2F78A

Benm effector binding domain with its effector benzoate
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
222
structure length
222
Chain Sequence
SVEKTIRIGFVGSLLFGLLPRIIHLYRQAHPNLRIELYEMGTKAQTEALKEGRIDAGFGRLKISDPAIKRTLLRNERLMVAVHASHPLNQMKDKGVHLNDLIDEKILLYPSSPKPNFSTHVMNIFSDHGLEPTKINEVREVQLALGLVAAGEGISLVPASTQSIQLFNLSYVPLLDPDAITPIYIAVRNMEESTYIYSLYETIRQIYAYEGFTEPPNWLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation
molecule keywords HTH-type transcriptional regulator benM
publication title Distinct Effector-binding Sites Enable Synergistic Transcriptional Activation by BenM, a LysR-type Regulator.
pubmed doi rcsb
source organism Acinetobacter baylyi
total genus 73
structure length 222
sequence length 222
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2f78A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2f78A02
1URGA 3PPOA 1ZTYA 1SI1A 3OSQA 2CMOA 4KR5A 3LC8A 4GL8A 5I2KB 2HZLA 1DPPA 4G68C 1MQJA 3SKPA 2PT2A 2XX8A 3QIMA 4TLMB 3U94A 1SYIA 3MC2A 1NNTA 2IA4A 2Y7RA 4R2BA 2ZNSA 2DE4A 3D4CA 2R71A 4GFRA 1SW1A 3LSXA 5I58A 1NMUA 1FQBA 3C33A 4IO6A 4P11A 2WKYA 2XX7A 1IXIA 2A5TB 1R1NA 4QF9A 5IAIA 3S4UA 3C36A 1AIVA 4OEVA 3N94A 4H67A 1H3DA 2QL3A 3H4ZA 2GH9A 3RTFB 4DLDA 2Z8EA 2Y7PA 3CIJA 1H76A 3OO6A 5A5XB 2CZLA 5TPAA 3BKIB 1VFDA 5I2NB 5AA2A 3HO7A 1B3HA 4O3CA 2FNCA 4QFNA 1MM6A 2F97A 4Q8RA 4POWA 4R74A 2P2AA 3U72A 2D21A 3RLFE 3K6UA 3ZKKA 2OWTA 4KYEA 1GR2A 1A40A 2XD2A 1B32A 2FYIA 1IEJA 2GRVA 3TTNA 5CMMA 3K01A 1AH5A 2QS2A 3ZKLA 4JWYA 3IOVA 3OO7A 5ITOA 3K4UA 4XKQA 1CB6A 2UVIA 4Q5TA 4NF4A 2UVHA 3S9EA 3K6XA 2NVUB 4Q30B 3PV0E 1YAEA 4BDLA 5TPAB 4O3AA 5AA2B 4R72A 4ZEIA 3BFTA 4MH5A 4JB7A 3IL1B 5AA2D 1NNFA 4GQOA 5DVIA 3O28A 3KSXA 3MQ9A 4LONB 1Q1KA 4XKPA 3TDJA 3TPAA 1Y1ZA 3TEPA 5I57B 1A99A 3UK4A 1Y9UA 3KG2A 3TZAA 3A3UA 3TTLA 2V93A 3M3FA 1QUKA 3OXNA 2XXWA 1AOVA 4FECA 2QJEA 4OMBA 3PUXE 1B3EA 3TTKA 4NE4A 4XXUA 2ALUA 4ELRA 4NF8B 1LFGA 2DVCA 3MBPA 3CVGA 2RC9A 3MP8A 2H9BA 3JV9A 4QSDA 5FHNA 4NF5A 2O1LA 4HTGA 1SD3A 4RJZA 1VE4A 3QYTA 1UTHA 1TFAA 1YTVA 2GHBA 4JWOA 2P1SA 3QK6A 5L9MA 4I1DA 3KBRA 5DEXA 1MQDA 4JBZA 4ND9A 3V89B 1D9YA 1SW4A 3DELB 1MY1A 3O6GA 2DSFA 4U1ZA 3CFXA 1IIWA 5LOMA 4KPTA 2F6GA 3SESA 3SDFA 4YICA 1O7TA 3CFZA 4FAJA 3PMWA 4YKJA 1R9QA 2D3IA 3T96B 4YKIA 3RPWA 4LQ5A 1MXXA 1PB7A 4X48A 1MPBA 2ZXTA 1OLAA 4KCDA 4NF5B 2DXRA 3MJNA 1UTHB 4AQ4A 3MVYA 1OQGA 3HCQA 3T9HB 2I3VA 3QXMA 4U4XA 2O7IA 4F39A 1RYOA 4AB5A 1OLCA 3PUZE 4NWCA 5ITPA 4MBPA 2F5XA 4M1VA 1H44A 2DS9A 4H6DA 4F1UA 1QVSA 5FTIA 4QFKA 4EXLA 5ICTA 3PGFA 4I8CA 1B3GA 1US5A 3W15C 2YJPA 1NL5A 2NOOA 2QSXA 2ZYMA 5L8DA 1BIYA 3RTWB 2HEUA 3OO8A 2VGQA 3K1MA 4QHQA 4QSEA 4X9TA 3G3GA 4F2OA 3PUWE 2REJA 3OD7A 3SEWA 5DT6A 4YZZA 2OLBA 1IQ7A 3PUVE 4F22A 2ONKE 1KWHA 4LATA 4GF8A 2OJTA 1MXYA 4WXJA 5B7DA 3TELA 3OOAA 3PD9A 2O7UA 4Z0IA 4LZ5A 3O6HA 3FD3A 2ONRA 3Q29A 5CI5A 4U22A 4N6PA 2QPQA 2Q9TA 4QRZA 3FATA 2I48A 3I5OA 1XC1A 5CMCA 4F31B 1MY0A 3SERA 3HPIA 2G93A 4R6HA 4F1VA 3HHGA 2AYSA 5M2VA 4NF6A 4F3PA 4OHNA 1MRPA 4G2ZA 4ZEDA 2PVUA 5TU0A 4ZDMA 3KJ7A 3U92A 2AL5A 2KLFA 2NWJA 4F3BA 1USYE 1LBBA 3MWBA 3O2AA 2XXHA 1NKXA 2HQ0A 3V8XB 1R6ZA 3T9VA 4RYAA 2O6AA 3G3FA 4PFTA 3U93A 2Q2CA 1MY4A 1JW5A 4BDQA 4YB6A 1AL3A 2UXAA 2I49A 2QMXA 4E0WA 4R6YA 4EQ7A 1XS5A 3KZGA 4C0RA 3TUSA 2X26A 1JNFA 1NH8A 5AA1A 2H25A 2B3FA 1PBPA 3B7DA 5JEIA 3KEIA 5IKBA 2O69A 3I6VA 1P1NA 3BFUA 4RK2A 3SEVA 4DXBA 1B1HA 3H3GA 3KOSA 1TWYA 2ANJA 1FQFA 4ZE8A 1POTA 2A5TA 4YAHX 2F35A 1IXGA 5HPQA 1P1UA 4GOTA 3VV5A 5DYHA 1CE2A 4XTCQ 4R6KA 1N76A 3T22A 3T9XB 3FJ7A 5A5XA 3FXRA 3S9LC 4PE5B 3RQTA 3IO4A 4IY6A 5I2NA 1GTKA 4RA1A 4F18A 2RINA 1SW5A 5AA4B 5ELVA 4FEBA 3PPNA 3K00A 4YU0A 1LCTA 1T0KA 3FXUA 5H8QB 4ZZAA 4DXCA 2V3TA 5CMBA 4F3SA 4DCXA 4OTEA 2IEEA 3O66A 3USDA 1B0HA 2ESNA 1EZPA 3L6GA 3GBAA 3TTMA 1P99A 1UTBB 3G3IA 1QKAA 2Z23A 1LCFA 5F1QA 2QS4A 4LQ2A 3LSLA 2DVZA 4O3BA 3GBBA 4U4SA 3QUFA 4N07A 1L5TA 3VDFA 3S9NC 5HBCA 3HHFA 1B52A 1S9TA 4LUBA 3FVKA 3IK6B 1ZU0A 3LSWA 4R75A 1QJMA 3G7WA 2I58A 1Y4CA 4GVOA 4PFYA 4PFWA 4G8MA 2HAUA 2OCUA 3ILTB 4RXLA 1QUJA 2A5SA 1FTOA 4G68B 5I57A 3C4MA 4G8HA 4M4GA 2XXXA 3ZS6A 1DOTA 4JSDA 1MDP1 3UA8A 3K1NA 4ZS9A 2Y7KA 1I6BA 2DOJA 4FORA 2R6GE 4NF8A 4ELPA 4RPOA 4ONYA 4IO3A 4H1XA 3VVEA 1DMBA 3IJOB 1B7UA 1EZOA 3T66A 1SQYA 2AIXA 3MW0A 1LAXA 1B5IA 3RN8A 3IB1A 5AA3A 1I6AA 5H8SA 3OMBA 4OFJA 3L6HA 3Q25A 4IO4A 1M5BA 3EHUA 1D4NA 3FV1A 5CM6A 2PBWA 1VSOA 1QUIA 2E0SA 2XD3A 2VHAA 4OQOA 1RKMA 3RGYA 1ATGA 3C35A 4XKNA 2H5YA 3TYHA 3O6IA 1FTJA 2W7YA 3N5LA 2UVGA 4GL0A 2B65A 2G29A 5H8FB 3MP1A 5KCJA 5KZTA 3JZJA 1BTJA 3MPKA 4WKMA 3PMVA 4RPNA 3JYRA 3PUYE 2HXWA 1UIUA 3IB0A 3DP6A 1JVXA 1PDAA 3U1OA 5FTHA 2VOZA 4HW8A 5JTYA 1N7WA 4YMAA 1O64A 1MH4A 3DM0A 2ZMBA 5HM4B 1DTZA 3OSRA 5CBSA 4PFUA 3VFJA 4H8JA 2Y7WA 1PB8A 1QULA 1GV8A 3DP4A 5KDTB 4IY5A 2F7CA 2HZKA 2ZYOA 4LP2B 2XXIA 3O97A 2OK2A 1R9LA 4ZEKA 4F29A 3TQLA 2NXOA 3C31A 4MLQA 2REGA 5KCJB 2GHAA 1FTKA 2VP1A 1B5JA 5F7VA 4RNSA 2QS1A 5DVJA 2RC8A 1H43A 3B6WA 1MXZA 4YKPA 3IORA 3PD8A 1LAFE 3TODA 1MY2A 4NTLA 1P1QA 4TOZA 4IB2A 4YB7A 5JTYB 1II5A 1A8EA 3N6TA 4XKRA 5B70A 3MUQA 1N0TA 3IAZA 1TXFA 2O1MA 2OWSA 3CRBA 3ONMA 3N26A 1FQDA 2PT1A 1N7XA 4H5GA 4GIZA 2VD2A 4BDNA 1ZLQA 4H65A 1M5FA 4TLLB 2H4IA 1D3KA 3HV1A 3R6UA 5EYFA 4LVQA 3U8QA 1USYH 4PETA 3KN7A 2H98A 3E4RA 3UN6A 1Y3NA 3CR9A 3C34A 3QUJA 1B2HA 3FXQA 3UIFA 1SDXA 4KQPA 3EN3A 2F7BA 4KFQA 1MS7A 1XHYA 3OELA 3ILUB 3MZ1A 1Y1MA 1B4ZA 2XX9A 1N3WA 1B05A 1JETA 2I0CA 5DVFA 4KCCA 3H6VA 3H6TA 1NFTA 4BDMA 2DE3A 3H6UA 1B6HA 3PPRA 3GLBA 4HCWA 1B9JA 1A55A 5EHMA 1H45A 4RY1A 1MDQA 1F9BA 4DIGA 3SETA 1J1NA 1LB8A 1YPNA 4XIGQ 1PEBA 2O84X 1B0LA 4OZ9A 4F1YA 3PPQA 4ELQA 2Y84A 3MVWA 2PX1A 1NNKA 2DP8A 4I9DA 1Z7ME 3GXAA 1EZ9A 4DZ1A 2XHDA 3M3KA 1S7YA 3EQ1A 4HS7A 4ISUA 4LZ8A 4OESA 1HSJA 1Y3PA 3RT8A 3C9HA 5H8HB 2Q89A 1PC3A 2Q2AA 2F7AA 1LAHE 3M3LA 4ECFA 3FZVA 3IR1A 4OFLA 1FQEA 3CG1A 4IO5A 3DLNA 1IZ1A 5I56A 3IB2A 4JXIA 1AMFA 4ZE9A 4OETA 1A54A 3K6VA 4OERA 1IXHA 4YMBA 1FW0A 1RYXA 3MP6A 1B1XA 2UVJA 3QSLA 2OZZA 3TFLA 4ZEBA 4G8NA 3IOWA 1Y20A 3T9UA 4JDFA 1HSEA 5AA4A 1MM7A 1HSLA 3MVZA 2DWAA 4H8IA 3TQWA 3MVXA 5H8QA 4F19A 5K2XA 3E9XA 4OFOA 2XXTA 1ELJA 1N3XA 4OVJA 2ZYKA 1P1OA 3O29A 2THIA 2F36A 4DE8A 3FVGA 3MAMA 4F3GA 4N13A 4ZEFA 2XXQA 3OENA 5I59B 3LBSA 1UTBA 2Y7IA 1OVBA 1OVTA 4R9FA 5L9OA 2DQVA 2PYYA 5I56B 3D4GA 4ELOA 4EF1A 1BLFA 1MQIA 3ZSFA 1WVJA 4UA8A 5J1DA 4MF3A 5CBRA 1DPEA 1ZKBA 3H06B 3B6TA 3MPLA 1XVYA 4GLIA 4X1DA 2RCBA 3FV2A 3TMGA 1LGBC 2X7PA 4U21A 3VE1B 1VR5A 1NNPA 2PMSA 2P0SA 1B7ZA 3UORA 5TP9A 1ANFA 4PQJA 3TCHA 3EF7A 1LFIA 4G68A 1LB9A 1EH3A 3FUZA 1B58A 3VVDA 2RCAA 3O9PA 1MXVA 4JWXA 1JW4A 1POY1 1LBCA 4DDDA 4P0GA 2DWJA 1UQWA 4MLVA 2DXYA 3K6WA 1LLSA 4L17A 3QAXA 3VVFA 1N04A 4BDOA 4GD5A 2UYFA 4EXKA 4OYVA 4KD5A 3VLVA 4F2QA 3FIRA 4NWDA 4C1UA 4FATA 2HAVA 3WAEA 2Z8FA 1URDA 3DP8A 3P7IA 2V3QA 2DE2A 4JSOA 5TP9B 3VXCA 2XXVA 4R73A 3OO9A 2DWHA 4KYSA 4YKKA 2E1SA 1N84A 1O63A 1JVYA 2XXYA 3S2VA 4DCYA 1Y4TA 2Q8JA 3IJXB 2HCAA 2RF1A 5H8FA 1GGGA 2V84A 5I58B 3LR1A 3E13X 1FCKA 3UGWA 1M5CA 1SYHA 2V3UA 3EHTA 4KYDA 1QW0A 3KN8A 4OWDA 4FIMA 1FQCA 4G4PA 3V5AA 2I3WA 2UYEA 4LZ7A 4TQUQ 1B51A 3M8UA 1QKBA 1ZMGA 5EHSA 2DWIA 4EUOA 2VD3A 3GZGA 3VLUA 5AE4A 4EF2A 1FTMA 3Q28A 5FHOA 2XXRA 5DTBA 5KDTA 5FHMA 5CRYA 4IGRA 1XVXA 4EQBA 3MZ9A 4DXUA 1A7LA 4R9GA 1BKAA 1WODA 1XT8A 1JW1A 2X7QA 4HCYA 4ZZEA 1URSA 4THIA 3ECRA 2OBGA 2XXPA 1MQHA 3KJTA 4LA9A 4NF4B 2H99A 4U23A 4PP0A 3CI8A 1OMPA 4OEUA 5ICQA 1DSNA 3C32A 4IO7A 3KGCA 3R7XA 1D9VA 1NH7A 4OENA 4EQ9A 1B3LA 3N6UA 1SW2A 2FA7A 2F78A 4KHZE 1B40A 2F34A 1MXWA 4ESXA 3K2DA 3RY3A 3TCFA 1I6QA 4E0XA 4BDRA 4Z7EA 1JEVA 3OEKA 1DTGA 2Z22A 1MPCA 2Z8DA 1YCJA 4QFPA 2ZYNA 2GFEA 2I4CA 2I4BA 3VLWA 2F6PA 4ESWA 3HN0A 2I0BA 4MFIA 3IOTA 3PU5A 3TAJA 2QRYA 1JQFA 5CMKA 3A3CA 4G77A 3F11A 3SEXA 4U1OA 3W9WA 3KOTA 4POXA 2V25A 5H8NA 1TFDA 3UP9A 4FJPA 3Q27A 1MPDA 3EPEA 1B7HA 5BWJA 2BJJX 2R9JA 3CSGA 3E3KA 1GVCA 3RT6B 1UIVA 4BLAA 5DEXB 3EHSA 4GRKA 3I3VA 4Q0CA 3BBRA 3FVOA 1B5HA 4YB5A 1ZJLA 3H6WA 1Z7NE 3H7MA 2I6EA 2LAOA 1M5EA 1IXCA 3H03A 2D5WA 3K1PA 1VFEA 3CSBA 3V83A 5L9SA 3FASA 3IO6A 2ONSA 4R2FA 1PB9A 1B3FA 1ZIUA 3TKDA 5H8HA 2YLNA 3ODBA 5JK4A 1B46A 1Y3QA 2ZNTA 3Q26A 1I69A 4RK9A 3SEUA 5H8NB 3OEMA 4QFLA 3CFLA 4H5FA 1FTLA 1MQGA 4P0IA 3RUMA 3FJGA 2O51A 1ZBMA 3THIA 3R26A 1BP5A 3VXBA 1P1WA 2O68A 1LSTA 1LAGE 1MY3A 3KFMA 4QSCA 3G3KA 3RNNA 3PMXA 4GXSB 4NEDA 1TT1A 4FEDA 3LUYA 1US4A 2HFBA 3LSFB 1IUDA 2XXUA 2RC7A 4IO2A 2QS3A 1MXUA 3AXFA 1PBQA 3IOUA 3PPPA 5K2YA 1SBPA 2M8CA 3B6QA 3HSTA 5BUUA 5ISUA 5I59A 4WEPA 1XOCA 4QFOA 4GWOA 4GXAA 1MG1A 4C1TA 1OQHA 3FGSA 3TCGA 3S9MC 3K02A 4NMYA 1IITA 4I62A 2F8DA 2RKMA 2Q88A 1SI0A 3FVNA 2B3BA 2YPNA 1OIBA 1Q35A 4OXVA 2DYXA 4IGTA 4FE8A 4WEDA 2AL4A 3W9VA 3G3JA 1EU8A 1SVXB 4K3FA 3KSJA 5I2KA 1S50A 1JEUA 3K0VA 1LFHA 5CC2A 1M5DA 1WDNA 1A8FA 4H0WA 3SEYA 4U2RA 2QMWA 2ABHA 3TTRA 4UACA 2NUVA 5I84A 1B4HA 4NF6B 4EDPA 3CG3A 3KN3A 1MH3A 4KI0E 4AB6A 3FJMA 3A09A 3T93B 3IX1A 3G3HA 1FQAA 3MZBA 4ZECA 4X1BA 3WAFA 2ZNUA
chains in the Genus database with same CATH superfamily
1DBZA 1YYZA 1SPIA 1URGA 3PPOA 1ZTYA 1SI1A 2PFYA 3OSQA 2CZIA 2CMOA 4KR5A 3LC8A 4GL8A 5I2KB 2HZLA 1DPPA 4G68C 1MQJA 2Q8MA 3SKPA 2PT2A 2XX8A 3QIMA 4TLMB 4O7IA 3U94A 1SYIA 3MC2A 1NNTA 2BJIA 2IA4A 2Y7RA 3A29A 4R2BA 2ZNSA 2DE4A 3D4CA 2R71A 5IGAA 4GFRA 1SW1A 3LSXA 2CEXA 4DI4B 5I58A 1NMUA 4GWSA 1FQBA 3C33A 4IO6A 4P11A 2WKYA 2XX7A 5F24A 1IXIA 2A5TB 1R1NA 4QF9A 5IAIA 3S4UA 3C36A 1AIVA 2L5VA 4OEVA 3N94A 1FPFA 4H67A 1H3DA 2QL3A 3H4ZA 2GH9A 3RTFB 4DLDA 2Z8EA 2Y7PA 3CIJA 1H76A 5IZ1A 3OO6A 5A5XB 2CZLA 5TPAA 3BKIB 1VFDA 5I2NB 5AA2A 3HO7A 1B3HA 1FBCA 4O3CA 2FNCA 4QFNA 3D1RA 1MM6A 2F97A 4Q8RA 3LV0A 4POWA 4R74A 2P2AA 3U72A 2D21A 1EYIA 3RLFE 1RDYA 3K6UA 4IR8A 3ZKKA 2OWTA 4KYEA 1GR2A 2FIEA 1A40A 2XD2A 1B32A 2FYIA 1IEJA 2GRVA 3TTNA 5CMMA 3K01A 1AH5A 2QS2A 1FPLA 3ZKLA 4JWYA 3IOVA 3OO7A 5ITOA 1INPA 3K4UA 4XKQA 1CB6A 2UVIA 4Q5TA 4NF4A 4OANA 2UVHA 3S9EA 3K6XA 2WYKA 2NVUB 4Q30B 3PV0E 3IFAA 5LTCA 1YAEA 4BDLA 5TPAB 3IFCA 4O3AA 5AA2B 4R72A 2HXRA 4ZEIA 3BFTA 4MH5A 4JB7A 3IL1B 5AA2D 1NNFA 4GQOA 5DVIA 3O28A 3KSXA 2KQZA 3MQ9A 4LONB 1Q1KA 4XKPA 3TDJA 4GBWA 3TPAA 1Y1ZA 3TEPA 5I57B 1A99A 3UK4A 1Q9DA 1Y9UA 3KG2A 3TZAA 3A3UA 1NV5A 3TTLA 2V93A 3M3FA 1QUKA 3ROJA 3OXNA 2XXWA 1AOVA 4FECA 3RYDA 2QJEA 4OMBA 4JVIA 3PUXE 1NUWA 1B3EA 3TTKA 4NE4A 4XXUA 2ALUA 4ELRA 4NF8B 1D9QA 1LFGA 2VT5A 2DVCA 3MBPA 1NUYA 1FPKA 3CVGA 2RC9A 3MP8A 4N4UA 4NQ8A 2H9BA 3JV9A 2XWKA 4QSDA 4GWXA 5FHNA 4NF5A 2O1LA 4HTGA 1SD3A 4RJZA 1VE4A 3QYTA 1UTHA 1TFAA 1YTVA 2GHBA 1IMAA 4JWOA 2P1SA 3QK6A 5L9MA 3QMFA 4I1DA 2QVRA 3KBRA 5DEXA 1MQDA 4JBZA 4ND9A 3V89B 1D9YA 1SW4A 3DELB 1MY1A 3O6GA 2DSFA 4U1ZA 3CFXA 1IIWA 5LOMA 4KPTA 2F6GA 3SESA 3SDFA 4YICA 1O7TA 3CFZA 4FAJA 2CZHA 3PMWA 4OVTA 4YKJA 1R9QA 2D3IA 4P56A 5IM2A 3T96B 4YKIA 3RPWA 4LQ5A 4OVPA 1MXXA 1PB7A 4OVSA 4X48A 4NGUA 1MPBA 2ZXTA 1OLAA 4KCDA 4NF5B 2DXRA 3MJNA 5LDZA 1UTHB 4AQ4A 3RPLA 3MVYA 1OQGA 3HCQA 4MX6A 3T9HB 2I3VA 3QXMA 4U4XA 2O7IA 4F39A 1RYOA 4AB5A 1OLCA 3PUZE 4NWCA 5ITPA 4MBPA 2F5XA 4M1VA 1H44A 3HFUA 3FBPA 2DS9A 4H6DA 4F1UA 2FBPA 1QVSA 5FTIA 4QFKA 4EXLA 5ICTA 3PGFA 4I8CA 1B3GA 1US5A 3W15C 2YJPA 4KXPA 1NL5A 2NOOA 2QSXA 2B4MA 2ZYMA 1FRPA 5L8DA 1BIYA 1YXIA 3RTWB 2HEUA 4NF0A 3OO8A 2VGQA 3K1MA 4QHQA 4QSEA 4X9TA 2FHYA 3G3GA 4F2OA 3PUWE 2REJA 3OD7A 3SEWA 5DT6A 4YZZA 2OLBA 1IQ7A 3PUVE 2ZZXA 4F22A 2ONKE 1KWHA 4LATA 4GF8A 2OJTA 1MXYA 4WXJA 5EQ7A 5B7DA 3TELA 2FIXA 3OOAA 3PD9A 2O7UA 4Z0IA 4LZ5A 3O6HA 3FD3A 2ONRA 3Q29A 5CI5A 4U22A 4N6PA 5J16A 2HPGA 2QPQA 2Q9TA 4QRZA 4I40A 3FATA 2I48A 3I5OA 1XC1A 5CMCA 4F31B 1MY0A 3SERA 3HPIA 2G93A 4R6HA 1EYKA 1K9ZA 4P3LA 4HE2A 4F1VA 3HHGA 2AYSA 1LBZA 2B4LA 2PCRA 5M2VA 4NF6A 4F3PA 4OHNA 1MRPA 4G2ZA 4ZEDA 2PVUA 5TU0A 4ZDMA 3KJ7A 3U92A 2AL5A 4H46A 2KLFA 2NWJA 4F3BA 1USYE 1NV7A 1LBBA 3MWBA 3O2AA 2XXHA 5I5PA 1NKXA 2HQ0A 3V8XB 1R6ZA 3T9VA 4RYAA 2CZKA 2O6AA 3G3FA 4PFTA 3U93A 2Q2CA 1MY4A 1JW5A 4BDQA 4YB6A 1IMEA 1AL3A 4X8RA 2UXAA 2I49A 2QMXA 4E0WA 4R6YA 4EQ7A 1XS5A 3KZGA 4C0RA 3TUSA 2X26A 1JNFA 1FPBA 1NH8A 5AA1A 2H25A 3B50A 2B3FA 1PBPA 3B7DA 5JEIA 3KEIA 5IKBA 2O69A 3E78A 3I6VA 1P1NA 1BK4A 3BFUA 4RK2A 3SEVA 4DXBA 1B1HA 3H3GA 3KOSA 1TWYA 4JVDA 2ANJA 1FQFA 4ZE8A 1POTA 4GX3A 2A5TA 4YAHX 2F35A 1IXGA 5HPQA 3BIGA 3LUZA 1P1UA 4GOTA 3VV5A 5DYHA 1CE2A 1NI9A 4XTCQ 4R6KA 1N76A 3T22A 3T9XB 4MCOA 3FJ7A 5A5XA 3FXRA 3S9LC 4PE5B 1QGXA 3RQTA 3IO4A 1FPJA 4IY6A 5I2NA 1GTKA 2MKZA 5EQ8A 4RA1A 4F18A 2RINA 1SW5A 1LBXA 5AA4B 5ELVA 4FEBA 3PPNA 3K00A 4YU0A 1LCTA 1T0KA 3FXUA 5H8QB 4ZZAA 4DXCA 2V3TA 5CMBA 4F3SA 4GX6A 4DCXA 4OTEA 2IEEA 3O66A 3USDA 4MEVA 1B0HA 2ZZWA 3EKIA 2ESNA 1EZPA 3L6GA 3GBAA 3TTMA 1P99A 1UTBB 3G3IA 1QKAA 4PE3A 2Z23A 1LCFA 5F1QA 2QS4A 4LQ2A 3LSLA 2DVZA 4O3BA 3GBBA 4U4SA 3QUFA 4N07A 1L5TA 3VDFA 3S9NC 2WBDA 5HBCA 3HHFA 1B52A 1S9TA 4LUBA 3FVKA 3IK6B 1ZU0A 3LSWA 4R75A 1QJMA 2XWOA 3G7WA 4GWWA 3CHGA 2I58A 1Y4CA 4GVOA 4PFYA 4PAKA 4PFWA 4G8MA 2HAUA 2OCUA 3ILTB 4RXLA 1QUJA 2A5SA 1FTOA 4G68B 5I57A 3C4MA 4G8HA 4M4GA 2XXXA 3ZS6A 4AS4A 1DOTA 1LBWA 4JSDA 4HXVA 1MDP1 3UA8A 3K1NA 4ZS9A 3E79A 2Y7KA 1I6BA 2DOJA 2OX3A 4FORA 2R6GE 4NF8A 4ELPA 4RPOA 4ONYA 4IO3A 4H1XA 3VVEA 1DMBA 3IJOB 1B7UA 4N8GA 1EZOA 3T66A 1SQYA 2AIXA 3MW0A 1LAXA 1B5IA 3T1BA 3RN8A 4GWYA 3IB1A 5AA3A 2PFZA 1I6AA 5H8SA 3OMBA 4OFJA 3L6HA 3Q25A 4IO4A 1M5BA 3EHUA 1D4NA 3FV1A 5CM6A 2PBWA 1VSOA 5I3SA 1QUIA 2E0SA 2XD3A 4OA4A 2VHAA 4OQOA 1RKMA 4NAPA 3RGYA 1ATGA 3C35A 4XKNA 2H5YA 3TYHA 3O6IA 1FTJA 2W7YA 3N5LA 2UVGA 4GL0A 3KBZA 2B65A 2G29A 5H8FB 3MP1A 2XA5A 5KCJA 5KZTA 3JZJA 2QVVA 1BTJA 3MPKA 4N15A 4WKMA 1NV6A 3PMVA 4RPNA 3JYRA 3PUYE 4GBVA 2HXWA 4MMPA 4N17A 1UIUA 3IB0A 5IZ3B 3DP6A 1JVXA 1PDAA 3U1OA 5FTHA 2XWIA 2VOZA 4HW8A 5JTYA 1N7WA 4NN3A 4YMAA 4O94A 1O64A 1MH4A 3DM0A 2ZMBA 5HM4B 1DTZA 3OSRA 5CBSA 4PFUA 3VFJA 4H8JA 2Y7WA 1PB8A 1NV4A 1QULA 1GV8A 3DP4A 5KDTB 4IY5A 2F7CA 2HZKA 2ZYOA 4LP2B 2XXIA 3O97A 2OK2A 1R9LA 4ZEKA 4F29A 3TQLA 1LEVA 2NXOA 3C31A 4MLQA 2REGA 5KCJB 4MAGA 2GHAA 1FTKA 2VP1A 1B5JA 5F7VA 4RNSA 2QS1A 5DVJA 2RC8A 1H43A 3B6WA 1MXZA 4YKPA 3IORA 3PD8A 1LAFE 3TODA 1MY2A 4NTLA 1P1QA 4TOZA 4IB2A 4YB7A 5JTYB 1II5A 1A8EA 3N6TA 4XKRA 5B70A 4MNIA 1YZ0A 3MUQA 1N0TA 3IAZA 1TXFA 2O1MA 2WYPA 2OWSA 3CRBA 3ONMA 3N26A 1FQDA 2PT1A 3GYYA 1N7XA 4H5GA 4GIZA 2VD2A 4BDNA 1K9YA 4UABA 1ZLQA 2OWZA 4H65A 1FBFA 1M5FA 3T0JA 3MYUA 4TLLB 2H4IA 1D3KA 3HV1A 3R6UA 5EYFA 4HE0A 3BIHA 4LVQA 3U8QA 1USYH 4PETA 3KN7A 2H98A 3E4RA 2CEYA 3UN6A 1Y3NA 3CR9A 3C34A 3QUJA 1B2HA 3FXQA 3UIFA 1SDXA 4KQPA 3EN3A 2F7BA 2VPNA 4KFQA 4DI3D 1MS7A 1XHYA 3OELA 3ILUB 3MZ1A 1Y1MA 5A5LA 1G0IA 1B4ZA 2XX9A 1N3WA 1B05A 3PTYA 2FVZA 1JETA 2I0CA 5DVFA 4KCCA 3H6VA 3H6TA 4NX1A 1NFTA 4BDMA 2DE3A 3H6UA 4XFEA 1B6HA 3PPRA 3GLBA 4HCWA 1CNQA 1B9JA 1A55A 5EHMA 1H45A 4RY1A 4AS5A 1MDQA 1F9BA 4DIGA 3SETA 1J1NA 1LB8A 1YPNA 4XIGQ 1PEBA 2O84X 4N81A 1B0LA 4OZ9A 4PGPA 4F1YA 3PPQA 4ELQA 2Y84A 3MVWA 2PX1A 1NNKA 2DP8A 4I9DA 1Z7ME 3GXAA 1EZ9A 4DZ1A 2XHDA 3M3KA 4PBHA 1S7YA 4O8MA 3EQ1A 4HS7A 4ISUA 4LZ8A 2WX9A 4OESA 1HSJA 5DW8A 1Y3PA 3RT8A 3C9HA 5H8HB 2Q89A 1PC3A 2Q2AA 4FBPA 2F7AA 1LAHE 3M3LA 4ECFA 2HHMA 3FZVA 3IR1A 4OFLA 1FQEA 3CG1A 4IO5A 3DLNA 1IZ1A 5I56A 3IB2A 2DDKA 4JXIA 5ET8A 1AMFA 3FXBA 4H45A 4ZE9A 4OETA 1A54A 3K6VA 4OERA 1IXHA 4YMBA 1FW0A 1RYXA 3MP6A 1B1XA 2UVJA 1NV0A 4LN5A 3QSLA 2OZZA 3TFLA 5FBPA 4GWZA 4ZEBA 4G8NA 3IOWA 3NOHA 1Y20A 3T9UA 4JDFA 5T3JA 1HSEA 5AA4A 1MM7A 1HSLA 3MVZA 2DWAA 4H8IA 1AWBA 3TQWA 3MVXA 4PCDA 4P9KA 5H8QA 4F19A 5K2XA 3E9XA 4OFOA 4N8YA 2XXTA 1ELJA 1N3XA 4OVJA 4QBAA 2ZYKA 1P1OA 1FPGA 2WEFA 3O29A 2THIA 2F36A 4DE8A 3FVGA 3MAMA 1LBYA 4F3GA 4N13A 4ZEFA 2XXQA 3OENA 5ET6A 2XWVA 1DK4A 5I59B 2JJKA 3LBSA 1UTBA 2Y7IA 1OVBA 3KC0A 1OVTA 4R9FA 5L9OA 2DQVA 4N6DA 2PYYA 5I56B 3D4GA 2XXKA 4ELOA 4EF1A 1BLFA 1FBDA 1MQIA 3ZSFA 2ZZVA 1WVJA 4UA8A 5J1DA 2F3DA 4MF3A 1FBGA 5CBRA 4PDDA 1DPEA 1ZKBA 3H06B 3B6TA 3MPLA 1XVYA 4GLIA 4X1DA 2RCBA 3FV2A 3TMGA 1LGBC 5ET7A 5ESYA 2X7PA 4U21A 3VE1B 1VR5A 1NNPA 2PMSA 2P0SA 1B7ZA 4I3YA 3UORA 4XF5A 2R8TA 5TP9A 1ANFA 4PQJA 3TCHA 3EF7A 1LFIA 4G68A 1LB9A 1EH3A 3FUZA 1B58A 3VVDA 2RCAA 3O9PA 1MXVA 4JWXA 1JW4A 1POY1 1LBCA 4DDDA 4P0GA 2DWJA 5EYHA 1UQWA 4MLVA 2DXYA 3K6WA 1LLSA 4L17A 3QAXA 3VVFA 1N04A 4BDOA 4GD5A 2UYFA 4EXKA 4JVCA 4OYVA 4KD5A 1LBVA 3VLVA 4F2QA 3FIRA 4NWDA 4C1UA 1NUXA 4FATA 1FTAA 4I3EA 3ISPA 2HAVA 3WAEA 2Z8FA 1URDA 2QFLA 3DP8A 1RDXA 3P7IA 2F3BA 2V3QA 1FBPA 2DE2A 4JSOA 5TP9B 3VXCA 2XXVA 4PFIA 4R73A 3OO9A 4N6KA 2DWHA 4KYSA 4YKKA 2E1SA 1N84A 1O63A 1JVYA 2XXYA 3S2VA 5EYGA 4G61A 4DCYA 1Y4TA 2Q8JA 4MIJA 3IJXB 2HCAA 2RF1A 5H8FA 1GGGA 2V84A 5I58B 4MJOA 3LR1A 3E13X 1FCKA 2P3VA 4NHBA 3UGWA 1M5CA 1SYHA 3KC1A 2V3UA 3EHTA 4KYDA 1QW0A 3KN8A 4OWDA 4PAIA 3SZPA 4FIMA 1FQCA 4G4PA 5IZ3A 4PF6A 3V5AA 2I3WA 2UYEA 4LZ7A 4TQUQ 1B51A 3M8UA 1KA1A 1QKBA 1ZMGA 5EHSA 2DWIA 4N91A 4EUOA 2VD3A 3GZGA 4PFRA 3VLUA 5AE4A 4EF2A 1FTMA 2GQ1A 3Q28A 5FHOA 2XXRA 5DTBA 3U65A 1RDZA 5KDTA 5FHMA 5CRYA 4IGRA 1XVXA 4EQBA 3MZ9A 4DXUA 1A7LA 4R9GA 1BKAA 1WODA 1XT8A 4MHFA 1JW1A 4OVRA 4P47A 4P1EA 1NV1A 2X7QA 4HCYA 4ZZEA 1URSA 4MNPA 4THIA 3ECRA 1FJ6A 2OBGA 2QVUA 2XXPA 1MQHA 4O7MA 3KJTA 4LA9A 1EYJA 4NF4B 2H99A 4U23A 4PP0A 3CI8A 1OMPA 4OEUA 5ICQA 1DSNA 3C32A 4IO7A 3KGCA 3R7XA 1D9VA 1NH7A 4OENA 4EQ9A 1B3LA 3N6UA 5ET5A 1SW2A 1FBEA 2FA7A 1NUZA 4PAFA 2F78A 4KHZE 1B40A 2F34A 1MXWA 5EQ9A 2V4CA 4ESXA 3K2DA 3RY3A 3TCFA 1NV3A 1I6QA 4PF8A 4E0XA 4BDRA 4Z7EA 1JEVA 1IMDA 3OEKA 1DTGA 1FSAA 2Z22A 4P8BA 1MPCA 2Z8DA 1YCJA 4QFPA 2ZYNA 2GFEA 2I4CA 2I4BA 3VLWA 2F6PA 4ESWA 5EQAA 3HN0A 2I0BA 4MFIA 3IOTA 3PU5A 3TAJA 1IMCA 2QRYA 1JQFA 5CMKA 3A3CA 4G77A 3F11A 3SEXA 4U1OA 3W9WA 3KOTA 4POXA 2V25A 5H8NA 1TFDA 5IZZA 3UP9A 1FPDA 3B8BA 4FJPA 3Q27A 1MPDA 3EPEA 2Y5KA 1B7HA 5BWJA 2BJJX 2R9JA 3CSGA 1DCUA 3E3KA 1GVCA 3RT6B 1UIVA 4BLAA 5DEXB 3EHSA 4GRKA 3I3VA 3MSTA 4Q0CA 3BBRA 3FVOA 2P3NA 1FPIA 1B5HA 4YB5A 1ZJLA 3H6WA 1Z7NE 3H7MA 2Q74A 4QXDA 2I6EA 2LAOA 1FBHA 1M5EA 1IXCA 3H03A 2D5WA 3K1PA 1VFEA 3CSBA 3V83A 5L9SA 3FASA 2WBBA 3IO6A 4PDHA 2ONSA 4R2FA 1PB9A 1B3FA 1FJ9A 1ZIUA 3TKDA 5H8HA 2YLNA 3ODBA 5JK4A 1B46A 1Y3QA 2ZNTA 4PFBA 3Q26A 1I69A 4RK9A 1NV2A 3SEUA 5H8NB 3OEMA 4QFLA 3CFLA 4H5FA 1IMBA 1FTLA 1MQGA 3RPLB 4P0IA 3RUMA 4MNCA 3FJGA 2O51A 1ZBMA 2Y5LA 4PTKA 3THIA 3R26A 1BP5A 1JP4A 3VXBA 1VDWA 1P1WA 2O68A 1LSTA 4HE1A 1LAGE 1MY3A 3KFMA 1XI6A 4QSCA 1KZ8A 3G3KA 3RNNA 4PGNA 3PMXA 4GXSB 4NEDA 1TT1A 4FEDA 3LUYA 1US4A 1KA0A 2HFBA 3LSFB 1IUDA 2XXUA 4NG7A 4PBQA 2RC7A 4IO2A 4OVQA 2QS3A 1MXUA 3AXFA 1PBQA 3IOUA 2KR0A 3PPPA 5K2YA 1SBPA 2M8CA 3B6QA 3HSTA 5BUUA 5ISUA 5I59A 4WEPA 1XOCA 4QFOA 4GWOA 4XEQA 4GXAA 1MG1A 4C1TA 1OQHA 3FGSA 3TCGA 3S9MC 5I7IA 3K02A 4NMYA 1IITA 4I62A 4P1LA 2F8DA 2RKMA 2Q88A 1SI0A 3FVNA 2B3BA 2YPNA 1OIBA 1Q35A 4OXVA 2DYXA 4IGTA 4FE8A 4WEDA 2AL4A 3W9VA 3G3JA 1EU8A 1SVXB 4K3FA 3KSJA 5I2KA 1S50A 1JEUA 3K0VA 1LFHA 5CC2A 1M5DA 1WDNA 1A8FA 2VPOA 4H0WA 3SEYA 4U2RA 2QMWA 2ABHA 3TTRA 4UACA 2NUVA 5I84A 1B4HA 4NF6B 4EDPA 3CG3A 3KN3A 1MH3A 4KI0E 1IMFA 1G0HA 4AB6A 3FJMA 3A09A 3T93B 3IX1A 3G3HA 1FQAA 3MZBA 4ZECA 4GWUA 4X04A 4X1BA 4GX4A 4PC9A 3WAFA 1FPEA 2ZNUA
chains in the Genus database with same CATH topology
1URGA 3PPOA 1ZTYA 1SI1A 3OSQA 2CMOA 4KR5A 3LC8A 4GL8A 5I2KB 2HZLA 1DPPA 4G68C 1MQJA 3SKPA 2PT2A 2XX8A 3QIMA 4TLMB 3U94A 1SYIA 3MC2A 1NNTA 2IA4A 2Y7RA 4R2BA 2ZNSA 2DE4A 3D4CA 2R71A 4GFRA 1SW1A 3LSXA 5I58A 1NMUA 1FQBA 3C33A 4IO6A 4P11A 2WKYA 2XX7A 1IXIA 2A5TB 1R1NA 4QF9A 5IAIA 3S4UA 3C36A 1AIVA 4OEVA 3N94A 4H67A 1H3DA 2QL3A 3H4ZA 2GH9A 3RTFB 4DLDA 2Z8EA 2Y7PA 3CIJA 1H76A 3OO6A 5A5XB 2CZLA 5TPAA 3BKIB 1VFDA 5I2NB 5AA2A 3HO7A 1B3HA 4O3CA 2FNCA 4QFNA 1MM6A 2F97A 4Q8RA 4POWA 4R74A 2P2AA 3U72A 2D21A 3RLFE 3K6UA 3ZKKA 2OWTA 4KYEA 1GR2A 1A40A 2XD2A 1B32A 2FYIA 1IEJA 2GRVA 3TTNA 5CMMA 3K01A 1AH5A 2QS2A 3ZKLA 4JWYA 3IOVA 3OO7A 5ITOA 3K4UA 4XKQA 1CB6A 2UVIA 4Q5TA 4NF4A 2UVHA 3S9EA 3K6XA 2NVUB 4Q30B 3PV0E 1YAEA 4BDLA 5TPAB 4O3AA 5AA2B 4R72A 4ZEIA 3BFTA 4MH5A 4JB7A 3IL1B 5AA2D 1NNFA 4GQOA 5DVIA 3O28A 3KSXA 3MQ9A 4LONB 1Q1KA 4XKPA 3TDJA 3TPAA 1Y1ZA 3TEPA 5I57B 1A99A 3UK4A 1Y9UA 3KG2A 3TZAA 3A3UA 3TTLA 2V93A 3M3FA 1QUKA 3OXNA 2XXWA 1AOVA 4FECA 2QJEA 4OMBA 3PUXE 1B3EA 3TTKA 4NE4A 4XXUA 2ALUA 4ELRA 4NF8B 1LFGA 2DVCA 3MBPA 3CVGA 2RC9A 3MP8A 2H9BA 3JV9A 4QSDA 5FHNA 4NF5A 2O1LA 4HTGA 1SD3A 4RJZA 1VE4A 3QYTA 1UTHA 1TFAA 1YTVA 2GHBA 4JWOA 2P1SA 3QK6A 5L9MA 4I1DA 3KBRA 5DEXA 1MQDA 4JBZA 4ND9A 3V89B 1D9YA 1SW4A 3DELB 1MY1A 3O6GA 2DSFA 4U1ZA 3CFXA 1IIWA 5LOMA 4KPTA 2F6GA 3SESA 3SDFA 4YICA 1O7TA 3CFZA 4FAJA 3PMWA 4YKJA 1R9QA 2D3IA 3T96B 4YKIA 3RPWA 4LQ5A 1MXXA 1PB7A 4X48A 1MPBA 2ZXTA 1OLAA 4KCDA 4NF5B 2DXRA 3MJNA 1UTHB 4AQ4A 3MVYA 1OQGA 3HCQA 3T9HB 2I3VA 3QXMA 4U4XA 2O7IA 4F39A 1RYOA 4AB5A 1OLCA 3PUZE 4NWCA 5ITPA 4MBPA 2F5XA 4M1VA 1H44A 2DS9A 4H6DA 4F1UA 1QVSA 5FTIA 4QFKA 4EXLA 5ICTA 3PGFA 4I8CA 1B3GA 1US5A 3W15C 2YJPA 1NL5A 2NOOA 2QSXA 2ZYMA 5L8DA 1BIYA 3RTWB 2HEUA 3OO8A 2VGQA 3K1MA 4QHQA 4QSEA 4X9TA 3G3GA 4F2OA 3PUWE 2REJA 3OD7A 3SEWA 5DT6A 4YZZA 2OLBA 1IQ7A 3PUVE 4F22A 2ONKE 1KWHA 4LATA 4GF8A 2OJTA 1MXYA 4WXJA 5B7DA 3TELA 3OOAA 3PD9A 2O7UA 4Z0IA 4LZ5A 3O6HA 3FD3A 2ONRA 3Q29A 5CI5A 4U22A 4N6PA 2QPQA 2Q9TA 4QRZA 3FATA 2I48A 3I5OA 1XC1A 5CMCA 4F31B 1MY0A 3SERA 3HPIA 2G93A 4R6HA 4F1VA 3HHGA 2AYSA 5M2VA 4NF6A 4F3PA 4OHNA 1MRPA 4G2ZA 4ZEDA 2PVUA 5TU0A 4ZDMA 3KJ7A 3U92A 2AL5A 2KLFA 2NWJA 4F3BA 1USYE 1LBBA 3MWBA 3O2AA 2XXHA 1NKXA 2HQ0A 3V8XB 1R6ZA 3T9VA 4RYAA 2O6AA 3G3FA 4PFTA 3U93A 2Q2CA 1MY4A 1JW5A 4BDQA 4YB6A 1AL3A 2UXAA 2I49A 2QMXA 4E0WA 4R6YA 4EQ7A 1XS5A 3KZGA 4C0RA 3TUSA 2X26A 1JNFA 1NH8A 5AA1A 2H25A 2B3FA 1PBPA 3B7DA 5JEIA 3KEIA 5IKBA 2O69A 3I6VA 1P1NA 3BFUA 4RK2A 3SEVA 4DXBA 1B1HA 3H3GA 3KOSA 1TWYA 2ANJA 1FQFA 4ZE8A 1POTA 2A5TA 4YAHX 2F35A 1IXGA 5HPQA 1P1UA 4GOTA 3VV5A 5DYHA 1CE2A 4XTCQ 4R6KA 1N76A 3T22A 3T9XB 3FJ7A 5A5XA 3FXRA 3S9LC 4PE5B 3RQTA 3IO4A 4IY6A 5I2NA 1GTKA 4RA1A 4F18A 2RINA 1SW5A 5AA4B 5ELVA 4FEBA 3PPNA 3K00A 4YU0A 1LCTA 1T0KA 3FXUA 5H8QB 4ZZAA 4DXCA 2V3TA 5CMBA 4F3SA 4DCXA 4OTEA 2IEEA 3O66A 3USDA 1B0HA 2ESNA 1EZPA 3L6GA 3GBAA 3TTMA 1P99A 1UTBB 3G3IA 1QKAA 2Z23A 1LCFA 5F1QA 2QS4A 4LQ2A 3LSLA 2DVZA 4O3BA 3GBBA 4U4SA 3QUFA 4N07A 1L5TA 3VDFA 3S9NC 5HBCA 3HHFA 1B52A 1S9TA 4LUBA 3FVKA 3IK6B 1ZU0A 3LSWA 4R75A 1QJMA 3G7WA 2I58A 1Y4CA 4GVOA 4PFYA 4PFWA 4G8MA 2HAUA 2OCUA 3ILTB 4RXLA 1QUJA 2A5SA 1FTOA 4G68B 5I57A 3C4MA 4G8HA 4M4GA 2XXXA 3ZS6A 1DOTA 4JSDA 1MDP1 3UA8A 3K1NA 4ZS9A 2Y7KA 1I6BA 2DOJA 4FORA 2R6GE 4NF8A 4ELPA 4RPOA 4ONYA 4IO3A 4H1XA 3VVEA 1DMBA 3IJOB 1B7UA 1EZOA 3T66A 1SQYA 2AIXA 3MW0A 1LAXA 1B5IA 3RN8A 3IB1A 5AA3A 1I6AA 5H8SA 3OMBA 4OFJA 3L6HA 3Q25A 4IO4A 1M5BA 3EHUA 1D4NA 3FV1A 5CM6A 2PBWA 1VSOA 1QUIA 2E0SA 2XD3A 2VHAA 4OQOA 1RKMA 3RGYA 1ATGA 3C35A 4XKNA 2H5YA 3TYHA 3O6IA 1FTJA 2W7YA 3N5LA 2UVGA 4GL0A 2B65A 2G29A 5H8FB 3MP1A 5KCJA 5KZTA 3JZJA 1BTJA 3MPKA 4WKMA 3PMVA 4RPNA 3JYRA 3PUYE 2HXWA 1UIUA 3IB0A 3DP6A 1JVXA 1PDAA 3U1OA 5FTHA 2VOZA 4HW8A 5JTYA 1N7WA 4YMAA 1O64A 1MH4A 3DM0A 2ZMBA 5HM4B 1DTZA 3OSRA 5CBSA 4PFUA 3VFJA 4H8JA 2Y7WA 1PB8A 1QULA 1GV8A 3DP4A 5KDTB 4IY5A 2F7CA 2HZKA 2ZYOA 4LP2B 2XXIA 3O97A 2OK2A 1R9LA 4ZEKA 4F29A 3TQLA 2NXOA 3C31A 4MLQA 2REGA 5KCJB 2GHAA 1FTKA 2VP1A 1B5JA 5F7VA 4RNSA 2QS1A 5DVJA 2RC8A 1H43A 3B6WA 1MXZA 4YKPA 3IORA 3PD8A 1LAFE 3TODA 1MY2A 4NTLA 1P1QA 4TOZA 4IB2A 4YB7A 5JTYB 1II5A 1A8EA 3N6TA 4XKRA 5B70A 3MUQA 1N0TA 3IAZA 1TXFA 2O1MA 2OWSA 3CRBA 3ONMA 3N26A 1FQDA 2PT1A 1N7XA 4H5GA 4GIZA 2VD2A 4BDNA 1ZLQA 4H65A 1M5FA 4TLLB 2H4IA 1D3KA 3HV1A 3R6UA 5EYFA 4LVQA 3U8QA 1USYH 4PETA 3KN7A 2H98A 3E4RA 3UN6A 1Y3NA 3CR9A 3C34A 3QUJA 1B2HA 3FXQA 3UIFA 1SDXA 4KQPA 3EN3A 2F7BA 4KFQA 1MS7A 1XHYA 3OELA 3ILUB 3MZ1A 1Y1MA 1B4ZA 2XX9A 1N3WA 1B05A 1JETA 2I0CA 5DVFA 4KCCA 3H6VA 3H6TA 1NFTA 4BDMA 2DE3A 3H6UA 1B6HA 3PPRA 3GLBA 4HCWA 1B9JA 1A55A 5EHMA 1H45A 4RY1A 1MDQA 1F9BA 4DIGA 3SETA 1J1NA 1LB8A 1YPNA 4XIGQ 1PEBA 2O84X 1B0LA 4OZ9A 4F1YA 3PPQA 4ELQA 2Y84A 3MVWA 2PX1A 1NNKA 2DP8A 4I9DA 1Z7ME 3GXAA 1EZ9A 4DZ1A 2XHDA 3M3KA 1S7YA 3EQ1A 4HS7A 4ISUA 4LZ8A 4OESA 1HSJA 1Y3PA 3RT8A 3C9HA 5H8HB 2Q89A 1PC3A 2Q2AA 2F7AA 1LAHE 3M3LA 4ECFA 3FZVA 3IR1A 4OFLA 1FQEA 3CG1A 4IO5A 3DLNA 1IZ1A 5I56A 3IB2A 4JXIA 1AMFA 4ZE9A 4OETA 1A54A 3K6VA 4OERA 1IXHA 4YMBA 1FW0A 1RYXA 3MP6A 1B1XA 2UVJA 3QSLA 2OZZA 3TFLA 4ZEBA 4G8NA 3IOWA 1Y20A 3T9UA 4JDFA 1HSEA 5AA4A 1MM7A 1HSLA 3MVZA 2DWAA 4H8IA 3TQWA 3MVXA 5H8QA 4F19A 5K2XA 3E9XA 4OFOA 2XXTA 1ELJA 1N3XA 4OVJA 2ZYKA 1P1OA 3O29A 2THIA 2F36A 4DE8A 3FVGA 3MAMA 4F3GA 4N13A 4ZEFA 2XXQA 3OENA 5I59B 3LBSA 1UTBA 2Y7IA 1OVBA 1OVTA 4R9FA 5L9OA 2DQVA 2PYYA 5I56B 3D4GA 4ELOA 4EF1A 1BLFA 1MQIA 3ZSFA 1WVJA 4UA8A 5J1DA 4MF3A 5CBRA 1DPEA 1ZKBA 3H06B 3B6TA 3MPLA 1XVYA 4GLIA 4X1DA 2RCBA 3FV2A 3TMGA 1LGBC 2X7PA 4U21A 3VE1B 1VR5A 1NNPA 2PMSA 2P0SA 1B7ZA 3UORA 5TP9A 1ANFA 4PQJA 3TCHA 3EF7A 1LFIA 4G68A 1LB9A 1EH3A 3FUZA 1B58A 3VVDA 2RCAA 3O9PA 1MXVA 4JWXA 1JW4A 1POY1 1LBCA 4DDDA 4P0GA 2DWJA 1UQWA 4MLVA 2DXYA 3K6WA 1LLSA 4L17A 3QAXA 3VVFA 1N04A 4BDOA 4GD5A 2UYFA 4EXKA 4OYVA 4KD5A 3VLVA 4F2QA 3FIRA 4NWDA 4C1UA 4FATA 2HAVA 3WAEA 2Z8FA 1URDA 3DP8A 3P7IA 2V3QA 2DE2A 4JSOA 5TP9B 3VXCA 2XXVA 4R73A 3OO9A 2DWHA 4KYSA 4YKKA 2E1SA 1N84A 1O63A 1JVYA 2XXYA 3S2VA 4DCYA 1Y4TA 2Q8JA 3IJXB 2HCAA 2RF1A 5H8FA 1GGGA 2V84A 5I58B 3LR1A 3E13X 1FCKA 3UGWA 1M5CA 1SYHA 2V3UA 3EHTA 4KYDA 1QW0A 3KN8A 4OWDA 4FIMA 1FQCA 4G4PA 3V5AA 2I3WA 2UYEA 4LZ7A 4TQUQ 1B51A 3M8UA 1QKBA 1ZMGA 5EHSA 2DWIA 4EUOA 2VD3A 3GZGA 3VLUA 5AE4A 4EF2A 1FTMA 3Q28A 5FHOA 2XXRA 5DTBA 5KDTA 5FHMA 5CRYA 4IGRA 1XVXA 4EQBA 3MZ9A 4DXUA 1A7LA 4R9GA 1BKAA 1WODA 1XT8A 1JW1A 2X7QA 4HCYA 4ZZEA 1URSA 4THIA 3ECRA 2OBGA 2XXPA 1MQHA 3KJTA 4LA9A 4NF4B 2H99A 4U23A 4PP0A 3CI8A 1OMPA 4OEUA 5ICQA 1DSNA 3C32A 4IO7A 3KGCA 3R7XA 1D9VA 1NH7A 4OENA 4EQ9A 1B3LA 3N6UA 1SW2A 2FA7A 2F78A 4KHZE 1B40A 2F34A 1MXWA 4ESXA 3K2DA 3RY3A 3TCFA 1I6QA 4E0XA 4BDRA 4Z7EA 1JEVA 3OEKA 1DTGA 2Z22A 1MPCA 2Z8DA 1YCJA 4QFPA 2ZYNA 2GFEA 2I4CA 2I4BA 3VLWA 2F6PA 4ESWA 3HN0A 2I0BA 4MFIA 3IOTA 3PU5A 3TAJA 2QRYA 1JQFA 5CMKA 3A3CA 4G77A 3F11A 3SEXA 4U1OA 3W9WA 3KOTA 4POXA 2V25A 5H8NA 1TFDA 3UP9A 4FJPA 3Q27A 1MPDA 3EPEA 1B7HA 5BWJA 2BJJX 2R9JA 3CSGA 3E3KA 1GVCA 3RT6B 1UIVA 4BLAA 5DEXB 3EHSA 4GRKA 3I3VA 4Q0CA 3BBRA 3FVOA 1B5HA 4YB5A 1ZJLA 3H6WA 1Z7NE 3H7MA 2I6EA 2LAOA 1M5EA 1IXCA 3H03A 2D5WA 3K1PA 1VFEA 3CSBA 3V83A 5L9SA 3FASA 3IO6A 2ONSA 4R2FA 1PB9A 1B3FA 1ZIUA 3TKDA 5H8HA 2YLNA 3ODBA 5JK4A 1B46A 1Y3QA 2ZNTA 3Q26A 1I69A 4RK9A 3SEUA 5H8NB 3OEMA 4QFLA 3CFLA 4H5FA 1FTLA 1MQGA 4P0IA 3RUMA 3FJGA 2O51A 1ZBMA 3THIA 3R26A 1BP5A 3VXBA 1P1WA 2O68A 1LSTA 1LAGE 1MY3A 3KFMA 4QSCA 3G3KA 3RNNA 3PMXA 4GXSB 4NEDA 1TT1A 4FEDA 3LUYA 1US4A 2HFBA 3LSFB 1IUDA 2XXUA 2RC7A 4IO2A 2QS3A 1MXUA 3AXFA 1PBQA 3IOUA 3PPPA 5K2YA 1SBPA 2M8CA 3B6QA 3HSTA 5BUUA 5ISUA 5I59A 4WEPA 1XOCA 4QFOA 4GWOA 4GXAA 1MG1A 4C1TA 1OQHA 3FGSA 3TCGA 3S9MC 3K02A 4NMYA 1IITA 4I62A 2F8DA 2RKMA 2Q88A 1SI0A 3FVNA 2B3BA 2YPNA 1OIBA 1Q35A 4OXVA 2DYXA 4IGTA 4FE8A 4WEDA 2AL4A 3W9VA 3G3JA 1EU8A 1SVXB 4K3FA 3KSJA 5I2KA 1S50A 1JEUA 3K0VA 1LFHA 5CC2A 1M5DA 1WDNA 1A8FA 4H0WA 3SEYA 4U2RA 2QMWA 2ABHA 3TTRA 4UACA 2NUVA 5I84A 1B4HA 4NF6B 4EDPA 3CG3A 3KN3A 1MH3A 4KI0E 4AB6A 3FJMA 3A09A 3T93B 3IX1A 3G3HA 1FQAA 3MZBA 4ZECA 4X1BA 3WAFA 2ZNUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1URG A;  3PPO A;  1ZTY A;  1SI1 A;  3OSQ A;  2CMO A;  4KR5 A;  3LC8 A;  4GL8 A;  5I2K B;  2HZL A;  1DPP A;  4G68 C;  1MQJ A;  3SKP A;  2PT2 A;  2XX8 A;  3QIM A;  4TLM B;  3U94 A;  1SYI A;  3MC2 A;  1NNT A;  2IA4 A;  2Y7R A;  4R2B A;  2ZNS A;  2DE4 A;  3D4C A;  2R71 A;  4GFR A;  1SW1 A;  3LSX A;  5I58 A;  1NMU A;  1FQB A;  3C33 A;  4IO6 A;  4P11 A;  2WKY A;  2XX7 A;  1IXI A;  2A5T B;  1R1N A;  4QF9 A;  5IAI A;  3S4U A;  3C36 A;  1AIV A;  4OEV A;  3N94 A;  4H67 A;  1H3D A;  2QL3 A;  3H4Z A;  2GH9 A;  3RTF B;  4DLD A;  2Z8E A;  2Y7P A;  3CIJ A;  1H76 A;  3OO6 A;  5A5X B;  2CZL A;  5TPA A;  3BKI B;  1VFD A;  5I2N B;  5AA2 A;  3HO7 A;  1B3H A;  4O3C A;  2FNC A;  4QFN A;  1MM6 A;  2F97 A;  4Q8R A;  4POW A;  4R74 A;  2P2A A;  3U72 A;  2D21 A;  3RLF E;  3K6U A;  3ZKK A;  2OWT A;  4KYE A;  1GR2 A;  1A40 A;  2XD2 A;  1B32 A;  2FYI A;  1IEJ A;  2GRV A;  3TTN A;  5CMM A;  3K01 A;  1AH5 A;  2QS2 A;  3ZKL A;  4JWY A;  3IOV A;  3OO7 A;  5ITO A;  3K4U A;  4XKQ A;  1CB6 A;  2UVI A;  4Q5T A;  4NF4 A;  2UVH A;  3S9E A;  3K6X A;  2NVU B;  4Q30 B;  3PV0 E;  1YAE A;  4BDL A;  5TPA B;  4O3A A;  5AA2 B;  4R72 A;  4ZEI A;  3BFT A;  4MH5 A;  4JB7 A;  3IL1 B;  5AA2 D;  1NNF A;  4GQO A;  5DVI A;  3O28 A;  3KSX A;  3MQ9 A;  4LON B;  1Q1K A;  4XKP A;  3TDJ A;  3TPA A;  1Y1Z A;  3TEP A;  5I57 B;  1A99 A;  3UK4 A;  1Y9U A;  3KG2 A;  3TZA A;  3A3U A;  3TTL A;  2V93 A;  3M3F A;  1QUK A;  3OXN A;  2XXW A;  1AOV A;  4FEC A;  2QJE A;  4OMB A;  3PUX E;  1B3E A;  3TTK A;  4NE4 A;  4XXU A;  2ALU A;  4ELR A;  4NF8 B;  1LFG A;  2DVC A;  3MBP A;  3CVG A;  2RC9 A;  3MP8 A;  2H9B A;  3JV9 A;  4QSD A;  5FHN A;  4NF5 A;  2O1L A;  4HTG A;  1SD3 A;  4RJZ A;  1VE4 A;  3QYT A;  1UTH A;  1TFA A;  1YTV A;  2GHB A;  4JWO A;  2P1S A;  3QK6 A;  5L9M A;  4I1D A;  3KBR A;  5DEX A;  1MQD A;  4JBZ A;  4ND9 A;  3V89 B;  1D9Y A;  1SW4 A;  3DEL B;  1MY1 A;  3O6G A;  2DSF A;  4U1Z A;  3CFX A;  1IIW A;  5LOM A;  4KPT A;  2F6G A;  3SES A;  3SDF A;  4YIC A;  1O7T A;  3CFZ A;  4FAJ A;  3PMW A;  4YKJ A;  1R9Q A;  2D3I A;  3T96 B;  4YKI A;  3RPW A;  4LQ5 A;  1MXX A;  1PB7 A;  4X48 A;  1MPB A;  2ZXT A;  1OLA A;  4KCD A;  4NF5 B;  2DXR A;  3MJN A;  1UTH B;  4AQ4 A;  3MVY A;  1OQG A;  3HCQ A;  3T9H B;  2I3V A;  3QXM A;  4U4X A;  2O7I A;  4F39 A;  1RYO A;  4AB5 A;  1OLC A;  3PUZ E;  4NWC A;  5ITP A;  4MBP A;  2F5X A;  4M1V A;  1H44 A;  2DS9 A;  4H6D A;  4F1U A;  1QVS A;  5FTI A;  4QFK A;  4EXL A;  5ICT A;  3PGF A;  4I8C A;  1B3G A;  1US5 A;  3W15 C;  2YJP A;  1NL5 A;  2NOO A;  2QSX A;  2ZYM A;  5L8D A;  1BIY A;  3RTW B;  2HEU A;  3OO8 A;  2VGQ A;  3K1M A;  4QHQ A;  4QSE A;  4X9T A;  3G3G A;  4F2O A;  3PUW E;  2REJ A;  3OD7 A;  3SEW A;  5DT6 A;  4YZZ A;  2OLB A;  1IQ7 A;  3PUV E;  4F22 A;  2ONK E;  1KWH A;  4LAT A;  4GF8 A;  2OJT A;  1MXY A;  4WXJ A;  5B7D A;  3TEL A;  3OOA A;  3PD9 A;  2O7U A;  4Z0I A;  4LZ5 A;  3O6H A;  3FD3 A;  2ONR A;  3Q29 A;  5CI5 A;  4U22 A;  4N6P A;  2QPQ A;  2Q9T A;  4QRZ A;  3FAT A;  2I48 A;  3I5O A;  1XC1 A;  5CMC A;  4F31 B;  1MY0 A;  3SER A;  3HPI A;  2G93 A;  4R6H A;  4F1V A;  3HHG A;  2AYS A;  5M2V A;  4NF6 A;  4F3P A;  4OHN A;  1MRP A;  4G2Z A;  4ZED A;  2PVU A;  5TU0 A;  4ZDM A;  3KJ7 A;  3U92 A;  2AL5 A;  2KLF A;  2NWJ A;  4F3B A;  1USY E;  1LBB A;  3MWB A;  3O2A A;  2XXH A;  1NKX A;  2HQ0 A;  3V8X B;  1R6Z A;  3T9V A;  4RYA A;  2O6A A;  3G3F A;  4PFT A;  3U93 A;  2Q2C A;  1MY4 A;  1JW5 A;  4BDQ A;  4YB6 A;  1AL3 A;  2UXA A;  2I49 A;  2QMX A;  4E0W A;  4R6Y A;  4EQ7 A;  1XS5 A;  3KZG A;  4C0R A;  3TUS A;  2X26 A;  1JNF A;  1NH8 A;  5AA1 A;  2H25 A;  2B3F A;  1PBP A;  3B7D A;  5JEI A;  3KEI A;  5IKB A;  2O69 A;  3I6V A;  1P1N A;  3BFU A;  4RK2 A;  3SEV A;  4DXB A;  1B1H A;  3H3G A;  3KOS A;  1TWY A;  2ANJ A;  1FQF A;  4ZE8 A;  1POT A;  2A5T A;  4YAH X;  2F35 A;  1IXG A;  5HPQ A;  1P1U A;  4GOT A;  3VV5 A;  5DYH A;  1CE2 A;  4XTC Q;  4R6K A;  1N76 A;  3T22 A;  3T9X B;  3FJ7 A;  5A5X A;  3FXR A;  3S9L C;  4PE5 B;  3RQT A;  3IO4 A;  4IY6 A;  5I2N A;  1GTK A;  4RA1 A;  4F18 A;  2RIN A;  1SW5 A;  5AA4 B;  5ELV A;  4FEB A;  3PPN A;  3K00 A;  4YU0 A;  1LCT A;  1T0K A;  3FXU A;  5H8Q B;  4ZZA A;  4DXC A;  2V3T A;  5CMB A;  4F3S A;  4DCX A;  4OTE A;  2IEE A;  3O66 A;  3USD A;  1B0H A;  2ESN A;  1EZP A;  3L6G A;  3GBA A;  3TTM A;  1P99 A;  1UTB B;  3G3I A;  1QKA A;  2Z23 A;  1LCF A;  5F1Q A;  2QS4 A;  4LQ2 A;  3LSL A;  2DVZ A;  4O3B A;  3GBB A;  4U4S A;  3QUF A;  4N07 A;  1L5T A;  3VDF A;  3S9N C;  5HBC A;  3HHF A;  1B52 A;  1S9T A;  4LUB A;  3FVK A;  3IK6 B;  1ZU0 A;  3LSW A;  4R75 A;  1QJM A;  3G7W A;  2I58 A;  1Y4C A;  4GVO A;  4PFY A;  4PFW A;  4G8M A;  2HAU A;  2OCU A;  3ILT B;  4RXL A;  1QUJ A;  2A5S A;  1FTO A;  4G68 B;  5I57 A;  3C4M A;  4G8H A;  4M4G A;  2XXX A;  3ZS6 A;  1DOT A;  4JSD A;  1MDP 1;  3UA8 A;  3K1N A;  4ZS9 A;  2Y7K A;  1I6B A;  2DOJ A;  4FOR A;  2R6G E;  4NF8 A;  4ELP A;  4RPO A;  4ONY A;  4IO3 A;  4H1X A;  3VVE A;  1DMB A;  3IJO B;  1B7U A;  1EZO A;  3T66 A;  1SQY A;  2AIX A;  3MW0 A;  1LAX A;  1B5I A;  3RN8 A;  3IB1 A;  5AA3 A;  1I6A A;  5H8S A;  3OMB A;  4OFJ A;  3L6H A;  3Q25 A;  4IO4 A;  1M5B A;  3EHU A;  1D4N A;  3FV1 A;  5CM6 A;  2PBW A;  1VSO A;  1QUI A;  2E0S A;  2XD3 A;  2VHA A;  4OQO A;  1RKM A;  3RGY A;  1ATG A;  3C35 A;  4XKN A;  2H5Y A;  3TYH A;  3O6I A;  1FTJ A;  2W7Y A;  3N5L A;  2UVG A;  4GL0 A;  2B65 A;  2G29 A;  5H8F B;  3MP1 A;  5KCJ A;  5KZT A;  3JZJ A;  1BTJ A;  3MPK A;  4WKM A;  3PMV A;  4RPN A;  3JYR A;  3PUY E;  2HXW A;  1UIU A;  3IB0 A;  3DP6 A;  1JVX A;  1PDA A;  3U1O A;  5FTH A;  2VOZ A;  4HW8 A;  5JTY A;  1N7W A;  4YMA A;  1O64 A;  1MH4 A;  3DM0 A;  2ZMB A;  5HM4 B;  1DTZ A;  3OSR A;  5CBS A;  4PFU A;  3VFJ A;  4H8J A;  2Y7W A;  1PB8 A;  1QUL A;  1GV8 A;  3DP4 A;  5KDT B;  4IY5 A;  2F7C A;  2HZK A;  2ZYO A;  4LP2 B;  2XXI A;  3O97 A;  2OK2 A;  1R9L A;  4ZEK A;  4F29 A;  3TQL A;  2NXO A;  3C31 A;  4MLQ A;  2REG A;  5KCJ B;  2GHA A;  1FTK A;  2VP1 A;  1B5J A;  5F7V A;  4RNS A;  2QS1 A;  5DVJ A;  2RC8 A;  1H43 A;  3B6W A;  1MXZ A;  4YKP A;  3IOR A;  3PD8 A;  1LAF E;  3TOD A;  1MY2 A;  4NTL A;  1P1Q A;  4TOZ A;  4IB2 A;  4YB7 A;  5JTY B;  1II5 A;  1A8E A;  3N6T A;  4XKR A;  5B70 A;  3MUQ A;  1N0T A;  3IAZ A;  1TXF A;  2O1M A;  2OWS A;  3CRB A;  3ONM A;  3N26 A;  1FQD A;  2PT1 A;  1N7X A;  4H5G A;  4GIZ A;  2VD2 A;  4BDN A;  1ZLQ A;  4H65 A;  1M5F A;  4TLL B;  2H4I A;  1D3K A;  3HV1 A;  3R6U A;  5EYF A;  4LVQ A;  3U8Q A;  1USY H;  4PET A;  3KN7 A;  2H98 A;  3E4R A;  3UN6 A;  1Y3N A;  3CR9 A;  3C34 A;  3QUJ A;  1B2H A;  3FXQ A;  3UIF A;  1SDX A;  4KQP A;  3EN3 A;  2F7B A;  4KFQ A;  1MS7 A;  1XHY A;  3OEL A;  3ILU B;  3MZ1 A;  1Y1M A;  1B4Z A;  2XX9 A;  1N3W A;  1B05 A;  1JET A;  2I0C A;  5DVF A;  4KCC A;  3H6V A;  3H6T A;  1NFT A;  4BDM A;  2DE3 A;  3H6U A;  1B6H A;  3PPR A;  3GLB A;  4HCW A;  1B9J A;  1A55 A;  5EHM A;  1H45 A;  4RY1 A;  1MDQ A;  1F9B A;  4DIG A;  3SET A;  1J1N A;  1LB8 A;  1YPN A;  4XIG Q;  1PEB A;  2O84 X;  1B0L A;  4OZ9 A;  4F1Y A;  3PPQ A;  4ELQ A;  2Y84 A;  3MVW A;  2PX1 A;  1NNK A;  2DP8 A;  4I9D A;  1Z7M E;  3GXA A;  1EZ9 A;  4DZ1 A;  2XHD A;  3M3K A;  1S7Y A;  3EQ1 A;  4HS7 A;  4ISU A;  4LZ8 A;  4OES A;  1HSJ A;  1Y3P A;  3RT8 A;  3C9H A;  5H8H B;  2Q89 A;  1PC3 A;  2Q2A A;  2F7A A;  1LAH E;  3M3L A;  4ECF A;  3FZV A;  3IR1 A;  4OFL A;  1FQE A;  3CG1 A;  4IO5 A;  3DLN A;  1IZ1 A;  5I56 A;  3IB2 A;  4JXI A;  1AMF A;  4ZE9 A;  4OET A;  1A54 A;  3K6V A;  4OER A;  1IXH A;  4YMB A;  1FW0 A;  1RYX A;  3MP6 A;  1B1X A;  2UVJ A;  3QSL A;  2OZZ A;  3TFL A;  4ZEB A;  4G8N A;  3IOW A;  1Y20 A;  3T9U A;  4JDF A;  1HSE A;  5AA4 A;  1MM7 A;  1HSL A;  3MVZ A;  2DWA A;  4H8I A;  3TQW A;  3MVX A;  5H8Q A;  4F19 A;  5K2X A;  3E9X A;  4OFO A;  2XXT A;  1ELJ A;  1N3X A;  4OVJ A;  2ZYK A;  1P1O A;  3O29 A;  2THI A;  2F36 A;  4DE8 A;  3FVG A;  3MAM A;  4F3G A;  4N13 A;  4ZEF A;  2XXQ A;  3OEN A;  5I59 B;  3LBS A;  1UTB A;  2Y7I A;  1OVB A;  1OVT A;  4R9F A;  5L9O A;  2DQV A;  2PYY A;  5I56 B;  3D4G A;  4ELO A;  4EF1 A;  1BLF A;  1MQI A;  3ZSF A;  1WVJ A;  4UA8 A;  5J1D A;  4MF3 A;  5CBR A;  1DPE A;  1ZKB A;  3H06 B;  3B6T A;  3MPL A;  1XVY A;  4GLI A;  4X1D A;  2RCB A;  3FV2 A;  3TMG A;  1LGB C;  2X7P A;  4U21 A;  3VE1 B;  1VR5 A;  1NNP A;  2PMS A;  2P0S A;  1B7Z A;  3UOR A;  5TP9 A;  1ANF A;  4PQJ A;  3TCH A;  3EF7 A;  1LFI A;  4G68 A;  1LB9 A;  1EH3 A;  3FUZ A;  1B58 A;  3VVD A;  2RCA A;  3O9P A;  1MXV A;  4JWX A;  1JW4 A;  1POY 1;  1LBC A;  4DDD A;  4P0G A;  2DWJ A;  1UQW A;  4MLV A;  2DXY A;  3K6W A;  1LLS A;  4L17 A;  3QAX A;  3VVF A;  1N04 A;  4BDO A;  4GD5 A;  2UYF A;  4EXK A;  4OYV A;  4KD5 A;  3VLV A;  4F2Q A;  3FIR A;  4NWD A;  4C1U A;  4FAT A;  2HAV A;  3WAE A;  2Z8F A;  1URD A;  3DP8 A;  3P7I A;  2V3Q A;  2DE2 A;  4JSO A;  5TP9 B;  3VXC A;  2XXV A;  4R73 A;  3OO9 A;  2DWH A;  4KYS A;  4YKK A;  2E1S A;  1N84 A;  1O63 A;  1JVY A;  2XXY A;  3S2V A;  4DCY A;  1Y4T A;  2Q8J A;  3IJX B;  2HCA A;  2RF1 A;  5H8F A;  1GGG A;  2V84 A;  5I58 B;  3LR1 A;  3E13 X;  1FCK A;  3UGW A;  1M5C A;  1SYH A;  2V3U A;  3EHT A;  4KYD A;  1QW0 A;  3KN8 A;  4OWD A;  4FIM A;  1FQC A;  4G4P A;  3V5A A;  2I3W A;  2UYE A;  4LZ7 A;  4TQU Q;  1B51 A;  3M8U A;  1QKB A;  1ZMG A;  5EHS A;  2DWI A;  4EUO A;  2VD3 A;  3GZG A;  3VLU A;  5AE4 A;  4EF2 A;  1FTM A;  3Q28 A;  5FHO A;  2XXR A;  5DTB A;  5KDT A;  5FHM A;  5CRY A;  4IGR A;  1XVX A;  4EQB A;  3MZ9 A;  4DXU A;  1A7L A;  4R9G A;  1BKA A;  1WOD A;  1XT8 A;  1JW1 A;  2X7Q A;  4HCY A;  4ZZE A;  1URS A;  4THI A;  3ECR A;  2OBG A;  2XXP A;  1MQH A;  3KJT A;  4LA9 A;  4NF4 B;  2H99 A;  4U23 A;  4PP0 A;  3CI8 A;  1OMP A;  4OEU A;  5ICQ A;  1DSN A;  3C32 A;  4IO7 A;  3KGC A;  3R7X A;  1D9V A;  1NH7 A;  4OEN A;  4EQ9 A;  1B3L A;  3N6U A;  1SW2 A;  2FA7 A;  2F78 A;  4KHZ E;  1B40 A;  2F34 A;  1MXW A;  4ESX A;  3K2D A;  3RY3 A;  3TCF A;  1I6Q A;  4E0X A;  4BDR A;  4Z7E A;  1JEV A;  3OEK A;  1DTG A;  2Z22 A;  1MPC A;  2Z8D A;  1YCJ A;  4QFP A;  2ZYN A;  2GFE A;  2I4C A;  2I4B A;  3VLW A;  2F6P A;  4ESW A;  3HN0 A;  2I0B A;  4MFI A;  3IOT A;  3PU5 A;  3TAJ A;  2QRY A;  1JQF A;  5CMK A;  3A3C A;  4G77 A;  3F11 A;  3SEX A;  4U1O A;  3W9W A;  3KOT A;  4POX A;  2V25 A;  5H8N A;  1TFD A;  3UP9 A;  4FJP A;  3Q27 A;  1MPD A;  3EPE A;  1B7H A;  5BWJ A;  2BJJ X;  2R9J A;  3CSG A;  3E3K A;  1GVC A;  3RT6 B;  1UIV A;  4BLA A;  5DEX B;  3EHS A;  4GRK A;  3I3V A;  4Q0C A;  3BBR A;  3FVO A;  1B5H A;  4YB5 A;  1ZJL A;  3H6W A;  1Z7N E;  3H7M A;  2I6E A;  2LAO A;  1M5E A;  1IXC A;  3H03 A;  2D5W A;  3K1P A;  1VFE A;  3CSB A;  3V83 A;  5L9S A;  3FAS A;  3IO6 A;  2ONS A;  4R2F A;  1PB9 A;  1B3F A;  1ZIU A;  3TKD A;  5H8H A;  2YLN A;  3ODB A;  5JK4 A;  1B46 A;  1Y3Q A;  2ZNT A;  3Q26 A;  1I69 A;  4RK9 A;  3SEU A;  5H8N B;  3OEM A;  4QFL A;  3CFL A;  4H5F A;  1FTL A;  1MQG A;  4P0I A;  3RUM A;  3FJG A;  2O51 A;  1ZBM A;  3THI A;  3R26 A;  1BP5 A;  3VXB A;  1P1W A;  2O68 A;  1LST A;  1LAG E;  1MY3 A;  3KFM A;  4QSC A;  3G3K A;  3RNN A;  3PMX A;  4GXS B;  4NED A;  1TT1 A;  4FED A;  3LUY A;  1US4 A;  2HFB A;  3LSF B;  1IUD A;  2XXU A;  2RC7 A;  4IO2 A;  2QS3 A;  1MXU A;  3AXF A;  1PBQ A;  3IOU A;  3PPP A;  5K2Y A;  1SBP A;  2M8C A;  3B6Q A;  3HST A;  5BUU A;  5ISU A;  5I59 A;  4WEP A;  1XOC A;  4QFO A;  4GWO A;  4GXA A;  1MG1 A;  4C1T A;  1OQH A;  3FGS A;  3TCG A;  3S9M C;  3K02 A;  4NMY A;  1IIT A;  4I62 A;  2F8D A;  2RKM A;  2Q88 A;  1SI0 A;  3FVN A;  2B3B A;  2YPN A;  1OIB A;  1Q35 A;  4OXV A;  2DYX A;  4IGT A;  4FE8 A;  4WED A;  2AL4 A;  3W9V A;  3G3J A;  1EU8 A;  1SVX B;  4K3F A;  3KSJ A;  5I2K A;  1S50 A;  1JEU A;  3K0V A;  1LFH A;  5CC2 A;  1M5D A;  1WDN A;  1A8F A;  4H0W A;  3SEY A;  4U2R A;  2QMW A;  2ABH A;  3TTR A;  4UAC A;  2NUV A;  5I84 A;  1B4H A;  4NF6 B;  4EDP A;  3CG3 A;  3KN3 A;  1MH3 A;  4KI0 E;  4AB6 A;  3FJM A;  3A09 A;  3T93 B;  3IX1 A;  3G3H A;  1FQA A;  3MZB A;  4ZEC A;  4X1B A;  3WAF A;  2ZNU A; 
#chains in the Genus database with same CATH topology
 1DBZ A;  1YYZ A;  1SPI A;  1URG A;  3PPO A;  1ZTY A;  1SI1 A;  2PFY A;  3OSQ A;  2CZI A;  2CMO A;  4KR5 A;  3LC8 A;  4GL8 A;  5I2K B;  2HZL A;  1DPP A;  4G68 C;  1MQJ A;  2Q8M A;  3SKP A;  2PT2 A;  2XX8 A;  3QIM A;  4TLM B;  4O7I A;  3U94 A;  1SYI A;  3MC2 A;  1NNT A;  2BJI A;  2IA4 A;  2Y7R A;  3A29 A;  4R2B A;  2ZNS A;  2DE4 A;  3D4C A;  2R71 A;  5IGA A;  4GFR A;  1SW1 A;  3LSX A;  2CEX A;  4DI4 B;  5I58 A;  1NMU A;  4GWS A;  1FQB A;  3C33 A;  4IO6 A;  4P11 A;  2WKY A;  2XX7 A;  5F24 A;  1IXI A;  2A5T B;  1R1N A;  4QF9 A;  5IAI A;  3S4U A;  3C36 A;  1AIV A;  2L5V A;  4OEV A;  3N94 A;  1FPF A;  4H67 A;  1H3D A;  2QL3 A;  3H4Z A;  2GH9 A;  3RTF B;  4DLD A;  2Z8E A;  2Y7P A;  3CIJ A;  1H76 A;  5IZ1 A;  3OO6 A;  5A5X B;  2CZL A;  5TPA A;  3BKI B;  1VFD A;  5I2N B;  5AA2 A;  3HO7 A;  1B3H A;  1FBC A;  4O3C A;  2FNC A;  4QFN A;  3D1R A;  1MM6 A;  2F97 A;  4Q8R A;  3LV0 A;  4POW A;  4R74 A;  2P2A A;  3U72 A;  2D21 A;  1EYI A;  3RLF E;  1RDY A;  3K6U A;  4IR8 A;  3ZKK A;  2OWT A;  4KYE A;  1GR2 A;  2FIE A;  1A40 A;  2XD2 A;  1B32 A;  2FYI A;  1IEJ A;  2GRV A;  3TTN A;  5CMM A;  3K01 A;  1AH5 A;  2QS2 A;  1FPL A;  3ZKL A;  4JWY A;  3IOV A;  3OO7 A;  5ITO A;  1INP A;  3K4U A;  4XKQ A;  1CB6 A;  2UVI A;  4Q5T A;  4NF4 A;  4OAN A;  2UVH A;  3S9E A;  3K6X A;  2WYK A;  2NVU B;  4Q30 B;  3PV0 E;  3IFA A;  5LTC A;  1YAE A;  4BDL A;  5TPA B;  3IFC A;  4O3A A;  5AA2 B;  4R72 A;  2HXR A;  4ZEI A;  3BFT A;  4MH5 A;  4JB7 A;  3IL1 B;  5AA2 D;  1NNF A;  4GQO A;  5DVI A;  3O28 A;  3KSX A;  2KQZ A;  3MQ9 A;  4LON B;  1Q1K A;  4XKP A;  3TDJ A;  4GBW A;  3TPA A;  1Y1Z A;  3TEP A;  5I57 B;  1A99 A;  3UK4 A;  1Q9D A;  1Y9U A;  3KG2 A;  3TZA A;  3A3U A;  1NV5 A;  3TTL A;  2V93 A;  3M3F A;  1QUK A;  3ROJ A;  3OXN A;  2XXW A;  1AOV A;  4FEC A;  3RYD A;  2QJE A;  4OMB A;  4JVI A;  3PUX E;  1NUW A;  1B3E A;  3TTK A;  4NE4 A;  4XXU A;  2ALU A;  4ELR A;  4NF8 B;  1D9Q A;  1LFG A;  2VT5 A;  2DVC A;  3MBP A;  1NUY A;  1FPK A;  3CVG A;  2RC9 A;  3MP8 A;  4N4U A;  4NQ8 A;  2H9B A;  3JV9 A;  2XWK A;  4QSD A;  4GWX A;  5FHN A;  4NF5 A;  2O1L A;  4HTG A;  1SD3 A;  4RJZ A;  1VE4 A;  3QYT A;  1UTH A;  1TFA A;  1YTV A;  2GHB A;  1IMA A;  4JWO A;  2P1S A;  3QK6 A;  5L9M A;  3QMF A;  4I1D A;  2QVR A;  3KBR A;  5DEX A;  1MQD A;  4JBZ A;  4ND9 A;  3V89 B;  1D9Y A;  1SW4 A;  3DEL B;  1MY1 A;  3O6G A;  2DSF A;  4U1Z A;  3CFX A;  1IIW A;  5LOM A;  4KPT A;  2F6G A;  3SES A;  3SDF A;  4YIC A;  1O7T A;  3CFZ A;  4FAJ A;  2CZH A;  3PMW A;  4OVT A;  4YKJ A;  1R9Q A;  2D3I A;  4P56 A;  5IM2 A;  3T96 B;  4YKI A;  3RPW A;  4LQ5 A;  4OVP A;  1MXX A;  1PB7 A;  4OVS A;  4X48 A;  4NGU A;  1MPB A;  2ZXT A;  1OLA A;  4KCD A;  4NF5 B;  2DXR A;  3MJN A;  5LDZ A;  1UTH B;  4AQ4 A;  3RPL A;  3MVY A;  1OQG A;  3HCQ A;  4MX6 A;  3T9H B;  2I3V A;  3QXM A;  4U4X A;  2O7I A;  4F39 A;  1RYO A;  4AB5 A;  1OLC A;  3PUZ E;  4NWC A;  5ITP A;  4MBP A;  2F5X A;  4M1V A;  1H44 A;  3HFU A;  3FBP A;  2DS9 A;  4H6D A;  4F1U A;  2FBP A;  1QVS A;  5FTI A;  4QFK A;  4EXL A;  5ICT A;  3PGF A;  4I8C A;  1B3G A;  1US5 A;  3W15 C;  2YJP A;  4KXP A;  1NL5 A;  2NOO A;  2QSX A;  2B4M A;  2ZYM A;  1FRP A;  5L8D A;  1BIY A;  1YXI A;  3RTW B;  2HEU A;  4NF0 A;  3OO8 A;  2VGQ A;  3K1M A;  4QHQ A;  4QSE A;  4X9T A;  2FHY A;  3G3G A;  4F2O A;  3PUW E;  2REJ A;  3OD7 A;  3SEW A;  5DT6 A;  4YZZ A;  2OLB A;  1IQ7 A;  3PUV E;  2ZZX A;  4F22 A;  2ONK E;  1KWH A;  4LAT A;  4GF8 A;  2OJT A;  1MXY A;  4WXJ A;  5EQ7 A;  5B7D A;  3TEL A;  2FIX A;  3OOA A;  3PD9 A;  2O7U A;  4Z0I A;  4LZ5 A;  3O6H A;  3FD3 A;  2ONR A;  3Q29 A;  5CI5 A;  4U22 A;  4N6P A;  5J16 A;  2HPG A;  2QPQ A;  2Q9T A;  4QRZ A;  4I40 A;  3FAT A;  2I48 A;  3I5O A;  1XC1 A;  5CMC A;  4F31 B;  1MY0 A;  3SER A;  3HPI A;  2G93 A;  4R6H A;  1EYK A;  1K9Z A;  4P3L A;  4HE2 A;  4F1V A;  3HHG A;  2AYS A;  1LBZ A;  2B4L A;  2PCR A;  5M2V A;  4NF6 A;  4F3P A;  4OHN A;  1MRP A;  4G2Z A;  4ZED A;  2PVU A;  5TU0 A;  4ZDM A;  3KJ7 A;  3U92 A;  2AL5 A;  4H46 A;  2KLF A;  2NWJ A;  4F3B A;  1USY E;  1NV7 A;  1LBB A;  3MWB A;  3O2A A;  2XXH A;  5I5P A;  1NKX A;  2HQ0 A;  3V8X B;  1R6Z A;  3T9V A;  4RYA A;  2CZK A;  2O6A A;  3G3F A;  4PFT A;  3U93 A;  2Q2C A;  1MY4 A;  1JW5 A;  4BDQ A;  4YB6 A;  1IME A;  1AL3 A;  4X8R A;  2UXA A;  2I49 A;  2QMX A;  4E0W A;  4R6Y A;  4EQ7 A;  1XS5 A;  3KZG A;  4C0R A;  3TUS A;  2X26 A;  1JNF A;  1FPB A;  1NH8 A;  5AA1 A;  2H25 A;  3B50 A;  2B3F A;  1PBP A;  3B7D A;  5JEI A;  3KEI A;  5IKB A;  2O69 A;  3E78 A;  3I6V A;  1P1N A;  1BK4 A;  3BFU A;  4RK2 A;  3SEV A;  4DXB A;  1B1H A;  3H3G A;  3KOS A;  1TWY A;  4JVD A;  2ANJ A;  1FQF A;  4ZE8 A;  1POT A;  4GX3 A;  2A5T A;  4YAH X;  2F35 A;  1IXG A;  5HPQ A;  3BIG A;  3LUZ A;  1P1U A;  4GOT A;  3VV5 A;  5DYH A;  1CE2 A;  1NI9 A;  4XTC Q;  4R6K A;  1N76 A;  3T22 A;  3T9X B;  4MCO A;  3FJ7 A;  5A5X A;  3FXR A;  3S9L C;  4PE5 B;  1QGX A;  3RQT A;  3IO4 A;  1FPJ A;  4IY6 A;  5I2N A;  1GTK A;  2MKZ A;  5EQ8 A;  4RA1 A;  4F18 A;  2RIN A;  1SW5 A;  1LBX A;  5AA4 B;  5ELV A;  4FEB A;  3PPN A;  3K00 A;  4YU0 A;  1LCT A;  1T0K A;  3FXU A;  5H8Q B;  4ZZA A;  4DXC A;  2V3T A;  5CMB A;  4F3S A;  4GX6 A;  4DCX A;  4OTE A;  2IEE A;  3O66 A;  3USD A;  4MEV A;  1B0H A;  2ZZW A;  3EKI A;  2ESN A;  1EZP A;  3L6G A;  3GBA A;  3TTM A;  1P99 A;  1UTB B;  3G3I A;  1QKA A;  4PE3 A;  2Z23 A;  1LCF A;  5F1Q A;  2QS4 A;  4LQ2 A;  3LSL A;  2DVZ A;  4O3B A;  3GBB A;  4U4S A;  3QUF A;  4N07 A;  1L5T A;  3VDF A;  3S9N C;  2WBD A;  5HBC A;  3HHF A;  1B52 A;  1S9T A;  4LUB A;  3FVK A;  3IK6 B;  1ZU0 A;  3LSW A;  4R75 A;  1QJM A;  2XWO A;  3G7W A;  4GWW A;  3CHG A;  2I58 A;  1Y4C A;  4GVO A;  4PFY A;  4PAK A;  4PFW A;  4G8M A;  2HAU A;  2OCU A;  3ILT B;  4RXL A;  1QUJ A;  2A5S A;  1FTO A;  4G68 B;  5I57 A;  3C4M A;  4G8H A;  4M4G A;  2XXX A;  3ZS6 A;  4AS4 A;  1DOT A;  1LBW A;  4JSD A;  4HXV A;  1MDP 1;  3UA8 A;  3K1N A;  4ZS9 A;  3E79 A;  2Y7K A;  1I6B A;  2DOJ A;  2OX3 A;  4FOR A;  2R6G E;  4NF8 A;  4ELP A;  4RPO A;  4ONY A;  4IO3 A;  4H1X A;  3VVE A;  1DMB A;  3IJO B;  1B7U A;  4N8G A;  1EZO A;  3T66 A;  1SQY A;  2AIX A;  3MW0 A;  1LAX A;  1B5I A;  3T1B A;  3RN8 A;  4GWY A;  3IB1 A;  5AA3 A;  2PFZ A;  1I6A A;  5H8S A;  3OMB A;  4OFJ A;  3L6H A;  3Q25 A;  4IO4 A;  1M5B A;  3EHU A;  1D4N A;  3FV1 A;  5CM6 A;  2PBW A;  1VSO A;  5I3S A;  1QUI A;  2E0S A;  2XD3 A;  4OA4 A;  2VHA A;  4OQO A;  1RKM A;  4NAP A;  3RGY A;  1ATG A;  3C35 A;  4XKN A;  2H5Y A;  3TYH A;  3O6I A;  1FTJ A;  2W7Y A;  3N5L A;  2UVG A;  4GL0 A;  3KBZ A;  2B65 A;  2G29 A;  5H8F B;  3MP1 A;  2XA5 A;  5KCJ A;  5KZT A;  3JZJ A;  2QVV A;  1BTJ A;  3MPK A;  4N15 A;  4WKM A;  1NV6 A;  3PMV A;  4RPN A;  3JYR A;  3PUY E;  4GBV A;  2HXW A;  4MMP A;  4N17 A;  1UIU A;  3IB0 A;  5IZ3 B;  3DP6 A;  1JVX A;  1PDA A;  3U1O A;  5FTH A;  2XWI A;  2VOZ A;  4HW8 A;  5JTY A;  1N7W A;  4NN3 A;  4YMA A;  4O94 A;  1O64 A;  1MH4 A;  3DM0 A;  2ZMB A;  5HM4 B;  1DTZ A;  3OSR A;  5CBS A;  4PFU A;  3VFJ A;  4H8J A;  2Y7W A;  1PB8 A;  1NV4 A;  1QUL A;  1GV8 A;  3DP4 A;  5KDT B;  4IY5 A;  2F7C A;  2HZK A;  2ZYO A;  4LP2 B;  2XXI A;  3O97 A;  2OK2 A;  1R9L A;  4ZEK A;  4F29 A;  3TQL A;  1LEV A;  2NXO A;  3C31 A;  4MLQ A;  2REG A;  5KCJ B;  4MAG A;  2GHA A;  1FTK A;  2VP1 A;  1B5J A;  5F7V A;  4RNS A;  2QS1 A;  5DVJ A;  2RC8 A;  1H43 A;  3B6W A;  1MXZ A;  4YKP A;  3IOR A;  3PD8 A;  1LAF E;  3TOD A;  1MY2 A;  4NTL A;  1P1Q A;  4TOZ A;  4IB2 A;  4YB7 A;  5JTY B;  1II5 A;  1A8E A;  3N6T A;  4XKR A;  5B70 A;  4MNI A;  1YZ0 A;  3MUQ A;  1N0T A;  3IAZ A;  1TXF A;  2O1M A;  2WYP A;  2OWS A;  3CRB A;  3ONM A;  3N26 A;  1FQD A;  2PT1 A;  3GYY A;  1N7X A;  4H5G A;  4GIZ A;  2VD2 A;  4BDN A;  1K9Y A;  4UAB A;  1ZLQ A;  2OWZ A;  4H65 A;  1FBF A;  1M5F A;  3T0J A;  3MYU A;  4TLL B;  2H4I A;  1D3K A;  3HV1 A;  3R6U A;  5EYF A;  4HE0 A;  3BIH A;  4LVQ A;  3U8Q A;  1USY H;  4PET A;  3KN7 A;  2H98 A;  3E4R A;  2CEY A;  3UN6 A;  1Y3N A;  3CR9 A;  3C34 A;  3QUJ A;  1B2H A;  3FXQ A;  3UIF A;  1SDX A;  4KQP A;  3EN3 A;  2F7B A;  2VPN A;  4KFQ A;  4DI3 D;  1MS7 A;  1XHY A;  3OEL A;  3ILU B;  3MZ1 A;  1Y1M A;  5A5L A;  1G0I A;  1B4Z A;  2XX9 A;  1N3W A;  1B05 A;  3PTY A;  2FVZ A;  1JET A;  2I0C A;  5DVF A;  4KCC A;  3H6V A;  3H6T A;  4NX1 A;  1NFT A;  4BDM A;  2DE3 A;  3H6U A;  4XFE A;  1B6H A;  3PPR A;  3GLB A;  4HCW A;  1CNQ A;  1B9J A;  1A55 A;  5EHM A;  1H45 A;  4RY1 A;  4AS5 A;  1MDQ A;  1F9B A;  4DIG A;  3SET A;  1J1N A;  1LB8 A;  1YPN A;  4XIG Q;  1PEB A;  2O84 X;  4N81 A;  1B0L A;  4OZ9 A;  4PGP A;  4F1Y A;  3PPQ A;  4ELQ A;  2Y84 A;  3MVW A;  2PX1 A;  1NNK A;  2DP8 A;  4I9D A;  1Z7M E;  3GXA A;  1EZ9 A;  4DZ1 A;  2XHD A;  3M3K A;  4PBH A;  1S7Y A;  4O8M A;  3EQ1 A;  4HS7 A;  4ISU A;  4LZ8 A;  2WX9 A;  4OES A;  1HSJ A;  5DW8 A;  1Y3P A;  3RT8 A;  3C9H A;  5H8H B;  2Q89 A;  1PC3 A;  2Q2A A;  4FBP A;  2F7A A;  1LAH E;  3M3L A;  4ECF A;  2HHM A;  3FZV A;  3IR1 A;  4OFL A;  1FQE A;  3CG1 A;  4IO5 A;  3DLN A;  1IZ1 A;  5I56 A;  3IB2 A;  2DDK A;  4JXI A;  5ET8 A;  1AMF A;  3FXB A;  4H45 A;  4ZE9 A;  4OET A;  1A54 A;  3K6V A;  4OER A;  1IXH A;  4YMB A;  1FW0 A;  1RYX A;  3MP6 A;  1B1X A;  2UVJ A;  1NV0 A;  4LN5 A;  3QSL A;  2OZZ A;  3TFL A;  5FBP A;  4GWZ A;  4ZEB A;  4G8N A;  3IOW A;  3NOH A;  1Y20 A;  3T9U A;  4JDF A;  5T3J A;  1HSE A;  5AA4 A;  1MM7 A;  1HSL A;  3MVZ A;  2DWA A;  4H8I A;  1AWB A;  3TQW A;  3MVX A;  4PCD A;  4P9K A;  5H8Q A;  4F19 A;  5K2X A;  3E9X A;  4OFO A;  4N8Y A;  2XXT A;  1ELJ A;  1N3X A;  4OVJ A;  4QBA A;  2ZYK A;  1P1O A;  1FPG A;  2WEF A;  3O29 A;  2THI A;  2F36 A;  4DE8 A;  3FVG A;  3MAM A;  1LBY A;  4F3G A;  4N13 A;  4ZEF A;  2XXQ A;  3OEN A;  5ET6 A;  2XWV A;  1DK4 A;  5I59 B;  2JJK A;  3LBS A;  1UTB A;  2Y7I A;  1OVB A;  3KC0 A;  1OVT A;  4R9F A;  5L9O A;  2DQV A;  4N6D A;  2PYY A;  5I56 B;  3D4G A;  2XXK A;  4ELO A;  4EF1 A;  1BLF A;  1FBD A;  1MQI A;  3ZSF A;  2ZZV A;  1WVJ A;  4UA8 A;  5J1D A;  2F3D A;  4MF3 A;  1FBG A;  5CBR A;  4PDD A;  1DPE A;  1ZKB A;  3H06 B;  3B6T A;  3MPL A;  1XVY A;  4GLI A;  4X1D A;  2RCB A;  3FV2 A;  3TMG A;  1LGB C;  5ET7 A;  5ESY A;  2X7P A;  4U21 A;  3VE1 B;  1VR5 A;  1NNP A;  2PMS A;  2P0S A;  1B7Z A;  4I3Y A;  3UOR A;  4XF5 A;  2R8T A;  5TP9 A;  1ANF A;  4PQJ A;  3TCH A;  3EF7 A;  1LFI A;  4G68 A;  1LB9 A;  1EH3 A;  3FUZ A;  1B58 A;  3VVD A;  2RCA A;  3O9P A;  1MXV A;  4JWX A;  1JW4 A;  1POY 1;  1LBC A;  4DDD A;  4P0G A;  2DWJ A;  5EYH A;  1UQW A;  4MLV A;  2DXY A;  3K6W A;  1LLS A;  4L17 A;  3QAX A;  3VVF A;  1N04 A;  4BDO A;  4GD5 A;  2UYF A;  4EXK A;  4JVC A;  4OYV A;  4KD5 A;  1LBV A;  3VLV A;  4F2Q A;  3FIR A;  4NWD A;  4C1U A;  1NUX A;  4FAT A;  1FTA A;  4I3E A;  3ISP A;  2HAV A;  3WAE A;  2Z8F A;  1URD A;  2QFL A;  3DP8 A;  1RDX A;  3P7I A;  2F3B A;  2V3Q A;  1FBP A;  2DE2 A;  4JSO A;  5TP9 B;  3VXC A;  2XXV A;  4PFI A;  4R73 A;  3OO9 A;  4N6K A;  2DWH A;  4KYS A;  4YKK A;  2E1S A;  1N84 A;  1O63 A;  1JVY A;  2XXY A;  3S2V A;  5EYG A;  4G61 A;  4DCY A;  1Y4T A;  2Q8J A;  4MIJ A;  3IJX B;  2HCA A;  2RF1 A;  5H8F A;  1GGG A;  2V84 A;  5I58 B;  4MJO A;  3LR1 A;  3E13 X;  1FCK A;  2P3V A;  4NHB A;  3UGW A;  1M5C A;  1SYH A;  3KC1 A;  2V3U A;  3EHT A;  4KYD A;  1QW0 A;  3KN8 A;  4OWD A;  4PAI A;  3SZP A;  4FIM A;  1FQC A;  4G4P A;  5IZ3 A;  4PF6 A;  3V5A A;  2I3W A;  2UYE A;  4LZ7 A;  4TQU Q;  1B51 A;  3M8U A;  1KA1 A;  1QKB A;  1ZMG A;  5EHS A;  2DWI A;  4N91 A;  4EUO A;  2VD3 A;  3GZG A;  4PFR A;  3VLU A;  5AE4 A;  4EF2 A;  1FTM A;  2GQ1 A;  3Q28 A;  5FHO A;  2XXR A;  5DTB A;  3U65 A;  1RDZ A;  5KDT A;  5FHM A;  5CRY A;  4IGR A;  1XVX A;  4EQB A;  3MZ9 A;  4DXU A;  1A7L A;  4R9G A;  1BKA A;  1WOD A;  1XT8 A;  4MHF A;  1JW1 A;  4OVR A;  4P47 A;  4P1E A;  1NV1 A;  2X7Q A;  4HCY A;  4ZZE A;  1URS A;  4MNP A;  4THI A;  3ECR A;  1FJ6 A;  2OBG A;  2QVU A;  2XXP A;  1MQH A;  4O7M A;  3KJT A;  4LA9 A;  1EYJ A;  4NF4 B;  2H99 A;  4U23 A;  4PP0 A;  3CI8 A;  1OMP A;  4OEU A;  5ICQ A;  1DSN A;  3C32 A;  4IO7 A;  3KGC A;  3R7X A;  1D9V A;  1NH7 A;  4OEN A;  4EQ9 A;  1B3L A;  3N6U A;  5ET5 A;  1SW2 A;  1FBE A;  2FA7 A;  1NUZ A;  4PAF A;  2F78 A;  4KHZ E;  1B40 A;  2F34 A;  1MXW A;  5EQ9 A;  2V4C A;  4ESX A;  3K2D A;  3RY3 A;  3TCF A;  1NV3 A;  1I6Q A;  4PF8 A;  4E0X A;  4BDR A;  4Z7E A;  1JEV A;  1IMD A;  3OEK A;  1DTG A;  1FSA A;  2Z22 A;  4P8B A;  1MPC A;  2Z8D A;  1YCJ A;  4QFP A;  2ZYN A;  2GFE A;  2I4C A;  2I4B A;  3VLW A;  2F6P A;  4ESW A;  5EQA A;  3HN0 A;  2I0B A;  4MFI A;  3IOT A;  3PU5 A;  3TAJ A;  1IMC A;  2QRY A;  1JQF A;  5CMK A;  3A3C A;  4G77 A;  3F11 A;  3SEX A;  4U1O A;  3W9W A;  3KOT A;  4POX A;  2V25 A;  5H8N A;  1TFD A;  5IZZ A;  3UP9 A;  1FPD A;  3B8B A;  4FJP A;  3Q27 A;  1MPD A;  3EPE A;  2Y5K A;  1B7H A;  5BWJ A;  2BJJ X;  2R9J A;  3CSG A;  1DCU A;  3E3K A;  1GVC A;  3RT6 B;  1UIV A;  4BLA A;  5DEX B;  3EHS A;  4GRK A;  3I3V A;  3MST A;  4Q0C A;  3BBR A;  3FVO A;  2P3N A;  1FPI A;  1B5H A;  4YB5 A;  1ZJL A;  3H6W A;  1Z7N E;  3H7M A;  2Q74 A;  4QXD A;  2I6E A;  2LAO A;  1FBH A;  1M5E A;  1IXC A;  3H03 A;  2D5W A;  3K1P A;  1VFE A;  3CSB A;  3V83 A;  5L9S A;  3FAS A;  2WBB A;  3IO6 A;  4PDH A;  2ONS A;  4R2F A;  1PB9 A;  1B3F A;  1FJ9 A;  1ZIU A;  3TKD A;  5H8H A;  2YLN A;  3ODB A;  5JK4 A;  1B46 A;  1Y3Q A;  2ZNT A;  4PFB A;  3Q26 A;  1I69 A;  4RK9 A;  1NV2 A;  3SEU A;  5H8N B;  3OEM A;  4QFL A;  3CFL A;  4H5F A;  1IMB A;  1FTL A;  1MQG A;  3RPL B;  4P0I A;  3RUM A;  4MNC A;  3FJG A;  2O51 A;  1ZBM A;  2Y5L A;  4PTK A;  3THI A;  3R26 A;  1BP5 A;  1JP4 A;  3VXB A;  1VDW A;  1P1W A;  2O68 A;  1LST A;  4HE1 A;  1LAG E;  1MY3 A;  3KFM A;  1XI6 A;  4QSC A;  1KZ8 A;  3G3K A;  3RNN A;  4PGN A;  3PMX A;  4GXS B;  4NED A;  1TT1 A;  4FED A;  3LUY A;  1US4 A;  1KA0 A;  2HFB A;  3LSF B;  1IUD A;  2XXU A;  4NG7 A;  4PBQ A;  2RC7 A;  4IO2 A;  4OVQ A;  2QS3 A;  1MXU A;  3AXF A;  1PBQ A;  3IOU A;  2KR0 A;  3PPP A;  5K2Y A;  1SBP A;  2M8C A;  3B6Q A;  3HST A;  5BUU A;  5ISU A;  5I59 A;  4WEP A;  1XOC A;  4QFO A;  4GWO A;  4XEQ A;  4GXA A;  1MG1 A;  4C1T A;  1OQH A;  3FGS A;  3TCG A;  3S9M C;  5I7I A;  3K02 A;  4NMY A;  1IIT A;  4I62 A;  4P1L A;  2F8D A;  2RKM A;  2Q88 A;  1SI0 A;  3FVN A;  2B3B A;  2YPN A;  1OIB A;  1Q35 A;  4OXV A;  2DYX A;  4IGT A;  4FE8 A;  4WED A;  2AL4 A;  3W9V A;  3G3J A;  1EU8 A;  1SVX B;  4K3F A;  3KSJ A;  5I2K A;  1S50 A;  1JEU A;  3K0V A;  1LFH A;  5CC2 A;  1M5D A;  1WDN A;  1A8F A;  2VPO A;  4H0W A;  3SEY A;  4U2R A;  2QMW A;  2ABH A;  3TTR A;  4UAC A;  2NUV A;  5I84 A;  1B4H A;  4NF6 B;  4EDP A;  3CG3 A;  3KN3 A;  1MH3 A;  4KI0 E;  1IMF A;  1G0H A;  4AB6 A;  3FJM A;  3A09 A;  3T93 B;  3IX1 A;  3G3H A;  1FQA A;  3MZB A;  4ZEC A;  4GWU A;  4X04 A;  4X1B A;  4GX4 A;  4PC9 A;  3WAF A;  1FPE A;  2ZNU A; 
#chains in the Genus database with same CATH homology
 1URG A;  3PPO A;  1ZTY A;  1SI1 A;  3OSQ A;  2CMO A;  4KR5 A;  3LC8 A;  4GL8 A;  5I2K B;  2HZL A;  1DPP A;  4G68 C;  1MQJ A;  3SKP A;  2PT2 A;  2XX8 A;  3QIM A;  4TLM B;  3U94 A;  1SYI A;  3MC2 A;  1NNT A;  2IA4 A;  2Y7R A;  4R2B A;  2ZNS A;  2DE4 A;  3D4C A;  2R71 A;  4GFR A;  1SW1 A;  3LSX A;  5I58 A;  1NMU A;  1FQB A;  3C33 A;  4IO6 A;  4P11 A;  2WKY A;  2XX7 A;  1IXI A;  2A5T B;  1R1N A;  4QF9 A;  5IAI A;  3S4U A;  3C36 A;  1AIV A;  4OEV A;  3N94 A;  4H67 A;  1H3D A;  2QL3 A;  3H4Z A;  2GH9 A;  3RTF B;  4DLD A;  2Z8E A;  2Y7P A;  3CIJ A;  1H76 A;  3OO6 A;  5A5X B;  2CZL A;  5TPA A;  3BKI B;  1VFD A;  5I2N B;  5AA2 A;  3HO7 A;  1B3H A;  4O3C A;  2FNC A;  4QFN A;  1MM6 A;  2F97 A;  4Q8R A;  4POW A;  4R74 A;  2P2A A;  3U72 A;  2D21 A;  3RLF E;  3K6U A;  3ZKK A;  2OWT A;  4KYE A;  1GR2 A;  1A40 A;  2XD2 A;  1B32 A;  2FYI A;  1IEJ A;  2GRV A;  3TTN A;  5CMM A;  3K01 A;  1AH5 A;  2QS2 A;  3ZKL A;  4JWY A;  3IOV A;  3OO7 A;  5ITO A;  3K4U A;  4XKQ A;  1CB6 A;  2UVI A;  4Q5T A;  4NF4 A;  2UVH A;  3S9E A;  3K6X A;  2NVU B;  4Q30 B;  3PV0 E;  1YAE A;  4BDL A;  5TPA B;  4O3A A;  5AA2 B;  4R72 A;  4ZEI A;  3BFT A;  4MH5 A;  4JB7 A;  3IL1 B;  5AA2 D;  1NNF A;  4GQO A;  5DVI A;  3O28 A;  3KSX A;  3MQ9 A;  4LON B;  1Q1K A;  4XKP A;  3TDJ A;  3TPA A;  1Y1Z A;  3TEP A;  5I57 B;  1A99 A;  3UK4 A;  1Y9U A;  3KG2 A;  3TZA A;  3A3U A;  3TTL A;  2V93 A;  3M3F A;  1QUK A;  3OXN A;  2XXW A;  1AOV A;  4FEC A;  2QJE A;  4OMB A;  3PUX E;  1B3E A;  3TTK A;  4NE4 A;  4XXU A;  2ALU A;  4ELR A;  4NF8 B;  1LFG A;  2DVC A;  3MBP A;  3CVG A;  2RC9 A;  3MP8 A;  2H9B A;  3JV9 A;  4QSD A;  5FHN A;  4NF5 A;  2O1L A;  4HTG A;  1SD3 A;  4RJZ A;  1VE4 A;  3QYT A;  1UTH A;  1TFA A;  1YTV A;  2GHB A;  4JWO A;  2P1S A;  3QK6 A;  5L9M A;  4I1D A;  3KBR A;  5DEX A;  1MQD A;  4JBZ A;  4ND9 A;  3V89 B;  1D9Y A;  1SW4 A;  3DEL B;  1MY1 A;  3O6G A;  2DSF A;  4U1Z A;  3CFX A;  1IIW A;  5LOM A;  4KPT A;  2F6G A;  3SES A;  3SDF A;  4YIC A;  1O7T A;  3CFZ A;  4FAJ A;  3PMW A;  4YKJ A;  1R9Q A;  2D3I A;  3T96 B;  4YKI A;  3RPW A;  4LQ5 A;  1MXX A;  1PB7 A;  4X48 A;  1MPB A;  2ZXT A;  1OLA A;  4KCD A;  4NF5 B;  2DXR A;  3MJN A;  1UTH B;  4AQ4 A;  3MVY A;  1OQG A;  3HCQ A;  3T9H B;  2I3V A;  3QXM A;  4U4X A;  2O7I A;  4F39 A;  1RYO A;  4AB5 A;  1OLC A;  3PUZ E;  4NWC A;  5ITP A;  4MBP A;  2F5X A;  4M1V A;  1H44 A;  2DS9 A;  4H6D A;  4F1U A;  1QVS A;  5FTI A;  4QFK A;  4EXL A;  5ICT A;  3PGF A;  4I8C A;  1B3G A;  1US5 A;  3W15 C;  2YJP A;  1NL5 A;  2NOO A;  2QSX A;  2ZYM A;  5L8D A;  1BIY A;  3RTW B;  2HEU A;  3OO8 A;  2VGQ A;  3K1M A;  4QHQ A;  4QSE A;  4X9T A;  3G3G A;  4F2O A;  3PUW E;  2REJ A;  3OD7 A;  3SEW A;  5DT6 A;  4YZZ A;  2OLB A;  1IQ7 A;  3PUV E;  4F22 A;  2ONK E;  1KWH A;  4LAT A;  4GF8 A;  2OJT A;  1MXY A;  4WXJ A;  5B7D A;  3TEL A;  3OOA A;  3PD9 A;  2O7U A;  4Z0I A;  4LZ5 A;  3O6H A;  3FD3 A;  2ONR A;  3Q29 A;  5CI5 A;  4U22 A;  4N6P A;  2QPQ A;  2Q9T A;  4QRZ A;  3FAT A;  2I48 A;  3I5O A;  1XC1 A;  5CMC A;  4F31 B;  1MY0 A;  3SER A;  3HPI A;  2G93 A;  4R6H A;  4F1V A;  3HHG A;  2AYS A;  5M2V A;  4NF6 A;  4F3P A;  4OHN A;  1MRP A;  4G2Z A;  4ZED A;  2PVU A;  5TU0 A;  4ZDM A;  3KJ7 A;  3U92 A;  2AL5 A;  2KLF A;  2NWJ A;  4F3B A;  1USY E;  1LBB A;  3MWB A;  3O2A A;  2XXH A;  1NKX A;  2HQ0 A;  3V8X B;  1R6Z A;  3T9V A;  4RYA A;  2O6A A;  3G3F A;  4PFT A;  3U93 A;  2Q2C A;  1MY4 A;  1JW5 A;  4BDQ A;  4YB6 A;  1AL3 A;  2UXA A;  2I49 A;  2QMX A;  4E0W A;  4R6Y A;  4EQ7 A;  1XS5 A;  3KZG A;  4C0R A;  3TUS A;  2X26 A;  1JNF A;  1NH8 A;  5AA1 A;  2H25 A;  2B3F A;  1PBP A;  3B7D A;  5JEI A;  3KEI A;  5IKB A;  2O69 A;  3I6V A;  1P1N A;  3BFU A;  4RK2 A;  3SEV A;  4DXB A;  1B1H A;  3H3G A;  3KOS A;  1TWY A;  2ANJ A;  1FQF A;  4ZE8 A;  1POT A;  2A5T A;  4YAH X;  2F35 A;  1IXG A;  5HPQ A;  1P1U A;  4GOT A;  3VV5 A;  5DYH A;  1CE2 A;  4XTC Q;  4R6K A;  1N76 A;  3T22 A;  3T9X B;  3FJ7 A;  5A5X A;  3FXR A;  3S9L C;  4PE5 B;  3RQT A;  3IO4 A;  4IY6 A;  5I2N A;  1GTK A;  4RA1 A;  4F18 A;  2RIN A;  1SW5 A;  5AA4 B;  5ELV A;  4FEB A;  3PPN A;  3K00 A;  4YU0 A;  1LCT A;  1T0K A;  3FXU A;  5H8Q B;  4ZZA A;  4DXC A;  2V3T A;  5CMB A;  4F3S A;  4DCX A;  4OTE A;  2IEE A;  3O66 A;  3USD A;  1B0H A;  2ESN A;  1EZP A;  3L6G A;  3GBA A;  3TTM A;  1P99 A;  1UTB B;  3G3I A;  1QKA A;  2Z23 A;  1LCF A;  5F1Q A;  2QS4 A;  4LQ2 A;  3LSL A;  2DVZ A;  4O3B A;  3GBB A;  4U4S A;  3QUF A;  4N07 A;  1L5T A;  3VDF A;  3S9N C;  5HBC A;  3HHF A;  1B52 A;  1S9T A;  4LUB A;  3FVK A;  3IK6 B;  1ZU0 A;  3LSW A;  4R75 A;  1QJM A;  3G7W A;  2I58 A;  1Y4C A;  4GVO A;  4PFY A;  4PFW A;  4G8M A;  2HAU A;  2OCU A;  3ILT B;  4RXL A;  1QUJ A;  2A5S A;  1FTO A;  4G68 B;  5I57 A;  3C4M A;  4G8H A;  4M4G A;  2XXX A;  3ZS6 A;  1DOT A;  4JSD A;  1MDP 1;  3UA8 A;  3K1N A;  4ZS9 A;  2Y7K A;  1I6B A;  2DOJ A;  4FOR A;  2R6G E;  4NF8 A;  4ELP A;  4RPO A;  4ONY A;  4IO3 A;  4H1X A;  3VVE A;  1DMB A;  3IJO B;  1B7U A;  1EZO A;  3T66 A;  1SQY A;  2AIX A;  3MW0 A;  1LAX A;  1B5I A;  3RN8 A;  3IB1 A;  5AA3 A;  1I6A A;  5H8S A;  3OMB A;  4OFJ A;  3L6H A;  3Q25 A;  4IO4 A;  1M5B A;  3EHU A;  1D4N A;  3FV1 A;  5CM6 A;  2PBW A;  1VSO A;  1QUI A;  2E0S A;  2XD3 A;  2VHA A;  4OQO A;  1RKM A;  3RGY A;  1ATG A;  3C35 A;  4XKN A;  2H5Y A;  3TYH A;  3O6I A;  1FTJ A;  2W7Y A;  3N5L A;  2UVG A;  4GL0 A;  2B65 A;  2G29 A;  5H8F B;  3MP1 A;  5KCJ A;  5KZT A;  3JZJ A;  1BTJ A;  3MPK A;  4WKM A;  3PMV A;  4RPN A;  3JYR A;  3PUY E;  2HXW A;  1UIU A;  3IB0 A;  3DP6 A;  1JVX A;  1PDA A;  3U1O A;  5FTH A;  2VOZ A;  4HW8 A;  5JTY A;  1N7W A;  4YMA A;  1O64 A;  1MH4 A;  3DM0 A;  2ZMB A;  5HM4 B;  1DTZ A;  3OSR A;  5CBS A;  4PFU A;  3VFJ A;  4H8J A;  2Y7W A;  1PB8 A;  1QUL A;  1GV8 A;  3DP4 A;  5KDT B;  4IY5 A;  2F7C A;  2HZK A;  2ZYO A;  4LP2 B;  2XXI A;  3O97 A;  2OK2 A;  1R9L A;  4ZEK A;  4F29 A;  3TQL A;  2NXO A;  3C31 A;  4MLQ A;  2REG A;  5KCJ B;  2GHA A;  1FTK A;  2VP1 A;  1B5J A;  5F7V A;  4RNS A;  2QS1 A;  5DVJ A;  2RC8 A;  1H43 A;  3B6W A;  1MXZ A;  4YKP A;  3IOR A;  3PD8 A;  1LAF E;  3TOD A;  1MY2 A;  4NTL A;  1P1Q A;  4TOZ A;  4IB2 A;  4YB7 A;  5JTY B;  1II5 A;  1A8E A;  3N6T A;  4XKR A;  5B70 A;  3MUQ A;  1N0T A;  3IAZ A;  1TXF A;  2O1M A;  2OWS A;  3CRB A;  3ONM A;  3N26 A;  1FQD A;  2PT1 A;  1N7X A;  4H5G A;  4GIZ A;  2VD2 A;  4BDN A;  1ZLQ A;  4H65 A;  1M5F A;  4TLL B;  2H4I A;  1D3K A;  3HV1 A;  3R6U A;  5EYF A;  4LVQ A;  3U8Q A;  1USY H;  4PET A;  3KN7 A;  2H98 A;  3E4R A;  3UN6 A;  1Y3N A;  3CR9 A;  3C34 A;  3QUJ A;  1B2H A;  3FXQ A;  3UIF A;  1SDX A;  4KQP A;  3EN3 A;  2F7B A;  4KFQ A;  1MS7 A;  1XHY A;  3OEL A;  3ILU B;  3MZ1 A;  1Y1M A;  1B4Z A;  2XX9 A;  1N3W A;  1B05 A;  1JET A;  2I0C A;  5DVF A;  4KCC A;  3H6V A;  3H6T A;  1NFT A;  4BDM A;  2DE3 A;  3H6U A;  1B6H A;  3PPR A;  3GLB A;  4HCW A;  1B9J A;  1A55 A;  5EHM A;  1H45 A;  4RY1 A;  1MDQ A;  1F9B A;  4DIG A;  3SET A;  1J1N A;  1LB8 A;  1YPN A;  4XIG Q;  1PEB A;  2O84 X;  1B0L A;  4OZ9 A;  4F1Y A;  3PPQ A;  4ELQ A;  2Y84 A;  3MVW A;  2PX1 A;  1NNK A;  2DP8 A;  4I9D A;  1Z7M E;  3GXA A;  1EZ9 A;  4DZ1 A;  2XHD A;  3M3K A;  1S7Y A;  3EQ1 A;  4HS7 A;  4ISU A;  4LZ8 A;  4OES A;  1HSJ A;  1Y3P A;  3RT8 A;  3C9H A;  5H8H B;  2Q89 A;  1PC3 A;  2Q2A A;  2F7A A;  1LAH E;  3M3L A;  4ECF A;  3FZV A;  3IR1 A;  4OFL A;  1FQE A;  3CG1 A;  4IO5 A;  3DLN A;  1IZ1 A;  5I56 A;  3IB2 A;  4JXI A;  1AMF A;  4ZE9 A;  4OET A;  1A54 A;  3K6V A;  4OER A;  1IXH A;  4YMB A;  1FW0 A;  1RYX A;  3MP6 A;  1B1X A;  2UVJ A;  3QSL A;  2OZZ A;  3TFL A;  4ZEB A;  4G8N A;  3IOW A;  1Y20 A;  3T9U A;  4JDF A;  1HSE A;  5AA4 A;  1MM7 A;  1HSL A;  3MVZ A;  2DWA A;  4H8I A;  3TQW A;  3MVX A;  5H8Q A;  4F19 A;  5K2X A;  3E9X A;  4OFO A;  2XXT A;  1ELJ A;  1N3X A;  4OVJ A;  2ZYK A;  1P1O A;  3O29 A;  2THI A;  2F36 A;  4DE8 A;  3FVG A;  3MAM A;  4F3G A;  4N13 A;  4ZEF A;  2XXQ A;  3OEN A;  5I59 B;  3LBS A;  1UTB A;  2Y7I A;  1OVB A;  1OVT A;  4R9F A;  5L9O A;  2DQV A;  2PYY A;  5I56 B;  3D4G A;  4ELO A;  4EF1 A;  1BLF A;  1MQI A;  3ZSF A;  1WVJ A;  4UA8 A;  5J1D A;  4MF3 A;  5CBR A;  1DPE A;  1ZKB A;  3H06 B;  3B6T A;  3MPL A;  1XVY A;  4GLI A;  4X1D A;  2RCB A;  3FV2 A;  3TMG A;  1LGB C;  2X7P A;  4U21 A;  3VE1 B;  1VR5 A;  1NNP A;  2PMS A;  2P0S A;  1B7Z A;  3UOR A;  5TP9 A;  1ANF A;  4PQJ A;  3TCH A;  3EF7 A;  1LFI A;  4G68 A;  1LB9 A;  1EH3 A;  3FUZ A;  1B58 A;  3VVD A;  2RCA A;  3O9P A;  1MXV A;  4JWX A;  1JW4 A;  1POY 1;  1LBC A;  4DDD A;  4P0G A;  2DWJ A;  1UQW A;  4MLV A;  2DXY A;  3K6W A;  1LLS A;  4L17 A;  3QAX A;  3VVF A;  1N04 A;  4BDO A;  4GD5 A;  2UYF A;  4EXK A;  4OYV A;  4KD5 A;  3VLV A;  4F2Q A;  3FIR A;  4NWD A;  4C1U A;  4FAT A;  2HAV A;  3WAE A;  2Z8F A;  1URD A;  3DP8 A;  3P7I A;  2V3Q A;  2DE2 A;  4JSO A;  5TP9 B;  3VXC A;  2XXV A;  4R73 A;  3OO9 A;  2DWH A;  4KYS A;  4YKK A;  2E1S A;  1N84 A;  1O63 A;  1JVY A;  2XXY A;  3S2V A;  4DCY A;  1Y4T A;  2Q8J A;  3IJX B;  2HCA A;  2RF1 A;  5H8F A;  1GGG A;  2V84 A;  5I58 B;  3LR1 A;  3E13 X;  1FCK A;  3UGW A;  1M5C A;  1SYH A;  2V3U A;  3EHT A;  4KYD A;  1QW0 A;  3KN8 A;  4OWD A;  4FIM A;  1FQC A;  4G4P A;  3V5A A;  2I3W A;  2UYE A;  4LZ7 A;  4TQU Q;  1B51 A;  3M8U A;  1QKB A;  1ZMG A;  5EHS A;  2DWI A;  4EUO A;  2VD3 A;  3GZG A;  3VLU A;  5AE4 A;  4EF2 A;  1FTM A;  3Q28 A;  5FHO A;  2XXR A;  5DTB A;  5KDT A;  5FHM A;  5CRY A;  4IGR A;  1XVX A;  4EQB A;  3MZ9 A;  4DXU A;  1A7L A;  4R9G A;  1BKA A;  1WOD A;  1XT8 A;  1JW1 A;  2X7Q A;  4HCY A;  4ZZE A;  1URS A;  4THI A;  3ECR A;  2OBG A;  2XXP A;  1MQH A;  3KJT A;  4LA9 A;  4NF4 B;  2H99 A;  4U23 A;  4PP0 A;  3CI8 A;  1OMP A;  4OEU A;  5ICQ A;  1DSN A;  3C32 A;  4IO7 A;  3KGC A;  3R7X A;  1D9V A;  1NH7 A;  4OEN A;  4EQ9 A;  1B3L A;  3N6U A;  1SW2 A;  2FA7 A;  2F78 A;  4KHZ E;  1B40 A;  2F34 A;  1MXW A;  4ESX A;  3K2D A;  3RY3 A;  3TCF A;  1I6Q A;  4E0X A;  4BDR A;  4Z7E A;  1JEV A;  3OEK A;  1DTG A;  2Z22 A;  1MPC A;  2Z8D A;  1YCJ A;  4QFP A;  2ZYN A;  2GFE A;  2I4C A;  2I4B A;  3VLW A;  2F6P A;  4ESW A;  3HN0 A;  2I0B A;  4MFI A;  3IOT A;  3PU5 A;  3TAJ A;  2QRY A;  1JQF A;  5CMK A;  3A3C A;  4G77 A;  3F11 A;  3SEX A;  4U1O A;  3W9W A;  3KOT A;  4POX A;  2V25 A;  5H8N A;  1TFD A;  3UP9 A;  4FJP A;  3Q27 A;  1MPD A;  3EPE A;  1B7H A;  5BWJ A;  2BJJ X;  2R9J A;  3CSG A;  3E3K A;  1GVC A;  3RT6 B;  1UIV A;  4BLA A;  5DEX B;  3EHS A;  4GRK A;  3I3V A;  4Q0C A;  3BBR A;  3FVO A;  1B5H A;  4YB5 A;  1ZJL A;  3H6W A;  1Z7N E;  3H7M A;  2I6E A;  2LAO A;  1M5E A;  1IXC A;  3H03 A;  2D5W A;  3K1P A;  1VFE A;  3CSB A;  3V83 A;  5L9S A;  3FAS A;  3IO6 A;  2ONS A;  4R2F A;  1PB9 A;  1B3F A;  1ZIU A;  3TKD A;  5H8H A;  2YLN A;  3ODB A;  5JK4 A;  1B46 A;  1Y3Q A;  2ZNT A;  3Q26 A;  1I69 A;  4RK9 A;  3SEU A;  5H8N B;  3OEM A;  4QFL A;  3CFL A;  4H5F A;  1FTL A;  1MQG A;  4P0I A;  3RUM A;  3FJG A;  2O51 A;  1ZBM A;  3THI A;  3R26 A;  1BP5 A;  3VXB A;  1P1W A;  2O68 A;  1LST A;  1LAG E;  1MY3 A;  3KFM A;  4QSC A;  3G3K A;  3RNN A;  3PMX A;  4GXS B;  4NED A;  1TT1 A;  4FED A;  3LUY A;  1US4 A;  2HFB A;  3LSF B;  1IUD A;  2XXU A;  2RC7 A;  4IO2 A;  2QS3 A;  1MXU A;  3AXF A;  1PBQ A;  3IOU A;  3PPP A;  5K2Y A;  1SBP A;  2M8C A;  3B6Q A;  3HST A;  5BUU A;  5ISU A;  5I59 A;  4WEP A;  1XOC A;  4QFO A;  4GWO A;  4GXA A;  1MG1 A;  4C1T A;  1OQH A;  3FGS A;  3TCG A;  3S9M C;  3K02 A;  4NMY A;  1IIT A;  4I62 A;  2F8D A;  2RKM A;  2Q88 A;  1SI0 A;  3FVN A;  2B3B A;  2YPN A;  1OIB A;  1Q35 A;  4OXV A;  2DYX A;  4IGT A;  4FE8 A;  4WED A;  2AL4 A;  3W9V A;  3G3J A;  1EU8 A;  1SVX B;  4K3F A;  3KSJ A;  5I2K A;  1S50 A;  1JEU A;  3K0V A;  1LFH A;  5CC2 A;  1M5D A;  1WDN A;  1A8F A;  4H0W A;  3SEY A;  4U2R A;  2QMW A;  2ABH A;  3TTR A;  4UAC A;  2NUV A;  5I84 A;  1B4H A;  4NF6 B;  4EDP A;  3CG3 A;  3KN3 A;  1MH3 A;  4KI0 E;  4AB6 A;  3FJM A;  3A09 A;  3T93 B;  3IX1 A;  3G3H A;  1FQA A;  3MZB A;  4ZEC A;  4X1B A;  3WAF A;  2ZNU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...