1IQ7A

Ovotransferrin, c-terminal lobe, apo form
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
343
structure length
341
Chain Sequence
RIQWCAVGKDEKSKCDRWSVVSNGDVECTVVDETKDCIIKIMKGEADAVALDGGLVYTAGVCGLVPVMAERYDDESCSKDERPASYFAVAVARKDSNVNWNNLKGKKSCHTAVGRTAGWVIPMGLIHNRTGTCNFDEYFSEGCAPGSPPNSRLCQLCQGSGGIPPEKCVASSHEKYFGYTGALRCLVEKGDVAFIQHSTVEENTGGKNKADWAKNLQMDDFELLCTDGRRANVMDYRECNLAEVPTHAVVVRPEKANKIRDLLERQEKRFGVNGSEKSKFMMFESQNKDLLFKDLTKCLFKVREGTTYKEFLGDKFYTVISSLKTCNPSDILQMCSFLEGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Metal transport
molecule keywords Ovotransferrin
publication title Anion-mediated Fe3+ release mechanism in ovotransferrin C-lobe: a structurally identified SO4(2-) binding site and its implications for the kinetic pathway.
pubmed doi rcsb
total genus 102
structure length 341
sequence length 343
ec nomenclature
pdb deposition date 2001-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00405 Transferrin Transferrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1iq7A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1iq7A02
3THIA 3BFTA 3CFXA 4ZEBA 2YJPA 3FD3A 1M5BA 5JTYB 3MZ9A 3O6HA 4I1DA 4R2FA 5AA2A 3IR1A 5ISUA 2XX8A 4XKQA 3TPAA 1MRPA 3ZSFA 4UACA 3BKIB 1NNTA 1OMPA 3E4RA 1MXZA 4JBZA 4TLLB 4WKMA 3W15C 3QK6A 1ZTYA 4QSEA 1B3HA 4MLVA 4JWOA 1MQDA 4KD5A 4OFLA 3C9HA 4QRZA 3KN7A 2NVUB 2PT1A 1AOVA 3Q25A 5KZTA 3S9NC 1BKAA 4ESXA 2F6PA 2F7BA 3USDA 3S9LC 5CBRA 1MPBA 3VLUA 3U8QA 2UVHA 3C31A 4F2QA 5I2KA 1M5FA 4QFKA 4QF9A 1OQHA 4U4XA 1M5DA 4I8CA 1I6BA 3T9VA 3TEPA 3PMWA 3T66A 1GVCA 4N13A 3IB1A 1TFDA 4PQJA 1LBBA 1GR2A 3KSXA 4HCWA 4Q0CA 3TZAA 1ELJA 3K1NA 4RA1A 5TPAB 3MVZA 1SI1A 3CFLA 2DS9A 4H67A 3UK4A 4OYVA 2NWJA 1MQGA 1JVXA 1MXYA 5ICTA 2Z8DA 2ZNTA 3PUYE 4RY1A 1YPNA 4ISUA 2DWJA 4JSDA 5DVJA 5I58A 1DOTA 5DEXB 4R6YA 4JDFA 3KG2A 5FHMA 4Q30B 1P1OA 4DXUA 3K2DA 1S50A 3IORA 4DLDA 3FVOA 1JNFA 3ECRA 4OERA 3KSJA 4G8HA 4FE8A 4E0XA 3OO7A 1N7XA 4GRKA 4F19A 1VSOA 1JVYA 1NMUA 1R1NA 4ONYA 1OQGA 3R7XA 1Z7NE 1JQFA 4R72A 3Q28A 1N3WA 3SEUA 3FXQA 4QSCA 3RT8A 1VFEA 3LSFB 4NF6A 3U92A 1PBPA 1FW0A 3PD8A 2FNCA 1XT8A 4THIA 4I9DA 5HBCA 3IJOB 2I3VA 3VLWA 1FCKA 5FTIA 5K2XA 3FJ7A 3SESA 3KJ7A 3W9VA 1FQEA 3TFLA 5M2VA 2ALUA 1NNPA 2V3QA 3FV1A 2GHAA 1FTOA 1LAHE 3S4UA 4LA9A 2A5SA 2XHDA 4OHNA 4OVJA 2UXAA 1I6AA 1NL5A 5F7VA 1HSLA 3UIFA 4ZZEA 2Y7KA 4G8NA 2O7IA 3FVNA 1GV8A 2QS3A 3O9PA 3GXAA 4DXCA 5H8QB 4H65A 2AL4A 3FZVA 5H8NB 1HSEA 4POXA 2DE4A 3CG3A 2QRYA 4GLIA 3FJMA 1MXVA 2ZNSA 3TQLA 5KDTA 2H5YA 3QSLA 5L9OA 4BDNA 4R6KA 4PFYA 1YAEA 3MJNA 4H5GA 5KCJB 1AMFA 3VE1B 1TT1A 4GF8A 4EQBA 1O63A 2G29A 1N04A 1IXCA 1RKMA 1B7ZA 4F31B 3LR1A 5BUUA 1SYIA 3K0VA 1TWYA 3TCHA 5I2NB 4O3BA 3BFUA 1EZ9A 2XXVA 1CE2A 2IA4A 4XXUA 2DXRA 3HPIA 3WAFA 2I49A 4RNSA 1RYXA 2UVIA 2WKYA 4H0WA 4EF1A 2Q2CA 2E1SA 4ZZAA 2R71A 4GL8A 4O3AA 1UTHA 3MPLA 4U2RA 4F1YA 3H4ZA 1MY1A 3MPKA 3FVKA 2XD3A 1B3LA 4NMYA 1IXGA 5L9SA 1R9QA 4LZ5A 2DWHA 1IXHA 1EH3A 3A3CA 1B6HA 1YCJA 3IL1B 4DCXA 1MH3A 1DPEA 3JZJA 2DOJA 4ZDMA 4ZS9A 3IOWA 3OXNA 3PGFA 1B1HA 1B3GA 4HCYA 1ZJLA 4U23A 5ITPA 2ABHA 2HEUA 2F35A 1DMBA 3LC8A 2Q2AA 3IJXB 3MZ1A 2O84X 5CBSA 5H8HA 4RYAA 4KCCA 1LCFA 2Y7WA 4OMBA 3O66A 4YKKA 1GTKA 3PUWE 4R73A 3K02A 4XKRA 5EYFA 4PETA 4G2ZA 2PVUA 4QFLA 4FJPA 3MWBA 5IAIA 1NNFA 2Q89A 5LOMA 4F22A 2XXXA 1PEBA 3TCGA 3MQ9A 1UTBA 3C33A 2VD2A 4M4GA 1GGGA 1LFGA 4KYDA 1LFHA 4C1UA 3VDFA 4EUOA 1MDQA 4IO3A 1OVTA 4ZEIA 4UA8A 3CSBA 1N0TA 1KWHA 1EU8A 1B0LA 5TPAA 4X1DA 1N84A 2ZYOA 3DM0A 3H6TA 3R26A 5F1QA 4FEBA 2VHAA 5TU0A 1MQJA 1OLCA 3OELA 3HCQA 1D4NA 2I0BA 1SD3A 4OEUA 2F78A 4F18A 3MZBA 4OEVA 3E13X 3EHSA 2DSFA 3EQ1A 4OETA 1N3XA 2UVJA 2OK2A 1II5A 4OWDA 4NWCA 2A5TB 3EPEA 4U1ZA 3PD9A 4YKIA 2IEEA 3IAZA 4DXBA 4GXAA 2KLFA 2I0CA 3N5LA 2PYYA 5DTBA 5AA2D 4KR5A 3VVFA 3VVDA 5A5XB 2PX1A 3SKPA 2HZKA 2GFEA 3TDJA 3F11A 4OXVA 3FVGA 1PB9A 3G3FA 4U1OA 1P1WA 1B7UA 4G68B 3V8XB 3RQTA 5JEIA 3QAXA 1MM7A 2RC9A 3TMGA 2HAUA 4BDOA 3BBRA 3OO8A 4LATA 1O64A 1QUIA 2OWTA 3MUQA 3MP1A 5I57B 4NF5A 3DLNA 3PMXA 2O69A 3O2AA 1ZLQA 3PPQA 1A55A 1SW2A 3IB0A 1R6ZA 4LP2B 3PV0E 1NH8A 5DT6A 4F3SA 3B6TA 1UIUA 3G3GA 1H44A 1P99A 1H3DA 4OENA 3TTMA 3QXMA 2ZYKA 1POTA 2H98A 2P0SA 1B32A 2W7YA 4NF4B 3H3GA 1AL3A 3OMBA 2ZYNA 3QUFA 1MPDA 4LVQA 4YKPA 4EF2A 3O6GA 2Y7PA 1D3KA 3OENA 3T9HB 1B5IA 4EQ7A 5CRYA 3PUZE 4GWOA 5H8SA 4EDPA 3PPRA 1TXFA 3R6UA 1FQCA 4FATA 1DPPA 4DIGA 3MP6A 3MVXA 5ITOA 3OO6A 1HSJA 4H8IA 3OO9A 2R6GE 2VD3A 2Y7IA 4ZE9A 2I6EA 2Z22A 2O6AA 3LBSA 4OZ9A 1H43A 1ZIUA 3MBPA 5CC2A 3TKDA 1Y3PA 2XXRA 3G3JA 5I56B 1B4HA 4LQ2A 4F1UA 3RTFB 4R75A 3LSXA 5L8DA 1FQDA 4YB5A 1IQ7A 4KQPA 3T93B 2FYIA 3WAEA 3CSGA 3K1PA 5ELVA 4OESA 2OWSA 3PU5A 4NTLA 4TLMB 5H8FA 2Z8EA 3ILUB 2DXYA 2FA7A 3KEIA 1PB8A 2X7QA 2RCBA 4JSOA 1M5EA 4FORA 1ZMGA 1UQWA 1MQHA 1PB7A 1I6QA 4LZ8A 2D3IA 3D4GA 5TP9A 4MLQA 2OBGA 5DVFA 4K3FA 4KI0E 1POY1 3V89B 2RF1A 4I62A 1VR5A 4JWXA 3HO7A 3TTLA 3O97A 3PUXE 5AA4A 4ZEKA 5I59B 4ZEFA 1LFIA 1MPCA 2RC7A 3QUJA 4IGTA 4POWA 4IY6A 1A99A 5AA2B 1QKBA 4RPOA 3KJTA 4WXJA 4Z7EA 1EZOA 3HV1A 2R9JA 4GIZA 3GBAA 4IB2A 1LB8A 2G93A 1N7WA 3AXFA 3H6UA 3ILTB 2H9BA 4WEPA 1Q1KA 3SEWA 4YU0A 4NF8A 3KOSA 3LSWA 4GXSB 1MY3A 4YAHX 4QFPA 3K1MA 1BTJA 3H06B 1B40A 3QIMA 5CMKA 3K6WA 2BJJX 2UVGA 3OSRA 4XKPA 4BLAA 2QS4A 2Q9TA 4QHQA 5HM4B 2O7UA 4YZZA 5FTHA 4G68C 3JV9A 1ANFA 5I2KB 1URSA 2DVCA 3P7IA 4O3CA 3RLFE 3PUVE 3I5OA 2HZLA 2QS2A 1FQBA 1SQYA 1WODA 1Y20A 2GRVA 1SYHA 2V93A 4DZ1A 1NH7A 3T22A 3TELA 4AB6A 3JYRA 1LAXA 1QW0A 3RGYA 2XXYA 2REGA 3C36A 4KYEA 3KN8A 1MG1A 4H8JA 3S9EA 1B2HA 4L17A 3H7MA 3T9UA 1LLSA 4ZEDA 5JTYA 2ZMBA 4R2BA 1IITA 3RTWB 1A8FA 3EF7A 3T9XB 1PC3A 4RXLA 3U93A 4XTCQ 1XVYA 3CRBA 3TODA 5I84A 3Q29A 3MP8A 3KGCA 4NE4A 3K01A 1H45A 3OSQA 2DQVA 3HSTA 4YMAA 1DTGA 1MDP1 1T0KA 3TQWA 1H76A 2ZNUA 4R6HA 4NF6B 3MW0A 1I69A 1JEVA 2B3FA 4X9TA 2ZYMA 2YPNA 2ANJA 4AB5A 2OLBA 1XS5A 1WVJA 1D9YA 3IO6A 2CMOA 2XXUA 4FAJA 4GD5A 3IOVA 1NNKA 1XVXA 3UA8A 4C1TA 2V3TA 3PPNA 1AIVA 4EQ9A 1URDA 4XIGQ 1MXUA 2Q88A 4PFTA 4NF4A 3K6UA 4QFOA 4IY5A 1N76A 3G7WA 3M8UA 1PDAA 2F6GA 5JK4A 4BDMA 2RINA 4NEDA 3O29A 4MFIA 1JETA 4Z0IA 3C4MA 3U72A 5IKBA 1B52A 1SVXB 3N6TA 3ODBA 4ZECA 5KDTB 3HHGA 3H6WA 1Y1MA 1Z7ME 4F3GA 3KFMA 4IO2A 1QULA 1LCTA 3I6VA 2VP1A 2OCUA 4G4PA 4F29A 1O7TA 1MY0A 3SEXA 1Y3NA 3U1OA 4RJZA 5DEXA 4TOZA 3DP8A 3C32A 3EHUA 4HS7A 2HCAA 4ELPA 2QSXA 4G8MA 1A54A 1SW5A 2HAVA 4KCDA 3IK6B 5L9MA 2F97A 3B6QA 4QFNA 4U21A 2I48A 4H5FA 3ZS6A 4X48A 1B5HA 1XOCA 2V84A 5CMMA 1SBPA 1QJMA 2REJA 1Q35A 4ND9A 3D4CA 1UTHB 3E3KA 4PE5B 3OEKA 4RPNA 4R9FA 5I59A 4EXLA 3FXRA 1XHYA 3UORA 3K4UA 4FEDA 4LONB 4N6PA 1PBQA 4IO6A 4HTGA 5BWJA 2VGQA 3FUZA 4DCYA 1IEJA 5AA1A 4H1XA 1P1QA 1SW1A 3FJGA 4XKNA 3B7DA 2RKMA 4WEDA 3FV2A 3LUYA 3TAJA 1RYOA 2H99A 1MXWA 3TYHA 4OFJA 3CVGA 5H8QA 2QMWA 2I58A 2XXHA 2Z23A 3OOAA 1YTVA 1OLAA 3KZGA 2HQ0A 4MF3A 1QVSA 1NFTA 5H8NA 2Y7RA 3FASA 4BDQA 4M1VA 1BLFA 4OQOA 5H8HB 1USYE 1Y3QA 3EHTA 2DWIA 3IB2A 5EHMA 4ECFA 2QL3A 2XXTA 3IX1A 4QSDA 2F7CA 2NUVA 4F1VA 3VXBA 1SW4A 3RPWA 3EN3A 2PT2A 3DP6A 1J1NA 3VV5A 1VFDA 3DP4A 3PPOA 2UYFA 5KCJA 3TUSA 1FTLA 2ONKE 3GBBA 4IO5A 1URGA 3G3IA 2X26A 2DP8A 2NOOA 1S7YA 3H6VA 1CB6A 2I4CA 4LUBA 3MVWA 1UTBB 5I2NA 1EZPA 2F5XA 1B5JA 2AIXA 2PMSA 3SEVA 2Q8JA 2M8CA 3TCFA 3S2VA 5FHOA 4BDLA 1B3EA 1QKAA 4PFWA 4Q8RA 1D9VA 1P1NA 1US4A 1LAGE 3OD7A 4KHZE 3HHFA 2F34A 4F2OA 3PMVA 3G3HA 1L5TA 4ELRA 3SETA 1MY4A 3V5AA 2NXOA 4JXIA 3VLVA 3N6UA 1FTJA 3TTRA 1ZU0A 3MAMA 1FTMA 2I4BA 2UYEA 2E0SA 1WDNA 4U4SA 3M3KA 4MH5A 1JEUA 4GFRA 2HXWA 3G3KA 2PBWA 2O1MA 1SI0A 4AQ4A 1B4ZA 5HPQA 5EHSA 1LBCA 1OVBA 2ONSA 2P2AA 3PPPA 4EXKA 3V83A 3KN3A 4OTEA 5DYHA 5CMBA 1B58A 1B51A 3O28A 4YMBA 1B7HA 2QJEA 3CIJA 4P11A 1NKXA 5J1DA 2AYSA 4PP0A 2DWAA 1BIYA 2XD2A 1DSNA 3GLBA 5CMCA 1A8EA 4IO7A 1IXIA 2V3UA 1F9BA 2XXWA 1B9JA 1AH5A 1FQAA 3ONMA 1USYH 4JB7A 1Y9UA 2DE3A 2DVZA 1ZBMA 2D21A 4F3BA 1R9LA 4E0WA 3M3LA 3I3VA 4NF5B 3MVYA 5ICQA 1LGBC 2B3BA 4GOTA 1IUDA 3FIRA 3W9WA 3OEMA 4U22A 1M5CA 2RCAA 2AL5A 4NWDA 4Q5TA 4YICA 4F39A 4YKJA 2B65A 4PFUA 3SERA 3QYTA 3UN6A 3SDFA 3FXUA 3CI8A 5K2YA 3RNNA 1Y4TA 2ZXTA 3MC2A 4FECA 3CFZA 3S9MC 4ELOA 1MXXA 5AE4A 3LSLA 1IZ1A 1A7LA 4GQOA 3B6WA 1BP5A 3C34A 2A5TA 3RN8A 2VOZA 1B0HA 2Z8FA 4LQ5A 3GZGA 1MS7A 5B70A 1XC1A 2XXQA 4P0GA 2QPQA 2YLNA 3UP9A 1JW4A 2F7AA 3T96B 2I3WA 4R9GA 4KFQA 4DE8A 3O6IA 3CR9A 3KBRA 1IIWA 4GVOA 5I58B 2XX7A 1VE4A 4G77A 2OJTA 3VXCA 4HW8A 1LB9A 5A5XA 4F3PA 1JW5A 2GH9A 4JWYA 5AA3A 5H8FB 4G68A 3K6VA 4GL0A 3N26A 1ATGA 2X7PA 1UIVA 2H25A 5FHNA 4LZ7A 5TP9B 3CG1A 4IO4A 5CM6A 3IOUA 3E9XA 1S9TA 2D5WA 1DTZA 2QS1A 4N07A 3N94A 1TFAA 5I57A 3FATA 5AA4B 3VVEA 3FGSA 1MM6A 2V25A 4KYSA 1QUKA 2DYXA 3TTKA 4P0IA 2CZLA 4ESWA 1MY2A 2DE2A 5B7DA 3UGWA 3RUMA 3TTNA 3Q27A 3C35A 3RT6B 3H03A 3K6XA 2XXPA 4YB7A 2O68A 2OZZA 4RK9A 4BDRA 2O51A 4NF8B 3A3UA 1B3FA 2Y84A 3Q26A 3ZKLA 1MH4A 1ZKBA 2XXIA 4OFOA 4MBPA 1Y4CA 1B05A 2RC8A 1OIBA 1QUJA 2HFBA 4TQUQ 1Y1ZA 2THIA 4DDDA 2GHBA 1MQIA 2F8DA 3SEYA 3IOTA 4RK2A 3IO4A 2QMXA 3KOTA 5I56A 1LAFE 1B46A 1US5A 2P1SA 3RY3A 2O1LA 2LAOA 3A09A 4IGRA 4X1BA 1SDXA 4R74A 4H6DA 4ELQA 4ZE8A 3K00A 4C0RA 1FQFA 1LSTA 2ESNA 4YB6A 1FTKA 4KPTA 1JW1A 1B1XA 4FIMA 3L6GA 3L6HA 3VFJA 3ZKKA 3U94A 5DVIA 3M3FA 3HN0A 1A40A 2F36A 2H4IA 2XX9A 1P1UA 2ONRA 3DELB 5CI5A
chains in the Genus database with same CATH superfamily
3THIA 3BFTA 3CFXA 4ZEBA 2YJPA 3FD3A 1M5BA 4NN3A 5JTYB 3MZ9A 3O6HA 4GWSA 5IZ3B 2DDKA 1YXIA 4I1DA 4MEVA 4R2FA 1LBVA 5AA2A 3IR1A 5ISUA 2XX8A 4XKQA 3A29A 3TPAA 1MRPA 5ET7A 3ZSFA 4UACA 5IGAA 2WX9A 1INPA 2L5VA 4NF0A 3BKIB 4AS5A 2OWZA 4OVQA 5EQ9A 4PCDA 1NNTA 1OMPA 3E4RA 1MXZA 4JBZA 4TLLB 4WKMA 3W15C 3QK6A 1ZTYA 4QSEA 1B3HA 4MLVA 3PTYA 4JWOA 4LN5A 1MQDA 4KD5A 4OFLA 1FBCA 3C9HA 4QRZA 3KN7A 2NVUB 2PT1A 1AOVA 3Q25A 5KZTA 2QVRA 3S9NC 5IM2A 1BKAA 4ESXA 4PGNA 2F6PA 2F7BA 3USDA 3S9LC 5CBRA 4MCOA 1MPBA 3VLUA 3U8QA 2UVHA 3C31A 4F2QA 4NQ8A 5I2KA 1M5FA 4QFKA 4QF9A 1OQHA 4U4XA 1M5DA 4I8CA 1I6BA 4OVSA 5EYHA 3T9VA 5F24A 2B4MA 2VPOA 3TEPA 3PMWA 3T66A 1GVCA 4N13A 3IB1A 1DBZA 1TFDA 4PQJA 1LBBA 1GR2A 3KSXA 4MMPA 4GWUA 4HCWA 4Q0CA 3TZAA 1ELJA 2KQZA 3K1NA 4RA1A 5TPAB 3MVZA 1SI1A 3CFLA 2DS9A 4H67A 3UK4A 4OYVA 2NWJA 1MQGA 1JVXA 1MXYA 5ICTA 4JVCA 2Z8DA 4PDHA 2ZNTA 3PUYE 4RY1A 4OANA 1YPNA 4ISUA 5I3SA 2DWJA 4JSDA 5DVJA 5I58A 1DOTA 5DEXB 4R6YA 4JDFA 3KG2A 5FHMA 4Q30B 1P1OA 4DXUA 1NV4A 3K2DA 1XI6A 1S50A 3IORA 4DLDA 3FVOA 1JNFA 3ECRA 4OERA 3KSJA 4I3EA 4G8HA 4FE8A 4E0XA 3OO7A 1N7XA 4GRKA 4F19A 1VSOA 1JVYA 1NMUA 1R1NA 4ONYA 1OQGA 3R7XA 1Z7NE 1JQFA 4R72A 3Q28A 1N3WA 3SEUA 3FXQA 4QSCA 3RT8A 1VFEA 3LSFB 4NF6A 3U92A 1PBPA 1FW0A 3PD8A 5LDZA 2FBPA 2FNCA 4PBQA 2ZZVA 1XT8A 1DCUA 4THIA 4I9DA 5HBCA 3IJOB 2I3VA 3VLWA 1FCKA 5FTIA 5K2XA 3FJ7A 3SESA 3KJ7A 4G61A 3W9VA 4H45A 1FQEA 3TFLA 2OX3A 5M2VA 2ALUA 1NNPA 2V3QA 3FV1A 2GHAA 1FTOA 4O7MA 1LAHE 2F3DA 3S4UA 4LA9A 2A5SA 2XHDA 4OHNA 4OVJA 2UXAA 1I6AA 1NL5A 5F7VA 1HSLA 3UIFA 4ZZEA 4QXDA 2Y7KA 4G8NA 2O7IA 3FVNA 1GV8A 4GX4A 2QS3A 3O9PA 4H46A 3GXAA 4DXCA 5H8QB 4H65A 2AL4A 3FZVA 5H8NB 1HSEA 4POXA 2DE4A 3CG3A 4N17A 2QRYA 5ET6A 2FVZA 4GLIA 3FJMA 1MXVA 2ZNSA 3TQLA 1YZ0A 5KDTA 2H5YA 3QSLA 5L9OA 4BDNA 2WBDA 4R6KA 4PFYA 1YAEA 3MJNA 4H5GA 5KCJB 1AMFA 1NV2A 2QVVA 2XWVA 3VE1B 1TT1A 1NV3A 4GF8A 4EQBA 1O63A 2G29A 1N04A 1IXCA 1NUXA 1RKMA 1LBZA 4PBHA 1B7ZA 4P47A 4F31B 2ZZXA 3LR1A 4XFEA 3EKIA 5BUUA 1SYIA 3K0VA 1TWYA 3TCHA 5I2NB 4O3BA 3BFUA 1FPFA 1EZ9A 2XXVA 1CE2A 2IA4A 4XXUA 2DXRA 3HPIA 3WAFA 4PC9A 2I49A 4RNSA 1RYXA 2UVIA 2WKYA 4H0WA 4EF1A 3E78A 2Q2CA 2E1SA 4ZZAA 1LBYA 1IMBA 2R71A 4MJOA 4GL8A 4O3AA 1EYKA 1UTHA 3MPLA 4U2RA 4F1YA 3H4ZA 1MY1A 3MPKA 5ESYA 3FVKA 2XD3A 1B3LA 4NMYA 1IXGA 5L9SA 1R9QA 2XXKA 4LZ5A 2DWHA 3CHGA 1IXHA 1NV6A 5ET5A 1EH3A 3A3CA 1B6HA 1YCJA 5ET8A 3IL1B 4DCXA 1MH3A 1DPEA 3JZJA 2DOJA 2CZIA 4ZDMA 2B4LA 4ZS9A 4PDDA 3IOWA 3OXNA 3PGFA 1B1HA 1B3GA 4HCYA 4N8GA 1ZJLA 4U23A 5ITPA 2ABHA 4O7IA 2HEUA 2F35A 1DMBA 3LC8A 2Q2AA 3IJXB 4PE3A 3MZ1A 2O84X 5CBSA 5H8HA 4RYAA 4KCCA 1DK4A 1LCFA 2Y7WA 4OMBA 3O66A 1FPIA 1NV1A 4YKKA 1GTKA 1EYJA 3PUWE 4R73A 3MSTA 3K02A 4GBWA 4XKRA 5EYFA 2WEFA 4PETA 4G2ZA 2PVUA 4QFLA 4FJPA 3MWBA 5IAIA 1NNFA 2Q89A 5LOMA 4F22A 2XXXA 1PEBA 3TCGA 3MQ9A 1UTBA 3C33A 4IR8A 2VD2A 4M4GA 1GGGA 1LFGA 4KYDA 1LFHA 4C1UA 3VDFA 4EUOA 1MDQA 4XF5A 4IO3A 1OVTA 4ZEIA 4UA8A 3CSBA 1N0TA 1KWHA 1EU8A 4OVTA 1B0LA 5TPAA 4X1DA 1N84A 2ZYOA 5IZ1A 3DM0A 3H6TA 3IFAA 3R26A 5F1QA 4FEBA 2VHAA 5TU0A 1MQJA 1OLCA 3OELA 3HCQA 1D4NA 2I0BA 2HPGA 1NV0A 1SD3A 4OEUA 2F78A 4F18A 1RDYA 3MZBA 4OEVA 3E13X 3EHSA 2DSFA 3EQ1A 1IMEA 4OETA 1N3XA 2UVJA 2OK2A 1II5A 3BIHA 4OWDA 4NWCA 2A5TB 3EPEA 4U1ZA 3PD9A 2QFLA 4YKIA 4X8RA 2IEEA 3IAZA 1FTAA 3E79A 4DXBA 4GXAA 2KLFA 2I0CA 3N5LA 2PYYA 5DTBA 5AA2D 4KR5A 3VVFA 3VVDA 5A5XB 2PX1A 3SKPA 2HZKA 2GFEA 3TDJA 3F11A 4OXVA 3FVGA 1PB9A 1FBGA 3G3FA 4U1OA 1P1WA 1B7UA 4G68B 3V8XB 3RQTA 5JEIA 3QAXA 4OA4A 1MM7A 2RC9A 4X04A 3TMGA 2HAUA 4BDOA 3BBRA 3OO8A 4LATA 1O64A 1QUIA 2OWTA 3MUQA 2V4CA 3MP1A 5I57B 4NF5A 3DLNA 3PMXA 2FIEA 2O69A 3O2AA 1ZLQA 3PPQA 1A55A 1SW2A 3IB0A 3RYDA 1R6ZA 4LP2B 3PV0E 1NH8A 4HE2A 5DT6A 2CEYA 4F3SA 3B6TA 1UIUA 3G3GA 1H44A 1P99A 1H3DA 4OENA 3TTMA 3QXMA 2ZYKA 1POTA 2H98A 3RPLA 3B50A 2P0SA 1B32A 2W7YA 4NF4B 1VDWA 3H3GA 1AL3A 3OMBA 4PAIA 2ZYNA 2XWKA 3QUFA 1MPDA 2QVUA 4LVQA 4YKPA 4EF2A 3O6GA 2Y7PA 1D3KA 3OENA 3T9HB 1B5IA 4EQ7A 5CRYA 3PUZE 4GWOA 5H8SA 4GX6A 4OVRA 4EDPA 1FPBA 4MNIA 3PPRA 1TXFA 3R6UA 1FQCA 4FATA 1DPPA 4DIGA 3MP6A 3MVXA 5ITOA 3OO6A 2F3BA 1HSJA 4H8IA 3OO9A 2R6GE 2VD3A 2Y7IA 4ZE9A 2I6EA 4P1EA 2Z22A 2O6AA 3LBSA 4OZ9A 1H43A 1ZIUA 3MBPA 4KXPA 5CC2A 3TKDA 1Y3PA 2XXRA 3G3JA 5I56B 1B4HA 4LQ2A 4F1UA 3RTFB 4R75A 5T3JA 3LSXA 1KA0A 5L8DA 2ZZWA 3D1RA 1FQDA 4YB5A 1IQ7A 4KQPA 3T93B 2FYIA 3WAEA 3CSGA 3K1PA 5ELVA 4OESA 3ISPA 2OWSA 3U65A 2VT5A 3PU5A 4NTLA 1K9ZA 4TLMB 5H8FA 2Z8EA 3ILUB 2DXYA 2FA7A 3KEIA 1PB8A 2WYPA 2X7QA 2RCBA 4JSOA 4N8YA 1M5EA 4FORA 4N91A 1ZMGA 1UQWA 1MQHA 1PB7A 1I6QA 4LZ8A 2D3IA 3D4GA 5TP9A 4MLQA 2OBGA 5DVFA 4K3FA 4KI0E 1POY1 3V89B 2RF1A 4I62A 1VR5A 4JWXA 3HO7A 3TTLA 3O97A 5I5PA 3PUXE 4NAPA 5AA4A 4PF6A 1YYZA 4ZEKA 4AS4A 5I59B 4ZEFA 1LFIA 2Q74A 1MPCA 2RC7A 3QUJA 4IGTA 4POWA 4IY6A 2WBBA 1A99A 5AA2B 1QKBA 4RPOA 3HFUA 3KJTA 1K9YA 4WXJA 4Z7EA 4JVDA 1EZOA 3HV1A 2R9JA 4GIZA 3GBAA 4IB2A 1LB8A 2G93A 1N7WA 3AXFA 3H6UA 3ILTB 2H9BA 4WEPA 1Q1KA 2Y5LA 3SEWA 4YU0A 4NF8A 3KOSA 3BIGA 3LSWA 4GXSB 1MY3A 4YAHX 4QFPA 3K1MA 1BTJA 3H06B 1B40A 3QIMA 5CMKA 3K6WA 4GWYA 2BJJX 2UVGA 3OSRA 4XKPA 4BLAA 1FPGA 2QS4A 2Q9TA 4QHQA 5HM4B 1LBWA 2O7UA 4YZZA 5FTHA 4G68C 2FIXA 5DW8A 4O94A 3JV9A 1ANFA 1FBHA 5I2KB 4P9KA 1URSA 2DVCA 3P7IA 4O3CA 3RLFE 2XWIA 3PUVE 3I5OA 2HZLA 5I7IA 2QS2A 1FQBA 1SQYA 1WODA 1Y20A 2GRVA 1SYHA 2V93A 4DZ1A 1NH7A 3T22A 3TELA 1CNQA 1FJ6A 2XA5A 4AB6A 3JYRA 1LAXA 5LTCA 1G0HA 1QW0A 3RGYA 2XXYA 2REGA 2PFYA 3C36A 2BJIA 2VPNA 4KYEA 3KN8A 1MG1A 4P1LA 4H8JA 3S9EA 1B2HA 4L17A 4MHFA 3H7MA 3T9UA 1LLSA 4ZEDA 1FRPA 3IFCA 5JTYA 2ZMBA 5IZ3A 4R2BA 1IITA 3RTWB 1A8FA 3EF7A 3T9XB 1PC3A 4P56A 4RXLA 3U93A 4XTCQ 1XVYA 3CRBA 3TODA 5I84A 3Q29A 5IZZA 3MP8A 3KGCA 4NE4A 3K01A 1H45A 3OSQA 2DQVA 4MNCA 3HSTA 4YMAA 1DTGA 1MDP1 1T0KA 3TQWA 1H76A 2ZNUA 4R6HA 4NF6B 3MW0A 1I69A 1JEVA 2B3FA 2MKZA 4X9TA 2ZYMA 2YPNA 2ANJA 4AB5A 2OLBA 2CZHA 1XS5A 1WVJA 1D9YA 3IO6A 2WYKA 2CMOA 2XXUA 4FAJA 4GD5A 3IOVA 1NNKA 1XVXA 3UA8A 4C1TA 2V3TA 3PPNA 1AIVA 5EQ7A 4EQ9A 1URDA 2P3NA 4XIGQ 1G0IA 1MXUA 2Q88A 4PFTA 4NF4A 3K6UA 4QFOA 4IY5A 1N76A 3G7WA 4QBAA 3M8UA 1PDAA 2F6GA 5JK4A 4BDMA 2RINA 4NEDA 3O29A 4MFIA 1JETA 4JVIA 4Z0IA 1NUYA 3C4MA 1FJ9A 4NGUA 3U72A 5IKBA 1B52A 1SVXB 3N6TA 3ODBA 4ZECA 5KDTB 3FBPA 1NV5A 3HHGA 3H6WA 1Y1MA 1Z7ME 4HXVA 4MX6A 4F3GA 3KFMA 4IO2A 1QULA 4FBPA 1LCTA 1RDXA 3I6VA 2VP1A 4GWZA 2OCUA 4G4PA 4F29A 1O7TA 1MY0A 1NUZA 3SEXA 1Y3NA 3U1OA 4RJZA 5DEXA 3FXBA 2Q8MA 3T0JA 4TOZA 3DP8A 3C32A 3EHUA 4HS7A 2HCAA 4ELPA 2QSXA 4G8MA 1A54A 4MNPA 1SW5A 2HAVA 4KCDA 3IK6B 5L9MA 5EYGA 2F97A 4PF8A 3B6QA 4QFNA 4U21A 2I48A 4H5FA 3ZS6A 4X48A 1B5HA 1XOCA 2V84A 5CMMA 3KC0A 1SBPA 1QJMA 1NI9A 2REJA 1Q35A 4ND9A 3D4CA 1UTHB 3E3KA 4N81A 4PE5B 3OEKA 4RPNA 3KBZA 4R9FA 5I59A 4OVPA 4EXLA 3FXRA 1XHYA 3UORA 3K4UA 4FEDA 4LONB 2P3VA 4N6PA 1PBQA 4IO6A 4HTGA 5BWJA 2VGQA 3FUZA 4DCYA 1IEJA 5AA1A 4H1XA 1P1QA 1SW1A 3FJGA 4XKNA 5A5LA 3B7DA 2RKMA 4WEDA 3FV2A 3LUYA 3TAJA 1RYOA 2H99A 1MXWA 3TYHA 4P8BA 4OFJA 3CVGA 5H8QA 2QMWA 2I58A 2XXHA 4MIJA 2Z23A 3OOAA 1YTVA 1OLAA 3QMFA 4HE0A 3KZGA 2HQ0A 4MF3A 1QVSA 1NFTA 5H8NA 2Y7RA 3FASA 4BDQA 4M1VA 1BLFA 4OQOA 5H8HB 1FPKA 1USYE 1Y3QA 3EHTA 2DWIA 3IB2A 5EHMA 4ECFA 2QL3A 2XXTA 1QGXA 3IX1A 4QSDA 2F7CA 4NG7A 2KR0A 2NUVA 4F1VA 3VXBA 1SW4A 3RPWA 3EN3A 2PT2A 3DP6A 1J1NA 3VV5A 4DI3D 1VFDA 3DP4A 3PPOA 1FPEA 2UYFA 5KCJA 1FBFA 3TUSA 1FTLA 2ONKE 2PCRA 3GBBA 4IO5A 1URGA 3G3IA 2CEXA 2X26A 2DP8A 2NOOA 1S7YA 3H6VA 1CB6A 2I4CA 2CZKA 4LUBA 3MVWA 1UTBB 5I2NA 1EZPA 4PGPA 2F5XA 4P3LA 1IMDA 1B5JA 2AIXA 3LUZA 2PMSA 3SEVA 1LEVA 2Q8JA 2M8CA 2XWOA 3TCFA 2JJKA 4UABA 3S2VA 5FHOA 4BDLA 4NHBA 1IMCA 1B3EA 1AWBA 1QKAA 4PFWA 4I40A 4Q8RA 1D9VA 1P1NA 1US4A 1LAGE 3OD7A 4KHZE 3HHFA 2F34A 4F2OA 3PMVA 1NV7A 3G3HA 1L5TA 4ELRA 3SETA 1MY4A 3V5AA 5FBPA 2NXOA 4N15A 4JXIA 3VLVA 3N6UA 1FTJA 4PFIA 3TTRA 4GWXA 1ZU0A 3MAMA 1FTMA 2I4BA 2UYEA 2E0SA 1WDNA 4U4SA 3M3KA 4N6DA 4MH5A 1JEUA 4GFRA 2HXWA 3G3KA 2PBWA 1BK4A 2O1MA 1SI0A 4AQ4A 1B4ZA 5HPQA 5EHSA 1LBCA 1OVBA 2ONSA 2P2AA 3PPPA 4EXKA 3V83A 3KN3A 4OTEA 5DYHA 5EQ8A 5CMBA 1B58A 1B51A 3O28A 4YMBA 1B7HA 2QJEA 3CIJA 4P11A 4GWWA 1NKXA 5J1DA 2AYSA 4PP0A 1EYIA 2DWAA 1BIYA 4O8MA 2XD2A 2Y5KA 1DSNA 3GLBA 1LBXA 5CMCA 1A8EA 4IO7A 1IXIA 4PFRA 2V3UA 1F9BA 2XXWA 1B9JA 1AH5A 1FQAA 3ONMA 3B8BA 1USYH 4JB7A 1Y9UA 4N6KA 2DE3A 4XEQA 2DVZA 4PTKA 1ZBMA 2D21A 4F3BA 1R9LA 4E0WA 3M3LA 3I3VA 4NF5B 3MVYA 5ICQA 1LGBC 2B3BA 4GOTA 1IUDA 3ROJA 2GQ1A 3FIRA 3W9WA 3OEMA 4U22A 1M5CA 2RCAA 2AL5A 4NWDA 4Q5TA 1FBEA 4YICA 4F39A 4YKJA 2B65A 3RPLB 4PFUA 3SERA 3QYTA 3UN6A 3SDFA 3FXUA 3CI8A 5K2YA 3RNNA 1KZ8A 1Y4TA 2ZXTA 4NX1A 4PAKA 3MC2A 1FSAA 4FECA 3CFZA 3S9MC 4ELOA 1MXXA 5AE4A 3LSLA 1IZ1A 3KC1A 1SPIA 1A7LA 1IMFA 4GQOA 3B6WA 1BP5A 3C34A 2A5TA 3RN8A 2VOZA 1B0HA 1Q9DA 2Z8FA 4LQ5A 3GZGA 1MS7A 5B70A 1XC1A 2XXQA 4P0GA 4GX3A 2QPQA 2YLNA 3UP9A 1JW4A 2F7AA 3T96B 2I3WA 1KA1A 4R9GA 4KFQA 4DE8A 3O6IA 3CR9A 3KBRA 1IIWA 4GVOA 5I58B 2XX7A 1VE4A 4G77A 2OJTA 3VXCA 1FBPA 4HW8A 1LB9A 5A5XA 5J16A 4F3PA 3LV0A 1JW5A 2GH9A 4HE1A 4JWYA 5AA3A 5H8FB 4G68A 3K6VA 2FHYA 4GL0A 3N26A 1ATGA 2X7PA 1UIVA 2H25A 5FHNA 4PFBA 4LZ7A 5TP9B 1RDZA 3CG1A 4IO4A 5CM6A 3IOUA 3E9XA 1S9TA 2D5WA 1DTZA 2QS1A 4N07A 3N94A 1TFAA 5I57A 3FATA 4N4UA 5AA4B 3VVEA 2PFZA 3FGSA 1MM6A 1FBDA 2V25A 4KYSA 1FPLA 1QUKA 2DYXA 3TTKA 4P0IA 2CZLA 4ESWA 1MY2A 2DE2A 5B7DA 1D9QA 3UGWA 3RUMA 2HHMA 2R8TA 1NUWA 3TTNA 3Q27A 5EQAA 3C35A 4GBVA 3H03A 1FPJA 3K6XA 2XXPA 3RT6B 4YB7A 2O68A 2OZZA 4RK9A 4BDRA 2O51A 4NF8B 3A3UA 1B3FA 4DI4B 2Y84A 3Q26A 3ZKLA 1MH4A 1ZKBA 2XXIA 4OFOA 4MBPA 1Y4CA 3SZPA 1B05A 2RC8A 3GYYA 1OIBA 1QUJA 2HFBA 4TQUQ 1Y1ZA 2THIA 4DDDA 4MAGA 2GHBA 1MQIA 2F8DA 3SEYA 3IOTA 4RK2A 3IO4A 2QMXA 3KOTA 5I56A 1LAFE 1B46A 1JP4A 4I3YA 3NOHA 1US5A 2P1SA 3RY3A 2HXRA 2O1LA 2LAOA 3A09A 4IGRA 4X1BA 1SDXA 4R74A 4H6DA 3MYUA 4ELQA 1IMAA 4ZE8A 4PAFA 3K00A 4C0RA 1FQFA 1LSTA 2ESNA 4YB6A 1FTKA 4KPTA 1JW1A 1B1XA 4FIMA 3L6GA 3L6HA 3VFJA 3T1BA 3ZKKA 3U94A 5DVIA 3M3FA 3HN0A 1A40A 2F36A 2H4IA 2XX9A 1P1UA 2ONRA 1FPDA 3DELB 5CI5A
chains in the Genus database with same CATH topology
3THIA 3BFTA 3CFXA 4ZEBA 2YJPA 3FD3A 1M5BA 5JTYB 3MZ9A 3O6HA 4I1DA 4R2FA 5AA2A 3IR1A 5ISUA 2XX8A 4XKQA 3TPAA 1MRPA 3ZSFA 4UACA 3BKIB 1NNTA 1OMPA 3E4RA 1MXZA 4JBZA 4TLLB 4WKMA 3W15C 3QK6A 1ZTYA 4QSEA 1B3HA 4MLVA 4JWOA 1MQDA 4KD5A 4OFLA 3C9HA 4QRZA 3KN7A 2NVUB 2PT1A 1AOVA 3Q25A 5KZTA 3S9NC 1BKAA 4ESXA 2F6PA 2F7BA 3USDA 3S9LC 5CBRA 1MPBA 3VLUA 3U8QA 2UVHA 3C31A 4F2QA 5I2KA 1M5FA 4QFKA 4QF9A 1OQHA 4U4XA 1M5DA 4I8CA 1I6BA 3T9VA 3TEPA 3PMWA 3T66A 1GVCA 4N13A 3IB1A 1TFDA 4PQJA 1LBBA 1GR2A 3KSXA 4HCWA 4Q0CA 3TZAA 1ELJA 3K1NA 4RA1A 5TPAB 3MVZA 1SI1A 3CFLA 2DS9A 4H67A 3UK4A 4OYVA 2NWJA 1MQGA 1JVXA 1MXYA 5ICTA 2Z8DA 2ZNTA 3PUYE 4RY1A 1YPNA 4ISUA 2DWJA 4JSDA 5DVJA 5I58A 1DOTA 5DEXB 4R6YA 4JDFA 3KG2A 5FHMA 4Q30B 1P1OA 4DXUA 3K2DA 1S50A 3IORA 4DLDA 3FVOA 1JNFA 3ECRA 4OERA 3KSJA 4G8HA 4FE8A 4E0XA 3OO7A 1N7XA 4GRKA 4F19A 1VSOA 1JVYA 1NMUA 1R1NA 4ONYA 1OQGA 3R7XA 1Z7NE 1JQFA 4R72A 3Q28A 1N3WA 3SEUA 3FXQA 4QSCA 3RT8A 1VFEA 3LSFB 4NF6A 3U92A 1PBPA 1FW0A 3PD8A 2FNCA 1XT8A 4THIA 4I9DA 5HBCA 3IJOB 2I3VA 3VLWA 1FCKA 5FTIA 5K2XA 3FJ7A 3SESA 3KJ7A 3W9VA 1FQEA 3TFLA 5M2VA 2ALUA 1NNPA 2V3QA 3FV1A 2GHAA 1FTOA 1LAHE 3S4UA 4LA9A 2A5SA 2XHDA 4OHNA 4OVJA 2UXAA 1I6AA 1NL5A 5F7VA 1HSLA 3UIFA 4ZZEA 2Y7KA 4G8NA 2O7IA 3FVNA 1GV8A 2QS3A 3O9PA 3GXAA 4DXCA 5H8QB 4H65A 2AL4A 3FZVA 5H8NB 1HSEA 4POXA 2DE4A 3CG3A 2QRYA 4GLIA 3FJMA 1MXVA 2ZNSA 3TQLA 5KDTA 2H5YA 3QSLA 5L9OA 4BDNA 4R6KA 4PFYA 1YAEA 3MJNA 4H5GA 5KCJB 1AMFA 3VE1B 1TT1A 4GF8A 4EQBA 1O63A 2G29A 1N04A 1IXCA 1RKMA 1B7ZA 4F31B 3LR1A 5BUUA 1SYIA 3K0VA 1TWYA 3TCHA 5I2NB 4O3BA 3BFUA 1EZ9A 2XXVA 1CE2A 2IA4A 4XXUA 2DXRA 3HPIA 3WAFA 2I49A 4RNSA 1RYXA 2UVIA 2WKYA 4H0WA 4EF1A 2Q2CA 2E1SA 4ZZAA 2R71A 4GL8A 4O3AA 1UTHA 3MPLA 4U2RA 4F1YA 3H4ZA 1MY1A 3MPKA 3FVKA 2XD3A 1B3LA 4NMYA 1IXGA 5L9SA 1R9QA 4LZ5A 2DWHA 1IXHA 1EH3A 3A3CA 1B6HA 1YCJA 3IL1B 4DCXA 1MH3A 1DPEA 3JZJA 2DOJA 4ZDMA 4ZS9A 3IOWA 3OXNA 3PGFA 1B1HA 1B3GA 4HCYA 1ZJLA 4U23A 5ITPA 2ABHA 2HEUA 2F35A 1DMBA 3LC8A 2Q2AA 3IJXB 3MZ1A 2O84X 5CBSA 5H8HA 4RYAA 4KCCA 1LCFA 2Y7WA 4OMBA 3O66A 4YKKA 1GTKA 3PUWE 4R73A 3K02A 4XKRA 5EYFA 4PETA 4G2ZA 2PVUA 4QFLA 4FJPA 3MWBA 5IAIA 1NNFA 2Q89A 5LOMA 4F22A 2XXXA 1PEBA 3TCGA 3MQ9A 1UTBA 3C33A 2VD2A 4M4GA 1GGGA 1LFGA 4KYDA 1LFHA 4C1UA 3VDFA 4EUOA 1MDQA 4IO3A 1OVTA 4ZEIA 4UA8A 3CSBA 1N0TA 1KWHA 1EU8A 1B0LA 5TPAA 4X1DA 1N84A 2ZYOA 3DM0A 3H6TA 3R26A 5F1QA 4FEBA 2VHAA 5TU0A 1MQJA 1OLCA 3OELA 3HCQA 1D4NA 2I0BA 1SD3A 4OEUA 2F78A 4F18A 3MZBA 4OEVA 3E13X 3EHSA 2DSFA 3EQ1A 4OETA 1N3XA 2UVJA 2OK2A 1II5A 4OWDA 4NWCA 2A5TB 3EPEA 4U1ZA 3PD9A 4YKIA 2IEEA 3IAZA 4DXBA 4GXAA 2KLFA 2I0CA 3N5LA 2PYYA 5DTBA 5AA2D 4KR5A 3VVFA 3VVDA 5A5XB 2PX1A 3SKPA 2HZKA 2GFEA 3TDJA 3F11A 4OXVA 3FVGA 1PB9A 3G3FA 4U1OA 1P1WA 1B7UA 4G68B 3V8XB 3RQTA 5JEIA 3QAXA 1MM7A 2RC9A 3TMGA 2HAUA 4BDOA 3BBRA 3OO8A 4LATA 1O64A 1QUIA 2OWTA 3MUQA 3MP1A 5I57B 4NF5A 3DLNA 3PMXA 2O69A 3O2AA 1ZLQA 3PPQA 1A55A 1SW2A 3IB0A 1R6ZA 4LP2B 3PV0E 1NH8A 5DT6A 4F3SA 3B6TA 1UIUA 3G3GA 1H44A 1P99A 1H3DA 4OENA 3TTMA 3QXMA 2ZYKA 1POTA 2H98A 2P0SA 1B32A 2W7YA 4NF4B 3H3GA 1AL3A 3OMBA 2ZYNA 3QUFA 1MPDA 4LVQA 4YKPA 4EF2A 3O6GA 2Y7PA 1D3KA 3OENA 3T9HB 1B5IA 4EQ7A 5CRYA 3PUZE 4GWOA 5H8SA 4EDPA 3PPRA 1TXFA 3R6UA 1FQCA 4FATA 1DPPA 4DIGA 3MP6A 3MVXA 5ITOA 3OO6A 1HSJA 4H8IA 3OO9A 2R6GE 2VD3A 2Y7IA 4ZE9A 2I6EA 2Z22A 2O6AA 3LBSA 4OZ9A 1H43A 1ZIUA 3MBPA 5CC2A 3TKDA 1Y3PA 2XXRA 3G3JA 5I56B 1B4HA 4LQ2A 4F1UA 3RTFB 4R75A 3LSXA 5L8DA 1FQDA 4YB5A 1IQ7A 4KQPA 3T93B 2FYIA 3WAEA 3CSGA 3K1PA 5ELVA 4OESA 2OWSA 3PU5A 4NTLA 4TLMB 5H8FA 2Z8EA 3ILUB 2DXYA 2FA7A 3KEIA 1PB8A 2X7QA 2RCBA 4JSOA 1M5EA 4FORA 1ZMGA 1UQWA 1MQHA 1PB7A 1I6QA 4LZ8A 2D3IA 3D4GA 5TP9A 4MLQA 2OBGA 5DVFA 4K3FA 4KI0E 1POY1 3V89B 2RF1A 4I62A 1VR5A 4JWXA 3HO7A 3TTLA 3O97A 3PUXE 5AA4A 4ZEKA 5I59B 4ZEFA 1LFIA 1MPCA 2RC7A 3QUJA 4IGTA 4POWA 4IY6A 1A99A 5AA2B 1QKBA 4RPOA 3KJTA 4WXJA 4Z7EA 1EZOA 3HV1A 2R9JA 4GIZA 3GBAA 4IB2A 1LB8A 2G93A 1N7WA 3AXFA 3H6UA 3ILTB 2H9BA 4WEPA 1Q1KA 3SEWA 4YU0A 4NF8A 3KOSA 3LSWA 4GXSB 1MY3A 4YAHX 4QFPA 3K1MA 1BTJA 3H06B 1B40A 3QIMA 5CMKA 3K6WA 2BJJX 2UVGA 3OSRA 4XKPA 4BLAA 2QS4A 2Q9TA 4QHQA 5HM4B 2O7UA 4YZZA 5FTHA 4G68C 3JV9A 1ANFA 5I2KB 1URSA 2DVCA 3P7IA 4O3CA 3RLFE 3PUVE 3I5OA 2HZLA 2QS2A 1FQBA 1SQYA 1WODA 1Y20A 2GRVA 1SYHA 2V93A 4DZ1A 1NH7A 3T22A 3TELA 4AB6A 3JYRA 1LAXA 1QW0A 3RGYA 2XXYA 2REGA 3C36A 4KYEA 3KN8A 1MG1A 4H8JA 3S9EA 1B2HA 4L17A 3H7MA 3T9UA 1LLSA 4ZEDA 5JTYA 2ZMBA 4R2BA 1IITA 3RTWB 1A8FA 3EF7A 3T9XB 1PC3A 4RXLA 3U93A 4XTCQ 1XVYA 3CRBA 3TODA 5I84A 3Q29A 3MP8A 3KGCA 4NE4A 3K01A 1H45A 3OSQA 2DQVA 3HSTA 4YMAA 1DTGA 1MDP1 1T0KA 3TQWA 1H76A 2ZNUA 4R6HA 4NF6B 3MW0A 1I69A 1JEVA 2B3FA 4X9TA 2ZYMA 2YPNA 2ANJA 4AB5A 2OLBA 1XS5A 1WVJA 1D9YA 3IO6A 2CMOA 2XXUA 4FAJA 4GD5A 3IOVA 1NNKA 1XVXA 3UA8A 4C1TA 2V3TA 3PPNA 1AIVA 4EQ9A 1URDA 4XIGQ 1MXUA 2Q88A 4PFTA 4NF4A 3K6UA 4QFOA 4IY5A 1N76A 3G7WA 3M8UA 1PDAA 2F6GA 5JK4A 4BDMA 2RINA 4NEDA 3O29A 4MFIA 1JETA 4Z0IA 3C4MA 3U72A 5IKBA 1B52A 1SVXB 3N6TA 3ODBA 4ZECA 5KDTB 3HHGA 3H6WA 1Y1MA 1Z7ME 4F3GA 3KFMA 4IO2A 1QULA 1LCTA 3I6VA 2VP1A 2OCUA 4G4PA 4F29A 1O7TA 1MY0A 3SEXA 1Y3NA 3U1OA 4RJZA 5DEXA 4TOZA 3DP8A 3C32A 3EHUA 4HS7A 2HCAA 4ELPA 2QSXA 4G8MA 1A54A 1SW5A 2HAVA 4KCDA 3IK6B 5L9MA 2F97A 3B6QA 4QFNA 4U21A 2I48A 4H5FA 3ZS6A 4X48A 1B5HA 1XOCA 2V84A 5CMMA 1SBPA 1QJMA 2REJA 1Q35A 4ND9A 3D4CA 1UTHB 3E3KA 4PE5B 3OEKA 4RPNA 4R9FA 5I59A 4EXLA 3FXRA 1XHYA 3UORA 3K4UA 4FEDA 4LONB 4N6PA 1PBQA 4IO6A 4HTGA 5BWJA 2VGQA 3FUZA 4DCYA 1IEJA 5AA1A 4H1XA 1P1QA 1SW1A 3FJGA 4XKNA 3B7DA 2RKMA 4WEDA 3FV2A 3LUYA 3TAJA 1RYOA 2H99A 1MXWA 3TYHA 4OFJA 3CVGA 5H8QA 2QMWA 2I58A 2XXHA 2Z23A 3OOAA 1YTVA 1OLAA 3KZGA 2HQ0A 4MF3A 1QVSA 1NFTA 5H8NA 2Y7RA 3FASA 4BDQA 4M1VA 1BLFA 4OQOA 5H8HB 1USYE 1Y3QA 3EHTA 2DWIA 3IB2A 5EHMA 4ECFA 2QL3A 2XXTA 3IX1A 4QSDA 2F7CA 2NUVA 4F1VA 3VXBA 1SW4A 3RPWA 3EN3A 2PT2A 3DP6A 1J1NA 3VV5A 1VFDA 3DP4A 3PPOA 2UYFA 5KCJA 3TUSA 1FTLA 2ONKE 3GBBA 4IO5A 1URGA 3G3IA 2X26A 2DP8A 2NOOA 1S7YA 3H6VA 1CB6A 2I4CA 4LUBA 3MVWA 1UTBB 5I2NA 1EZPA 2F5XA 1B5JA 2AIXA 2PMSA 3SEVA 2Q8JA 2M8CA 3TCFA 3S2VA 5FHOA 4BDLA 1B3EA 1QKAA 4PFWA 4Q8RA 1D9VA 1P1NA 1US4A 1LAGE 3OD7A 4KHZE 3HHFA 2F34A 4F2OA 3PMVA 3G3HA 1L5TA 4ELRA 3SETA 1MY4A 3V5AA 2NXOA 4JXIA 3VLVA 3N6UA 1FTJA 3TTRA 1ZU0A 3MAMA 1FTMA 2I4BA 2UYEA 2E0SA 1WDNA 4U4SA 3M3KA 4MH5A 1JEUA 4GFRA 2HXWA 3G3KA 2PBWA 2O1MA 1SI0A 4AQ4A 1B4ZA 5HPQA 5EHSA 1LBCA 1OVBA 2ONSA 2P2AA 3PPPA 4EXKA 3V83A 3KN3A 4OTEA 5DYHA 5CMBA 1B58A 1B51A 3O28A 4YMBA 1B7HA 2QJEA 3CIJA 4P11A 1NKXA 5J1DA 2AYSA 4PP0A 2DWAA 1BIYA 2XD2A 1DSNA 3GLBA 5CMCA 1A8EA 4IO7A 1IXIA 2V3UA 1F9BA 2XXWA 1B9JA 1AH5A 1FQAA 3ONMA 1USYH 4JB7A 1Y9UA 2DE3A 2DVZA 1ZBMA 2D21A 4F3BA 1R9LA 4E0WA 3M3LA 3I3VA 4NF5B 3MVYA 5ICQA 1LGBC 2B3BA 4GOTA 1IUDA 3FIRA 3W9WA 3OEMA 4U22A 1M5CA 2RCAA 2AL5A 4NWDA 4Q5TA 4YICA 4F39A 4YKJA 2B65A 4PFUA 3SERA 3QYTA 3UN6A 3SDFA 3FXUA 3CI8A 5K2YA 3RNNA 1Y4TA 2ZXTA 3MC2A 4FECA 3CFZA 3S9MC 4ELOA 1MXXA 5AE4A 3LSLA 1IZ1A 1A7LA 4GQOA 3B6WA 1BP5A 3C34A 2A5TA 3RN8A 2VOZA 1B0HA 2Z8FA 4LQ5A 3GZGA 1MS7A 5B70A 1XC1A 2XXQA 4P0GA 2QPQA 2YLNA 3UP9A 1JW4A 2F7AA 3T96B 2I3WA 4R9GA 4KFQA 4DE8A 3O6IA 3CR9A 3KBRA 1IIWA 4GVOA 5I58B 2XX7A 1VE4A 4G77A 2OJTA 3VXCA 4HW8A 1LB9A 5A5XA 4F3PA 1JW5A 2GH9A 4JWYA 5AA3A 5H8FB 4G68A 3K6VA 4GL0A 3N26A 1ATGA 2X7PA 1UIVA 2H25A 5FHNA 4LZ7A 5TP9B 3CG1A 4IO4A 5CM6A 3IOUA 3E9XA 1S9TA 2D5WA 1DTZA 2QS1A 4N07A 3N94A 1TFAA 5I57A 3FATA 5AA4B 3VVEA 3FGSA 1MM6A 2V25A 4KYSA 1QUKA 2DYXA 3TTKA 4P0IA 2CZLA 4ESWA 1MY2A 2DE2A 5B7DA 3UGWA 3RUMA 3TTNA 3Q27A 3C35A 3RT6B 3H03A 3K6XA 2XXPA 4YB7A 2O68A 2OZZA 4RK9A 4BDRA 2O51A 4NF8B 3A3UA 1B3FA 2Y84A 3Q26A 3ZKLA 1MH4A 1ZKBA 2XXIA 4OFOA 4MBPA 1Y4CA 1B05A 2RC8A 1OIBA 1QUJA 2HFBA 4TQUQ 1Y1ZA 2THIA 4DDDA 2GHBA 1MQIA 2F8DA 3SEYA 3IOTA 4RK2A 3IO4A 2QMXA 3KOTA 5I56A 1LAFE 1B46A 1US5A 2P1SA 3RY3A 2O1LA 2LAOA 3A09A 4IGRA 4X1BA 1SDXA 4R74A 4H6DA 4ELQA 4ZE8A 3K00A 4C0RA 1FQFA 1LSTA 2ESNA 4YB6A 1FTKA 4KPTA 1JW1A 1B1XA 4FIMA 3L6GA 3L6HA 3VFJA 3ZKKA 3U94A 5DVIA 3M3FA 3HN0A 1A40A 2F36A 2H4IA 2XX9A 1P1UA 2ONRA 3DELB 5CI5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3THI A;  3BFT A;  3CFX A;  4ZEB A;  2YJP A;  3FD3 A;  1M5B A;  5JTY B;  3MZ9 A;  3O6H A;  4I1D A;  4R2F A;  5AA2 A;  3IR1 A;  5ISU A;  2XX8 A;  4XKQ A;  3TPA A;  1MRP A;  3ZSF A;  4UAC A;  3BKI B;  1NNT A;  1OMP A;  3E4R A;  1MXZ A;  4JBZ A;  4TLL B;  4WKM A;  3W15 C;  3QK6 A;  1ZTY A;  4QSE A;  1B3H A;  4MLV A;  4JWO A;  1MQD A;  4KD5 A;  4OFL A;  3C9H A;  4QRZ A;  3KN7 A;  2NVU B;  2PT1 A;  1AOV A;  3Q25 A;  5KZT A;  3S9N C;  1BKA A;  4ESX A;  2F6P A;  2F7B A;  3USD A;  3S9L C;  5CBR A;  1MPB A;  3VLU A;  3U8Q A;  2UVH A;  3C31 A;  4F2Q A;  5I2K A;  1M5F A;  4QFK A;  4QF9 A;  1OQH A;  4U4X A;  1M5D A;  4I8C A;  1I6B A;  3T9V A;  3TEP A;  3PMW A;  3T66 A;  1GVC A;  4N13 A;  3IB1 A;  1TFD A;  4PQJ A;  1LBB A;  1GR2 A;  3KSX A;  4HCW A;  4Q0C A;  3TZA A;  1ELJ A;  3K1N A;  4RA1 A;  5TPA B;  3MVZ A;  1SI1 A;  3CFL A;  2DS9 A;  4H67 A;  3UK4 A;  4OYV A;  2NWJ A;  1MQG A;  1JVX A;  1MXY A;  5ICT A;  2Z8D A;  2ZNT A;  3PUY E;  4RY1 A;  1YPN A;  4ISU A;  2DWJ A;  4JSD A;  5DVJ A;  5I58 A;  1DOT A;  5DEX B;  4R6Y A;  4JDF A;  3KG2 A;  5FHM A;  4Q30 B;  1P1O A;  4DXU A;  3K2D A;  1S50 A;  3IOR A;  4DLD A;  3FVO A;  1JNF A;  3ECR A;  4OER A;  3KSJ A;  4G8H A;  4FE8 A;  4E0X A;  3OO7 A;  1N7X A;  4GRK A;  4F19 A;  1VSO A;  1JVY A;  1NMU A;  1R1N A;  4ONY A;  1OQG A;  3R7X A;  1Z7N E;  1JQF A;  4R72 A;  3Q28 A;  1N3W A;  3SEU A;  3FXQ A;  4QSC A;  3RT8 A;  1VFE A;  3LSF B;  4NF6 A;  3U92 A;  1PBP A;  1FW0 A;  3PD8 A;  2FNC A;  1XT8 A;  4THI A;  4I9D A;  5HBC A;  3IJO B;  2I3V A;  3VLW A;  1FCK A;  5FTI A;  5K2X A;  3FJ7 A;  3SES A;  3KJ7 A;  3W9V A;  1FQE A;  3TFL A;  5M2V A;  2ALU A;  1NNP A;  2V3Q A;  3FV1 A;  2GHA A;  1FTO A;  1LAH E;  3S4U A;  4LA9 A;  2A5S A;  2XHD A;  4OHN A;  4OVJ A;  2UXA A;  1I6A A;  1NL5 A;  5F7V A;  1HSL A;  3UIF A;  4ZZE A;  2Y7K A;  4G8N A;  2O7I A;  3FVN A;  1GV8 A;  2QS3 A;  3O9P A;  3GXA A;  4DXC A;  5H8Q B;  4H65 A;  2AL4 A;  3FZV A;  5H8N B;  1HSE A;  4POX A;  2DE4 A;  3CG3 A;  2QRY A;  4GLI A;  3FJM A;  1MXV A;  2ZNS A;  3TQL A;  5KDT A;  2H5Y A;  3QSL A;  5L9O A;  4BDN A;  4R6K A;  4PFY A;  1YAE A;  3MJN A;  4H5G A;  5KCJ B;  1AMF A;  3VE1 B;  1TT1 A;  4GF8 A;  4EQB A;  1O63 A;  2G29 A;  1N04 A;  1IXC A;  1RKM A;  1B7Z A;  4F31 B;  3LR1 A;  5BUU A;  1SYI A;  3K0V A;  1TWY A;  3TCH A;  5I2N B;  4O3B A;  3BFU A;  1EZ9 A;  2XXV A;  1CE2 A;  2IA4 A;  4XXU A;  2DXR A;  3HPI A;  3WAF A;  2I49 A;  4RNS A;  1RYX A;  2UVI A;  2WKY A;  4H0W A;  4EF1 A;  2Q2C A;  2E1S A;  4ZZA A;  2R71 A;  4GL8 A;  4O3A A;  1UTH A;  3MPL A;  4U2R A;  4F1Y A;  3H4Z A;  1MY1 A;  3MPK A;  3FVK A;  2XD3 A;  1B3L A;  4NMY A;  1IXG A;  5L9S A;  1R9Q A;  4LZ5 A;  2DWH A;  1IXH A;  1EH3 A;  3A3C A;  1B6H A;  1YCJ A;  3IL1 B;  4DCX A;  1MH3 A;  1DPE A;  3JZJ A;  2DOJ A;  4ZDM A;  4ZS9 A;  3IOW A;  3OXN A;  3PGF A;  1B1H A;  1B3G A;  4HCY A;  1ZJL A;  4U23 A;  5ITP A;  2ABH A;  2HEU A;  2F35 A;  1DMB A;  3LC8 A;  2Q2A A;  3IJX B;  3MZ1 A;  2O84 X;  5CBS A;  5H8H A;  4RYA A;  4KCC A;  1LCF A;  2Y7W A;  4OMB A;  3O66 A;  4YKK A;  1GTK A;  3PUW E;  4R73 A;  3K02 A;  4XKR A;  5EYF A;  4PET A;  4G2Z A;  2PVU A;  4QFL A;  4FJP A;  3MWB A;  5IAI A;  1NNF A;  2Q89 A;  5LOM A;  4F22 A;  2XXX A;  1PEB A;  3TCG A;  3MQ9 A;  1UTB A;  3C33 A;  2VD2 A;  4M4G A;  1GGG A;  1LFG A;  4KYD A;  1LFH A;  4C1U A;  3VDF A;  4EUO A;  1MDQ A;  4IO3 A;  1OVT A;  4ZEI A;  4UA8 A;  3CSB A;  1N0T A;  1KWH A;  1EU8 A;  1B0L A;  5TPA A;  4X1D A;  1N84 A;  2ZYO A;  3DM0 A;  3H6T A;  3R26 A;  5F1Q A;  4FEB A;  2VHA A;  5TU0 A;  1MQJ A;  1OLC A;  3OEL A;  3HCQ A;  1D4N A;  2I0B A;  1SD3 A;  4OEU A;  2F78 A;  4F18 A;  3MZB A;  4OEV A;  3E13 X;  3EHS A;  2DSF A;  3EQ1 A;  4OET A;  1N3X A;  2UVJ A;  2OK2 A;  1II5 A;  4OWD A;  4NWC A;  2A5T B;  3EPE A;  4U1Z A;  3PD9 A;  4YKI A;  2IEE A;  3IAZ A;  4DXB A;  4GXA A;  2KLF A;  2I0C A;  3N5L A;  2PYY A;  5DTB A;  5AA2 D;  4KR5 A;  3VVF A;  3VVD A;  5A5X B;  2PX1 A;  3SKP A;  2HZK A;  2GFE A;  3TDJ A;  3F11 A;  4OXV A;  3FVG A;  1PB9 A;  3G3F A;  4U1O A;  1P1W A;  1B7U A;  4G68 B;  3V8X B;  3RQT A;  5JEI A;  3QAX A;  1MM7 A;  2RC9 A;  3TMG A;  2HAU A;  4BDO A;  3BBR A;  3OO8 A;  4LAT A;  1O64 A;  1QUI A;  2OWT A;  3MUQ A;  3MP1 A;  5I57 B;  4NF5 A;  3DLN A;  3PMX A;  2O69 A;  3O2A A;  1ZLQ A;  3PPQ A;  1A55 A;  1SW2 A;  3IB0 A;  1R6Z A;  4LP2 B;  3PV0 E;  1NH8 A;  5DT6 A;  4F3S A;  3B6T A;  1UIU A;  3G3G A;  1H44 A;  1P99 A;  1H3D A;  4OEN A;  3TTM A;  3QXM A;  2ZYK A;  1POT A;  2H98 A;  2P0S A;  1B32 A;  2W7Y A;  4NF4 B;  3H3G A;  1AL3 A;  3OMB A;  2ZYN A;  3QUF A;  1MPD A;  4LVQ A;  4YKP A;  4EF2 A;  3O6G A;  2Y7P A;  1D3K A;  3OEN A;  3T9H B;  1B5I A;  4EQ7 A;  5CRY A;  3PUZ E;  4GWO A;  5H8S A;  4EDP A;  3PPR A;  1TXF A;  3R6U A;  1FQC A;  4FAT A;  1DPP A;  4DIG A;  3MP6 A;  3MVX A;  5ITO A;  3OO6 A;  1HSJ A;  4H8I A;  3OO9 A;  2R6G E;  2VD3 A;  2Y7I A;  4ZE9 A;  2I6E A;  2Z22 A;  2O6A A;  3LBS A;  4OZ9 A;  1H43 A;  1ZIU A;  3MBP A;  5CC2 A;  3TKD A;  1Y3P A;  2XXR A;  3G3J A;  5I56 B;  1B4H A;  4LQ2 A;  4F1U A;  3RTF B;  4R75 A;  3LSX A;  5L8D A;  1FQD A;  4YB5 A;  1IQ7 A;  4KQP A;  3T93 B;  2FYI A;  3WAE A;  3CSG A;  3K1P A;  5ELV A;  4OES A;  2OWS A;  3PU5 A;  4NTL A;  4TLM B;  5H8F A;  2Z8E A;  3ILU B;  2DXY A;  2FA7 A;  3KEI A;  1PB8 A;  2X7Q A;  2RCB A;  4JSO A;  1M5E A;  4FOR A;  1ZMG A;  1UQW A;  1MQH A;  1PB7 A;  1I6Q A;  4LZ8 A;  2D3I A;  3D4G A;  5TP9 A;  4MLQ A;  2OBG A;  5DVF A;  4K3F A;  4KI0 E;  1POY 1;  3V89 B;  2RF1 A;  4I62 A;  1VR5 A;  4JWX A;  3HO7 A;  3TTL A;  3O97 A;  3PUX E;  5AA4 A;  4ZEK A;  5I59 B;  4ZEF A;  1LFI A;  1MPC A;  2RC7 A;  3QUJ A;  4IGT A;  4POW A;  4IY6 A;  1A99 A;  5AA2 B;  1QKB A;  4RPO A;  3KJT A;  4WXJ A;  4Z7E A;  1EZO A;  3HV1 A;  2R9J A;  4GIZ A;  3GBA A;  4IB2 A;  1LB8 A;  2G93 A;  1N7W A;  3AXF A;  3H6U A;  3ILT B;  2H9B A;  4WEP A;  1Q1K A;  3SEW A;  4YU0 A;  4NF8 A;  3KOS A;  3LSW A;  4GXS B;  1MY3 A;  4YAH X;  4QFP A;  3K1M A;  1BTJ A;  3H06 B;  1B40 A;  3QIM A;  5CMK A;  3K6W A;  2BJJ X;  2UVG A;  3OSR A;  4XKP A;  4BLA A;  2QS4 A;  2Q9T A;  4QHQ A;  5HM4 B;  2O7U A;  4YZZ A;  5FTH A;  4G68 C;  3JV9 A;  1ANF A;  5I2K B;  1URS A;  2DVC A;  3P7I A;  4O3C A;  3RLF E;  3PUV E;  3I5O A;  2HZL A;  2QS2 A;  1FQB A;  1SQY A;  1WOD A;  1Y20 A;  2GRV A;  1SYH A;  2V93 A;  4DZ1 A;  1NH7 A;  3T22 A;  3TEL A;  4AB6 A;  3JYR A;  1LAX A;  1QW0 A;  3RGY A;  2XXY A;  2REG A;  3C36 A;  4KYE A;  3KN8 A;  1MG1 A;  4H8J A;  3S9E A;  1B2H A;  4L17 A;  3H7M A;  3T9U A;  1LLS A;  4ZED A;  5JTY A;  2ZMB A;  4R2B A;  1IIT A;  3RTW B;  1A8F A;  3EF7 A;  3T9X B;  1PC3 A;  4RXL A;  3U93 A;  4XTC Q;  1XVY A;  3CRB A;  3TOD A;  5I84 A;  3Q29 A;  3MP8 A;  3KGC A;  4NE4 A;  3K01 A;  1H45 A;  3OSQ A;  2DQV A;  3HST A;  4YMA A;  1DTG A;  1MDP 1;  1T0K A;  3TQW A;  1H76 A;  2ZNU A;  4R6H A;  4NF6 B;  3MW0 A;  1I69 A;  1JEV A;  2B3F A;  4X9T A;  2ZYM A;  2YPN A;  2ANJ A;  4AB5 A;  2OLB A;  1XS5 A;  1WVJ A;  1D9Y A;  3IO6 A;  2CMO A;  2XXU A;  4FAJ A;  4GD5 A;  3IOV A;  1NNK A;  1XVX A;  3UA8 A;  4C1T A;  2V3T A;  3PPN A;  1AIV A;  4EQ9 A;  1URD A;  4XIG Q;  1MXU A;  2Q88 A;  4PFT A;  4NF4 A;  3K6U A;  4QFO A;  4IY5 A;  1N76 A;  3G7W A;  3M8U A;  1PDA A;  2F6G A;  5JK4 A;  4BDM A;  2RIN A;  4NED A;  3O29 A;  4MFI A;  1JET A;  4Z0I A;  3C4M A;  3U72 A;  5IKB A;  1B52 A;  1SVX B;  3N6T A;  3ODB A;  4ZEC A;  5KDT B;  3HHG A;  3H6W A;  1Y1M A;  1Z7M E;  4F3G A;  3KFM A;  4IO2 A;  1QUL A;  1LCT A;  3I6V A;  2VP1 A;  2OCU A;  4G4P A;  4F29 A;  1O7T A;  1MY0 A;  3SEX A;  1Y3N A;  3U1O A;  4RJZ A;  5DEX A;  4TOZ A;  3DP8 A;  3C32 A;  3EHU A;  4HS7 A;  2HCA A;  4ELP A;  2QSX A;  4G8M A;  1A54 A;  1SW5 A;  2HAV A;  4KCD A;  3IK6 B;  5L9M A;  2F97 A;  3B6Q A;  4QFN A;  4U21 A;  2I48 A;  4H5F A;  3ZS6 A;  4X48 A;  1B5H A;  1XOC A;  2V84 A;  5CMM A;  1SBP A;  1QJM A;  2REJ A;  1Q35 A;  4ND9 A;  3D4C A;  1UTH B;  3E3K A;  4PE5 B;  3OEK A;  4RPN A;  4R9F A;  5I59 A;  4EXL A;  3FXR A;  1XHY A;  3UOR A;  3K4U A;  4FED A;  4LON B;  4N6P A;  1PBQ A;  4IO6 A;  4HTG A;  5BWJ A;  2VGQ A;  3FUZ A;  4DCY A;  1IEJ A;  5AA1 A;  4H1X A;  1P1Q A;  1SW1 A;  3FJG A;  4XKN A;  3B7D A;  2RKM A;  4WED A;  3FV2 A;  3LUY A;  3TAJ A;  1RYO A;  2H99 A;  1MXW A;  3TYH A;  4OFJ A;  3CVG A;  5H8Q A;  2QMW A;  2I58 A;  2XXH A;  2Z23 A;  3OOA A;  1YTV A;  1OLA A;  3KZG A;  2HQ0 A;  4MF3 A;  1QVS A;  1NFT A;  5H8N A;  2Y7R A;  3FAS A;  4BDQ A;  4M1V A;  1BLF A;  4OQO A;  5H8H B;  1USY E;  1Y3Q A;  3EHT A;  2DWI A;  3IB2 A;  5EHM A;  4ECF A;  2QL3 A;  2XXT A;  3IX1 A;  4QSD A;  2F7C A;  2NUV A;  4F1V A;  3VXB A;  1SW4 A;  3RPW A;  3EN3 A;  2PT2 A;  3DP6 A;  1J1N A;  3VV5 A;  1VFD A;  3DP4 A;  3PPO A;  2UYF A;  5KCJ A;  3TUS A;  1FTL A;  2ONK E;  3GBB A;  4IO5 A;  1URG A;  3G3I A;  2X26 A;  2DP8 A;  2NOO A;  1S7Y A;  3H6V A;  1CB6 A;  2I4C A;  4LUB A;  3MVW A;  1UTB B;  5I2N A;  1EZP A;  2F5X A;  1B5J A;  2AIX A;  2PMS A;  3SEV A;  2Q8J A;  2M8C A;  3TCF A;  3S2V A;  5FHO A;  4BDL A;  1B3E A;  1QKA A;  4PFW A;  4Q8R A;  1D9V A;  1P1N A;  1US4 A;  1LAG E;  3OD7 A;  4KHZ E;  3HHF A;  2F34 A;  4F2O A;  3PMV A;  3G3H A;  1L5T A;  4ELR A;  3SET A;  1MY4 A;  3V5A A;  2NXO A;  4JXI A;  3VLV A;  3N6U A;  1FTJ A;  3TTR A;  1ZU0 A;  3MAM A;  1FTM A;  2I4B A;  2UYE A;  2E0S A;  1WDN A;  4U4S A;  3M3K A;  4MH5 A;  1JEU A;  4GFR A;  2HXW A;  3G3K A;  2PBW A;  2O1M A;  1SI0 A;  4AQ4 A;  1B4Z A;  5HPQ A;  5EHS A;  1LBC A;  1OVB A;  2ONS A;  2P2A A;  3PPP A;  4EXK A;  3V83 A;  3KN3 A;  4OTE A;  5DYH A;  5CMB A;  1B58 A;  1B51 A;  3O28 A;  4YMB A;  1B7H A;  2QJE A;  3CIJ A;  4P11 A;  1NKX A;  5J1D A;  2AYS A;  4PP0 A;  2DWA A;  1BIY A;  2XD2 A;  1DSN A;  3GLB A;  5CMC A;  1A8E A;  4IO7 A;  1IXI A;  2V3U A;  1F9B A;  2XXW A;  1B9J A;  1AH5 A;  1FQA A;  3ONM A;  1USY H;  4JB7 A;  1Y9U A;  2DE3 A;  2DVZ A;  1ZBM A;  2D21 A;  4F3B A;  1R9L A;  4E0W A;  3M3L A;  3I3V A;  4NF5 B;  3MVY A;  5ICQ A;  1LGB C;  2B3B A;  4GOT A;  1IUD A;  3FIR A;  3W9W A;  3OEM A;  4U22 A;  1M5C A;  2RCA A;  2AL5 A;  4NWD A;  4Q5T A;  4YIC A;  4F39 A;  4YKJ A;  2B65 A;  4PFU A;  3SER A;  3QYT A;  3UN6 A;  3SDF A;  3FXU A;  3CI8 A;  5K2Y A;  3RNN A;  1Y4T A;  2ZXT A;  3MC2 A;  4FEC A;  3CFZ A;  3S9M C;  4ELO A;  1MXX A;  5AE4 A;  3LSL A;  1IZ1 A;  1A7L A;  4GQO A;  3B6W A;  1BP5 A;  3C34 A;  2A5T A;  3RN8 A;  2VOZ A;  1B0H A;  2Z8F A;  4LQ5 A;  3GZG A;  1MS7 A;  5B70 A;  1XC1 A;  2XXQ A;  4P0G A;  2QPQ A;  2YLN A;  3UP9 A;  1JW4 A;  2F7A A;  3T96 B;  2I3W A;  4R9G A;  4KFQ A;  4DE8 A;  3O6I A;  3CR9 A;  3KBR A;  1IIW A;  4GVO A;  5I58 B;  2XX7 A;  1VE4 A;  4G77 A;  2OJT A;  3VXC A;  4HW8 A;  1LB9 A;  5A5X A;  4F3P A;  1JW5 A;  2GH9 A;  4JWY A;  5AA3 A;  5H8F B;  4G68 A;  3K6V A;  4GL0 A;  3N26 A;  1ATG A;  2X7P A;  1UIV A;  2H25 A;  5FHN A;  4LZ7 A;  5TP9 B;  3CG1 A;  4IO4 A;  5CM6 A;  3IOU A;  3E9X A;  1S9T A;  2D5W A;  1DTZ A;  2QS1 A;  4N07 A;  3N94 A;  1TFA A;  5I57 A;  3FAT A;  5AA4 B;  3VVE A;  3FGS A;  1MM6 A;  2V25 A;  4KYS A;  1QUK A;  2DYX A;  3TTK A;  4P0I A;  2CZL A;  4ESW A;  1MY2 A;  2DE2 A;  5B7D A;  3UGW A;  3RUM A;  3TTN A;  3Q27 A;  3C35 A;  3RT6 B;  3H03 A;  3K6X A;  2XXP A;  4YB7 A;  2O68 A;  2OZZ A;  4RK9 A;  4BDR A;  2O51 A;  4NF8 B;  3A3U A;  1B3F A;  2Y84 A;  3Q26 A;  3ZKL A;  1MH4 A;  1ZKB A;  2XXI A;  4OFO A;  4MBP A;  1Y4C A;  1B05 A;  2RC8 A;  1OIB A;  1QUJ A;  2HFB A;  4TQU Q;  1Y1Z A;  2THI A;  4DDD A;  2GHB A;  1MQI A;  2F8D A;  3SEY A;  3IOT A;  4RK2 A;  3IO4 A;  2QMX A;  3KOT A;  5I56 A;  1LAF E;  1B46 A;  1US5 A;  2P1S A;  3RY3 A;  2O1L A;  2LAO A;  3A09 A;  4IGR A;  4X1B A;  1SDX A;  4R74 A;  4H6D A;  4ELQ A;  4ZE8 A;  3K00 A;  4C0R A;  1FQF A;  1LST A;  2ESN A;  4YB6 A;  1FTK A;  4KPT A;  1JW1 A;  1B1X A;  4FIM A;  3L6G A;  3L6H A;  3VFJ A;  3ZKK A;  3U94 A;  5DVI A;  3M3F A;  3HN0 A;  1A40 A;  2F36 A;  2H4I A;  2XX9 A;  1P1U A;  2ONR A;  3DEL B;  5CI5 A; 
#chains in the Genus database with same CATH topology
 3THI A;  3BFT A;  3CFX A;  4ZEB A;  2YJP A;  3FD3 A;  1M5B A;  4NN3 A;  5JTY B;  3MZ9 A;  3O6H A;  4GWS A;  5IZ3 B;  2DDK A;  1YXI A;  4I1D A;  4MEV A;  4R2F A;  1LBV A;  5AA2 A;  3IR1 A;  5ISU A;  2XX8 A;  4XKQ A;  3A29 A;  3TPA A;  1MRP A;  5ET7 A;  3ZSF A;  4UAC A;  5IGA A;  2WX9 A;  1INP A;  2L5V A;  4NF0 A;  3BKI B;  4AS5 A;  2OWZ A;  4OVQ A;  5EQ9 A;  4PCD A;  1NNT A;  1OMP A;  3E4R A;  1MXZ A;  4JBZ A;  4TLL B;  4WKM A;  3W15 C;  3QK6 A;  1ZTY A;  4QSE A;  1B3H A;  4MLV A;  3PTY A;  4JWO A;  4LN5 A;  1MQD A;  4KD5 A;  4OFL A;  1FBC A;  3C9H A;  4QRZ A;  3KN7 A;  2NVU B;  2PT1 A;  1AOV A;  3Q25 A;  5KZT A;  2QVR A;  3S9N C;  5IM2 A;  1BKA A;  4ESX A;  4PGN A;  2F6P A;  2F7B A;  3USD A;  3S9L C;  5CBR A;  4MCO A;  1MPB A;  3VLU A;  3U8Q A;  2UVH A;  3C31 A;  4F2Q A;  4NQ8 A;  5I2K A;  1M5F A;  4QFK A;  4QF9 A;  1OQH A;  4U4X A;  1M5D A;  4I8C A;  1I6B A;  4OVS A;  5EYH A;  3T9V A;  5F24 A;  2B4M A;  2VPO A;  3TEP A;  3PMW A;  3T66 A;  1GVC A;  4N13 A;  3IB1 A;  1DBZ A;  1TFD A;  4PQJ A;  1LBB A;  1GR2 A;  3KSX A;  4MMP A;  4GWU A;  4HCW A;  4Q0C A;  3TZA A;  1ELJ A;  2KQZ A;  3K1N A;  4RA1 A;  5TPA B;  3MVZ A;  1SI1 A;  3CFL A;  2DS9 A;  4H67 A;  3UK4 A;  4OYV A;  2NWJ A;  1MQG A;  1JVX A;  1MXY A;  5ICT A;  4JVC A;  2Z8D A;  4PDH A;  2ZNT A;  3PUY E;  4RY1 A;  4OAN A;  1YPN A;  4ISU A;  5I3S A;  2DWJ A;  4JSD A;  5DVJ A;  5I58 A;  1DOT A;  5DEX B;  4R6Y A;  4JDF A;  3KG2 A;  5FHM A;  4Q30 B;  1P1O A;  4DXU A;  1NV4 A;  3K2D A;  1XI6 A;  1S50 A;  3IOR A;  4DLD A;  3FVO A;  1JNF A;  3ECR A;  4OER A;  3KSJ A;  4I3E A;  4G8H A;  4FE8 A;  4E0X A;  3OO7 A;  1N7X A;  4GRK A;  4F19 A;  1VSO A;  1JVY A;  1NMU A;  1R1N A;  4ONY A;  1OQG A;  3R7X A;  1Z7N E;  1JQF A;  4R72 A;  3Q28 A;  1N3W A;  3SEU A;  3FXQ A;  4QSC A;  3RT8 A;  1VFE A;  3LSF B;  4NF6 A;  3U92 A;  1PBP A;  1FW0 A;  3PD8 A;  5LDZ A;  2FBP A;  2FNC A;  4PBQ A;  2ZZV A;  1XT8 A;  1DCU A;  4THI A;  4I9D A;  5HBC A;  3IJO B;  2I3V A;  3VLW A;  1FCK A;  5FTI A;  5K2X A;  3FJ7 A;  3SES A;  3KJ7 A;  4G61 A;  3W9V A;  4H45 A;  1FQE A;  3TFL A;  2OX3 A;  5M2V A;  2ALU A;  1NNP A;  2V3Q A;  3FV1 A;  2GHA A;  1FTO A;  4O7M A;  1LAH E;  2F3D A;  3S4U A;  4LA9 A;  2A5S A;  2XHD A;  4OHN A;  4OVJ A;  2UXA A;  1I6A A;  1NL5 A;  5F7V A;  1HSL A;  3UIF A;  4ZZE A;  4QXD A;  2Y7K A;  4G8N A;  2O7I A;  3FVN A;  1GV8 A;  4GX4 A;  2QS3 A;  3O9P A;  4H46 A;  3GXA A;  4DXC A;  5H8Q B;  4H65 A;  2AL4 A;  3FZV A;  5H8N B;  1HSE A;  4POX A;  2DE4 A;  3CG3 A;  4N17 A;  2QRY A;  5ET6 A;  2FVZ A;  4GLI A;  3FJM A;  1MXV A;  2ZNS A;  3TQL A;  1YZ0 A;  5KDT A;  2H5Y A;  3QSL A;  5L9O A;  4BDN A;  2WBD A;  4R6K A;  4PFY A;  1YAE A;  3MJN A;  4H5G A;  5KCJ B;  1AMF A;  1NV2 A;  2QVV A;  2XWV A;  3VE1 B;  1TT1 A;  1NV3 A;  4GF8 A;  4EQB A;  1O63 A;  2G29 A;  1N04 A;  1IXC A;  1NUX A;  1RKM A;  1LBZ A;  4PBH A;  1B7Z A;  4P47 A;  4F31 B;  2ZZX A;  3LR1 A;  4XFE A;  3EKI A;  5BUU A;  1SYI A;  3K0V A;  1TWY A;  3TCH A;  5I2N B;  4O3B A;  3BFU A;  1FPF A;  1EZ9 A;  2XXV A;  1CE2 A;  2IA4 A;  4XXU A;  2DXR A;  3HPI A;  3WAF A;  4PC9 A;  2I49 A;  4RNS A;  1RYX A;  2UVI A;  2WKY A;  4H0W A;  4EF1 A;  3E78 A;  2Q2C A;  2E1S A;  4ZZA A;  1LBY A;  1IMB A;  2R71 A;  4MJO A;  4GL8 A;  4O3A A;  1EYK A;  1UTH A;  3MPL A;  4U2R A;  4F1Y A;  3H4Z A;  1MY1 A;  3MPK A;  5ESY A;  3FVK A;  2XD3 A;  1B3L A;  4NMY A;  1IXG A;  5L9S A;  1R9Q A;  2XXK A;  4LZ5 A;  2DWH A;  3CHG A;  1IXH A;  1NV6 A;  5ET5 A;  1EH3 A;  3A3C A;  1B6H A;  1YCJ A;  5ET8 A;  3IL1 B;  4DCX A;  1MH3 A;  1DPE A;  3JZJ A;  2DOJ A;  2CZI A;  4ZDM A;  2B4L A;  4ZS9 A;  4PDD A;  3IOW A;  3OXN A;  3PGF A;  1B1H A;  1B3G A;  4HCY A;  4N8G A;  1ZJL A;  4U23 A;  5ITP A;  2ABH A;  4O7I A;  2HEU A;  2F35 A;  1DMB A;  3LC8 A;  2Q2A A;  3IJX B;  4PE3 A;  3MZ1 A;  2O84 X;  5CBS A;  5H8H A;  4RYA A;  4KCC A;  1DK4 A;  1LCF A;  2Y7W A;  4OMB A;  3O66 A;  1FPI A;  1NV1 A;  4YKK A;  1GTK A;  1EYJ A;  3PUW E;  4R73 A;  3MST A;  3K02 A;  4GBW A;  4XKR A;  5EYF A;  2WEF A;  4PET A;  4G2Z A;  2PVU A;  4QFL A;  4FJP A;  3MWB A;  5IAI A;  1NNF A;  2Q89 A;  5LOM A;  4F22 A;  2XXX A;  1PEB A;  3TCG A;  3MQ9 A;  1UTB A;  3C33 A;  4IR8 A;  2VD2 A;  4M4G A;  1GGG A;  1LFG A;  4KYD A;  1LFH A;  4C1U A;  3VDF A;  4EUO A;  1MDQ A;  4XF5 A;  4IO3 A;  1OVT A;  4ZEI A;  4UA8 A;  3CSB A;  1N0T A;  1KWH A;  1EU8 A;  4OVT A;  1B0L A;  5TPA A;  4X1D A;  1N84 A;  2ZYO A;  5IZ1 A;  3DM0 A;  3H6T A;  3IFA A;  3R26 A;  5F1Q A;  4FEB A;  2VHA A;  5TU0 A;  1MQJ A;  1OLC A;  3OEL A;  3HCQ A;  1D4N A;  2I0B A;  2HPG A;  1NV0 A;  1SD3 A;  4OEU A;  2F78 A;  4F18 A;  1RDY A;  3MZB A;  4OEV A;  3E13 X;  3EHS A;  2DSF A;  3EQ1 A;  1IME A;  4OET A;  1N3X A;  2UVJ A;  2OK2 A;  1II5 A;  3BIH A;  4OWD A;  4NWC A;  2A5T B;  3EPE A;  4U1Z A;  3PD9 A;  2QFL A;  4YKI A;  4X8R A;  2IEE A;  3IAZ A;  1FTA A;  3E79 A;  4DXB A;  4GXA A;  2KLF A;  2I0C A;  3N5L A;  2PYY A;  5DTB A;  5AA2 D;  4KR5 A;  3VVF A;  3VVD A;  5A5X B;  2PX1 A;  3SKP A;  2HZK A;  2GFE A;  3TDJ A;  3F11 A;  4OXV A;  3FVG A;  1PB9 A;  1FBG A;  3G3F A;  4U1O A;  1P1W A;  1B7U A;  4G68 B;  3V8X B;  3RQT A;  5JEI A;  3QAX A;  4OA4 A;  1MM7 A;  2RC9 A;  4X04 A;  3TMG A;  2HAU A;  4BDO A;  3BBR A;  3OO8 A;  4LAT A;  1O64 A;  1QUI A;  2OWT A;  3MUQ A;  2V4C A;  3MP1 A;  5I57 B;  4NF5 A;  3DLN A;  3PMX A;  2FIE A;  2O69 A;  3O2A A;  1ZLQ A;  3PPQ A;  1A55 A;  1SW2 A;  3IB0 A;  3RYD A;  1R6Z A;  4LP2 B;  3PV0 E;  1NH8 A;  4HE2 A;  5DT6 A;  2CEY A;  4F3S A;  3B6T A;  1UIU A;  3G3G A;  1H44 A;  1P99 A;  1H3D A;  4OEN A;  3TTM A;  3QXM A;  2ZYK A;  1POT A;  2H98 A;  3RPL A;  3B50 A;  2P0S A;  1B32 A;  2W7Y A;  4NF4 B;  1VDW A;  3H3G A;  1AL3 A;  3OMB A;  4PAI A;  2ZYN A;  2XWK A;  3QUF A;  1MPD A;  2QVU A;  4LVQ A;  4YKP A;  4EF2 A;  3O6G A;  2Y7P A;  1D3K A;  3OEN A;  3T9H B;  1B5I A;  4EQ7 A;  5CRY A;  3PUZ E;  4GWO A;  5H8S A;  4GX6 A;  4OVR A;  4EDP A;  1FPB A;  4MNI A;  3PPR A;  1TXF A;  3R6U A;  1FQC A;  4FAT A;  1DPP A;  4DIG A;  3MP6 A;  3MVX A;  5ITO A;  3OO6 A;  2F3B A;  1HSJ A;  4H8I A;  3OO9 A;  2R6G E;  2VD3 A;  2Y7I A;  4ZE9 A;  2I6E A;  4P1E A;  2Z22 A;  2O6A A;  3LBS A;  4OZ9 A;  1H43 A;  1ZIU A;  3MBP A;  4KXP A;  5CC2 A;  3TKD A;  1Y3P A;  2XXR A;  3G3J A;  5I56 B;  1B4H A;  4LQ2 A;  4F1U A;  3RTF B;  4R75 A;  5T3J A;  3LSX A;  1KA0 A;  5L8D A;  2ZZW A;  3D1R A;  1FQD A;  4YB5 A;  1IQ7 A;  4KQP A;  3T93 B;  2FYI A;  3WAE A;  3CSG A;  3K1P A;  5ELV A;  4OES A;  3ISP A;  2OWS A;  3U65 A;  2VT5 A;  3PU5 A;  4NTL A;  1K9Z A;  4TLM B;  5H8F A;  2Z8E A;  3ILU B;  2DXY A;  2FA7 A;  3KEI A;  1PB8 A;  2WYP A;  2X7Q A;  2RCB A;  4JSO A;  4N8Y A;  1M5E A;  4FOR A;  4N91 A;  1ZMG A;  1UQW A;  1MQH A;  1PB7 A;  1I6Q A;  4LZ8 A;  2D3I A;  3D4G A;  5TP9 A;  4MLQ A;  2OBG A;  5DVF A;  4K3F A;  4KI0 E;  1POY 1;  3V89 B;  2RF1 A;  4I62 A;  1VR5 A;  4JWX A;  3HO7 A;  3TTL A;  3O97 A;  5I5P A;  3PUX E;  4NAP A;  5AA4 A;  4PF6 A;  1YYZ A;  4ZEK A;  4AS4 A;  5I59 B;  4ZEF A;  1LFI A;  2Q74 A;  1MPC A;  2RC7 A;  3QUJ A;  4IGT A;  4POW A;  4IY6 A;  2WBB A;  1A99 A;  5AA2 B;  1QKB A;  4RPO A;  3HFU A;  3KJT A;  1K9Y A;  4WXJ A;  4Z7E A;  4JVD A;  1EZO A;  3HV1 A;  2R9J A;  4GIZ A;  3GBA A;  4IB2 A;  1LB8 A;  2G93 A;  1N7W A;  3AXF A;  3H6U A;  3ILT B;  2H9B A;  4WEP A;  1Q1K A;  2Y5L A;  3SEW A;  4YU0 A;  4NF8 A;  3KOS A;  3BIG A;  3LSW A;  4GXS B;  1MY3 A;  4YAH X;  4QFP A;  3K1M A;  1BTJ A;  3H06 B;  1B40 A;  3QIM A;  5CMK A;  3K6W A;  4GWY A;  2BJJ X;  2UVG A;  3OSR A;  4XKP A;  4BLA A;  1FPG A;  2QS4 A;  2Q9T A;  4QHQ A;  5HM4 B;  1LBW A;  2O7U A;  4YZZ A;  5FTH A;  4G68 C;  2FIX A;  5DW8 A;  4O94 A;  3JV9 A;  1ANF A;  1FBH A;  5I2K B;  4P9K A;  1URS A;  2DVC A;  3P7I A;  4O3C A;  3RLF E;  2XWI A;  3PUV E;  3I5O A;  2HZL A;  5I7I A;  2QS2 A;  1FQB A;  1SQY A;  1WOD A;  1Y20 A;  2GRV A;  1SYH A;  2V93 A;  4DZ1 A;  1NH7 A;  3T22 A;  3TEL A;  1CNQ A;  1FJ6 A;  2XA5 A;  4AB6 A;  3JYR A;  1LAX A;  5LTC A;  1G0H A;  1QW0 A;  3RGY A;  2XXY A;  2REG A;  2PFY A;  3C36 A;  2BJI A;  2VPN A;  4KYE A;  3KN8 A;  1MG1 A;  4P1L A;  4H8J A;  3S9E A;  1B2H A;  4L17 A;  4MHF A;  3H7M A;  3T9U A;  1LLS A;  4ZED A;  1FRP A;  3IFC A;  5JTY A;  2ZMB A;  5IZ3 A;  4R2B A;  1IIT A;  3RTW B;  1A8F A;  3EF7 A;  3T9X B;  1PC3 A;  4P56 A;  4RXL A;  3U93 A;  4XTC Q;  1XVY A;  3CRB A;  3TOD A;  5I84 A;  3Q29 A;  5IZZ A;  3MP8 A;  3KGC A;  4NE4 A;  3K01 A;  1H45 A;  3OSQ A;  2DQV A;  4MNC A;  3HST A;  4YMA A;  1DTG A;  1MDP 1;  1T0K A;  3TQW A;  1H76 A;  2ZNU A;  4R6H A;  4NF6 B;  3MW0 A;  1I69 A;  1JEV A;  2B3F A;  2MKZ A;  4X9T A;  2ZYM A;  2YPN A;  2ANJ A;  4AB5 A;  2OLB A;  2CZH A;  1XS5 A;  1WVJ A;  1D9Y A;  3IO6 A;  2WYK A;  2CMO A;  2XXU A;  4FAJ A;  4GD5 A;  3IOV A;  1NNK A;  1XVX A;  3UA8 A;  4C1T A;  2V3T A;  3PPN A;  1AIV A;  5EQ7 A;  4EQ9 A;  1URD A;  2P3N A;  4XIG Q;  1G0I A;  1MXU A;  2Q88 A;  4PFT A;  4NF4 A;  3K6U A;  4QFO A;  4IY5 A;  1N76 A;  3G7W A;  4QBA A;  3M8U A;  1PDA A;  2F6G A;  5JK4 A;  4BDM A;  2RIN A;  4NED A;  3O29 A;  4MFI A;  1JET A;  4JVI A;  4Z0I A;  1NUY A;  3C4M A;  1FJ9 A;  4NGU A;  3U72 A;  5IKB A;  1B52 A;  1SVX B;  3N6T A;  3ODB A;  4ZEC A;  5KDT B;  3FBP A;  1NV5 A;  3HHG A;  3H6W A;  1Y1M A;  1Z7M E;  4HXV A;  4MX6 A;  4F3G A;  3KFM A;  4IO2 A;  1QUL A;  4FBP A;  1LCT A;  1RDX A;  3I6V A;  2VP1 A;  4GWZ A;  2OCU A;  4G4P A;  4F29 A;  1O7T A;  1MY0 A;  1NUZ A;  3SEX A;  1Y3N A;  3U1O A;  4RJZ A;  5DEX A;  3FXB A;  2Q8M A;  3T0J A;  4TOZ A;  3DP8 A;  3C32 A;  3EHU A;  4HS7 A;  2HCA A;  4ELP A;  2QSX A;  4G8M A;  1A54 A;  4MNP A;  1SW5 A;  2HAV A;  4KCD A;  3IK6 B;  5L9M A;  5EYG A;  2F97 A;  4PF8 A;  3B6Q A;  4QFN A;  4U21 A;  2I48 A;  4H5F A;  3ZS6 A;  4X48 A;  1B5H A;  1XOC A;  2V84 A;  5CMM A;  3KC0 A;  1SBP A;  1QJM A;  1NI9 A;  2REJ A;  1Q35 A;  4ND9 A;  3D4C A;  1UTH B;  3E3K A;  4N81 A;  4PE5 B;  3OEK A;  4RPN A;  3KBZ A;  4R9F A;  5I59 A;  4OVP A;  4EXL A;  3FXR A;  1XHY A;  3UOR A;  3K4U A;  4FED A;  4LON B;  2P3V A;  4N6P A;  1PBQ A;  4IO6 A;  4HTG A;  5BWJ A;  2VGQ A;  3FUZ A;  4DCY A;  1IEJ A;  5AA1 A;  4H1X A;  1P1Q A;  1SW1 A;  3FJG A;  4XKN A;  5A5L A;  3B7D A;  2RKM A;  4WED A;  3FV2 A;  3LUY A;  3TAJ A;  1RYO A;  2H99 A;  1MXW A;  3TYH A;  4P8B A;  4OFJ A;  3CVG A;  5H8Q A;  2QMW A;  2I58 A;  2XXH A;  4MIJ A;  2Z23 A;  3OOA A;  1YTV A;  1OLA A;  3QMF A;  4HE0 A;  3KZG A;  2HQ0 A;  4MF3 A;  1QVS A;  1NFT A;  5H8N A;  2Y7R A;  3FAS A;  4BDQ A;  4M1V A;  1BLF A;  4OQO A;  5H8H B;  1FPK A;  1USY E;  1Y3Q A;  3EHT A;  2DWI A;  3IB2 A;  5EHM A;  4ECF A;  2QL3 A;  2XXT A;  1QGX A;  3IX1 A;  4QSD A;  2F7C A;  4NG7 A;  2KR0 A;  2NUV A;  4F1V A;  3VXB A;  1SW4 A;  3RPW A;  3EN3 A;  2PT2 A;  3DP6 A;  1J1N A;  3VV5 A;  4DI3 D;  1VFD A;  3DP4 A;  3PPO A;  1FPE A;  2UYF A;  5KCJ A;  1FBF A;  3TUS A;  1FTL A;  2ONK E;  2PCR A;  3GBB A;  4IO5 A;  1URG A;  3G3I A;  2CEX A;  2X26 A;  2DP8 A;  2NOO A;  1S7Y A;  3H6V A;  1CB6 A;  2I4C A;  2CZK A;  4LUB A;  3MVW A;  1UTB B;  5I2N A;  1EZP A;  4PGP A;  2F5X A;  4P3L A;  1IMD A;  1B5J A;  2AIX A;  3LUZ A;  2PMS A;  3SEV A;  1LEV A;  2Q8J A;  2M8C A;  2XWO A;  3TCF A;  2JJK A;  4UAB A;  3S2V A;  5FHO A;  4BDL A;  4NHB A;  1IMC A;  1B3E A;  1AWB A;  1QKA A;  4PFW A;  4I40 A;  4Q8R A;  1D9V A;  1P1N A;  1US4 A;  1LAG E;  3OD7 A;  4KHZ E;  3HHF A;  2F34 A;  4F2O A;  3PMV A;  1NV7 A;  3G3H A;  1L5T A;  4ELR A;  3SET A;  1MY4 A;  3V5A A;  5FBP A;  2NXO A;  4N15 A;  4JXI A;  3VLV A;  3N6U A;  1FTJ A;  4PFI A;  3TTR A;  4GWX A;  1ZU0 A;  3MAM A;  1FTM A;  2I4B A;  2UYE A;  2E0S A;  1WDN A;  4U4S A;  3M3K A;  4N6D A;  4MH5 A;  1JEU A;  4GFR A;  2HXW A;  3G3K A;  2PBW A;  1BK4 A;  2O1M A;  1SI0 A;  4AQ4 A;  1B4Z A;  5HPQ A;  5EHS A;  1LBC A;  1OVB A;  2ONS A;  2P2A A;  3PPP A;  4EXK A;  3V83 A;  3KN3 A;  4OTE A;  5DYH A;  5EQ8 A;  5CMB A;  1B58 A;  1B51 A;  3O28 A;  4YMB A;  1B7H A;  2QJE A;  3CIJ A;  4P11 A;  4GWW A;  1NKX A;  5J1D A;  2AYS A;  4PP0 A;  1EYI A;  2DWA A;  1BIY A;  4O8M A;  2XD2 A;  2Y5K A;  1DSN A;  3GLB A;  1LBX A;  5CMC A;  1A8E A;  4IO7 A;  1IXI A;  4PFR A;  2V3U A;  1F9B A;  2XXW A;  1B9J A;  1AH5 A;  1FQA A;  3ONM A;  3B8B A;  1USY H;  4JB7 A;  1Y9U A;  4N6K A;  2DE3 A;  4XEQ A;  2DVZ A;  4PTK A;  1ZBM A;  2D21 A;  4F3B A;  1R9L A;  4E0W A;  3M3L A;  3I3V A;  4NF5 B;  3MVY A;  5ICQ A;  1LGB C;  2B3B A;  4GOT A;  1IUD A;  3ROJ A;  2GQ1 A;  3FIR A;  3W9W A;  3OEM A;  4U22 A;  1M5C A;  2RCA A;  2AL5 A;  4NWD A;  4Q5T A;  1FBE A;  4YIC A;  4F39 A;  4YKJ A;  2B65 A;  3RPL B;  4PFU A;  3SER A;  3QYT A;  3UN6 A;  3SDF A;  3FXU A;  3CI8 A;  5K2Y A;  3RNN A;  1KZ8 A;  1Y4T A;  2ZXT A;  4NX1 A;  4PAK A;  3MC2 A;  1FSA A;  4FEC A;  3CFZ A;  3S9M C;  4ELO A;  1MXX A;  5AE4 A;  3LSL A;  1IZ1 A;  3KC1 A;  1SPI A;  1A7L A;  1IMF A;  4GQO A;  3B6W A;  1BP5 A;  3C34 A;  2A5T A;  3RN8 A;  2VOZ A;  1B0H A;  1Q9D A;  2Z8F A;  4LQ5 A;  3GZG A;  1MS7 A;  5B70 A;  1XC1 A;  2XXQ A;  4P0G A;  4GX3 A;  2QPQ A;  2YLN A;  3UP9 A;  1JW4 A;  2F7A A;  3T96 B;  2I3W A;  1KA1 A;  4R9G A;  4KFQ A;  4DE8 A;  3O6I A;  3CR9 A;  3KBR A;  1IIW A;  4GVO A;  5I58 B;  2XX7 A;  1VE4 A;  4G77 A;  2OJT A;  3VXC A;  1FBP A;  4HW8 A;  1LB9 A;  5A5X A;  5J16 A;  4F3P A;  3LV0 A;  1JW5 A;  2GH9 A;  4HE1 A;  4JWY A;  5AA3 A;  5H8F B;  4G68 A;  3K6V A;  2FHY A;  4GL0 A;  3N26 A;  1ATG A;  2X7P A;  1UIV A;  2H25 A;  5FHN A;  4PFB A;  4LZ7 A;  5TP9 B;  1RDZ A;  3CG1 A;  4IO4 A;  5CM6 A;  3IOU A;  3E9X A;  1S9T A;  2D5W A;  1DTZ A;  2QS1 A;  4N07 A;  3N94 A;  1TFA A;  5I57 A;  3FAT A;  4N4U A;  5AA4 B;  3VVE A;  2PFZ A;  3FGS A;  1MM6 A;  1FBD A;  2V25 A;  4KYS A;  1FPL A;  1QUK A;  2DYX A;  3TTK A;  4P0I A;  2CZL A;  4ESW A;  1MY2 A;  2DE2 A;  5B7D A;  1D9Q A;  3UGW A;  3RUM A;  2HHM A;  2R8T A;  1NUW A;  3TTN A;  3Q27 A;  5EQA A;  3C35 A;  4GBV A;  3H03 A;  1FPJ A;  3K6X A;  2XXP A;  3RT6 B;  4YB7 A;  2O68 A;  2OZZ A;  4RK9 A;  4BDR A;  2O51 A;  4NF8 B;  3A3U A;  1B3F A;  4DI4 B;  2Y84 A;  3Q26 A;  3ZKL A;  1MH4 A;  1ZKB A;  2XXI A;  4OFO A;  4MBP A;  1Y4C A;  3SZP A;  1B05 A;  2RC8 A;  3GYY A;  1OIB A;  1QUJ A;  2HFB A;  4TQU Q;  1Y1Z A;  2THI A;  4DDD A;  4MAG A;  2GHB A;  1MQI A;  2F8D A;  3SEY A;  3IOT A;  4RK2 A;  3IO4 A;  2QMX A;  3KOT A;  5I56 A;  1LAF E;  1B46 A;  1JP4 A;  4I3Y A;  3NOH A;  1US5 A;  2P1S A;  3RY3 A;  2HXR A;  2O1L A;  2LAO A;  3A09 A;  4IGR A;  4X1B A;  1SDX A;  4R74 A;  4H6D A;  3MYU A;  4ELQ A;  1IMA A;  4ZE8 A;  4PAF A;  3K00 A;  4C0R A;  1FQF A;  1LST A;  2ESN A;  4YB6 A;  1FTK A;  4KPT A;  1JW1 A;  1B1X A;  4FIM A;  3L6G A;  3L6H A;  3VFJ A;  3T1B A;  3ZKK A;  3U94 A;  5DVI A;  3M3F A;  3HN0 A;  1A40 A;  2F36 A;  2H4I A;  2XX9 A;  1P1U A;  2ONR A;  1FPD A;  3DEL B;  5CI5 A; 
#chains in the Genus database with same CATH homology
 3THI A;  3BFT A;  3CFX A;  4ZEB A;  2YJP A;  3FD3 A;  1M5B A;  5JTY B;  3MZ9 A;  3O6H A;  4I1D A;  4R2F A;  5AA2 A;  3IR1 A;  5ISU A;  2XX8 A;  4XKQ A;  3TPA A;  1MRP A;  3ZSF A;  4UAC A;  3BKI B;  1NNT A;  1OMP A;  3E4R A;  1MXZ A;  4JBZ A;  4TLL B;  4WKM A;  3W15 C;  3QK6 A;  1ZTY A;  4QSE A;  1B3H A;  4MLV A;  4JWO A;  1MQD A;  4KD5 A;  4OFL A;  3C9H A;  4QRZ A;  3KN7 A;  2NVU B;  2PT1 A;  1AOV A;  3Q25 A;  5KZT A;  3S9N C;  1BKA A;  4ESX A;  2F6P A;  2F7B A;  3USD A;  3S9L C;  5CBR A;  1MPB A;  3VLU A;  3U8Q A;  2UVH A;  3C31 A;  4F2Q A;  5I2K A;  1M5F A;  4QFK A;  4QF9 A;  1OQH A;  4U4X A;  1M5D A;  4I8C A;  1I6B A;  3T9V A;  3TEP A;  3PMW A;  3T66 A;  1GVC A;  4N13 A;  3IB1 A;  1TFD A;  4PQJ A;  1LBB A;  1GR2 A;  3KSX A;  4HCW A;  4Q0C A;  3TZA A;  1ELJ A;  3K1N A;  4RA1 A;  5TPA B;  3MVZ A;  1SI1 A;  3CFL A;  2DS9 A;  4H67 A;  3UK4 A;  4OYV A;  2NWJ A;  1MQG A;  1JVX A;  1MXY A;  5ICT A;  2Z8D A;  2ZNT A;  3PUY E;  4RY1 A;  1YPN A;  4ISU A;  2DWJ A;  4JSD A;  5DVJ A;  5I58 A;  1DOT A;  5DEX B;  4R6Y A;  4JDF A;  3KG2 A;  5FHM A;  4Q30 B;  1P1O A;  4DXU A;  3K2D A;  1S50 A;  3IOR A;  4DLD A;  3FVO A;  1JNF A;  3ECR A;  4OER A;  3KSJ A;  4G8H A;  4FE8 A;  4E0X A;  3OO7 A;  1N7X A;  4GRK A;  4F19 A;  1VSO A;  1JVY A;  1NMU A;  1R1N A;  4ONY A;  1OQG A;  3R7X A;  1Z7N E;  1JQF A;  4R72 A;  3Q28 A;  1N3W A;  3SEU A;  3FXQ A;  4QSC A;  3RT8 A;  1VFE A;  3LSF B;  4NF6 A;  3U92 A;  1PBP A;  1FW0 A;  3PD8 A;  2FNC A;  1XT8 A;  4THI A;  4I9D A;  5HBC A;  3IJO B;  2I3V A;  3VLW A;  1FCK A;  5FTI A;  5K2X A;  3FJ7 A;  3SES A;  3KJ7 A;  3W9V A;  1FQE A;  3TFL A;  5M2V A;  2ALU A;  1NNP A;  2V3Q A;  3FV1 A;  2GHA A;  1FTO A;  1LAH E;  3S4U A;  4LA9 A;  2A5S A;  2XHD A;  4OHN A;  4OVJ A;  2UXA A;  1I6A A;  1NL5 A;  5F7V A;  1HSL A;  3UIF A;  4ZZE A;  2Y7K A;  4G8N A;  2O7I A;  3FVN A;  1GV8 A;  2QS3 A;  3O9P A;  3GXA A;  4DXC A;  5H8Q B;  4H65 A;  2AL4 A;  3FZV A;  5H8N B;  1HSE A;  4POX A;  2DE4 A;  3CG3 A;  2QRY A;  4GLI A;  3FJM A;  1MXV A;  2ZNS A;  3TQL A;  5KDT A;  2H5Y A;  3QSL A;  5L9O A;  4BDN A;  4R6K A;  4PFY A;  1YAE A;  3MJN A;  4H5G A;  5KCJ B;  1AMF A;  3VE1 B;  1TT1 A;  4GF8 A;  4EQB A;  1O63 A;  2G29 A;  1N04 A;  1IXC A;  1RKM A;  1B7Z A;  4F31 B;  3LR1 A;  5BUU A;  1SYI A;  3K0V A;  1TWY A;  3TCH A;  5I2N B;  4O3B A;  3BFU A;  1EZ9 A;  2XXV A;  1CE2 A;  2IA4 A;  4XXU A;  2DXR A;  3HPI A;  3WAF A;  2I49 A;  4RNS A;  1RYX A;  2UVI A;  2WKY A;  4H0W A;  4EF1 A;  2Q2C A;  2E1S A;  4ZZA A;  2R71 A;  4GL8 A;  4O3A A;  1UTH A;  3MPL A;  4U2R A;  4F1Y A;  3H4Z A;  1MY1 A;  3MPK A;  3FVK A;  2XD3 A;  1B3L A;  4NMY A;  1IXG A;  5L9S A;  1R9Q A;  4LZ5 A;  2DWH A;  1IXH A;  1EH3 A;  3A3C A;  1B6H A;  1YCJ A;  3IL1 B;  4DCX A;  1MH3 A;  1DPE A;  3JZJ A;  2DOJ A;  4ZDM A;  4ZS9 A;  3IOW A;  3OXN A;  3PGF A;  1B1H A;  1B3G A;  4HCY A;  1ZJL A;  4U23 A;  5ITP A;  2ABH A;  2HEU A;  2F35 A;  1DMB A;  3LC8 A;  2Q2A A;  3IJX B;  3MZ1 A;  2O84 X;  5CBS A;  5H8H A;  4RYA A;  4KCC A;  1LCF A;  2Y7W A;  4OMB A;  3O66 A;  4YKK A;  1GTK A;  3PUW E;  4R73 A;  3K02 A;  4XKR A;  5EYF A;  4PET A;  4G2Z A;  2PVU A;  4QFL A;  4FJP A;  3MWB A;  5IAI A;  1NNF A;  2Q89 A;  5LOM A;  4F22 A;  2XXX A;  1PEB A;  3TCG A;  3MQ9 A;  1UTB A;  3C33 A;  2VD2 A;  4M4G A;  1GGG A;  1LFG A;  4KYD A;  1LFH A;  4C1U A;  3VDF A;  4EUO A;  1MDQ A;  4IO3 A;  1OVT A;  4ZEI A;  4UA8 A;  3CSB A;  1N0T A;  1KWH A;  1EU8 A;  1B0L A;  5TPA A;  4X1D A;  1N84 A;  2ZYO A;  3DM0 A;  3H6T A;  3R26 A;  5F1Q A;  4FEB A;  2VHA A;  5TU0 A;  1MQJ A;  1OLC A;  3OEL A;  3HCQ A;  1D4N A;  2I0B A;  1SD3 A;  4OEU A;  2F78 A;  4F18 A;  3MZB A;  4OEV A;  3E13 X;  3EHS A;  2DSF A;  3EQ1 A;  4OET A;  1N3X A;  2UVJ A;  2OK2 A;  1II5 A;  4OWD A;  4NWC A;  2A5T B;  3EPE A;  4U1Z A;  3PD9 A;  4YKI A;  2IEE A;  3IAZ A;  4DXB A;  4GXA A;  2KLF A;  2I0C A;  3N5L A;  2PYY A;  5DTB A;  5AA2 D;  4KR5 A;  3VVF A;  3VVD A;  5A5X B;  2PX1 A;  3SKP A;  2HZK A;  2GFE A;  3TDJ A;  3F11 A;  4OXV A;  3FVG A;  1PB9 A;  3G3F A;  4U1O A;  1P1W A;  1B7U A;  4G68 B;  3V8X B;  3RQT A;  5JEI A;  3QAX A;  1MM7 A;  2RC9 A;  3TMG A;  2HAU A;  4BDO A;  3BBR A;  3OO8 A;  4LAT A;  1O64 A;  1QUI A;  2OWT A;  3MUQ A;  3MP1 A;  5I57 B;  4NF5 A;  3DLN A;  3PMX A;  2O69 A;  3O2A A;  1ZLQ A;  3PPQ A;  1A55 A;  1SW2 A;  3IB0 A;  1R6Z A;  4LP2 B;  3PV0 E;  1NH8 A;  5DT6 A;  4F3S A;  3B6T A;  1UIU A;  3G3G A;  1H44 A;  1P99 A;  1H3D A;  4OEN A;  3TTM A;  3QXM A;  2ZYK A;  1POT A;  2H98 A;  2P0S A;  1B32 A;  2W7Y A;  4NF4 B;  3H3G A;  1AL3 A;  3OMB A;  2ZYN A;  3QUF A;  1MPD A;  4LVQ A;  4YKP A;  4EF2 A;  3O6G A;  2Y7P A;  1D3K A;  3OEN A;  3T9H B;  1B5I A;  4EQ7 A;  5CRY A;  3PUZ E;  4GWO A;  5H8S A;  4EDP A;  3PPR A;  1TXF A;  3R6U A;  1FQC A;  4FAT A;  1DPP A;  4DIG A;  3MP6 A;  3MVX A;  5ITO A;  3OO6 A;  1HSJ A;  4H8I A;  3OO9 A;  2R6G E;  2VD3 A;  2Y7I A;  4ZE9 A;  2I6E A;  2Z22 A;  2O6A A;  3LBS A;  4OZ9 A;  1H43 A;  1ZIU A;  3MBP A;  5CC2 A;  3TKD A;  1Y3P A;  2XXR A;  3G3J A;  5I56 B;  1B4H A;  4LQ2 A;  4F1U A;  3RTF B;  4R75 A;  3LSX A;  5L8D A;  1FQD A;  4YB5 A;  1IQ7 A;  4KQP A;  3T93 B;  2FYI A;  3WAE A;  3CSG A;  3K1P A;  5ELV A;  4OES A;  2OWS A;  3PU5 A;  4NTL A;  4TLM B;  5H8F A;  2Z8E A;  3ILU B;  2DXY A;  2FA7 A;  3KEI A;  1PB8 A;  2X7Q A;  2RCB A;  4JSO A;  1M5E A;  4FOR A;  1ZMG A;  1UQW A;  1MQH A;  1PB7 A;  1I6Q A;  4LZ8 A;  2D3I A;  3D4G A;  5TP9 A;  4MLQ A;  2OBG A;  5DVF A;  4K3F A;  4KI0 E;  1POY 1;  3V89 B;  2RF1 A;  4I62 A;  1VR5 A;  4JWX A;  3HO7 A;  3TTL A;  3O97 A;  3PUX E;  5AA4 A;  4ZEK A;  5I59 B;  4ZEF A;  1LFI A;  1MPC A;  2RC7 A;  3QUJ A;  4IGT A;  4POW A;  4IY6 A;  1A99 A;  5AA2 B;  1QKB A;  4RPO A;  3KJT A;  4WXJ A;  4Z7E A;  1EZO A;  3HV1 A;  2R9J A;  4GIZ A;  3GBA A;  4IB2 A;  1LB8 A;  2G93 A;  1N7W A;  3AXF A;  3H6U A;  3ILT B;  2H9B A;  4WEP A;  1Q1K A;  3SEW A;  4YU0 A;  4NF8 A;  3KOS A;  3LSW A;  4GXS B;  1MY3 A;  4YAH X;  4QFP A;  3K1M A;  1BTJ A;  3H06 B;  1B40 A;  3QIM A;  5CMK A;  3K6W A;  2BJJ X;  2UVG A;  3OSR A;  4XKP A;  4BLA A;  2QS4 A;  2Q9T A;  4QHQ A;  5HM4 B;  2O7U A;  4YZZ A;  5FTH A;  4G68 C;  3JV9 A;  1ANF A;  5I2K B;  1URS A;  2DVC A;  3P7I A;  4O3C A;  3RLF E;  3PUV E;  3I5O A;  2HZL A;  2QS2 A;  1FQB A;  1SQY A;  1WOD A;  1Y20 A;  2GRV A;  1SYH A;  2V93 A;  4DZ1 A;  1NH7 A;  3T22 A;  3TEL A;  4AB6 A;  3JYR A;  1LAX A;  1QW0 A;  3RGY A;  2XXY A;  2REG A;  3C36 A;  4KYE A;  3KN8 A;  1MG1 A;  4H8J A;  3S9E A;  1B2H A;  4L17 A;  3H7M A;  3T9U A;  1LLS A;  4ZED A;  5JTY A;  2ZMB A;  4R2B A;  1IIT A;  3RTW B;  1A8F A;  3EF7 A;  3T9X B;  1PC3 A;  4RXL A;  3U93 A;  4XTC Q;  1XVY A;  3CRB A;  3TOD A;  5I84 A;  3Q29 A;  3MP8 A;  3KGC A;  4NE4 A;  3K01 A;  1H45 A;  3OSQ A;  2DQV A;  3HST A;  4YMA A;  1DTG A;  1MDP 1;  1T0K A;  3TQW A;  1H76 A;  2ZNU A;  4R6H A;  4NF6 B;  3MW0 A;  1I69 A;  1JEV A;  2B3F A;  4X9T A;  2ZYM A;  2YPN A;  2ANJ A;  4AB5 A;  2OLB A;  1XS5 A;  1WVJ A;  1D9Y A;  3IO6 A;  2CMO A;  2XXU A;  4FAJ A;  4GD5 A;  3IOV A;  1NNK A;  1XVX A;  3UA8 A;  4C1T A;  2V3T A;  3PPN A;  1AIV A;  4EQ9 A;  1URD A;  4XIG Q;  1MXU A;  2Q88 A;  4PFT A;  4NF4 A;  3K6U A;  4QFO A;  4IY5 A;  1N76 A;  3G7W A;  3M8U A;  1PDA A;  2F6G A;  5JK4 A;  4BDM A;  2RIN A;  4NED A;  3O29 A;  4MFI A;  1JET A;  4Z0I A;  3C4M A;  3U72 A;  5IKB A;  1B52 A;  1SVX B;  3N6T A;  3ODB A;  4ZEC A;  5KDT B;  3HHG A;  3H6W A;  1Y1M A;  1Z7M E;  4F3G A;  3KFM A;  4IO2 A;  1QUL A;  1LCT A;  3I6V A;  2VP1 A;  2OCU A;  4G4P A;  4F29 A;  1O7T A;  1MY0 A;  3SEX A;  1Y3N A;  3U1O A;  4RJZ A;  5DEX A;  4TOZ A;  3DP8 A;  3C32 A;  3EHU A;  4HS7 A;  2HCA A;  4ELP A;  2QSX A;  4G8M A;  1A54 A;  1SW5 A;  2HAV A;  4KCD A;  3IK6 B;  5L9M A;  2F97 A;  3B6Q A;  4QFN A;  4U21 A;  2I48 A;  4H5F A;  3ZS6 A;  4X48 A;  1B5H A;  1XOC A;  2V84 A;  5CMM A;  1SBP A;  1QJM A;  2REJ A;  1Q35 A;  4ND9 A;  3D4C A;  1UTH B;  3E3K A;  4PE5 B;  3OEK A;  4RPN A;  4R9F A;  5I59 A;  4EXL A;  3FXR A;  1XHY A;  3UOR A;  3K4U A;  4FED A;  4LON B;  4N6P A;  1PBQ A;  4IO6 A;  4HTG A;  5BWJ A;  2VGQ A;  3FUZ A;  4DCY A;  1IEJ A;  5AA1 A;  4H1X A;  1P1Q A;  1SW1 A;  3FJG A;  4XKN A;  3B7D A;  2RKM A;  4WED A;  3FV2 A;  3LUY A;  3TAJ A;  1RYO A;  2H99 A;  1MXW A;  3TYH A;  4OFJ A;  3CVG A;  5H8Q A;  2QMW A;  2I58 A;  2XXH A;  2Z23 A;  3OOA A;  1YTV A;  1OLA A;  3KZG A;  2HQ0 A;  4MF3 A;  1QVS A;  1NFT A;  5H8N A;  2Y7R A;  3FAS A;  4BDQ A;  4M1V A;  1BLF A;  4OQO A;  5H8H B;  1USY E;  1Y3Q A;  3EHT A;  2DWI A;  3IB2 A;  5EHM A;  4ECF A;  2QL3 A;  2XXT A;  3IX1 A;  4QSD A;  2F7C A;  2NUV A;  4F1V A;  3VXB A;  1SW4 A;  3RPW A;  3EN3 A;  2PT2 A;  3DP6 A;  1J1N A;  3VV5 A;  1VFD A;  3DP4 A;  3PPO A;  2UYF A;  5KCJ A;  3TUS A;  1FTL A;  2ONK E;  3GBB A;  4IO5 A;  1URG A;  3G3I A;  2X26 A;  2DP8 A;  2NOO A;  1S7Y A;  3H6V A;  1CB6 A;  2I4C A;  4LUB A;  3MVW A;  1UTB B;  5I2N A;  1EZP A;  2F5X A;  1B5J A;  2AIX A;  2PMS A;  3SEV A;  2Q8J A;  2M8C A;  3TCF A;  3S2V A;  5FHO A;  4BDL A;  1B3E A;  1QKA A;  4PFW A;  4Q8R A;  1D9V A;  1P1N A;  1US4 A;  1LAG E;  3OD7 A;  4KHZ E;  3HHF A;  2F34 A;  4F2O A;  3PMV A;  3G3H A;  1L5T A;  4ELR A;  3SET A;  1MY4 A;  3V5A A;  2NXO A;  4JXI A;  3VLV A;  3N6U A;  1FTJ A;  3TTR A;  1ZU0 A;  3MAM A;  1FTM A;  2I4B A;  2UYE A;  2E0S A;  1WDN A;  4U4S A;  3M3K A;  4MH5 A;  1JEU A;  4GFR A;  2HXW A;  3G3K A;  2PBW A;  2O1M A;  1SI0 A;  4AQ4 A;  1B4Z A;  5HPQ A;  5EHS A;  1LBC A;  1OVB A;  2ONS A;  2P2A A;  3PPP A;  4EXK A;  3V83 A;  3KN3 A;  4OTE A;  5DYH A;  5CMB A;  1B58 A;  1B51 A;  3O28 A;  4YMB A;  1B7H A;  2QJE A;  3CIJ A;  4P11 A;  1NKX A;  5J1D A;  2AYS A;  4PP0 A;  2DWA A;  1BIY A;  2XD2 A;  1DSN A;  3GLB A;  5CMC A;  1A8E A;  4IO7 A;  1IXI A;  2V3U A;  1F9B A;  2XXW A;  1B9J A;  1AH5 A;  1FQA A;  3ONM A;  1USY H;  4JB7 A;  1Y9U A;  2DE3 A;  2DVZ A;  1ZBM A;  2D21 A;  4F3B A;  1R9L A;  4E0W A;  3M3L A;  3I3V A;  4NF5 B;  3MVY A;  5ICQ A;  1LGB C;  2B3B A;  4GOT A;  1IUD A;  3FIR A;  3W9W A;  3OEM A;  4U22 A;  1M5C A;  2RCA A;  2AL5 A;  4NWD A;  4Q5T A;  4YIC A;  4F39 A;  4YKJ A;  2B65 A;  4PFU A;  3SER A;  3QYT A;  3UN6 A;  3SDF A;  3FXU A;  3CI8 A;  5K2Y A;  3RNN A;  1Y4T A;  2ZXT A;  3MC2 A;  4FEC A;  3CFZ A;  3S9M C;  4ELO A;  1MXX A;  5AE4 A;  3LSL A;  1IZ1 A;  1A7L A;  4GQO A;  3B6W A;  1BP5 A;  3C34 A;  2A5T A;  3RN8 A;  2VOZ A;  1B0H A;  2Z8F A;  4LQ5 A;  3GZG A;  1MS7 A;  5B70 A;  1XC1 A;  2XXQ A;  4P0G A;  2QPQ A;  2YLN A;  3UP9 A;  1JW4 A;  2F7A A;  3T96 B;  2I3W A;  4R9G A;  4KFQ A;  4DE8 A;  3O6I A;  3CR9 A;  3KBR A;  1IIW A;  4GVO A;  5I58 B;  2XX7 A;  1VE4 A;  4G77 A;  2OJT A;  3VXC A;  4HW8 A;  1LB9 A;  5A5X A;  4F3P A;  1JW5 A;  2GH9 A;  4JWY A;  5AA3 A;  5H8F B;  4G68 A;  3K6V A;  4GL0 A;  3N26 A;  1ATG A;  2X7P A;  1UIV A;  2H25 A;  5FHN A;  4LZ7 A;  5TP9 B;  3CG1 A;  4IO4 A;  5CM6 A;  3IOU A;  3E9X A;  1S9T A;  2D5W A;  1DTZ A;  2QS1 A;  4N07 A;  3N94 A;  1TFA A;  5I57 A;  3FAT A;  5AA4 B;  3VVE A;  3FGS A;  1MM6 A;  2V25 A;  4KYS A;  1QUK A;  2DYX A;  3TTK A;  4P0I A;  2CZL A;  4ESW A;  1MY2 A;  2DE2 A;  5B7D A;  3UGW A;  3RUM A;  3TTN A;  3Q27 A;  3C35 A;  3RT6 B;  3H03 A;  3K6X A;  2XXP A;  4YB7 A;  2O68 A;  2OZZ A;  4RK9 A;  4BDR A;  2O51 A;  4NF8 B;  3A3U A;  1B3F A;  2Y84 A;  3Q26 A;  3ZKL A;  1MH4 A;  1ZKB A;  2XXI A;  4OFO A;  4MBP A;  1Y4C A;  1B05 A;  2RC8 A;  1OIB A;  1QUJ A;  2HFB A;  4TQU Q;  1Y1Z A;  2THI A;  4DDD A;  2GHB A;  1MQI A;  2F8D A;  3SEY A;  3IOT A;  4RK2 A;  3IO4 A;  2QMX A;  3KOT A;  5I56 A;  1LAF E;  1B46 A;  1US5 A;  2P1S A;  3RY3 A;  2O1L A;  2LAO A;  3A09 A;  4IGR A;  4X1B A;  1SDX A;  4R74 A;  4H6D A;  4ELQ A;  4ZE8 A;  3K00 A;  4C0R A;  1FQF A;  1LST A;  2ESN A;  4YB6 A;  1FTK A;  4KPT A;  1JW1 A;  1B1X A;  4FIM A;  3L6G A;  3L6H A;  3VFJ A;  3ZKK A;  3U94 A;  5DVI A;  3M3F A;  3HN0 A;  1A40 A;  2F36 A;  2H4I A;  2XX9 A;  1P1U A;  2ONR A;  3DEL B;  5CI5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...