;  5KCJ A;  5J1D A;  2I0B A;  3S9M C;  1MQG A;  1YTV A;  1Y4C A;  5CMB A;  3U93 A;  4FJP A;  5I59 B;  3K01 A;  5B70 A;  1HSE A;  1DTZ A;  3TPA A;  4GD5 A;  1Z7N E;  3QUJ A;  1EZO A;  5ICQ A;  1OQH A;  4R74 A;  1VSO A;  2XX8 A;  2NOO A;  4OTE A;  1N3W A;  5H8H A;  1QUK A;  3E13 X;  5H8Q A;  1N7W A;  3U94 A;  3Q28 A;  1D4N A;  3FXU A;  1IQ7 A;  4U4S A;  3MVX A;  1BTJ A;  4O3B A;  1YPN A;  5L9S A;  2B3B A;  3KJ7 A;  3FJG A;  1UIV A;  1URG A;  4PQJ A;  4PFT A;  3U8Q A;  3V89 B;  3RLF E;  4NF6 A;  4JBZ A;  4IB2 A;  2OWT A;  2DWI A;  3S2V A;  4X48 A;  1FTJ A;  1FW0 A;  4M4G A;  3T9U A;  2OJT A;  2A5T A;  1GR2 A;  3W9W A;  2HXW A;  3H6V A;  1DTG A;  2VHA A;  4L17 A;  1MM7 A;  3O28 A;  2ESN A;  3H7M A;  5DYH A;  1MPB A;  3LC8 A;  2UVH A;  2AIX A;  2XXP A;  4EUO A;  3KEI A;  4EQ9 A;  1GTK A;  3DP6 A;  2D5W A;  4ELO A;  3RT8 A;  1B40 A;  3OSR A;  2DP8 A;  1URS A;  4EF2 A;  5FHN A;  1MQH A;  1P1W A;  1LCF A;  5CMK A;  4U21 A;  1OLC A;  4F1Y A;  3AXF A;  2DVZ A;  2O1L A;  4ZEI A;  4DDD A;  1N04 A;  4GQO A;  3H6U A;  3FVG A;  4QFP A;  2QS1 A;  4G68 B;  1ZU0 A;  4RNS A;  4EXL A;  4FEC A;  3MJN A;  1HSL A;  3C9H A;  3PPN A;  2GHB A;  3M8U A;  1LAX A;  4H5G A;  4IO7 A;  2ALU A;  5HBC A;  2ONS A;  4H8I A;  4OYV A;  4IGR A;  1A7L A;  4F1V A;  2NUV A;  1QJM A;  3B7D A;  4GWO A;  1A54 A;  1QUI A;  2O7U A;  2Q88 A;  3FJ7 A;  1UIU A;  3MWB A;  4R73 A;  4POW A;  1Y20 A;  2QJE A;  3OO7 A;  3TCF A;  3OXN A;  5AA2 B;  2XX7 A;  3CVG A;  1EH3 A;  4ZEC A;  3BKI B;  1MXV A;  3VFJ A;  2ZYO A;  3A09 A;  4FAJ A;  1PBP A;  4F1U A;  3IK6 B;  4FEB A;  2QMX A;  2Q89 A;  3FAT A;  1A8E A;  4G8N A;  4Q30 B;  2V3T A;  4EDP A;  4JXI A;  1ZJL A;  2HCA A;  4NE4 A;  3TOD A;  4MF3 A;  2DE3 A;  3O66 A;  3KJT A;  5AA2 D;  1UTH B;  1ZKB A;  1ZIU A;  3KG2 A;  5A5X B;  3LUY A;  5EHS A;  1Q1K A;  1IUD A;  1OLA A;  3I3V A;  5H8N B;  4YU0 A;  3MVY A;  4I9D A;  3K6V A;  2XXT A;  1DMB A;  3IB2 A;  3OMB A;  3LR1 A;  1B9J A;  1MH4 A;  5BUU A;  3IB0 A;  4U1O A;  4OQO A;  3H06 B;  4I8C A;  1SYI A;  5JTY A;  4M1V A;  4P0G A;  3IJO B;  5TPA A;  1RYX A;  1FTK A;  3E3K A;  4PP0 A;  2PT2 A;  4KD5 A;  4ZDM A;  1XT8 A;  3RPW A;  4ZE9 A;  1R9L A;  3UOR A;  2DS9 A; 
#chains in the Genus database with same CATH topology
 2HQ0 A;  4N81 A;  4U22 A;  4DXB A;  4EF1 A;  4JVC A;  4JSD A;  4G4P A;  4NGU A;  3O29 A;  1P1Q A;  5A5L A;  4TLM B;  3IO4 A;  2CZL A;  3K1N A;  3ISP A;  3TFL A;  4PFW A;  1FPJ A;  4LA9 A;  1FPB A;  1MXZ A;  4GL0 A;  4F22 A;  3MQ9 A;  3KSX A;  1URD A;  2KLF A;  3LSW A;  3VVD A;  1VFD A;  1OVB A;  4GX6 A;  3CR9 A;  3GBA A;  3M3L A;  3MZB A;  3EF7 A;  1SW1 A;  1II5 A;  4G8M A;  1IXC A;  5H8Q B;  3C31 A;  5I58 B;  1IMC A;  3A3U A;  4JWO A;  2Q8M A;  4GL8 A;  2DOJ A;  3GLB A;  5AA4 A;  2MKZ A;  4XEQ A;  4THI A;  2QMW A;  3BBR A;  1YCJ A;  3ZKK A;  2XHD A;  4LQ2 A;  2F7A A;  1L5T A;  3LBS A;  3SET A;  4Z7E A;  1UQW A;  4O7I A;  2F36 A;  4GX4 A;  4NF6 B;  1QKA A;  4Q5T A;  2XD2 A;  1B3E A;  1DBZ A;  3C4M A;  4HTG A;  2A5T B;  3KZG A;  2REG A;  1BLF A;  3N94 A;  1EYI A;  5I3S A;  3UIF A;  3QMF A;  4DXU A;  4Z0I A;  4GWU A;  1FQE A;  2WX9 A;  3HHG A;  4ND9 A;  5CMM A;  2PFZ A;  4KCD A;  3RT6 B;  1P1N A;  1DOT A;  1DPE A;  4R6Y A;  1B32 A;  1BKA A;  1NI9 A;  3IOU A;  1NV1 A;  4GVO A;  3K4U A;  2QFL A;  4QBA A;  1XC1 A;  1RDX A;  1US5 A;  4QHQ A;  4X1B A;  2H9B A;  3A29 A;  3HST A;  4OES A;  3KN7 A;  3TTM A;  3T9X B;  3QSL A;  4GFR A;  1FTO A;  1JP4 A;  4O3C A;  1N0T A;  4P56 A;  4TOZ A;  3T22 A;  1FCK A;  2DWH A;  3CG1 A;  1USY H;  2QL3 A;  3LV0 A;  1MQD A;  4E0W A;  4OEN A;  3I5O A;  1B2H A;  3FZV A;  4MFI A;  3FV2 A;  1AOV A;  5AA2 A;  1I6A A;  1S9T A;  2I4B A;  3TTK A;  1P99 A;  4QFN A;  1SPI A;  4XKN A;  4OER A;  3VXB A;  1IXI A;  4BDN A;  3CRB A;  3ZKL A;  4UAB A;  4WXJ A;  4PAF A;  2THI A;  4IY5 A;  2B65 A;  4GWW A;  5LOM A;  1GVC A;  4GWZ A;  1P1U A;  4OFL A;  1B0H A;  5KDT B;  1POT A;  2FNC A;  2H99 A;  5H8S A;  3Q26 A;  1NV5 A;  2PVU A;  1MQJ A;  1VDW A;  4YB5 A;  2XWK A;  1FJ6 A;  2Y5K A;  3UA8 A;  3NOH A;  1H3D A;  4RPO A;  4P0I A;  4KYD A;  3MVZ A;  1OQG A;  3RTW B;  2V84 A;  2XX9 A;  4GLI A;  1A40 A;  3VE1 B;  1TFA A;  3T93 B;  1VR5 A;  1MDQ A;  3RQT A;  4IO6 A;  5DTB A;  3EHT A;  1FPE A;  3L6G A;  2B3F A;  4NN3 A;  3L6H A;  4FAT A;  2XWI A;  2QRY A;  3G7W A;  4P9K A;  2GH9 A;  4GWY A;  2RC9 A;  5FHM A;  4OVS A;  5ITO A;  4N17 A;  1VFE A;  1LLS A;  4HCW A;  3K1M A;  5I2N A;  3FJM A;  4OXV A;  1H45 A;  4OAN A;  3KBZ A;  2ZXT A;  2VP1 A;  1QUL A;  3DM0 A;  4NMY A;  2P1S A;  1N84 A;  3K6U A;  3H3G A;  1K9Y A;  3QIM A;  2CZI A;  3VLU A;  4YB7 A;  4RA1 A;  3PUV E;  2RCB A;  2VD3 A;  3HHF A;  1JNF A;  4RYA A;  3IOV A;  3TUS A;  2ZYN A;  3QUF A;  1NUZ A;  1ZMG A;  3G3J A;  5ESY A;  1MS7 A;  4AB5 A;  4YZZ A;  3CHG A;  1B4H A;  2QVU A;  2QS4 A;  3VLW A;  4ESX A;  3H6W A;  4KHZ E;  3PU5 A;  2BJJ X;  3E78 A;  5JTY B;  1NNT A;  2OX3 A;  4OZ9 A;  2P0S A;  2AYS A;  5I58 A;  5TPA B;  1B52 A;  1IXG A;  2RCA A;  3T0J A;  3D4G A;  2BJI A;  3N6T A;  4EXK A;  1FSA A;  4X04 A;  1Y1Z A;  2F7B A;  4MAG A;  5HM4 B;  1M5D A;  1NV7 A;  2QVV A;  1JEU A;  4LUB A;  1JVY A;  4ZS9 A;  4IO4 A;  3T9V A;  1SW2 A;  2FBP A;  1LST A;  2ZZX A;  1SQY A;  3FVO A;  5I56 B;  1O64 A;  4XIG Q;  2YJP A;  3BIG A;  1XVY A;  3I6V A;  4NF5 A;  1AWB A;  4H67 A;  4G8H A;  5F1Q A;  2Q8J A;  3M3K A;  4ZZE A;  4XXU A;  2X7P A;  2ZNS A;  3TKD A;  5ET7 A;  1PB7 A;  3RGY A;  1A99 A;  1LAH E;  3PMW A;  4XTC Q;  1LBV A;  2H4I A;  4H65 A;  5DVF A;  1NV3 A;  4H46 A;  2XXI A;  2XA5 A;  5AA4 B;  3OO9 A;  4YB6 A;  3O2A A;  4WEP A;  4X1D A;  1FQD A;  1R1N A;  1Z7M E;  2F97 A;  1SI1 A;  3KN3 A;  3K2D A;  1RDY A;  2O51 A;  3KN8 A;  1EZ9 A;  2IEE A;  4U2R A;  4PF6 A;  2REJ A;  1B46 A;  3O6I A;  2X7Q A;  3ECR A;  1LBY A;  1NKX A;  2JJK A;  2O1M A;  4O8M A;  3MZ9 A;  3MC2 A;  2VPO A;  3IR1 A;  3IFC A;  3HN0 A;  1Q9D A;  2AL5 A;  4IR8 A;  2FIX A;  4QF9 A;  1UTB A;  4RXL A;  2QSX A;  2Q2C A;  5AE4 A;  5CC2 A;  5KDT A;  3EQ1 A;  1Y3Q A;  1B7H A;  1MRP A;  4I62 A;  5DVI A;  2D21 A;  2HEU A;  3KC1 A;  4G61 A;  3KOS A;  4LAT A;  2G93 A;  2DE4 A;  2F78 A;  3FD3 A;  3RY3 A;  2WBB A;  1FBG A;  1LCT A;  3IX1 A;  2Q2A A;  1Y4T A;  1HSJ A;  1NH7 A;  2IA4 A;  3B6Q A;  3GBB A;  2Q9T A;  4HE0 A;  4I3Y A;  4ELQ A;  3PGF A;  3PUZ E;  3VV5 A;  1M5C A;  3LUZ A;  3IL1 B;  1FQA A;  1H76 A;  4P11 A;  1FBC A;  4AB6 A;  1EYJ A;  2VD2 A;  3R7X A;  5FBP A;  1B7Z A;  3IFA A;  2OWS A;  2ZNU A;  1PEB A;  1B51 A;  3PMV A;  2WBD A;  3EHU A;  3DEL B;  4H1X A;  5KZT A;  1MXU A;  1MM6 A;  4ESW A;  5EHM A;  4RJZ A;  4GXS B;  1XVX A;  5EQ7 A;  4N07 A;  4KCC A;  3MBP A;  1RKM A;  2UVJ A;  1M5F A;  3T66 A;  4GOT A;  5CBR A;  5FTH A;  1N76 A;  5CMC A;  3SES A;  3OEM A;  4IO3 A;  3B6T A;  1NNP A;  2PMS A;  4OET A;  4TLL B;  5K2X A;  3TZA A;  4C1U A;  3LSX A;  1Y9U A;  3B6W A;  4XKP A;  3BIH A;  1MXW A;  4C1T A;  4PBH A;  1PB8 A;  3WAE A;  1EU8 A;  4YKP A;  4U1Z A;  2Z8E A;  1B3F A;  5I2N B;  1NV6 A;  4LP2 B;  4EQ7 A;  2ZYK A;  1AL3 A;  4F18 A;  1FQB A;  2I48 A;  1ATG A;  4JSO A;  4JWY A;  2ABH A;  2XXV A;  5T3J A;  3K00 A;  3N26 A;  1CE2 A;  2GRV A;  4PCD A;  1LFG A;  4MLV A;  2OBG A;  4MEV A;  1MY1 A;  1B7U A;  4QFL A;  3LSL A;  5TP9 B;  3K6X A;  3JV9 A;  4N6P A;  4YKJ A;  1FPF A;  4NF8 B;  1PDA A;  3SKP A;  4H0W A;  3SEY A;  5I56 A;  2O69 A;  3O6H A;  3G3I A;  3E9X A;  3VLV A;  4UA8 A;  4HE2 A;  1LB9 A;  3ONM A;  2OK2 A;  4BDL A;  2FVZ A;  3W15 C;  3G3G A;  5F24 A;  2KR0 A;  2ANJ A;  4DE8 A;  2FA7 A;  5ET5 A;  1O63 A;  4PET A;  1SW4 A;  4BDM A;  4PAI A;  2FHY A;  2FIE A;  4XKQ A;  3MZ1 A;  1H44 A;  3PPP A;  2O7I A;  2F7C A;  4LON B;  2ONR A;  1MPD A;  3SER A;  1FQC A;  4HXV A;  4O3A A;  3RNN A;  4HS7 A;  1LBB A;  2XWO A;  3K02 A;  1LFI A;  3S9E A;  2QPQ A;  2ZMB A;  1BP5 A;  1Y3N A;  3TCG A;  3S9N C;  1NV2 A;  3PUX E;  1NMU A;  4NF5 B;  3QXM A;  3RUM A;  5DW8 A;  4F29 A;  4I3E A;  4F31 B;  1G0I A;  2DQV A;  4BLA A;  1R9Q A;  1IMD A;  2R9J A;  4KYS A;  4OEU A;  1SBP A;  5K2Y A;  1KZ8 A;  3KC0 A;  1JW5 A;  4R9G A;  2R71 A;  4KI0 E;  4F3P A;  1XI6 A;  3QYT A;  4ZEB A;  3EHS A;  4Q8R A;  1AH5 A;  4LVQ A;  4QXD A;  2F35 A;  1FRP A;  3TEL A;  3U65 A;  4R6H A;  4NAP A;  3TTN A;  5I57 A;  3R26 A;  3HPI A;  4DCX A;  4GXA A;  3ODB A;  4RK9 A;  1LBX A;  3RTF B;  4DLD A;  3U72 A;  3HV1 A;  4FIM A;  4F2O A;  3W9V A;  3O97 A;  5CBS A;  3GZG A;  3DP8 A;  4QSE A;  4NG7 A;  1UTB B;  2L5V A;  2D3I A;  1D9Y A;  4U23 A;  1LBZ A;  4HW8 A;  3CSG A;  1GV8 A;  1EZP A;  5ITP A;  5EYF A;  2H25 A;  3E4R A;  1FQF A;  3HO7 A;  3H4Z A;  1MY0 A;  3TDJ A;  1AIV A;  1H43 A;  4ZZA A;  4ZED A;  3OEN A;  3CFX A;  4GF8 A;  2RIN A;  1OIB A;  1FPI A;  1IXH A;  4JWX A;  2CMO A;  4P8B A;  4YAH X;  4TQU Q;  5ISU A;  5DT6 A;  5DEX B;  3C34 A;  4I1D A;  4KXP A;  4OWD A;  3UP9 A;  2HZL A;  4Q0C A;  1MPC A;  5DVJ A;  2F6G A;  4BDO A;  4NED A;  3PMX A;  3B50 A;  4JDF A;  4MX6 A;  4KR5 A;  4ECF A;  2Z22 A;  3CFL A;  4MH5 A;  3TQW A;  3USD A;  3LSF B;  3PPO A;  3SZP A;  4KFQ A;  5EYH A;  4GRK A;  3RYD A;  2HFB A;  3THI A;  1NUW A;  3PPQ A;  4R72 A;  1SDX A;  5EQ8 A;  4PFY A;  2OZZ A;  2VOZ A;  1OVT A;  3MPL A;  5IZ3 B;  3MYU A;  3OOA A;  4FE8 A;  3FUZ A;  5HPQ A;  4OA4 A;  1B5H A;  4HCY A;  1M5B A;  5H8F A;  3OSQ A;  5TP9 A;  2Z8D A;  4OMB A;  1B58 A;  3FV1 A;  1GGG A;  4F3G A;  4NWD A;  2CEX A;  1MQI A;  2Y7P A;  1MXY A;  1FBH A;  3KOT A;  4NF8 A;  1D9V A;  2ZZW A;  2UXA A;  3DP4 A;  1ZLQ A;  3N5L A;  3Q27 A;  4F39 A;  3PV0 E;  1NUY A;  1F9B A;  1TXF A;  1G0H A;  1NFT A;  4PDH A;  2P2A A;  2OLB A;  1DSN A;  2AL4 A;  2PT1 A;  4YMB A;  1MY4 A;  4P1L A;  3B8B A;  1B4Z A;  1JVX A;  4H8J A;  1POY 1;  1AMF A;  1LB8 A;  4G68 C;  4NWC A;  1QGX A;  1K9Z A;  2QS3 A;  3K6W A;  1LBC A;  1WVJ A;  4XFE A;  1QVS A;  2Z23 A;  1NNF A;  1MDP 1;  4QRZ A;  2Y7W A;  4KQP A;  2UYE A;  3MUQ A;  3CSB A;  4ISU A;  4U4X A;  4I40 A;  4MCO A;  4PAK A;  3TEP A;  3TCH A;  4LZ7 A;  2P3V A;  5ET8 A;  2DXY A;  5L8D A;  3FXR A;  3MP1 A;  1NV0 A;  2NVU B;  2UVG A;  4YIC A;  2XXW A;  1DPP A;  1RYO A;  3SEV A;  5I84 A;  2DYX A;  2DDK A;  3KBR A;  2M8C A;  3K1P A;  3V83 A;  1PC3 A;  5CI5 A;  1JW4 A;  4F3S A;  3VXC A;  1B3G A;  5L9O A;  1I69 A;  2QS2 A;  3IO6 A;  1LGB C;  3EKI A;  3BFT A;  3S9L C;  1A8F A;  1IEJ A;  2NXO A;  2ZNT A;  3V5A A;  2XXK A;  3CI8 A;  2XXX A;  4KYE A;  1XOC A;  2XXR A;  3UN6 A;  3IOT A;  5TU0 A;  4K3F A;  1KWH A;  4HE1 A;  4GIZ A;  2RC7 A;  2O84 X;  1IIT A;  2YLN A;  3IJX B;  3SDF A;  2DWJ A;  4OVP A;  1JW1 A;  3S4U A;  2Z8F A;  5IGA A;  1FBF A;  3JZJ A;  3VVE A;  2ZZV A;  2E1S A;  3FVK A;  3FAS A;  4R75 A;  4N15 A;  4BDR A;  2F5X A;  4QFO A;  2Y7K A;  3C33 A;  1FTL A;  2LAO A;  4POX A;  3MVW A;  4MBP A;  4N13 A;  3PPR A;  1NL5 A;  2Y7R A;  4OFJ A;  3OEK A;  3JYR A;  3KGC A;  2Y7I A;  1S50 A;  3QK6 A;  2V3Q A;  5CRY A;  3G3H A;  3MPK A;  3U92 A;  2F8D A;  2XXU A;  4N6D A;  1MXX A;  4P3L A;  5I57 B;  5BWJ A;  3C35 A;  2PBW A;  4DZ1 A;  5I2K B;  2O68 A;  2PX1 A;  2A5S A;  3OD7 A;  5DEX A;  2VGQ A;  1KA1 A;  1FTA A;  1SYH A;  3R6U A;  3SEX A;  1B6H A;  1FTM A;  5I5P A;  5JK4 A;  1US4 A;  4AS5 A;  1TT1 A;  1QW0 A;  2KQZ A;  4NF4 A;  1MY2 A;  2UYF A;  1B3L A;  2WYP A;  3ZS6 A;  3U1O A;  1ZBM A;  3HFU A;  1Y1M A;  3F11 A;  4G2Z A;  3C36 A;  3OEL A;  1INP A;  2RC8 A;  1N3X A;  1TWY A;  2F3D A;  5IZ3 A;  5AA1 A;  4ZE8 A;  1N7X A;  4PF8 A;  3SEU A;  1I6Q A;  1JEV A;  3D4C A;  3UGW A;  3H03 A;  3T9H B;  3E79 A;  1NUX A;  4E0X A;  1NNK A;  1Y3P A;  4QSC A;  2DE2 A;  4O7M A;  4LZ8 A;  2I3W A;  4O94 A;  5IKB A;  2F6P A;  3ILU B;  1YAE A;  1FPK A;  1I6B A;  3FBP A;  1WOD A;  4R2F A;  3Q29 A;  1IMF A;  3T96 B;  2I49 A;  1LAF E;  3HCQ A;  5I59 A;  4KPT A;  3FIR A;  2PYY A;  3CG3 A;  4FBP A;  1LFH A;  5ICT A;  2Y84 A;  1JET A;  1KA0 A;  4PE5 B;  1FPL A;  1MH3 A;  1BIY A;  2VT5 A;  2V93 A;  5H8F B;  2GHA A;  2YPN A;  2XXQ A;  2F3B A;  1XHY A;  4OFO A;  3FXQ A;  4YMA A;  3A3C A;  2DVC A;  4DI4 B;  4X9T A;  4EQB A;  4PFU A;  4ONY A;  1D3K A;  1ELJ A;  2NWJ A;  2X26 A;  2FYI A;  5KCJ B;  1MY3 A;  2HAV A;  1O7T A;  4LN5 A;  5AA3 A;  4RPN A;  3PD8 A;  2OCU A;  2XD3 A;  1XS5 A;  3ILT B;  4R6K A;  1D9Q A;  2H5Y A;  4G77 A;  3UK4 A;  3FGS A;  1PB9 A;  3PD9 A;  4IO2 A;  3IOW A;  1MG1 A;  3MP8 A;  1IME A;  5H8H B;  4MNI A;  5ELV A;  3SEW A;  1B3H A;  2HAU A;  2O6A A;  3CIJ A;  3M3F A;  1J1N A;  2HPG A;  5JEI A;  3TTR A;  4QSD A;  2VPN A;  2WYK A;  3RPL B;  3ZSF A;  2V3U A;  5LDZ A;  4OVT A;  4R9F A;  4OVJ A;  5L9M A;  4H5F A;  4ELR A;  3MP6 A;  4YKK A;  3GYY A;  2XXY A;  2ONK E;  4BDQ A;  1FJ9 A;  1P1O A;  1IMA A;  3QAX A;  1DCU A;  2I58 A;  3K0V A;  1USY E;  2I6E A;  1JQF A;  2I0C A;  3ROJ A;  3WAF A;  1WDN A;  1SD3 A;  2HHM A;  3TQL A;  3N6U A;  1R6Z A;  4G68 A;  1SW5 A;  3C32 A;  4AQ4 A;  3OO6 A;  1T0K A;  4ZEK A;  5EYG A;  3H6T A;  3O6G A;  3O9P A;  3G3F A;  1B5I A;  1B1X A;  3PUW E;  1ANF A;  1EYK A;  3Q25 A;  1A55 A;  2UVI A;  3IB1 A;  1YZ0 A;  4IGT A;  4DIG A;  4NTL A;  2CEY A;  1TFD A;  1S7Y A;  1B5J A;  4GWX A;  4MNP A;  4IY6 A;  5I2K A;  5IM2 A;  3G3K A;  2E0S A;  4IO5 A;  4OEV A;  4FOR A;  1CB6 A;  3TYH A;  3IAZ A;  2I3V A;  2DSF A;  2OWZ A;  1QUJ A;  1Q35 A;  3PUY E;  4MIJ A;  4LQ5 A;  2GFE A;  2GQ1 A;  1B05 A;  1PBQ A;  3MST A;  4C0R A;  4H45 A;  1RDZ A;  3BFU A;  1FBP A;  5FTI A;  3EN3 A;  4R2B A;  5FHO A;  2RKM A;  2HZK A;  5CM6 A;  1IIW A;  4OHN A;  4XKR A;  5EQ9 A;  3KFM A;  3DLN A;  4GWS A;  4N8G A;  2H98 A;  2WKY A;  3IOR A;  4RK2 A;  1M5E A;  2PFY A;  1NH8 A;  1B1H A;  1IZ1 A;  1CNQ A;  4ELP A;  3CFZ A;  1B0L A;  4F3B A;  2W7Y A;  2G29 A;  4WKM A;  2F34 A;  4F19 A;  5B7D A;  2WEF A;  3MW0 A;  4UAC A;  3MAM A;  1FPG A;  3TAJ A;  4JB7 A;  1SI0 A;  4OVR A;  1QKB A;  2ZYM A;  3TTL A;  1UTH A;  4NQ8 A;  4NF4 B;  3FVN A;  4F2Q A;  1NV4 A;  5A5X A;  4H6D A;  3TMG A;  4WED A;  2R6G E;  4LZ5 A;  4DXC A;  5H8N A;  4MLQ A;  2V25 A;  5F7V A;  4JVI A;  3OO8 A;  3P7I A;  3KSJ A;  1OMP A;  1VE4 A;  1LAG E;  2Q74 A;  4DCY A;  4JVD A;  4MNC A;  4P47 A;  2RF1 A;  2DXR A;  3VDF A;  2Y5L A;  3GXA A;  4GX3 A;  4ZEF A;  4FED A;  1ZTY A;  2I4C A;  4QFK A;  4PFR A;  1SVX B;  4YKI A;  3RN8 A;  3VVF A;  2DWA A;  3V8X B;  3EPE A;  4PDD A;  4PFI A;  4RY1 A;  2XXH A;  5IAI A;  5M2V A;  5KCJ A;  5J1D A;  1YXI A;  2I0B A;  2PCR A;  3S9M C;  1MQG A;  1YTV A;  1Y4C A;  4PFB A;  4NHB A;  5CMB A;  3U93 A;  4FJP A;  5I59 B;  3K01 A;  5B70 A;  1HSE A;  1IMB A;  1DTZ A;  3TPA A;  4GD5 A;  1Z7N E;  3QUJ A;  1EZO A;  5ICQ A;  1OQH A;  4R74 A;  1VSO A;  2XX8 A;  4PC9 A;  2NOO A;  4OTE A;  1N3W A;  5H8H A;  1QUK A;  3E13 X;  5H8Q A;  1N7W A;  3U94 A;  3Q28 A;  1D4N A;  3FXU A;  1IQ7 A;  4U4S A;  3MVX A;  1BTJ A;  4O3B A;  1YPN A;  3RPL A;  2B3B A;  5L9S A;  5IZ1 A;  3KJ7 A;  3FJG A;  1UIV A;  1URG A;  4PQJ A;  4AS4 A;  4PFT A;  3U8Q A;  3V89 B;  3RLF E;  2B4M A;  4NF6 A;  4JBZ A;  4IB2 A;  2OWT A;  2DWI A;  3S2V A;  4X48 A;  1FTJ A;  1FW0 A;  4M4G A;  2CZK A;  3T9U A;  2OJT A;  2A5T A;  1GR2 A;  3W9W A;  2HXW A;  3H6V A;  1DTG A;  4NF0 A;  2VHA A;  4L17 A;  1MM7 A;  4MJO A;  3O28 A;  2ESN A;  4NX1 A;  4MHF A;  3H7M A;  4GBV A;  4MMP A;  5DYH A;  1MPB A;  3LC8 A;  2UVH A;  2AIX A;  1DK4 A;  2XXP A;  4EUO A;  3KEI A;  4EQ9 A;  4PBQ A;  1GTK A;  3DP6 A;  2D5W A;  1B40 A;  3RT8 A;  4ELO A;  3OSR A;  2DP8 A;  1URS A;  4EF2 A;  5FHN A;  1MQH A;  4P1E A;  1P1W A;  1LCF A;  5CMK A;  1FBE A;  4PGN A;  4U21 A;  1OLC A;  4F1Y A;  3AXF A;  4X8R A;  4N4U A;  5EQA A;  2DVZ A;  2O1L A;  4ZEI A;  4DDD A;  1N04 A;  4GQO A;  3H6U A;  2XWV A;  3FVG A;  4QFP A;  2QS1 A;  4G68 B;  4RNS A;  1ZU0 A;  4EXL A;  4FEC A;  3MJN A;  1LBW A;  4GBW A;  3PTY A;  1HSL A;  3C9H A;  5I7I A;  1YYZ A;  3PPN A;  2GHB A;  3M8U A;  1LAX A;  4H5G A;  4IO7 A;  2ALU A;  5HBC A;  2ONS A;  4H8I A;  4OYV A;  4IGR A;  1A7L A;  4F1V A;  2NUV A;  1QJM A;  3B7D A;  1BK4 A;  5J16 A;  4N8Y A;  4GWO A;  1A54 A;  2HXR A;  1QUI A;  2O7U A;  2Q88 A;  3FJ7 A;  1UIU A;  3MWB A;  4R73 A;  4POW A;  1Y20 A;  4N91 A;  2QJE A;  3OO7 A;  3TCF A;  3OXN A;  5AA2 B;  1LEV A;  2XX7 A;  3CVG A;  1EH3 A;  4ZEC A;  3BKI B;  1MXV A;  1FPD A;  2QVR A;  3VFJ A;  5IZZ A;  2ZYO A;  3A09 A;  4FAJ A;  1PBP A;  4F1U A;  3IK6 B;  4PGP A;  4PE3 A;  4FEB A;  2QMX A;  2Q89 A;  3FAT A;  1A8E A;  3FXB A;  4G8N A;  4Q30 B;  2V3T A;  4EDP A;  2R8T A;  4JXI A;  2P3N A;  1ZJL A;  2HCA A;  1FBD A;  4NE4 A;  3TOD A;  4MF3 A;  2DE3 A;  3O66 A;  3KJT A;  5AA2 D;  2B4L A;  1UTH B;  5LTC A;  1ZKB A;  4N6K A;  1ZIU A;  3KG2 A;  5A5X B;  3LUY A;  5EHS A;  1Q1K A;  1IUD A;  3T1B A;  1OLA A;  3I3V A;  5H8N B;  3MVY A;  4I9D A;  4YU0 A;  3K6V A;  2XXT A;  2CZH A;  1DMB A;  3D1R A;  3IB2 A;  3OMB A;  3LR1 A;  1B9J A;  4DI3 D;  1MH4 A;  5BUU A;  3IB0 A;  4U1O A;  4OQO A;  3H06 B;  4I8C A;  2V4C A;  1SYI A;  5JTY A;  4M1V A;  4P0G A;  3IJO B;  5TPA A;  1RYX A;  1FTK A;  3E3K A;  4OVQ A;  4PP0 A;  2PT2 A;  4PTK A;  4KD5 A;  4ZDM A;  1XT8 A;  3RPW A;  4ZE9 A;  1R9L A;  3UOR A;  2DS9 A;  4XF5 A;  5ET6 A; 
#chains in the Genus database with same CATH homology
 2HQ0 A;  4U22 A;  4DXB A;  4EF1 A;  4JSD A;  4G4P A;  3O29 A;  1P1Q A;  4TLM B;  3IO4 A;  2CZL A;  3K1N A;  3TFL A;  4PFW A;  4LA9 A;  1MXZ A;  4GL0 A;  4F22 A;  3MQ9 A;  3KSX A;  1URD A;  2KLF A;  3LSW A;  3VVD A;  1VFD A;  1OVB A;  3CR9 A;  3GBA A;  3M3L A;  3MZB A;  3EF7 A;  1SW1 A;  1II5 A;  4G8M A;  1IXC A;  5H8Q B;  3C31 A;  5I58 B;  3A3U A;  4JWO A;  4GL8 A;  2DOJ A;  3GLB A;  5AA4 A;  4THI A;  2QMW A;  3BBR A;  1YCJ A;  3ZKK A;  2XHD A;  4LQ2 A;  2F7A A;  1L5T A;  3LBS A;  3SET A;  4Z7E A;  1UQW A;  2F36 A;  4NF6 B;  1QKA A;  4Q5T A;  2XD2 A;  1B3E A;  3C4M A;  4HTG A;  2A5T B;  3KZG A;  2REG A;  1BLF A;  3N94 A;  3UIF A;  4DXU A;  4Z0I A;  1FQE A;  3HHG A;  4ND9 A;  5CMM A;  3RT6 B;  4KCD A;  1P1N A;  1DOT A;  1DPE A;  4R6Y A;  1B32 A;  1BKA A;  3IOU A;  4GVO A;  3K4U A;  1XC1 A;  1US5 A;  4QHQ A;  4X1B A;  2H9B A;  3HST A;  4OES A;  3KN7 A;  3TTM A;  3T9X B;  3QSL A;  4GFR A;  1FTO A;  4O3C A;  1N0T A;  4TOZ A;  3T22 A;  1FCK A;  2DWH A;  3CG1 A;  1USY H;  2QL3 A;  1MQD A;  4E0W A;  4OEN A;  3I5O A;  1B2H A;  3FZV A;  4MFI A;  3FV2 A;  1AOV A;  5AA2 A;  1I6A A;  1S9T A;  2I4B A;  3TTK A;  1P99 A;  4QFN A;  4XKN A;  4OER A;  3VXB A;  1IXI A;  4BDN A;  3CRB A;  3ZKL A;  4WXJ A;  2THI A;  4IY5 A;  2B65 A;  5LOM A;  1GVC A;  1P1U A;  4OFL A;  1B0H A;  5KDT B;  1POT A;  2FNC A;  2H99 A;  5H8S A;  3Q26 A;  2PVU A;  1MQJ A;  4YB5 A;  3UA8 A;  1H3D A;  4RPO A;  4P0I A;  4KYD A;  3MVZ A;  1OQG A;  3RTW B;  2V84 A;  2XX9 A;  4GLI A;  1A40 A;  3VE1 B;  1TFA A;  3T93 B;  1VR5 A;  1MDQ A;  3RQT A;  4IO6 A;  5DTB A;  3EHT A;  3L6G A;  2B3F A;  3L6H A;  4FAT A;  2QRY A;  3G7W A;  2GH9 A;  2RC9 A;  5FHM A;  5ITO A;  1VFE A;  1LLS A;  4HCW A;  3K1M A;  5I2N A;  3FJM A;  4OXV A;  1H45 A;  2ZXT A;  2VP1 A;  1QUL A;  3DM0 A;  4NMY A;  2P1S A;  1N84 A;  3K6U A;  3H3G A;  3QIM A;  3VLU A;  4YB7 A;  4RA1 A;  3PUV E;  2RCB A;  2VD3 A;  3HHF A;  1JNF A;  4RYA A;  3IOV A;  3TUS A;  2ZYN A;  3QUF A;  1ZMG A;  3G3J A;  1MS7 A;  4AB5 A;  4YZZ A;  1B4H A;  2QS4 A;  3VLW A;  4ESX A;  3H6W A;  4KHZ E;  3PU5 A;  2BJJ X;  5JTY B;  1NNT A;  4OZ9 A;  2P0S A;  2AYS A;  5I58 A;  5TPA B;  1B52 A;  1IXG A;  2RCA A;  3D4G A;  3N6T A;  4EXK A;  1Y1Z A;  2F7B A;  5HM4 B;  1M5D A;  1JEU A;  4LUB A;  1JVY A;  4ZS9 A;  4IO4 A;  3T9V A;  1SW2 A;  1LST A;  1SQY A;  3FVO A;  5I56 B;  1O64 A;  4XIG Q;  2YJP A;  1XVY A;  3I6V A;  4NF5 A;  4H67 A;  4G8H A;  5F1Q A;  2Q8J A;  3M3K A;  4ZZE A;  4XXU A;  2X7P A;  2ZNS A;  3TKD A;  1PB7 A;  3RGY A;  1A99 A;  1LAH E;  3PMW A;  4XTC Q;  2H4I A;  4H65 A;  5DVF A;  2XXI A;  5AA4 B;  3OO9 A;  4YB6 A;  3O2A A;  4WEP A;  4X1D A;  1FQD A;  1R1N A;  1Z7M E;  2F97 A;  1SI1 A;  3KN3 A;  3K2D A;  2O51 A;  3KN8 A;  1EZ9 A;  2IEE A;  4U2R A;  2REJ A;  1B46 A;  3O6I A;  2X7Q A;  3ECR A;  1NKX A;  2O1M A;  3MZ9 A;  3MC2 A;  3IR1 A;  3HN0 A;  2AL5 A;  4QF9 A;  1UTB A;  4RXL A;  2QSX A;  2Q2C A;  5AE4 A;  5CC2 A;  5KDT A;  3EQ1 A;  1Y3Q A;  1B7H A;  1MRP A;  4I62 A;  5DVI A;  2D21 A;  2HEU A;  3KOS A;  4LAT A;  2G93 A;  2DE4 A;  2F78 A;  3FD3 A;  3RY3 A;  1LCT A;  3IX1 A;  2Q2A A;  1Y4T A;  1HSJ A;  1NH7 A;  2IA4 A;  3B6Q A;  3GBB A;  2Q9T A;  4ELQ A;  3PGF A;  3PUZ E;  3VV5 A;  1M5C A;  3IL1 B;  1FQA A;  1H76 A;  4P11 A;  4AB6 A;  2VD2 A;  3R7X A;  1B7Z A;  2OWS A;  2ZNU A;  1PEB A;  1B51 A;  3PMV A;  3EHU A;  3DEL B;  4H1X A;  5KZT A;  1MXU A;  1MM6 A;  4ESW A;  5EHM A;  4RJZ A;  4GXS B;  1XVX A;  4N07 A;  4KCC A;  3MBP A;  1RKM A;  2UVJ A;  1M5F A;  3T66 A;  4GOT A;  5CBR A;  5FTH A;  1N76 A;  5CMC A;  3SES A;  3OEM A;  4IO3 A;  3B6T A;  1NNP A;  2PMS A;  4OET A;  4TLL B;  5K2X A;  3TZA A;  4C1U A;  3LSX A;  1Y9U A;  3B6W A;  4XKP A;  4C1T A;  1MXW A;  1PB8 A;  3WAE A;  1EU8 A;  4YKP A;  4U1Z A;  2Z8E A;  1B3F A;  5I2N B;  4LP2 B;  4EQ7 A;  2ZYK A;  1AL3 A;  4F18 A;  1FQB A;  2I48 A;  1ATG A;  4JSO A;  4JWY A;  2ABH A;  2XXV A;  3K00 A;  3N26 A;  1CE2 A;  2GRV A;  1LFG A;  4MLV A;  2OBG A;  1MY1 A;  1B7U A;  4QFL A;  3LSL A;  5TP9 B;  3K6X A;  3JV9 A;  4N6P A;  4YKJ A;  4NF8 B;  1PDA A;  3SKP A;  4H0W A;  3SEY A;  5I56 A;  2O69 A;  3O6H A;  3G3I A;  3E9X A;  3VLV A;  4UA8 A;  1LB9 A;  3ONM A;  2OK2 A;  4BDL A;  3W15 C;  3G3G A;  2ANJ A;  4DE8 A;  2FA7 A;  1O63 A;  4PET A;  1SW4 A;  4BDM A;  4XKQ A;  3MZ1 A;  1H44 A;  3PPP A;  2O7I A;  2F7C A;  4LON B;  2ONR A;  1MPD A;  3SER A;  1FQC A;  4O3A A;  3RNN A;  4HS7 A;  1LBB A;  3K02 A;  1LFI A;  3S9E A;  2QPQ A;  2ZMB A;  1BP5 A;  1Y3N A;  3TCG A;  3S9N C;  3PUX E;  1NMU A;  4NF5 B;  3QXM A;  3RUM A;  4F29 A;  4F31 B;  2DQV A;  4BLA A;  1R9Q A;  2R9J A;  4KYS A;  4OEU A;  1SBP A;  5K2Y A;  1JW5 A;  4R9G A;  2R71 A;  4KI0 E;  4F3P A;  3QYT A;  4ZEB A;  3EHS A;  4Q8R A;  1AH5 A;  4LVQ A;  2F35 A;  3TEL A;  4R6H A;  3TTN A;  5I57 A;  3R26 A;  3HPI A;  4DCX A;  4GXA A;  3ODB A;  4RK9 A;  3RTF B;  4DLD A;  3U72 A;  3HV1 A;  4FIM A;  4F2O A;  3W9V A;  3O97 A;  5CBS A;  3GZG A;  3DP8 A;  4QSE A;  1UTB B;  2D3I A;  1D9Y A;  4U23 A;  4HW8 A;  3CSG A;  1GV8 A;  1EZP A;  5ITP A;  5EYF A;  2H25 A;  3E4R A;  1FQF A;  3HO7 A;  3H4Z A;  1MY0 A;  3TDJ A;  1AIV A;  1H43 A;  4ZZA A;  4ZED A;  3OEN A;  3CFX A;  4GF8 A;  2RIN A;  1OIB A;  1IXH A;  4JWX A;  2CMO A;  4YAH X;  4TQU Q;  5ISU A;  5DT6 A;  5DEX B;  3C34 A;  4I1D A;  4OWD A;  3UP9 A;  2HZL A;  4Q0C A;  1MPC A;  5DVJ A;  2F6G A;  4BDO A;  4NED A;  3PMX A;  4JDF A;  4KR5 A;  4ECF A;  2Z22 A;  3CFL A;  4MH5 A;  3TQW A;  3USD A;  3LSF B;  3PPO A;  4KFQ A;  4GRK A;  2HFB A;  3THI A;  3PPQ A;  4R72 A;  1SDX A;  4PFY A;  2OZZ A;  2VOZ A;  1OVT A;  3MPL A;  3OOA A;  4FE8 A;  3FUZ A;  5HPQ A;  1B5H A;  4HCY A;  1M5B A;  5H8F A;  3OSQ A;  5TP9 A;  2Z8D A;  4OMB A;  1B58 A;  3FV1 A;  1GGG A;  4F3G A;  4NWD A;  1MQI A;  2Y7P A;  1MXY A;  3KOT A;  4NF8 A;  1D9V A;  2UXA A;  3DP4 A;  1ZLQ A;  3N5L A;  3Q27 A;  4F39 A;  3PV0 E;  1F9B A;  1TXF A;  1NFT A;  2P2A A;  2OLB A;  1DSN A;  2AL4 A;  2PT1 A;  4YMB A;  1MY4 A;  1B4Z A;  1JVX A;  4H8J A;  1POY 1;  1AMF A;  1LB8 A;  4G68 C;  4NWC A;  2QS3 A;  3K6W A;  1LBC A;  1WVJ A;  1QVS A;  2Z23 A;  1NNF A;  1MDP 1;  4QRZ A;  2Y7W A;  4KQP A;  2UYE A;  3MUQ A;  3CSB A;  4ISU A;  4U4X A;  3TEP A;  3TCH A;  4LZ7 A;  2DXY A;  5L8D A;  3FXR A;  3MP1 A;  2NVU B;  2UVG A;  4YIC A;  2XXW A;  1DPP A;  1RYO A;  3SEV A;  5I84 A;  2DYX A;  3KBR A;  2M8C A;  3K1P A;  3V83 A;  1PC3 A;  5CI5 A;  1JW4 A;  4F3S A;  3VXC A;  1B3G A;  5L9O A;  1I69 A;  2QS2 A;  3IO6 A;  1LGB C;  3BFT A;  3S9L C;  1A8F A;  1IEJ A;  2NXO A;  2ZNT A;  3V5A A;  3CI8 A;  2XXX A;  4KYE A;  1XOC A;  2XXR A;  3UN6 A;  3IOT A;  5TU0 A;  4K3F A;  1KWH A;  4GIZ A;  2RC7 A;  2O84 X;  1IIT A;  2YLN A;  3IJX B;  3SDF A;  2DWJ A;  1JW1 A;  3S4U A;  2Z8F A;  3JZJ A;  3VVE A;  2E1S A;  3FVK A;  3FAS A;  4R75 A;  4BDR A;  2F5X A;  4QFO A;  2Y7K A;  3C33 A;  1FTL A;  2LAO A;  4POX A;  3MVW A;  4MBP A;  4N13 A;  3PPR A;  1NL5 A;  2Y7R A;  4OFJ A;  3OEK A;  3JYR A;  3KGC A;  2Y7I A;  1S50 A;  3QK6 A;  2V3Q A;  5CRY A;  3G3H A;  3MPK A;  3U92 A;  2F8D A;  2XXU A;  1MXX A;  5I57 B;  5BWJ A;  3C35 A;  2PBW A;  4DZ1 A;  5I2K B;  2O68 A;  2PX1 A;  2A5S A;  3OD7 A;  5DEX A;  2VGQ A;  1SYH A;  3R6U A;  3SEX A;  1B6H A;  1FTM A;  5JK4 A;  1US4 A;  1TT1 A;  1QW0 A;  4NF4 A;  1MY2 A;  2UYF A;  1B3L A;  3ZS6 A;  3U1O A;  1ZBM A;  1Y1M A;  3F11 A;  4G2Z A;  3C36 A;  3OEL A;  2RC8 A;  1N3X A;  1TWY A;  5AA1 A;  4ZE8 A;  1N7X A;  3SEU A;  1I6Q A;  1JEV A;  3D4C A;  3UGW A;  3H03 A;  3T9H B;  4E0X A;  1NNK A;  1Y3P A;  4QSC A;  2DE2 A;  4LZ8 A;  2I3W A;  5IKB A;  2F6P A;  3ILU B;  1YAE A;  1I6B A;  1WOD A;  4R2F A;  3Q29 A;  3T96 B;  2I49 A;  1LAF E;  3HCQ A;  5I59 A;  4KPT A;  3FIR A;  2PYY A;  3CG3 A;  1LFH A;  5ICT A;  2Y84 A;  1JET A;  4PE5 B;  1MH3 A;  1BIY A;  2V93 A;  5H8F B;  2GHA A;  2YPN A;  2XXQ A;  1XHY A;  4OFO A;  3FXQ A;  4YMA A;  3A3C A;  2DVC A;  4X9T A;  4EQB A;  4PFU A;  4ONY A;  1D3K A;  1ELJ A;  2NWJ A;  2X26 A;  2FYI A;  5KCJ B;  1MY3 A;  2HAV A;  1O7T A;  5AA3 A;  4RPN A;  3PD8 A;  2OCU A;  2XD3 A;  1XS5 A;  3ILT B;  4R6K A;  2H5Y A;  4G77 A;  3UK4 A;  3FGS A;  1PB9 A;  3PD9 A;  4IO2 A;  3IOW A;  1MG1 A;  3MP8 A;  5H8H B;  5ELV A;  3SEW A;  1B3H A;  2HAU A;  2O6A A;  3CIJ A;  3M3F A;  1J1N A;  5JEI A;  3TTR A;  4QSD A;  3ZSF A;  2V3U A;  4R9F A;  4OVJ A;  5L9M A;  4H5F A;  4ELR A;  3MP6 A;  4YKK A;  2XXY A;  2ONK E;  4BDQ A;  1P1O A;  3QAX A;  2I58 A;  3K0V A;  1USY E;  2I6E A;  1JQF A;  2I0C A;  3WAF A;  1WDN A;  1SD3 A;  3TQL A;  3N6U A;  1R6Z A;  4G68 A;  1SW5 A;  3C32 A;  4AQ4 A;  3OO6 A;  1T0K A;  4ZEK A;  3H6T A;  3O6G A;  3O9P A;  3G3F A;  1B5I A;  1B1X A;  3PUW E;  1ANF A;  3Q25 A;  1A55 A;  2UVI A;  3IB1 A;  4IGT A;  4DIG A;  4NTL A;  1TFD A;  1S7Y A;  1B5J A;  4IY6 A;  5I2K A;  3G3K A;  2E0S A;  4IO5 A;  4OEV A;  4FOR A;  1CB6 A;  3TYH A;  3IAZ A;  2I3V A;  2DSF A;  1QUJ A;  1Q35 A;  3PUY E;  4LQ5 A;  2GFE A;  1B05 A;  1PBQ A;  4C0R A;  3BFU A;  5FTI A;  3EN3 A;  4R2B A;  5FHO A;  2RKM A;  2HZK A;  5CM6 A;  1IIW A;  4OHN A;  4XKR A;  3KFM A;  3DLN A;  2H98 A;  2WKY A;  3IOR A;  4RK2 A;  1M5E A;  1NH8 A;  1B1H A;  1IZ1 A;  4ELP A;  3CFZ A;  1B0L A;  4F3B A;  2W7Y A;  2G29 A;  4WKM A;  2F34 A;  4F19 A;  5B7D A;  4UAC A;  3MW0 A;  3MAM A;  3TAJ A;  4JB7 A;  1SI0 A;  1QKB A;  2ZYM A;  3TTL A;  1UTH A;  4NF4 B;  3FVN A;  4F2Q A;  5A5X A;  4H6D A;  3TMG A;  4WED A;  2R6G E;  4LZ5 A;  4DXC A;  5H8N A;  4MLQ A;  2V25 A;  5F7V A;  3OO8 A;  3P7I A;  3KSJ A;  1OMP A;  1VE4 A;  1LAG E;  4DCY A;  2RF1 A;  2DXR A;  3VDF A;  3GXA A;  4ZEF A;  4FED A;  1ZTY A;  2I4C A;  4QFK A;  1SVX B;  4YKI A;  3RN8 A;  3VVF A;  2DWA A;  3V8X B;  3EPE A;  4RY1 A;  2XXH A;  5IAI A;  5M2V A;  5KCJ A;  5J1D A;  2I0B A;  3S9M C;  1MQG A;  1YTV A;  1Y4C A;  5CMB A;  3U93 A;  4FJP A;  5I59 B;  3K01 A;  5B70 A;  1HSE A;  1DTZ A;  3TPA A;  4GD5 A;  1Z7N E;  3QUJ A;  1EZO A;  5ICQ A;  1OQH A;  4R74 A;  1VSO A;  2XX8 A;  2NOO A;  4OTE A;  1N3W A;  5H8H A;  1QUK A;  3E13 X;  5H8Q A;  1N7W A;  3U94 A;  3Q28 A;  1D4N A;  3FXU A;  1IQ7 A;  4U4S A;  3MVX A;  1BTJ A;  4O3B A;  1YPN A;  5L9S A;  2B3B A;  3KJ7 A;  3FJG A;  1UIV A;  1URG A;  4PQJ A;  4PFT A;  3U8Q A;  3V89 B;  3RLF E;  4NF6 A;  4JBZ A;  4IB2 A;  2OWT A;  2DWI A;  3S2V A;  4X48 A;  1FTJ A;  1FW0 A;  4M4G A;  3T9U A;  2OJT A;  2A5T A;  1GR2 A;  3W9W A;  2HXW A;  3H6V A;  1DTG A;  2VHA A;  4L17 A;  1MM7 A;  3O28 A;  2ESN A;  3H7M A;  5DYH A;  1MPB A;  3LC8 A;  2UVH A;  2AIX A;  2XXP A;  4EUO A;  3KEI A;  4EQ9 A;  1GTK A;  3DP6 A;  2D5W A;  4ELO A;  3RT8 A;  1B40 A;  3OSR A;  2DP8 A;  1URS A;  4EF2 A;  5FHN A;  1MQH A;  1P1W A;  1LCF A;  5CMK A;  4U21 A;  1OLC A;  4F1Y A;  3AXF A;  2DVZ A;  2O1L A;  4ZEI A;  4DDD A;  1N04 A;  4GQO A;  3H6U A;  3FVG A;  4QFP A;  2QS1 A;  4G68 B;  1ZU0 A;  4RNS A;  4EXL A;  4FEC A;  3MJN A;  1HSL A;  3C9H A;  3PPN A;  2GHB A;  3M8U A;  1LAX A;  4H5G A;  4IO7 A;  2ALU A;  5HBC A;  2ONS A;  4H8I A;  4OYV A;  4IGR A;  1A7L A;  4F1V A;  2NUV A;  1QJM A;  3B7D A;  4GWO A;  1A54 A;  1QUI A;  2O7U A;  2Q88 A;  3FJ7 A;  1UIU A;  3MWB A;  4R73 A;  4POW A;  1Y20 A;  2QJE A;  3OO7 A;  3TCF A;  3OXN A;  5AA2 B;  2XX7 A;  3CVG A;  1EH3 A;  4ZEC A;  3BKI B;  1MXV A;  3VFJ A;  2ZYO A;  3A09 A;  4FAJ A;  1PBP A;  4F1U A;  3IK6 B;  4FEB A;  2QMX A;  2Q89 A;  3FAT A;  1A8E A;  4G8N A;  4Q30 B;  2V3T A;  4EDP A;  4JXI A;  1ZJL A;  2HCA A;  4NE4 A;  3TOD A;  4MF3 A;  2DE3 A;  3O66 A;  3KJT A;  5AA2 D;  1UTH B;  1ZKB A;  1ZIU A;  3KG2 A;  5A5X B;  3LUY A;  5EHS A;  1Q1K A;  1IUD A;  1OLA A;  3I3V A;  5H8N B;  4YU0 A;  3MVY A;  4I9D A;  3K6V A;  2XXT A;  1DMB A;  3IB2 A;  3OMB A;  3LR1 A;  1B9J A;  1MH4 A;  5BUU A;  3IB0 A;  4U1O A;  4OQO A;  3H06 B;  4I8C A;  1SYI A;  5JTY A;  4M1V A;  4P0G A;  3IJO B;  5TPA A;  1RYX A;  1FTK A;  3E3K A;  4PP0 A;  2PT2 A;  4KD5 A;  4ZDM A;  1XT8 A;  3RPW A;  4ZE9 A;  1R9L A;  3UOR A;  2DS9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...