3G3FA

Crystal structure of the glur6 ligand binding domain dimer with glutamate and nacl at 1.38 angstrom resolution
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
251
structure length
251
Chain Sequence
NRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKGTPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Glutamate receptor, ionotropic kainate 2
publication title Stability of ligand-binding domain dimer assembly controls kainate receptor desensitization.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 80
structure length 251
sequence length 251
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-02-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3g3fA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3g3fA02
4GOTA 1XOCA 2PYYA 1JEUA 4WKMA 2DXYA 4I8CA 3U72A 1B3HA 3SKPA 4M1VA 4R73A 4YAHX 4DXBA 4Z0IA 1KWHA 1NNTA 3GLBA 1TT1A 2H25A 4GVOA 2YLNA 3ILUB 1B1HA 5M2VA 5KDTA 2R71A 3C33A 2QS2A 1MXUA 3LR1A 5ISUA 2QS3A 3MPKA 1J1NA 1Z7ME 3GBBA 4LP2B 2H98A 4NEDA 2XXVA 3QK6A 4KI0E 3OEKA 3PD8A 1LFGA 3SEXA 3MP8A 4R72A 1DPPA 5I58A 1MPBA 4GL0A 2QSXA 1B3LA 3EN3A 1GTKA 1P1OA 2I6EA 3FV2A 3C36A 3GZGA 2RINA 4DZ1A 3IO4A 2Y7WA 3TODA 4R74A 1US4A 2REJA 2I48A 1B0LA 1FW0A 1VFEA 1B3FA 3G3KA 2XX9A 2M8CA 4IO6A 4NF8B 1GV8A 1M5DA 4JBZA 4N13A 3U93A 4TQUQ 3MAMA 1IIWA 4RK2A 1USYE 2OLBA 3FXQA 3CIJA 1MY2A 3N6UA 1M5EA 2OK2A 5ELVA 2OWTA 3KBRA 2XXPA 1UTHB 1USYH 4OQOA 3RT6B 2XXHA 4OFJA 5FHNA 2Y7KA 3FZVA 5TPAB 1SYHA 1LAFE 1EZPA 4H5FA 4O3CA 3TELA 3K1NA 1SW5A 3K01A 1PB7A 3CFLA 5H8NB 1LCTA 3MW0A 4QFNA 4LVQA 1DOTA 4JSDA 4TLLB 3MQ9A 4F3PA 1ZU0A 3PD9A 3SDFA 4OZ9A 3O6HA 1GR2A 5EHSA 3K1PA 3FJ7A 5I84A 5AA2D 4QHQA 3OXNA 5AA4B 2ONKE 1ZLQA 3PPPA 1ZJLA 1QVSA 1H44A 3GXAA 4IY6A 2ANJA 2RC8A 3MP1A 2G93A 1JEVA 1R9LA 4OWDA 4O3AA 4F3SA 3Q26A 3S4UA 2V25A 3E13X 3E4RA 3BBRA 1LB9A 3N5LA 3A3UA 1A55A 4YICA 1SYIA 4ZZAA 4BDLA 2DWHA 1S50A 1A7LA 3SEVA 1LLSA 3U8QA 1CB6A 5JTYA 3ZS6A 5J1DA 3DM0A 3VVEA 2ABHA 2QJEA 4WXJA 2VD3A 4F18A 3TAJA 5EYFA 5I57A 4OEVA 5TP9A 1AMFA 5DEXA 4BDRA 1FTKA 2DS9A 3K6XA 4R2BA 4IO5A 3LSFB 3UN6A 3TTNA 1XVXA 3B6TA 3SERA 4BDMA 4L17A 2O6AA 3H06B 1B46A 4P0GA 4EXKA 2DSFA 3FXRA 4ECFA 4RNSA 2UYEA 4GXAA 4XKRA 3IB2A 4GD5A 4KCCA 2XHDA 5AA2B 1QUJA 1MM7A 1S7YA 1FTMA 1ELJA 4U1OA 4RA1A 3TUSA 1D9YA 3FD3A 1AL3A 3H6UA 4F39A 4U2RA 4NF4B 1D9VA 3CR9A 5KCJA 1Y4CA 2ZYKA 1IUDA 3IJXB 1Y3NA 4BDOA 1QKBA 4JXIA 2Z8EA 1NKXA 3RQTA 3IX1A 3L6GA 3ZKLA 3QUFA 3O2AA 2XXWA 3SEUA 4FEBA 4ELOA 3IR1A 3K6VA 4F1VA 3N94A 3FVGA 5L9SA 3G3GA 1MPCA 1Q35A 1I6QA 3CG1A 4LA9A 1ZBMA 2Z22A 4ZEFA 3HPIA 1M5BA 1IITA 5DT6A 1VSOA 1SW2A 2NUVA 1P1QA 3KJTA 3DP8A 1MY1A 4QF9A 4TOZA 4LQ5A 1LGBC 3OO7A 3TTKA 4XKQA 1GVCA 4POXA 1LBBA 4QFOA 4DCYA 3TPAA 4C0RA 4XKNA 3P7IA 2O7UA 1LBCA 4TLMB 4KR5A 3KGCA 4RYAA 4ONYA 3K02A 5K2XA 4OFOA 2XXQA 4F1UA 4JWXA 4EQ7A 1R1NA 3K1MA 4U1ZA 3FASA 2ZNSA 3IK6B 1IXIA 1VFDA 4E0XA 4WEDA 2UVIA 4GF8A 3FVKA 4DDDA 1MQGA 2W7YA 5DVIA 4G77A 1Y1ZA 1MS7A 3MBPA 3TTLA 3EQ1A 3KG2A 1JW4A 4IO4A 1MY3A 2GHBA 2XXYA 3KSJA 1JQFA 2O1LA 4NF5A 1N7WA 3M8UA 1DSNA 5AA1A 1DTGA 3BFUA 1N04A 4M4GA 2AL5A 1SDXA 4IGTA 1R6ZA 5KCJB 3IO6A 4KPTA 1OQHA 1SD3A 3VV5A 2H9BA 2UXAA 2X7PA 1Y20A 2DVZA 4NF8A 3C4MA 4EF1A 1N76A 4GLIA 2F97A 4FORA 4YB5A 1MQJA 1I69A 3QAXA 5KZTA 1B5HA 4NF6B 2Y84A 3ZKKA 4YU0A 2ZMBA 2FA7A 3TCGA 3MZ1A 1UTHA 2H4IA 3MWBA 3TTMA 3CI8A 4EF2A 4OENA 1AOVA 2YPNA 4ZECA 1D3KA 2B3FA 3PUVE 2X7QA 3O6IA 5TPAA 1LB8A 3TMGA 1BP5A 4LZ8A 1UTBA 3RNNA 4R6KA 4F19A 1PB8A 3Q29A 4DXCA 3M3LA 5H8NA 4AB5A 3HV1A 3N6TA 4R75A 4DLDA 4QSEA 3MPLA 2CZLA 2RKMA 3SEYA 1N7XA 3K6UA 2F7BA 3KOSA 1PBQA 4ZS9A 2V84A 3UA8A 3QSLA 3FIRA 5DYHA 3F11A 4DCXA 2O68A 5AA4A 3PMXA 5AA3A 1Z7NE 3Q28A 1B51A 2QMWA 3QUJA 3THIA 3G3IA 2Q2CA 4I1DA 1M5FA 1Y3QA 3OEMA 4ISUA 2F7AA 2Q89A 4QRZA 3O9PA 3B6WA 5H8QB 3W9VA 1XHYA 1WVJA 1JVYA 1HSJA 4NF5B 2BJJX 3IORA 3C9HA 3S2VA 4GWOA 2AYSA 1OQGA 2VP1A 2XXIA 3PUXE 5I2KB 4ZEBA 3Q25A 2XD3A 1II5A 4ND9A 2KLFA 3VDFA 4ZEKA 3S9LC 2O7IA 2ZNTA 3OSQA 1P1UA 3RTWB 4RPNA 2XXUA 3MJNA 5L9OA 4PFUA 3O28A 2FYIA 4JSOA 3RLFE 3KN7A 5H8SA 5TU0A 2B65A 4PETA 3TEPA 2P0SA 4Z7EA 4I9DA 1R9QA 2VOZA 1BKAA 1H3DA 1B7HA 3FXUA 4KYDA 4FAJA 1B4ZA 5LOMA 1SQYA 5BUUA 2HCAA 1B0HA 1QUKA 1LFHA 2F6PA 4U4XA 1F9BA 4MH5A 4AB6A 5L8DA 5AA2A 3A09A 3KEIA 4GIZA 1UTBB 2E1SA 3MUQA 1I6BA 4OEUA 1QKAA 1H45A 4H65A 4NF4A 1VE4A 1POY1 5DTBA 2PVUA 1HSLA 1B7ZA 2H5YA 5ITPA 1TFAA 5CMCA 1B52A 3ODBA 4HW8A 3UP9A 3OELA 1MRPA 4QFKA 3EHUA 3H4ZA 4P0IA 4BDQA 3KJ7A 2QPQA 1ZIUA 2RF1A 4OETA 2F5XA 1CE2A 2CMOA 3IOWA 3PPQA 3U92A 5DVFA 1YPNA 1Y9UA 3H3GA 1A99A 4GRKA 2XD2A 3JYRA 1A54A 2RCAA 4Q8RA 1US5A 1FQFA 1IQ7A 1D4NA 4ESWA 1B40A 1Y3PA 4F3GA 4ELPA 4RPOA 4IO3A 1MQDA 3O6GA 4HCYA 4LZ7A 3IJOB 2ONRA 3OO9A 3FVOA 2QRYA 1UQWA 4LATA 3L6HA 4LQ2A 2ZXTA 1JETA 3VXBA 2A5SA 3RPWA 3RT8A 2GRVA 2IA4A 4RJZA 4YZZA 1NH7A 5F7VA 1XC1A 1B9JA 4U21A 3TYHA 1NMUA 4OHNA 1WDNA 4MF3A 2AIXA 3ILTB 4XXUA 3PUZE 2I58A 3IB1A 5I56A 4MLVA 2DQVA 4U22A 4FEDA 3N26A 1NNKA 3EHTA 2YJPA 4R6HA 4QFLA 1MQIA 1URSA 1P1NA 1FQBA 5CMMA 2HAUA 5CI5A 5ICQA 2O1MA 2R6GE 2UVHA 3T9UA 1MM6A 1OVTA 3G7WA 2QS4A 4G68C 1IZ1A 3PPRA 4X48A 3PV0E 1MY4A 2VD2A 4WEPA 3DLNA 3VLVA 4RXLA 3G3FA 3MVXA 3R7XA 2QMXA 2NWJA 2PBWA 2IEEA 4O3BA 1YTVA 4JDFA 4NF6A 3I6VA 2Q8JA 4G2ZA 3H7MA 1DMBA 4LUBA 5ICTA 4F2QA 1ATGA 1B5JA 4YMBA 5CMKA 3LBSA 3CFZA 5ITOA 3IAZA 2DE3A 4X1BA 1Y4TA 1POTA 4NWCA 4I62A 2D21A 2OBGA 1O63A 1ANFA 1MY0A 4NTLA 2O51A 2XX8A 2E0SA 3PU5A 4GQOA 1MXZA 1L5TA 4KCDA 1IXGA 3T93B 1SVXB 1Y1MA 2REGA 4YMAA 3RY3A 4PP0A 3T96B 4LONB 1UIVA 4G8NA 4RY1A 5A5XB 4QFPA 3DP6A 3O97A 4G8MA 4FE8A 1BTJA 5I2NB 5IKBA 3USDA 2H99A 1TXFA 3TTRA 2PT1A 2V3UA 1I6AA 4G4PA 3M3KA 4PQJA 2THIA 1DTZA 5I56B 1ZKBA 1PDAA 2GH9A 2F8DA 5H8QA 2F7CA 4JWOA 3LSLA 2DWAA 4YB7A 2DWIA 1LAXA 3LSWA 3I3VA 5I2KA 2F34A 4C1TA 4DXUA 3E3KA 2P2AA 4EUOA 4ZEIA 1IEJA 1VR5A 4OFLA 5JEIA 4NMYA 4UA8A 4KFQA 5I59B 2ESNA 3CRBA 4GL8A 2F6GA 3LUYA 4NWDA 3BFTA 5FTIA 1B3GA 3ECRA 4ZE8A 1JW1A 3LC8A 1A40A 1PBPA 1PB9A 3FUZA 4HTGA 3IB0A 1URDA 3PMVA 3KN8A 4MBPA 3RUMA 5H8FB 1H76A 2HFBA 1LFIA 1PEBA 4N6PA 3G3JA 5CM6A 4H67A 1JVXA 2F35A 2DE2A 5L9MA 1SBPA 4NE4A 3LSXA 2XXTA 4EDPA 2ZNUA 2NXOA 4H5GA 3V89B 3VE1B 4H8IA 4MFIA 4F2OA 1QJMA 5H8HB 2HAVA 1FQAA 4C1UA 2HZLA 2RC9A 1FTLA 3PPNA 4G68B 4XKPA 3FJGA 3IOTA 1N3WA 3T66A 4G8HA 1FQCA 1SW1A 3D4GA 1NH8A 3OENA 3ZSFA 4HCWA 4GXSB 2NVUB 3TCHA 4RK9A 1OMPA 3TQWA 2A5TB 3PGFA 2QL3A 1B4HA 3IL1B 3UORA 4ELQA 4H1XA 4KD5A 3AXFA 1LSTA 3HCQA 3S9EA 3CSBA 3MC2A 3MP6A 3OO6A 5B70A 2Y7IA 1NNPA 3KZGA 1QULA 3T9XB 3UGWA 3KFMA 1N3XA 3G3HA 3SEWA 3R26A 3DP4A 2O84X 3QYTA 4QSDA 3PMWA 4F22A 4YKIA 2RC7A 3FV1A 3R6UA 4FJPA 1B1XA 3VVDA 4EQBA 2OCUA 4OVJA 2ZYNA 4OMBA 1TFDA 1N0TA 4IB2A 3V5AA 1OIBA 4R6YA 4PFWA 3RTFB 2DYXA 2DE4A 3JV9A 5F1QA 2F78A 3K2DA 5HPQA 2GHAA 1A8EA 1M5CA 4PFYA 1MDQA 3ONMA 2Y7PA 3TFLA 1IXHA 3MVWA 2GFEA 3SETA 4ESXA 4DIGA 2P1SA 1FTJA 4YKKA 2UYFA 3K4UA 4KYEA 2D3IA 2I3VA 1AIVA 3K6WA 3A3CA 3TDJA 3KN3A 4KYSA 1ZMGA 3UIFA 3EHSA 4E0WA 1MXWA 1SW4A 2I4CA 2XXXA 3T22A 2Z8DA 5JK4A 2Q88A 1XVYA 2QS1A 2FNCA 1OLAA 1DPEA 1XS5A 4R2FA 2O69A 1O7TA 5KDTB 4H8JA 4UACA 4DE8A 2ZYOA 3QXMA 3S9MC 4KHZE 4XTCQ 1BIYA 1OLCA 1B2HA 4R9FA 4ZDMA 3U94A 4FIMA 4YKJA 1LAGE 2I0BA 3SESA 3HN0A 1T0KA 3C35A 3OSRA 2DWJA 4F3BA 5I58B 2NOOA 1Q1KA 2VHAA 4H0WA 3WAFA 3HO7A 4EQ9A 2I4BA 3W15C 2Q2AA 3CG3A 3VXCA 2ONSA 1RKMA 1MH4A 4OTEA 4PFTA 2DXRA 2D5WA 1RYXA 3FJMA 4OXVA 3VLUA 1FCKA 2R9JA 1ZTYA 3PPOA 3DELB 4MLQA 3BKIB 1LCFA 5A5XA 1H43A 5I2NA 3H6TA 2HQ0A 5HM4B 3FGSA 4F31B 4F29A 2RCBA 2XXRA 3UK4A 1YCJA 1FQDA 3FATA 4IO7A 1MH3A 3OOAA 4AQ4A 2PMSA 2UVJA 3JZJA 3KOTA 1AH5A 3D4CA 1N84A 2PT2A 5B7DA 3TKDA 3TCFA 1MQHA 4QSCA 2DOJA 1MDP1 3T9HB 4ZZEA 4ELRA 4IY5A 4ZEDA 4BDNA 3VLWA 1FQEA 2LAOA 1B5IA 1EZ9A 1URGA 3H6VA 5I59A 2V93A 3K00A 3CSGA 3MVZA 2V3QA 4Q5TA 2AL4A 3GBAA 4U4SA 4XIGQ 3FVNA 1B6HA 1MXXA 3MZ9A 2XX7A 1PC3A 1OVBA 1A8FA 3TZAA 2HZKA 4JWYA 1SI0A 4X9TA 5FHMA 1O64A 2OZZA 4KQPA 1NL5A 5H8FA 3VVFA 5CRYA 3C34A 3OO8A 1EH3A 4K3FA 4OESA 4FATA 4IO2A 4U23A 3KSXA 5K2YA 3K0VA 3PUYE 2VGQA 1HSEA 1JW5A 3O29A 3B7DA 3IOUA 2PX1A 5IAIA 1FTOA 3OMBA 1S9TA 5DVJA 3QIMA 2ZYMA 5HBCA 4F1YA 4HS7A 5H8HA 2B3BA 4N07A 2DP8A 4PE5B 4YKPA 1MXVA 5JTYB 4G68A 3B6QA 2I0CA 4R9GA 3MZBA 3EF7A 4YB6A 4THIA 5I57B 5TP9B 3E9XA 5BWJA 1MG1A 2Y7RA 1WODA 4POWA 5DEXB 2A5TA 3W9WA 1MXYA 2UVGA 4IGRA 1RYOA 2Z23A 2I3WA 1EZOA 3O66A 1NNFA 2Z8FA 3OD7A 1IXCA 3Q27A 3WAEA 4FECA 3H03A 1JNFA 3MVYA 3V83A 4GFRA 5AE4A 3VFJA 3RGYA 2HXWA 1XT8A 4JB7A 1GGGA 3TQLA 1YAEA 2OJTA 2WKYA 1SI1A 5FTHA 1B3EA 3C31A 3IOVA 1B58A 1NFTA 4Q30B 3CVGA 1P1WA 4OYVA 3V8XB 1TWYA 1QW0A 3EPEA 4H6DA 4X1DA 1LAHE 4P11A 2F36A 3RN8A 2ALUA 3HHFA 2I49A 4LZ5A 4EXLA 1QUIA 5FHOA 5EHMA 4OERA 3HSTA 3S9NC 1BLFA 3M3FA 4Q0CA 3HHGA 4BLAA 2HEUA 3T9VA 2V3TA 2Q9TA 5CBRA 2DVCA 1P99A 3I5OA 5CC2A 1B32A 4ZE9A 3H6WA 1UIUA 3PUWE 3CFXA 3C32A 5CMBA 2X26A 3U1OA 1EU8A 1MPDA 2G29A 2OWSA 1B05A 5CBSA 1B7UA
chains in the Genus database with same CATH superfamily
4GOTA 1XOCA 2PYYA 1JEUA 4WKMA 2DXYA 4I8CA 4MNCA 4PTKA 3U72A 1B3HA 3SKPA 4M1VA 4R73A 4YAHX 4PFBA 4DXBA 5I7IA 4Z0IA 1KWHA 4PBQA 2B4LA 4NHBA 1NNTA 3GLBA 1TT1A 2H25A 4GVOA 2YLNA 3ILUB 4MNPA 1B1HA 5M2VA 5KDTA 1YYZA 2R71A 3C33A 2QS2A 1MXUA 4X8RA 3LR1A 5ISUA 1G0IA 2QS3A 4PFRA 3MPKA 1NV7A 1J1NA 1Z7ME 5ET5A 3GBBA 4LP2B 2QFLA 2H98A 4NEDA 2XXVA 4MMPA 3QK6A 5LTCA 4KI0E 3OEKA 1FBPA 3PD8A 1LFGA 1NV3A 3SEXA 3MP8A 4R72A 1DPPA 5I58A 1MPBA 4GL0A 2QSXA 1B3LA 3EN3A 1GTKA 1P1OA 2I6EA 3FV2A 3C36A 3GZGA 2RINA 4DZ1A 3E78A 4NX1A 3IO4A 2Y7WA 3TODA 4R74A 1US4A 2REJA 2I48A 1B0LA 1FW0A 4I3EA 1VFEA 1B3FA 3G3KA 2XX9A 2M8CA 4IO6A 4NF8B 2V4CA 1NUWA 3QMFA 1GV8A 1M5DA 1K9YA 4JBZA 1FPIA 4N13A 3U93A 4TQUQ 3MAMA 1NUZA 2WBBA 1IIWA 4P9KA 4RK2A 1USYE 2OLBA 2OX3A 3CIJA 3FXQA 1MY2A 3N6UA 1M5EA 2OK2A 5ELVA 1FPGA 2OWTA 4GBVA 2FIXA 1FBGA 3KBRA 2XXPA 1UTHB 4XEQA 5ET7A 1USYH 4OQOA 3RT6B 2XXHA 4OFJA 4MNIA 5FHNA 2Y7KA 3FZVA 1BK4A 5TPAB 1SYHA 2VPOA 5EYHA 1LAFE 1EZPA 1NV1A 4H5FA 1FRPA 4O3CA 3TELA 3K1NA 1SW5A 3K01A 1PB7A 2Y5KA 3CFLA 4NN3A 5H8NB 1LCTA 3MW0A 4QFNA 4LVQA 1DOTA 4JSDA 4TLLB 3MQ9A 4FBPA 4F3PA 1ZU0A 3PD9A 3SDFA 1RDZA 4OZ9A 3O6HA 1GR2A 4PAIA 5EHSA 3K1PA 3FJ7A 5I84A 1VDWA 5AA2D 4QHQA 3OXNA 5AA4B 2ONKE 1ZLQA 3PPPA 1ZJLA 1QVSA 1H44A 3GXAA 4IY6A 2ANJA 2RC8A 3MP1A 2G93A 1JEVA 1R9LA 4OWDA 4O3AA 4F3SA 3Q26A 1FPFA 3S4UA 2V25A 3E13X 3E4RA 3BBRA 3T1BA 1LB9A 2QVRA 3N5LA 3A3UA 1A55A 4YICA 1SYIA 2KR0A 4ZZAA 4BDLA 2DWHA 1S50A 1A7LA 3SEVA 4GX3A 1LLSA 3U8QA 1CB6A 5JTYA 3ZS6A 5J1DA 3DM0A 3VVEA 2ABHA 2QJEA 4WXJA 2VD3A 3ROJA 4F18A 3TAJA 5EYFA 5I57A 4OEVA 5TP9A 4P1LA 1AMFA 1NV6A 5DEXA 4BDRA 1FTKA 2DS9A 4NAPA 4P56A 1D9QA 3K6XA 4R2BA 4IO5A 3LSFB 3UN6A 3TTNA 1XVXA 3B6TA 3SERA 4BDMA 4L17A 2O6AA 3H06B 1B46A 4P0GA 4EXKA 2DSFA 3FXRA 4ECFA 4RNSA 2UYEA 4GXAA 4XKRA 3IB2A 4GD5A 4KCCA 4AS4A 2XHDA 5AA2B 1QUJA 1MM7A 1S7YA 1FTMA 1ELJA 4U1OA 4JVDA 4RA1A 4HE2A 3TUSA 1D9YA 2WYPA 3FD3A 2XWIA 1AL3A 2ZZWA 3H6UA 4F39A 4U2RA 4NF4B 1D9VA 3CR9A 5KCJA 1Y4CA 2ZYKA 1IUDA 3IJXB 1Y3NA 4BDOA 1QKBA 4MHFA 4JXIA 2Z8EA 1NKXA 3RQTA 3IX1A 3L6GA 3ZKLA 4OVQA 3QUFA 3O2AA 2XXWA 3KC0A 3SEUA 4FEBA 3IR1A 3K6VA 4ELOA 4F1VA 3N94A 3FVGA 5L9SA 3G3GA 1MPCA 1Q35A 1I6QA 3CG1A 3PTYA 4LA9A 1ZBMA 2Z22A 4ZEFA 3HPIA 1M5BA 1IITA 5DT6A 1IMDA 1VSOA 1SW2A 2NUVA 1P1QA 3KJTA 3DP8A 1MY1A 4QF9A 1QGXA 4TOZA 4LQ5A 1NV0A 1LGBC 3OO7A 3TTKA 4XKQA 1GVCA 4POXA 4DI4B 1LBBA 4QFOA 4HXVA 4DCYA 3TPAA 4C0RA 4XKNA 5EQ8A 3P7IA 2O7UA 1LBCA 2HPGA 4TLMB 2ZZVA 4KR5A 3KGCA 4RYAA 4ONYA 4PDDA 3K02A 5K2XA 4OVTA 4OFOA 2XXQA 2FBPA 4F1UA 4JWXA 4EQ7A 1R1NA 4MEVA 3K1MA 4U1ZA 3FASA 2ZNSA 2Q74A 3IK6B 1IXIA 1VFDA 4E0XA 4WEDA 2UVIA 4GF8A 3FVKA 4DDDA 4N6KA 1MQGA 2W7YA 5DVIA 4N4UA 4QXDA 4G77A 1Y1ZA 1MS7A 1LBXA 3MBPA 3TTLA 3EQ1A 3KG2A 4OANA 1JW4A 4IO4A 1MY3A 4GX4A 5ET8A 4NF0A 2GHBA 1INPA 2XXYA 3KSJA 1JQFA 2O1LA 4NF5A 1N7WA 3M8UA 1DSNA 5AA1A 1DTGA 3BFUA 1N04A 4M4GA 2AL5A 2PFZA 1SDXA 4IGTA 1R6ZA 5KCJB 3IO6A 4KPTA 1OQHA 1SD3A 3VV5A 2H9BA 2UXAA 2X7PA 1Y20A 2DVZA 2VT5A 4NF8A 3B50A 3C4MA 4EF1A 1N76A 4GLIA 4PE3A 2F97A 5FBPA 4FORA 4YB5A 1MQJA 3E79A 1I69A 3QAXA 5KZTA 1B5HA 4NF6B 2WBDA 2Y84A 3ZKKA 4YU0A 4MIJA 2HXRA 2FA7A 2ZMBA 3TCGA 3MZ1A 1UTHA 2H4IA 3MWBA 3TTMA 3CI8A 4EF2A 4OENA 1AOVA 2YPNA 4ZECA 1D3KA 2B3FA 3PUVE 4N6DA 2X7QA 3O6IA 5TPAA 1LB8A 3TMGA 2CZIA 1BP5A 4LZ8A 1EYIA 1UTBA 3RNNA 4R6KA 4F19A 1PB8A 3Q29A 4PGPA 4DXCA 3M3LA 5H8NA 4AB5A 3HV1A 3N6TA 4R75A 4DLDA 4N15A 4QSEA 3MPLA 2CZLA 2RKMA 3KBZA 3SEYA 1N7XA 3K6UA 2F7BA 3KOSA 1PBQA 4ZS9A 4PCDA 2V84A 4PC9A 3UA8A 1FPEA 3QSLA 3FIRA 4DI3D 5DYHA 3IFAA 3F11A 4DCXA 2O68A 5AA4A 3PMXA 4P47A 5AA3A 1Z7NE 3Q28A 1B51A 1AWBA 2QMWA 3QUJA 3THIA 2XWOA 3G3IA 2Q2CA 4I1DA 1M5FA 1Y3QA 1LBZA 3OEMA 4ISUA 2F7AA 2Q89A 4QRZA 3O9PA 2WEFA 3B6WA 5H8QB 3W9VA 1XHYA 1WVJA 1JVYA 1HSJA 4NF5B 2BJJX 3IORA 3C9HA 5A5LA 3S2VA 4GWOA 2AYSA 1OQGA 2VP1A 2XXIA 3NOHA 3PUXE 5I2KB 1NUXA 5I5PA 4ZEBA 3Q25A 2XD3A 1II5A 4ND9A 2KLFA 3VDFA 4ZEKA 3S9LC 2XWVA 2O7IA 1FTAA 2ZNTA 3OSQA 1P1UA 3RTWB 4RPNA 2XXUA 3MJNA 5L9OA 4PFUA 4UABA 3O28A 2FYIA 5EYGA 4JSOA 3RLFE 3KN7A 5H8SA 5TU0A 2B65A 4PETA 1RDXA 3TEPA 2P0SA 4Z7EA 4I9DA 1R9QA 2VOZA 1BKAA 1DK4A 1H3DA 1B7HA 3FXUA 5LDZA 4KYDA 4FAJA 1B4ZA 5LOMA 1SQYA 5BUUA 2HCAA 1B0HA 1QUKA 4OVSA 1IMEA 1LFHA 2F6PA 4U4XA 1F9BA 4MH5A 4AB6A 5L8DA 5AA2A 3A09A 3KEIA 4GIZA 1IMBA 1UTBB 2E1SA 3EKIA 3MUQA 1I6BA 4GWSA 4OEUA 1QKAA 1FPBA 2ZZXA 2PFYA 1H45A 4H65A 4NF4A 2HHMA 1VE4A 1POY1 4N81A 5DTBA 4G61A 2PVUA 2BJIA 1HSLA 1B7ZA 2H5YA 5ITPA 1TFAA 5CMCA 1B52A 3ODBA 4HW8A 3UP9A 3OELA 1MRPA 4QFKA 3EHUA 3H4ZA 4P0IA 1DCUA 4BDQA 3KJ7A 4LN5A 2QPQA 1SPIA 1ZIUA 2RF1A 4OETA 2F5XA 1CE2A 4GWXA 2CMOA 3IOWA 3PPQA 3U92A 5DVFA 1YPNA 1Y9UA 3H3GA 1A99A 4GRKA 2XD2A 3JYRA 1A54A 2RCAA 4Q8RA 1US5A 1FQFA 1IQ7A 1D4NA 1YZ0A 4ESWA 1LBWA 1B40A 1Y3PA 4P8BA 4F3GA 4ELPA 2F3DA 4RPOA 4IO3A 1MQDA 3O6GA 4HCYA 4LZ7A 3IJOB 2ONRA 3OO9A 3FVOA 2QRYA 1UQWA 1NV2A 4LATA 3L6HA 4LQ2A 2ZXTA 1JETA 3VXBA 2A5SA 3RPWA 3RT8A 2DDKA 1FSAA 3FXBA 2GRVA 2IA4A 4RJZA 4YZZA 2L5VA 1NH7A 5F7VA 1XC1A 1B9JA 4U21A 5EQ7A 3TYHA 2CZKA 1NMUA 4OHNA 2WX9A 2FHYA 4GWZA 1WDNA 4PAKA 4MF3A 2AIXA 3ILTB 4XXUA 5IGAA 3PUZE 2I58A 3IB1A 5I56A 4MLVA 2DQVA 4U22A 4FEDA 1DBZA 5IZZA 3N26A 1NNKA 3EHTA 2YJPA 4R6HA 1KA1A 4QFLA 1MQIA 1URSA 1EYKA 1P1NA 1FQBA 5CMMA 2HAUA 5CI5A 5ICQA 2JJKA 2O1MA 2R6GE 2UVHA 3T9UA 1MM6A 1OVTA 3G7WA 2QS4A 4G68C 1IZ1A 3PPRA 4X48A 3PV0E 1MY4A 2VD2A 4WEPA 3DLNA 1FPJA 4HE1A 3VLVA 4RXLA 1LBVA 3G3FA 3MVXA 3R7XA 2QMXA 2NWJA 2PBWA 2IEEA 4O3BA 1YTVA 4JDFA 4NF6A 3I6VA 2Q8JA 4G2ZA 3H7MA 1DMBA 4LUBA 5ICTA 4F2QA 3CHGA 1ATGA 1B5JA 4YMBA 5CMKA 1IMAA 3LBSA 3CFZA 5ITOA 3IAZA 2DE3A 4X1BA 1Y4TA 1LBYA 1POTA 1LEVA 4NWCA 4I62A 4GWUA 2D21A 2OBGA 4PDHA 2F3BA 1O63A 1ANFA 1MY0A 4NTLA 2O51A 2XX8A 2E0SA 3PU5A 4GQOA 1MXZA 1L5TA 4KCDA 1IXGA 4XF5A 3T93B 1SVXB 1Y1MA 4X04A 2REGA 4YMAA 1FBHA 4GWYA 3RY3A 4PP0A 3T96B 4LONB 1UIVA 4QBAA 4G8NA 4RY1A 2CZHA 5A5XB 4QFPA 3DP6A 3O97A 4G8MA 4FE8A 1BTJA 5I2NB 3LUZA 5IKBA 3USDA 2H99A 1TXFA 4H46A 3TTRA 2PT1A 4JVIA 2OWZA 2V3UA 1I6AA 4G4PA 3M3KA 4PQJA 1K9ZA 3MYUA 2THIA 1DTZA 5I56B 1ZKBA 1PDAA 2GH9A 2F8DA 5H8QA 2F7CA 4JWOA 3LSLA 2DWAA 4YB7A 2DWIA 1LAXA 3LSWA 3I3VA 5I2KA 2F34A 4C1TA 4DXUA 3E3KA 2P2AA 4EUOA 4ZEIA 1IEJA 1VR5A 4OFLA 5JEIA 4NMYA 4UA8A 4KFQA 5T3JA 5I59B 2ESNA 3CRBA 4GL8A 2F6GA 3LUYA 4NWDA 3BFTA 5FTIA 1B3GA 3ECRA 4ZE8A 1JW1A 3LC8A 4XFEA 1A40A 1PBPA 1PB9A 3FUZA 4HTGA 3IB0A 1URDA 3PMVA 3KN8A 4MBPA 3RUMA 1XI6A 5H8FB 1H76A 2HFBA 1LFIA 1PEBA 4N6PA 3G3JA 5CM6A 4H67A 1JVXA 2F35A 2DE2A 5L9MA 1SBPA 4NE4A 3LSXA 2XXTA 3ISPA 4EDPA 2ZNUA 2NXOA 4H5GA 3V89B 3VE1B 4OA4A 4H8IA 4MFIA 4F2OA 2WYKA 1QJMA 1FJ6A 5H8HB 2HAVA 1FQAA 4C1UA 2HZLA 2RC9A 3MSTA 2CEXA 1FTLA 3PPNA 4G68B 5EQAA 4XKPA 3FJGA 3IOTA 1N3WA 3T66A 4G8HA 1FQCA 1SW1A 3D4GA 1NH8A 3OENA 3LV0A 3ZSFA 4HCWA 2Q8MA 4GXSB 2NVUB 3RPLB 3TCHA 4RK9A 1OMPA 3TQWA 4IR8A 4NQ8A 2A5TB 3PGFA 2QL3A 1B4HA 3IL1B 3UORA 4ELQA 4H1XA 4KD5A 3AXFA 1LSTA 3HCQA 3A29A 3S9EA 3CSBA 3MC2A 3MP6A 3OO6A 5B70A 2Y7IA 1NNPA 3KZGA 4HE0A 1QULA 3T9XB 3UGWA 1JP4A 3KFMA 1N3XA 2FVZA 3G3HA 2FIEA 1KA0A 3SEWA 3R26A 3DP4A 2O84X 3QYTA 4QSDA 3PMWA 4F22A 4YKIA 2RC7A 4O7IA 3FV1A 3R6UA 4FJPA 1B1XA 3VVDA 4EQBA 2XA5A 2OCUA 4OVJA 2ZYNA 4OMBA 1TFDA 1N0TA 4IB2A 3V5AA 4PAFA 1OIBA 4R6YA 5J16A 4PFWA 3RTFB 2XWKA 5IZ3B 2DYXA 2DE4A 3JV9A 3SZPA 4PF8A 5F1QA 2F78A 3K2DA 5ET6A 2GHAA 4N8YA 1A8EA 5HPQA 4I40A 1M5CA 4PFYA 1MDQA 3ONMA 2Y7PA 3TFLA 1IXHA 3MVWA 2GFEA 3SETA 4ESXA 4DIGA 2P1SA 1FTJA 4YKKA 4I3YA 2B4MA 2UYFA 2GQ1A 3K4UA 5I3SA 4KYEA 2D3IA 2I3VA 1AIVA 3K6WA 3A3CA 3TDJA 3KN3A 1IMFA 4KYSA 1ZMGA 3UIFA 3EHSA 4E0WA 1MXWA 1SW4A 2I4CA 2XXXA 3T22A 2Z8DA 5JK4A 2Q88A 1XVYA 2QS1A 1CNQA 2FNCA 1OLAA 1Q9DA 1DPEA 1XS5A 5IZ1A 4R2FA 2O69A 1O7TA 1FPDA 5KDTB 4H8JA 4UACA 4DE8A 5EQ9A 2ZYOA 3QXMA 3S9MC 4KHZE 4XTCQ 1BIYA 4OVRA 1OLCA 1B2HA 4R9FA 4ZDMA 3U94A 4FIMA 4YKJA 1LAGE 2I0BA 4H45A 3SESA 3HN0A 1T0KA 5DW8A 3C35A 3OSRA 2DWJA 4F3BA 5I58B 2NOOA 4PF6A 1Q1KA 2VHAA 4MCOA 4H0WA 3WAFA 3HO7A 2QVVA 4EQ9A 2I4BA 3W15C 2Q2AA 3CG3A 3VXCA 2ONSA 1RKMA 1MH4A 1FBDA 4OTEA 4PFTA 2DXRA 2D5WA 1RYXA 3FJMA 1NV4A 4OXVA 3VLUA 1FCKA 2R9JA 1ZTYA 3PPOA 3DELB 4MLQA 4PFIA 3BKIB 1LCFA 5A5XA 1H43A 5I2NA 3H6TA 2HQ0A 4N91A 5HM4B 3FGSA 4F31B 4F29A 2RCBA 2XXRA 3UK4A 1YCJA 1FQDA 4MJOA 3FATA 4IO7A 1MH3A 4O7MA 3OOAA 4AQ4A 2PMSA 2UVJA 3JZJA 3KOTA 1AH5A 3D4CA 1N84A 2PT2A 5B7DA 3U65A 3TKDA 1G0HA 3TCFA 1MQHA 4QSCA 2DOJA 1MDP1 3T0JA 3T9HB 4ZZEA 4ELRA 3B8BA 4IY5A 4ZEDA 4BDNA 3VLWA 1FQEA 4GWWA 2LAOA 1B5IA 2CEYA 1EZ9A 4P3LA 1URGA 3H6VA 1FPLA 5I59A 2V93A 3K00A 3CSGA 3MVZA 2QVUA 2V3QA 4JVCA 4Q5TA 2AL4A 1FBEA 3GBAA 4U4SA 2VPNA 4XIGQ 3FVNA 1B6HA 1MXXA 2P3VA 5F24A 3MZ9A 2XX7A 1PC3A 1OVBA 1A8FA 3TZAA 2HZKA 3KC1A 1FPKA 4JWYA 4MX6A 1SI0A 4X9TA 5FHMA 1O64A 2OZZA 4KQPA 1NL5A 5H8FA 3VVFA 5CRYA 3C34A 3OO8A 1EH3A 4N17A 4K3FA 4OESA 4FATA 1YXIA 4IO2A 4U23A 3KSXA 5K2YA 3K0VA 3PUYE 2VGQA 1HSEA 1JW5A 3O29A 2P3NA 3HFUA 3B7DA 3IOUA 2PX1A 5IAIA 4GBWA 1FTOA 3OMBA 3BIHA 1S9TA 4AS5A 5DVJA 3QIMA 2ZYMA 2MKZA 5HBCA 4F1YA 4HS7A 5H8HA 2B3BA 4N07A 2DP8A 4PE5B 4GX6A 1NI9A 4YKPA 1MXVA 1IMCA 5JTYB 4G68A 2XXKA 3B6QA 4O8MA 2I0CA 4R9GA 3MZBA 3EF7A 4YB6A 4THIA 5I57B 5TP9B 2Y5LA 3RPLA 3E9XA 5BWJA 1MG1A 4PBHA 1RDYA 2Y7RA 3GYYA 1WODA 4POWA 5DEXB 1FBCA 2A5TA 3D1RA 3W9WA 1MXYA 2UVGA 1KZ8A 4IGRA 1RYOA 2Z23A 4OVPA 2I3WA 3BIGA 1EZOA 3O66A 3IFCA 1NNFA 2Z8FA 3OD7A 1IXCA 3Q27A 4PGNA 3WAEA 4FECA 3H03A 1JNFA 3MVYA 3V83A 4GFRA 5AE4A 3VFJA 3RGYA 2HXWA 1FJ9A 1XT8A 2R8TA 4JB7A 1GGGA 1FBFA 3TQLA 1YAEA 2OJTA 2WKYA 1SI1A 1NUYA 5ESYA 5FTHA 1B3EA 3C31A 3IOVA 1B58A 1NFTA 4MAGA 4Q30B 3CVGA 1P1WA 4OYVA 2PCRA 3V8XB 1TWYA 4P1EA 1QW0A 3EPEA 3RYDA 4H6DA 4X1DA 1LAHE 4N8GA 2F36A 4P11A 3RN8A 2ALUA 4O94A 3HHFA 2I49A 4LZ5A 1NV5A 4KXPA 5IZ3A 4EXLA 1QUIA 5FHOA 5EHMA 4OERA 3HSTA 3S9NC 1BLFA 3M3FA 4Q0CA 3HHGA 5IM2A 4BLAA 1EYJA 2HEUA 3T9VA 2V3TA 2Q9TA 5CBRA 2DVCA 1P99A 3I5OA 2KQZA 5CC2A 1B32A 4ZE9A 3H6WA 1UIUA 3PUWE 3CFXA 3C32A 3FBPA 5CMBA 2X26A 3U1OA 1EU8A 1MPDA 2G29A 2OWSA 1B05A 4NGUA 5CBSA 1B7UA 4NG7A
chains in the Genus database with same CATH topology
4GOTA 1XOCA 2PYYA 1JEUA 4WKMA 2DXYA 4I8CA 3U72A 1B3HA 3SKPA 4M1VA 4R73A 4YAHX 4DXBA 4Z0IA 1KWHA 1NNTA 3GLBA 1TT1A 2H25A 4GVOA 2YLNA 3ILUB 1B1HA 5M2VA 5KDTA 2R71A 3C33A 2QS2A 1MXUA 3LR1A 5ISUA 2QS3A 3MPKA 1J1NA 1Z7ME 3GBBA 4LP2B 2H98A 4NEDA 2XXVA 3QK6A 4KI0E 3OEKA 3PD8A 1LFGA 3SEXA 3MP8A 4R72A 1DPPA 5I58A 1MPBA 4GL0A 2QSXA 1B3LA 3EN3A 1GTKA 1P1OA 2I6EA 3FV2A 3C36A 3GZGA 2RINA 4DZ1A 3IO4A 2Y7WA 3TODA 4R74A 1US4A 2REJA 2I48A 1B0LA 1FW0A 1VFEA 1B3FA 3G3KA 2XX9A 2M8CA 4IO6A 4NF8B 1GV8A 1M5DA 4JBZA 4N13A 3U93A 4TQUQ 3MAMA 1IIWA 4RK2A 1USYE 2OLBA 3FXQA 3CIJA 1MY2A 3N6UA 1M5EA 2OK2A 5ELVA 2OWTA 3KBRA 2XXPA 1UTHB 1USYH 4OQOA 3RT6B 2XXHA 4OFJA 5FHNA 2Y7KA 3FZVA 5TPAB 1SYHA 1LAFE 1EZPA 4H5FA 4O3CA 3TELA 3K1NA 1SW5A 3K01A 1PB7A 3CFLA 5H8NB 1LCTA 3MW0A 4QFNA 4LVQA 1DOTA 4JSDA 4TLLB 3MQ9A 4F3PA 1ZU0A 3PD9A 3SDFA 4OZ9A 3O6HA 1GR2A 5EHSA 3K1PA 3FJ7A 5I84A 5AA2D 4QHQA 3OXNA 5AA4B 2ONKE 1ZLQA 3PPPA 1ZJLA 1QVSA 1H44A 3GXAA 4IY6A 2ANJA 2RC8A 3MP1A 2G93A 1JEVA 1R9LA 4OWDA 4O3AA 4F3SA 3Q26A 3S4UA 2V25A 3E13X 3E4RA 3BBRA 1LB9A 3N5LA 3A3UA 1A55A 4YICA 1SYIA 4ZZAA 4BDLA 2DWHA 1S50A 1A7LA 3SEVA 1LLSA 3U8QA 1CB6A 5JTYA 3ZS6A 5J1DA 3DM0A 3VVEA 2ABHA 2QJEA 4WXJA 2VD3A 4F18A 3TAJA 5EYFA 5I57A 4OEVA 5TP9A 1AMFA 5DEXA 4BDRA 1FTKA 2DS9A 3K6XA 4R2BA 4IO5A 3LSFB 3UN6A 3TTNA 1XVXA 3B6TA 3SERA 4BDMA 4L17A 2O6AA 3H06B 1B46A 4P0GA 4EXKA 2DSFA 3FXRA 4ECFA 4RNSA 2UYEA 4GXAA 4XKRA 3IB2A 4GD5A 4KCCA 2XHDA 5AA2B 1QUJA 1MM7A 1S7YA 1FTMA 1ELJA 4U1OA 4RA1A 3TUSA 1D9YA 3FD3A 1AL3A 3H6UA 4F39A 4U2RA 4NF4B 1D9VA 3CR9A 5KCJA 1Y4CA 2ZYKA 1IUDA 3IJXB 1Y3NA 4BDOA 1QKBA 4JXIA 2Z8EA 1NKXA 3RQTA 3IX1A 3L6GA 3ZKLA 3QUFA 3O2AA 2XXWA 3SEUA 4FEBA 4ELOA 3IR1A 3K6VA 4F1VA 3N94A 3FVGA 5L9SA 3G3GA 1MPCA 1Q35A 1I6QA 3CG1A 4LA9A 1ZBMA 2Z22A 4ZEFA 3HPIA 1M5BA 1IITA 5DT6A 1VSOA 1SW2A 2NUVA 1P1QA 3KJTA 3DP8A 1MY1A 4QF9A 4TOZA 4LQ5A 1LGBC 3OO7A 3TTKA 4XKQA 1GVCA 4POXA 1LBBA 4QFOA 4DCYA 3TPAA 4C0RA 4XKNA 3P7IA 2O7UA 1LBCA 4TLMB 4KR5A 3KGCA 4RYAA 4ONYA 3K02A 5K2XA 4OFOA 2XXQA 4F1UA 4JWXA 4EQ7A 1R1NA 3K1MA 4U1ZA 3FASA 2ZNSA 3IK6B 1IXIA 1VFDA 4E0XA 4WEDA 2UVIA 4GF8A 3FVKA 4DDDA 1MQGA 2W7YA 5DVIA 4G77A 1Y1ZA 1MS7A 3MBPA 3TTLA 3EQ1A 3KG2A 1JW4A 4IO4A 1MY3A 2GHBA 2XXYA 3KSJA 1JQFA 2O1LA 4NF5A 1N7WA 3M8UA 1DSNA 5AA1A 1DTGA 3BFUA 1N04A 4M4GA 2AL5A 1SDXA 4IGTA 1R6ZA 5KCJB 3IO6A 4KPTA 1OQHA 1SD3A 3VV5A 2H9BA 2UXAA 2X7PA 1Y20A 2DVZA 4NF8A 3C4MA 4EF1A 1N76A 4GLIA 2F97A 4FORA 4YB5A 1MQJA 1I69A 3QAXA 5KZTA 1B5HA 4NF6B 2Y84A 3ZKKA 4YU0A 2ZMBA 2FA7A 3TCGA 3MZ1A 1UTHA 2H4IA 3MWBA 3TTMA 3CI8A 4EF2A 4OENA 1AOVA 2YPNA 4ZECA 1D3KA 2B3FA 3PUVE 2X7QA 3O6IA 5TPAA 1LB8A 3TMGA 1BP5A 4LZ8A 1UTBA 3RNNA 4R6KA 4F19A 1PB8A 3Q29A 4DXCA 3M3LA 5H8NA 4AB5A 3HV1A 3N6TA 4R75A 4DLDA 4QSEA 3MPLA 2CZLA 2RKMA 3SEYA 1N7XA 3K6UA 2F7BA 3KOSA 1PBQA 4ZS9A 2V84A 3UA8A 3QSLA 3FIRA 5DYHA 3F11A 4DCXA 2O68A 5AA4A 3PMXA 5AA3A 1Z7NE 3Q28A 1B51A 2QMWA 3QUJA 3THIA 3G3IA 2Q2CA 4I1DA 1M5FA 1Y3QA 3OEMA 4ISUA 2F7AA 2Q89A 4QRZA 3O9PA 3B6WA 5H8QB 3W9VA 1XHYA 1WVJA 1JVYA 1HSJA 4NF5B 2BJJX 3IORA 3C9HA 3S2VA 4GWOA 2AYSA 1OQGA 2VP1A 2XXIA 3PUXE 5I2KB 4ZEBA 3Q25A 2XD3A 1II5A 4ND9A 2KLFA 3VDFA 4ZEKA 3S9LC 2O7IA 2ZNTA 3OSQA 1P1UA 3RTWB 4RPNA 2XXUA 3MJNA 5L9OA 4PFUA 3O28A 2FYIA 4JSOA 3RLFE 3KN7A 5H8SA 5TU0A 2B65A 4PETA 3TEPA 2P0SA 4Z7EA 4I9DA 1R9QA 2VOZA 1BKAA 1H3DA 1B7HA 3FXUA 4KYDA 4FAJA 1B4ZA 5LOMA 1SQYA 5BUUA 2HCAA 1B0HA 1QUKA 1LFHA 2F6PA 4U4XA 1F9BA 4MH5A 4AB6A 5L8DA 5AA2A 3A09A 3KEIA 4GIZA 1UTBB 2E1SA 3MUQA 1I6BA 4OEUA 1QKAA 1H45A 4H65A 4NF4A 1VE4A 1POY1 5DTBA 2PVUA 1HSLA 1B7ZA 2H5YA 5ITPA 1TFAA 5CMCA 1B52A 3ODBA 4HW8A 3UP9A 3OELA 1MRPA 4QFKA 3EHUA 3H4ZA 4P0IA 4BDQA 3KJ7A 2QPQA 1ZIUA 2RF1A 4OETA 2F5XA 1CE2A 2CMOA 3IOWA 3PPQA 3U92A 5DVFA 1YPNA 1Y9UA 3H3GA 1A99A 4GRKA 2XD2A 3JYRA 1A54A 2RCAA 4Q8RA 1US5A 1FQFA 1IQ7A 1D4NA 4ESWA 1B40A 1Y3PA 4F3GA 4ELPA 4RPOA 4IO3A 1MQDA 3O6GA 4HCYA 4LZ7A 3IJOB 2ONRA 3OO9A 3FVOA 2QRYA 1UQWA 4LATA 3L6HA 4LQ2A 2ZXTA 1JETA 3VXBA 2A5SA 3RPWA 3RT8A 2GRVA 2IA4A 4RJZA 4YZZA 1NH7A 5F7VA 1XC1A 1B9JA 4U21A 3TYHA 1NMUA 4OHNA 1WDNA 4MF3A 2AIXA 3ILTB 4XXUA 3PUZE 2I58A 3IB1A 5I56A 4MLVA 2DQVA 4U22A 4FEDA 3N26A 1NNKA 3EHTA 2YJPA 4R6HA 4QFLA 1MQIA 1URSA 1P1NA 1FQBA 5CMMA 2HAUA 5CI5A 5ICQA 2O1MA 2R6GE 2UVHA 3T9UA 1MM6A 1OVTA 3G7WA 2QS4A 4G68C 1IZ1A 3PPRA 4X48A 3PV0E 1MY4A 2VD2A 4WEPA 3DLNA 3VLVA 4RXLA 3G3FA 3MVXA 3R7XA 2QMXA 2NWJA 2PBWA 2IEEA 4O3BA 1YTVA 4JDFA 4NF6A 3I6VA 2Q8JA 4G2ZA 3H7MA 1DMBA 4LUBA 5ICTA 4F2QA 1ATGA 1B5JA 4YMBA 5CMKA 3LBSA 3CFZA 5ITOA 3IAZA 2DE3A 4X1BA 1Y4TA 1POTA 4NWCA 4I62A 2D21A 2OBGA 1O63A 1ANFA 1MY0A 4NTLA 2O51A 2XX8A 2E0SA 3PU5A 4GQOA 1MXZA 1L5TA 4KCDA 1IXGA 3T93B 1SVXB 1Y1MA 2REGA 4YMAA 3RY3A 4PP0A 3T96B 4LONB 1UIVA 4G8NA 4RY1A 5A5XB 4QFPA 3DP6A 3O97A 4G8MA 4FE8A 1BTJA 5I2NB 5IKBA 3USDA 2H99A 1TXFA 3TTRA 2PT1A 2V3UA 1I6AA 4G4PA 3M3KA 4PQJA 2THIA 1DTZA 5I56B 1ZKBA 1PDAA 2GH9A 2F8DA 5H8QA 2F7CA 4JWOA 3LSLA 2DWAA 4YB7A 2DWIA 1LAXA 3LSWA 3I3VA 5I2KA 2F34A 4C1TA 4DXUA 3E3KA 2P2AA 4EUOA 4ZEIA 1IEJA 1VR5A 4OFLA 5JEIA 4NMYA 4UA8A 4KFQA 5I59B 2ESNA 3CRBA 4GL8A 2F6GA 3LUYA 4NWDA 3BFTA 5FTIA 1B3GA 3ECRA 4ZE8A 1JW1A 3LC8A 1A40A 1PBPA 1PB9A 3FUZA 4HTGA 3IB0A 1URDA 3PMVA 3KN8A 4MBPA 3RUMA 5H8FB 1H76A 2HFBA 1LFIA 1PEBA 4N6PA 3G3JA 5CM6A 4H67A 1JVXA 2F35A 2DE2A 5L9MA 1SBPA 4NE4A 3LSXA 2XXTA 4EDPA 2ZNUA 2NXOA 4H5GA 3V89B 3VE1B 4H8IA 4MFIA 4F2OA 1QJMA 5H8HB 2HAVA 1FQAA 4C1UA 2HZLA 2RC9A 1FTLA 3PPNA 4G68B 4XKPA 3FJGA 3IOTA 1N3WA 3T66A 4G8HA 1FQCA 1SW1A 3D4GA 1NH8A 3OENA 3ZSFA 4HCWA 4GXSB 2NVUB 3TCHA 4RK9A 1OMPA 3TQWA 2A5TB 3PGFA 2QL3A 1B4HA 3IL1B 3UORA 4ELQA 4H1XA 4KD5A 3AXFA 1LSTA 3HCQA 3S9EA 3CSBA 3MC2A 3MP6A 3OO6A 5B70A 2Y7IA 1NNPA 3KZGA 1QULA 3T9XB 3UGWA 3KFMA 1N3XA 3G3HA 3SEWA 3R26A 3DP4A 2O84X 3QYTA 4QSDA 3PMWA 4F22A 4YKIA 2RC7A 3FV1A 3R6UA 4FJPA 1B1XA 3VVDA 4EQBA 2OCUA 4OVJA 2ZYNA 4OMBA 1TFDA 1N0TA 4IB2A 3V5AA 1OIBA 4R6YA 4PFWA 3RTFB 2DYXA 2DE4A 3JV9A 5F1QA 2F78A 3K2DA 5HPQA 2GHAA 1A8EA 1M5CA 4PFYA 1MDQA 3ONMA 2Y7PA 3TFLA 1IXHA 3MVWA 2GFEA 3SETA 4ESXA 4DIGA 2P1SA 1FTJA 4YKKA 2UYFA 3K4UA 4KYEA 2D3IA 2I3VA 1AIVA 3K6WA 3A3CA 3TDJA 3KN3A 4KYSA 1ZMGA 3UIFA 3EHSA 4E0WA 1MXWA 1SW4A 2I4CA 2XXXA 3T22A 2Z8DA 5JK4A 2Q88A 1XVYA 2QS1A 2FNCA 1OLAA 1DPEA 1XS5A 4R2FA 2O69A 1O7TA 5KDTB 4H8JA 4UACA 4DE8A 2ZYOA 3QXMA 3S9MC 4KHZE 4XTCQ 1BIYA 1OLCA 1B2HA 4R9FA 4ZDMA 3U94A 4FIMA 4YKJA 1LAGE 2I0BA 3SESA 3HN0A 1T0KA 3C35A 3OSRA 2DWJA 4F3BA 5I58B 2NOOA 1Q1KA 2VHAA 4H0WA 3WAFA 3HO7A 4EQ9A 2I4BA 3W15C 2Q2AA 3CG3A 3VXCA 2ONSA 1RKMA 1MH4A 4OTEA 4PFTA 2DXRA 2D5WA 1RYXA 3FJMA 4OXVA 3VLUA 1FCKA 2R9JA 1ZTYA 3PPOA 3DELB 4MLQA 3BKIB 1LCFA 5A5XA 1H43A 5I2NA 3H6TA 2HQ0A 5HM4B 3FGSA 4F31B 4F29A 2RCBA 2XXRA 3UK4A 1YCJA 1FQDA 3FATA 4IO7A 1MH3A 3OOAA 4AQ4A 2PMSA 2UVJA 3JZJA 3KOTA 1AH5A 3D4CA 1N84A 2PT2A 5B7DA 3TKDA 3TCFA 1MQHA 4QSCA 2DOJA 1MDP1 3T9HB 4ZZEA 4ELRA 4IY5A 4ZEDA 4BDNA 3VLWA 1FQEA 2LAOA 1B5IA 1EZ9A 1URGA 3H6VA 5I59A 2V93A 3K00A 3CSGA 3MVZA 2V3QA 4Q5TA 2AL4A 3GBAA 4U4SA 4XIGQ 3FVNA 1B6HA 1MXXA 3MZ9A 2XX7A 1PC3A 1OVBA 1A8FA 3TZAA 2HZKA 4JWYA 1SI0A 4X9TA 5FHMA 1O64A 2OZZA 4KQPA 1NL5A 5H8FA 3VVFA 5CRYA 3C34A 3OO8A 1EH3A 4K3FA 4OESA 4FATA 4IO2A 4U23A 3KSXA 5K2YA 3K0VA 3PUYE 2VGQA 1HSEA 1JW5A 3O29A 3B7DA 3IOUA 2PX1A 5IAIA 1FTOA 3OMBA 1S9TA 5DVJA 3QIMA 2ZYMA 5HBCA 4F1YA 4HS7A 5H8HA 2B3BA 4N07A 2DP8A 4PE5B 4YKPA 1MXVA 5JTYB 4G68A 3B6QA 2I0CA 4R9GA 3MZBA 3EF7A 4YB6A 4THIA 5I57B 5TP9B 3E9XA 5BWJA 1MG1A 2Y7RA 1WODA 4POWA 5DEXB 2A5TA 3W9WA 1MXYA 2UVGA 4IGRA 1RYOA 2Z23A 2I3WA 1EZOA 3O66A 1NNFA 2Z8FA 3OD7A 1IXCA 3Q27A 3WAEA 4FECA 3H03A 1JNFA 3MVYA 3V83A 4GFRA 5AE4A 3VFJA 3RGYA 2HXWA 1XT8A 4JB7A 1GGGA 3TQLA 1YAEA 2OJTA 2WKYA 1SI1A 5FTHA 1B3EA 3C31A 3IOVA 1B58A 1NFTA 4Q30B 3CVGA 1P1WA 4OYVA 3V8XB 1TWYA 1QW0A 3EPEA 4H6DA 4X1DA 1LAHE 4P11A 2F36A 3RN8A 2ALUA 3HHFA 2I49A 4LZ5A 4EXLA 1QUIA 5FHOA 5EHMA 4OERA 3HSTA 3S9NC 1BLFA 3M3FA 4Q0CA 3HHGA 4BLAA 2HEUA 3T9VA 2V3TA 2Q9TA 5CBRA 2DVCA 1P99A 3I5OA 5CC2A 1B32A 4ZE9A 3H6WA 1UIUA 3PUWE 3CFXA 3C32A 5CMBA 2X26A 3U1OA 1EU8A 1MPDA 2G29A 2OWSA 1B05A 5CBSA 1B7UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GOT A;  1XOC A;  2PYY A;  1JEU A;  4WKM A;  2DXY A;  4I8C A;  3U72 A;  1B3H A;  3SKP A;  4M1V A;  4R73 A;  4YAH X;  4DXB A;  4Z0I A;  1KWH A;  1NNT A;  3GLB A;  1TT1 A;  2H25 A;  4GVO A;  2YLN A;  3ILU B;  1B1H A;  5M2V A;  5KDT A;  2R71 A;  3C33 A;  2QS2 A;  1MXU A;  3LR1 A;  5ISU A;  2QS3 A;  3MPK A;  1J1N A;  1Z7M E;  3GBB A;  4LP2 B;  2H98 A;  4NED A;  2XXV A;  3QK6 A;  4KI0 E;  3OEK A;  3PD8 A;  1LFG A;  3SEX A;  3MP8 A;  4R72 A;  1DPP A;  5I58 A;  1MPB A;  4GL0 A;  2QSX A;  1B3L A;  3EN3 A;  1GTK A;  1P1O A;  2I6E A;  3FV2 A;  3C36 A;  3GZG A;  2RIN A;  4DZ1 A;  3IO4 A;  2Y7W A;  3TOD A;  4R74 A;  1US4 A;  2REJ A;  2I48 A;  1B0L A;  1FW0 A;  1VFE A;  1B3F A;  3G3K A;  2XX9 A;  2M8C A;  4IO6 A;  4NF8 B;  1GV8 A;  1M5D A;  4JBZ A;  4N13 A;  3U93 A;  4TQU Q;  3MAM A;  1IIW A;  4RK2 A;  1USY E;  2OLB A;  3FXQ A;  3CIJ A;  1MY2 A;  3N6U A;  1M5E A;  2OK2 A;  5ELV A;  2OWT A;  3KBR A;  2XXP A;  1UTH B;  1USY H;  4OQO A;  3RT6 B;  2XXH A;  4OFJ A;  5FHN A;  2Y7K A;  3FZV A;  5TPA B;  1SYH A;  1LAF E;  1EZP A;  4H5F A;  4O3C A;  3TEL A;  3K1N A;  1SW5 A;  3K01 A;  1PB7 A;  3CFL A;  5H8N B;  1LCT A;  3MW0 A;  4QFN A;  4LVQ A;  1DOT A;  4JSD A;  4TLL B;  3MQ9 A;  4F3P A;  1ZU0 A;  3PD9 A;  3SDF A;  4OZ9 A;  3O6H A;  1GR2 A;  5EHS A;  3K1P A;  3FJ7 A;  5I84 A;  5AA2 D;  4QHQ A;  3OXN A;  5AA4 B;  2ONK E;  1ZLQ A;  3PPP A;  1ZJL A;  1QVS A;  1H44 A;  3GXA A;  4IY6 A;  2ANJ A;  2RC8 A;  3MP1 A;  2G93 A;  1JEV A;  1R9L A;  4OWD A;  4O3A A;  4F3S A;  3Q26 A;  3S4U A;  2V25 A;  3E13 X;  3E4R A;  3BBR A;  1LB9 A;  3N5L A;  3A3U A;  1A55 A;  4YIC A;  1SYI A;  4ZZA A;  4BDL A;  2DWH A;  1S50 A;  1A7L A;  3SEV A;  1LLS A;  3U8Q A;  1CB6 A;  5JTY A;  3ZS6 A;  5J1D A;  3DM0 A;  3VVE A;  2ABH A;  2QJE A;  4WXJ A;  2VD3 A;  4F18 A;  3TAJ A;  5EYF A;  5I57 A;  4OEV A;  5TP9 A;  1AMF A;  5DEX A;  4BDR A;  1FTK A;  2DS9 A;  3K6X A;  4R2B A;  4IO5 A;  3LSF B;  3UN6 A;  3TTN A;  1XVX A;  3B6T A;  3SER A;  4BDM A;  4L17 A;  2O6A A;  3H06 B;  1B46 A;  4P0G A;  4EXK A;  2DSF A;  3FXR A;  4ECF A;  4RNS A;  2UYE A;  4GXA A;  4XKR A;  3IB2 A;  4GD5 A;  4KCC A;  2XHD A;  5AA2 B;  1QUJ A;  1MM7 A;  1S7Y A;  1FTM A;  1ELJ A;  4U1O A;  4RA1 A;  3TUS A;  1D9Y A;  3FD3 A;  1AL3 A;  3H6U A;  4F39 A;  4U2R A;  4NF4 B;  1D9V A;  3CR9 A;  5KCJ A;  1Y4C A;  2ZYK A;  1IUD A;  3IJX B;  1Y3N A;  4BDO A;  1QKB A;  4JXI A;  2Z8E A;  1NKX A;  3RQT A;  3IX1 A;  3L6G A;  3ZKL A;  3QUF A;  3O2A A;  2XXW A;  3SEU A;  4FEB A;  4ELO A;  3IR1 A;  3K6V A;  4F1V A;  3N94 A;  3FVG A;  5L9S A;  3G3G A;  1MPC A;  1Q35 A;  1I6Q A;  3CG1 A;  4LA9 A;  1ZBM A;  2Z22 A;  4ZEF A;  3HPI A;  1M5B A;  1IIT A;  5DT6 A;  1VSO A;  1SW2 A;  2NUV A;  1P1Q A;  3KJT A;  3DP8 A;  1MY1 A;  4QF9 A;  4TOZ A;  4LQ5 A;  1LGB C;  3OO7 A;  3TTK A;  4XKQ A;  1GVC A;  4POX A;  1LBB A;  4QFO A;  4DCY A;  3TPA A;  4C0R A;  4XKN A;  3P7I A;  2O7U A;  1LBC A;  4TLM B;  4KR5 A;  3KGC A;  4RYA A;  4ONY A;  3K02 A;  5K2X A;  4OFO A;  2XXQ A;  4F1U A;  4JWX A;  4EQ7 A;  1R1N A;  3K1M A;  4U1Z A;  3FAS A;  2ZNS A;  3IK6 B;  1IXI A;  1VFD A;  4E0X A;  4WED A;  2UVI A;  4GF8 A;  3FVK A;  4DDD A;  1MQG A;  2W7Y A;  5DVI A;  4G77 A;  1Y1Z A;  1MS7 A;  3MBP A;  3TTL A;  3EQ1 A;  3KG2 A;  1JW4 A;  4IO4 A;  1MY3 A;  2GHB A;  2XXY A;  3KSJ A;  1JQF A;  2O1L A;  4NF5 A;  1N7W A;  3M8U A;  1DSN A;  5AA1 A;  1DTG A;  3BFU A;  1N04 A;  4M4G A;  2AL5 A;  1SDX A;  4IGT A;  1R6Z A;  5KCJ B;  3IO6 A;  4KPT A;  1OQH A;  1SD3 A;  3VV5 A;  2H9B A;  2UXA A;  2X7P A;  1Y20 A;  2DVZ A;  4NF8 A;  3C4M A;  4EF1 A;  1N76 A;  4GLI A;  2F97 A;  4FOR A;  4YB5 A;  1MQJ A;  1I69 A;  3QAX A;  5KZT A;  1B5H A;  4NF6 B;  2Y84 A;  3ZKK A;  4YU0 A;  2ZMB A;  2FA7 A;  3TCG A;  3MZ1 A;  1UTH A;  2H4I A;  3MWB A;  3TTM A;  3CI8 A;  4EF2 A;  4OEN A;  1AOV A;  2YPN A;  4ZEC A;  1D3K A;  2B3F A;  3PUV E;  2X7Q A;  3O6I A;  5TPA A;  1LB8 A;  3TMG A;  1BP5 A;  4LZ8 A;  1UTB A;  3RNN A;  4R6K A;  4F19 A;  1PB8 A;  3Q29 A;  4DXC A;  3M3L A;  5H8N A;  4AB5 A;  3HV1 A;  3N6T A;  4R75 A;  4DLD A;  4QSE A;  3MPL A;  2CZL A;  2RKM A;  3SEY A;  1N7X A;  3K6U A;  2F7B A;  3KOS A;  1PBQ A;  4ZS9 A;  2V84 A;  3UA8 A;  3QSL A;  3FIR A;  5DYH A;  3F11 A;  4DCX A;  2O68 A;  5AA4 A;  3PMX A;  5AA3 A;  1Z7N E;  3Q28 A;  1B51 A;  2QMW A;  3QUJ A;  3THI A;  3G3I A;  2Q2C A;  4I1D A;  1M5F A;  1Y3Q A;  3OEM A;  4ISU A;  2F7A A;  2Q89 A;  4QRZ A;  3O9P A;  3B6W A;  5H8Q B;  3W9V A;  1XHY A;  1WVJ A;  1JVY A;  1HSJ A;  4NF5 B;  2BJJ X;  3IOR A;  3C9H A;  3S2V A;  4GWO A;  2AYS A;  1OQG A;  2VP1 A;  2XXI A;  3PUX E;  5I2K B;  4ZEB A;  3Q25 A;  2XD3 A;  1II5 A;  4ND9 A;  2KLF A;  3VDF A;  4ZEK A;  3S9L C;  2O7I A;  2ZNT A;  3OSQ A;  1P1U A;  3RTW B;  4RPN A;  2XXU A;  3MJN A;  5L9O A;  4PFU A;  3O28 A;  2FYI A;  4JSO A;  3RLF E;  3KN7 A;  5H8S A;  5TU0 A;  2B65 A;  4PET A;  3TEP A;  2P0S A;  4Z7E A;  4I9D A;  1R9Q A;  2VOZ A;  1BKA A;  1H3D A;  1B7H A;  3FXU A;  4KYD A;  4FAJ A;  1B4Z A;  5LOM A;  1SQY A;  5BUU A;  2HCA A;  1B0H A;  1QUK A;  1LFH A;  2F6P A;  4U4X A;  1F9B A;  4MH5 A;  4AB6 A;  5L8D A;  5AA2 A;  3A09 A;  3KEI A;  4GIZ A;  1UTB B;  2E1S A;  3MUQ A;  1I6B A;  4OEU A;  1QKA A;  1H45 A;  4H65 A;  4NF4 A;  1VE4 A;  1POY 1;  5DTB A;  2PVU A;  1HSL A;  1B7Z A;  2H5Y A;  5ITP A;  1TFA A;  5CMC A;  1B52 A;  3ODB A;  4HW8 A;  3UP9 A;  3OEL A;  1MRP A;  4QFK A;  3EHU A;  3H4Z A;  4P0I A;  4BDQ A;  3KJ7 A;  2QPQ A;  1ZIU A;  2RF1 A;  4OET A;  2F5X A;  1CE2 A;  2CMO A;  3IOW A;  3PPQ A;  3U92 A;  5DVF A;  1YPN A;  1Y9U A;  3H3G A;  1A99 A;  4GRK A;  2XD2 A;  3JYR A;  1A54 A;  2RCA A;  4Q8R A;  1US5 A;  1FQF A;  1IQ7 A;  1D4N A;  4ESW A;  1B40 A;  1Y3P A;  4F3G A;  4ELP A;  4RPO A;  4IO3 A;  1MQD A;  3O6G A;  4HCY A;  4LZ7 A;  3IJO B;  2ONR A;  3OO9 A;  3FVO A;  2QRY A;  1UQW A;  4LAT A;  3L6H A;  4LQ2 A;  2ZXT A;  1JET A;  3VXB A;  2A5S A;  3RPW A;  3RT8 A;  2GRV A;  2IA4 A;  4RJZ A;  4YZZ A;  1NH7 A;  5F7V A;  1XC1 A;  1B9J A;  4U21 A;  3TYH A;  1NMU A;  4OHN A;  1WDN A;  4MF3 A;  2AIX A;  3ILT B;  4XXU A;  3PUZ E;  2I58 A;  3IB1 A;  5I56 A;  4MLV A;  2DQV A;  4U22 A;  4FED A;  3N26 A;  1NNK A;  3EHT A;  2YJP A;  4R6H A;  4QFL A;  1MQI A;  1URS A;  1P1N A;  1FQB A;  5CMM A;  2HAU A;  5CI5 A;  5ICQ A;  2O1M A;  2R6G E;  2UVH A;  3T9U A;  1MM6 A;  1OVT A;  3G7W A;  2QS4 A;  4G68 C;  1IZ1 A;  3PPR A;  4X48 A;  3PV0 E;  1MY4 A;  2VD2 A;  4WEP A;  3DLN A;  3VLV A;  4RXL A;  3G3F A;  3MVX A;  3R7X A;  2QMX A;  2NWJ A;  2PBW A;  2IEE A;  4O3B A;  1YTV A;  4JDF A;  4NF6 A;  3I6V A;  2Q8J A;  4G2Z A;  3H7M A;  1DMB A;  4LUB A;  5ICT A;  4F2Q A;  1ATG A;  1B5J A;  4YMB A;  5CMK A;  3LBS A;  3CFZ A;  5ITO A;  3IAZ A;  2DE3 A;  4X1B A;  1Y4T A;  1POT A;  4NWC A;  4I62 A;  2D21 A;  2OBG A;  1O63 A;  1ANF A;  1MY0 A;  4NTL A;  2O51 A;  2XX8 A;  2E0S A;  3PU5 A;  4GQO A;  1MXZ A;  1L5T A;  4KCD A;  1IXG A;  3T93 B;  1SVX B;  1Y1M A;  2REG A;  4YMA A;  3RY3 A;  4PP0 A;  3T96 B;  4LON B;  1UIV A;  4G8N A;  4RY1 A;  5A5X B;  4QFP A;  3DP6 A;  3O97 A;  4G8M A;  4FE8 A;  1BTJ A;  5I2N B;  5IKB A;  3USD A;  2H99 A;  1TXF A;  3TTR A;  2PT1 A;  2V3U A;  1I6A A;  4G4P A;  3M3K A;  4PQJ A;  2THI A;  1DTZ A;  5I56 B;  1ZKB A;  1PDA A;  2GH9 A;  2F8D A;  5H8Q A;  2F7C A;  4JWO A;  3LSL A;  2DWA A;  4YB7 A;  2DWI A;  1LAX A;  3LSW A;  3I3V A;  5I2K A;  2F34 A;  4C1T A;  4DXU A;  3E3K A;  2P2A A;  4EUO A;  4ZEI A;  1IEJ A;  1VR5 A;  4OFL A;  5JEI A;  4NMY A;  4UA8 A;  4KFQ A;  5I59 B;  2ESN A;  3CRB A;  4GL8 A;  2F6G A;  3LUY A;  4NWD A;  3BFT A;  5FTI A;  1B3G A;  3ECR A;  4ZE8 A;  1JW1 A;  3LC8 A;  1A40 A;  1PBP A;  1PB9 A;  3FUZ A;  4HTG A;  3IB0 A;  1URD A;  3PMV A;  3KN8 A;  4MBP A;  3RUM A;  5H8F B;  1H76 A;  2HFB A;  1LFI A;  1PEB A;  4N6P A;  3G3J A;  5CM6 A;  4H67 A;  1JVX A;  2F35 A;  2DE2 A;  5L9M A;  1SBP A;  4NE4 A;  3LSX A;  2XXT A;  4EDP A;  2ZNU A;  2NXO A;  4H5G A;  3V89 B;  3VE1 B;  4H8I A;  4MFI A;  4F2O A;  1QJM A;  5H8H B;  2HAV A;  1FQA A;  4C1U A;  2HZL A;  2RC9 A;  1FTL A;  3PPN A;  4G68 B;  4XKP A;  3FJG A;  3IOT A;  1N3W A;  3T66 A;  4G8H A;  1FQC A;  1SW1 A;  3D4G A;  1NH8 A;  3OEN A;  3ZSF A;  4HCW A;  4GXS B;  2NVU B;  3TCH A;  4RK9 A;  1OMP A;  3TQW A;  2A5T B;  3PGF A;  2QL3 A;  1B4H A;  3IL1 B;  3UOR A;  4ELQ A;  4H1X A;  4KD5 A;  3AXF A;  1LST A;  3HCQ A;  3S9E A;  3CSB A;  3MC2 A;  3MP6 A;  3OO6 A;  5B70 A;  2Y7I A;  1NNP A;  3KZG A;  1QUL A;  3T9X B;  3UGW A;  3KFM A;  1N3X A;  3G3H A;  3SEW A;  3R26 A;  3DP4 A;  2O84 X;  3QYT A;  4QSD A;  3PMW A;  4F22 A;  4YKI A;  2RC7 A;  3FV1 A;  3R6U A;  4FJP A;  1B1X A;  3VVD A;  4EQB A;  2OCU A;  4OVJ A;  2ZYN A;  4OMB A;  1TFD A;  1N0T A;  4IB2 A;  3V5A A;  1OIB A;  4R6Y A;  4PFW A;  3RTF B;  2DYX A;  2DE4 A;  3JV9 A;  5F1Q A;  2F78 A;  3K2D A;  5HPQ A;  2GHA A;  1A8E A;  1M5C A;  4PFY A;  1MDQ A;  3ONM A;  2Y7P A;  3TFL A;  1IXH A;  3MVW A;  2GFE A;  3SET A;  4ESX A;  4DIG A;  2P1S A;  1FTJ A;  4YKK A;  2UYF A;  3K4U A;  4KYE A;  2D3I A;  2I3V A;  1AIV A;  3K6W A;  3A3C A;  3TDJ A;  3KN3 A;  4KYS A;  1ZMG A;  3UIF A;  3EHS A;  4E0W A;  1MXW A;  1SW4 A;  2I4C A;  2XXX A;  3T22 A;  2Z8D A;  5JK4 A;  2Q88 A;  1XVY A;  2QS1 A;  2FNC A;  1OLA A;  1DPE A;  1XS5 A;  4R2F A;  2O69 A;  1O7T A;  5KDT B;  4H8J A;  4UAC A;  4DE8 A;  2ZYO A;  3QXM A;  3S9M C;  4KHZ E;  4XTC Q;  1BIY A;  1OLC A;  1B2H A;  4R9F A;  4ZDM A;  3U94 A;  4FIM A;  4YKJ A;  1LAG E;  2I0B A;  3SES A;  3HN0 A;  1T0K A;  3C35 A;  3OSR A;  2DWJ A;  4F3B A;  5I58 B;  2NOO A;  1Q1K A;  2VHA A;  4H0W A;  3WAF A;  3HO7 A;  4EQ9 A;  2I4B A;  3W15 C;  2Q2A A;  3CG3 A;  3VXC A;  2ONS A;  1RKM A;  1MH4 A;  4OTE A;  4PFT A;  2DXR A;  2D5W A;  1RYX A;  3FJM A;  4OXV A;  3VLU A;  1FCK A;  2R9J A;  1ZTY A;  3PPO A;  3DEL B;  4MLQ A;  3BKI B;  1LCF A;  5A5X A;  1H43 A;  5I2N A;  3H6T A;  2HQ0 A;  5HM4 B;  3FGS A;  4F31 B;  4F29 A;  2RCB A;  2XXR A;  3UK4 A;  1YCJ A;  1FQD A;  3FAT A;  4IO7 A;  1MH3 A;  3OOA A;  4AQ4 A;  2PMS A;  2UVJ A;  3JZJ A;  3KOT A;  1AH5 A;  3D4C A;  1N84 A;  2PT2 A;  5B7D A;  3TKD A;  3TCF A;  1MQH A;  4QSC A;  2DOJ A;  1MDP 1;  3T9H B;  4ZZE A;  4ELR A;  4IY5 A;  4ZED A;  4BDN A;  3VLW A;  1FQE A;  2LAO A;  1B5I A;  1EZ9 A;  1URG A;  3H6V A;  5I59 A;  2V93 A;  3K00 A;  3CSG A;  3MVZ A;  2V3Q A;  4Q5T A;  2AL4 A;  3GBA A;  4U4S A;  4XIG Q;  3FVN A;  1B6H A;  1MXX A;  3MZ9 A;  2XX7 A;  1PC3 A;  1OVB A;  1A8F A;  3TZA A;  2HZK A;  4JWY A;  1SI0 A;  4X9T A;  5FHM A;  1O64 A;  2OZZ A;  4KQP A;  1NL5 A;  5H8F A;  3VVF A;  5CRY A;  3C34 A;  3OO8 A;  1EH3 A;  4K3F A;  4OES A;  4FAT A;  4IO2 A;  4U23 A;  3KSX A;  5K2Y A;  3K0V A;  3PUY E;  2VGQ A;  1HSE A;  1JW5 A;  3O29 A;  3B7D A;  3IOU A;  2PX1 A;  5IAI A;  1FTO A;  3OMB A;  1S9T A;  5DVJ A;  3QIM A;  2ZYM A;  5HBC A;  4F1Y A;  4HS7 A;  5H8H A;  2B3B A;  4N07 A;  2DP8 A;  4PE5 B;  4YKP A;  1MXV A;  5JTY B;  4G68 A;  3B6Q A;  2I0C A;  4R9G A;  3MZB A;  3EF7 A;  4YB6 A;  4THI A;  5I57 B;  5TP9 B;  3E9X A;  5BWJ A;  1MG1 A;  2Y7R A;  1WOD A;  4POW A;  5DEX B;  2A5T A;  3W9W A;  1MXY A;  2UVG A;  4IGR A;  1RYO A;  2Z23 A;  2I3W A;  1EZO A;  3O66 A;  1NNF A;  2Z8F A;  3OD7 A;  1IXC A;  3Q27 A;  3WAE A;  4FEC A;  3H03 A;  1JNF A;  3MVY A;  3V83 A;  4GFR A;  5AE4 A;  3VFJ A;  3RGY A;  2HXW A;  1XT8 A;  4JB7 A;  1GGG A;  3TQL A;  1YAE A;  2OJT A;  2WKY A;  1SI1 A;  5FTH A;  1B3E A;  3C31 A;  3IOV A;  1B58 A;  1NFT A;  4Q30 B;  3CVG A;  1P1W A;  4OYV A;  3V8X B;  1TWY A;  1QW0 A;  3EPE A;  4H6D A;  4X1D A;  1LAH E;  4P11 A;  2F36 A;  3RN8 A;  2ALU A;  3HHF A;  2I49 A;  4LZ5 A;  4EXL A;  1QUI A;  5FHO A;  5EHM A;  4OER A;  3HST A;  3S9N C;  1BLF A;  3M3F A;  4Q0C A;  3HHG A;  4BLA A;  2HEU A;  3T9V A;  2V3T A;  2Q9T A;  5CBR A;  2DVC A;  1P99 A;  3I5O A;  5CC2 A;  1B32 A;  4ZE9 A;  3H6W A;  1UIU A;  3PUW E;  3CFX A;  3C32 A;  5CMB A;  2X26 A;  3U1O A;  1EU8 A;  1MPD A;  2G29 A;  2OWS A;  1B05 A;  5CBS A;  1B7U A; 
#chains in the Genus database with same CATH topology
 4GOT A;  1XOC A;  2PYY A;  1JEU A;  4WKM A;  2DXY A;  4I8C A;  4MNC A;  4PTK A;  3U72 A;  1B3H A;  3SKP A;  4M1V A;  4R73 A;  4YAH X;  4PFB A;  4DXB A;  5I7I A;  4Z0I A;  1KWH A;  4PBQ A;  2B4L A;  4NHB A;  1NNT A;  3GLB A;  1TT1 A;  2H25 A;  4GVO A;  2YLN A;  3ILU B;  4MNP A;  1B1H A;  5M2V A;  5KDT A;  1YYZ A;  2R71 A;  3C33 A;  2QS2 A;  1MXU A;  4X8R A;  3LR1 A;  5ISU A;  1G0I A;  2QS3 A;  4PFR A;  3MPK A;  1NV7 A;  1J1N A;  1Z7M E;  5ET5 A;  3GBB A;  4LP2 B;  2QFL A;  2H98 A;  4NED A;  2XXV A;  4MMP A;  3QK6 A;  5LTC A;  4KI0 E;  3OEK A;  1FBP A;  3PD8 A;  1LFG A;  1NV3 A;  3SEX A;  3MP8 A;  4R72 A;  1DPP A;  5I58 A;  1MPB A;  4GL0 A;  2QSX A;  1B3L A;  3EN3 A;  1GTK A;  1P1O A;  2I6E A;  3FV2 A;  3C36 A;  3GZG A;  2RIN A;  4DZ1 A;  3E78 A;  4NX1 A;  3IO4 A;  2Y7W A;  3TOD A;  4R74 A;  1US4 A;  2REJ A;  2I48 A;  1B0L A;  1FW0 A;  4I3E A;  1VFE A;  1B3F A;  3G3K A;  2XX9 A;  2M8C A;  4IO6 A;  4NF8 B;  2V4C A;  1NUW A;  3QMF A;  1GV8 A;  1M5D A;  1K9Y A;  4JBZ A;  1FPI A;  4N13 A;  3U93 A;  4TQU Q;  3MAM A;  1NUZ A;  2WBB A;  1IIW A;  4P9K A;  4RK2 A;  1USY E;  2OLB A;  2OX3 A;  3CIJ A;  3FXQ A;  1MY2 A;  3N6U A;  1M5E A;  2OK2 A;  5ELV A;  1FPG A;  2OWT A;  4GBV A;  2FIX A;  1FBG A;  3KBR A;  2XXP A;  1UTH B;  4XEQ A;  5ET7 A;  1USY H;  4OQO A;  3RT6 B;  2XXH A;  4OFJ A;  4MNI A;  5FHN A;  2Y7K A;  3FZV A;  1BK4 A;  5TPA B;  1SYH A;  2VPO A;  5EYH A;  1LAF E;  1EZP A;  1NV1 A;  4H5F A;  1FRP A;  4O3C A;  3TEL A;  3K1N A;  1SW5 A;  3K01 A;  1PB7 A;  2Y5K A;  3CFL A;  4NN3 A;  5H8N B;  1LCT A;  3MW0 A;  4QFN A;  4LVQ A;  1DOT A;  4JSD A;  4TLL B;  3MQ9 A;  4FBP A;  4F3P A;  1ZU0 A;  3PD9 A;  3SDF A;  1RDZ A;  4OZ9 A;  3O6H A;  1GR2 A;  4PAI A;  5EHS A;  3K1P A;  3FJ7 A;  5I84 A;  1VDW A;  5AA2 D;  4QHQ A;  3OXN A;  5AA4 B;  2ONK E;  1ZLQ A;  3PPP A;  1ZJL A;  1QVS A;  1H44 A;  3GXA A;  4IY6 A;  2ANJ A;  2RC8 A;  3MP1 A;  2G93 A;  1JEV A;  1R9L A;  4OWD A;  4O3A A;  4F3S A;  3Q26 A;  1FPF A;  3S4U A;  2V25 A;  3E13 X;  3E4R A;  3BBR A;  3T1B A;  1LB9 A;  2QVR A;  3N5L A;  3A3U A;  1A55 A;  4YIC A;  1SYI A;  2KR0 A;  4ZZA A;  4BDL A;  2DWH A;  1S50 A;  1A7L A;  3SEV A;  4GX3 A;  1LLS A;  3U8Q A;  1CB6 A;  5JTY A;  3ZS6 A;  5J1D A;  3DM0 A;  3VVE A;  2ABH A;  2QJE A;  4WXJ A;  2VD3 A;  3ROJ A;  4F18 A;  3TAJ A;  5EYF A;  5I57 A;  4OEV A;  5TP9 A;  4P1L A;  1AMF A;  1NV6 A;  5DEX A;  4BDR A;  1FTK A;  2DS9 A;  4NAP A;  4P56 A;  1D9Q A;  3K6X A;  4R2B A;  4IO5 A;  3LSF B;  3UN6 A;  3TTN A;  1XVX A;  3B6T A;  3SER A;  4BDM A;  4L17 A;  2O6A A;  3H06 B;  1B46 A;  4P0G A;  4EXK A;  2DSF A;  3FXR A;  4ECF A;  4RNS A;  2UYE A;  4GXA A;  4XKR A;  3IB2 A;  4GD5 A;  4KCC A;  4AS4 A;  2XHD A;  5AA2 B;  1QUJ A;  1MM7 A;  1S7Y A;  1FTM A;  1ELJ A;  4U1O A;  4JVD A;  4RA1 A;  4HE2 A;  3TUS A;  1D9Y A;  2WYP A;  3FD3 A;  2XWI A;  1AL3 A;  2ZZW A;  3H6U A;  4F39 A;  4U2R A;  4NF4 B;  1D9V A;  3CR9 A;  5KCJ A;  1Y4C A;  2ZYK A;  1IUD A;  3IJX B;  1Y3N A;  4BDO A;  1QKB A;  4MHF A;  4JXI A;  2Z8E A;  1NKX A;  3RQT A;  3IX1 A;  3L6G A;  3ZKL A;  4OVQ A;  3QUF A;  3O2A A;  2XXW A;  3KC0 A;  3SEU A;  4FEB A;  3IR1 A;  3K6V A;  4ELO A;  4F1V A;  3N94 A;  3FVG A;  5L9S A;  3G3G A;  1MPC A;  1Q35 A;  1I6Q A;  3CG1 A;  3PTY A;  4LA9 A;  1ZBM A;  2Z22 A;  4ZEF A;  3HPI A;  1M5B A;  1IIT A;  5DT6 A;  1IMD A;  1VSO A;  1SW2 A;  2NUV A;  1P1Q A;  3KJT A;  3DP8 A;  1MY1 A;  4QF9 A;  1QGX A;  4TOZ A;  4LQ5 A;  1NV0 A;  1LGB C;  3OO7 A;  3TTK A;  4XKQ A;  1GVC A;  4POX A;  4DI4 B;  1LBB A;  4QFO A;  4HXV A;  4DCY A;  3TPA A;  4C0R A;  4XKN A;  5EQ8 A;  3P7I A;  2O7U A;  1LBC A;  2HPG A;  4TLM B;  2ZZV A;  4KR5 A;  3KGC A;  4RYA A;  4ONY A;  4PDD A;  3K02 A;  5K2X A;  4OVT A;  4OFO A;  2XXQ A;  2FBP A;  4F1U A;  4JWX A;  4EQ7 A;  1R1N A;  4MEV A;  3K1M A;  4U1Z A;  3FAS A;  2ZNS A;  2Q74 A;  3IK6 B;  1IXI A;  1VFD A;  4E0X A;  4WED A;  2UVI A;  4GF8 A;  3FVK A;  4DDD A;  4N6K A;  1MQG A;  2W7Y A;  5DVI A;  4N4U A;  4QXD A;  4G77 A;  1Y1Z A;  1MS7 A;  1LBX A;  3MBP A;  3TTL A;  3EQ1 A;  3KG2 A;  4OAN A;  1JW4 A;  4IO4 A;  1MY3 A;  4GX4 A;  5ET8 A;  4NF0 A;  2GHB A;  1INP A;  2XXY A;  3KSJ A;  1JQF A;  2O1L A;  4NF5 A;  1N7W A;  3M8U A;  1DSN A;  5AA1 A;  1DTG A;  3BFU A;  1N04 A;  4M4G A;  2AL5 A;  2PFZ A;  1SDX A;  4IGT A;  1R6Z A;  5KCJ B;  3IO6 A;  4KPT A;  1OQH A;  1SD3 A;  3VV5 A;  2H9B A;  2UXA A;  2X7P A;  1Y20 A;  2DVZ A;  2VT5 A;  4NF8 A;  3B50 A;  3C4M A;  4EF1 A;  1N76 A;  4GLI A;  4PE3 A;  2F97 A;  5FBP A;  4FOR A;  4YB5 A;  1MQJ A;  3E79 A;  1I69 A;  3QAX A;  5KZT A;  1B5H A;  4NF6 B;  2WBD A;  2Y84 A;  3ZKK A;  4YU0 A;  4MIJ A;  2HXR A;  2FA7 A;  2ZMB A;  3TCG A;  3MZ1 A;  1UTH A;  2H4I A;  3MWB A;  3TTM A;  3CI8 A;  4EF2 A;  4OEN A;  1AOV A;  2YPN A;  4ZEC A;  1D3K A;  2B3F A;  3PUV E;  4N6D A;  2X7Q A;  3O6I A;  5TPA A;  1LB8 A;  3TMG A;  2CZI A;  1BP5 A;  4LZ8 A;  1EYI A;  1UTB A;  3RNN A;  4R6K A;  4F19 A;  1PB8 A;  3Q29 A;  4PGP A;  4DXC A;  3M3L A;  5H8N A;  4AB5 A;  3HV1 A;  3N6T A;  4R75 A;  4DLD A;  4N15 A;  4QSE A;  3MPL A;  2CZL A;  2RKM A;  3KBZ A;  3SEY A;  1N7X A;  3K6U A;  2F7B A;  3KOS A;  1PBQ A;  4ZS9 A;  4PCD A;  2V84 A;  4PC9 A;  3UA8 A;  1FPE A;  3QSL A;  3FIR A;  4DI3 D;  5DYH A;  3IFA A;  3F11 A;  4DCX A;  2O68 A;  5AA4 A;  3PMX A;  4P47 A;  5AA3 A;  1Z7N E;  3Q28 A;  1B51 A;  1AWB A;  2QMW A;  3QUJ A;  3THI A;  2XWO A;  3G3I A;  2Q2C A;  4I1D A;  1M5F A;  1Y3Q A;  1LBZ A;  3OEM A;  4ISU A;  2F7A A;  2Q89 A;  4QRZ A;  3O9P A;  2WEF A;  3B6W A;  5H8Q B;  3W9V A;  1XHY A;  1WVJ A;  1JVY A;  1HSJ A;  4NF5 B;  2BJJ X;  3IOR A;  3C9H A;  5A5L A;  3S2V A;  4GWO A;  2AYS A;  1OQG A;  2VP1 A;  2XXI A;  3NOH A;  3PUX E;  5I2K B;  1NUX A;  5I5P A;  4ZEB A;  3Q25 A;  2XD3 A;  1II5 A;  4ND9 A;  2KLF A;  3VDF A;  4ZEK A;  3S9L C;  2XWV A;  2O7I A;  1FTA A;  2ZNT A;  3OSQ A;  1P1U A;  3RTW B;  4RPN A;  2XXU A;  3MJN A;  5L9O A;  4PFU A;  4UAB A;  3O28 A;  2FYI A;  5EYG A;  4JSO A;  3RLF E;  3KN7 A;  5H8S A;  5TU0 A;  2B65 A;  4PET A;  1RDX A;  3TEP A;  2P0S A;  4Z7E A;  4I9D A;  1R9Q A;  2VOZ A;  1BKA A;  1DK4 A;  1H3D A;  1B7H A;  3FXU A;  5LDZ A;  4KYD A;  4FAJ A;  1B4Z A;  5LOM A;  1SQY A;  5BUU A;  2HCA A;  1B0H A;  1QUK A;  4OVS A;  1IME A;  1LFH A;  2F6P A;  4U4X A;  1F9B A;  4MH5 A;  4AB6 A;  5L8D A;  5AA2 A;  3A09 A;  3KEI A;  4GIZ A;  1IMB A;  1UTB B;  2E1S A;  3EKI A;  3MUQ A;  1I6B A;  4GWS A;  4OEU A;  1QKA A;  1FPB A;  2ZZX A;  2PFY A;  1H45 A;  4H65 A;  4NF4 A;  2HHM A;  1VE4 A;  1POY 1;  4N81 A;  5DTB A;  4G61 A;  2PVU A;  2BJI A;  1HSL A;  1B7Z A;  2H5Y A;  5ITP A;  1TFA A;  5CMC A;  1B52 A;  3ODB A;  4HW8 A;  3UP9 A;  3OEL A;  1MRP A;  4QFK A;  3EHU A;  3H4Z A;  4P0I A;  1DCU A;  4BDQ A;  3KJ7 A;  4LN5 A;  2QPQ A;  1SPI A;  1ZIU A;  2RF1 A;  4OET A;  2F5X A;  1CE2 A;  4GWX A;  2CMO A;  3IOW A;  3PPQ A;  3U92 A;  5DVF A;  1YPN A;  1Y9U A;  3H3G A;  1A99 A;  4GRK A;  2XD2 A;  3JYR A;  1A54 A;  2RCA A;  4Q8R A;  1US5 A;  1FQF A;  1IQ7 A;  1D4N A;  1YZ0 A;  4ESW A;  1LBW A;  1B40 A;  1Y3P A;  4P8B A;  4F3G A;  4ELP A;  2F3D A;  4RPO A;  4IO3 A;  1MQD A;  3O6G A;  4HCY A;  4LZ7 A;  3IJO B;  2ONR A;  3OO9 A;  3FVO A;  2QRY A;  1UQW A;  1NV2 A;  4LAT A;  3L6H A;  4LQ2 A;  2ZXT A;  1JET A;  3VXB A;  2A5S A;  3RPW A;  3RT8 A;  2DDK A;  1FSA A;  3FXB A;  2GRV A;  2IA4 A;  4RJZ A;  4YZZ A;  2L5V A;  1NH7 A;  5F7V A;  1XC1 A;  1B9J A;  4U21 A;  5EQ7 A;  3TYH A;  2CZK A;  1NMU A;  4OHN A;  2WX9 A;  2FHY A;  4GWZ A;  1WDN A;  4PAK A;  4MF3 A;  2AIX A;  3ILT B;  4XXU A;  5IGA A;  3PUZ E;  2I58 A;  3IB1 A;  5I56 A;  4MLV A;  2DQV A;  4U22 A;  4FED A;  1DBZ A;  5IZZ A;  3N26 A;  1NNK A;  3EHT A;  2YJP A;  4R6H A;  1KA1 A;  4QFL A;  1MQI A;  1URS A;  1EYK A;  1P1N A;  1FQB A;  5CMM A;  2HAU A;  5CI5 A;  5ICQ A;  2JJK A;  2O1M A;  2R6G E;  2UVH A;  3T9U A;  1MM6 A;  1OVT A;  3G7W A;  2QS4 A;  4G68 C;  1IZ1 A;  3PPR A;  4X48 A;  3PV0 E;  1MY4 A;  2VD2 A;  4WEP A;  3DLN A;  1FPJ A;  4HE1 A;  3VLV A;  4RXL A;  1LBV A;  3G3F A;  3MVX A;  3R7X A;  2QMX A;  2NWJ A;  2PBW A;  2IEE A;  4O3B A;  1YTV A;  4JDF A;  4NF6 A;  3I6V A;  2Q8J A;  4G2Z A;  3H7M A;  1DMB A;  4LUB A;  5ICT A;  4F2Q A;  3CHG A;  1ATG A;  1B5J A;  4YMB A;  5CMK A;  1IMA A;  3LBS A;  3CFZ A;  5ITO A;  3IAZ A;  2DE3 A;  4X1B A;  1Y4T A;  1LBY A;  1POT A;  1LEV A;  4NWC A;  4I62 A;  4GWU A;  2D21 A;  2OBG A;  4PDH A;  2F3B A;  1O63 A;  1ANF A;  1MY0 A;  4NTL A;  2O51 A;  2XX8 A;  2E0S A;  3PU5 A;  4GQO A;  1MXZ A;  1L5T A;  4KCD A;  1IXG A;  4XF5 A;  3T93 B;  1SVX B;  1Y1M A;  4X04 A;  2REG A;  4YMA A;  1FBH A;  4GWY A;  3RY3 A;  4PP0 A;  3T96 B;  4LON B;  1UIV A;  4QBA A;  4G8N A;  4RY1 A;  2CZH A;  5A5X B;  4QFP A;  3DP6 A;  3O97 A;  4G8M A;  4FE8 A;  1BTJ A;  5I2N B;  3LUZ A;  5IKB A;  3USD A;  2H99 A;  1TXF A;  4H46 A;  3TTR A;  2PT1 A;  4JVI A;  2OWZ A;  2V3U A;  1I6A A;  4G4P A;  3M3K A;  4PQJ A;  1K9Z A;  3MYU A;  2THI A;  1DTZ A;  5I56 B;  1ZKB A;  1PDA A;  2GH9 A;  2F8D A;  5H8Q A;  2F7C A;  4JWO A;  3LSL A;  2DWA A;  4YB7 A;  2DWI A;  1LAX A;  3LSW A;  3I3V A;  5I2K A;  2F34 A;  4C1T A;  4DXU A;  3E3K A;  2P2A A;  4EUO A;  4ZEI A;  1IEJ A;  1VR5 A;  4OFL A;  5JEI A;  4NMY A;  4UA8 A;  4KFQ A;  5T3J A;  5I59 B;  2ESN A;  3CRB A;  4GL8 A;  2F6G A;  3LUY A;  4NWD A;  3BFT A;  5FTI A;  1B3G A;  3ECR A;  4ZE8 A;  1JW1 A;  3LC8 A;  4XFE A;  1A40 A;  1PBP A;  1PB9 A;  3FUZ A;  4HTG A;  3IB0 A;  1URD A;  3PMV A;  3KN8 A;  4MBP A;  3RUM A;  1XI6 A;  5H8F B;  1H76 A;  2HFB A;  1LFI A;  1PEB A;  4N6P A;  3G3J A;  5CM6 A;  4H67 A;  1JVX A;  2F35 A;  2DE2 A;  5L9M A;  1SBP A;  4NE4 A;  3LSX A;  2XXT A;  3ISP A;  4EDP A;  2ZNU A;  2NXO A;  4H5G A;  3V89 B;  3VE1 B;  4OA4 A;  4H8I A;  4MFI A;  4F2O A;  2WYK A;  1QJM A;  1FJ6 A;  5H8H B;  2HAV A;  1FQA A;  4C1U A;  2HZL A;  2RC9 A;  3MST A;  2CEX A;  1FTL A;  3PPN A;  4G68 B;  5EQA A;  4XKP A;  3FJG A;  3IOT A;  1N3W A;  3T66 A;  4G8H A;  1FQC A;  1SW1 A;  3D4G A;  1NH8 A;  3OEN A;  3LV0 A;  3ZSF A;  4HCW A;  2Q8M A;  4GXS B;  2NVU B;  3RPL B;  3TCH A;  4RK9 A;  1OMP A;  3TQW A;  4IR8 A;  4NQ8 A;  2A5T B;  3PGF A;  2QL3 A;  1B4H A;  3IL1 B;  3UOR A;  4ELQ A;  4H1X A;  4KD5 A;  3AXF A;  1LST A;  3HCQ A;  3A29 A;  3S9E A;  3CSB A;  3MC2 A;  3MP6 A;  3OO6 A;  5B70 A;  2Y7I A;  1NNP A;  3KZG A;  4HE0 A;  1QUL A;  3T9X B;  3UGW A;  1JP4 A;  3KFM A;  1N3X A;  2FVZ A;  3G3H A;  2FIE A;  1KA0 A;  3SEW A;  3R26 A;  3DP4 A;  2O84 X;  3QYT A;  4QSD A;  3PMW A;  4F22 A;  4YKI A;  2RC7 A;  4O7I A;  3FV1 A;  3R6U A;  4FJP A;  1B1X A;  3VVD A;  4EQB A;  2XA5 A;  2OCU A;  4OVJ A;  2ZYN A;  4OMB A;  1TFD A;  1N0T A;  4IB2 A;  3V5A A;  4PAF A;  1OIB A;  4R6Y A;  5J16 A;  4PFW A;  3RTF B;  2XWK A;  5IZ3 B;  2DYX A;  2DE4 A;  3JV9 A;  3SZP A;  4PF8 A;  5F1Q A;  2F78 A;  3K2D A;  5ET6 A;  2GHA A;  4N8Y A;  1A8E A;  5HPQ A;  4I40 A;  1M5C A;  4PFY A;  1MDQ A;  3ONM A;  2Y7P A;  3TFL A;  1IXH A;  3MVW A;  2GFE A;  3SET A;  4ESX A;  4DIG A;  2P1S A;  1FTJ A;  4YKK A;  4I3Y A;  2B4M A;  2UYF A;  2GQ1 A;  3K4U A;  5I3S A;  4KYE A;  2D3I A;  2I3V A;  1AIV A;  3K6W A;  3A3C A;  3TDJ A;  3KN3 A;  1IMF A;  4KYS A;  1ZMG A;  3UIF A;  3EHS A;  4E0W A;  1MXW A;  1SW4 A;  2I4C A;  2XXX A;  3T22 A;  2Z8D A;  5JK4 A;  2Q88 A;  1XVY A;  2QS1 A;  1CNQ A;  2FNC A;  1OLA A;  1Q9D A;  1DPE A;  1XS5 A;  5IZ1 A;  4R2F A;  2O69 A;  1O7T A;  1FPD A;  5KDT B;  4H8J A;  4UAC A;  4DE8 A;  5EQ9 A;  2ZYO A;  3QXM A;  3S9M C;  4KHZ E;  4XTC Q;  1BIY A;  4OVR A;  1OLC A;  1B2H A;  4R9F A;  4ZDM A;  3U94 A;  4FIM A;  4YKJ A;  1LAG E;  2I0B A;  4H45 A;  3SES A;  3HN0 A;  1T0K A;  5DW8 A;  3C35 A;  3OSR A;  2DWJ A;  4F3B A;  5I58 B;  2NOO A;  4PF6 A;  1Q1K A;  2VHA A;  4MCO A;  4H0W A;  3WAF A;  3HO7 A;  2QVV A;  4EQ9 A;  2I4B A;  3W15 C;  2Q2A A;  3CG3 A;  3VXC A;  2ONS A;  1RKM A;  1MH4 A;  1FBD A;  4OTE A;  4PFT A;  2DXR A;  2D5W A;  1RYX A;  3FJM A;  1NV4 A;  4OXV A;  3VLU A;  1FCK A;  2R9J A;  1ZTY A;  3PPO A;  3DEL B;  4MLQ A;  4PFI A;  3BKI B;  1LCF A;  5A5X A;  1H43 A;  5I2N A;  3H6T A;  2HQ0 A;  4N91 A;  5HM4 B;  3FGS A;  4F31 B;  4F29 A;  2RCB A;  2XXR A;  3UK4 A;  1YCJ A;  1FQD A;  4MJO A;  3FAT A;  4IO7 A;  1MH3 A;  4O7M A;  3OOA A;  4AQ4 A;  2PMS A;  2UVJ A;  3JZJ A;  3KOT A;  1AH5 A;  3D4C A;  1N84 A;  2PT2 A;  5B7D A;  3U65 A;  3TKD A;  1G0H A;  3TCF A;  1MQH A;  4QSC A;  2DOJ A;  1MDP 1;  3T0J A;  3T9H B;  4ZZE A;  4ELR A;  3B8B A;  4IY5 A;  4ZED A;  4BDN A;  3VLW A;  1FQE A;  4GWW A;  2LAO A;  1B5I A;  2CEY A;  1EZ9 A;  4P3L A;  1URG A;  3H6V A;  1FPL A;  5I59 A;  2V93 A;  3K00 A;  3CSG A;  3MVZ A;  2QVU A;  2V3Q A;  4JVC A;  4Q5T A;  2AL4 A;  1FBE A;  3GBA A;  4U4S A;  2VPN A;  4XIG Q;  3FVN A;  1B6H A;  1MXX A;  2P3V A;  5F24 A;  3MZ9 A;  2XX7 A;  1PC3 A;  1OVB A;  1A8F A;  3TZA A;  2HZK A;  3KC1 A;  1FPK A;  4JWY A;  4MX6 A;  1SI0 A;  4X9T A;  5FHM A;  1O64 A;  2OZZ A;  4KQP A;  1NL5 A;  5H8F A;  3VVF A;  5CRY A;  3C34 A;  3OO8 A;  1EH3 A;  4N17 A;  4K3F A;  4OES A;  4FAT A;  1YXI A;  4IO2 A;  4U23 A;  3KSX A;  5K2Y A;  3K0V A;  3PUY E;  2VGQ A;  1HSE A;  1JW5 A;  3O29 A;  2P3N A;  3HFU A;  3B7D A;  3IOU A;  2PX1 A;  5IAI A;  4GBW A;  1FTO A;  3OMB A;  3BIH A;  1S9T A;  4AS5 A;  5DVJ A;  3QIM A;  2ZYM A;  2MKZ A;  5HBC A;  4F1Y A;  4HS7 A;  5H8H A;  2B3B A;  4N07 A;  2DP8 A;  4PE5 B;  4GX6 A;  1NI9 A;  4YKP A;  1MXV A;  1IMC A;  5JTY B;  4G68 A;  2XXK A;  3B6Q A;  4O8M A;  2I0C A;  4R9G A;  3MZB A;  3EF7 A;  4YB6 A;  4THI A;  5I57 B;  5TP9 B;  2Y5L A;  3RPL A;  3E9X A;  5BWJ A;  1MG1 A;  4PBH A;  1RDY A;  2Y7R A;  3GYY A;  1WOD A;  4POW A;  5DEX B;  1FBC A;  2A5T A;  3D1R A;  3W9W A;  1MXY A;  2UVG A;  1KZ8 A;  4IGR A;  1RYO A;  2Z23 A;  4OVP A;  2I3W A;  3BIG A;  1EZO A;  3O66 A;  3IFC A;  1NNF A;  2Z8F A;  3OD7 A;  1IXC A;  3Q27 A;  4PGN A;  3WAE A;  4FEC A;  3H03 A;  1JNF A;  3MVY A;  3V83 A;  4GFR A;  5AE4 A;  3VFJ A;  3RGY A;  2HXW A;  1FJ9 A;  1XT8 A;  2R8T A;  4JB7 A;  1GGG A;  1FBF A;  3TQL A;  1YAE A;  2OJT A;  2WKY A;  1SI1 A;  1NUY A;  5ESY A;  5FTH A;  1B3E A;  3C31 A;  3IOV A;  1B58 A;  1NFT A;  4MAG A;  4Q30 B;  3CVG A;  1P1W A;  4OYV A;  2PCR A;  3V8X B;  1TWY A;  4P1E A;  1QW0 A;  3EPE A;  3RYD A;  4H6D A;  4X1D A;  1LAH E;  4N8G A;  2F36 A;  4P11 A;  3RN8 A;  2ALU A;  4O94 A;  3HHF A;  2I49 A;  4LZ5 A;  1NV5 A;  4KXP A;  5IZ3 A;  4EXL A;  1QUI A;  5FHO A;  5EHM A;  4OER A;  3HST A;  3S9N C;  1BLF A;  3M3F A;  4Q0C A;  3HHG A;  5IM2 A;  4BLA A;  1EYJ A;  2HEU A;  3T9V A;  2V3T A;  2Q9T A;  5CBR A;  2DVC A;  1P99 A;  3I5O A;  2KQZ A;  5CC2 A;  1B32 A;  4ZE9 A;  3H6W A;  1UIU A;  3PUW E;  3CFX A;  3C32 A;  3FBP A;  5CMB A;  2X26 A;  3U1O A;  1EU8 A;  1MPD A;  2G29 A;  2OWS A;  1B05 A;  4NGU A;  5CBS A;  1B7U A;  4NG7 A; 
#chains in the Genus database with same CATH homology
 4GOT A;  1XOC A;  2PYY A;  1JEU A;  4WKM A;  2DXY A;  4I8C A;  3U72 A;  1B3H A;  3SKP A;  4M1V A;  4R73 A;  4YAH X;  4DXB A;  4Z0I A;  1KWH A;  1NNT A;  3GLB A;  1TT1 A;  2H25 A;  4GVO A;  2YLN A;  3ILU B;  1B1H A;  5M2V A;  5KDT A;  2R71 A;  3C33 A;  2QS2 A;  1MXU A;  3LR1 A;  5ISU A;  2QS3 A;  3MPK A;  1J1N A;  1Z7M E;  3GBB A;  4LP2 B;  2H98 A;  4NED A;  2XXV A;  3QK6 A;  4KI0 E;  3OEK A;  3PD8 A;  1LFG A;  3SEX A;  3MP8 A;  4R72 A;  1DPP A;  5I58 A;  1MPB A;  4GL0 A;  2QSX A;  1B3L A;  3EN3 A;  1GTK A;  1P1O A;  2I6E A;  3FV2 A;  3C36 A;  3GZG A;  2RIN A;  4DZ1 A;  3IO4 A;  2Y7W A;  3TOD A;  4R74 A;  1US4 A;  2REJ A;  2I48 A;  1B0L A;  1FW0 A;  1VFE A;  1B3F A;  3G3K A;  2XX9 A;  2M8C A;  4IO6 A;  4NF8 B;  1GV8 A;  1M5D A;  4JBZ A;  4N13 A;  3U93 A;  4TQU Q;  3MAM A;  1IIW A;  4RK2 A;  1USY E;  2OLB A;  3FXQ A;  3CIJ A;  1MY2 A;  3N6U A;  1M5E A;  2OK2 A;  5ELV A;  2OWT A;  3KBR A;  2XXP A;  1UTH B;  1USY H;  4OQO A;  3RT6 B;  2XXH A;  4OFJ A;  5FHN A;  2Y7K A;  3FZV A;  5TPA B;  1SYH A;  1LAF E;  1EZP A;  4H5F A;  4O3C A;  3TEL A;  3K1N A;  1SW5 A;  3K01 A;  1PB7 A;  3CFL A;  5H8N B;  1LCT A;  3MW0 A;  4QFN A;  4LVQ A;  1DOT A;  4JSD A;  4TLL B;  3MQ9 A;  4F3P A;  1ZU0 A;  3PD9 A;  3SDF A;  4OZ9 A;  3O6H A;  1GR2 A;  5EHS A;  3K1P A;  3FJ7 A;  5I84 A;  5AA2 D;  4QHQ A;  3OXN A;  5AA4 B;  2ONK E;  1ZLQ A;  3PPP A;  1ZJL A;  1QVS A;  1H44 A;  3GXA A;  4IY6 A;  2ANJ A;  2RC8 A;  3MP1 A;  2G93 A;  1JEV A;  1R9L A;  4OWD A;  4O3A A;  4F3S A;  3Q26 A;  3S4U A;  2V25 A;  3E13 X;  3E4R A;  3BBR A;  1LB9 A;  3N5L A;  3A3U A;  1A55 A;  4YIC A;  1SYI A;  4ZZA A;  4BDL A;  2DWH A;  1S50 A;  1A7L A;  3SEV A;  1LLS A;  3U8Q A;  1CB6 A;  5JTY A;  3ZS6 A;  5J1D A;  3DM0 A;  3VVE A;  2ABH A;  2QJE A;  4WXJ A;  2VD3 A;  4F18 A;  3TAJ A;  5EYF A;  5I57 A;  4OEV A;  5TP9 A;  1AMF A;  5DEX A;  4BDR A;  1FTK A;  2DS9 A;  3K6X A;  4R2B A;  4IO5 A;  3LSF B;  3UN6 A;  3TTN A;  1XVX A;  3B6T A;  3SER A;  4BDM A;  4L17 A;  2O6A A;  3H06 B;  1B46 A;  4P0G A;  4EXK A;  2DSF A;  3FXR A;  4ECF A;  4RNS A;  2UYE A;  4GXA A;  4XKR A;  3IB2 A;  4GD5 A;  4KCC A;  2XHD A;  5AA2 B;  1QUJ A;  1MM7 A;  1S7Y A;  1FTM A;  1ELJ A;  4U1O A;  4RA1 A;  3TUS A;  1D9Y A;  3FD3 A;  1AL3 A;  3H6U A;  4F39 A;  4U2R A;  4NF4 B;  1D9V A;  3CR9 A;  5KCJ A;  1Y4C A;  2ZYK A;  1IUD A;  3IJX B;  1Y3N A;  4BDO A;  1QKB A;  4JXI A;  2Z8E A;  1NKX A;  3RQT A;  3IX1 A;  3L6G A;  3ZKL A;  3QUF A;  3O2A A;  2XXW A;  3SEU A;  4FEB A;  4ELO A;  3IR1 A;  3K6V A;  4F1V A;  3N94 A;  3FVG A;  5L9S A;  3G3G A;  1MPC A;  1Q35 A;  1I6Q A;  3CG1 A;  4LA9 A;  1ZBM A;  2Z22 A;  4ZEF A;  3HPI A;  1M5B A;  1IIT A;  5DT6 A;  1VSO A;  1SW2 A;  2NUV A;  1P1Q A;  3KJT A;  3DP8 A;  1MY1 A;  4QF9 A;  4TOZ A;  4LQ5 A;  1LGB C;  3OO7 A;  3TTK A;  4XKQ A;  1GVC A;  4POX A;  1LBB A;  4QFO A;  4DCY A;  3TPA A;  4C0R A;  4XKN A;  3P7I A;  2O7U A;  1LBC A;  4TLM B;  4KR5 A;  3KGC A;  4RYA A;  4ONY A;  3K02 A;  5K2X A;  4OFO A;  2XXQ A;  4F1U A;  4JWX A;  4EQ7 A;  1R1N A;  3K1M A;  4U1Z A;  3FAS A;  2ZNS A;  3IK6 B;  1IXI A;  1VFD A;  4E0X A;  4WED A;  2UVI A;  4GF8 A;  3FVK A;  4DDD A;  1MQG A;  2W7Y A;  5DVI A;  4G77 A;  1Y1Z A;  1MS7 A;  3MBP A;  3TTL A;  3EQ1 A;  3KG2 A;  1JW4 A;  4IO4 A;  1MY3 A;  2GHB A;  2XXY A;  3KSJ A;  1JQF A;  2O1L A;  4NF5 A;  1N7W A;  3M8U A;  1DSN A;  5AA1 A;  1DTG A;  3BFU A;  1N04 A;  4M4G A;  2AL5 A;  1SDX A;  4IGT A;  1R6Z A;  5KCJ B;  3IO6 A;  4KPT A;  1OQH A;  1SD3 A;  3VV5 A;  2H9B A;  2UXA A;  2X7P A;  1Y20 A;  2DVZ A;  4NF8 A;  3C4M A;  4EF1 A;  1N76 A;  4GLI A;  2F97 A;  4FOR A;  4YB5 A;  1MQJ A;  1I69 A;  3QAX A;  5KZT A;  1B5H A;  4NF6 B;  2Y84 A;  3ZKK A;  4YU0 A;  2ZMB A;  2FA7 A;  3TCG A;  3MZ1 A;  1UTH A;  2H4I A;  3MWB A;  3TTM A;  3CI8 A;  4EF2 A;  4OEN A;  1AOV A;  2YPN A;  4ZEC A;  1D3K A;  2B3F A;  3PUV E;  2X7Q A;  3O6I A;  5TPA A;  1LB8 A;  3TMG A;  1BP5 A;  4LZ8 A;  1UTB A;  3RNN A;  4R6K A;  4F19 A;  1PB8 A;  3Q29 A;  4DXC A;  3M3L A;  5H8N A;  4AB5 A;  3HV1 A;  3N6T A;  4R75 A;  4DLD A;  4QSE A;  3MPL A;  2CZL A;  2RKM A;  3SEY A;  1N7X A;  3K6U A;  2F7B A;  3KOS A;  1PBQ A;  4ZS9 A;  2V84 A;  3UA8 A;  3QSL A;  3FIR A;  5DYH A;  3F11 A;  4DCX A;  2O68 A;  5AA4 A;  3PMX A;  5AA3 A;  1Z7N E;  3Q28 A;  1B51 A;  2QMW A;  3QUJ A;  3THI A;  3G3I A;  2Q2C A;  4I1D A;  1M5F A;  1Y3Q A;  3OEM A;  4ISU A;  2F7A A;  2Q89 A;  4QRZ A;  3O9P A;  3B6W A;  5H8Q B;  3W9V A;  1XHY A;  1WVJ A;  1JVY A;  1HSJ A;  4NF5 B;  2BJJ X;  3IOR A;  3C9H A;  3S2V A;  4GWO A;  2AYS A;  1OQG A;  2VP1 A;  2XXI A;  3PUX E;  5I2K B;  4ZEB A;  3Q25 A;  2XD3 A;  1II5 A;  4ND9 A;  2KLF A;  3VDF A;  4ZEK A;  3S9L C;  2O7I A;  2ZNT A;  3OSQ A;  1P1U A;  3RTW B;  4RPN A;  2XXU A;  3MJN A;  5L9O A;  4PFU A;  3O28 A;  2FYI A;  4JSO A;  3RLF E;  3KN7 A;  5H8S A;  5TU0 A;  2B65 A;  4PET A;  3TEP A;  2P0S A;  4Z7E A;  4I9D A;  1R9Q A;  2VOZ A;  1BKA A;  1H3D A;  1B7H A;  3FXU A;  4KYD A;  4FAJ A;  1B4Z A;  5LOM A;  1SQY A;  5BUU A;  2HCA A;  1B0H A;  1QUK A;  1LFH A;  2F6P A;  4U4X A;  1F9B A;  4MH5 A;  4AB6 A;  5L8D A;  5AA2 A;  3A09 A;  3KEI A;  4GIZ A;  1UTB B;  2E1S A;  3MUQ A;  1I6B A;  4OEU A;  1QKA A;  1H45 A;  4H65 A;  4NF4 A;  1VE4 A;  1POY 1;  5DTB A;  2PVU A;  1HSL A;  1B7Z A;  2H5Y A;  5ITP A;  1TFA A;  5CMC A;  1B52 A;  3ODB A;  4HW8 A;  3UP9 A;  3OEL A;  1MRP A;  4QFK A;  3EHU A;  3H4Z A;  4P0I A;  4BDQ A;  3KJ7 A;  2QPQ A;  1ZIU A;  2RF1 A;  4OET A;  2F5X A;  1CE2 A;  2CMO A;  3IOW A;  3PPQ A;  3U92 A;  5DVF A;  1YPN A;  1Y9U A;  3H3G A;  1A99 A;  4GRK A;  2XD2 A;  3JYR A;  1A54 A;  2RCA A;  4Q8R A;  1US5 A;  1FQF A;  1IQ7 A;  1D4N A;  4ESW A;  1B40 A;  1Y3P A;  4F3G A;  4ELP A;  4RPO A;  4IO3 A;  1MQD A;  3O6G A;  4HCY A;  4LZ7 A;  3IJO B;  2ONR A;  3OO9 A;  3FVO A;  2QRY A;  1UQW A;  4LAT A;  3L6H A;  4LQ2 A;  2ZXT A;  1JET A;  3VXB A;  2A5S A;  3RPW A;  3RT8 A;  2GRV A;  2IA4 A;  4RJZ A;  4YZZ A;  1NH7 A;  5F7V A;  1XC1 A;  1B9J A;  4U21 A;  3TYH A;  1NMU A;  4OHN A;  1WDN A;  4MF3 A;  2AIX A;  3ILT B;  4XXU A;  3PUZ E;  2I58 A;  3IB1 A;  5I56 A;  4MLV A;  2DQV A;  4U22 A;  4FED A;  3N26 A;  1NNK A;  3EHT A;  2YJP A;  4R6H A;  4QFL A;  1MQI A;  1URS A;  1P1N A;  1FQB A;  5CMM A;  2HAU A;  5CI5 A;  5ICQ A;  2O1M A;  2R6G E;  2UVH A;  3T9U A;  1MM6 A;  1OVT A;  3G7W A;  2QS4 A;  4G68 C;  1IZ1 A;  3PPR A;  4X48 A;  3PV0 E;  1MY4 A;  2VD2 A;  4WEP A;  3DLN A;  3VLV A;  4RXL A;  3G3F A;  3MVX A;  3R7X A;  2QMX A;  2NWJ A;  2PBW A;  2IEE A;  4O3B A;  1YTV A;  4JDF A;  4NF6 A;  3I6V A;  2Q8J A;  4G2Z A;  3H7M A;  1DMB A;  4LUB A;  5ICT A;  4F2Q A;  1ATG A;  1B5J A;  4YMB A;  5CMK A;  3LBS A;  3CFZ A;  5ITO A;  3IAZ A;  2DE3 A;  4X1B A;  1Y4T A;  1POT A;  4NWC A;  4I62 A;  2D21 A;  2OBG A;  1O63 A;  1ANF A;  1MY0 A;  4NTL A;  2O51 A;  2XX8 A;  2E0S A;  3PU5 A;  4GQO A;  1MXZ A;  1L5T A;  4KCD A;  1IXG A;  3T93 B;  1SVX B;  1Y1M A;  2REG A;  4YMA A;  3RY3 A;  4PP0 A;  3T96 B;  4LON B;  1UIV A;  4G8N A;  4RY1 A;  5A5X B;  4QFP A;  3DP6 A;  3O97 A;  4G8M A;  4FE8 A;  1BTJ A;  5I2N B;  5IKB A;  3USD A;  2H99 A;  1TXF A;  3TTR A;  2PT1 A;  2V3U A;  1I6A A;  4G4P A;  3M3K A;  4PQJ A;  2THI A;  1DTZ A;  5I56 B;  1ZKB A;  1PDA A;  2GH9 A;  2F8D A;  5H8Q A;  2F7C A;  4JWO A;  3LSL A;  2DWA A;  4YB7 A;  2DWI A;  1LAX A;  3LSW A;  3I3V A;  5I2K A;  2F34 A;  4C1T A;  4DXU A;  3E3K A;  2P2A A;  4EUO A;  4ZEI A;  1IEJ A;  1VR5 A;  4OFL A;  5JEI A;  4NMY A;  4UA8 A;  4KFQ A;  5I59 B;  2ESN A;  3CRB A;  4GL8 A;  2F6G A;  3LUY A;  4NWD A;  3BFT A;  5FTI A;  1B3G A;  3ECR A;  4ZE8 A;  1JW1 A;  3LC8 A;  1A40 A;  1PBP A;  1PB9 A;  3FUZ A;  4HTG A;  3IB0 A;  1URD A;  3PMV A;  3KN8 A;  4MBP A;  3RUM A;  5H8F B;  1H76 A;  2HFB A;  1LFI A;  1PEB A;  4N6P A;  3G3J A;  5CM6 A;  4H67 A;  1JVX A;  2F35 A;  2DE2 A;  5L9M A;  1SBP A;  4NE4 A;  3LSX A;  2XXT A;  4EDP A;  2ZNU A;  2NXO A;  4H5G A;  3V89 B;  3VE1 B;  4H8I A;  4MFI A;  4F2O A;  1QJM A;  5H8H B;  2HAV A;  1FQA A;  4C1U A;  2HZL A;  2RC9 A;  1FTL A;  3PPN A;  4G68 B;  4XKP A;  3FJG A;  3IOT A;  1N3W A;  3T66 A;  4G8H A;  1FQC A;  1SW1 A;  3D4G A;  1NH8 A;  3OEN A;  3ZSF A;  4HCW A;  4GXS B;  2NVU B;  3TCH A;  4RK9 A;  1OMP A;  3TQW A;  2A5T B;  3PGF A;  2QL3 A;  1B4H A;  3IL1 B;  3UOR A;  4ELQ A;  4H1X A;  4KD5 A;  3AXF A;  1LST A;  3HCQ A;  3S9E A;  3CSB A;  3MC2 A;  3MP6 A;  3OO6 A;  5B70 A;  2Y7I A;  1NNP A;  3KZG A;  1QUL A;  3T9X B;  3UGW A;  3KFM A;  1N3X A;  3G3H A;  3SEW A;  3R26 A;  3DP4 A;  2O84 X;  3QYT A;  4QSD A;  3PMW A;  4F22 A;  4YKI A;  2RC7 A;  3FV1 A;  3R6U A;  4FJP A;  1B1X A;  3VVD A;  4EQB A;  2OCU A;  4OVJ A;  2ZYN A;  4OMB A;  1TFD A;  1N0T A;  4IB2 A;  3V5A A;  1OIB A;  4R6Y A;  4PFW A;  3RTF B;  2DYX A;  2DE4 A;  3JV9 A;  5F1Q A;  2F78 A;  3K2D A;  5HPQ A;  2GHA A;  1A8E A;  1M5C A;  4PFY A;  1MDQ A;  3ONM A;  2Y7P A;  3TFL A;  1IXH A;  3MVW A;  2GFE A;  3SET A;  4ESX A;  4DIG A;  2P1S A;  1FTJ A;  4YKK A;  2UYF A;  3K4U A;  4KYE A;  2D3I A;  2I3V A;  1AIV A;  3K6W A;  3A3C A;  3TDJ A;  3KN3 A;  4KYS A;  1ZMG A;  3UIF A;  3EHS A;  4E0W A;  1MXW A;  1SW4 A;  2I4C A;  2XXX A;  3T22 A;  2Z8D A;  5JK4 A;  2Q88 A;  1XVY A;  2QS1 A;  2FNC A;  1OLA A;  1DPE A;  1XS5 A;  4R2F A;  2O69 A;  1O7T A;  5KDT B;  4H8J A;  4UAC A;  4DE8 A;  2ZYO A;  3QXM A;  3S9M C;  4KHZ E;  4XTC Q;  1BIY A;  1OLC A;  1B2H A;  4R9F A;  4ZDM A;  3U94 A;  4FIM A;  4YKJ A;  1LAG E;  2I0B A;  3SES A;  3HN0 A;  1T0K A;  3C35 A;  3OSR A;  2DWJ A;  4F3B A;  5I58 B;  2NOO A;  1Q1K A;  2VHA A;  4H0W A;  3WAF A;  3HO7 A;  4EQ9 A;  2I4B A;  3W15 C;  2Q2A A;  3CG3 A;  3VXC A;  2ONS A;  1RKM A;  1MH4 A;  4OTE A;  4PFT A;  2DXR A;  2D5W A;  1RYX A;  3FJM A;  4OXV A;  3VLU A;  1FCK A;  2R9J A;  1ZTY A;  3PPO A;  3DEL B;  4MLQ A;  3BKI B;  1LCF A;  5A5X A;  1H43 A;  5I2N A;  3H6T A;  2HQ0 A;  5HM4 B;  3FGS A;  4F31 B;  4F29 A;  2RCB A;  2XXR A;  3UK4 A;  1YCJ A;  1FQD A;  3FAT A;  4IO7 A;  1MH3 A;  3OOA A;  4AQ4 A;  2PMS A;  2UVJ A;  3JZJ A;  3KOT A;  1AH5 A;  3D4C A;  1N84 A;  2PT2 A;  5B7D A;  3TKD A;  3TCF A;  1MQH A;  4QSC A;  2DOJ A;  1MDP 1;  3T9H B;  4ZZE A;  4ELR A;  4IY5 A;  4ZED A;  4BDN A;  3VLW A;  1FQE A;  2LAO A;  1B5I A;  1EZ9 A;  1URG A;  3H6V A;  5I59 A;  2V93 A;  3K00 A;  3CSG A;  3MVZ A;  2V3Q A;  4Q5T A;  2AL4 A;  3GBA A;  4U4S A;  4XIG Q;  3FVN A;  1B6H A;  1MXX A;  3MZ9 A;  2XX7 A;  1PC3 A;  1OVB A;  1A8F A;  3TZA A;  2HZK A;  4JWY A;  1SI0 A;  4X9T A;  5FHM A;  1O64 A;  2OZZ A;  4KQP A;  1NL5 A;  5H8F A;  3VVF A;  5CRY A;  3C34 A;  3OO8 A;  1EH3 A;  4K3F A;  4OES A;  4FAT A;  4IO2 A;  4U23 A;  3KSX A;  5K2Y A;  3K0V A;  3PUY E;  2VGQ A;  1HSE A;  1JW5 A;  3O29 A;  3B7D A;  3IOU A;  2PX1 A;  5IAI A;  1FTO A;  3OMB A;  1S9T A;  5DVJ A;  3QIM A;  2ZYM A;  5HBC A;  4F1Y A;  4HS7 A;  5H8H A;  2B3B A;  4N07 A;  2DP8 A;  4PE5 B;  4YKP A;  1MXV A;  5JTY B;  4G68 A;  3B6Q A;  2I0C A;  4R9G A;  3MZB A;  3EF7 A;  4YB6 A;  4THI A;  5I57 B;  5TP9 B;  3E9X A;  5BWJ A;  1MG1 A;  2Y7R A;  1WOD A;  4POW A;  5DEX B;  2A5T A;  3W9W A;  1MXY A;  2UVG A;  4IGR A;  1RYO A;  2Z23 A;  2I3W A;  1EZO A;  3O66 A;  1NNF A;  2Z8F A;  3OD7 A;  1IXC A;  3Q27 A;  3WAE A;  4FEC A;  3H03 A;  1JNF A;  3MVY A;  3V83 A;  4GFR A;  5AE4 A;  3VFJ A;  3RGY A;  2HXW A;  1XT8 A;  4JB7 A;  1GGG A;  3TQL A;  1YAE A;  2OJT A;  2WKY A;  1SI1 A;  5FTH A;  1B3E A;  3C31 A;  3IOV A;  1B58 A;  1NFT A;  4Q30 B;  3CVG A;  1P1W A;  4OYV A;  3V8X B;  1TWY A;  1QW0 A;  3EPE A;  4H6D A;  4X1D A;  1LAH E;  4P11 A;  2F36 A;  3RN8 A;  2ALU A;  3HHF A;  2I49 A;  4LZ5 A;  4EXL A;  1QUI A;  5FHO A;  5EHM A;  4OER A;  3HST A;  3S9N C;  1BLF A;  3M3F A;  4Q0C A;  3HHG A;  4BLA A;  2HEU A;  3T9V A;  2V3T A;  2Q9T A;  5CBR A;  2DVC A;  1P99 A;  3I5O A;  5CC2 A;  1B32 A;  4ZE9 A;  3H6W A;  1UIU A;  3PUW E;  3CFX A;  3C32 A;  5CMB A;  2X26 A;  3U1O A;  1EU8 A;  1MPD A;  2G29 A;  2OWS A;  1B05 A;  5CBS A;  1B7U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...