1IQ7A

Ovotransferrin, c-terminal lobe, apo form
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
343
structure length
341
Chain Sequence
RIQWCAVGKDEKSKCDRWSVVSNGDVECTVVDETKDCIIKIMKGEADAVALDGGLVYTAGVCGLVPVMAERYDDESCSKDERPASYFAVAVARKDSNVNWNNLKGKKSCHTAVGRTAGWVIPMGLIHNRTGTCNFDEYFSEGCAPGSPPNSRLCQLCQGSGGIPPEKCVASSHEKYFGYTGALRCLVEKGDVAFIQHSTVEENTGGKNKADWAKNLQMDDFELLCTDGRRANVMDYRECNLAEVPTHAVVVRPEKANKIRDLLERQEKRFGVNGSEKSKFMMFESQNKDLLFKDLTKCLFKVREGTTYKEFLGDKFYTVISSLKTCNPSDILQMCSFLEGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Anion-mediated Fe3+ release mechanism in ovotransferrin C-lobe: a structurally identified SO4(2-) binding site and its implications for the kinetic pathway.
pubmed doi rcsb
molecule tags Metal transport
molecule keywords Ovotransferrin
total genus 102
structure length 341
sequence length 343
ec nomenclature
pdb deposition date 2001-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00405 Transferrin Transferrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1iq7A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1iq7A02
5DVFA 1SW5A 5EYFA 5IAIA 1OIBA 3SEVA 5AA2B 2V3QA 1OLCA 3U1OA 1M5CA 1MPBA 1B46A 1A8FA 1P1OA 4QRZA 4RPOA 1Y3PA 4NF8B 4PFYA 5TPAB 3RY3A 1OLAA 1S9TA 3UORA 5CC2A 1IITA 4RPNA 4DLDA 2XXQA 3H6WA 3SEYA 1A7LA 1UIUA 3K0VA 3IX1A 4QSCA 5H8NB 2THIA 3K00A 2DSFA 4NWCA 2HEUA 4X9TA 4R6KA 4DIGA 3QUJA 3R26A 2Z8DA 3IOVA 1M5FA 1MXYA 1URDA 2H98A 3CFZA 3IAZA 4XKRA 1USYE 1NMUA 2AIXA 3W9WA 2IEEA 4OVJA 4F22A 1VFDA 5I56B 1OQGA 2RINA 2ZYOA 4N6PA 1SW2A 4PFTA 4RA1A 4ESXA 3C4MA 3CVGA 3IL1B 2DXYA 1FTJA 1MRPA 2KLFA 2NOOA 1FQEA 1ZMGA 4QFKA 3T93B 2XXXA 4YKIA 1B32A 1LBCA 2XXHA 2Q89A 3CSBA 4FIMA 3S9LC 3KN8A 4I1DA 1MQGA 1FW0A 3EQ1A 4ZEKA 3PPRA 1DPPA 3MAMA 4G8NA 1XVXA 3AXFA 3FIRA 4H67A 1VFEA 3KJTA 4OXVA 4QFOA 4Z0IA 2QMXA 3ZS6A 5I2KB 5I56A 4JXIA 3RTFB 1JW4A 4NF6B 3MP1A 3TELA 3PMVA 4YAHX 2Z8EA 4YKJA 2RCBA 4ONYA 3MJNA 1B7HA 1VE4A 1JW1A 4JB7A 1MQDA 1IXCA 2F36A 1AH5A 5EHSA 5AA2D 3DELB 4U1ZA 1B52A 1Y20A 3I5OA 2X26A 4WXJA 2PT1A 2XXPA 3BKIB 4YU0A 2UVGA 5FHOA 3FVNA 1JVXA 1JVYA 1ZIUA 1FQFA 3SEXA 4F3BA 3D4CA 5L9MA 4XTCQ 4PETA 1Y4TA 4YKKA 1B2HA 3RTWB 3TTLA 1IUDA 3TEPA 4EF2A 5BUUA 2V93A 3CRBA 2F5XA 1BKAA 2XHDA 3QXMA 4ISUA 4GL8A 1OMPA 2OWTA 1I6BA 3C31A 4KCDA 2I3WA 5AA4A 1FCKA 2AL5A 3LSFB 3TKDA 3VXCA 3H6VA 1MXUA 1FQBA 3FJMA 1F9BA 4GL0A 2AL4A 4GXSB 1B3LA 1J1NA 3SEUA 4FEDA 3FXRA 5CI5A 2HFBA 1SYIA 4RYAA 3TPAA 4NE4A 1JETA 4H5FA 1N7XA 2B65A 2PT2A 1UTHB 4ESWA 4ZE8A 2HCAA 5H8HB 4PP0A 5I58B 4KI0E 1TFDA 2DVZA 1B3GA 1N3XA 3UGWA 5JEIA 1FTLA 3DP6A 3H06B 4O3CA 4ZEFA 3FD3A 1MM7A 3QK6A 2I6EA 1QUIA 3OXNA 4QFPA 2YJPA 1XHYA 4EDPA 4ELQA 4OESA 4BDOA 1P1WA 1NNFA 2PMSA 5IKBA 4R9FA 4F29A 5CBRA 5I84A 1SDXA 4X1BA 4NMYA 4MLVA 5HBCA 1LCTA 3OO8A 2IA4A 2X7QA 3FASA 5H8HA 2H99A 1OVTA 3JZJA 4X48A 1URSA 3KG2A 3UIFA 3IO6A 3KZGA 2A5TB 1XT8A 2OWSA 1LFIA 2XXYA 4MLQA 3H6UA 3EHUA 2HAUA 4U4SA 4GWOA 3HHGA 3L6GA 1DSNA 2RC7A 4IO2A 3K01A 4P0GA 2QL3A 3CFLA 3K1PA 2QS2A 3KN3A 4HS7A 3RGYA 1DTZA 4M1VA 1I6QA 1N76A 4GQOA 4YKPA 3UN6A 2V84A 3QUFA 1MXWA 5FTHA 3HV1A 2AYSA 3HN0A 4AB5A 3VLUA 3F11A 4OWDA 2GFEA 3TTRA 2X7PA 1XC1A 4THIA 1B5IA 3OO9A 4ECFA 1B3EA 2ONKE 1NL5A 2DXRA 2Q2AA 3PGFA 2OLBA 3RT6B 5KZTA 4O3BA 2O51A 1O63A 1Y9UA 4MF3A 1SVXB 3IB0A 3E4RA 3N26A 3PPPA 3S4UA 3U93A 3V89B 1UTHA 4N07A 4RK2A 5BWJA 1AOVA 2OK2A 3BBRA 4PQJA 3VXBA 1B7UA 1IXHA 1D3KA 1LGBC 1N04A 1HSLA 4PFWA 3OO6A 4KYDA 4TLMB 5I57B 1IEJA 3LC8A 2H9BA 4YB7A 2F78A 3RUMA 4ND9A 4F19A 5I58A 2PVUA 3M8UA 2OZZA 1EZPA 5AA2A 3TODA 4PFUA 3HO7A 4OENA 4OFJA 5DYHA 2FA7A 3C32A 3D4GA 5ICTA 2XXIA 2O69A 5H8QA 1B58A 4OMBA 1MDP1 4EUOA 3U92A 3B6TA 1EH3A 2RC8A 4R2FA 3TCGA 4ZEIA 2REGA 2XXUA 1O7TA 3S9MC 5EHMA 1PEBA 3O2AA 2A5TA 5KCJB 1FTOA 2XX9A 2ZNTA 4E0XA 3EPEA 2I48A 1FQCA 3W15C 5J1DA 1WDNA 4G68C 1GGGA 4NWDA 3N6TA 2A5SA 2ANJA 2D3IA 2NXOA 4QSDA 2Z23A 3MP8A 4ZECA 3H03A 1M5BA 1UTBA 4G68B 5L9SA 3OELA 3H7MA 1LFGA 1SBPA 3O6IA 4JWOA 4ZZAA 3C33A 1H3DA 4IB2A 5TP9B 1AL3A 3EHSA 3OMBA 3K6XA 3MWBA 3VFJA 3SDFA 4IO6A 3TTKA 4EQBA 1B9JA 3O28A 4NEDA 4NF5A 2QRYA 4C0RA 2HXWA 1R1NA 4FEBA 3RQTA 3DP4A 3QYTA 5I2KA 4TQUQ 3C9HA 3S2VA 3IR1A 2DOJA 1UTBB 2DP8A 4YB6A 4ZS9A 3T9VA 5LOMA 2XX7A 4JWYA 2HAVA 4KYSA 3T9HB 3VDFA 4GFRA 4EQ7A 1OQHA 3FXUA 3IB2A 3Q25A 3ZKLA 3S9EA 1IXGA 3KSXA 5I59B 1RYOA 1TFAA 1B40A 3PUXE 2NUVA 3IOWA 1PBQA 2ZXTA 1PB9A 4H8IA 4QF9A 1MDQA 3MZ9A 3KOSA 4I9DA 4NF4B 4Q30B 1B0HA 4WEPA 5DEXB 4BDNA 4DZ1A 4KYEA 1GVCA 4F2QA 2I0CA 1US4A 1O64A 1QJMA 2UVIA 4G4PA 4NF6A 1NH8A 4F18A 1QKBA 2DE3A 3RNNA 5HPQA 3VVEA 4DCYA 4M4GA 4UACA 3FGSA 1D9YA 2FYIA 1YCJA 4XKNA 3RLFE 4DCXA 4XKQA 5I59A 1DPEA 4LUBA 1AIVA 1N0TA 2H25A 4RNSA 5JTYA 4R75A 2QSXA 2I49A 4R6YA 2XXRA 3KSJA 3MVYA 3PD9A 4OTEA 2XXTA 1LSTA 3HSTA 4RXLA 3TCFA 4IO5A 2G93A 2GRVA 5L8DA 3USDA 4MH5A 4Q0CA 2D5WA 3JYRA 4G68A 4DE8A 4ZEBA 1NKXA 1AMFA 1H43A 1VSOA 4LONB 1S7YA 1P99A 1B3FA 4KR5A 5ITPA 4PE5B 1S50A 4EF1A 4LVQA 1Z7ME 3SETA 5JTYB 3MBPA 1QULA 1A99A 1SD3A 1LFHA 4XXUA 5TP9A 1RYXA 2VD2A 1MQIA 4F3PA 2ZYNA 2DS9A 4XKPA 2XD2A 4KCCA 4AQ4A 2CMOA 2I4BA 3CI8A 5DTBA 2P0SA 1ZKBA 4F31B 3T96B 5TU0A 2B3BA 1US5A 3K4UA 2VHAA 3MQ9A 4HCYA 4HCWA 4IY5A 3IK6B 4N13A 3PV0E 4H6DA 5K2XA 2E1SA 2HQ0A 4MFIA 4LQ5A 4YZZA 4JWXA 3T66A 3Q28A 3M3KA 1H44A 1B5JA 4K3FA 4GOTA 5FHMA 5A5XA 3L6HA 1PC3A 1SI0A 5DEXA 2Y7IA 1Q35A 1MY3A 3QAXA 5KDTA 4GVOA 2P1SA 1XS5A 2CZLA 4LQ2A 1LAHE 1LB9A 4ZEDA 3B6QA 5A5XB 1LAFE 3Q26A 1MQHA 2QPQA 1VR5A 4H8JA 4QHQA 2Y84A 3WAFA 3KJ7A 3LUYA 3O6HA 3E13X 3MPLA 3O66A 2BJJX 3MVZA 4OQOA 4OEVA 3GLBA 3VV5A 1URGA 1YAEA 2DWHA 2V25A 4RK9A 2R6GE 5ITOA 3U94A 2R9JA 1XOCA 3FV2A 3PUZE 4DXBA 4EQ9A 1SW1A 4U2RA 1PB7A 4G77A 4GXAA 2UYEA 5B70A 4G8HA 4KD5A 1Y1ZA 3G3KA 3M3LA 4QSEA 3A3UA 2F7CA 2M8CA 4KQPA 1NNPA 1R6ZA 4BDLA 5H8SA 5ICQA 5I2NA 2Z22A 1NFTA 4R74A 5H8FA 1ELJA 2F7AA 1MXVA 3WAEA 3TQLA 2DQVA 1MY2A 1OVBA 3G3FA 1R9LA 3LR1A 3B6WA 4KFQA 3K2DA 4F1UA 2ZYMA 4HTGA 3LSXA 3C35A 3TTMA 1MH3A 1MH4A 1TT1A 4P0IA 1B5HA 2F8DA 3H6TA 3O97A 4GD5A 1QUKA 1QUJA 4DXCA 1EU8A 2RC9A 2O1LA 2Y7KA 3JV9A 1MXZA 3IJOB 4C1UA 3K6WA 3OEMA 4JDFA 1FQAA 1MPCA 3ODBA 4MBPA 3K6VA 2ZMBA 1PB8A 2GH9A 1R9QA 2I58A 5AA3A 3UA8A 1IIWA 2Q2CA 3KEIA 5ISUA 1DOTA 1JQFA 1A55A 2I0BA 1B1HA 1ZLQA 3M3FA 3TFLA 3Q27A 3VLWA 2XD3A 3TMGA 2ONSA 4R72A 3O6GA 1LB8A 2GHBA 4H0WA 4WEDA 5CMMA 3U8QA 4OETA 2H4IA 4NTLA 3R7XA 4F3SA 4BDRA 3G7WA 4Q5TA 1B51A 1QVSA 2HZKA 3FVGA 1TWYA 1WODA 3W9VA 3EHTA 4XIGQ 4U4XA 1B4HA 2OBGA 4RY1A 2RKMA 5I57A 2QS3A 2VD3A 1P1QA 2O84X 2YPNA 3A3CA 5FTIA 1B1XA 4JSOA 1Q1KA 1MPDA 1ZJLA 1B05A 3VE1B 3ILTB 1A40A 1MG1A 1NNTA 2XXVA 3FJ7A 2F7BA 1BP5A 3E9XA 3G3GA 3HHFA 3OO7A 1M5DA 1FTKA 3IJXB 3Q29A 5H8FB 3PPOA 5DT6A 3U72A 4OFLA 1QKAA 3GBBA 2NWJA 2ABHA 4F3GA 2RCAA 3C36A 2Y7RA 2I4CA 1B7ZA 3TTNA 5L9OA 2DE4A 4GRKA 4ELPA 3LBSA 1ANFA 3G3JA 5FHNA 3MUQA 1PBPA 2E0SA 5H8QB 5I2NB 3MVWA 3PD8A 3PU5A 1B4ZA 4UA8A 3FV1A 1KWHA 4X1DA 1USYH 4Z7EA 4R73A 2Q8JA 3KOTA 1JW5A 3G3HA 3PMXA 4U1OA 2LAOA 4FE8A 1MY0A 1FTMA 1ZU0A 2F97A 2W7YA 3E3KA 1DMBA 3IO4A 1Y3NA 4QFNA 5CRYA 4ZDMA 4FATA 4O3AA 4U23A 1H45A 1HSJA 3OOAA 2UVHA 1MM6A 4LP2B 2ONRA 2PX1A 4BDQA 3BFUA 2UYFA 4I8CA 1XVYA 1DTGA 4H65A 5AE4A 3KBRA 4KHZE 4LATA 1PDAA 4AB6A 4RJZA 2Q9TA 3FZVA 3CG1A 3CR9A 1BLFA 3MC2A 4FJPA 4ELOA 3A09A 3PPNA 4F1YA 5CM6A 1LCFA 3VLVA 4YMAA 1TXFA 1T0KA 2PYYA 5HM4B 3IORA 2Z8FA 4IO4A 3OSRA 2QMWA 5K2YA 2VP1A 4FORA 3CSGA 3SEWA 2XX8A 4E0WA 3SESA 4OYVA 3C34A 1Y3QA 1ATGA 4IGRA 4R6HA 5KDTB 2ALUA 3PUVE 3V83A 1BTJA 3K1MA 1CE2A 2F35A 3I3VA 3K6UA 3OD7A 3PUYE 3MZBA 4I62A 4IY6A 1LAXA 2Q88A 1Z7NE 3T9XB 3VVDA 3IB1A 1NH7A 1POTA 2DE2A 3DLNA 4POWA 1A8EA 3GXAA 5CMCA 4ELRA 3H3GA 5KCJA 1GTKA 2F6PA 3FUZA 4H1XA 5CMBA 2Y7PA 2QS1A 2ESNA 3TUSA 4ZZEA 1B6HA 1ZTYA 2P2AA 3HCQA 3N94A 4TLLB 5ELVA 1GV8A 2DYXA 2O6AA 2OCUA 2UVJA 3DP8A 3QSLA 4JSDA 5M2VA 3MVXA 2O7IA 2REJA 4OERA 3TQWA 4F39A 1EZOA 3PPQA 4DXUA 1I69A 1SI1A 2QS4A 1L5TA 1P1NA 2D21A 3TZAA 4YMBA 3IOUA 3UP9A 1D4NA 1I6AA 1EZ9A 2OJTA 5F1QA 1MS7A 1MQJA 1LAGE 1QW0A 1YPNA 4FECA 4NF5B 3V5AA 3CFXA 4F1VA 4OHNA 3LSLA 4LZ8A 4ZE9A 3N6UA 4OFOA 3I6VA 3DM0A 4KPTA 3PUWE 3SKPA 3T22A 3TDJA 3O29A 3IOTA 3BFTA 3ILUB 1IXIA 3QIMA 4G8MA 1LBBA 3OENA 3RT8A 4IO7A 3TYHA 3H4ZA 2DWAA 3EF7A 4NF8A 1SYHA 3ECRA 3MPKA 3MW0A 1MXXA 3FATA 3MP6A 4DDDA 3TCHA 4OZ9A 4U22A 4YICA 1B0LA 3K1NA 5CMKA 4IGTA 2O68A 1LLSA 1JEVA 2Y7WA 2PBWA 4FAJA 4GIZA 4GLIA 4YB5A 5AA1A 3THIA 3CG3A 5F7VA 1II5A 4WKMA 4R9GA 3OSQA 4L17A 4TOZA 2GHAA 1SW4A 2F6GA 2H5YA 2R71A 1POY1 2UXAA 5H8NA 1A54A 1MY4A 4EXKA 4U21A 4POXA 4LZ7A 2WKYA 2YLNA 3MZ1A 4QFLA 4GF8A 3RN8A 3VVFA 2RF1A 3GZGA 2V3UA 5DVJA 1MY1A 2VOZA 1NNKA 1IQ7A 1M5EA 4G2ZA 2HZLA 4F2OA 2XXWA 2B3FA 2DWIA 1Y1MA 5CBSA 2V3TA 1FQDA 2O7UA 4JBZA 4EXLA 5B7DA 2DVCA 2ZNSA 3SERA 2ZYKA 1B3HA 2I3VA 3TAJA 5JK4A 4P11A 3N5LA 3P7IA 1JNFA 2G29A 3K02A 3OEKA 2NVUB 2QJEA 1UIVA 4BLAA 3ZSFA 1ZBMA 1JEUA 3UK4A 4Q8RA 3S9NC 3CIJA 3KN7A 3LSWA 4LA9A 5DVIA 4OEUA 2F34A 1RKMA 2FNCA 1IZ1A 1HSEA 1D9VA 1N7WA 3FXQA 3EN3A 4LZ5A 1WVJA 3ONMA 2DWJA 3T9UA 2ZNUA 3B7DA 1H76A 3FVOA 1SQYA 4R2BA 3RPWA 1CB6A 2O1MA 3PMWA 5TPAA 3V8XB 4BDMA 1UQWA 3KFMA 3ZKKA 4H5GA 1Y4CA 1BIYA 4HW8A 3HPIA 3FVKA 3O9PA 3FJGA 1GR2A 2VGQA 1N3WA 1N84A 1P1UA 3G3IA 3GBAA 4C1TA 3R6UA 3KGCA 5AA4B 4IO3A 1YTVA 4NF4A
chains in the Genus database with same CATH superfamily
1SW5A 1OIBA 1M5CA 4PFYA 1S9TA 5CC2A 4RPNA 4DLDA 2XXQA 3H6WA 4NWCA 4DIGA 4R6KA 3R26A 1M5FA 2H98A 3CFZA 4XKRA 2AIXA 2RINA 2ZYOA 3C4MA 2NOOA 1FQEA 3BIGA 2XXXA 4YKIA 1B32A 4AS4A 3S9LC 3KN8A 4ZEKA 3PPRA 3MAMA 3D1RA 4Z0IA 3ZS6A 4NF6B 1DBZA 3MP1A 2Z8EA 1CNQA 2RCBA 5AA2D 3DELB 3I5OA 5FHOA 2PT1A 3BKIB 2UVGA 1JVYA 3SEXA 1FQFA 3D4CA 3TTLA 3TEPA 3CRBA 1I6BA 3C31A 4MNPA 2AL5A 3LSFB 3PTYA 3VXCA 1MXUA 3FJMA 1B3LA 3TPAA 3RPLA 5I58B 1N3XA 3LV0A 5JEIA 2I6EA 4BDOA 2PFZA 4MLVA 3OO8A 2Q74A 3EHUA 1QGXA 3RGYA 2Y5LA 2QS2A 3K1PA 4P8BA 1DTZA 4PBQA 2V84A 3QUFA 5FTHA 4AB5A 3HV1A 4THIA 3OO9A 2P3VA 2FHYA 3RT6B 4O3BA 1O63A 3N26A 3E4RA 3S4UA 3V89B 1UTHA 4N07A 2OK2A 3BBRA 5A5XA 1D3KA 1LGBC 4P3LA 3LC8A 2OZZA 5ICTA 4OMBA 2CZIA 2RC8A 1O7TA 1FTOA 2HPGA 1FQCA 2KR0A 1WDNA 4G68C 1GGGA 4NWDA 3N6TA 1M5BA 1UTBA 5L9SA 1LFGA 1SBPA 4JWOA 1INPA 1AL3A 4IO6A 4EQBA 1B9JA 5IM2A 4NF5A 2HXWA 1FPDA 1Q9DA 4FEBA 3RQTA 3C9HA 3IR1A 2DP8A 2XX7A 4EQ7A 3FXUA 3IB2A 3Q25A 2HHMA 3ZKLA 1IXGA 5I59B 2F3BA 1PB9A 4DI4B 4DZ1A 4I9DA 1B0HA 1KA1A 2DE3A 3VVEA 4NG7A 3RLFE 4DCXA 1DPEA 2FVZA 2QSXA 4R75A 4R6YA 3MVYA 1FPKA 1G0IA 4RXLA 4Q0CA 2D5WA 4ZEBA 4LONB 5ET7A 4MX6A 5JTYB 5LDZA 1QULA 1LFHA 3MSTA 2XD2A 2CMOA 3CI8A 4PC9A 1ZKBA 3T96B 4P47A 3T66A 1H44A 5FHMA 4GOTA 1PC3A 1SI0A 1Q35A 2XWIA 1MY3A 4GVOA 4LN5A 4LQ2A 1XS5A 3Q26A 4QXDA 4H8JA 4QHQA 1NV7A 2XXKA 4OEVA 3GLBA 3VV5A 3B50A 1XOCA 4EQ9A 4G77A 4QSEA 4KQPA 4R74A 1ELJA 2R8TA 1OVBA 4F1UA 1MH4A 4P0IA 4N17A 1SPIA 4C1UA 4MBPA 4I40A 3K6VA 3UA8A 2Q2CA 3LUZA 4F31B 1ZLQA 3TFLA 3Q27A 2PCRA 3O6GA 1FPBA 2GHBA 2OBGA 4RY1A 2QS3A 2O84X 5FTIA 1D9QA 3RTWB 4U23A 5TU0A 1BP5A 3E9XA 3G3GA 3OO7A 5H8FB 1M5DA 3U72A 2MKZA 3GBBA 2ABHA 2Y7RA 1ANFA 3MUQA 5H8QB 5I2NB 3PU5A 4UA8A 3FV1A 4N6KA 1USYH 2Q8JA 3KOTA 1JW5A 3PMXA 2XA5A 2W7YA 4QFNA 4FATA 1DMBA 1MM6A 4BDQA 3E79A 2UYFA 5AE4A 3CHGA 3KBRA 4X04A 3FZVA 3CR9A 3MC2A 5CM6A 3A09A 3PPNA 4YMAA 5K2YA 2QMWA 2XX8A 1FBHA 1Y3QA 3V83A 1BTJA 1CE2A 2F35A 3SZPA 3MZBA 2Q88A 1Z7NE 3VVDA 3IB1A 1POTA 1KZ8A 4ELRA 5KCJA 2WBDA 3TUSA 3QMFA 4TLLB 5ELVA 5M2VA 3QSLA 3TQWA 1EZOA 3BIHA 5DW8A 4HE1A 2D21A 1D4NA 2OJTA 4NF5B 3V5AA 5I7IA 4LZ8A 3N6UA 3SKPA 3DM0A 2OWZA 3O29A 3BFTA 1IXIA 4IO7A 3H4ZA 2DWAA 4NF8A 1SYHA 3TCHA 5IZZA 1LLSA 2Y7WA 4GLIA 2QFLA 1II5A 3HFUA 2R71A 1MY4A 4PCDA 4EXKA 5DVJA 4OVTA 1NNKA 1IQ7A 1M5EA 4MEVA 2HZLA 4OVQA 2DWIA 2V3TA 2O7UA 5B7DA 1B3HA 5JK4A 2QJEA 1ZBMA 1YYZA 3KN7A 4OEUA 4M1VA 1IZ1A 4LZ5A 3ONMA 1NV5A 1SQYA 4R2BA 4BDMA 2O1MA 3KFMA 4HW8A 1GR2A 3GBAA 3G3IA 1YTVA 4NF4A 5EYFA 5IAIA 2V3QA 1OLCA 1B46A 1A8FA 3RY3A 2CZKA 3SEYA 3K0VA 3K00A 4X9TA 2Z8DA 5IZ3B 3IAZA 3W9WA 4F22A 4OVJA 1JP4A 4MHFA 2DXYA 2KLFA 2XXHA 4FIMA 2VT5A 5IZ3A 1DPPA 3AXFA 3FIRA 4KXPA 4OXVA 1VFEA 3KJTA 5ET5A 4E0WA 5I56A 5I2KB 3NOHA 4XEQA 4P56A 4ONYA 1B7HA 4OVSA 4JB7A 5EHSA 1B52A 1Y20A 4WXJA 4YU0A 1JVXA 1FSAA 1IUDA 4EF2A 4ISUA 1OMPA 4KCDA 3TKDA 1FQBA 4XFEA 2AL4A 1LEVA 3FXRA 4RYAA 4H5FA 2QVRA 1N7XA 4N81A 5H8HB 4KI0E 1TFDA 1B3GA 3DP6A 4ZEFA 1MM7A 4QFPA 1YXIA 1P1WA 2PMSA 1NV3A 4F29A 1SDXA 4N8GA 2H99A 4X48A 3KG2A 2A5TB 2OWSA 4MLQA 3H6UA 2HAUA 4GWOA 3HHGA 2QVUA 4I3YA 4IO2A 3K01A 2QL3A 1FBEA 1MXWA 3F11A 4OWDA 2GFEA 4HE2A 1XC1A 1NV2A 1EYKA 4MF3A 3IB0A 4RK2A 4H45A 4PQJA 1B7UA 4KYDA 4YB7A 2F78A 4F19A 2PVUA 3TODA 4PBHA 3HO7A 2XXIA 1MDP1 3U92A 3S9MC 2XXUA 5EHMA 5KCJB 2ZNTA 1NUZA 2A5SA 2NXOA 3KC1A 4ZECA 4G68B 3O6IA 3C33A 3MWBA 3O28A 1LBWA 5ET6A 4NEDA 1NV1A 5I2KA 4TQUQ 4KYSA 1FPLA 4OVRA 4HXVA 3KSXA 4O7MA 4GWWA 3PUXE 1PBQA 4H8IA 1MDQA 5H8FA 4Q30B 4WEPA 4KYEA 1O64A 1QJMA 4PF8A 4DCYA 1YCJA 1FPIA 1AIVA 2H25A 3KSJA 4AS5A 4IO5A 4MH5A 3JYRA 1FPEA 1NKXA 1AMFA 1H43A 1B3FA 4PE5B 1NUXA 3MBPA 5TP9A 4NF0A 1MQIA 1US5A 2VHAA 3MQ9A 4HCWA 2E1SA 2HQ0A 4MFIA 2Y5KA 3FBPA 5KDTA 2P1SA 2CZLA 5ET8A 5A5XB 2Y84A 3KJ7A 3O6HA 2BJJX 2R6GE 5ITOA 2R9JA 1SW1A 3FXBA 3G3KA 3A3UA 1NI9A 1NNPA 4GX4A 5I2NA 2Z22A 1MXVA 3WAEA 3LR1A 4P1LA 3K2DA 4HTGA 3C35A 1TT1A 2F8DA 1QUJA 2RC9A 2O1LA 1MXZA 3IJOB 3K6WA 1IIWA 2P3NA 1A55A 4WEDA 5CMMA 3U8QA 4NTLA 4F3SA 4Q5TA 1B51A 1QVSA 1VDWA 3FVGA 4XIGQ 1B4HA 2RKMA 1IMAA 1P1QA 5EQ8A 1Q1KA 1ZJLA 1B05A 1NNTA 1AOVA 3UGWA 2RCAA 4NX1A 5L9OA 1B7ZA 4GRKA 3LBSA 3G3JA 2E0SA 3MVWA 4R73A 4U1OA 3G3HA 4FE8A 2F97A 5CRYA 2UVHA 4LP2B 2PX1A 1FTAA 2VPNA 1DTGA 4KHZE 2Q9TA 4F1YA 1LCFA 3VLVA 1TXFA 4OVPA 2Z8FA 4IO4A 3OSRA 3SEWA 3SESA 3C34A 4IGRA 1ATGA 2ALUA 3PUVE 3T9XB 1NH7A 5CMCA 1GTKA 2F6PA 2Y7PA 3N94A 2P2AA 3HCQA 1FJ9A 2DYXA 2OCUA 2UVJA 3MVXA 4O94A 4DXUA 1SI1A 2QS4A 1P1NA 3IOUA 3UP9A 1I6AA 5F1QA 5IZ1A 1MS7A 4F1VA 4FECA 3CFXA 4OHNA 3LSLA 4OFOA 3PUWE 3T22A 4PE3A 3TYHA 2GQ1A 3ECRA 4OZ9A 4IGTA 1DCUA 1JEVA 2PBWA 2OX3A 5F7VA 4WKMA 4PTKA 4TOZA 1AWBA 1FJ6A 2F6GA 2H5YA 4NHBA 4U21A 4GF8A 3VVFA 2DDKA 4F2OA 1FQDA 2ZYKA 3TAJA 4MCOA 4P11A 3P7IA 1JNFA 3OEKA 1UIVA 3ZSFA 4Q8RA 1EYIA 3IFAA 3LSWA 4LA9A 2FNCA 1HSEA 3FXQA 3EN3A 1WVJA 2ZNUA 3B7DA 3V8XB 5FBPA 1UQWA 1BIYA 3HPIA 3FVKA 3O9PA 2CEXA 4C1TA 1N3WA 4PAIA 3R6UA 3MZ1A 5DVFA 3SEVA 1P1OA 3UORA 4NF8B 1OLAA 4QSCA 3IX1A 2THIA 3QUJA 3IOVA 1MXYA 1NV6A 1VFDA 4FBPA 4N6PA 1SW2A 4PFTA 4RA1A 3IL1B 5T3JA 1MRPA 1ZMGA 4QFKA 3T93B 3CSBA 4IY6A 4H67A 1XVXA 4QFOA 3TELA 1VE4A 1MQDA 2F36A 4JVCA 3FVNA 1ZIUA 1BK4A 4XTCQ 3B8BA 1Y4TA 1B2HA 2L5VA 2F5XA 2OWTA 2I3WA 5AA4A 1FCKA 3H6VA 1F9BA 3SEUA 4FEDA 2HFBA 1SYIA 4NE4A 2PT2A 1UTHB 4ESWA 4ZE8A 2HCAA 4PP0A 4HE0A 2DVZA 4O3CA 3FD3A 2YJPA 1XHYA 5IKBA 4X1BA 4NMYA 5EQ7A 5HBCA 1LCTA 2IA4A 3FASA 5H8HA 1OVTA 3JZJA 1URSA 3UIFA 3IO6A 1XT8A 1LFIA 2XXYA 4U4SA 3L6GA 1DSNA 2RC7A 4MIJA 5EYHA 4P0GA 4HS7A 3KN3A 1I6QA 3HN0A 3VLUA 2X7PA 1B5IA 2ZZVA 4ECFA 1B3EA 2KQZA 2ONKE 2DXRA 4PFIA 2Q2AA 3PGFA 2OLBA 5KZTA 3PPPA 3U93A 3VXBA 4TLMB 1HSLA 3OO6A 1IEJA 1IMEA 2H9BA 4O7IA 3RUMA 4ND9A 5I58A 4N6DA 4OFJA 2FA7A 1B58A 4EUOA 4N15A 3B6TA 2QVVA 4R2FA 3TCGA 4ZEIA 4PF6A 3O2AA 2A5TA 2XX9A 3W15C 5J1DA 2ANJA 4MNCA 4QSDA 2Z23A 5EQAA 3OELA 3H7MA 4ZZAA 5TP9B 3OMBA 3K6XA 4GWYA 4C0RA 3QYTA 2DOJA 1UTBB 2PFYA 4ZS9A 4JWYA 3T9HB 3VDFA 4GFRA 1OQHA 3S9EA 1RYOA 1B40A 3IOWA 2ZXTA 4QF9A 3MZ9A 5DEXB 4NF4B 5A5LA 4F2QA 2UVIA 1NH8A 3T1BA 1QKBA 4M4GA 4UACA 1D9YA 2FYIA 4LUBA 4RNSA 5JTYA 4OTEA 2XXTA 1LSTA 3TCFA 2G93A 2GRVA 3USDA 4G68A 1S7YA 1P99A 5ITPA 4EF1A 4LVQA 1SD3A 4XXUA 2VD2A 4F3PA 3A29A 2DS9A 4XKPA 4KCCA 5DTBA 2P0SA 3ISPA 2B3BA 4GWZA 4N13A 1LBVA 4YZZA 4JWXA 1B5JA 3GYYA 3L6HA 2Y7IA 3QAXA 1LB9A 3B6QA 1MQHA 2QPQA 3WAFA 3LUYA 3E13X 3MPLA 3O66A 2V25A 4N91A 3PUZE 2HXRA 1PB7A 4GXAA 2UYEA 5B70A 2F7CA 2FBPA 2M8CA 1IMCA 1R6ZA 4BDLA 4PGPA 3TQLA 3G3FA 4KFQA 1MH3A 4GD5A 1EU8A 2Y7KA 3OEMA 3ODBA 4NQ8A 1R9QA 2I58A 3MYUA 5AA3A 4GWUA 3VLWA 5LTCA 2ONSA 2CZHA 4BDRA 4N4UA 2HZKA 1WODA 2WYPA 5I57A 2YPNA 3A3CA 4JSOA 1MPDA 3VE1B 3ILTB 4XF5A 1MG1A 2XXVA 3FJ7A 2F7BA 3Q29A 3HHFA 1FTKA 3IJXB 3PPOA 5DT6A 5FHNA 1PBPA 3PD8A 5J16A 1B4ZA 2FIXA 4X1DA 4Z7EA 3SETA 3RPWA 2LAOA 1FTMA 4O3AA 1HSJA 3RPLB 4DI3D 1NUWA 4PGNA 1XVYA 4H65A 3EKIA 4JVDA 4LATA 1PDAA 4AB6A 1BLFA 2XWOA 1KA0A 3IORA 3OD7A 3I3VA 3K6UA 3DLNA 1A8EA 3GXAA 2QS1A 1GV8A 2O6AA 2REJA 4OERA 4F39A 3PPQA 4GX6A 1I69A 1L5TA 1RDXA 3RYDA 2XWKA 4YMBA 1EZ9A 1MQJA 1LAGE 1YPNA 3TDJA 3QIMA 4G8MA 3RT8A 4MJOA 3MPKA 3FATA 3T0JA 4U22A 4YICA 1B0LA 5CMKA 2O68A 4PAFA 4FAJA 4YB5A 5AA1A 4R9GA 3OSQA 1POY1 5H8NA 1A54A 4JVIA 4POXA 2WKYA 2YLNA 4QFLA 2RF1A 3GZGA 1MY1A 2VOZA 4G2ZA 2XXWA 1Y1MA 5CBSA 2DVCA 2ZNSA 3SERA 3N5LA 2G29A 2NVUB 5DVIA 5I57B 2F34A 1RKMA 1EZPA 3T9UA 2DWJA 1H76A 3FVOA 5TPAA 3ZKKA 1Y4CA 3FJGA 2VGQA 3KGCA 4IO3A 4E0XA 5I3SA 5AA2B 3U1OA 1MPBA 4PFBA 4RPOA 2Q8MA 4QRZA 5TPAB 1Y3PA 2WX9A 1IITA 1FRPA 1A7LA 1UIUA 5H8NB 2DSFA 2HEUA 1URDA 1RDZA 1USYE 1NMUA 2IEEA 5I56B 1OQGA 4MAGA 4ESXA 3CVGA 1FTJA 1LBCA 2Q89A 4I1DA 1MQGA 1FW0A 3EQ1A 5H8SA 4G8NA 5EQ9A 2QMXA 4JXIA 3RTFB 1JW4A 3PMVA 4YAHX 4YKJA 3MJNA 3IFCA 1JW1A 1IXCA 1AH5A 4U1ZA 2X26A 2XXPA 4F3BA 5L9MA 4PETA 4YKKA 5BUUA 2V93A 4PDDA 1BKAA 2XHDA 4H46A 3QXMA 4GL8A 4PFRA 4GL0A 4GBVA 4GXSB 1J1NA 4NGUA 5CI5A 4O8MA 1JETA 2JJKA 2B65A 4IR8A 4P9KA 5I5PA 2CEYA 4OA4A 1FTLA 3H06B 3QK6A 1QUIA 3OXNA 4EDPA 4ELQA 4OESA 1NNFA 4R9FA 5CBRA 5I84A 2B4MA 2X7QA 3KZGA 2FIEA 1NV0A 4NAPA 3CFLA 1N76A 4YKPA 4GQOA 3UN6A 2AYSA 3TTRA 1FBGA 1NL5A 1K9ZA 1NUYA 2O51A 4P1EA 1Y9UA 4G61A 5F24A 1SVXB 1DK4A 5BWJA 1IXHA 1N04A 4PFWA 4MMPA 3M8UA 4GWSA 5AA2A 4PFUA 4OENA 5DYHA 3C32A 3D4GA 1IMDA 2O69A 4GBWA 5H8QA 2ZZWA 4OANA 1EH3A 2REGA 1IMFA 1PEBA 3EPEA 2I48A 2D3IA 3MP8A 3H03A 1LBYA 1H3DA 4IB2A 3EHSA 4MNIA 1RDYA 3VFJA 3SDFA 1K9YA 3TTKA 2QRYA 1R1NA 3DP4A 3S2VA 3T9VA 4YB6A 5LOMA 2HAVA 5IGAA 1TFAA 2NUVA 3KOSA 4BDNA 1GVCA 2I0CA 1US4A 4G4PA 4NF6A 4F18A 3RNNA 5HPQA 3FGSA 4XKNA 5I59A 4XKQA 1N0TA 2I49A 2XXRA 3PD9A 2ZZXA 3HSTA 5ESYA 5L8DA 3E78A 4DE8A 1VSOA 1FBDA 4KR5A 1S50A 1Z7ME 2WYKA 1A99A 1RYXA 2ZYNA 2VPOA 4AQ4A 2I4BA 2F3DA 1LBZA 3K4UA 4HCYA 4IY5A 4X8RA 3IK6B 5K2XA 3PV0E 4H6DA 4LQ5A 3KBZA 3Q28A 3M3KA 4K3FA 1FBPA 1YZ0A 1XI6A 5DEXA 1EYJA 1LAHE 4ZEDA 1LAFE 1VR5A 4OQOA 3MVZA 1URGA 1YAEA 2DWHA 4RK9A 3U94A 1FBFA 3FV2A 4DXBA 4U2RA 4G8HA 4KD5A 1Y1ZA 3M3LA 5ICQA 1NFTA 2F7AA 2DQVA 1MY2A 1R9LA 3B6WA 2ZYMA 3LSXA 3TTMA 4N8YA 1B5HA 3H6TA 3O97A 4NN3A 4QBAA 1QUKA 4DXCA 3JV9A 4JDFA 1FQAA 1MPCA 2ZMBA 1PB8A 2GH9A 3KEIA 1LBXA 5ISUA 1DOTA 1JQFA 1NV4A 2I0BA 1B1HA 3M3FA 2XD3A 3TMGA 4R72A 1LB8A 4H0WA 4OETA 2H4IA 3R7XA 1FBCA 3G7WA 2WBBA 1TWYA 3W9VA 3EHTA 4U4XA 2B4LA 2VD3A 1B1XA 1FPJA 2V4CA 1A40A 3KC0A 4OFLA 1QKAA 4F3GA 2NWJA 3C36A 3TTNA 2I4CA 2DE4A 4ELPA 1KWHA 1MY0A 1ZU0A 3E3KA 3IO4A 1Y3NA 4ZDMA 1H45A 3OOAA 2ONRA 3BFUA 4I8CA 2BJIA 4RJZA 3CG1A 4FJPA 4ELOA 1T0KA 4UABA 2PYYA 1IMBA 4I3EA 2VP1A 4FORA 3CSGA 4OYVA 4R6HA 5KDTB 3K1MA 3PUYE 4I62A 1LAXA 2DE2A 4POWA 3H3GA 4H1XA 3FUZA 5CMBA 3ROJA 2ESNA 4PDHA 4ZZEA 1B6HA 1ZTYA 3DP8A 4JSDA 2O7IA 3TZAA 1QW0A 5HM4B 4ZE9A 3I6VA 2XWVA 4KPTA 3IOTA 3ILUB 1LBBA 3OENA 3EF7A 3MW0A 4DDDA 1MXXA 3MP6A 3K1NA 3U65A 4GIZA 5EYGA 3THIA 3CG3A 4L17A 2GHAA 1SW4A 2UXAA 4GWXA 4GX3A 4LZ7A 3RN8A 2V3UA 2B3FA 4EXLA 4JBZA 4PAKA 2I3VA 4BLAA 3K02A 3S9NC 1JEUA 3UK4A 3CIJA 1D9VA 1N7WA 1CB6A 1G0HA 3PMWA 4H5GA 1N84A 1P1UA 1FPFA 2WEFA 5AA4B 1FPGA
chains in the Genus database with same CATH topology
5DVFA 1SW5A 5EYFA 5IAIA 1OIBA 3SEVA 5AA2B 2V3QA 1OLCA 3U1OA 1M5CA 1MPBA 1B46A 1A8FA 1P1OA 4QRZA 4RPOA 1Y3PA 4NF8B 4PFYA 5TPAB 3RY3A 1OLAA 1S9TA 3UORA 5CC2A 1IITA 4RPNA 4DLDA 2XXQA 3H6WA 3SEYA 1A7LA 1UIUA 3K0VA 3IX1A 4QSCA 5H8NB 2THIA 3K00A 2DSFA 4NWCA 2HEUA 4X9TA 4R6KA 4DIGA 3QUJA 3R26A 2Z8DA 3IOVA 1M5FA 1MXYA 1URDA 2H98A 3CFZA 3IAZA 4XKRA 1USYE 1NMUA 2AIXA 3W9WA 2IEEA 4OVJA 4F22A 1VFDA 5I56B 1OQGA 2RINA 2ZYOA 4N6PA 1SW2A 4PFTA 4RA1A 4ESXA 3C4MA 3CVGA 3IL1B 2DXYA 1FTJA 1MRPA 2KLFA 2NOOA 1FQEA 1ZMGA 4QFKA 3T93B 2XXXA 4YKIA 1B32A 1LBCA 2XXHA 2Q89A 3CSBA 4FIMA 3S9LC 3KN8A 4I1DA 1MQGA 1FW0A 3EQ1A 4ZEKA 3PPRA 1DPPA 3MAMA 4G8NA 1XVXA 3AXFA 3FIRA 4H67A 1VFEA 3KJTA 4OXVA 4QFOA 4Z0IA 2QMXA 3ZS6A 5I2KB 5I56A 4JXIA 3RTFB 1JW4A 4NF6B 3MP1A 3TELA 3PMVA 4YAHX 2Z8EA 4YKJA 2RCBA 4ONYA 3MJNA 1B7HA 1VE4A 1JW1A 4JB7A 1MQDA 1IXCA 2F36A 1AH5A 5EHSA 5AA2D 3DELB 4U1ZA 1B52A 1Y20A 3I5OA 2X26A 4WXJA 2PT1A 2XXPA 3BKIB 4YU0A 2UVGA 5FHOA 3FVNA 1JVXA 1JVYA 1ZIUA 1FQFA 3SEXA 4F3BA 3D4CA 5L9MA 4XTCQ 4PETA 1Y4TA 4YKKA 1B2HA 3RTWB 3TTLA 1IUDA 3TEPA 4EF2A 5BUUA 2V93A 3CRBA 2F5XA 1BKAA 2XHDA 3QXMA 4ISUA 4GL8A 1OMPA 2OWTA 1I6BA 3C31A 4KCDA 2I3WA 5AA4A 1FCKA 2AL5A 3LSFB 3TKDA 3VXCA 3H6VA 1MXUA 1FQBA 3FJMA 1F9BA 4GL0A 2AL4A 4GXSB 1B3LA 1J1NA 3SEUA 4FEDA 3FXRA 5CI5A 2HFBA 1SYIA 4RYAA 3TPAA 4NE4A 1JETA 4H5FA 1N7XA 2B65A 2PT2A 1UTHB 4ESWA 4ZE8A 2HCAA 5H8HB 4PP0A 5I58B 4KI0E 1TFDA 2DVZA 1B3GA 1N3XA 3UGWA 5JEIA 1FTLA 3DP6A 3H06B 4O3CA 4ZEFA 3FD3A 1MM7A 3QK6A 2I6EA 1QUIA 3OXNA 4QFPA 2YJPA 1XHYA 4EDPA 4ELQA 4OESA 4BDOA 1P1WA 1NNFA 2PMSA 5IKBA 4R9FA 4F29A 5CBRA 5I84A 1SDXA 4X1BA 4NMYA 4MLVA 5HBCA 1LCTA 3OO8A 2IA4A 2X7QA 3FASA 5H8HA 2H99A 1OVTA 3JZJA 4X48A 1URSA 3KG2A 3UIFA 3IO6A 3KZGA 2A5TB 1XT8A 2OWSA 1LFIA 2XXYA 4MLQA 3H6UA 3EHUA 2HAUA 4U4SA 4GWOA 3HHGA 3L6GA 1DSNA 2RC7A 4IO2A 3K01A 4P0GA 2QL3A 3CFLA 3K1PA 2QS2A 3KN3A 4HS7A 3RGYA 1DTZA 4M1VA 1I6QA 1N76A 4GQOA 4YKPA 3UN6A 2V84A 3QUFA 1MXWA 5FTHA 3HV1A 2AYSA 3HN0A 4AB5A 3VLUA 3F11A 4OWDA 2GFEA 3TTRA 2X7PA 1XC1A 4THIA 1B5IA 3OO9A 4ECFA 1B3EA 2ONKE 1NL5A 2DXRA 2Q2AA 3PGFA 2OLBA 3RT6B 5KZTA 4O3BA 2O51A 1O63A 1Y9UA 4MF3A 1SVXB 3IB0A 3E4RA 3N26A 3PPPA 3S4UA 3U93A 3V89B 1UTHA 4N07A 4RK2A 5BWJA 1AOVA 2OK2A 3BBRA 4PQJA 3VXBA 1B7UA 1IXHA 1D3KA 1LGBC 1N04A 1HSLA 4PFWA 3OO6A 4KYDA 4TLMB 5I57B 1IEJA 3LC8A 2H9BA 4YB7A 2F78A 3RUMA 4ND9A 4F19A 5I58A 2PVUA 3M8UA 2OZZA 1EZPA 5AA2A 3TODA 4PFUA 3HO7A 4OENA 4OFJA 5DYHA 2FA7A 3C32A 3D4GA 5ICTA 2XXIA 2O69A 5H8QA 1B58A 4OMBA 1MDP1 4EUOA 3U92A 3B6TA 1EH3A 2RC8A 4R2FA 3TCGA 4ZEIA 2REGA 2XXUA 1O7TA 3S9MC 5EHMA 1PEBA 3O2AA 2A5TA 5KCJB 1FTOA 2XX9A 2ZNTA 4E0XA 3EPEA 2I48A 1FQCA 3W15C 5J1DA 1WDNA 4G68C 1GGGA 4NWDA 3N6TA 2A5SA 2ANJA 2D3IA 2NXOA 4QSDA 2Z23A 3MP8A 4ZECA 3H03A 1M5BA 1UTBA 4G68B 5L9SA 3OELA 3H7MA 1LFGA 1SBPA 3O6IA 4JWOA 4ZZAA 3C33A 1H3DA 4IB2A 5TP9B 1AL3A 3EHSA 3OMBA 3K6XA 3MWBA 3VFJA 3SDFA 4IO6A 3TTKA 4EQBA 1B9JA 3O28A 4NEDA 4NF5A 2QRYA 4C0RA 2HXWA 1R1NA 4FEBA 3RQTA 3DP4A 3QYTA 5I2KA 4TQUQ 3C9HA 3S2VA 3IR1A 2DOJA 1UTBB 2DP8A 4YB6A 4ZS9A 3T9VA 5LOMA 2XX7A 4JWYA 2HAVA 4KYSA 3T9HB 3VDFA 4GFRA 4EQ7A 1OQHA 3FXUA 3IB2A 3Q25A 3ZKLA 3S9EA 1IXGA 3KSXA 5I59B 1RYOA 1TFAA 1B40A 3PUXE 2NUVA 3IOWA 1PBQA 2ZXTA 1PB9A 4H8IA 4QF9A 1MDQA 3MZ9A 3KOSA 4I9DA 4NF4B 4Q30B 1B0HA 4WEPA 5DEXB 4BDNA 4DZ1A 4KYEA 1GVCA 4F2QA 2I0CA 1US4A 1O64A 1QJMA 2UVIA 4G4PA 4NF6A 1NH8A 4F18A 1QKBA 2DE3A 3RNNA 5HPQA 3VVEA 4DCYA 4M4GA 4UACA 3FGSA 1D9YA 2FYIA 1YCJA 4XKNA 3RLFE 4DCXA 4XKQA 5I59A 1DPEA 4LUBA 1AIVA 1N0TA 2H25A 4RNSA 5JTYA 4R75A 2QSXA 2I49A 4R6YA 2XXRA 3KSJA 3MVYA 3PD9A 4OTEA 2XXTA 1LSTA 3HSTA 4RXLA 3TCFA 4IO5A 2G93A 2GRVA 5L8DA 3USDA 4MH5A 4Q0CA 2D5WA 3JYRA 4G68A 4DE8A 4ZEBA 1NKXA 1AMFA 1H43A 1VSOA 4LONB 1S7YA 1P99A 1B3FA 4KR5A 5ITPA 4PE5B 1S50A 4EF1A 4LVQA 1Z7ME 3SETA 5JTYB 3MBPA 1QULA 1A99A 1SD3A 1LFHA 4XXUA 5TP9A 1RYXA 2VD2A 1MQIA 4F3PA 2ZYNA 2DS9A 4XKPA 2XD2A 4KCCA 4AQ4A 2CMOA 2I4BA 3CI8A 5DTBA 2P0SA 1ZKBA 4F31B 3T96B 5TU0A 2B3BA 1US5A 3K4UA 2VHAA 3MQ9A 4HCYA 4HCWA 4IY5A 3IK6B 4N13A 3PV0E 4H6DA 5K2XA 2E1SA 2HQ0A 4MFIA 4LQ5A 4YZZA 4JWXA 3T66A 3Q28A 3M3KA 1H44A 1B5JA 4K3FA 4GOTA 5FHMA 5A5XA 3L6HA 1PC3A 1SI0A 5DEXA 2Y7IA 1Q35A 1MY3A 3QAXA 5KDTA 4GVOA 2P1SA 1XS5A 2CZLA 4LQ2A 1LAHE 1LB9A 4ZEDA 3B6QA 5A5XB 1LAFE 3Q26A 1MQHA 2QPQA 1VR5A 4H8JA 4QHQA 2Y84A 3WAFA 3KJ7A 3LUYA 3O6HA 3E13X 3MPLA 3O66A 2BJJX 3MVZA 4OQOA 4OEVA 3GLBA 3VV5A 1URGA 1YAEA 2DWHA 2V25A 4RK9A 2R6GE 5ITOA 3U94A 2R9JA 1XOCA 3FV2A 3PUZE 4DXBA 4EQ9A 1SW1A 4U2RA 1PB7A 4G77A 4GXAA 2UYEA 5B70A 4G8HA 4KD5A 1Y1ZA 3G3KA 3M3LA 4QSEA 3A3UA 2F7CA 2M8CA 4KQPA 1NNPA 1R6ZA 4BDLA 5H8SA 5ICQA 5I2NA 2Z22A 1NFTA 4R74A 5H8FA 1ELJA 2F7AA 1MXVA 3WAEA 3TQLA 2DQVA 1MY2A 1OVBA 3G3FA 1R9LA 3LR1A 3B6WA 4KFQA 3K2DA 4F1UA 2ZYMA 4HTGA 3LSXA 3C35A 3TTMA 1MH3A 1MH4A 1TT1A 4P0IA 1B5HA 2F8DA 3H6TA 3O97A 4GD5A 1QUKA 1QUJA 4DXCA 1EU8A 2RC9A 2O1LA 2Y7KA 3JV9A 1MXZA 3IJOB 4C1UA 3K6WA 3OEMA 4JDFA 1FQAA 1MPCA 3ODBA 4MBPA 3K6VA 2ZMBA 1PB8A 2GH9A 1R9QA 2I58A 5AA3A 3UA8A 1IIWA 2Q2CA 3KEIA 5ISUA 1DOTA 1JQFA 1A55A 2I0BA 1B1HA 1ZLQA 3M3FA 3TFLA 3Q27A 3VLWA 2XD3A 3TMGA 2ONSA 4R72A 3O6GA 1LB8A 2GHBA 4H0WA 4WEDA 5CMMA 3U8QA 4OETA 2H4IA 4NTLA 3R7XA 4F3SA 4BDRA 3G7WA 4Q5TA 1B51A 1QVSA 2HZKA 3FVGA 1TWYA 1WODA 3W9VA 3EHTA 4XIGQ 4U4XA 1B4HA 2OBGA 4RY1A 2RKMA 5I57A 2QS3A 2VD3A 1P1QA 2O84X 2YPNA 3A3CA 5FTIA 1B1XA 4JSOA 1Q1KA 1MPDA 1ZJLA 1B05A 3VE1B 3ILTB 1A40A 1MG1A 1NNTA 2XXVA 3FJ7A 2F7BA 1BP5A 3E9XA 3G3GA 3HHFA 3OO7A 1M5DA 1FTKA 3IJXB 3Q29A 5H8FB 3PPOA 5DT6A 3U72A 4OFLA 1QKAA 3GBBA 2NWJA 2ABHA 4F3GA 2RCAA 3C36A 2Y7RA 2I4CA 1B7ZA 3TTNA 5L9OA 2DE4A 4GRKA 4ELPA 3LBSA 1ANFA 3G3JA 5FHNA 3MUQA 1PBPA 2E0SA 5H8QB 5I2NB 3MVWA 3PD8A 3PU5A 1B4ZA 4UA8A 3FV1A 1KWHA 4X1DA 1USYH 4Z7EA 4R73A 2Q8JA 3KOTA 1JW5A 3G3HA 3PMXA 4U1OA 2LAOA 4FE8A 1MY0A 1FTMA 1ZU0A 2F97A 2W7YA 3E3KA 1DMBA 3IO4A 1Y3NA 4QFNA 5CRYA 4ZDMA 4FATA 4O3AA 4U23A 1H45A 1HSJA 3OOAA 2UVHA 1MM6A 4LP2B 2ONRA 2PX1A 4BDQA 3BFUA 2UYFA 4I8CA 1XVYA 1DTGA 4H65A 5AE4A 3KBRA 4KHZE 4LATA 1PDAA 4AB6A 4RJZA 2Q9TA 3FZVA 3CG1A 3CR9A 1BLFA 3MC2A 4FJPA 4ELOA 3A09A 3PPNA 4F1YA 5CM6A 1LCFA 3VLVA 4YMAA 1TXFA 1T0KA 2PYYA 5HM4B 3IORA 2Z8FA 4IO4A 3OSRA 2QMWA 5K2YA 2VP1A 4FORA 3CSGA 3SEWA 2XX8A 4E0WA 3SESA 4OYVA 3C34A 1Y3QA 1ATGA 4IGRA 4R6HA 5KDTB 2ALUA 3PUVE 3V83A 1BTJA 3K1MA 1CE2A 2F35A 3I3VA 3K6UA 3OD7A 3PUYE 3MZBA 4I62A 4IY6A 1LAXA 2Q88A 1Z7NE 3T9XB 3VVDA 3IB1A 1NH7A 1POTA 2DE2A 3DLNA 4POWA 1A8EA 3GXAA 5CMCA 4ELRA 3H3GA 5KCJA 1GTKA 2F6PA 3FUZA 4H1XA 5CMBA 2Y7PA 2QS1A 2ESNA 3TUSA 4ZZEA 1B6HA 1ZTYA 2P2AA 3HCQA 3N94A 4TLLB 5ELVA 1GV8A 2DYXA 2O6AA 2OCUA 2UVJA 3DP8A 3QSLA 4JSDA 5M2VA 3MVXA 2O7IA 2REJA 4OERA 3TQWA 4F39A 1EZOA 3PPQA 4DXUA 1I69A 1SI1A 2QS4A 1L5TA 1P1NA 2D21A 3TZAA 4YMBA 3IOUA 3UP9A 1D4NA 1I6AA 1EZ9A 2OJTA 5F1QA 1MS7A 1MQJA 1LAGE 1QW0A 1YPNA 4FECA 4NF5B 3V5AA 3CFXA 4F1VA 4OHNA 3LSLA 4LZ8A 4ZE9A 3N6UA 4OFOA 3I6VA 3DM0A 4KPTA 3PUWE 3SKPA 3T22A 3TDJA 3O29A 3IOTA 3BFTA 3ILUB 1IXIA 3QIMA 4G8MA 1LBBA 3OENA 3RT8A 4IO7A 3TYHA 3H4ZA 2DWAA 3EF7A 4NF8A 1SYHA 3ECRA 3MPKA 3MW0A 1MXXA 3FATA 3MP6A 4DDDA 3TCHA 4OZ9A 4U22A 4YICA 1B0LA 3K1NA 5CMKA 4IGTA 2O68A 1LLSA 1JEVA 2Y7WA 2PBWA 4FAJA 4GIZA 4GLIA 4YB5A 5AA1A 3THIA 3CG3A 5F7VA 1II5A 4WKMA 4R9GA 3OSQA 4L17A 4TOZA 2GHAA 1SW4A 2F6GA 2H5YA 2R71A 1POY1 2UXAA 5H8NA 1A54A 1MY4A 4EXKA 4U21A 4POXA 4LZ7A 2WKYA 2YLNA 3MZ1A 4QFLA 4GF8A 3RN8A 3VVFA 2RF1A 3GZGA 2V3UA 5DVJA 1MY1A 2VOZA 1NNKA 1IQ7A 1M5EA 4G2ZA 2HZLA 4F2OA 2XXWA 2B3FA 2DWIA 1Y1MA 5CBSA 2V3TA 1FQDA 2O7UA 4JBZA 4EXLA 5B7DA 2DVCA 2ZNSA 3SERA 2ZYKA 1B3HA 2I3VA 3TAJA 5JK4A 4P11A 3N5LA 3P7IA 1JNFA 2G29A 3K02A 3OEKA 2NVUB 2QJEA 1UIVA 4BLAA 3ZSFA 1ZBMA 1JEUA 3UK4A 4Q8RA 3S9NC 3CIJA 3KN7A 3LSWA 4LA9A 5DVIA 4OEUA 2F34A 1RKMA 2FNCA 1IZ1A 1HSEA 1D9VA 1N7WA 3FXQA 3EN3A 4LZ5A 1WVJA 3ONMA 2DWJA 3T9UA 2ZNUA 3B7DA 1H76A 3FVOA 1SQYA 4R2BA 3RPWA 1CB6A 2O1MA 3PMWA 5TPAA 3V8XB 4BDMA 1UQWA 3KFMA 3ZKKA 4H5GA 1Y4CA 1BIYA 4HW8A 3HPIA 3FVKA 3O9PA 3FJGA 1GR2A 2VGQA 1N3WA 1N84A 1P1UA 3G3IA 3GBAA 4C1TA 3R6UA 3KGCA 5AA4B 4IO3A 1YTVA 4NF4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DVF A;  1SW5 A;  5EYF A;  5IAI A;  1OIB A;  3SEV A;  5AA2 B;  2V3Q A;  1OLC A;  3U1O A;  1M5C A;  1MPB A;  1B46 A;  1A8F A;  1P1O A;  4QRZ A;  4RPO A;  1Y3P A;  4NF8 B;  4PFY A;  5TPA B;  3RY3 A;  1OLA A;  1S9T A;  3UOR A;  5CC2 A;  1IIT A;  4RPN A;  4DLD A;  2XXQ A;  3H6W A;  3SEY A;  1A7L A;  1UIU A;  3K0V A;  3IX1 A;  4QSC A;  5H8N B;  2THI A;  3K00 A;  2DSF A;  4NWC A;  2HEU A;  4X9T A;  4R6K A;  4DIG A;  3QUJ A;  3R26 A;  2Z8D A;  3IOV A;  1M5F A;  1MXY A;  1URD A;  2H98 A;  3CFZ A;  3IAZ A;  4XKR A;  1USY E;  1NMU A;  2AIX A;  3W9W A;  2IEE A;  4OVJ A;  4F22 A;  1VFD A;  5I56 B;  1OQG A;  2RIN A;  2ZYO A;  4N6P A;  1SW2 A;  4PFT A;  4RA1 A;  4ESX A;  3C4M A;  3CVG A;  3IL1 B;  2DXY A;  1FTJ A;  1MRP A;  2KLF A;  2NOO A;  1FQE A;  1ZMG A;  4QFK A;  3T93 B;  2XXX A;  4YKI A;  1B32 A;  1LBC A;  2XXH A;  2Q89 A;  3CSB A;  4FIM A;  3S9L C;  3KN8 A;  4I1D A;  1MQG A;  1FW0 A;  3EQ1 A;  4ZEK A;  3PPR A;  1DPP A;  3MAM A;  4G8N A;  1XVX A;  3AXF A;  3FIR A;  4H67 A;  1VFE A;  3KJT A;  4OXV A;  4QFO A;  4Z0I A;  2QMX A;  3ZS6 A;  5I2K B;  5I56 A;  4JXI A;  3RTF B;  1JW4 A;  4NF6 B;  3MP1 A;  3TEL A;  3PMV A;  4YAH X;  2Z8E A;  4YKJ A;  2RCB A;  4ONY A;  3MJN A;  1B7H A;  1VE4 A;  1JW1 A;  4JB7 A;  1MQD A;  1IXC A;  2F36 A;  1AH5 A;  5EHS A;  5AA2 D;  3DEL B;  4U1Z A;  1B52 A;  1Y20 A;  3I5O A;  2X26 A;  4WXJ A;  2PT1 A;  2XXP A;  3BKI B;  4YU0 A;  2UVG A;  5FHO A;  3FVN A;  1JVX A;  1JVY A;  1ZIU A;  1FQF A;  3SEX A;  4F3B A;  3D4C A;  5L9M A;  4XTC Q;  4PET A;  1Y4T A;  4YKK A;  1B2H A;  3RTW B;  3TTL A;  1IUD A;  3TEP A;  4EF2 A;  5BUU A;  2V93 A;  3CRB A;  2F5X A;  1BKA A;  2XHD A;  3QXM A;  4ISU A;  4GL8 A;  1OMP A;  2OWT A;  1I6B A;  3C31 A;  4KCD A;  2I3W A;  5AA4 A;  1FCK A;  2AL5 A;  3LSF B;  3TKD A;  3VXC A;  3H6V A;  1MXU A;  1FQB A;  3FJM A;  1F9B A;  4GL0 A;  2AL4 A;  4GXS B;  1B3L A;  1J1N A;  3SEU A;  4FED A;  3FXR A;  5CI5 A;  2HFB A;  1SYI A;  4RYA A;  3TPA A;  4NE4 A;  1JET A;  4H5F A;  1N7X A;  2B65 A;  2PT2 A;  1UTH B;  4ESW A;  4ZE8 A;  2HCA A;  5H8H B;  4PP0 A;  5I58 B;  4KI0 E;  1TFD A;  2DVZ A;  1B3G A;  1N3X A;  3UGW A;  5JEI A;  1FTL A;  3DP6 A;  3H06 B;  4O3C A;  4ZEF A;  3FD3 A;  1MM7 A;  3QK6 A;  2I6E A;  1QUI A;  3OXN A;  4QFP A;  2YJP A;  1XHY A;  4EDP A;  4ELQ A;  4OES A;  4BDO A;  1P1W A;  1NNF A;  2PMS A;  5IKB A;  4R9F A;  4F29 A;  5CBR A;  5I84 A;  1SDX A;  4X1B A;  4NMY A;  4MLV A;  5HBC A;  1LCT A;  3OO8 A;  2IA4 A;  2X7Q A;  3FAS A;  5H8H A;  2H99 A;  1OVT A;  3JZJ A;  4X48 A;  1URS A;  3KG2 A;  3UIF A;  3IO6 A;  3KZG A;  2A5T B;  1XT8 A;  2OWS A;  1LFI A;  2XXY A;  4MLQ A;  3H6U A;  3EHU A;  2HAU A;  4U4S A;  4GWO A;  3HHG A;  3L6G A;  1DSN A;  2RC7 A;  4IO2 A;  3K01 A;  4P0G A;  2QL3 A;  3CFL A;  3K1P A;  2QS2 A;  3KN3 A;  4HS7 A;  3RGY A;  1DTZ A;  4M1V A;  1I6Q A;  1N76 A;  4GQO A;  4YKP A;  3UN6 A;  2V84 A;  3QUF A;  1MXW A;  5FTH A;  3HV1 A;  2AYS A;  3HN0 A;  4AB5 A;  3VLU A;  3F11 A;  4OWD A;  2GFE A;  3TTR A;  2X7P A;  1XC1 A;  4THI A;  1B5I A;  3OO9 A;  4ECF A;  1B3E A;  2ONK E;  1NL5 A;  2DXR A;  2Q2A A;  3PGF A;  2OLB A;  3RT6 B;  5KZT A;  4O3B A;  2O51 A;  1O63 A;  1Y9U A;  4MF3 A;  1SVX B;  3IB0 A;  3E4R A;  3N26 A;  3PPP A;  3S4U A;  3U93 A;  3V89 B;  1UTH A;  4N07 A;  4RK2 A;  5BWJ A;  1AOV A;  2OK2 A;  3BBR A;  4PQJ A;  3VXB A;  1B7U A;  1IXH A;  1D3K A;  1LGB C;  1N04 A;  1HSL A;  4PFW A;  3OO6 A;  4KYD A;  4TLM B;  5I57 B;  1IEJ A;  3LC8 A;  2H9B A;  4YB7 A;  2F78 A;  3RUM A;  4ND9 A;  4F19 A;  5I58 A;  2PVU A;  3M8U A;  2OZZ A;  1EZP A;  5AA2 A;  3TOD A;  4PFU A;  3HO7 A;  4OEN A;  4OFJ A;  5DYH A;  2FA7 A;  3C32 A;  3D4G A;  5ICT A;  2XXI A;  2O69 A;  5H8Q A;  1B58 A;  4OMB A;  1MDP 1;  4EUO A;  3U92 A;  3B6T A;  1EH3 A;  2RC8 A;  4R2F A;  3TCG A;  4ZEI A;  2REG A;  2XXU A;  1O7T A;  3S9M C;  5EHM A;  1PEB A;  3O2A A;  2A5T A;  5KCJ B;  1FTO A;  2XX9 A;  2ZNT A;  4E0X A;  3EPE A;  2I48 A;  1FQC A;  3W15 C;  5J1D A;  1WDN A;  4G68 C;  1GGG A;  4NWD A;  3N6T A;  2A5S A;  2ANJ A;  2D3I A;  2NXO A;  4QSD A;  2Z23 A;  3MP8 A;  4ZEC A;  3H03 A;  1M5B A;  1UTB A;  4G68 B;  5L9S A;  3OEL A;  3H7M A;  1LFG A;  1SBP A;  3O6I A;  4JWO A;  4ZZA A;  3C33 A;  1H3D A;  4IB2 A;  5TP9 B;  1AL3 A;  3EHS A;  3OMB A;  3K6X A;  3MWB A;  3VFJ A;  3SDF A;  4IO6 A;  3TTK A;  4EQB A;  1B9J A;  3O28 A;  4NED A;  4NF5 A;  2QRY A;  4C0R A;  2HXW A;  1R1N A;  4FEB A;  3RQT A;  3DP4 A;  3QYT A;  5I2K A;  4TQU Q;  3C9H A;  3S2V A;  3IR1 A;  2DOJ A;  1UTB B;  2DP8 A;  4YB6 A;  4ZS9 A;  3T9V A;  5LOM A;  2XX7 A;  4JWY A;  2HAV A;  4KYS A;  3T9H B;  3VDF A;  4GFR A;  4EQ7 A;  1OQH A;  3FXU A;  3IB2 A;  3Q25 A;  3ZKL A;  3S9E A;  1IXG A;  3KSX A;  5I59 B;  1RYO A;  1TFA A;  1B40 A;  3PUX E;  2NUV A;  3IOW A;  1PBQ A;  2ZXT A;  1PB9 A;  4H8I A;  4QF9 A;  1MDQ A;  3MZ9 A;  3KOS A;  4I9D A;  4NF4 B;  4Q30 B;  1B0H A;  4WEP A;  5DEX B;  4BDN A;  4DZ1 A;  4KYE A;  1GVC A;  4F2Q A;  2I0C A;  1US4 A;  1O64 A;  1QJM A;  2UVI A;  4G4P A;  4NF6 A;  1NH8 A;  4F18 A;  1QKB A;  2DE3 A;  3RNN A;  5HPQ A;  3VVE A;  4DCY A;  4M4G A;  4UAC A;  3FGS A;  1D9Y A;  2FYI A;  1YCJ A;  4XKN A;  3RLF E;  4DCX A;  4XKQ A;  5I59 A;  1DPE A;  4LUB A;  1AIV A;  1N0T A;  2H25 A;  4RNS A;  5JTY A;  4R75 A;  2QSX A;  2I49 A;  4R6Y A;  2XXR A;  3KSJ A;  3MVY A;  3PD9 A;  4OTE A;  2XXT A;  1LST A;  3HST A;  4RXL A;  3TCF A;  4IO5 A;  2G93 A;  2GRV A;  5L8D A;  3USD A;  4MH5 A;  4Q0C A;  2D5W A;  3JYR A;  4G68 A;  4DE8 A;  4ZEB A;  1NKX A;  1AMF A;  1H43 A;  1VSO A;  4LON B;  1S7Y A;  1P99 A;  1B3F A;  4KR5 A;  5ITP A;  4PE5 B;  1S50 A;  4EF1 A;  4LVQ A;  1Z7M E;  3SET A;  5JTY B;  3MBP A;  1QUL A;  1A99 A;  1SD3 A;  1LFH A;  4XXU A;  5TP9 A;  1RYX A;  2VD2 A;  1MQI A;  4F3P A;  2ZYN A;  2DS9 A;  4XKP A;  2XD2 A;  4KCC A;  4AQ4 A;  2CMO A;  2I4B A;  3CI8 A;  5DTB A;  2P0S A;  1ZKB A;  4F31 B;  3T96 B;  5TU0 A;  2B3B A;  1US5 A;  3K4U A;  2VHA A;  3MQ9 A;  4HCY A;  4HCW A;  4IY5 A;  3IK6 B;  4N13 A;  3PV0 E;  4H6D A;  5K2X A;  2E1S A;  2HQ0 A;  4MFI A;  4LQ5 A;  4YZZ A;  4JWX A;  3T66 A;  3Q28 A;  3M3K A;  1H44 A;  1B5J A;  4K3F A;  4GOT A;  5FHM A;  5A5X A;  3L6H A;  1PC3 A;  1SI0 A;  5DEX A;  2Y7I A;  1Q35 A;  1MY3 A;  3QAX A;  5KDT A;  4GVO A;  2P1S A;  1XS5 A;  2CZL A;  4LQ2 A;  1LAH E;  1LB9 A;  4ZED A;  3B6Q A;  5A5X B;  1LAF E;  3Q26 A;  1MQH A;  2QPQ A;  1VR5 A;  4H8J A;  4QHQ A;  2Y84 A;  3WAF A;  3KJ7 A;  3LUY A;  3O6H A;  3E13 X;  3MPL A;  3O66 A;  2BJJ X;  3MVZ A;  4OQO A;  4OEV A;  3GLB A;  3VV5 A;  1URG A;  1YAE A;  2DWH A;  2V25 A;  4RK9 A;  2R6G E;  5ITO A;  3U94 A;  2R9J A;  1XOC A;  3FV2 A;  3PUZ E;  4DXB A;  4EQ9 A;  1SW1 A;  4U2R A;  1PB7 A;  4G77 A;  4GXA A;  2UYE A;  5B70 A;  4G8H A;  4KD5 A;  1Y1Z A;  3G3K A;  3M3L A;  4QSE A;  3A3U A;  2F7C A;  2M8C A;  4KQP A;  1NNP A;  1R6Z A;  4BDL A;  5H8S A;  5ICQ A;  5I2N A;  2Z22 A;  1NFT A;  4R74 A;  5H8F A;  1ELJ A;  2F7A A;  1MXV A;  3WAE A;  3TQL A;  2DQV A;  1MY2 A;  1OVB A;  3G3F A;  1R9L A;  3LR1 A;  3B6W A;  4KFQ A;  3K2D A;  4F1U A;  2ZYM A;  4HTG A;  3LSX A;  3C35 A;  3TTM A;  1MH3 A;  1MH4 A;  1TT1 A;  4P0I A;  1B5H A;  2F8D A;  3H6T A;  3O97 A;  4GD5 A;  1QUK A;  1QUJ A;  4DXC A;  1EU8 A;  2RC9 A;  2O1L A;  2Y7K A;  3JV9 A;  1MXZ A;  3IJO B;  4C1U A;  3K6W A;  3OEM A;  4JDF A;  1FQA A;  1MPC A;  3ODB A;  4MBP A;  3K6V A;  2ZMB A;  1PB8 A;  2GH9 A;  1R9Q A;  2I58 A;  5AA3 A;  3UA8 A;  1IIW A;  2Q2C A;  3KEI A;  5ISU A;  1DOT A;  1JQF A;  1A55 A;  2I0B A;  1B1H A;  1ZLQ A;  3M3F A;  3TFL A;  3Q27 A;  3VLW A;  2XD3 A;  3TMG A;  2ONS A;  4R72 A;  3O6G A;  1LB8 A;  2GHB A;  4H0W A;  4WED A;  5CMM A;  3U8Q A;  4OET A;  2H4I A;  4NTL A;  3R7X A;  4F3S A;  4BDR A;  3G7W A;  4Q5T A;  1B51 A;  1QVS A;  2HZK A;  3FVG A;  1TWY A;  1WOD A;  3W9V A;  3EHT A;  4XIG Q;  4U4X A;  1B4H A;  2OBG A;  4RY1 A;  2RKM A;  5I57 A;  2QS3 A;  2VD3 A;  1P1Q A;  2O84 X;  2YPN A;  3A3C A;  5FTI A;  1B1X A;  4JSO A;  1Q1K A;  1MPD A;  1ZJL A;  1B05 A;  3VE1 B;  3ILT B;  1A40 A;  1MG1 A;  1NNT A;  2XXV A;  3FJ7 A;  2F7B A;  1BP5 A;  3E9X A;  3G3G A;  3HHF A;  3OO7 A;  1M5D A;  1FTK A;  3IJX B;  3Q29 A;  5H8F B;  3PPO A;  5DT6 A;  3U72 A;  4OFL A;  1QKA A;  3GBB A;  2NWJ A;  2ABH A;  4F3G A;  2RCA A;  3C36 A;  2Y7R A;  2I4C A;  1B7Z A;  3TTN A;  5L9O A;  2DE4 A;  4GRK A;  4ELP A;  3LBS A;  1ANF A;  3G3J A;  5FHN A;  3MUQ A;  1PBP A;  2E0S A;  5H8Q B;  5I2N B;  3MVW A;  3PD8 A;  3PU5 A;  1B4Z A;  4UA8 A;  3FV1 A;  1KWH A;  4X1D A;  1USY H;  4Z7E A;  4R73 A;  2Q8J A;  3KOT A;  1JW5 A;  3G3H A;  3PMX A;  4U1O A;  2LAO A;  4FE8 A;  1MY0 A;  1FTM A;  1ZU0 A;  2F97 A;  2W7Y A;  3E3K A;  1DMB A;  3IO4 A;  1Y3N A;  4QFN A;  5CRY A;  4ZDM A;  4FAT A;  4O3A A;  4U23 A;  1H45 A;  1HSJ A;  3OOA A;  2UVH A;  1MM6 A;  4LP2 B;  2ONR A;  2PX1 A;  4BDQ A;  3BFU A;  2UYF A;  4I8C A;  1XVY A;  1DTG A;  4H65 A;  5AE4 A;  3KBR A;  4KHZ E;  4LAT A;  1PDA A;  4AB6 A;  4RJZ A;  2Q9T A;  3FZV A;  3CG1 A;  3CR9 A;  1BLF A;  3MC2 A;  4FJP A;  4ELO A;  3A09 A;  3PPN A;  4F1Y A;  5CM6 A;  1LCF A;  3VLV A;  4YMA A;  1TXF A;  1T0K A;  2PYY A;  5HM4 B;  3IOR A;  2Z8F A;  4IO4 A;  3OSR A;  2QMW A;  5K2Y A;  2VP1 A;  4FOR A;  3CSG A;  3SEW A;  2XX8 A;  4E0W A;  3SES A;  4OYV A;  3C34 A;  1Y3Q A;  1ATG A;  4IGR A;  4R6H A;  5KDT B;  2ALU A;  3PUV E;  3V83 A;  1BTJ A;  3K1M A;  1CE2 A;  2F35 A;  3I3V A;  3K6U A;  3OD7 A;  3PUY E;  3MZB A;  4I62 A;  4IY6 A;  1LAX A;  2Q88 A;  1Z7N E;  3T9X B;  3VVD A;  3IB1 A;  1NH7 A;  1POT A;  2DE2 A;  3DLN A;  4POW A;  1A8E A;  3GXA A;  5CMC A;  4ELR A;  3H3G A;  5KCJ A;  1GTK A;  2F6P A;  3FUZ A;  4H1X A;  5CMB A;  2Y7P A;  2QS1 A;  2ESN A;  3TUS A;  4ZZE A;  1B6H A;  1ZTY A;  2P2A A;  3HCQ A;  3N94 A;  4TLL B;  5ELV A;  1GV8 A;  2DYX A;  2O6A A;  2OCU A;  2UVJ A;  3DP8 A;  3QSL A;  4JSD A;  5M2V A;  3MVX A;  2O7I A;  2REJ A;  4OER A;  3TQW A;  4F39 A;  1EZO A;  3PPQ A;  4DXU A;  1I69 A;  1SI1 A;  2QS4 A;  1L5T A;  1P1N A;  2D21 A;  3TZA A;  4YMB A;  3IOU A;  3UP9 A;  1D4N A;  1I6A A;  1EZ9 A;  2OJT A;  5F1Q A;  1MS7 A;  1MQJ A;  1LAG E;  1QW0 A;  1YPN A;  4FEC A;  4NF5 B;  3V5A A;  3CFX A;  4F1V A;  4OHN A;  3LSL A;  4LZ8 A;  4ZE9 A;  3N6U A;  4OFO A;  3I6V A;  3DM0 A;  4KPT A;  3PUW E;  3SKP A;  3T22 A;  3TDJ A;  3O29 A;  3IOT A;  3BFT A;  3ILU B;  1IXI A;  3QIM A;  4G8M A;  1LBB A;  3OEN A;  3RT8 A;  4IO7 A;  3TYH A;  3H4Z A;  2DWA A;  3EF7 A;  4NF8 A;  1SYH A;  3ECR A;  3MPK A;  3MW0 A;  1MXX A;  3FAT A;  3MP6 A;  4DDD A;  3TCH A;  4OZ9 A;  4U22 A;  4YIC A;  1B0L A;  3K1N A;  5CMK A;  4IGT A;  2O68 A;  1LLS A;  1JEV A;  2Y7W A;  2PBW A;  4FAJ A;  4GIZ A;  4GLI A;  4YB5 A;  5AA1 A;  3THI A;  3CG3 A;  5F7V A;  1II5 A;  4WKM A;  4R9G A;  3OSQ A;  4L17 A;  4TOZ A;  2GHA A;  1SW4 A;  2F6G A;  2H5Y A;  2R71 A;  1POY 1;  2UXA A;  5H8N A;  1A54 A;  1MY4 A;  4EXK A;  4U21 A;  4POX A;  4LZ7 A;  2WKY A;  2YLN A;  3MZ1 A;  4QFL A;  4GF8 A;  3RN8 A;  3VVF A;  2RF1 A;  3GZG A;  2V3U A;  5DVJ A;  1MY1 A;  2VOZ A;  1NNK A;  1IQ7 A;  1M5E A;  4G2Z A;  2HZL A;  4F2O A;  2XXW A;  2B3F A;  2DWI A;  1Y1M A;  5CBS A;  2V3T A;  1FQD A;  2O7U A;  4JBZ A;  4EXL A;  5B7D A;  2DVC A;  2ZNS A;  3SER A;  2ZYK A;  1B3H A;  2I3V A;  3TAJ A;  5JK4 A;  4P11 A;  3N5L A;  3P7I A;  1JNF A;  2G29 A;  3K02 A;  3OEK A;  2NVU B;  2QJE A;  1UIV A;  4BLA A;  3ZSF A;  1ZBM A;  1JEU A;  3UK4 A;  4Q8R A;  3S9N C;  3CIJ A;  3KN7 A;  3LSW A;  4LA9 A;  5DVI A;  4OEU A;  2F34 A;  1RKM A;  2FNC A;  1IZ1 A;  1HSE A;  1D9V A;  1N7W A;  3FXQ A;  3EN3 A;  4LZ5 A;  1WVJ A;  3ONM A;  2DWJ A;  3T9U A;  2ZNU A;  3B7D A;  1H76 A;  3FVO A;  1SQY A;  4R2B A;  3RPW A;  1CB6 A;  2O1M A;  3PMW A;  5TPA A;  3V8X B;  4BDM A;  1UQW A;  3KFM A;  3ZKK A;  4H5G A;  1Y4C A;  1BIY A;  4HW8 A;  3HPI A;  3FVK A;  3O9P A;  3FJG A;  1GR2 A;  2VGQ A;  1N3W A;  1N84 A;  1P1U A;  3G3I A;  3GBA A;  4C1T A;  3R6U A;  3KGC A;  5AA4 B;  4IO3 A;  1YTV A;  4NF4 A; 
#chains in the Genus database with same CATH topology
 1SW5 A;  1OIB A;  1M5C A;  4PFY A;  1S9T A;  5CC2 A;  4RPN A;  4DLD A;  2XXQ A;  3H6W A;  4NWC A;  4DIG A;  4R6K A;  3R26 A;  1M5F A;  2H98 A;  3CFZ A;  4XKR A;  2AIX A;  2RIN A;  2ZYO A;  3C4M A;  2NOO A;  1FQE A;  3BIG A;  2XXX A;  4YKI A;  1B32 A;  4AS4 A;  3S9L C;  3KN8 A;  4ZEK A;  3PPR A;  3MAM A;  3D1R A;  4Z0I A;  3ZS6 A;  4NF6 B;  1DBZ A;  3MP1 A;  2Z8E A;  1CNQ A;  2RCB A;  5AA2 D;  3DEL B;  3I5O A;  5FHO A;  2PT1 A;  3BKI B;  2UVG A;  1JVY A;  3SEX A;  1FQF A;  3D4C A;  3TTL A;  3TEP A;  3CRB A;  1I6B A;  3C31 A;  4MNP A;  2AL5 A;  3LSF B;  3PTY A;  3VXC A;  1MXU A;  3FJM A;  1B3L A;  3TPA A;  3RPL A;  5I58 B;  1N3X A;  3LV0 A;  5JEI A;  2I6E A;  4BDO A;  2PFZ A;  4MLV A;  3OO8 A;  2Q74 A;  3EHU A;  1QGX A;  3RGY A;  2Y5L A;  2QS2 A;  3K1P A;  4P8B A;  1DTZ A;  4PBQ A;  2V84 A;  3QUF A;  5FTH A;  4AB5 A;  3HV1 A;  4THI A;  3OO9 A;  2P3V A;  2FHY A;  3RT6 B;  4O3B A;  1O63 A;  3N26 A;  3E4R A;  3S4U A;  3V89 B;  1UTH A;  4N07 A;  2OK2 A;  3BBR A;  5A5X A;  1D3K A;  1LGB C;  4P3L A;  3LC8 A;  2OZZ A;  5ICT A;  4OMB A;  2CZI A;  2RC8 A;  1O7T A;  1FTO A;  2HPG A;  1FQC A;  2KR0 A;  1WDN A;  4G68 C;  1GGG A;  4NWD A;  3N6T A;  1M5B A;  1UTB A;  5L9S A;  1LFG A;  1SBP A;  4JWO A;  1INP A;  1AL3 A;  4IO6 A;  4EQB A;  1B9J A;  5IM2 A;  4NF5 A;  2HXW A;  1FPD A;  1Q9D A;  4FEB A;  3RQT A;  3C9H A;  3IR1 A;  2DP8 A;  2XX7 A;  4EQ7 A;  3FXU A;  3IB2 A;  3Q25 A;  2HHM A;  3ZKL A;  1IXG A;  5I59 B;  2F3B A;  1PB9 A;  4DI4 B;  4DZ1 A;  4I9D A;  1B0H A;  1KA1 A;  2DE3 A;  3VVE A;  4NG7 A;  3RLF E;  4DCX A;  1DPE A;  2FVZ A;  2QSX A;  4R75 A;  4R6Y A;  3MVY A;  1FPK A;  1G0I A;  4RXL A;  4Q0C A;  2D5W A;  4ZEB A;  4LON B;  5ET7 A;  4MX6 A;  5JTY B;  5LDZ A;  1QUL A;  1LFH A;  3MST A;  2XD2 A;  2CMO A;  3CI8 A;  4PC9 A;  1ZKB A;  3T96 B;  4P47 A;  3T66 A;  1H44 A;  5FHM A;  4GOT A;  1PC3 A;  1SI0 A;  1Q35 A;  2XWI A;  1MY3 A;  4GVO A;  4LN5 A;  4LQ2 A;  1XS5 A;  3Q26 A;  4QXD A;  4H8J A;  4QHQ A;  1NV7 A;  2XXK A;  4OEV A;  3GLB A;  3VV5 A;  3B50 A;  1XOC A;  4EQ9 A;  4G77 A;  4QSE A;  4KQP A;  4R74 A;  1ELJ A;  2R8T A;  1OVB A;  4F1U A;  1MH4 A;  4P0I A;  4N17 A;  1SPI A;  4C1U A;  4MBP A;  4I40 A;  3K6V A;  3UA8 A;  2Q2C A;  3LUZ A;  4F31 B;  1ZLQ A;  3TFL A;  3Q27 A;  2PCR A;  3O6G A;  1FPB A;  2GHB A;  2OBG A;  4RY1 A;  2QS3 A;  2O84 X;  5FTI A;  1D9Q A;  3RTW B;  4U23 A;  5TU0 A;  1BP5 A;  3E9X A;  3G3G A;  3OO7 A;  5H8F B;  1M5D A;  3U72 A;  2MKZ A;  3GBB A;  2ABH A;  2Y7R A;  1ANF A;  3MUQ A;  5H8Q B;  5I2N B;  3PU5 A;  4UA8 A;  3FV1 A;  4N6K A;  1USY H;  2Q8J A;  3KOT A;  1JW5 A;  3PMX A;  2XA5 A;  2W7Y A;  4QFN A;  4FAT A;  1DMB A;  1MM6 A;  4BDQ A;  3E79 A;  2UYF A;  5AE4 A;  3CHG A;  3KBR A;  4X04 A;  3FZV A;  3CR9 A;  3MC2 A;  5CM6 A;  3A09 A;  3PPN A;  4YMA A;  5K2Y A;  2QMW A;  2XX8 A;  1FBH A;  1Y3Q A;  3V83 A;  1BTJ A;  1CE2 A;  2F35 A;  3SZP A;  3MZB A;  2Q88 A;  1Z7N E;  3VVD A;  3IB1 A;  1POT A;  1KZ8 A;  4ELR A;  5KCJ A;  2WBD A;  3TUS A;  3QMF A;  4TLL B;  5ELV A;  5M2V A;  3QSL A;  3TQW A;  1EZO A;  3BIH A;  5DW8 A;  4HE1 A;  2D21 A;  1D4N A;  2OJT A;  4NF5 B;  3V5A A;  5I7I A;  4LZ8 A;  3N6U A;  3SKP A;  3DM0 A;  2OWZ A;  3O29 A;  3BFT A;  1IXI A;  4IO7 A;  3H4Z A;  2DWA A;  4NF8 A;  1SYH A;  3TCH A;  5IZZ A;  1LLS A;  2Y7W A;  4GLI A;  2QFL A;  1II5 A;  3HFU A;  2R71 A;  1MY4 A;  4PCD A;  4EXK A;  5DVJ A;  4OVT A;  1NNK A;  1IQ7 A;  1M5E A;  4MEV A;  2HZL A;  4OVQ A;  2DWI A;  2V3T A;  2O7U A;  5B7D A;  1B3H A;  5JK4 A;  2QJE A;  1ZBM A;  1YYZ A;  3KN7 A;  4OEU A;  4M1V A;  1IZ1 A;  4LZ5 A;  3ONM A;  1NV5 A;  1SQY A;  4R2B A;  4BDM A;  2O1M A;  3KFM A;  4HW8 A;  1GR2 A;  3GBA A;  3G3I A;  1YTV A;  4NF4 A;  5EYF A;  5IAI A;  2V3Q A;  1OLC A;  1B46 A;  1A8F A;  3RY3 A;  2CZK A;  3SEY A;  3K0V A;  3K00 A;  4X9T A;  2Z8D A;  5IZ3 B;  3IAZ A;  3W9W A;  4F22 A;  4OVJ A;  1JP4 A;  4MHF A;  2DXY A;  2KLF A;  2XXH A;  4FIM A;  2VT5 A;  5IZ3 A;  1DPP A;  3AXF A;  3FIR A;  4KXP A;  4OXV A;  1VFE A;  3KJT A;  5ET5 A;  4E0W A;  5I56 A;  5I2K B;  3NOH A;  4XEQ A;  4P56 A;  4ONY A;  1B7H A;  4OVS A;  4JB7 A;  5EHS A;  1B52 A;  1Y20 A;  4WXJ A;  4YU0 A;  1JVX A;  1FSA A;  1IUD A;  4EF2 A;  4ISU A;  1OMP A;  4KCD A;  3TKD A;  1FQB A;  4XFE A;  2AL4 A;  1LEV A;  3FXR A;  4RYA A;  4H5F A;  2QVR A;  1N7X A;  4N81 A;  5H8H B;  4KI0 E;  1TFD A;  1B3G A;  3DP6 A;  4ZEF A;  1MM7 A;  4QFP A;  1YXI A;  1P1W A;  2PMS A;  1NV3 A;  4F29 A;  1SDX A;  4N8G A;  2H99 A;  4X48 A;  3KG2 A;  2A5T B;  2OWS A;  4MLQ A;  3H6U A;  2HAU A;  4GWO A;  3HHG A;  2QVU A;  4I3Y A;  4IO2 A;  3K01 A;  2QL3 A;  1FBE A;  1MXW A;  3F11 A;  4OWD A;  2GFE A;  4HE2 A;  1XC1 A;  1NV2 A;  1EYK A;  4MF3 A;  3IB0 A;  4RK2 A;  4H45 A;  4PQJ A;  1B7U A;  4KYD A;  4YB7 A;  2F78 A;  4F19 A;  2PVU A;  3TOD A;  4PBH A;  3HO7 A;  2XXI A;  1MDP 1;  3U92 A;  3S9M C;  2XXU A;  5EHM A;  5KCJ B;  2ZNT A;  1NUZ A;  2A5S A;  2NXO A;  3KC1 A;  4ZEC A;  4G68 B;  3O6I A;  3C33 A;  3MWB A;  3O28 A;  1LBW A;  5ET6 A;  4NED A;  1NV1 A;  5I2K A;  4TQU Q;  4KYS A;  1FPL A;  4OVR A;  4HXV A;  3KSX A;  4O7M A;  4GWW A;  3PUX E;  1PBQ A;  4H8I A;  1MDQ A;  5H8F A;  4Q30 B;  4WEP A;  4KYE A;  1O64 A;  1QJM A;  4PF8 A;  4DCY A;  1YCJ A;  1FPI A;  1AIV A;  2H25 A;  3KSJ A;  4AS5 A;  4IO5 A;  4MH5 A;  3JYR A;  1FPE A;  1NKX A;  1AMF A;  1H43 A;  1B3F A;  4PE5 B;  1NUX A;  3MBP A;  5TP9 A;  4NF0 A;  1MQI A;  1US5 A;  2VHA A;  3MQ9 A;  4HCW A;  2E1S A;  2HQ0 A;  4MFI A;  2Y5K A;  3FBP A;  5KDT A;  2P1S A;  2CZL A;  5ET8 A;  5A5X B;  2Y84 A;  3KJ7 A;  3O6H A;  2BJJ X;  2R6G E;  5ITO A;  2R9J A;  1SW1 A;  3FXB A;  3G3K A;  3A3U A;  1NI9 A;  1NNP A;  4GX4 A;  5I2N A;  2Z22 A;  1MXV A;  3WAE A;  3LR1 A;  4P1L A;  3K2D A;  4HTG A;  3C35 A;  1TT1 A;  2F8D A;  1QUJ A;  2RC9 A;  2O1L A;  1MXZ A;  3IJO B;  3K6W A;  1IIW A;  2P3N A;  1A55 A;  4WED A;  5CMM A;  3U8Q A;  4NTL A;  4F3S A;  4Q5T A;  1B51 A;  1QVS A;  1VDW A;  3FVG A;  4XIG Q;  1B4H A;  2RKM A;  1IMA A;  1P1Q A;  5EQ8 A;  1Q1K A;  1ZJL A;  1B05 A;  1NNT A;  1AOV A;  3UGW A;  2RCA A;  4NX1 A;  5L9O A;  1B7Z A;  4GRK A;  3LBS A;  3G3J A;  2E0S A;  3MVW A;  4R73 A;  4U1O A;  3G3H A;  4FE8 A;  2F97 A;  5CRY A;  2UVH A;  4LP2 B;  2PX1 A;  1FTA A;  2VPN A;  1DTG A;  4KHZ E;  2Q9T A;  4F1Y A;  1LCF A;  3VLV A;  1TXF A;  4OVP A;  2Z8F A;  4IO4 A;  3OSR A;  3SEW A;  3SES A;  3C34 A;  4IGR A;  1ATG A;  2ALU A;  3PUV E;  3T9X B;  1NH7 A;  5CMC A;  1GTK A;  2F6P A;  2Y7P A;  3N94 A;  2P2A A;  3HCQ A;  1FJ9 A;  2DYX A;  2OCU A;  2UVJ A;  3MVX A;  4O94 A;  4DXU A;  1SI1 A;  2QS4 A;  1P1N A;  3IOU A;  3UP9 A;  1I6A A;  5F1Q A;  5IZ1 A;  1MS7 A;  4F1V A;  4FEC A;  3CFX A;  4OHN A;  3LSL A;  4OFO A;  3PUW E;  3T22 A;  4PE3 A;  3TYH A;  2GQ1 A;  3ECR A;  4OZ9 A;  4IGT A;  1DCU A;  1JEV A;  2PBW A;  2OX3 A;  5F7V A;  4WKM A;  4PTK A;  4TOZ A;  1AWB A;  1FJ6 A;  2F6G A;  2H5Y A;  4NHB A;  4U21 A;  4GF8 A;  3VVF A;  2DDK A;  4F2O A;  1FQD A;  2ZYK A;  3TAJ A;  4MCO A;  4P11 A;  3P7I A;  1JNF A;  3OEK A;  1UIV A;  3ZSF A;  4Q8R A;  1EYI A;  3IFA A;  3LSW A;  4LA9 A;  2FNC A;  1HSE A;  3FXQ A;  3EN3 A;  1WVJ A;  2ZNU A;  3B7D A;  3V8X B;  5FBP A;  1UQW A;  1BIY A;  3HPI A;  3FVK A;  3O9P A;  2CEX A;  4C1T A;  1N3W A;  4PAI A;  3R6U A;  3MZ1 A;  5DVF A;  3SEV A;  1P1O A;  3UOR A;  4NF8 B;  1OLA A;  4QSC A;  3IX1 A;  2THI A;  3QUJ A;  3IOV A;  1MXY A;  1NV6 A;  1VFD A;  4FBP A;  4N6P A;  1SW2 A;  4PFT A;  4RA1 A;  3IL1 B;  5T3J A;  1MRP A;  1ZMG A;  4QFK A;  3T93 B;  3CSB A;  4IY6 A;  4H67 A;  1XVX A;  4QFO A;  3TEL A;  1VE4 A;  1MQD A;  2F36 A;  4JVC A;  3FVN A;  1ZIU A;  1BK4 A;  4XTC Q;  3B8B A;  1Y4T A;  1B2H A;  2L5V A;  2F5X A;  2OWT A;  2I3W A;  5AA4 A;  1FCK A;  3H6V A;  1F9B A;  3SEU A;  4FED A;  2HFB A;  1SYI A;  4NE4 A;  2PT2 A;  1UTH B;  4ESW A;  4ZE8 A;  2HCA A;  4PP0 A;  4HE0 A;  2DVZ A;  4O3C A;  3FD3 A;  2YJP A;  1XHY A;  5IKB A;  4X1B A;  4NMY A;  5EQ7 A;  5HBC A;  1LCT A;  2IA4 A;  3FAS A;  5H8H A;  1OVT A;  3JZJ A;  1URS A;  3UIF A;  3IO6 A;  1XT8 A;  1LFI A;  2XXY A;  4U4S A;  3L6G A;  1DSN A;  2RC7 A;  4MIJ A;  5EYH A;  4P0G A;  4HS7 A;  3KN3 A;  1I6Q A;  3HN0 A;  3VLU A;  2X7P A;  1B5I A;  2ZZV A;  4ECF A;  1B3E A;  2KQZ A;  2ONK E;  2DXR A;  4PFI A;  2Q2A A;  3PGF A;  2OLB A;  5KZT A;  3PPP A;  3U93 A;  3VXB A;  4TLM B;  1HSL A;  3OO6 A;  1IEJ A;  1IME A;  2H9B A;  4O7I A;  3RUM A;  4ND9 A;  5I58 A;  4N6D A;  4OFJ A;  2FA7 A;  1B58 A;  4EUO A;  4N15 A;  3B6T A;  2QVV A;  4R2F A;  3TCG A;  4ZEI A;  4PF6 A;  3O2A A;  2A5T A;  2XX9 A;  3W15 C;  5J1D A;  2ANJ A;  4MNC A;  4QSD A;  2Z23 A;  5EQA A;  3OEL A;  3H7M A;  4ZZA A;  5TP9 B;  3OMB A;  3K6X A;  4GWY A;  4C0R A;  3QYT A;  2DOJ A;  1UTB B;  2PFY A;  4ZS9 A;  4JWY A;  3T9H B;  3VDF A;  4GFR A;  1OQH A;  3S9E A;  1RYO A;  1B40 A;  3IOW A;  2ZXT A;  4QF9 A;  3MZ9 A;  5DEX B;  4NF4 B;  5A5L A;  4F2Q A;  2UVI A;  1NH8 A;  3T1B A;  1QKB A;  4M4G A;  4UAC A;  1D9Y A;  2FYI A;  4LUB A;  4RNS A;  5JTY A;  4OTE A;  2XXT A;  1LST A;  3TCF A;  2G93 A;  2GRV A;  3USD A;  4G68 A;  1S7Y A;  1P99 A;  5ITP A;  4EF1 A;  4LVQ A;  1SD3 A;  4XXU A;  2VD2 A;  4F3P A;  3A29 A;  2DS9 A;  4XKP A;  4KCC A;  5DTB A;  2P0S A;  3ISP A;  2B3B A;  4GWZ A;  4N13 A;  1LBV A;  4YZZ A;  4JWX A;  1B5J A;  3GYY A;  3L6H A;  2Y7I A;  3QAX A;  1LB9 A;  3B6Q A;  1MQH A;  2QPQ A;  3WAF A;  3LUY A;  3E13 X;  3MPL A;  3O66 A;  2V25 A;  4N91 A;  3PUZ E;  2HXR A;  1PB7 A;  4GXA A;  2UYE A;  5B70 A;  2F7C A;  2FBP A;  2M8C A;  1IMC A;  1R6Z A;  4BDL A;  4PGP A;  3TQL A;  3G3F A;  4KFQ A;  1MH3 A;  4GD5 A;  1EU8 A;  2Y7K A;  3OEM A;  3ODB A;  4NQ8 A;  1R9Q A;  2I58 A;  3MYU A;  5AA3 A;  4GWU A;  3VLW A;  5LTC A;  2ONS A;  2CZH A;  4BDR A;  4N4U A;  2HZK A;  1WOD A;  2WYP A;  5I57 A;  2YPN A;  3A3C A;  4JSO A;  1MPD A;  3VE1 B;  3ILT B;  4XF5 A;  1MG1 A;  2XXV A;  3FJ7 A;  2F7B A;  3Q29 A;  3HHF A;  1FTK A;  3IJX B;  3PPO A;  5DT6 A;  5FHN A;  1PBP A;  3PD8 A;  5J16 A;  1B4Z A;  2FIX A;  4X1D A;  4Z7E A;  3SET A;  3RPW A;  2LAO A;  1FTM A;  4O3A A;  1HSJ A;  3RPL B;  4DI3 D;  1NUW A;  4PGN A;  1XVY A;  4H65 A;  3EKI A;  4JVD A;  4LAT A;  1PDA A;  4AB6 A;  1BLF A;  2XWO A;  1KA0 A;  3IOR A;  3OD7 A;  3I3V A;  3K6U A;  3DLN A;  1A8E A;  3GXA A;  2QS1 A;  1GV8 A;  2O6A A;  2REJ A;  4OER A;  4F39 A;  3PPQ A;  4GX6 A;  1I69 A;  1L5T A;  1RDX A;  3RYD A;  2XWK A;  4YMB A;  1EZ9 A;  1MQJ A;  1LAG E;  1YPN A;  3TDJ A;  3QIM A;  4G8M A;  3RT8 A;  4MJO A;  3MPK A;  3FAT A;  3T0J A;  4U22 A;  4YIC A;  1B0L A;  5CMK A;  2O68 A;  4PAF A;  4FAJ A;  4YB5 A;  5AA1 A;  4R9G A;  3OSQ A;  1POY 1;  5H8N A;  1A54 A;  4JVI A;  4POX A;  2WKY A;  2YLN A;  4QFL A;  2RF1 A;  3GZG A;  1MY1 A;  2VOZ A;  4G2Z A;  2XXW A;  1Y1M A;  5CBS A;  2DVC A;  2ZNS A;  3SER A;  3N5L A;  2G29 A;  2NVU B;  5DVI A;  5I57 B;  2F34 A;  1RKM A;  1EZP A;  3T9U A;  2DWJ A;  1H76 A;  3FVO A;  5TPA A;  3ZKK A;  1Y4C A;  3FJG A;  2VGQ A;  3KGC A;  4IO3 A;  4E0X A;  5I3S A;  5AA2 B;  3U1O A;  1MPB A;  4PFB A;  4RPO A;  2Q8M A;  4QRZ A;  5TPA B;  1Y3P A;  2WX9 A;  1IIT A;  1FRP A;  1A7L A;  1UIU A;  5H8N B;  2DSF A;  2HEU A;  1URD A;  1RDZ A;  1USY E;  1NMU A;  2IEE A;  5I56 B;  1OQG A;  4MAG A;  4ESX A;  3CVG A;  1FTJ A;  1LBC A;  2Q89 A;  4I1D A;  1MQG A;  1FW0 A;  3EQ1 A;  5H8S A;  4G8N A;  5EQ9 A;  2QMX A;  4JXI A;  3RTF B;  1JW4 A;  3PMV A;  4YAH X;  4YKJ A;  3MJN A;  3IFC A;  1JW1 A;  1IXC A;  1AH5 A;  4U1Z A;  2X26 A;  2XXP A;  4F3B A;  5L9M A;  4PET A;  4YKK A;  5BUU A;  2V93 A;  4PDD A;  1BKA A;  2XHD A;  4H46 A;  3QXM A;  4GL8 A;  4PFR A;  4GL0 A;  4GBV A;  4GXS B;  1J1N A;  4NGU A;  5CI5 A;  4O8M A;  1JET A;  2JJK A;  2B65 A;  4IR8 A;  4P9K A;  5I5P A;  2CEY A;  4OA4 A;  1FTL A;  3H06 B;  3QK6 A;  1QUI A;  3OXN A;  4EDP A;  4ELQ A;  4OES A;  1NNF A;  4R9F A;  5CBR A;  5I84 A;  2B4M A;  2X7Q A;  3KZG A;  2FIE A;  1NV0 A;  4NAP A;  3CFL A;  1N76 A;  4YKP A;  4GQO A;  3UN6 A;  2AYS A;  3TTR A;  1FBG A;  1NL5 A;  1K9Z A;  1NUY A;  2O51 A;  4P1E A;  1Y9U A;  4G61 A;  5F24 A;  1SVX B;  1DK4 A;  5BWJ A;  1IXH A;  1N04 A;  4PFW A;  4MMP A;  3M8U A;  4GWS A;  5AA2 A;  4PFU A;  4OEN A;  5DYH A;  3C32 A;  3D4G A;  1IMD A;  2O69 A;  4GBW A;  5H8Q A;  2ZZW A;  4OAN A;  1EH3 A;  2REG A;  1IMF A;  1PEB A;  3EPE A;  2I48 A;  2D3I A;  3MP8 A;  3H03 A;  1LBY A;  1H3D A;  4IB2 A;  3EHS A;  4MNI A;  1RDY A;  3VFJ A;  3SDF A;  1K9Y A;  3TTK A;  2QRY A;  1R1N A;  3DP4 A;  3S2V A;  3T9V A;  4YB6 A;  5LOM A;  2HAV A;  5IGA A;  1TFA A;  2NUV A;  3KOS A;  4BDN A;  1GVC A;  2I0C A;  1US4 A;  4G4P A;  4NF6 A;  4F18 A;  3RNN A;  5HPQ A;  3FGS A;  4XKN A;  5I59 A;  4XKQ A;  1N0T A;  2I49 A;  2XXR A;  3PD9 A;  2ZZX A;  3HST A;  5ESY A;  5L8D A;  3E78 A;  4DE8 A;  1VSO A;  1FBD A;  4KR5 A;  1S50 A;  1Z7M E;  2WYK A;  1A99 A;  1RYX A;  2ZYN A;  2VPO A;  4AQ4 A;  2I4B A;  2F3D A;  1LBZ A;  3K4U A;  4HCY A;  4IY5 A;  4X8R A;  3IK6 B;  5K2X A;  3PV0 E;  4H6D A;  4LQ5 A;  3KBZ A;  3Q28 A;  3M3K A;  4K3F A;  1FBP A;  1YZ0 A;  1XI6 A;  5DEX A;  1EYJ A;  1LAH E;  4ZED A;  1LAF E;  1VR5 A;  4OQO A;  3MVZ A;  1URG A;  1YAE A;  2DWH A;  4RK9 A;  3U94 A;  1FBF A;  3FV2 A;  4DXB A;  4U2R A;  4G8H A;  4KD5 A;  1Y1Z A;  3M3L A;  5ICQ A;  1NFT A;  2F7A A;  2DQV A;  1MY2 A;  1R9L A;  3B6W A;  2ZYM A;  3LSX A;  3TTM A;  4N8Y A;  1B5H A;  3H6T A;  3O97 A;  4NN3 A;  4QBA A;  1QUK A;  4DXC A;  3JV9 A;  4JDF A;  1FQA A;  1MPC A;  2ZMB A;  1PB8 A;  2GH9 A;  3KEI A;  1LBX A;  5ISU A;  1DOT A;  1JQF A;  1NV4 A;  2I0B A;  1B1H A;  3M3F A;  2XD3 A;  3TMG A;  4R72 A;  1LB8 A;  4H0W A;  4OET A;  2H4I A;  3R7X A;  1FBC A;  3G7W A;  2WBB A;  1TWY A;  3W9V A;  3EHT A;  4U4X A;  2B4L A;  2VD3 A;  1B1X A;  1FPJ A;  2V4C A;  1A40 A;  3KC0 A;  4OFL A;  1QKA A;  4F3G A;  2NWJ A;  3C36 A;  3TTN A;  2I4C A;  2DE4 A;  4ELP A;  1KWH A;  1MY0 A;  1ZU0 A;  3E3K A;  3IO4 A;  1Y3N A;  4ZDM A;  1H45 A;  3OOA A;  2ONR A;  3BFU A;  4I8C A;  2BJI A;  4RJZ A;  3CG1 A;  4FJP A;  4ELO A;  1T0K A;  4UAB A;  2PYY A;  1IMB A;  4I3E A;  2VP1 A;  4FOR A;  3CSG A;  4OYV A;  4R6H A;  5KDT B;  3K1M A;  3PUY E;  4I62 A;  1LAX A;  2DE2 A;  4POW A;  3H3G A;  4H1X A;  3FUZ A;  5CMB A;  3ROJ A;  2ESN A;  4PDH A;  4ZZE A;  1B6H A;  1ZTY A;  3DP8 A;  4JSD A;  2O7I A;  3TZA A;  1QW0 A;  5HM4 B;  4ZE9 A;  3I6V A;  2XWV A;  4KPT A;  3IOT A;  3ILU B;  1LBB A;  3OEN A;  3EF7 A;  3MW0 A;  4DDD A;  1MXX A;  3MP6 A;  3K1N A;  3U65 A;  4GIZ A;  5EYG A;  3THI A;  3CG3 A;  4L17 A;  2GHA A;  1SW4 A;  2UXA A;  4GWX A;  4GX3 A;  4LZ7 A;  3RN8 A;  2V3U A;  2B3F A;  4EXL A;  4JBZ A;  4PAK A;  2I3V A;  4BLA A;  3K02 A;  3S9N C;  1JEU A;  3UK4 A;  3CIJ A;  1D9V A;  1N7W A;  1CB6 A;  1G0H A;  3PMW A;  4H5G A;  1N84 A;  1P1U A;  1FPF A;  2WEF A;  5AA4 B;  1FPG A; 
#chains in the Genus database with same CATH homology
 5DVF A;  1SW5 A;  5EYF A;  5IAI A;  1OIB A;  3SEV A;  5AA2 B;  2V3Q A;  1OLC A;  3U1O A;  1M5C A;  1MPB A;  1B46 A;  1A8F A;  1P1O A;  4QRZ A;  4RPO A;  1Y3P A;  4NF8 B;  4PFY A;  5TPA B;  3RY3 A;  1OLA A;  1S9T A;  3UOR A;  5CC2 A;  1IIT A;  4RPN A;  4DLD A;  2XXQ A;  3H6W A;  3SEY A;  1A7L A;  1UIU A;  3K0V A;  3IX1 A;  4QSC A;  5H8N B;  2THI A;  3K00 A;  2DSF A;  4NWC A;  2HEU A;  4X9T A;  4R6K A;  4DIG A;  3QUJ A;  3R26 A;  2Z8D A;  3IOV A;  1M5F A;  1MXY A;  1URD A;  2H98 A;  3CFZ A;  3IAZ A;  4XKR A;  1USY E;  1NMU A;  2AIX A;  3W9W A;  2IEE A;  4OVJ A;  4F22 A;  1VFD A;  5I56 B;  1OQG A;  2RIN A;  2ZYO A;  4N6P A;  1SW2 A;  4PFT A;  4RA1 A;  4ESX A;  3C4M A;  3CVG A;  3IL1 B;  2DXY A;  1FTJ A;  1MRP A;  2KLF A;  2NOO A;  1FQE A;  1ZMG A;  4QFK A;  3T93 B;  2XXX A;  4YKI A;  1B32 A;  1LBC A;  2XXH A;  2Q89 A;  3CSB A;  4FIM A;  3S9L C;  3KN8 A;  4I1D A;  1MQG A;  1FW0 A;  3EQ1 A;  4ZEK A;  3PPR A;  1DPP A;  3MAM A;  4G8N A;  1XVX A;  3AXF A;  3FIR A;  4H67 A;  1VFE A;  3KJT A;  4OXV A;  4QFO A;  4Z0I A;  2QMX A;  3ZS6 A;  5I2K B;  5I56 A;  4JXI A;  3RTF B;  1JW4 A;  4NF6 B;  3MP1 A;  3TEL A;  3PMV A;  4YAH X;  2Z8E A;  4YKJ A;  2RCB A;  4ONY A;  3MJN A;  1B7H A;  1VE4 A;  1JW1 A;  4JB7 A;  1MQD A;  1IXC A;  2F36 A;  1AH5 A;  5EHS A;  5AA2 D;  3DEL B;  4U1Z A;  1B52 A;  1Y20 A;  3I5O A;  2X26 A;  4WXJ A;  2PT1 A;  2XXP A;  3BKI B;  4YU0 A;  2UVG A;  5FHO A;  3FVN A;  1JVX A;  1JVY A;  1ZIU A;  1FQF A;  3SEX A;  4F3B A;  3D4C A;  5L9M A;  4XTC Q;  4PET A;  1Y4T A;  4YKK A;  1B2H A;  3RTW B;  3TTL A;  1IUD A;  3TEP A;  4EF2 A;  5BUU A;  2V93 A;  3CRB A;  2F5X A;  1BKA A;  2XHD A;  3QXM A;  4ISU A;  4GL8 A;  1OMP A;  2OWT A;  1I6B A;  3C31 A;  4KCD A;  2I3W A;  5AA4 A;  1FCK A;  2AL5 A;  3LSF B;  3TKD A;  3VXC A;  3H6V A;  1MXU A;  1FQB A;  3FJM A;  1F9B A;  4GL0 A;  2AL4 A;  4GXS B;  1B3L A;  1J1N A;  3SEU A;  4FED A;  3FXR A;  5CI5 A;  2HFB A;  1SYI A;  4RYA A;  3TPA A;  4NE4 A;  1JET A;  4H5F A;  1N7X A;  2B65 A;  2PT2 A;  1UTH B;  4ESW A;  4ZE8 A;  2HCA A;  5H8H B;  4PP0 A;  5I58 B;  4KI0 E;  1TFD A;  2DVZ A;  1B3G A;  1N3X A;  3UGW A;  5JEI A;  1FTL A;  3DP6 A;  3H06 B;  4O3C A;  4ZEF A;  3FD3 A;  1MM7 A;  3QK6 A;  2I6E A;  1QUI A;  3OXN A;  4QFP A;  2YJP A;  1XHY A;  4EDP A;  4ELQ A;  4OES A;  4BDO A;  1P1W A;  1NNF A;  2PMS A;  5IKB A;  4R9F A;  4F29 A;  5CBR A;  5I84 A;  1SDX A;  4X1B A;  4NMY A;  4MLV A;  5HBC A;  1LCT A;  3OO8 A;  2IA4 A;  2X7Q A;  3FAS A;  5H8H A;  2H99 A;  1OVT A;  3JZJ A;  4X48 A;  1URS A;  3KG2 A;  3UIF A;  3IO6 A;  3KZG A;  2A5T B;  1XT8 A;  2OWS A;  1LFI A;  2XXY A;  4MLQ A;  3H6U A;  3EHU A;  2HAU A;  4U4S A;  4GWO A;  3HHG A;  3L6G A;  1DSN A;  2RC7 A;  4IO2 A;  3K01 A;  4P0G A;  2QL3 A;  3CFL A;  3K1P A;  2QS2 A;  3KN3 A;  4HS7 A;  3RGY A;  1DTZ A;  4M1V A;  1I6Q A;  1N76 A;  4GQO A;  4YKP A;  3UN6 A;  2V84 A;  3QUF A;  1MXW A;  5FTH A;  3HV1 A;  2AYS A;  3HN0 A;  4AB5 A;  3VLU A;  3F11 A;  4OWD A;  2GFE A;  3TTR A;  2X7P A;  1XC1 A;  4THI A;  1B5I A;  3OO9 A;  4ECF A;  1B3E A;  2ONK E;  1NL5 A;  2DXR A;  2Q2A A;  3PGF A;  2OLB A;  3RT6 B;  5KZT A;  4O3B A;  2O51 A;  1O63 A;  1Y9U A;  4MF3 A;  1SVX B;  3IB0 A;  3E4R A;  3N26 A;  3PPP A;  3S4U A;  3U93 A;  3V89 B;  1UTH A;  4N07 A;  4RK2 A;  5BWJ A;  1AOV A;  2OK2 A;  3BBR A;  4PQJ A;  3VXB A;  1B7U A;  1IXH A;  1D3K A;  1LGB C;  1N04 A;  1HSL A;  4PFW A;  3OO6 A;  4KYD A;  4TLM B;  5I57 B;  1IEJ A;  3LC8 A;  2H9B A;  4YB7 A;  2F78 A;  3RUM A;  4ND9 A;  4F19 A;  5I58 A;  2PVU A;  3M8U A;  2OZZ A;  1EZP A;  5AA2 A;  3TOD A;  4PFU A;  3HO7 A;  4OEN A;  4OFJ A;  5DYH A;  2FA7 A;  3C32 A;  3D4G A;  5ICT A;  2XXI A;  2O69 A;  5H8Q A;  1B58 A;  4OMB A;  1MDP 1;  4EUO A;  3U92 A;  3B6T A;  1EH3 A;  2RC8 A;  4R2F A;  3TCG A;  4ZEI A;  2REG A;  2XXU A;  1O7T A;  3S9M C;  5EHM A;  1PEB A;  3O2A A;  2A5T A;  5KCJ B;  1FTO A;  2XX9 A;  2ZNT A;  4E0X A;  3EPE A;  2I48 A;  1FQC A;  3W15 C;  5J1D A;  1WDN A;  4G68 C;  1GGG A;  4NWD A;  3N6T A;  2A5S A;  2ANJ A;  2D3I A;  2NXO A;  4QSD A;  2Z23 A;  3MP8 A;  4ZEC A;  3H03 A;  1M5B A;  1UTB A;  4G68 B;  5L9S A;  3OEL A;  3H7M A;  1LFG A;  1SBP A;  3O6I A;  4JWO A;  4ZZA A;  3C33 A;  1H3D A;  4IB2 A;  5TP9 B;  1AL3 A;  3EHS A;  3OMB A;  3K6X A;  3MWB A;  3VFJ A;  3SDF A;  4IO6 A;  3TTK A;  4EQB A;  1B9J A;  3O28 A;  4NED A;  4NF5 A;  2QRY A;  4C0R A;  2HXW A;  1R1N A;  4FEB A;  3RQT A;  3DP4 A;  3QYT A;  5I2K A;  4TQU Q;  3C9H A;  3S2V A;  3IR1 A;  2DOJ A;  1UTB B;  2DP8 A;  4YB6 A;  4ZS9 A;  3T9V A;  5LOM A;  2XX7 A;  4JWY A;  2HAV A;  4KYS A;  3T9H B;  3VDF A;  4GFR A;  4EQ7 A;  1OQH A;  3FXU A;  3IB2 A;  3Q25 A;  3ZKL A;  3S9E A;  1IXG A;  3KSX A;  5I59 B;  1RYO A;  1TFA A;  1B40 A;  3PUX E;  2NUV A;  3IOW A;  1PBQ A;  2ZXT A;  1PB9 A;  4H8I A;  4QF9 A;  1MDQ A;  3MZ9 A;  3KOS A;  4I9D A;  4NF4 B;  4Q30 B;  1B0H A;  4WEP A;  5DEX B;  4BDN A;  4DZ1 A;  4KYE A;  1GVC A;  4F2Q A;  2I0C A;  1US4 A;  1O64 A;  1QJM A;  2UVI A;  4G4P A;  4NF6 A;  1NH8 A;  4F18 A;  1QKB A;  2DE3 A;  3RNN A;  5HPQ A;  3VVE A;  4DCY A;  4M4G A;  4UAC A;  3FGS A;  1D9Y A;  2FYI A;  1YCJ A;  4XKN A;  3RLF E;  4DCX A;  4XKQ A;  5I59 A;  1DPE A;  4LUB A;  1AIV A;  1N0T A;  2H25 A;  4RNS A;  5JTY A;  4R75 A;  2QSX A;  2I49 A;  4R6Y A;  2XXR A;  3KSJ A;  3MVY A;  3PD9 A;  4OTE A;  2XXT A;  1LST A;  3HST A;  4RXL A;  3TCF A;  4IO5 A;  2G93 A;  2GRV A;  5L8D A;  3USD A;  4MH5 A;  4Q0C A;  2D5W A;  3JYR A;  4G68 A;  4DE8 A;  4ZEB A;  1NKX A;  1AMF A;  1H43 A;  1VSO A;  4LON B;  1S7Y A;  1P99 A;  1B3F A;  4KR5 A;  5ITP A;  4PE5 B;  1S50 A;  4EF1 A;  4LVQ A;  1Z7M E;  3SET A;  5JTY B;  3MBP A;  1QUL A;  1A99 A;  1SD3 A;  1LFH A;  4XXU A;  5TP9 A;  1RYX A;  2VD2 A;  1MQI A;  4F3P A;  2ZYN A;  2DS9 A;  4XKP A;  2XD2 A;  4KCC A;  4AQ4 A;  2CMO A;  2I4B A;  3CI8 A;  5DTB A;  2P0S A;  1ZKB A;  4F31 B;  3T96 B;  5TU0 A;  2B3B A;  1US5 A;  3K4U A;  2VHA A;  3MQ9 A;  4HCY A;  4HCW A;  4IY5 A;  3IK6 B;  4N13 A;  3PV0 E;  4H6D A;  5K2X A;  2E1S A;  2HQ0 A;  4MFI A;  4LQ5 A;  4YZZ A;  4JWX A;  3T66 A;  3Q28 A;  3M3K A;  1H44 A;  1B5J A;  4K3F A;  4GOT A;  5FHM A;  5A5X A;  3L6H A;  1PC3 A;  1SI0 A;  5DEX A;  2Y7I A;  1Q35 A;  1MY3 A;  3QAX A;  5KDT A;  4GVO A;  2P1S A;  1XS5 A;  2CZL A;  4LQ2 A;  1LAH E;  1LB9 A;  4ZED A;  3B6Q A;  5A5X B;  1LAF E;  3Q26 A;  1MQH A;  2QPQ A;  1VR5 A;  4H8J A;  4QHQ A;  2Y84 A;  3WAF A;  3KJ7 A;  3LUY A;  3O6H A;  3E13 X;  3MPL A;  3O66 A;  2BJJ X;  3MVZ A;  4OQO A;  4OEV A;  3GLB A;  3VV5 A;  1URG A;  1YAE A;  2DWH A;  2V25 A;  4RK9 A;  2R6G E;  5ITO A;  3U94 A;  2R9J A;  1XOC A;  3FV2 A;  3PUZ E;  4DXB A;  4EQ9 A;  1SW1 A;  4U2R A;  1PB7 A;  4G77 A;  4GXA A;  2UYE A;  5B70 A;  4G8H A;  4KD5 A;  1Y1Z A;  3G3K A;  3M3L A;  4QSE A;  3A3U A;  2F7C A;  2M8C A;  4KQP A;  1NNP A;  1R6Z A;  4BDL A;  5H8S A;  5ICQ A;  5I2N A;  2Z22 A;  1NFT A;  4R74 A;  5H8F A;  1ELJ A;  2F7A A;  1MXV A;  3WAE A;  3TQL A;  2DQV A;  1MY2 A;  1OVB A;  3G3F A;  1R9L A;  3LR1 A;  3B6W A;  4KFQ A;  3K2D A;  4F1U A;  2ZYM A;  4HTG A;  3LSX A;  3C35 A;  3TTM A;  1MH3 A;  1MH4 A;  1TT1 A;  4P0I A;  1B5H A;  2F8D A;  3H6T A;  3O97 A;  4GD5 A;  1QUK A;  1QUJ A;  4DXC A;  1EU8 A;  2RC9 A;  2O1L A;  2Y7K A;  3JV9 A;  1MXZ A;  3IJO B;  4C1U A;  3K6W A;  3OEM A;  4JDF A;  1FQA A;  1MPC A;  3ODB A;  4MBP A;  3K6V A;  2ZMB A;  1PB8 A;  2GH9 A;  1R9Q A;  2I58 A;  5AA3 A;  3UA8 A;  1IIW A;  2Q2C A;  3KEI A;  5ISU A;  1DOT A;  1JQF A;  1A55 A;  2I0B A;  1B1H A;  1ZLQ A;  3M3F A;  3TFL A;  3Q27 A;  3VLW A;  2XD3 A;  3TMG A;  2ONS A;  4R72 A;  3O6G A;  1LB8 A;  2GHB A;  4H0W A;  4WED A;  5CMM A;  3U8Q A;  4OET A;  2H4I A;  4NTL A;  3R7X A;  4F3S A;  4BDR A;  3G7W A;  4Q5T A;  1B51 A;  1QVS A;  2HZK A;  3FVG A;  1TWY A;  1WOD A;  3W9V A;  3EHT A;  4XIG Q;  4U4X A;  1B4H A;  2OBG A;  4RY1 A;  2RKM A;  5I57 A;  2QS3 A;  2VD3 A;  1P1Q A;  2O84 X;  2YPN A;  3A3C A;  5FTI A;  1B1X A;  4JSO A;  1Q1K A;  1MPD A;  1ZJL A;  1B05 A;  3VE1 B;  3ILT B;  1A40 A;  1MG1 A;  1NNT A;  2XXV A;  3FJ7 A;  2F7B A;  1BP5 A;  3E9X A;  3G3G A;  3HHF A;  3OO7 A;  1M5D A;  1FTK A;  3IJX B;  3Q29 A;  5H8F B;  3PPO A;  5DT6 A;  3U72 A;  4OFL A;  1QKA A;  3GBB A;  2NWJ A;  2ABH A;  4F3G A;  2RCA A;  3C36 A;  2Y7R A;  2I4C A;  1B7Z A;  3TTN A;  5L9O A;  2DE4 A;  4GRK A;  4ELP A;  3LBS A;  1ANF A;  3G3J A;  5FHN A;  3MUQ A;  1PBP A;  2E0S A;  5H8Q B;  5I2N B;  3MVW A;  3PD8 A;  3PU5 A;  1B4Z A;  4UA8 A;  3FV1 A;  1KWH A;  4X1D A;  1USY H;  4Z7E A;  4R73 A;  2Q8J A;  3KOT A;  1JW5 A;  3G3H A;  3PMX A;  4U1O A;  2LAO A;  4FE8 A;  1MY0 A;  1FTM A;  1ZU0 A;  2F97 A;  2W7Y A;  3E3K A;  1DMB A;  3IO4 A;  1Y3N A;  4QFN A;  5CRY A;  4ZDM A;  4FAT A;  4O3A A;  4U23 A;  1H45 A;  1HSJ A;  3OOA A;  2UVH A;  1MM6 A;  4LP2 B;  2ONR A;  2PX1 A;  4BDQ A;  3BFU A;  2UYF A;  4I8C A;  1XVY A;  1DTG A;  4H65 A;  5AE4 A;  3KBR A;  4KHZ E;  4LAT A;  1PDA A;  4AB6 A;  4RJZ A;  2Q9T A;  3FZV A;  3CG1 A;  3CR9 A;  1BLF A;  3MC2 A;  4FJP A;  4ELO A;  3A09 A;  3PPN A;  4F1Y A;  5CM6 A;  1LCF A;  3VLV A;  4YMA A;  1TXF A;  1T0K A;  2PYY A;  5HM4 B;  3IOR A;  2Z8F A;  4IO4 A;  3OSR A;  2QMW A;  5K2Y A;  2VP1 A;  4FOR A;  3CSG A;  3SEW A;  2XX8 A;  4E0W A;  3SES A;  4OYV A;  3C34 A;  1Y3Q A;  1ATG A;  4IGR A;  4R6H A;  5KDT B;  2ALU A;  3PUV E;  3V83 A;  1BTJ A;  3K1M A;  1CE2 A;  2F35 A;  3I3V A;  3K6U A;  3OD7 A;  3PUY E;  3MZB A;  4I62 A;  4IY6 A;  1LAX A;  2Q88 A;  1Z7N E;  3T9X B;  3VVD A;  3IB1 A;  1NH7 A;  1POT A;  2DE2 A;  3DLN A;  4POW A;  1A8E A;  3GXA A;  5CMC A;  4ELR A;  3H3G A;  5KCJ A;  1GTK A;  2F6P A;  3FUZ A;  4H1X A;  5CMB A;  2Y7P A;  2QS1 A;  2ESN A;  3TUS A;  4ZZE A;  1B6H A;  1ZTY A;  2P2A A;  3HCQ A;  3N94 A;  4TLL B;  5ELV A;  1GV8 A;  2DYX A;  2O6A A;  2OCU A;  2UVJ A;  3DP8 A;  3QSL A;  4JSD A;  5M2V A;  3MVX A;  2O7I A;  2REJ A;  4OER A;  3TQW A;  4F39 A;  1EZO A;  3PPQ A;  4DXU A;  1I69 A;  1SI1 A;  2QS4 A;  1L5T A;  1P1N A;  2D21 A;  3TZA A;  4YMB A;  3IOU A;  3UP9 A;  1D4N A;  1I6A A;  1EZ9 A;  2OJT A;  5F1Q A;  1MS7 A;  1MQJ A;  1LAG E;  1QW0 A;  1YPN A;  4FEC A;  4NF5 B;  3V5A A;  3CFX A;  4F1V A;  4OHN A;  3LSL A;  4LZ8 A;  4ZE9 A;  3N6U A;  4OFO A;  3I6V A;  3DM0 A;  4KPT A;  3PUW E;  3SKP A;  3T22 A;  3TDJ A;  3O29 A;  3IOT A;  3BFT A;  3ILU B;  1IXI A;  3QIM A;  4G8M A;  1LBB A;  3OEN A;  3RT8 A;  4IO7 A;  3TYH A;  3H4Z A;  2DWA A;  3EF7 A;  4NF8 A;  1SYH A;  3ECR A;  3MPK A;  3MW0 A;  1MXX A;  3FAT A;  3MP6 A;  4DDD A;  3TCH A;  4OZ9 A;  4U22 A;  4YIC A;  1B0L A;  3K1N A;  5CMK A;  4IGT A;  2O68 A;  1LLS A;  1JEV A;  2Y7W A;  2PBW A;  4FAJ A;  4GIZ A;  4GLI A;  4YB5 A;  5AA1 A;  3THI A;  3CG3 A;  5F7V A;  1II5 A;  4WKM A;  4R9G A;  3OSQ A;  4L17 A;  4TOZ A;  2GHA A;  1SW4 A;  2F6G A;  2H5Y A;  2R71 A;  1POY 1;  2UXA A;  5H8N A;  1A54 A;  1MY4 A;  4EXK A;  4U21 A;  4POX A;  4LZ7 A;  2WKY A;  2YLN A;  3MZ1 A;  4QFL A;  4GF8 A;  3RN8 A;  3VVF A;  2RF1 A;  3GZG A;  2V3U A;  5DVJ A;  1MY1 A;  2VOZ A;  1NNK A;  1IQ7 A;  1M5E A;  4G2Z A;  2HZL A;  4F2O A;  2XXW A;  2B3F A;  2DWI A;  1Y1M A;  5CBS A;  2V3T A;  1FQD A;  2O7U A;  4JBZ A;  4EXL A;  5B7D A;  2DVC A;  2ZNS A;  3SER A;  2ZYK A;  1B3H A;  2I3V A;  3TAJ A;  5JK4 A;  4P11 A;  3N5L A;  3P7I A;  1JNF A;  2G29 A;  3K02 A;  3OEK A;  2NVU B;  2QJE A;  1UIV A;  4BLA A;  3ZSF A;  1ZBM A;  1JEU A;  3UK4 A;  4Q8R A;  3S9N C;  3CIJ A;  3KN7 A;  3LSW A;  4LA9 A;  5DVI A;  4OEU A;  2F34 A;  1RKM A;  2FNC A;  1IZ1 A;  1HSE A;  1D9V A;  1N7W A;  3FXQ A;  3EN3 A;  4LZ5 A;  1WVJ A;  3ONM A;  2DWJ A;  3T9U A;  2ZNU A;  3B7D A;  1H76 A;  3FVO A;  1SQY A;  4R2B A;  3RPW A;  1CB6 A;  2O1M A;  3PMW A;  5TPA A;  3V8X B;  4BDM A;  1UQW A;  3KFM A;  3ZKK A;  4H5G A;  1Y4C A;  1BIY A;  4HW8 A;  3HPI A;  3FVK A;  3O9P A;  3FJG A;  1GR2 A;  2VGQ A;  1N3W A;  1N84 A;  1P1U A;  3G3I A;  3GBA A;  4C1T A;  3R6U A;  3KGC A;  5AA4 B;  4IO3 A;  1YTV A;  4NF4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...