2F5XA

Structure of periplasmic binding protein bugd
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
299
structure length
299
Chain Sequence
YPERPVNMVVPFAAGGPTDNVARSLAESMRPTLGETVVVENKGGAGGTIGTTQVARAQPDGYSILLMHAGFSTAPSLYKNPGYEPYTSFEPIGLVVDVPMTIIARGDFPPNNIKELAEYVKKNADKISLANAGIGAASHLCGTMLVEALGVNLLTIPYKGTAPAMNDLLGKQVDLMCDQTTNTTQQITSGKVKAYAVTSLKRVPTLPDLPTMDESGYKGFEVGIWHGMWAPKGTPKPVVDKLVKSLQAGLADPKFQERMKQLGAEVLTNEANPEALQAKVKQQVPQWAELFKKAGVEKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords BugD
publication title Crystal Structure of Bordetella pertussis BugD Solute Receptor Unveils the Basis of Ligand Binding in a New Family of Periplasmic Binding Proteins
pubmed doi rcsb
source organism Bordetella pertussis tohama i
total genus 88
structure length 299
sequence length 299
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03401 TctC Tripartite tricarboxylate transporter family receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2f5xA02
3.40.190.150 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2f5xA01
3MZ1A 1B51A 4RY1A 4X1DA 5ICQA 2F6PA 1ANFA 3IB2A 2DE2A 5CC2A 1I6AA 3C32A 2Z8FA 3OD7A 4FEBA 3DELB 1VR5A 4GRKA 3T9HB 3ZKKA 1B3EA 2HAUA 1MQGA 3TCGA 4QFKA 2ONSA 2ZYKA 3H6WA 4KHZE 3F11A 3SETA 2DWJA 2A5SA 4LZ5A 1FQBA 3CFXA 3MQ9A 3T9XB 4YB5A 1SDXA 5ISUA 2HZLA 2PVUA 3IORA 4IO6A 4G68C 2GH9A 3TTLA 4I62A 4LP2B 4QFPA 4IO5A 1Z7ME 1MM6A 1B7UA 3SEXA 3QIMA 3K6WA 1CE2A 2DYXA 4EF1A 4OFLA 3EN3A 3A3CA 3O6HA 2HAVA 3S4UA 4NWCA 2HCAA 5I56B 3T93B 1LGBC 5FTIA 1R9LA 4XXUA 1DPPA 2F5XA 2DWIA 4R2FA 1A99A 3S9NC 1Y1ZA 5FHOA 4R6YA 4GL0A 3KFMA 3Q28A 5TU0A 3SDFA 1P1UA 3IR1A 1LBCA 4K3FA 4OERA 3V89B 5IKBA 4H5GA 4HCWA 4F1YA 4R6KA 1MY4A 5K2YA 2X7QA 1Y4CA 4NWDA 3VLUA 1XVYA 4XKPA 1GR2A 3U1OA 4QFLA 1URSA 3Q26A 3FJMA 4MBPA 4AQ4A 1JVXA 1O7TA 2THIA 4YU0A 1YPNA 3MJNA 3JYRA 4OETA 4P0GA 1PBPA 5FHMA 1PB9A 2QPQA 3G3IA 1IXHA 1VSOA 2P1SA 5KCJB 2DOJA 4KQPA 2DQVA 5CMCA 2W7YA 1N3WA 3RPWA 1FTJA 2NOOA 1OMPA 3KSJA 1GVCA 4DXUA 3TTKA 5JTYB 3PUVE 2ABHA 4E0WA 3H6VA 4HTGA 1D9YA 4OEVA 3RT6B 4DDDA 5FTHA 5L9MA 5CMMA 4PFYA 3HSTA 3L6HA 3IK6B 1UTBA 2VGQA 3SEYA 2XXWA 3SEWA 1MQJA 1JW4A 2H9BA 1FTLA 3PUYE 4NF6B 3DM0A 4NF5B 5IAIA 3JV9A 1H43A 2Q89A 2AYSA 2I4BA 1OIBA 1RYOA 5I57B 2O1LA 2PBWA 4EF2A 4DIGA 1B3GA 4NF4B 3OXNA 1Z7NE 2Z23A 1IXGA 3OEMA 1Y3PA 4RA1A 1B7ZA 2B3FA 2XXXA 2AIXA 2O7IA 4G68A 3PMXA 4R74A 4KI0E 1USYH 4QFOA 3PPQA 2G29A 3GXAA 2ALUA 1B58A 4ONYA 1P1NA 1QVSA 2ZYNA 4XKRA 1M5EA 3OOAA 1NKXA 1Y1MA 2ONRA 3RN8A 5I58A 2Y7RA 1ZTYA 5H8QB 1MXUA 3PMVA 4R72A 3T9VA 5ITPA 4R75A 4U21A 4JWOA 5A5XB 4EQBA 3CG1A 4Q5TA 4RK9A 3TTNA 4HW8A 1Q1KA 5F7VA 1II5A 1A54A 4F2OA 3EPEA 1MG1A 3BKIB 4F1VA 2I0BA 2VHAA 3GBBA 3SKPA 1N84A 1MXWA 4EQ9A 1B3LA 3KN3A 4H8JA 3B6QA 1ZJLA 2UVIA 4LATA 2DP8A 3IL1B 3R7XA 3TCHA 4QFNA 1B9JA 3PPPA 4YAHX 2F34A 5H8SA 3BFTA 1D4NA 3USDA 1MXZA 1I69A 2XXHA 3U92A 5AA2B 3O6IA 3I6VA 2F7BA 1JW1A 1IQ7A 3TEPA 5M2VA 1ZIUA 3HHFA 1XVXA 1BP5A 3K1NA 4FIMA 2RC8A 4U1ZA 1JEUA 4BDMA 2V25A 3MP8A 3QUFA 3VLWA 2XXVA 5DVJA 4GFRA 4PETA 1IITA 3KSXA 4NF8B 5TP9B 3U72A 3PU5A 3H03A 4R9GA 3GZGA 2O7UA 3MVZA 4ZEIA 1RYXA 4X1BA 5HM4B 5L9OA 3K1MA 4F3GA 1B1HA 4MF3A 3CG3A 3LUYA 5I2NB 3TQLA 2ZNUA 3N94A 4BDRA 3VFJA 4F1UA 2OLBA 5B7DA 4U4SA 5CM6A 1PC3A 3K1PA 1WODA 3Q25A 4QSEA 3CSBA 4ZEDA 3S9LC 4ECFA 3O9PA 3K4UA 1ZBMA 5B70A 3GLBA 4UA8A 3ZSFA 5AA4B 2OZZA 4F31B 1SVXB 4KCCA 2ZNSA 4ZE8A 2ANJA 3TODA 2ZNTA 2XXTA 1YTVA 5I59A 3VXCA 2I58A 4OHNA 1UTHA 3M8UA 1H44A 4O3CA 1N7XA 3D4GA 5I2KA 5JK4A 4I9DA 1IUDA 3OMBA 3BBRA 2F78A 1SI0A 3TTMA 3T66A 4G77A 1FQFA 4F3BA 4DXBA 3PV0E 1POTA 2RKMA 3LSXA 3CRBA 1XHYA 2QL3A 4DCXA 3FATA 1QUJA 4YB7A 4IO3A 4BDOA 2PT2A 3GBAA 1SW1A 2OK2A 3K6XA 2OBGA 1WVJA 4L17A 3FASA 3OO8A 3S2VA 3FJ7A 4IO4A 1MY0A 2Z22A 2OCUA 1I6QA 5CI5A 1OVBA 3Q29A 4H65A 2I48A 1MPDA 2YLNA 4OQOA 2HZKA 2Q9TA 3CFLA 2REGA 4ND9A 4NE4A 2Q8JA 4MLVA 4UACA 3TELA 4YMBA 1URDA 2F97A 5AE4A 3ZS6A 1ATGA 4KFQA 2F7CA 3I3VA 2UYFA 1EZ9A 3R26A 1JNFA 1MQHA 1SBPA 5CMBA 3QSLA 3TDJA 1D3KA 3C9HA 5H8FA 4G8NA 3PGFA 3N6TA 1Q35A 4GL8A 2HQ0A 3SERA 2DWAA 2KLFA 4JB7A 5DVFA 2RC9A 4OZ9A 1N7WA 3PUXE 4GXAA 4MFIA 1J1NA 3VVEA 4LZ7A 1MPBA 5KZTA 3WAFA 4ZZEA 1JW5A 1A40A 1LAFE 2DE3A 4U22A 1NL5A 1UIUA 2R71A 2DS9A 4H5FA 3TTRA 4JBZA 3HN0A 3MZBA 1O63A 3M3LA 3ILUB 1JEVA 4F3SA 1P1OA 3FV2A 2O69A 3L6GA 5I84A 3KG2A 4M1VA 3KOSA 4BDNA 1UIVA 3E13X 1P99A 3G3FA 2GFEA 4DE8A 2I3WA 1FW0A 2PYYA 4JSDA 2D5WA 4C1UA 1PB7A 1FQAA 3PPRA 1P1WA 4F29A 3RTFB 3PD8A 2OWTA 3K2DA 4I8CA 4POWA 2BJJX 2H25A 4YB6A 1R6ZA 5KDTA 2VD2A 3TCFA 1AH5A 3ZKLA 1EU8A 3H6TA 1USYE 3MPLA 2AL4A 3B6WA 2QS1A 4Z0IA 1SI1A 3RTWB 1LB8A 2QMWA 2XXQA 5H8HA 5K2XA 4KYDA 1LCFA 1HSEA 3EHTA 1LAXA 3MPKA 3N6UA 4IY6A 5HPQA 1H3DA 4R73A 1H45A 4LZ8A 3EF7A 4JXIA 3MUQA 4GVOA 4DLDA 3DP8A 3CFZA 3G3GA 1IXCA 4R2BA 3QYTA 1QJMA 5H8NB 3W15C 1A8EA 3E9XA 4OENA 3W9VA 3U93A 2Y7KA 2XXUA 1MDQA 3LC8A 4LUBA 4XIGQ 1DPEA 3LSLA 3O28A 1QULA 2X7PA 1DTGA 3OENA 3IB0A 4YKIA 3TPAA 3E4RA 4FAJA 3VDFA 4LA9A 1Y20A 2GHAA 4ZDMA 4X9TA 2Y7WA 3PMWA 2A5TB 4OXVA 4E0XA 1BTJA 1T0KA 3FD3A 2IA4A 4IGRA 5TPAA 3KBRA 2V3TA 3DP4A 3E3KA 1VE4A 3PD9A 2XXYA 3MP6A 2PX1A 2UVJA 1XOCA 3ECRA 5LOMA 1MY2A 1OLCA 3KGCA 3FVGA 4KCDA 5DEXB 3T22A 1PB8A 4ZE9A 3C31A 1ZU0A 4PFUA 2IEEA 4QSCA 2PT1A 2QRYA 1A7LA 1A8FA 3DP6A 4RXLA 4TQUQ 4WEPA 5DVIA 3TZAA 1TWYA 3IX1A 4H1XA 1JVYA 3MBPA 5HBCA 2DVCA 1HSJA 2ONKE 4GOTA 3IOVA 4YICA 2UVHA 1B46A 1NNTA 1FTKA 1NFTA 2E1SA 2QJEA 4H0WA 1IXIA 2DWHA 1DOTA 3H3GA 1LFHA 1LCTA 3A3UA 1PEBA 3KN7A 3QAXA 4C1TA 1QKBA 4H6DA 4F2QA 2ZYOA 2P0SA 3M3KA 4JDFA 4N07A 2XXPA 1GGGA 4Q30B 5I56A 4RJZA 1SD3A 3OO7A 4EQ7A 3OO9A 4GD5A 3SEVA 2D3IA 3VLVA 3UK4A 1N04A 3G3HA 1FTMA 2HXWA 4RK2A 4RYAA 2XD2A 2RCAA 4F19A 3MC2A 4RPNA 4YZZA 3B7DA 2FNCA 2Y7IA 1B5IA 4ZEKA 1UQWA 2O51A 2YPNA 1N76A 4OEUA 2XD3A 4LVQA 4U2RA 4EXKA 1FCKA 1FQEA 2H98A 3IOUA 3CR9A 1B5HA 1TFDA 3V83A 2P2AA 1ZMGA 5KCJA 3D4CA 3AXFA 1ZLQA 1MH3A 3OO6A 1OQHA 2H5YA 2NVUB 3QXMA 2XX7A 1SW5A 5JTYA 1QKAA 1B05A 1GV8A 2H99A 4IY5A 1XS5A 2LAOA 2B3BA 3KOTA 2RCBA 3PPNA 1OLAA 4BLAA 2QSXA 5CBSA 4NF6A 1S7YA 3VXBA 4Q8RA 4NF5A 1B40A 4G4PA 1VFDA 3K01A 4PE5B 1F9BA 3O2AA 2Y7PA 5I57A 2F35A 1OQGA 4OESA 1UTBB 4NF4A 1TXFA 1TFAA 1B2HA 2Q2AA 1Y3QA 1EZPA 4TLLB 5EHSA 1B5JA 3CIJA 3UN6A 3JZJA 1NNFA 2FA7A 2VD3A 3K02A 1H76A 3OSRA 1MS7A 4GWOA 3K6VA 2XHDA 3C33A 4THIA 3SESA 2QS2A 2DVZA 1EH3A 4PFWA 1LAHE 3N26A 3O6GA 4OMBA 4G68B 2V84A 5ICTA 4DXCA 4ZECA 5H8QA 1YAEA 4G8MA 2I0CA 4GF8A 1MY3A 3G7WA 4OFOA 2R6GE 3U8QA 4KPTA 1MRPA 4H8IA 5A5XA 2O6AA 3C35A 3EQ1A 5I58B 3OSQA 3OEKA 3G3JA 4AB5A 3KZGA 4M4GA 3QUJA 1JQFA 4FE8A 2E0SA 1O64A 2F6GA 4R9FA 4IO2A 3EHSA 1Y4TA 3KEIA 2DE4A 2REJA 3FVNA 2RC7A 4U1OA 3S9EA 2XXIA 4FECA 1M5DA 4QSDA 3VVFA 5AA2A 3O97A 4YKJA 2VOZA 3C4MA 2UXAA 4QHQA 1M5BA 4KD5A 3ILTB 1TT1A 2GRVA 3M3FA 1MXVA 1JETA 1US5A 1MM7A 3KJ7A 2GHBA 1ZKBA 4JWYA 4R6HA 3DLNA 3VE1B 5EYFA 1B0HA 1SW4A 3PPOA 4F39A 2HEUA 1B6HA 4Q0CA 4OYVA 3P7IA 2I6EA 4NF8A 1MQIA 5AA1A 1FQDA 3MW0A 5TP9A 3TMGA 4PQJA 2ZYMA 1URGA 1SW2A 4MLQA 1NH8A 3LBSA 1MXYA 2I3VA 3G3KA 5FHNA 3IJXB 1B4ZA 3O66A 4N6PA 3IO6A 3THIA 4KR5A 3H7MA 4XTCQ 3T96B 4DCYA 5I2NA 2O68A 4QF9A 3RQTA 2FYIA 3A09A 3R6UA 3V8XB 2DXYA 1QUKA 3FJGA 3N5LA 1NMUA 4GLIA 2ZXTA 1B7HA 4WEDA 5AA4A 2XX9A 4WXJA 4YKPA 1GTKA 4BDQA 2OWSA 2QS4A 3FUZA 3RGYA 4OVJA 1SYHA 1ELJA 1IEJA 3T9UA 3PUZE 1MPCA 5JEIA 1M5FA 1RKMA 1B52A 3K00A 2F7AA 4H67A 5AA2D 3IJOB 3ONMA 3KJTA 3RNNA 5DYHA 5J1DA 3EHUA 1P1QA 3FVOA 3CI8A 2UYEA 2NWJA 3Q27A 1MDP1 4FORA 5I59B 1UTHB 3TQWA 1QW0A 2WKYA 1PDAA 3FXRA 4OFJA 5I2KB 3U94A 4IO7A 3PUWE 4RNSA 5CMKA 1AIVA 1KWHA 4XKNA 2RF1A 3IOWA 3MWBA 1AMFA 4GXSB 3UP9A 4WKMA 3TAJA 3MP1A 1Y3NA 2NXOA 2D21A 4LQ2A 3HO7A 3FXUA 1IZ1A 3FGSA 2OJTA 5EHMA 3TUSA 4YKKA 1AOVA 4G2ZA 5DT6A 5F1QA 4ISUA 3MVXA 2X26A 4JSOA 4YMAA 5AA3A 3TFLA 1BLFA 4ESWA 2HFBA 4MH5A 4EXLA 1B3HA 4EDPA 1M5CA 3VV5A 1VFEA 2Y84A 1MQDA 1LFIA 3C34A 3MAMA 2AL5A 1US4A 4IGTA 1FTOA 3MVWA 3OELA 1LBBA 4ELPA 2VP1A 3UIFA 5ITOA 3O29A 5BWJA 4EUOA 3UA8A 1B32A 2M8CA 4OWDA 1Y9UA 1NH7A 4F3PA 3ODBA 4G8HA 3WAEA 2Z8EA 2I49A 4KYSA 5H8FB 4C0RA 3FIRA 5ELVA 2DXRA 3I5OA 2ZMBA 4X48A 2RINA 3HHGA 2XX8A 3C36A 4U4XA 4ZZAA 2UVGA 1LFGA 4P0IA 1B4HA 4NEDA 3MZ9A 2Q2CA 2XXRA 3UORA 2O1MA 2NUVA 4XKQA 4PFTA 3HPIA 1B3FA 1NNKA 3FV1A 4U23A 2B65A 3FZVA 4BDLA 3S9MC 1HSLA 4HCYA 1S50A 3H4ZA 4O3AA 1YCJA 5L9SA 4ZS9A 3K0VA 4F22A 1LB9A 3IOTA 1B0LA 1QUIA 3IB1A 1SYIA 1MY1A 3CVGA 3FXQA 1LSTA 3HCQA 4PP0A 3H06B 3TYHA 4JWXA 5CRYA 4RPOA 1N0TA 4FEDA 4QRZA 3RT8A 3QK6A 1B1XA 3TKDA 4TLMB 3SEUA 4POXA 1EZOA 4FJPA 3LSWA 1D9VA 2F36A 4ELRA 3KN8A 1L5TA 1R1NA 5KDTB 4O3BA 2YJPA 2CZLA 5BUUA 2V3QA 4F18A 1XT8A 4OTEA 1MXXA 1PBQA 2QS3A 4GQOA 5DTBA 1BKAA 5H8HB 3RY3A 4ELOA 4ELQA 4P11A 3VVDA 3B6TA 4HS7A 5H8NA 3LR1A 2O84X 1DSNA 1FQCA 3HV1A 4DZ1A 1SQYA 3BFUA 3H6UA 4GIZA 1N3XA 1POY1 1LAGE 5CBRA 4IB2A 1DMBA 5L8DA 3W9WA 1BIYA 1I6BA 2PMSA 2F8DA 2Z8DA 1A55A 3IO4A 2R9JA 4LQ5A 4NMYA 3RLFE 1AL3A 3LSFB 4FATA 3IAZA 3V5AA 1NNPA 1MH4A 2A5TA 1S9TA 2V93A 4Z7EA 2Q88A 1WDNA 2H4IA 1OVTA 4AB6A 1CB6A 3RUMA 1R9QA 2ESNA 4N13A 4LONB 4ESXA 1DTZA 4I1DA 4ZEBA 2V3UA 3CSGA 3UGWA 4KYEA 1XC1A 5TPAB 1LLSA 5DEXA 4ZEFA 2CMOA 2QMXA 2DSFA 3MVYA 3FVKA 4NTLA 3K6UA 2I4CA 1IIWA 2G93A 4TOZA
chains in the Genus database with same CATH superfamily
3MZ1A 4XF5A 1B51A 4RY1A 4X1DA 5ICQA 2F6PA 1ANFA 3IB2A 2DE2A 5CC2A 4P1EA 1I6AA 3C32A 2Z8FA 3OD7A 5I3SA 5ET5A 4FEBA 3DELB 1VR5A 4GRKA 3T9HB 3ZKKA 1B3EA 4I3EA 2HAUA 1MQGA 3TCGA 4MNIA 4QFKA 2ONSA 2ZYKA 3H6WA 4KHZE 3F11A 1YYZA 3SETA 2DWJA 2A5SA 4LZ5A 1FQBA 3CFXA 3MQ9A 3T9XB 4YB5A 2FIEA 1SDXA 3RPLB 5ISUA 2HZLA 2PVUA 3IORA 4IO6A 4G68C 2GH9A 3TTLA 4NHBA 4PF6A 4I62A 4LP2B 4OVRA 4QFPA 4IO5A 1Z7ME 1MM6A 3T1BA 2WYKA 1LBVA 1B7UA 3SEXA 1QGXA 3QIMA 3K6WA 1CE2A 1FBDA 2DYXA 4EF1A 4OFLA 3EN3A 3A3CA 3O6HA 2HAVA 3S4UA 4NWCA 2HCAA 5I56B 3T93B 1LGBC 5FTIA 1R9LA 4XXUA 4GBVA 1DPPA 2F5XA 1IMBA 2DWIA 4R2FA 1A99A 3S9NC 1Y1ZA 5FHOA 4R6YA 4GL0A 3KFMA 3Q28A 5TU0A 3SDFA 1P1UA 4NQ8A 3IR1A 1CNQA 1LBCA 4NAPA 4K3FA 4OERA 3V89B 5IKBA 4H5GA 4HCWA 4F1YA 4R6KA 1MY4A 1NUZA 5K2YA 2OWZA 2X7QA 1Y4CA 4NWDA 3VLUA 1XVYA 4XKPA 1GR2A 3U1OA 4QFLA 1URSA 3Q26A 3FJMA 4MBPA 4AQ4A 1JVXA 1O7TA 2THIA 4YU0A 1YPNA 3MJNA 3JYRA 4OETA 4P0GA 1PBPA 5FHMA 1PB9A 2QPQA 3G3IA 1IXHA 1VSOA 2P1SA 5KCJB 2DOJA 4KQPA 1FPBA 2DQVA 5CMCA 2FHYA 2W7YA 1N3WA 3RPWA 4NG7A 1FTJA 2NOOA 1OMPA 3KSJA 1GVCA 4DXUA 3TTKA 5JTYB 3PUVE 5FBPA 2ABHA 4E0WA 3H6VA 4HTGA 1D9YA 4OEVA 3RT6B 4DDDA 2XWIA 5FTHA 5L9MA 5CMMA 4PFYA 3HSTA 3L6HA 3IK6B 1UTBA 2VGQA 3SEYA 2XXWA 3SEWA 1MQJA 1JW4A 2H9BA 1FTLA 3PUYE 4NF6B 3DM0A 4NF5B 5IAIA 3JV9A 1H43A 2Q89A 4G61A 4JVIA 1INPA 2AYSA 2I4BA 1OIBA 4N8YA 1RYOA 2PFZA 5I57B 2O1LA 2PBWA 4EF2A 4PGNA 4DIGA 1B3GA 4NF4B 4GX3A 3OXNA 1Z7NE 2Z23A 1IXGA 3OEMA 1Y3PA 4RA1A 1B7ZA 2B3FA 2XXXA 2AIXA 2O7IA 4HE1A 4G68A 3PMXA 4R74A 4KI0E 1USYH 4QFOA 3PPQA 2G29A 3GXAA 2ALUA 1B58A 1FPDA 4ONYA 1FRPA 1P1NA 4PAKA 1QVSA 2ZYNA 4XKRA 1M5EA 3OOAA 1NKXA 1Y1MA 2ONRA 4LN5A 3RN8A 5I58A 2Y7RA 5LDZA 1ZTYA 1K9YA 5H8QB 1MXUA 3PMVA 4R72A 3T9VA 5ITPA 2QVVA 4R75A 4PE3A 4U21A 3HFUA 4JWOA 5A5XB 4EQBA 3CG1A 4Q5TA 4RK9A 3TTNA 4HW8A 1Q1KA 5F7VA 1II5A 5ET7A 1A54A 4F2OA 4MEVA 5IZZA 3EPEA 1MG1A 3BKIB 4F1VA 2I0BA 2ZZVA 2VHAA 4PBHA 3GBBA 3SKPA 1N84A 4PFRA 1NI9A 1MXWA 4EQ9A 1B3LA 3KN3A 4H8JA 3B6QA 1ZJLA 2UVIA 4LATA 2DP8A 3IL1B 3R7XA 3TCHA 5T3JA 4QFNA 1B9JA 3PPPA 4YAHX 2F34A 5H8SA 5ESYA 3BFTA 1D4NA 3USDA 1MXZA 1I69A 2XXHA 3U92A 5AA2B 3O6IA 3I6VA 2F7BA 1JW1A 1IQ7A 3TEPA 4HXVA 5M2VA 1ZIUA 3HHFA 4XFEA 1XVXA 1BP5A 4QBAA 3K1NA 4FIMA 2RC8A 4U1ZA 1JEUA 4BDMA 2GQ1A 2V25A 3MP8A 3QUFA 3VLWA 2XXVA 5DVJA 4GFRA 4PETA 1IITA 3KSXA 4OVQA 4NF8B 5TP9B 3U72A 3PU5A 3H03A 4R9GA 3GZGA 2O7UA 2P3VA 3MVZA 4ZEIA 1RYXA 4X1BA 5HM4B 5L9OA 3K1MA 4F3GA 1B1HA 4MF3A 3CG3A 3LUYA 3LV0A 5I2NB 3TQLA 2ZNUA 3N94A 4BDRA 3VFJA 4F1UA 2OLBA 5B7DA 4U4SA 5CM6A 1PC3A 3K1PA 1WODA 3Q25A 4QSEA 3CSBA 4ZEDA 3S9LC 4ECFA 3O9PA 3K4UA 1ZBMA 5B70A 3GLBA 4UA8A 3ZSFA 5AA4B 2OZZA 4F31B 4N6KA 2VPOA 1SVXB 4KCCA 2ZNSA 2VPNA 2R8TA 4ZE8A 4GWZA 2ANJA 4MMPA 3TODA 2ZNTA 2XXTA 4PDHA 1YTVA 5I59A 3VXCA 2I58A 4OHNA 1UTHA 3M8UA 1H44A 4O3CA 2WBBA 1N7XA 3D4GA 5I2KA 5JK4A 4I9DA 1IUDA 5ET8A 3OMBA 3BBRA 2F78A 1SI0A 3TTMA 3T66A 4G77A 1FQFA 3U65A 4F3BA 1FBFA 4DXBA 4N6DA 3PV0E 1POTA 2RKMA 1YXIA 4PAFA 3LSXA 3CRBA 1XHYA 2QL3A 2CZKA 4DCXA 3FATA 1QUJA 1RDXA 4YB7A 4IO3A 4BDOA 2PT2A 3GBAA 1DBZA 1SW1A 2OK2A 3K6XA 2OBGA 1WVJA 4L17A 3FASA 3OO8A 3S2VA 3FJ7A 3ISPA 4IO4A 3E79A 1MY0A 2Z22A 2OCUA 4MIJA 1I6QA 5CI5A 1OVBA 3Q29A 4H65A 2I48A 5I5PA 1MPDA 2YLNA 4OQOA 2HZKA 2Q9TA 3CFLA 2REGA 2CZHA 4ND9A 4NE4A 2Q8JA 4MLVA 3D1RA 4UACA 4OVPA 4AS5A 3TELA 4YMBA 1URDA 2F97A 5AE4A 3ZS6A 1FPIA 1ATGA 4KFQA 2F7CA 4JVCA 3I3VA 2UYFA 1EZ9A 4PCDA 3R26A 1JNFA 1MQHA 1SBPA 4O7MA 5CMBA 3QSLA 3TDJA 1D3KA 3C9HA 5H8FA 4G8NA 3PGFA 3N6TA 1Q35A 4GL8A 4MCOA 2HQ0A 3SERA 2DWAA 2KLFA 4JB7A 5DVFA 2RC9A 4OZ9A 1N7WA 3PUXE 5I7IA 4GXAA 4MFIA 1J1NA 3VVEA 4LZ7A 1MPBA 5KZTA 3WAFA 4ZZEA 1JW5A 1A40A 4N4UA 1LAFE 2DE3A 4U22A 1NL5A 1UIUA 2Q8MA 2R71A 2DS9A 5EQAA 4H5FA 3TTRA 4JBZA 1FPEA 3HN0A 4I3YA 3MZBA 1O63A 3M3LA 3ILUB 1JEVA 2Y5LA 4N17A 4F3SA 2VT5A 1P1OA 4H45A 3FV2A 2O69A 3L6GA 5I84A 3KG2A 4M1VA 5EYGA 3KOSA 4BDNA 1UIVA 3E13X 4NN3A 1P99A 3G3FA 2GFEA 4DE8A 5EQ9A 2I3WA 1FW0A 2PYYA 4JSDA 2D5WA 4C1UA 1PB7A 1FQAA 3PPRA 1P1WA 4F29A 3RTFB 3PD8A 2OWTA 1LBWA 3K2DA 4I8CA 4POWA 2BJJX 2H25A 4YB6A 1R6ZA 5KDTA 1IMCA 2VD2A 3TCFA 1AH5A 3ZKLA 4X04A 1EU8A 3H6TA 1FBCA 1USYE 3MPLA 2AL4A 2DDKA 3B6WA 2QS1A 4Z0IA 1SI1A 3RTWB 1LB8A 4MJOA 2QMWA 2XXQA 5H8HA 5K2XA 4KYDA 4PF8A 1LCFA 1HSEA 3EHTA 1LAXA 3MPKA 1NUXA 3N6UA 4IY6A 3B8BA 5HPQA 1H3DA 4R73A 1H45A 4LZ8A 3EF7A 4JXIA 3MUQA 4GVOA 4DLDA 1YZ0A 3DP8A 2HPGA 2Q74A 3CFZA 3G3GA 1IXCA 4R2BA 3QYTA 1QJMA 5H8NB 3W15C 1A8EA 3E9XA 4KXPA 4FBPA 4OENA 3W9VA 3U93A 2Y7KA 2XXUA 1G0HA 1MDQA 3LC8A 3NOHA 4LUBA 5IZ3B 4XIGQ 5LTCA 1DPEA 3LSLA 3O28A 1QULA 2X7PA 1DTGA 3OENA 3IB0A 4YKIA 3TPAA 3E4RA 4FAJA 3VDFA 4LA9A 1Y20A 2GHAA 4ZDMA 4X9TA 2Y7WA 3PMWA 2A5TB 4OXVA 4E0XA 1BTJA 1FBEA 4MAGA 1T0KA 3FD3A 2IA4A 4IGRA 5TPAA 3KBRA 2V3TA 3DP4A 3T0JA 3E3KA 1VE4A 3PD9A 2XXYA 3MP6A 2PX1A 2UVJA 4PTKA 1XOCA 3ECRA 5LOMA 1MY2A 1OLCA 3KGCA 4DI3D 1DK4A 3FVGA 4KCDA 5DEXB 3T22A 1PB8A 4ZE9A 2JJKA 3C31A 1ZU0A 1FPGA 4PFUA 2IEEA 4QSCA 2FBPA 4MNCA 1NV5A 2PT1A 2QRYA 1A7LA 1A8FA 3DP6A 4RXLA 1FJ9A 1FPKA 4TQUQ 4WEPA 5DVIA 3TZAA 1TWYA 4I40A 3B50A 3IX1A 4H1XA 1JVYA 3MBPA 3RPLA 5HBCA 2DVCA 1HSJA 2ONKE 1EYKA 4GOTA 1D9QA 3IOVA 4YICA 2UVHA 1B46A 5IM2A 1NNTA 1FTKA 1NFTA 2E1SA 2QJEA 4H0WA 1IXIA 2DWHA 1DOTA 3H3GA 1LFHA 1LCTA 3A3UA 2FVZA 1PEBA 3KN7A 3QAXA 4C1TA 1QKBA 4H6DA 5EQ7A 4F2QA 4MNPA 1FPJA 3KBZA 2ZYOA 2P0SA 3M3KA 4JDFA 1IMAA 4N07A 2XXPA 1GGGA 4Q30B 5I56A 4RJZA 1SD3A 3OO7A 4EQ7A 1EYIA 4N8GA 4X8RA 3OO9A 4GD5A 3SEVA 2D3IA 3VLVA 3UK4A 1N04A 3G3HA 1FTAA 1FTMA 2HXWA 4RK2A 1IMEA 4RYAA 2XD2A 4NGUA 2RCAA 4F19A 3MC2A 4RPNA 4YZZA 2XWVA 3B7DA 4HE2A 2FNCA 2KR0A 2Y7IA 1RDYA 1B5IA 4ZEKA 1UQWA 2O51A 2YPNA 3ROJA 1N76A 4OEUA 2XD3A 4LVQA 4U2RA 5IZ1A 4EXKA 3LUZA 1FCKA 1FQEA 2H98A 3IOUA 3CR9A 1B5HA 4NF0A 4IR8A 1TFDA 3V83A 3IFAA 2P2AA 4GX6A 1ZMGA 5KCJA 3D4CA 3QMFA 3AXFA 1ZLQA 1MH3A 3OO6A 1OQHA 2H5YA 2NVUB 4PC9A 3QXMA 2XX7A 1FPFA 1XI6A 1SW5A 5JTYA 1QKAA 1B05A 1GV8A 2H99A 4IY5A 1XS5A 2LAOA 2B3BA 2ZZWA 3KOTA 4PBQA 2RCBA 3PPNA 1OLAA 4BLAA 2QSXA 4QXDA 5CBSA 4NF6A 1S7YA 3VXBA 4Q8RA 4NF5A 1B40A 4G4PA 1VFDA 2ZZXA 3K01A 4PE5B 1F9BA 1AWBA 3O2AA 2Y7PA 3MYUA 5I57A 2F35A 1OQGA 4OESA 1UTBB 1NV4A 4NF4A 1TXFA 1TFAA 3IFCA 1B2HA 2Q2AA 1Y3QA 1EZPA 4TLLB 5EHSA 1B5JA 3CIJA 3UN6A 3JZJA 1NNFA 2FA7A 2VD3A 3K02A 1LBYA 1H76A 3OSRA 2PCRA 3EKIA 1MS7A 4P47A 2XWOA 3K6VA 4GWOA 2XHDA 4OVSA 3C33A 4THIA 3SESA 2QS2A 2DVZA 1EH3A 2V4CA 4JVDA 4PFWA 1LAHE 3N26A 3O6GA 4OMBA 4G68B 2V84A 5ICTA 1FJ6A 1KA0A 4DXCA 2WYPA 4ZECA 5H8QA 1YAEA 4G8MA 2I0CA 4GF8A 4PAIA 1MY3A 3G7WA 4OFOA 2R6GE 3U8QA 4KPTA 1MRPA 4H8IA 5A5XA 2MKZA 2O6AA 3C35A 3EQ1A 5I58B 3OSQA 3OEKA 3G3JA 4GWYA 4AB5A 3KZGA 4M4GA 3QUJA 1JQFA 4FE8A 4GWWA 2E0SA 1O64A 2F6GA 4R9FA 4MHFA 4IO2A 3EHSA 1Y4TA 3KEIA 2DE4A 2REJA 3FVNA 2RC7A 4U1OA 3S9EA 2XXIA 4FECA 1M5DA 3PTYA 4QSDA 3VVFA 5AA2A 3O97A 4YKJA 2VOZA 3C4MA 2UXAA 4QHQA 3KC1A 1M5BA 4KD5A 4DI4B 1NV0A 3ILTB 1FBGA 1TT1A 2GRVA 2XWKA 3M3FA 4AS4A 1MXVA 1JETA 1US5A 1MM7A 2QVUA 3KJ7A 2GHBA 1ZKBA 4JWYA 3CHGA 4R6HA 1NUWA 3DLNA 3VE1B 5J16A 5EYFA 4GBWA 1B0HA 1SW4A 3PPOA 4F39A 2HEUA 1B6HA 4Q0CA 4OYVA 1LEVA 3P7IA 2I6EA 4NF8A 1G0IA 4O7IA 1MQIA 5AA1A 1FQDA 2XXKA 3MW0A 5TP9A 3TMGA 4PQJA 2ZYMA 1URGA 1SW2A 4MLQA 4PGPA 1NH8A 4NX1A 3LBSA 1MXYA 1FBPA 2I3VA 3G3KA 5FHNA 2FIXA 3IJXB 1B4ZA 3O66A 4N6PA 3IO6A 3THIA 4PDDA 4KR5A 3H7MA 4XTCQ 3T96B 4DCYA 5I2NA 2O68A 4QF9A 4H46A 3RQTA 2FYIA 3A09A 3R6UA 3V8XB 2DXYA 1QUKA 3FJGA 3N5LA 1BK4A 1NMUA 4GLIA 2ZXTA 1B7HA 4WEDA 2BJIA 5AA4A 2XX9A 1K9ZA 4WXJA 2HXRA 4YKPA 1GTKA 1NV2A 4OANA 4BDQA 2OWSA 2QS4A 4O8MA 4P3LA 3FUZA 3RGYA 4OVJA 3RYDA 1SYHA 1ELJA 1IEJA 2OX3A 3T9UA 1NUYA 2QFLA 3PUZE 1MPCA 3BIHA 5JEIA 1M5FA 1RKMA 4P56A 1B52A 3K00A 2F7AA 4H67A 4GX4A 5AA2D 1NV7A 3IJOB 3ONMA 3KJTA 3RNNA 5DYHA 1LBXA 5J1DA 3EHUA 1P1QA 3FVOA 3CI8A 2UYEA 2NWJA 3Q27A 1MDP1 2WEFA 4FORA 5I59B 4O94A 1UTHB 3TQWA 1QW0A 2WKYA 1PDAA 3FXRA 4OFJA 5I2KB 3U94A 2CZIA 4IO7A 3PUWE 4RNSA 5CMKA 1AIVA 1KWHA 4XKNA 2RF1A 3IOWA 3MWBA 1Q9DA 4P9KA 1AMFA 4OA4A 4GXSB 3UP9A 3A29A 4WKMA 3TAJA 3MP1A 1Y3NA 2NXOA 2D21A 4LQ2A 3HO7A 3FXUA 1IZ1A 3FGSA 2OJTA 5EHMA 3TUSA 4YKKA 2B4LA 1AOVA 4G2ZA 5DT6A 5F1QA 4ISUA 3MVXA 2X26A 4JSOA 4YMAA 5AA3A 3TFLA 1BLFA 4ESWA 2HFBA 4MH5A 3KC0A 4EXLA 1B3HA 1NV6A 4EDPA 1M5CA 1LBZA 3SZPA 3VV5A 1VFEA 2Y84A 1MQDA 1LFIA 3C34A 3MAMA 2AL5A 1SPIA 1US4A 2QVRA 4IGTA 1FTOA 3MVWA 3OELA 1LBBA 4ELPA 4GWXA 2VP1A 3UIFA 5ITOA 1NV1A 3O29A 5BWJA 2Y5KA 4EUOA 3UA8A 1B32A 2M8CA 4UABA 4OWDA 1Y9UA 1NH7A 4F3PA 3ODBA 3FXBA 3GYYA 5F24A 4G8HA 3WAEA 2Z8EA 2I49A 4KYSA 5H8FB 4C0RA 2CEXA 3FIRA 4HE0A 5ELVA 2DXRA 3I5OA 4PFIA 2ZMBA 4X48A 2RINA 3HHGA 2XX8A 4P8BA 1IMFA 1IMDA 3C36A 4U4XA 1JP4A 4ZZAA 2UVGA 1LFGA 1EYJA 4P0IA 1B4HA 4NEDA 3MZ9A 2L5VA 2Q2CA 2XXRA 3UORA 2O1MA 2NUVA 4XKQA 4PFTA 3HPIA 1B3FA 1NNKA 3FV1A 2HHMA 4U23A 2B65A 3FZVA 4BDLA 3S9MC 1HSLA 4HCYA 2KQZA 1S50A 2XA5A 5ET6A 3H4ZA 4O3AA 1YCJA 4N91A 5L9SA 4ZS9A 2CEYA 1VDWA 3MSTA 3K0VA 4F22A 1LB9A 5DW8A 3IOTA 1B0LA 1QUIA 3IB1A 1SYIA 1MY1A 3CVGA 3FXQA 1LSTA 3HCQA 4PP0A 3H06B 3TYHA 4JWXA 4N81A 5CRYA 4RPOA 1N0TA 4FEDA 4QRZA 3RT8A 3QK6A 1B1XA 3TKDA 4TLMB 3SEUA 4POXA 1EZOA 4FJPA 3LSWA 1D9VA 2WX9A 1NV3A 2F36A 4ELRA 3KN8A 1L5TA 1R1NA 5KDTB 4O3BA 2YJPA 3BIGA 1FPLA 2CZLA 5BUUA 2V3QA 4F18A 1XT8A 4OTEA 1MXXA 5A5LA 1PBQA 2QS3A 4GQOA 5DTBA 1BKAA 5H8HB 3RY3A 4ELOA 4ELQA 5EQ8A 4P11A 3VVDA 4GWUA 3B6TA 4HS7A 5H8NA 3LR1A 2O84X 1DSNA 1FQCA 3HV1A 4DZ1A 2PFYA 1SQYA 3BFUA 4N15A 3H6UA 2F3BA 4GIZA 4P1LA 1N3XA 1POY1 4GWSA 3FBPA 1LAGE 5EYHA 5CBRA 1RDZA 4IB2A 1DMBA 3E78A 5L8DA 3W9WA 1BIYA 1I6BA 5IZ3A 5IGAA 2PMSA 2F8DA 2Z8DA 1A55A 3IO4A 4MX6A 2R9JA 4LQ5A 1FSAA 4NMYA 3RLFE 1DCUA 1AL3A 3LSFB 4FATA 3IAZA 3V5AA 1NNPA 2WBDA 1MH4A 1S9TA 2A5TA 2V93A 4Z7EA 1KA1A 2Q88A 1WDNA 2H4IA 1OVTA 4AB6A 1CB6A 3RUMA 1R9QA 2ESNA 1FBHA 4N13A 4LONB 4ESXA 1DTZA 4XEQA 4I1DA 4ZEBA 2V3UA 4PFBA 2B4MA 3CSGA 4OVTA 3UGWA 4KYEA 1XC1A 5TPAB 1LLSA 5DEXA 1KZ8A 2P3NA 4ZEFA 2CMOA 2QMXA 2F3DA 2DSFA 3MVYA 3FVKA 4NTLA 3K6UA 2I4CA 1IIWA 2G93A 4TOZA
chains in the Genus database with same CATH topology
3MZ1A 4XF5A 1B51A 4RY1A 4X1DA 5ICQA 2F6PA 1ANFA 3IB2A 2DE2A 5CC2A 4P1EA 1I6AA 3C32A 2Z8FA 3OD7A 5I3SA 5ET5A 4FEBA 3DELB 1VR5A 4GRKA 3T9HB 3ZKKA 1B3EA 4I3EA 2HAUA 1MQGA 3TCGA 4MNIA 4QFKA 2ONSA 2ZYKA 3H6WA 4KHZE 3F11A 1YYZA 3SETA 2DWJA 2A5SA 4LZ5A 1FQBA 3CFXA 3MQ9A 3T9XB 4YB5A 2FIEA 1SDXA 3RPLB 5ISUA 2HZLA 2PVUA 3IORA 4IO6A 4G68C 2GH9A 3TTLA 4NHBA 4PF6A 4I62A 4LP2B 4OVRA 4QFPA 4IO5A 1Z7ME 1MM6A 3T1BA 2WYKA 1LBVA 1B7UA 3SEXA 1QGXA 3QIMA 3K6WA 1CE2A 1FBDA 2DYXA 4EF1A 4OFLA 3EN3A 3A3CA 3O6HA 2HAVA 3S4UA 4NWCA 2HCAA 5I56B 3T93B 1LGBC 5FTIA 1R9LA 4XXUA 4GBVA 1DPPA 2F5XA 1IMBA 2DWIA 4R2FA 1A99A 3S9NC 1Y1ZA 5FHOA 4R6YA 4GL0A 3KFMA 3Q28A 5TU0A 3SDFA 1P1UA 4NQ8A 3IR1A 1CNQA 1LBCA 4NAPA 4K3FA 4OERA 3V89B 5IKBA 4H5GA 4HCWA 4F1YA 4R6KA 1MY4A 1NUZA 5K2YA 2OWZA 2X7QA 1Y4CA 4NWDA 3VLUA 1XVYA 4XKPA 1GR2A 3U1OA 4QFLA 1URSA 3Q26A 3FJMA 4MBPA 4AQ4A 1JVXA 1O7TA 2THIA 4YU0A 1YPNA 3MJNA 3JYRA 4OETA 4P0GA 1PBPA 5FHMA 1PB9A 2QPQA 3G3IA 1IXHA 1VSOA 2P1SA 5KCJB 2DOJA 4KQPA 1FPBA 2DQVA 5CMCA 2FHYA 2W7YA 1N3WA 3RPWA 4NG7A 1FTJA 2NOOA 1OMPA 3KSJA 1GVCA 4DXUA 3TTKA 5JTYB 3PUVE 5FBPA 2ABHA 4E0WA 3H6VA 4HTGA 1D9YA 4OEVA 3RT6B 4DDDA 2XWIA 5FTHA 5L9MA 5CMMA 4PFYA 3HSTA 3L6HA 3IK6B 1UTBA 2VGQA 3SEYA 2XXWA 3SEWA 1MQJA 1JW4A 2H9BA 1FTLA 3PUYE 4NF6B 3DM0A 4NF5B 5IAIA 3JV9A 1H43A 2Q89A 4G61A 4JVIA 1INPA 2AYSA 2I4BA 1OIBA 4N8YA 1RYOA 2PFZA 5I57B 2O1LA 2PBWA 4EF2A 4PGNA 4DIGA 1B3GA 4NF4B 4GX3A 3OXNA 1Z7NE 2Z23A 1IXGA 3OEMA 1Y3PA 4RA1A 1B7ZA 2B3FA 2XXXA 2AIXA 2O7IA 4HE1A 4G68A 3PMXA 4R74A 4KI0E 1USYH 4QFOA 3PPQA 2G29A 3GXAA 2ALUA 1B58A 1FPDA 4ONYA 1FRPA 1P1NA 4PAKA 1QVSA 2ZYNA 4XKRA 1M5EA 3OOAA 1NKXA 1Y1MA 2ONRA 4LN5A 3RN8A 5I58A 2Y7RA 5LDZA 1ZTYA 1K9YA 5H8QB 1MXUA 3PMVA 4R72A 3T9VA 5ITPA 2QVVA 4R75A 4PE3A 4U21A 4JWOA 3HFUA 5A5XB 4EQBA 3CG1A 4Q5TA 4RK9A 3TTNA 4HW8A 1Q1KA 5F7VA 1II5A 5ET7A 1A54A 4F2OA 4MEVA 5IZZA 3EPEA 1MG1A 3BKIB 4F1VA 2I0BA 2ZZVA 2VHAA 4PBHA 3GBBA 3SKPA 1N84A 4PFRA 1NI9A 1MXWA 4EQ9A 1B3LA 3KN3A 4H8JA 3B6QA 1ZJLA 2UVIA 4LATA 2DP8A 3IL1B 3R7XA 3TCHA 5T3JA 4QFNA 1B9JA 3PPPA 4YAHX 2F34A 5H8SA 5ESYA 3BFTA 1D4NA 3USDA 1MXZA 1I69A 2XXHA 3U92A 5AA2B 3O6IA 3I6VA 2F7BA 1JW1A 1IQ7A 3TEPA 4HXVA 5M2VA 1ZIUA 3HHFA 4XFEA 1XVXA 1BP5A 4QBAA 3K1NA 4FIMA 2RC8A 4U1ZA 1JEUA 4BDMA 2GQ1A 2V25A 3MP8A 3QUFA 3VLWA 2XXVA 5DVJA 4GFRA 4PETA 1IITA 3KSXA 4OVQA 4NF8B 5TP9B 3U72A 3PU5A 3H03A 4R9GA 3GZGA 2O7UA 3MVZA 4ZEIA 2P3VA 1RYXA 4X1BA 5HM4B 5L9OA 3K1MA 4F3GA 1B1HA 4MF3A 3CG3A 3LUYA 5I2NB 3LV0A 3TQLA 2ZNUA 3N94A 4BDRA 3VFJA 4F1UA 2OLBA 5B7DA 4U4SA 5CM6A 1PC3A 3K1PA 1WODA 3Q25A 4QSEA 3CSBA 4ZEDA 3S9LC 4ECFA 3O9PA 3K4UA 1ZBMA 5B70A 3GLBA 4UA8A 3ZSFA 5AA4B 2OZZA 4F31B 4N6KA 2VPOA 1SVXB 4KCCA 2ZNSA 2VPNA 2R8TA 4ZE8A 4GWZA 2ANJA 4MMPA 3TODA 2ZNTA 2XXTA 4PDHA 1YTVA 5I59A 3VXCA 2I58A 4OHNA 1UTHA 3M8UA 1H44A 4O3CA 2WBBA 1N7XA 3D4GA 5I2KA 5JK4A 4I9DA 1IUDA 5ET8A 3OMBA 3BBRA 2F78A 1SI0A 3TTMA 3T66A 4G77A 1FQFA 3U65A 4F3BA 1FBFA 4DXBA 4N6DA 3PV0E 1POTA 2RKMA 1YXIA 4PAFA 3LSXA 3CRBA 1XHYA 2QL3A 2CZKA 4DCXA 3FATA 1QUJA 4YB7A 1RDXA 4IO3A 4BDOA 2PT2A 3GBAA 1DBZA 1SW1A 2OK2A 3K6XA 2OBGA 1WVJA 4L17A 3FASA 3OO8A 3S2VA 3FJ7A 3ISPA 4IO4A 3E79A 1MY0A 2Z22A 2OCUA 4MIJA 1I6QA 5CI5A 1OVBA 3Q29A 4H65A 2I48A 5I5PA 1MPDA 2YLNA 4OQOA 2HZKA 2Q9TA 3CFLA 2REGA 2CZHA 4ND9A 4NE4A 2Q8JA 4MLVA 3D1RA 4UACA 4OVPA 4AS5A 3TELA 4YMBA 1URDA 2F97A 5AE4A 3ZS6A 1FPIA 1ATGA 4KFQA 2F7CA 4JVCA 3I3VA 2UYFA 1EZ9A 4PCDA 3R26A 1JNFA 1MQHA 1SBPA 4O7MA 5CMBA 3QSLA 3TDJA 1D3KA 3C9HA 5H8FA 4G8NA 3PGFA 3N6TA 1Q35A 4GL8A 4MCOA 2HQ0A 3SERA 2DWAA 2KLFA 4JB7A 5DVFA 2RC9A 4OZ9A 1N7WA 3PUXE 5I7IA 4GXAA 4MFIA 1J1NA 3VVEA 4LZ7A 1MPBA 5KZTA 3WAFA 4ZZEA 1JW5A 1A40A 4N4UA 1LAFE 2DE3A 4U22A 1NL5A 1UIUA 2Q8MA 2R71A 2DS9A 5EQAA 4H5FA 3TTRA 4JBZA 1FPEA 3HN0A 4I3YA 3MZBA 1O63A 3M3LA 3ILUB 1JEVA 2Y5LA 4N17A 4F3SA 2VT5A 1P1OA 4H45A 3FV2A 2O69A 3L6GA 5I84A 3KG2A 4M1VA 5EYGA 3KOSA 4BDNA 1UIVA 3E13X 4NN3A 1P99A 3G3FA 2GFEA 4DE8A 5EQ9A 2I3WA 1FW0A 2PYYA 4JSDA 2D5WA 4C1UA 1PB7A 1FQAA 3PPRA 1P1WA 4F29A 3RTFB 3PD8A 2OWTA 3K2DA 1LBWA 4I8CA 4POWA 2BJJX 2H25A 4YB6A 1R6ZA 5KDTA 1IMCA 2VD2A 3TCFA 1AH5A 3ZKLA 4X04A 1EU8A 3H6TA 1FBCA 1USYE 3MPLA 2AL4A 2DDKA 3B6WA 2QS1A 4Z0IA 1SI1A 3RTWB 1LB8A 4MJOA 2QMWA 2XXQA 5H8HA 5K2XA 4KYDA 4PF8A 1LCFA 1HSEA 3EHTA 1LAXA 3MPKA 1NUXA 3N6UA 4IY6A 3B8BA 5HPQA 1H3DA 4R73A 1H45A 4LZ8A 3EF7A 4JXIA 3MUQA 4GVOA 4DLDA 1YZ0A 3DP8A 2HPGA 2Q74A 3CFZA 3G3GA 1IXCA 4R2BA 3QYTA 1QJMA 5H8NB 3W15C 1A8EA 3E9XA 4KXPA 4FBPA 4OENA 3W9VA 3U93A 2Y7KA 2XXUA 1G0HA 1MDQA 3LC8A 3NOHA 4LUBA 5IZ3B 4XIGQ 5LTCA 1DPEA 3LSLA 3O28A 1QULA 2X7PA 1DTGA 3OENA 3IB0A 4YKIA 3TPAA 3E4RA 4FAJA 3VDFA 4LA9A 1Y20A 2GHAA 4ZDMA 4X9TA 2Y7WA 3PMWA 2A5TB 4OXVA 4E0XA 1BTJA 1FBEA 4MAGA 1T0KA 3FD3A 2IA4A 4IGRA 5TPAA 3KBRA 2V3TA 3DP4A 3T0JA 3E3KA 1VE4A 3PD9A 2XXYA 3MP6A 2PX1A 2UVJA 4PTKA 1XOCA 3ECRA 5LOMA 1MY2A 1OLCA 3KGCA 4DI3D 3FVGA 1DK4A 4KCDA 5DEXB 3T22A 1PB8A 4ZE9A 2JJKA 3C31A 1ZU0A 4PFUA 1FPGA 2IEEA 4QSCA 2FBPA 4MNCA 1NV5A 2PT1A 2QRYA 1A7LA 1A8FA 3DP6A 4RXLA 1FJ9A 1FPKA 4TQUQ 4WEPA 5DVIA 3TZAA 1TWYA 4I40A 3B50A 3IX1A 4H1XA 1JVYA 3MBPA 3RPLA 5HBCA 2DVCA 1HSJA 2ONKE 1EYKA 4GOTA 1D9QA 3IOVA 4YICA 2UVHA 1B46A 5IM2A 1NNTA 1FTKA 1NFTA 2E1SA 2QJEA 4H0WA 1IXIA 2DWHA 1DOTA 3H3GA 1LFHA 1LCTA 3A3UA 2FVZA 1PEBA 3KN7A 3QAXA 4C1TA 1QKBA 4H6DA 5EQ7A 4F2QA 4MNPA 1FPJA 3KBZA 2ZYOA 2P0SA 3M3KA 4JDFA 1IMAA 4N07A 2XXPA 1GGGA 4Q30B 5I56A 4RJZA 1SD3A 3OO7A 4EQ7A 1EYIA 4N8GA 4X8RA 3OO9A 4GD5A 3SEVA 2D3IA 3VLVA 3UK4A 1N04A 3G3HA 1FTAA 1FTMA 2HXWA 4RK2A 1IMEA 4RYAA 2XD2A 4NGUA 2RCAA 4F19A 3MC2A 4RPNA 4YZZA 2XWVA 3B7DA 4HE2A 2FNCA 2KR0A 2Y7IA 1RDYA 1B5IA 4ZEKA 1UQWA 2O51A 2YPNA 3ROJA 1N76A 4OEUA 2XD3A 4LVQA 4U2RA 5IZ1A 4EXKA 3LUZA 1FCKA 1FQEA 2H98A 3IOUA 3CR9A 1B5HA 4NF0A 4IR8A 1TFDA 3V83A 3IFAA 2P2AA 4GX6A 1ZMGA 5KCJA 3D4CA 3QMFA 3AXFA 1ZLQA 1MH3A 3OO6A 1OQHA 2H5YA 2NVUB 4PC9A 3QXMA 2XX7A 1FPFA 1XI6A 1SW5A 5JTYA 1QKAA 1B05A 1GV8A 2H99A 4IY5A 1XS5A 2LAOA 2B3BA 2ZZWA 3KOTA 4PBQA 2RCBA 3PPNA 1OLAA 4BLAA 2QSXA 4QXDA 5CBSA 4NF6A 1S7YA 3VXBA 4Q8RA 4NF5A 1B40A 4G4PA 1VFDA 2ZZXA 3K01A 4PE5B 1F9BA 1AWBA 3O2AA 2Y7PA 3MYUA 5I57A 2F35A 1OQGA 4OESA 1UTBB 1NV4A 4NF4A 1TXFA 1TFAA 3IFCA 1B2HA 2Q2AA 1Y3QA 1EZPA 4TLLB 5EHSA 1B5JA 3CIJA 3UN6A 3JZJA 1NNFA 2FA7A 2VD3A 3K02A 1LBYA 1H76A 3OSRA 2PCRA 3EKIA 1MS7A 4P47A 4GWOA 3K6VA 2XWOA 2XHDA 4OVSA 3C33A 4THIA 3SESA 2QS2A 2DVZA 1EH3A 2V4CA 4PFWA 4JVDA 1LAHE 3N26A 3O6GA 4OMBA 4G68B 2V84A 5ICTA 1FJ6A 1KA0A 4DXCA 2WYPA 4ZECA 5H8QA 1YAEA 4G8MA 2I0CA 4GF8A 4PAIA 1MY3A 3G7WA 4OFOA 2R6GE 3U8QA 4KPTA 1MRPA 4H8IA 5A5XA 2MKZA 2O6AA 3C35A 3EQ1A 5I58B 3OSQA 3OEKA 3G3JA 4GWYA 4AB5A 3KZGA 4M4GA 3QUJA 1JQFA 4FE8A 4GWWA 2E0SA 1O64A 2F6GA 4R9FA 4MHFA 4IO2A 3EHSA 1Y4TA 3KEIA 2DE4A 2REJA 3FVNA 2RC7A 4U1OA 3S9EA 2XXIA 4FECA 1M5DA 4QSDA 3PTYA 3VVFA 5AA2A 3O97A 4YKJA 2VOZA 3C4MA 2UXAA 4QHQA 3KC1A 1M5BA 4KD5A 4DI4B 1NV0A 3ILTB 1FBGA 1TT1A 2GRVA 2XWKA 3M3FA 4AS4A 1MXVA 1JETA 1US5A 1MM7A 2QVUA 3KJ7A 2GHBA 1ZKBA 4JWYA 4R6HA 3CHGA 3DLNA 1NUWA 3VE1B 5J16A 5EYFA 4GBWA 1B0HA 1SW4A 3PPOA 4F39A 2HEUA 1B6HA 4Q0CA 4OYVA 1LEVA 3P7IA 2I6EA 4NF8A 1G0IA 4O7IA 1MQIA 5AA1A 1FQDA 3MW0A 5TP9A 3TMGA 2XXKA 4PQJA 2ZYMA 1URGA 1SW2A 4MLQA 4PGPA 1NH8A 4NX1A 3LBSA 1MXYA 1FBPA 2I3VA 3G3KA 5FHNA 2FIXA 3IJXB 1B4ZA 3O66A 4N6PA 3IO6A 3THIA 4PDDA 4KR5A 3H7MA 4XTCQ 3T96B 4DCYA 5I2NA 2O68A 4QF9A 3RQTA 4H46A 2FYIA 3A09A 3R6UA 3V8XB 2DXYA 1QUKA 3FJGA 3N5LA 1BK4A 1NMUA 4GLIA 2ZXTA 1B7HA 4WEDA 2BJIA 5AA4A 2XX9A 4WXJA 1K9ZA 2HXRA 4YKPA 1GTKA 1NV2A 4OANA 4BDQA 2OWSA 2QS4A 4O8MA 4P3LA 3FUZA 3RGYA 4OVJA 3RYDA 1SYHA 1ELJA 1IEJA 2OX3A 3T9UA 1NUYA 2QFLA 3PUZE 1MPCA 3BIHA 5JEIA 1M5FA 1RKMA 4P56A 1B52A 3K00A 2F7AA 4H67A 4GX4A 5AA2D 1NV7A 3IJOB 3ONMA 3KJTA 3RNNA 5DYHA 5J1DA 1LBXA 3EHUA 1P1QA 3FVOA 3CI8A 2UYEA 2NWJA 3Q27A 1MDP1 2WEFA 4FORA 5I59B 4O94A 1UTHB 3TQWA 1QW0A 2WKYA 1PDAA 3FXRA 4OFJA 5I2KB 3U94A 2CZIA 4IO7A 3PUWE 4RNSA 5CMKA 1AIVA 1KWHA 4XKNA 2RF1A 3IOWA 3MWBA 1Q9DA 4P9KA 1AMFA 4OA4A 4GXSB 3UP9A 3A29A 4WKMA 3TAJA 3MP1A 1Y3NA 2NXOA 2D21A 4LQ2A 3HO7A 3FXUA 1IZ1A 3FGSA 2OJTA 5EHMA 3TUSA 4YKKA 2B4LA 1AOVA 4G2ZA 5DT6A 5F1QA 4ISUA 3MVXA 2X26A 4JSOA 4YMAA 5AA3A 3TFLA 1BLFA 4ESWA 2HFBA 4MH5A 4EXLA 3KC0A 1B3HA 1NV6A 4EDPA 1M5CA 1LBZA 3SZPA 3VV5A 1VFEA 2Y84A 1MQDA 1LFIA 3C34A 3MAMA 2AL5A 1SPIA 1US4A 4IGTA 2QVRA 1FTOA 3MVWA 3OELA 1LBBA 4ELPA 4GWXA 2VP1A 3UIFA 5ITOA 1NV1A 3O29A 5BWJA 2Y5KA 4EUOA 3UA8A 1B32A 2M8CA 4UABA 4OWDA 1Y9UA 1NH7A 4F3PA 3ODBA 3FXBA 3GYYA 5F24A 4G8HA 3WAEA 2Z8EA 2I49A 4KYSA 5H8FB 4C0RA 2CEXA 3FIRA 4HE0A 5ELVA 2DXRA 3I5OA 4PFIA 2ZMBA 4X48A 2RINA 3HHGA 2XX8A 4P8BA 1IMFA 1IMDA 3C36A 4U4XA 1JP4A 4ZZAA 2UVGA 1LFGA 1EYJA 4P0IA 1B4HA 4NEDA 3MZ9A 2L5VA 2Q2CA 2XXRA 3UORA 2O1MA 2NUVA 4XKQA 4PFTA 3HPIA 1B3FA 1NNKA 3FV1A 2HHMA 4U23A 2B65A 3FZVA 4BDLA 3S9MC 1HSLA 4HCYA 2KQZA 1S50A 2XA5A 5ET6A 3H4ZA 4O3AA 1YCJA 4N91A 5L9SA 4ZS9A 2CEYA 1VDWA 3MSTA 3K0VA 4F22A 1LB9A 5DW8A 3IOTA 1B0LA 1QUIA 3IB1A 1SYIA 1MY1A 3CVGA 3FXQA 1LSTA 3HCQA 4PP0A 3H06B 3TYHA 4JWXA 4N81A 5CRYA 4RPOA 1N0TA 4FEDA 4QRZA 3RT8A 3QK6A 1B1XA 3TKDA 4TLMB 3SEUA 4POXA 1EZOA 4FJPA 3LSWA 1D9VA 2WX9A 1NV3A 2F36A 4ELRA 3KN8A 1L5TA 1R1NA 5KDTB 4O3BA 2YJPA 3BIGA 1FPLA 2CZLA 5BUUA 2V3QA 4F18A 1XT8A 4OTEA 1MXXA 5A5LA 1PBQA 2QS3A 4GQOA 5DTBA 1BKAA 5H8HB 3RY3A 4ELOA 4ELQA 5EQ8A 4P11A 3VVDA 4GWUA 3B6TA 4HS7A 5H8NA 3LR1A 2O84X 1DSNA 1FQCA 3HV1A 4DZ1A 2PFYA 1SQYA 3BFUA 4N15A 3H6UA 2F3BA 4GIZA 4P1LA 1N3XA 1POY1 4GWSA 3FBPA 1LAGE 5CBRA 5EYHA 1RDZA 4IB2A 1DMBA 3E78A 5L8DA 3W9WA 1BIYA 1I6BA 5IZ3A 5IGAA 2PMSA 2F8DA 2Z8DA 1A55A 3IO4A 4MX6A 2R9JA 4LQ5A 1FSAA 4NMYA 3RLFE 1DCUA 1AL3A 3LSFB 4FATA 3IAZA 3V5AA 1NNPA 2WBDA 1MH4A 2A5TA 1S9TA 2V93A 4Z7EA 1KA1A 2Q88A 1WDNA 2H4IA 1OVTA 4AB6A 1CB6A 3RUMA 1R9QA 2ESNA 1FBHA 4N13A 4LONB 4ESXA 1DTZA 4XEQA 4I1DA 4ZEBA 2V3UA 4PFBA 2B4MA 3CSGA 4OVTA 3UGWA 4KYEA 1XC1A 5TPAB 1LLSA 5DEXA 1KZ8A 2P3NA 4ZEFA 2CMOA 2QMXA 2F3DA 2DSFA 3MVYA 3FVKA 4NTLA 3K6UA 2I4CA 1IIWA 2G93A 4TOZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MZ1 A;  1B51 A;  4RY1 A;  4X1D A;  5ICQ A;  2F6P A;  1ANF A;  3IB2 A;  2DE2 A;  5CC2 A;  1I6A A;  3C32 A;  2Z8F A;  3OD7 A;  4FEB A;  3DEL B;  1VR5 A;  4GRK A;  3T9H B;  3ZKK A;  1B3E A;  2HAU A;  1MQG A;  3TCG A;  4QFK A;  2ONS A;  2ZYK A;  3H6W A;  4KHZ E;  3F11 A;  3SET A;  2DWJ A;  2A5S A;  4LZ5 A;  1FQB A;  3CFX A;  3MQ9 A;  3T9X B;  4YB5 A;  1SDX A;  5ISU A;  2HZL A;  2PVU A;  3IOR A;  4IO6 A;  4G68 C;  2GH9 A;  3TTL A;  4I62 A;  4LP2 B;  4QFP A;  4IO5 A;  1Z7M E;  1MM6 A;  1B7U A;  3SEX A;  3QIM A;  3K6W A;  1CE2 A;  2DYX A;  4EF1 A;  4OFL A;  3EN3 A;  3A3C A;  3O6H A;  2HAV A;  3S4U A;  4NWC A;  2HCA A;  5I56 B;  3T93 B;  1LGB C;  5FTI A;  1R9L A;  4XXU A;  1DPP A;  2F5X A;  2DWI A;  4R2F A;  1A99 A;  3S9N C;  1Y1Z A;  5FHO A;  4R6Y A;  4GL0 A;  3KFM A;  3Q28 A;  5TU0 A;  3SDF A;  1P1U A;  3IR1 A;  1LBC A;  4K3F A;  4OER A;  3V89 B;  5IKB A;  4H5G A;  4HCW A;  4F1Y A;  4R6K A;  1MY4 A;  5K2Y A;  2X7Q A;  1Y4C A;  4NWD A;  3VLU A;  1XVY A;  4XKP A;  1GR2 A;  3U1O A;  4QFL A;  1URS A;  3Q26 A;  3FJM A;  4MBP A;  4AQ4 A;  1JVX A;  1O7T A;  2THI A;  4YU0 A;  1YPN A;  3MJN A;  3JYR A;  4OET A;  4P0G A;  1PBP A;  5FHM A;  1PB9 A;  2QPQ A;  3G3I A;  1IXH A;  1VSO A;  2P1S A;  5KCJ B;  2DOJ A;  4KQP A;  2DQV A;  5CMC A;  2W7Y A;  1N3W A;  3RPW A;  1FTJ A;  2NOO A;  1OMP A;  3KSJ A;  1GVC A;  4DXU A;  3TTK A;  5JTY B;  3PUV E;  2ABH A;  4E0W A;  3H6V A;  4HTG A;  1D9Y A;  4OEV A;  3RT6 B;  4DDD A;  5FTH A;  5L9M A;  5CMM A;  4PFY A;  3HST A;  3L6H A;  3IK6 B;  1UTB A;  2VGQ A;  3SEY A;  2XXW A;  3SEW A;  1MQJ A;  1JW4 A;  2H9B A;  1FTL A;  3PUY E;  4NF6 B;  3DM0 A;  4NF5 B;  5IAI A;  3JV9 A;  1H43 A;  2Q89 A;  2AYS A;  2I4B A;  1OIB A;  1RYO A;  5I57 B;  2O1L A;  2PBW A;  4EF2 A;  4DIG A;  1B3G A;  4NF4 B;  3OXN A;  1Z7N E;  2Z23 A;  1IXG A;  3OEM A;  1Y3P A;  4RA1 A;  1B7Z A;  2B3F A;  2XXX A;  2AIX A;  2O7I A;  4G68 A;  3PMX A;  4R74 A;  4KI0 E;  1USY H;  4QFO A;  3PPQ A;  2G29 A;  3GXA A;  2ALU A;  1B58 A;  4ONY A;  1P1N A;  1QVS A;  2ZYN A;  4XKR A;  1M5E A;  3OOA A;  1NKX A;  1Y1M A;  2ONR A;  3RN8 A;  5I58 A;  2Y7R A;  1ZTY A;  5H8Q B;  1MXU A;  3PMV A;  4R72 A;  3T9V A;  5ITP A;  4R75 A;  4U21 A;  4JWO A;  5A5X B;  4EQB A;  3CG1 A;  4Q5T A;  4RK9 A;  3TTN A;  4HW8 A;  1Q1K A;  5F7V A;  1II5 A;  1A54 A;  4F2O A;  3EPE A;  1MG1 A;  3BKI B;  4F1V A;  2I0B A;  2VHA A;  3GBB A;  3SKP A;  1N84 A;  1MXW A;  4EQ9 A;  1B3L A;  3KN3 A;  4H8J A;  3B6Q A;  1ZJL A;  2UVI A;  4LAT A;  2DP8 A;  3IL1 B;  3R7X A;  3TCH A;  4QFN A;  1B9J A;  3PPP A;  4YAH X;  2F34 A;  5H8S A;  3BFT A;  1D4N A;  3USD A;  1MXZ A;  1I69 A;  2XXH A;  3U92 A;  5AA2 B;  3O6I A;  3I6V A;  2F7B A;  1JW1 A;  1IQ7 A;  3TEP A;  5M2V A;  1ZIU A;  3HHF A;  1XVX A;  1BP5 A;  3K1N A;  4FIM A;  2RC8 A;  4U1Z A;  1JEU A;  4BDM A;  2V25 A;  3MP8 A;  3QUF A;  3VLW A;  2XXV A;  5DVJ A;  4GFR A;  4PET A;  1IIT A;  3KSX A;  4NF8 B;  5TP9 B;  3U72 A;  3PU5 A;  3H03 A;  4R9G A;  3GZG A;  2O7U A;  3MVZ A;  4ZEI A;  1RYX A;  4X1B A;  5HM4 B;  5L9O A;  3K1M A;  4F3G A;  1B1H A;  4MF3 A;  3CG3 A;  3LUY A;  5I2N B;  3TQL A;  2ZNU A;  3N94 A;  4BDR A;  3VFJ A;  4F1U A;  2OLB A;  5B7D A;  4U4S A;  5CM6 A;  1PC3 A;  3K1P A;  1WOD A;  3Q25 A;  4QSE A;  3CSB A;  4ZED A;  3S9L C;  4ECF A;  3O9P A;  3K4U A;  1ZBM A;  5B70 A;  3GLB A;  4UA8 A;  3ZSF A;  5AA4 B;  2OZZ A;  4F31 B;  1SVX B;  4KCC A;  2ZNS A;  4ZE8 A;  2ANJ A;  3TOD A;  2ZNT A;  2XXT A;  1YTV A;  5I59 A;  3VXC A;  2I58 A;  4OHN A;  1UTH A;  3M8U A;  1H44 A;  4O3C A;  1N7X A;  3D4G A;  5I2K A;  5JK4 A;  4I9D A;  1IUD A;  3OMB A;  3BBR A;  2F78 A;  1SI0 A;  3TTM A;  3T66 A;  4G77 A;  1FQF A;  4F3B A;  4DXB A;  3PV0 E;  1POT A;  2RKM A;  3LSX A;  3CRB A;  1XHY A;  2QL3 A;  4DCX A;  3FAT A;  1QUJ A;  4YB7 A;  4IO3 A;  4BDO A;  2PT2 A;  3GBA A;  1SW1 A;  2OK2 A;  3K6X A;  2OBG A;  1WVJ A;  4L17 A;  3FAS A;  3OO8 A;  3S2V A;  3FJ7 A;  4IO4 A;  1MY0 A;  2Z22 A;  2OCU A;  1I6Q A;  5CI5 A;  1OVB A;  3Q29 A;  4H65 A;  2I48 A;  1MPD A;  2YLN A;  4OQO A;  2HZK A;  2Q9T A;  3CFL A;  2REG A;  4ND9 A;  4NE4 A;  2Q8J A;  4MLV A;  4UAC A;  3TEL A;  4YMB A;  1URD A;  2F97 A;  5AE4 A;  3ZS6 A;  1ATG A;  4KFQ A;  2F7C A;  3I3V A;  2UYF A;  1EZ9 A;  3R26 A;  1JNF A;  1MQH A;  1SBP A;  5CMB A;  3QSL A;  3TDJ A;  1D3K A;  3C9H A;  5H8F A;  4G8N A;  3PGF A;  3N6T A;  1Q35 A;  4GL8 A;  2HQ0 A;  3SER A;  2DWA A;  2KLF A;  4JB7 A;  5DVF A;  2RC9 A;  4OZ9 A;  1N7W A;  3PUX E;  4GXA A;  4MFI A;  1J1N A;  3VVE A;  4LZ7 A;  1MPB A;  5KZT A;  3WAF A;  4ZZE A;  1JW5 A;  1A40 A;  1LAF E;  2DE3 A;  4U22 A;  1NL5 A;  1UIU A;  2R71 A;  2DS9 A;  4H5F A;  3TTR A;  4JBZ A;  3HN0 A;  3MZB A;  1O63 A;  3M3L A;  3ILU B;  1JEV A;  4F3S A;  1P1O A;  3FV2 A;  2O69 A;  3L6G A;  5I84 A;  3KG2 A;  4M1V A;  3KOS A;  4BDN A;  1UIV A;  3E13 X;  1P99 A;  3G3F A;  2GFE A;  4DE8 A;  2I3W A;  1FW0 A;  2PYY A;  4JSD A;  2D5W A;  4C1U A;  1PB7 A;  1FQA A;  3PPR A;  1P1W A;  4F29 A;  3RTF B;  3PD8 A;  2OWT A;  3K2D A;  4I8C A;  4POW A;  2BJJ X;  2H25 A;  4YB6 A;  1R6Z A;  5KDT A;  2VD2 A;  3TCF A;  1AH5 A;  3ZKL A;  1EU8 A;  3H6T A;  1USY E;  3MPL A;  2AL4 A;  3B6W A;  2QS1 A;  4Z0I A;  1SI1 A;  3RTW B;  1LB8 A;  2QMW A;  2XXQ A;  5H8H A;  5K2X A;  4KYD A;  1LCF A;  1HSE A;  3EHT A;  1LAX A;  3MPK A;  3N6U A;  4IY6 A;  5HPQ A;  1H3D A;  4R73 A;  1H45 A;  4LZ8 A;  3EF7 A;  4JXI A;  3MUQ A;  4GVO A;  4DLD A;  3DP8 A;  3CFZ A;  3G3G A;  1IXC A;  4R2B A;  3QYT A;  1QJM A;  5H8N B;  3W15 C;  1A8E A;  3E9X A;  4OEN A;  3W9V A;  3U93 A;  2Y7K A;  2XXU A;  1MDQ A;  3LC8 A;  4LUB A;  4XIG Q;  1DPE A;  3LSL A;  3O28 A;  1QUL A;  2X7P A;  1DTG A;  3OEN A;  3IB0 A;  4YKI A;  3TPA A;  3E4R A;  4FAJ A;  3VDF A;  4LA9 A;  1Y20 A;  2GHA A;  4ZDM A;  4X9T A;  2Y7W A;  3PMW A;  2A5T B;  4OXV A;  4E0X A;  1BTJ A;  1T0K A;  3FD3 A;  2IA4 A;  4IGR A;  5TPA A;  3KBR A;  2V3T A;  3DP4 A;  3E3K A;  1VE4 A;  3PD9 A;  2XXY A;  3MP6 A;  2PX1 A;  2UVJ A;  1XOC A;  3ECR A;  5LOM A;  1MY2 A;  1OLC A;  3KGC A;  3FVG A;  4KCD A;  5DEX B;  3T22 A;  1PB8 A;  4ZE9 A;  3C31 A;  1ZU0 A;  4PFU A;  2IEE A;  4QSC A;  2PT1 A;  2QRY A;  1A7L A;  1A8F A;  3DP6 A;  4RXL A;  4TQU Q;  4WEP A;  5DVI A;  3TZA A;  1TWY A;  3IX1 A;  4H1X A;  1JVY A;  3MBP A;  5HBC A;  2DVC A;  1HSJ A;  2ONK E;  4GOT A;  3IOV A;  4YIC A;  2UVH A;  1B46 A;  1NNT A;  1FTK A;  1NFT A;  2E1S A;  2QJE A;  4H0W A;  1IXI A;  2DWH A;  1DOT A;  3H3G A;  1LFH A;  1LCT A;  3A3U A;  1PEB A;  3KN7 A;  3QAX A;  4C1T A;  1QKB A;  4H6D A;  4F2Q A;  2ZYO A;  2P0S A;  3M3K A;  4JDF A;  4N07 A;  2XXP A;  1GGG A;  4Q30 B;  5I56 A;  4RJZ A;  1SD3 A;  3OO7 A;  4EQ7 A;  3OO9 A;  4GD5 A;  3SEV A;  2D3I A;  3VLV A;  3UK4 A;  1N04 A;  3G3H A;  1FTM A;  2HXW A;  4RK2 A;  4RYA A;  2XD2 A;  2RCA A;  4F19 A;  3MC2 A;  4RPN A;  4YZZ A;  3B7D A;  2FNC A;  2Y7I A;  1B5I A;  4ZEK A;  1UQW A;  2O51 A;  2YPN A;  1N76 A;  4OEU A;  2XD3 A;  4LVQ A;  4U2R A;  4EXK A;  1FCK A;  1FQE A;  2H98 A;  3IOU A;  3CR9 A;  1B5H A;  1TFD A;  3V83 A;  2P2A A;  1ZMG A;  5KCJ A;  3D4C A;  3AXF A;  1ZLQ A;  1MH3 A;  3OO6 A;  1OQH A;  2H5Y A;  2NVU B;  3QXM A;  2XX7 A;  1SW5 A;  5JTY A;  1QKA A;  1B05 A;  1GV8 A;  2H99 A;  4IY5 A;  1XS5 A;  2LAO A;  2B3B A;  3KOT A;  2RCB A;  3PPN A;  1OLA A;  4BLA A;  2QSX A;  5CBS A;  4NF6 A;  1S7Y A;  3VXB A;  4Q8R A;  4NF5 A;  1B40 A;  4G4P A;  1VFD A;  3K01 A;  4PE5 B;  1F9B A;  3O2A A;  2Y7P A;  5I57 A;  2F35 A;  1OQG A;  4OES A;  1UTB B;  4NF4 A;  1TXF A;  1TFA A;  1B2H A;  2Q2A A;  1Y3Q A;  1EZP A;  4TLL B;  5EHS A;  1B5J A;  3CIJ A;  3UN6 A;  3JZJ A;  1NNF A;  2FA7 A;  2VD3 A;  3K02 A;  1H76 A;  3OSR A;  1MS7 A;  4GWO A;  3K6V A;  2XHD A;  3C33 A;  4THI A;  3SES A;  2QS2 A;  2DVZ A;  1EH3 A;  4PFW A;  1LAH E;  3N26 A;  3O6G A;  4OMB A;  4G68 B;  2V84 A;  5ICT A;  4DXC A;  4ZEC A;  5H8Q A;  1YAE A;  4G8M A;  2I0C A;  4GF8 A;  1MY3 A;  3G7W A;  4OFO A;  2R6G E;  3U8Q A;  4KPT A;  1MRP A;  4H8I A;  5A5X A;  2O6A A;  3C35 A;  3EQ1 A;  5I58 B;  3OSQ A;  3OEK A;  3G3J A;  4AB5 A;  3KZG A;  4M4G A;  3QUJ A;  1JQF A;  4FE8 A;  2E0S A;  1O64 A;  2F6G A;  4R9F A;  4IO2 A;  3EHS A;  1Y4T A;  3KEI A;  2DE4 A;  2REJ A;  3FVN A;  2RC7 A;  4U1O A;  3S9E A;  2XXI A;  4FEC A;  1M5D A;  4QSD A;  3VVF A;  5AA2 A;  3O97 A;  4YKJ A;  2VOZ A;  3C4M A;  2UXA A;  4QHQ A;  1M5B A;  4KD5 A;  3ILT B;  1TT1 A;  2GRV A;  3M3F A;  1MXV A;  1JET A;  1US5 A;  1MM7 A;  3KJ7 A;  2GHB A;  1ZKB A;  4JWY A;  4R6H A;  3DLN A;  3VE1 B;  5EYF A;  1B0H A;  1SW4 A;  3PPO A;  4F39 A;  2HEU A;  1B6H A;  4Q0C A;  4OYV A;  3P7I A;  2I6E A;  4NF8 A;  1MQI A;  5AA1 A;  1FQD A;  3MW0 A;  5TP9 A;  3TMG A;  4PQJ A;  2ZYM A;  1URG A;  1SW2 A;  4MLQ A;  1NH8 A;  3LBS A;  1MXY A;  2I3V A;  3G3K A;  5FHN A;  3IJX B;  1B4Z A;  3O66 A;  4N6P A;  3IO6 A;  3THI A;  4KR5 A;  3H7M A;  4XTC Q;  3T96 B;  4DCY A;  5I2N A;  2O68 A;  4QF9 A;  3RQT A;  2FYI A;  3A09 A;  3R6U A;  3V8X B;  2DXY A;  1QUK A;  3FJG A;  3N5L A;  1NMU A;  4GLI A;  2ZXT A;  1B7H A;  4WED A;  5AA4 A;  2XX9 A;  4WXJ A;  4YKP A;  1GTK A;  4BDQ A;  2OWS A;  2QS4 A;  3FUZ A;  3RGY A;  4OVJ A;  1SYH A;  1ELJ A;  1IEJ A;  3T9U A;  3PUZ E;  1MPC A;  5JEI A;  1M5F A;  1RKM A;  1B52 A;  3K00 A;  2F7A A;  4H67 A;  5AA2 D;  3IJO B;  3ONM A;  3KJT A;  3RNN A;  5DYH A;  5J1D A;  3EHU A;  1P1Q A;  3FVO A;  3CI8 A;  2UYE A;  2NWJ A;  3Q27 A;  1MDP 1;  4FOR A;  5I59 B;  1UTH B;  3TQW A;  1QW0 A;  2WKY A;  1PDA A;  3FXR A;  4OFJ A;  5I2K B;  3U94 A;  4IO7 A;  3PUW E;  4RNS A;  5CMK A;  1AIV A;  1KWH A;  4XKN A;  2RF1 A;  3IOW A;  3MWB A;  1AMF A;  4GXS B;  3UP9 A;  4WKM A;  3TAJ A;  3MP1 A;  1Y3N A;  2NXO A;  2D21 A;  4LQ2 A;  3HO7 A;  3FXU A;  1IZ1 A;  3FGS A;  2OJT A;  5EHM A;  3TUS A;  4YKK A;  1AOV A;  4G2Z A;  5DT6 A;  5F1Q A;  4ISU A;  3MVX A;  2X26 A;  4JSO A;  4YMA A;  5AA3 A;  3TFL A;  1BLF A;  4ESW A;  2HFB A;  4MH5 A;  4EXL A;  1B3H A;  4EDP A;  1M5C A;  3VV5 A;  1VFE A;  2Y84 A;  1MQD A;  1LFI A;  3C34 A;  3MAM A;  2AL5 A;  1US4 A;  4IGT A;  1FTO A;  3MVW A;  3OEL A;  1LBB A;  4ELP A;  2VP1 A;  3UIF A;  5ITO A;  3O29 A;  5BWJ A;  4EUO A;  3UA8 A;  1B32 A;  2M8C A;  4OWD A;  1Y9U A;  1NH7 A;  4F3P A;  3ODB A;  4G8H A;  3WAE A;  2Z8E A;  2I49 A;  4KYS A;  5H8F B;  4C0R A;  3FIR A;  5ELV A;  2DXR A;  3I5O A;  2ZMB A;  4X48 A;  2RIN A;  3HHG A;  2XX8 A;  3C36 A;  4U4X A;  4ZZA A;  2UVG A;  1LFG A;  4P0I A;  1B4H A;  4NED A;  3MZ9 A;  2Q2C A;  2XXR A;  3UOR A;  2O1M A;  2NUV A;  4XKQ A;  4PFT A;  3HPI A;  1B3F A;  1NNK A;  3FV1 A;  4U23 A;  2B65 A;  3FZV A;  4BDL A;  3S9M C;  1HSL A;  4HCY A;  1S50 A;  3H4Z A;  4O3A A;  1YCJ A;  5L9S A;  4ZS9 A;  3K0V A;  4F22 A;  1LB9 A;  3IOT A;  1B0L A;  1QUI A;  3IB1 A;  1SYI A;  1MY1 A;  3CVG A;  3FXQ A;  1LST A;  3HCQ A;  4PP0 A;  3H06 B;  3TYH A;  4JWX A;  5CRY A;  4RPO A;  1N0T A;  4FED A;  4QRZ A;  3RT8 A;  3QK6 A;  1B1X A;  3TKD A;  4TLM B;  3SEU A;  4POX A;  1EZO A;  4FJP A;  3LSW A;  1D9V A;  2F36 A;  4ELR A;  3KN8 A;  1L5T A;  1R1N A;  5KDT B;  4O3B A;  2YJP A;  2CZL A;  5BUU A;  2V3Q A;  4F18 A;  1XT8 A;  4OTE A;  1MXX A;  1PBQ A;  2QS3 A;  4GQO A;  5DTB A;  1BKA A;  5H8H B;  3RY3 A;  4ELO A;  4ELQ A;  4P11 A;  3VVD A;  3B6T A;  4HS7 A;  5H8N A;  3LR1 A;  2O84 X;  1DSN A;  1FQC A;  3HV1 A;  4DZ1 A;  1SQY A;  3BFU A;  3H6U A;  4GIZ A;  1N3X A;  1POY 1;  1LAG E;  5CBR A;  4IB2 A;  1DMB A;  5L8D A;  3W9W A;  1BIY A;  1I6B A;  2PMS A;  2F8D A;  2Z8D A;  1A55 A;  3IO4 A;  2R9J A;  4LQ5 A;  4NMY A;  3RLF E;  1AL3 A;  3LSF B;  4FAT A;  3IAZ A;  3V5A A;  1NNP A;  1MH4 A;  2A5T A;  1S9T A;  2V93 A;  4Z7E A;  2Q88 A;  1WDN A;  2H4I A;  1OVT A;  4AB6 A;  1CB6 A;  3RUM A;  1R9Q A;  2ESN A;  4N13 A;  4LON B;  4ESX A;  1DTZ A;  4I1D A;  4ZEB A;  2V3U A;  3CSG A;  3UGW A;  4KYE A;  1XC1 A;  5TPA B;  1LLS A;  5DEX A;  4ZEF A;  2CMO A;  2QMX A;  2DSF A;  3MVY A;  3FVK A;  4NTL A;  3K6U A;  2I4C A;  1IIW A;  2G93 A;  4TOZ A; 
#chains in the Genus database with same CATH topology
 3MZ1 A;  4XF5 A;  1B51 A;  4RY1 A;  4X1D A;  5ICQ A;  2F6P A;  1ANF A;  3IB2 A;  2DE2 A;  5CC2 A;  4P1E A;  1I6A A;  3C32 A;  2Z8F A;  3OD7 A;  5I3S A;  5ET5 A;  4FEB A;  3DEL B;  1VR5 A;  4GRK A;  3T9H B;  3ZKK A;  1B3E A;  4I3E A;  2HAU A;  1MQG A;  3TCG A;  4MNI A;  4QFK A;  2ONS A;  2ZYK A;  3H6W A;  4KHZ E;  3F11 A;  1YYZ A;  3SET A;  2DWJ A;  2A5S A;  4LZ5 A;  1FQB A;  3CFX A;  3MQ9 A;  3T9X B;  4YB5 A;  2FIE A;  1SDX A;  3RPL B;  5ISU A;  2HZL A;  2PVU A;  3IOR A;  4IO6 A;  4G68 C;  2GH9 A;  3TTL A;  4NHB A;  4PF6 A;  4I62 A;  4LP2 B;  4OVR A;  4QFP A;  4IO5 A;  1Z7M E;  1MM6 A;  3T1B A;  2WYK A;  1LBV A;  1B7U A;  3SEX A;  1QGX A;  3QIM A;  3K6W A;  1CE2 A;  1FBD A;  2DYX A;  4EF1 A;  4OFL A;  3EN3 A;  3A3C A;  3O6H A;  2HAV A;  3S4U A;  4NWC A;  2HCA A;  5I56 B;  3T93 B;  1LGB C;  5FTI A;  1R9L A;  4XXU A;  4GBV A;  1DPP A;  2F5X A;  1IMB A;  2DWI A;  4R2F A;  1A99 A;  3S9N C;  1Y1Z A;  5FHO A;  4R6Y A;  4GL0 A;  3KFM A;  3Q28 A;  5TU0 A;  3SDF A;  1P1U A;  4NQ8 A;  3IR1 A;  1CNQ A;  1LBC A;  4NAP A;  4K3F A;  4OER A;  3V89 B;  5IKB A;  4H5G A;  4HCW A;  4F1Y A;  4R6K A;  1MY4 A;  1NUZ A;  5K2Y A;  2OWZ A;  2X7Q A;  1Y4C A;  4NWD A;  3VLU A;  1XVY A;  4XKP A;  1GR2 A;  3U1O A;  4QFL A;  1URS A;  3Q26 A;  3FJM A;  4MBP A;  4AQ4 A;  1JVX A;  1O7T A;  2THI A;  4YU0 A;  1YPN A;  3MJN A;  3JYR A;  4OET A;  4P0G A;  1PBP A;  5FHM A;  1PB9 A;  2QPQ A;  3G3I A;  1IXH A;  1VSO A;  2P1S A;  5KCJ B;  2DOJ A;  4KQP A;  1FPB A;  2DQV A;  5CMC A;  2FHY A;  2W7Y A;  1N3W A;  3RPW A;  4NG7 A;  1FTJ A;  2NOO A;  1OMP A;  3KSJ A;  1GVC A;  4DXU A;  3TTK A;  5JTY B;  3PUV E;  5FBP A;  2ABH A;  4E0W A;  3H6V A;  4HTG A;  1D9Y A;  4OEV A;  3RT6 B;  4DDD A;  2XWI A;  5FTH A;  5L9M A;  5CMM A;  4PFY A;  3HST A;  3L6H A;  3IK6 B;  1UTB A;  2VGQ A;  3SEY A;  2XXW A;  3SEW A;  1MQJ A;  1JW4 A;  2H9B A;  1FTL A;  3PUY E;  4NF6 B;  3DM0 A;  4NF5 B;  5IAI A;  3JV9 A;  1H43 A;  2Q89 A;  4G61 A;  4JVI A;  1INP A;  2AYS A;  2I4B A;  1OIB A;  4N8Y A;  1RYO A;  2PFZ A;  5I57 B;  2O1L A;  2PBW A;  4EF2 A;  4PGN A;  4DIG A;  1B3G A;  4NF4 B;  4GX3 A;  3OXN A;  1Z7N E;  2Z23 A;  1IXG A;  3OEM A;  1Y3P A;  4RA1 A;  1B7Z A;  2B3F A;  2XXX A;  2AIX A;  2O7I A;  4HE1 A;  4G68 A;  3PMX A;  4R74 A;  4KI0 E;  1USY H;  4QFO A;  3PPQ A;  2G29 A;  3GXA A;  2ALU A;  1B58 A;  1FPD A;  4ONY A;  1FRP A;  1P1N A;  4PAK A;  1QVS A;  2ZYN A;  4XKR A;  1M5E A;  3OOA A;  1NKX A;  1Y1M A;  2ONR A;  4LN5 A;  3RN8 A;  5I58 A;  2Y7R A;  5LDZ A;  1ZTY A;  1K9Y A;  5H8Q B;  1MXU A;  3PMV A;  4R72 A;  3T9V A;  5ITP A;  2QVV A;  4R75 A;  4PE3 A;  4U21 A;  3HFU A;  4JWO A;  5A5X B;  4EQB A;  3CG1 A;  4Q5T A;  4RK9 A;  3TTN A;  4HW8 A;  1Q1K A;  5F7V A;  1II5 A;  5ET7 A;  1A54 A;  4F2O A;  4MEV A;  5IZZ A;  3EPE A;  1MG1 A;  3BKI B;  4F1V A;  2I0B A;  2ZZV A;  2VHA A;  4PBH A;  3GBB A;  3SKP A;  1N84 A;  4PFR A;  1NI9 A;  1MXW A;  4EQ9 A;  1B3L A;  3KN3 A;  4H8J A;  3B6Q A;  1ZJL A;  2UVI A;  4LAT A;  2DP8 A;  3IL1 B;  3R7X A;  3TCH A;  5T3J A;  4QFN A;  1B9J A;  3PPP A;  4YAH X;  2F34 A;  5H8S A;  5ESY A;  3BFT A;  1D4N A;  3USD A;  1MXZ A;  1I69 A;  2XXH A;  3U92 A;  5AA2 B;  3O6I A;  3I6V A;  2F7B A;  1JW1 A;  1IQ7 A;  3TEP A;  4HXV A;  5M2V A;  1ZIU A;  3HHF A;  4XFE A;  1XVX A;  1BP5 A;  4QBA A;  3K1N A;  4FIM A;  2RC8 A;  4U1Z A;  1JEU A;  4BDM A;  2GQ1 A;  2V25 A;  3MP8 A;  3QUF A;  3VLW A;  2XXV A;  5DVJ A;  4GFR A;  4PET A;  1IIT A;  3KSX A;  4OVQ A;  4NF8 B;  5TP9 B;  3U72 A;  3PU5 A;  3H03 A;  4R9G A;  3GZG A;  2O7U A;  2P3V A;  3MVZ A;  4ZEI A;  1RYX A;  4X1B A;  5HM4 B;  5L9O A;  3K1M A;  4F3G A;  1B1H A;  4MF3 A;  3CG3 A;  3LUY A;  3LV0 A;  5I2N B;  3TQL A;  2ZNU A;  3N94 A;  4BDR A;  3VFJ A;  4F1U A;  2OLB A;  5B7D A;  4U4S A;  5CM6 A;  1PC3 A;  3K1P A;  1WOD A;  3Q25 A;  4QSE A;  3CSB A;  4ZED A;  3S9L C;  4ECF A;  3O9P A;  3K4U A;  1ZBM A;  5B70 A;  3GLB A;  4UA8 A;  3ZSF A;  5AA4 B;  2OZZ A;  4F31 B;  4N6K A;  2VPO A;  1SVX B;  4KCC A;  2ZNS A;  2VPN A;  2R8T A;  4ZE8 A;  4GWZ A;  2ANJ A;  4MMP A;  3TOD A;  2ZNT A;  2XXT A;  4PDH A;  1YTV A;  5I59 A;  3VXC A;  2I58 A;  4OHN A;  1UTH A;  3M8U A;  1H44 A;  4O3C A;  2WBB A;  1N7X A;  3D4G A;  5I2K A;  5JK4 A;  4I9D A;  1IUD A;  5ET8 A;  3OMB A;  3BBR A;  2F78 A;  1SI0 A;  3TTM A;  3T66 A;  4G77 A;  1FQF A;  3U65 A;  4F3B A;  1FBF A;  4DXB A;  4N6D A;  3PV0 E;  1POT A;  2RKM A;  1YXI A;  4PAF A;  3LSX A;  3CRB A;  1XHY A;  2QL3 A;  2CZK A;  4DCX A;  3FAT A;  1QUJ A;  1RDX A;  4YB7 A;  4IO3 A;  4BDO A;  2PT2 A;  3GBA A;  1DBZ A;  1SW1 A;  2OK2 A;  3K6X A;  2OBG A;  1WVJ A;  4L17 A;  3FAS A;  3OO8 A;  3S2V A;  3FJ7 A;  3ISP A;  4IO4 A;  3E79 A;  1MY0 A;  2Z22 A;  2OCU A;  4MIJ A;  1I6Q A;  5CI5 A;  1OVB A;  3Q29 A;  4H65 A;  2I48 A;  5I5P A;  1MPD A;  2YLN A;  4OQO A;  2HZK A;  2Q9T A;  3CFL A;  2REG A;  2CZH A;  4ND9 A;  4NE4 A;  2Q8J A;  4MLV A;  3D1R A;  4UAC A;  4OVP A;  4AS5 A;  3TEL A;  4YMB A;  1URD A;  2F97 A;  5AE4 A;  3ZS6 A;  1FPI A;  1ATG A;  4KFQ A;  2F7C A;  4JVC A;  3I3V A;  2UYF A;  1EZ9 A;  4PCD A;  3R26 A;  1JNF A;  1MQH A;  1SBP A;  4O7M A;  5CMB A;  3QSL A;  3TDJ A;  1D3K A;  3C9H A;  5H8F A;  4G8N A;  3PGF A;  3N6T A;  1Q35 A;  4GL8 A;  4MCO A;  2HQ0 A;  3SER A;  2DWA A;  2KLF A;  4JB7 A;  5DVF A;  2RC9 A;  4OZ9 A;  1N7W A;  3PUX E;  5I7I A;  4GXA A;  4MFI A;  1J1N A;  3VVE A;  4LZ7 A;  1MPB A;  5KZT A;  3WAF A;  4ZZE A;  1JW5 A;  1A40 A;  4N4U A;  1LAF E;  2DE3 A;  4U22 A;  1NL5 A;  1UIU A;  2Q8M A;  2R71 A;  2DS9 A;  5EQA A;  4H5F A;  3TTR A;  4JBZ A;  1FPE A;  3HN0 A;  4I3Y A;  3MZB A;  1O63 A;  3M3L A;  3ILU B;  1JEV A;  2Y5L A;  4N17 A;  4F3S A;  2VT5 A;  1P1O A;  4H45 A;  3FV2 A;  2O69 A;  3L6G A;  5I84 A;  3KG2 A;  4M1V A;  5EYG A;  3KOS A;  4BDN A;  1UIV A;  3E13 X;  4NN3 A;  1P99 A;  3G3F A;  2GFE A;  4DE8 A;  5EQ9 A;  2I3W A;  1FW0 A;  2PYY A;  4JSD A;  2D5W A;  4C1U A;  1PB7 A;  1FQA A;  3PPR A;  1P1W A;  4F29 A;  3RTF B;  3PD8 A;  2OWT A;  1LBW A;  3K2D A;  4I8C A;  4POW A;  2BJJ X;  2H25 A;  4YB6 A;  1R6Z A;  5KDT A;  1IMC A;  2VD2 A;  3TCF A;  1AH5 A;  3ZKL A;  4X04 A;  1EU8 A;  3H6T A;  1FBC A;  1USY E;  3MPL A;  2AL4 A;  2DDK A;  3B6W A;  2QS1 A;  4Z0I A;  1SI1 A;  3RTW B;  1LB8 A;  4MJO A;  2QMW A;  2XXQ A;  5H8H A;  5K2X A;  4KYD A;  4PF8 A;  1LCF A;  1HSE A;  3EHT A;  1LAX A;  3MPK A;  1NUX A;  3N6U A;  4IY6 A;  3B8B A;  5HPQ A;  1H3D A;  4R73 A;  1H45 A;  4LZ8 A;  3EF7 A;  4JXI A;  3MUQ A;  4GVO A;  4DLD A;  1YZ0 A;  3DP8 A;  2HPG A;  2Q74 A;  3CFZ A;  3G3G A;  1IXC A;  4R2B A;  3QYT A;  1QJM A;  5H8N B;  3W15 C;  1A8E A;  3E9X A;  4KXP A;  4FBP A;  4OEN A;  3W9V A;  3U93 A;  2Y7K A;  2XXU A;  1G0H A;  1MDQ A;  3LC8 A;  3NOH A;  4LUB A;  5IZ3 B;  4XIG Q;  5LTC A;  1DPE A;  3LSL A;  3O28 A;  1QUL A;  2X7P A;  1DTG A;  3OEN A;  3IB0 A;  4YKI A;  3TPA A;  3E4R A;  4FAJ A;  3VDF A;  4LA9 A;  1Y20 A;  2GHA A;  4ZDM A;  4X9T A;  2Y7W A;  3PMW A;  2A5T B;  4OXV A;  4E0X A;  1BTJ A;  1FBE A;  4MAG A;  1T0K A;  3FD3 A;  2IA4 A;  4IGR A;  5TPA A;  3KBR A;  2V3T A;  3DP4 A;  3T0J A;  3E3K A;  1VE4 A;  3PD9 A;  2XXY A;  3MP6 A;  2PX1 A;  2UVJ A;  4PTK A;  1XOC A;  3ECR A;  5LOM A;  1MY2 A;  1OLC A;  3KGC A;  4DI3 D;  1DK4 A;  3FVG A;  4KCD A;  5DEX B;  3T22 A;  1PB8 A;  4ZE9 A;  2JJK A;  3C31 A;  1ZU0 A;  1FPG A;  4PFU A;  2IEE A;  4QSC A;  2FBP A;  4MNC A;  1NV5 A;  2PT1 A;  2QRY A;  1A7L A;  1A8F A;  3DP6 A;  4RXL A;  1FJ9 A;  1FPK A;  4TQU Q;  4WEP A;  5DVI A;  3TZA A;  1TWY A;  4I40 A;  3B50 A;  3IX1 A;  4H1X A;  1JVY A;  3MBP A;  3RPL A;  5HBC A;  2DVC A;  1HSJ A;  2ONK E;  1EYK A;  4GOT A;  1D9Q A;  3IOV A;  4YIC A;  2UVH A;  1B46 A;  5IM2 A;  1NNT A;  1FTK A;  1NFT A;  2E1S A;  2QJE A;  4H0W A;  1IXI A;  2DWH A;  1DOT A;  3H3G A;  1LFH A;  1LCT A;  3A3U A;  2FVZ A;  1PEB A;  3KN7 A;  3QAX A;  4C1T A;  1QKB A;  4H6D A;  5EQ7 A;  4F2Q A;  4MNP A;  1FPJ A;  3KBZ A;  2ZYO A;  2P0S A;  3M3K A;  4JDF A;  1IMA A;  4N07 A;  2XXP A;  1GGG A;  4Q30 B;  5I56 A;  4RJZ A;  1SD3 A;  3OO7 A;  4EQ7 A;  1EYI A;  4N8G A;  4X8R A;  3OO9 A;  4GD5 A;  3SEV A;  2D3I A;  3VLV A;  3UK4 A;  1N04 A;  3G3H A;  1FTA A;  1FTM A;  2HXW A;  4RK2 A;  1IME A;  4RYA A;  2XD2 A;  4NGU A;  2RCA A;  4F19 A;  3MC2 A;  4RPN A;  4YZZ A;  2XWV A;  3B7D A;  4HE2 A;  2FNC A;  2KR0 A;  2Y7I A;  1RDY A;  1B5I A;  4ZEK A;  1UQW A;  2O51 A;  2YPN A;  3ROJ A;  1N76 A;  4OEU A;  2XD3 A;  4LVQ A;  4U2R A;  5IZ1 A;  4EXK A;  3LUZ A;  1FCK A;  1FQE A;  2H98 A;  3IOU A;  3CR9 A;  1B5H A;  4NF0 A;  4IR8 A;  1TFD A;  3V83 A;  3IFA A;  2P2A A;  4GX6 A;  1ZMG A;  5KCJ A;  3D4C A;  3QMF A;  3AXF A;  1ZLQ A;  1MH3 A;  3OO6 A;  1OQH A;  2H5Y A;  2NVU B;  4PC9 A;  3QXM A;  2XX7 A;  1FPF A;  1XI6 A;  1SW5 A;  5JTY A;  1QKA A;  1B05 A;  1GV8 A;  2H99 A;  4IY5 A;  1XS5 A;  2LAO A;  2B3B A;  2ZZW A;  3KOT A;  4PBQ A;  2RCB A;  3PPN A;  1OLA A;  4BLA A;  2QSX A;  4QXD A;  5CBS A;  4NF6 A;  1S7Y A;  3VXB A;  4Q8R A;  4NF5 A;  1B40 A;  4G4P A;  1VFD A;  2ZZX A;  3K01 A;  4PE5 B;  1F9B A;  1AWB A;  3O2A A;  2Y7P A;  3MYU A;  5I57 A;  2F35 A;  1OQG A;  4OES A;  1UTB B;  1NV4 A;  4NF4 A;  1TXF A;  1TFA A;  3IFC A;  1B2H A;  2Q2A A;  1Y3Q A;  1EZP A;  4TLL B;  5EHS A;  1B5J A;  3CIJ A;  3UN6 A;  3JZJ A;  1NNF A;  2FA7 A;  2VD3 A;  3K02 A;  1LBY A;  1H76 A;  3OSR A;  2PCR A;  3EKI A;  1MS7 A;  4P47 A;  2XWO A;  3K6V A;  4GWO A;  2XHD A;  4OVS A;  3C33 A;  4THI A;  3SES A;  2QS2 A;  2DVZ A;  1EH3 A;  2V4C A;  4JVD A;  4PFW A;  1LAH E;  3N26 A;  3O6G A;  4OMB A;  4G68 B;  2V84 A;  5ICT A;  1FJ6 A;  1KA0 A;  4DXC A;  2WYP A;  4ZEC A;  5H8Q A;  1YAE A;  4G8M A;  2I0C A;  4GF8 A;  4PAI A;  1MY3 A;  3G7W A;  4OFO A;  2R6G E;  3U8Q A;  4KPT A;  1MRP A;  4H8I A;  5A5X A;  2MKZ A;  2O6A A;  3C35 A;  3EQ1 A;  5I58 B;  3OSQ A;  3OEK A;  3G3J A;  4GWY A;  4AB5 A;  3KZG A;  4M4G A;  3QUJ A;  1JQF A;  4FE8 A;  4GWW A;  2E0S A;  1O64 A;  2F6G A;  4R9F A;  4MHF A;  4IO2 A;  3EHS A;  1Y4T A;  3KEI A;  2DE4 A;  2REJ A;  3FVN A;  2RC7 A;  4U1O A;  3S9E A;  2XXI A;  4FEC A;  1M5D A;  3PTY A;  4QSD A;  3VVF A;  5AA2 A;  3O97 A;  4YKJ A;  2VOZ A;  3C4M A;  2UXA A;  4QHQ A;  3KC1 A;  1M5B A;  4KD5 A;  4DI4 B;  1NV0 A;  3ILT B;  1FBG A;  1TT1 A;  2GRV A;  2XWK A;  3M3F A;  4AS4 A;  1MXV A;  1JET A;  1US5 A;  1MM7 A;  2QVU A;  3KJ7 A;  2GHB A;  1ZKB A;  4JWY A;  3CHG A;  4R6H A;  1NUW A;  3DLN A;  3VE1 B;  5J16 A;  5EYF A;  4GBW A;  1B0H A;  1SW4 A;  3PPO A;  4F39 A;  2HEU A;  1B6H A;  4Q0C A;  4OYV A;  1LEV A;  3P7I A;  2I6E A;  4NF8 A;  1G0I A;  4O7I A;  1MQI A;  5AA1 A;  1FQD A;  2XXK A;  3MW0 A;  5TP9 A;  3TMG A;  4PQJ A;  2ZYM A;  1URG A;  1SW2 A;  4MLQ A;  4PGP A;  1NH8 A;  4NX1 A;  3LBS A;  1MXY A;  1FBP A;  2I3V A;  3G3K A;  5FHN A;  2FIX A;  3IJX B;  1B4Z A;  3O66 A;  4N6P A;  3IO6 A;  3THI A;  4PDD A;  4KR5 A;  3H7M A;  4XTC Q;  3T96 B;  4DCY A;  5I2N A;  2O68 A;  4QF9 A;  4H46 A;  3RQT A;  2FYI A;  3A09 A;  3R6U A;  3V8X B;  2DXY A;  1QUK A;  3FJG A;  3N5L A;  1BK4 A;  1NMU A;  4GLI A;  2ZXT A;  1B7H A;  4WED A;  2BJI A;  5AA4 A;  2XX9 A;  1K9Z A;  4WXJ A;  2HXR A;  4YKP A;  1GTK A;  1NV2 A;  4OAN A;  4BDQ A;  2OWS A;  2QS4 A;  4O8M A;  4P3L A;  3FUZ A;  3RGY A;  4OVJ A;  3RYD A;  1SYH A;  1ELJ A;  1IEJ A;  2OX3 A;  3T9U A;  1NUY A;  2QFL A;  3PUZ E;  1MPC A;  3BIH A;  5JEI A;  1M5F A;  1RKM A;  4P56 A;  1B52 A;  3K00 A;  2F7A A;  4H67 A;  4GX4 A;  5AA2 D;  1NV7 A;  3IJO B;  3ONM A;  3KJT A;  3RNN A;  5DYH A;  1LBX A;  5J1D A;  3EHU A;  1P1Q A;  3FVO A;  3CI8 A;  2UYE A;  2NWJ A;  3Q27 A;  1MDP 1;  2WEF A;  4FOR A;  5I59 B;  4O94 A;  1UTH B;  3TQW A;  1QW0 A;  2WKY A;  1PDA A;  3FXR A;  4OFJ A;  5I2K B;  3U94 A;  2CZI A;  4IO7 A;  3PUW E;  4RNS A;  5CMK A;  1AIV A;  1KWH A;  4XKN A;  2RF1 A;  3IOW A;  3MWB A;  1Q9D A;  4P9K A;  1AMF A;  4OA4 A;  4GXS B;  3UP9 A;  3A29 A;  4WKM A;  3TAJ A;  3MP1 A;  1Y3N A;  2NXO A;  2D21 A;  4LQ2 A;  3HO7 A;  3FXU A;  1IZ1 A;  3FGS A;  2OJT A;  5EHM A;  3TUS A;  4YKK A;  2B4L A;  1AOV A;  4G2Z A;  5DT6 A;  5F1Q A;  4ISU A;  3MVX A;  2X26 A;  4JSO A;  4YMA A;  5AA3 A;  3TFL A;  1BLF A;  4ESW A;  2HFB A;  4MH5 A;  3KC0 A;  4EXL A;  1B3H A;  1NV6 A;  4EDP A;  1M5C A;  1LBZ A;  3SZP A;  3VV5 A;  1VFE A;  2Y84 A;  1MQD A;  1LFI A;  3C34 A;  3MAM A;  2AL5 A;  1SPI A;  1US4 A;  2QVR A;  4IGT A;  1FTO A;  3MVW A;  3OEL A;  1LBB A;  4ELP A;  4GWX A;  2VP1 A;  3UIF A;  5ITO A;  1NV1 A;  3O29 A;  5BWJ A;  2Y5K A;  4EUO A;  3UA8 A;  1B32 A;  2M8C A;  4UAB A;  4OWD A;  1Y9U A;  1NH7 A;  4F3P A;  3ODB A;  3FXB A;  3GYY A;  5F24 A;  4G8H A;  3WAE A;  2Z8E A;  2I49 A;  4KYS A;  5H8F B;  4C0R A;  2CEX A;  3FIR A;  4HE0 A;  5ELV A;  2DXR A;  3I5O A;  4PFI A;  2ZMB A;  4X48 A;  2RIN A;  3HHG A;  2XX8 A;  4P8B A;  1IMF A;  1IMD A;  3C36 A;  4U4X A;  1JP4 A;  4ZZA A;  2UVG A;  1LFG A;  1EYJ A;  4P0I A;  1B4H A;  4NED A;  3MZ9 A;  2L5V A;  2Q2C A;  2XXR A;  3UOR A;  2O1M A;  2NUV A;  4XKQ A;  4PFT A;  3HPI A;  1B3F A;  1NNK A;  3FV1 A;  2HHM A;  4U23 A;  2B65 A;  3FZV A;  4BDL A;  3S9M C;  1HSL A;  4HCY A;  2KQZ A;  1S50 A;  2XA5 A;  5ET6 A;  3H4Z A;  4O3A A;  1YCJ A;  4N91 A;  5L9S A;  4ZS9 A;  2CEY A;  1VDW A;  3MST A;  3K0V A;  4F22 A;  1LB9 A;  5DW8 A;  3IOT A;  1B0L A;  1QUI A;  3IB1 A;  1SYI A;  1MY1 A;  3CVG A;  3FXQ A;  1LST A;  3HCQ A;  4PP0 A;  3H06 B;  3TYH A;  4JWX A;  4N81 A;  5CRY A;  4RPO A;  1N0T A;  4FED A;  4QRZ A;  3RT8 A;  3QK6 A;  1B1X A;  3TKD A;  4TLM B;  3SEU A;  4POX A;  1EZO A;  4FJP A;  3LSW A;  1D9V A;  2WX9 A;  1NV3 A;  2F36 A;  4ELR A;  3KN8 A;  1L5T A;  1R1N A;  5KDT B;  4O3B A;  2YJP A;  3BIG A;  1FPL A;  2CZL A;  5BUU A;  2V3Q A;  4F18 A;  1XT8 A;  4OTE A;  1MXX A;  5A5L A;  1PBQ A;  2QS3 A;  4GQO A;  5DTB A;  1BKA A;  5H8H B;  3RY3 A;  4ELO A;  4ELQ A;  5EQ8 A;  4P11 A;  3VVD A;  4GWU A;  3B6T A;  4HS7 A;  5H8N A;  3LR1 A;  2O84 X;  1DSN A;  1FQC A;  3HV1 A;  4DZ1 A;  2PFY A;  1SQY A;  3BFU A;  4N15 A;  3H6U A;  2F3B A;  4GIZ A;  4P1L A;  1N3X A;  1POY 1;  4GWS A;  3FBP A;  1LAG E;  5EYH A;  5CBR A;  1RDZ A;  4IB2 A;  1DMB A;  3E78 A;  5L8D A;  3W9W A;  1BIY A;  1I6B A;  5IZ3 A;  5IGA A;  2PMS A;  2F8D A;  2Z8D A;  1A55 A;  3IO4 A;  4MX6 A;  2R9J A;  4LQ5 A;  1FSA A;  4NMY A;  3RLF E;  1DCU A;  1AL3 A;  3LSF B;  4FAT A;  3IAZ A;  3V5A A;  1NNP A;  2WBD A;  1MH4 A;  1S9T A;  2A5T A;  2V93 A;  4Z7E A;  1KA1 A;  2Q88 A;  1WDN A;  2H4I A;  1OVT A;  4AB6 A;  1CB6 A;  3RUM A;  1R9Q A;  2ESN A;  1FBH A;  4N13 A;  4LON B;  4ESX A;  1DTZ A;  4XEQ A;  4I1D A;  4ZEB A;  2V3U A;  4PFB A;  2B4M A;  3CSG A;  4OVT A;  3UGW A;  4KYE A;  1XC1 A;  5TPA B;  1LLS A;  5DEX A;  1KZ8 A;  2P3N A;  4ZEF A;  2CMO A;  2QMX A;  2F3D A;  2DSF A;  3MVY A;  3FVK A;  4NTL A;  3K6U A;  2I4C A;  1IIW A;  2G93 A;  4TOZ A; 
#chains in the Genus database with same CATH homology
 3MZ1 A;  4XF5 A;  1B51 A;  4RY1 A;  4X1D A;  5ICQ A;  2F6P A;  1ANF A;  3IB2 A;  2DE2 A;  5CC2 A;  4P1E A;  1I6A A;  3C32 A;  2Z8F A;  3OD7 A;  5I3S A;  5ET5 A;  4FEB A;  3DEL B;  1VR5 A;  4GRK A;  3T9H B;  3ZKK A;  1B3E A;  4I3E A;  2HAU A;  1MQG A;  3TCG A;  4MNI A;  4QFK A;  2ONS A;  2ZYK A;  3H6W A;  4KHZ E;  3F11 A;  1YYZ A;  3SET A;  2DWJ A;  2A5S A;  4LZ5 A;  1FQB A;  3CFX A;  3MQ9 A;  3T9X B;  4YB5 A;  2FIE A;  1SDX A;  3RPL B;  5ISU A;  2HZL A;  2PVU A;  3IOR A;  4IO6 A;  4G68 C;  2GH9 A;  3TTL A;  4NHB A;  4PF6 A;  4I62 A;  4LP2 B;  4OVR A;  4QFP A;  4IO5 A;  1Z7M E;  1MM6 A;  3T1B A;  2WYK A;  1LBV A;  1B7U A;  3SEX A;  1QGX A;  3QIM A;  3K6W A;  1CE2 A;  1FBD A;  2DYX A;  4EF1 A;  4OFL A;  3EN3 A;  3A3C A;  3O6H A;  2HAV A;  3S4U A;  4NWC A;  2HCA A;  5I56 B;  3T93 B;  1LGB C;  5FTI A;  1R9L A;  4XXU A;  4GBV A;  1DPP A;  2F5X A;  1IMB A;  2DWI A;  4R2F A;  1A99 A;  3S9N C;  1Y1Z A;  5FHO A;  4R6Y A;  4GL0 A;  3KFM A;  3Q28 A;  5TU0 A;  3SDF A;  1P1U A;  4NQ8 A;  3IR1 A;  1CNQ A;  1LBC A;  4NAP A;  4K3F A;  4OER A;  3V89 B;  5IKB A;  4H5G A;  4HCW A;  4F1Y A;  4R6K A;  1MY4 A;  1NUZ A;  5K2Y A;  2OWZ A;  2X7Q A;  1Y4C A;  4NWD A;  3VLU A;  1XVY A;  4XKP A;  1GR2 A;  3U1O A;  4QFL A;  1URS A;  3Q26 A;  3FJM A;  4MBP A;  4AQ4 A;  1JVX A;  1O7T A;  2THI A;  4YU0 A;  1YPN A;  3MJN A;  3JYR A;  4OET A;  4P0G A;  1PBP A;  5FHM A;  1PB9 A;  2QPQ A;  3G3I A;  1IXH A;  1VSO A;  2P1S A;  5KCJ B;  2DOJ A;  4KQP A;  1FPB A;  2DQV A;  5CMC A;  2FHY A;  2W7Y A;  1N3W A;  3RPW A;  4NG7 A;  1FTJ A;  2NOO A;  1OMP A;  3KSJ A;  1GVC A;  4DXU A;  3TTK A;  5JTY B;  3PUV E;  5FBP A;  2ABH A;  4E0W A;  3H6V A;  4HTG A;  1D9Y A;  4OEV A;  3RT6 B;  4DDD A;  2XWI A;  5FTH A;  5L9M A;  5CMM A;  4PFY A;  3HST A;  3L6H A;  3IK6 B;  1UTB A;  2VGQ A;  3SEY A;  2XXW A;  3SEW A;  1MQJ A;  1JW4 A;  2H9B A;  1FTL A;  3PUY E;  4NF6 B;  3DM0 A;  4NF5 B;  5IAI A;  3JV9 A;  1H43 A;  2Q89 A;  4G61 A;  4JVI A;  1INP A;  2AYS A;  2I4B A;  1OIB A;  4N8Y A;  1RYO A;  2PFZ A;  5I57 B;  2O1L A;  2PBW A;  4EF2 A;  4PGN A;  4DIG A;  1B3G A;  4NF4 B;  4GX3 A;  3OXN A;  1Z7N E;  2Z23 A;  1IXG A;  3OEM A;  1Y3P A;  4RA1 A;  1B7Z A;  2B3F A;  2XXX A;  2AIX A;  2O7I A;  4HE1 A;  4G68 A;  3PMX A;  4R74 A;  4KI0 E;  1USY H;  4QFO A;  3PPQ A;  2G29 A;  3GXA A;  2ALU A;  1B58 A;  1FPD A;  4ONY A;  1FRP A;  1P1N A;  4PAK A;  1QVS A;  2ZYN A;  4XKR A;  1M5E A;  3OOA A;  1NKX A;  1Y1M A;  2ONR A;  4LN5 A;  3RN8 A;  5I58 A;  2Y7R A;  5LDZ A;  1ZTY A;  1K9Y A;  5H8Q B;  1MXU A;  3PMV A;  4R72 A;  3T9V A;  5ITP A;  2QVV A;  4R75 A;  4PE3 A;  4U21 A;  4JWO A;  3HFU A;  5A5X B;  4EQB A;  3CG1 A;  4Q5T A;  4RK9 A;  3TTN A;  4HW8 A;  1Q1K A;  5F7V A;  1II5 A;  5ET7 A;  1A54 A;  4F2O A;  4MEV A;  5IZZ A;  3EPE A;  1MG1 A;  3BKI B;  4F1V A;  2I0B A;  2ZZV A;  2VHA A;  4PBH A;  3GBB A;  3SKP A;  1N84 A;  4PFR A;  1NI9 A;  1MXW A;  4EQ9 A;  1B3L A;  3KN3 A;  4H8J A;  3B6Q A;  1ZJL A;  2UVI A;  4LAT A;  2DP8 A;  3IL1 B;  3R7X A;  3TCH A;  5T3J A;  4QFN A;  1B9J A;  3PPP A;  4YAH X;  2F34 A;  5H8S A;  5ESY A;  3BFT A;  1D4N A;  3USD A;  1MXZ A;  1I69 A;  2XXH A;  3U92 A;  5AA2 B;  3O6I A;  3I6V A;  2F7B A;  1JW1 A;  1IQ7 A;  3TEP A;  4HXV A;  5M2V A;  1ZIU A;  3HHF A;  4XFE A;  1XVX A;  1BP5 A;  4QBA A;  3K1N A;  4FIM A;  2RC8 A;  4U1Z A;  1JEU A;  4BDM A;  2GQ1 A;  2V25 A;  3MP8 A;  3QUF A;  3VLW A;  2XXV A;  5DVJ A;  4GFR A;  4PET A;  1IIT A;  3KSX A;  4OVQ A;  4NF8 B;  5TP9 B;  3U72 A;  3PU5 A;  3H03 A;  4R9G A;  3GZG A;  2O7U A;  3MVZ A;  4ZEI A;  2P3V A;  1RYX A;  4X1B A;  5HM4 B;  5L9O A;  3K1M A;  4F3G A;  1B1H A;  4MF3 A;  3CG3 A;  3LUY A;  5I2N B;  3LV0 A;  3TQL A;  2ZNU A;  3N94 A;  4BDR A;  3VFJ A;  4F1U A;  2OLB A;  5B7D A;  4U4S A;  5CM6 A;  1PC3 A;  3K1P A;  1WOD A;  3Q25 A;  4QSE A;  3CSB A;  4ZED A;  3S9L C;  4ECF A;  3O9P A;  3K4U A;  1ZBM A;  5B70 A;  3GLB A;  4UA8 A;  3ZSF A;  5AA4 B;  2OZZ A;  4F31 B;  4N6K A;  2VPO A;  1SVX B;  4KCC A;  2ZNS A;  2VPN A;  2R8T A;  4ZE8 A;  4GWZ A;  2ANJ A;  4MMP A;  3TOD A;  2ZNT A;  2XXT A;  4PDH A;  1YTV A;  5I59 A;  3VXC A;  2I58 A;  4OHN A;  1UTH A;  3M8U A;  1H44 A;  4O3C A;  2WBB A;  1N7X A;  3D4G A;  5I2K A;  5JK4 A;  4I9D A;  1IUD A;  5ET8 A;  3OMB A;  3BBR A;  2F78 A;  1SI0 A;  3TTM A;  3T66 A;  4G77 A;  1FQF A;  3U65 A;  4F3B A;  1FBF A;  4DXB A;  4N6D A;  3PV0 E;  1POT A;  2RKM A;  1YXI A;  4PAF A;  3LSX A;  3CRB A;  1XHY A;  2QL3 A;  2CZK A;  4DCX A;  3FAT A;  1QUJ A;  4YB7 A;  1RDX A;  4IO3 A;  4BDO A;  2PT2 A;  3GBA A;  1DBZ A;  1SW1 A;  2OK2 A;  3K6X A;  2OBG A;  1WVJ A;  4L17 A;  3FAS A;  3OO8 A;  3S2V A;  3FJ7 A;  3ISP A;  4IO4 A;  3E79 A;  1MY0 A;  2Z22 A;  2OCU A;  4MIJ A;  1I6Q A;  5CI5 A;  1OVB A;  3Q29 A;  4H65 A;  2I48 A;  5I5P A;  1MPD A;  2YLN A;  4OQO A;  2HZK A;  2Q9T A;  3CFL A;  2REG A;  2CZH A;  4ND9 A;  4NE4 A;  2Q8J A;  4MLV A;  3D1R A;  4UAC A;  4OVP A;  4AS5 A;  3TEL A;  4YMB A;  1URD A;  2F97 A;  5AE4 A;  3ZS6 A;  1FPI A;  1ATG A;  4KFQ A;  2F7C A;  4JVC A;  3I3V A;  2UYF A;  1EZ9 A;  4PCD A;  3R26 A;  1JNF A;  1MQH A;  1SBP A;  4O7M A;  5CMB A;  3QSL A;  3TDJ A;  1D3K A;  3C9H A;  5H8F A;  4G8N A;  3PGF A;  3N6T A;  1Q35 A;  4GL8 A;  4MCO A;  2HQ0 A;  3SER A;  2DWA A;  2KLF A;  4JB7 A;  5DVF A;  2RC9 A;  4OZ9 A;  1N7W A;  3PUX E;  5I7I A;  4GXA A;  4MFI A;  1J1N A;  3VVE A;  4LZ7 A;  1MPB A;  5KZT A;  3WAF A;  4ZZE A;  1JW5 A;  1A40 A;  4N4U A;  1LAF E;  2DE3 A;  4U22 A;  1NL5 A;  1UIU A;  2Q8M A;  2R71 A;  2DS9 A;  5EQA A;  4H5F A;  3TTR A;  4JBZ A;  1FPE A;  3HN0 A;  4I3Y A;  3MZB A;  1O63 A;  3M3L A;  3ILU B;  1JEV A;  2Y5L A;  4N17 A;  4F3S A;  2VT5 A;  1P1O A;  4H45 A;  3FV2 A;  2O69 A;  3L6G A;  5I84 A;  3KG2 A;  4M1V A;  5EYG A;  3KOS A;  4BDN A;  1UIV A;  3E13 X;  4NN3 A;  1P99 A;  3G3F A;  2GFE A;  4DE8 A;  5EQ9 A;  2I3W A;  1FW0 A;  2PYY A;  4JSD A;  2D5W A;  4C1U A;  1PB7 A;  1FQA A;  3PPR A;  1P1W A;  4F29 A;  3RTF B;  3PD8 A;  2OWT A;  3K2D A;  1LBW A;  4I8C A;  4POW A;  2BJJ X;  2H25 A;  4YB6 A;  1R6Z A;  5KDT A;  1IMC A;  2VD2 A;  3TCF A;  1AH5 A;  3ZKL A;  4X04 A;  1EU8 A;  3H6T A;  1FBC A;  1USY E;  3MPL A;  2AL4 A;  2DDK A;  3B6W A;  2QS1 A;  4Z0I A;  1SI1 A;  3RTW B;  1LB8 A;  4MJO A;  2QMW A;  2XXQ A;  5H8H A;  5K2X A;  4KYD A;  4PF8 A;  1LCF A;  1HSE A;  3EHT A;  1LAX A;  3MPK A;  1NUX A;  3N6U A;  4IY6 A;  3B8B A;  5HPQ A;  1H3D A;  4R73 A;  1H45 A;  4LZ8 A;  3EF7 A;  4JXI A;  3MUQ A;  4GVO A;  4DLD A;  1YZ0 A;  3DP8 A;  2HPG A;  2Q74 A;  3CFZ A;  3G3G A;  1IXC A;  4R2B A;  3QYT A;  1QJM A;  5H8N B;  3W15 C;  1A8E A;  3E9X A;  4KXP A;  4FBP A;  4OEN A;  3W9V A;  3U93 A;  2Y7K A;  2XXU A;  1G0H A;  1MDQ A;  3LC8 A;  3NOH A;  4LUB A;  5IZ3 B;  4XIG Q;  5LTC A;  1DPE A;  3LSL A;  3O28 A;  1QUL A;  2X7P A;  1DTG A;  3OEN A;  3IB0 A;  4YKI A;  3TPA A;  3E4R A;  4FAJ A;  3VDF A;  4LA9 A;  1Y20 A;  2GHA A;  4ZDM A;  4X9T A;  2Y7W A;  3PMW A;  2A5T B;  4OXV A;  4E0X A;  1BTJ A;  1FBE A;  4MAG A;  1T0K A;  3FD3 A;  2IA4 A;  4IGR A;  5TPA A;  3KBR A;  2V3T A;  3DP4 A;  3T0J A;  3E3K A;  1VE4 A;  3PD9 A;  2XXY A;  3MP6 A;  2PX1 A;  2UVJ A;  4PTK A;  1XOC A;  3ECR A;  5LOM A;  1MY2 A;  1OLC A;  3KGC A;  4DI3 D;  3FVG A;  1DK4 A;  4KCD A;  5DEX B;  3T22 A;  1PB8 A;  4ZE9 A;  2JJK A;  3C31 A;  1ZU0 A;  4PFU A;  1FPG A;  2IEE A;  4QSC A;  2FBP A;  4MNC A;  1NV5 A;  2PT1 A;  2QRY A;  1A7L A;  1A8F A;  3DP6 A;  4RXL A;  1FJ9 A;  1FPK A;  4TQU Q;  4WEP A;  5DVI A;  3TZA A;  1TWY A;  4I40 A;  3B50 A;  3IX1 A;  4H1X A;  1JVY A;  3MBP A;  3RPL A;  5HBC A;  2DVC A;  1HSJ A;  2ONK E;  1EYK A;  4GOT A;  1D9Q A;  3IOV A;  4YIC A;  2UVH A;  1B46 A;  5IM2 A;  1NNT A;  1FTK A;  1NFT A;  2E1S A;  2QJE A;  4H0W A;  1IXI A;  2DWH A;  1DOT A;  3H3G A;  1LFH A;  1LCT A;  3A3U A;  2FVZ A;  1PEB A;  3KN7 A;  3QAX A;  4C1T A;  1QKB A;  4H6D A;  5EQ7 A;  4F2Q A;  4MNP A;  1FPJ A;  3KBZ A;  2ZYO A;  2P0S A;  3M3K A;  4JDF A;  1IMA A;  4N07 A;  2XXP A;  1GGG A;  4Q30 B;  5I56 A;  4RJZ A;  1SD3 A;  3OO7 A;  4EQ7 A;  1EYI A;  4N8G A;  4X8R A;  3OO9 A;  4GD5 A;  3SEV A;  2D3I A;  3VLV A;  3UK4 A;  1N04 A;  3G3H A;  1FTA A;  1FTM A;  2HXW A;  4RK2 A;  1IME A;  4RYA A;  2XD2 A;  4NGU A;  2RCA A;  4F19 A;  3MC2 A;  4RPN A;  4YZZ A;  2XWV A;  3B7D A;  4HE2 A;  2FNC A;  2KR0 A;  2Y7I A;  1RDY A;  1B5I A;  4ZEK A;  1UQW A;  2O51 A;  2YPN A;  3ROJ A;  1N76 A;  4OEU A;  2XD3 A;  4LVQ A;  4U2R A;  5IZ1 A;  4EXK A;  3LUZ A;  1FCK A;  1FQE A;  2H98 A;  3IOU A;  3CR9 A;  1B5H A;  4NF0 A;  4IR8 A;  1TFD A;  3V83 A;  3IFA A;  2P2A A;  4GX6 A;  1ZMG A;  5KCJ A;  3D4C A;  3QMF A;  3AXF A;  1ZLQ A;  1MH3 A;  3OO6 A;  1OQH A;  2H5Y A;  2NVU B;  4PC9 A;  3QXM A;  2XX7 A;  1FPF A;  1XI6 A;  1SW5 A;  5JTY A;  1QKA A;  1B05 A;  1GV8 A;  2H99 A;  4IY5 A;  1XS5 A;  2LAO A;  2B3B A;  2ZZW A;  3KOT A;  4PBQ A;  2RCB A;  3PPN A;  1OLA A;  4BLA A;  2QSX A;  4QXD A;  5CBS A;  4NF6 A;  1S7Y A;  3VXB A;  4Q8R A;  4NF5 A;  1B40 A;  4G4P A;  1VFD A;  2ZZX A;  3K01 A;  4PE5 B;  1F9B A;  1AWB A;  3O2A A;  2Y7P A;  3MYU A;  5I57 A;  2F35 A;  1OQG A;  4OES A;  1UTB B;  1NV4 A;  4NF4 A;  1TXF A;  1TFA A;  3IFC A;  1B2H A;  2Q2A A;  1Y3Q A;  1EZP A;  4TLL B;  5EHS A;  1B5J A;  3CIJ A;  3UN6 A;  3JZJ A;  1NNF A;  2FA7 A;  2VD3 A;  3K02 A;  1LBY A;  1H76 A;  3OSR A;  2PCR A;  3EKI A;  1MS7 A;  4P47 A;  4GWO A;  3K6V A;  2XWO A;  2XHD A;  4OVS A;  3C33 A;  4THI A;  3SES A;  2QS2 A;  2DVZ A;  1EH3 A;  2V4C A;  4PFW A;  4JVD A;  1LAH E;  3N26 A;  3O6G A;  4OMB A;  4G68 B;  2V84 A;  5ICT A;  1FJ6 A;  1KA0 A;  4DXC A;  2WYP A;  4ZEC A;  5H8Q A;  1YAE A;  4G8M A;  2I0C A;  4GF8 A;  4PAI A;  1MY3 A;  3G7W A;  4OFO A;  2R6G E;  3U8Q A;  4KPT A;  1MRP A;  4H8I A;  5A5X A;  2MKZ A;  2O6A A;  3C35 A;  3EQ1 A;  5I58 B;  3OSQ A;  3OEK A;  3G3J A;  4GWY A;  4AB5 A;  3KZG A;  4M4G A;  3QUJ A;  1JQF A;  4FE8 A;  4GWW A;  2E0S A;  1O64 A;  2F6G A;  4R9F A;  4MHF A;  4IO2 A;  3EHS A;  1Y4T A;  3KEI A;  2DE4 A;  2REJ A;  3FVN A;  2RC7 A;  4U1O A;  3S9E A;  2XXI A;  4FEC A;  1M5D A;  4QSD A;  3PTY A;  3VVF A;  5AA2 A;  3O97 A;  4YKJ A;  2VOZ A;  3C4M A;  2UXA A;  4QHQ A;  3KC1 A;  1M5B A;  4KD5 A;  4DI4 B;  1NV0 A;  3ILT B;  1FBG A;  1TT1 A;  2GRV A;  2XWK A;  3M3F A;  4AS4 A;  1MXV A;  1JET A;  1US5 A;  1MM7 A;  2QVU A;  3KJ7 A;  2GHB A;  1ZKB A;  4JWY A;  4R6H A;  3CHG A;  3DLN A;  1NUW A;  3VE1 B;  5J16 A;  5EYF A;  4GBW A;  1B0H A;  1SW4 A;  3PPO A;  4F39 A;  2HEU A;  1B6H A;  4Q0C A;  4OYV A;  1LEV A;  3P7I A;  2I6E A;  4NF8 A;  1G0I A;  4O7I A;  1MQI A;  5AA1 A;  1FQD A;  3MW0 A;  5TP9 A;  3TMG A;  2XXK A;  4PQJ A;  2ZYM A;  1URG A;  1SW2 A;  4MLQ A;  4PGP A;  1NH8 A;  4NX1 A;  3LBS A;  1MXY A;  1FBP A;  2I3V A;  3G3K A;  5FHN A;  2FIX A;  3IJX B;  1B4Z A;  3O66 A;  4N6P A;  3IO6 A;  3THI A;  4PDD A;  4KR5 A;  3H7M A;  4XTC Q;  3T96 B;  4DCY A;  5I2N A;  2O68 A;  4QF9 A;  3RQT A;  4H46 A;  2FYI A;  3A09 A;  3R6U A;  3V8X B;  2DXY A;  1QUK A;  3FJG A;  3N5L A;  1BK4 A;  1NMU A;  4GLI A;  2ZXT A;  1B7H A;  4WED A;  2BJI A;  5AA4 A;  2XX9 A;  4WXJ A;  1K9Z A;  2HXR A;  4YKP A;  1GTK A;  1NV2 A;  4OAN A;  4BDQ A;  2OWS A;  2QS4 A;  4O8M A;  4P3L A;  3FUZ A;  3RGY A;  4OVJ A;  3RYD A;  1SYH A;  1ELJ A;  1IEJ A;  2OX3 A;  3T9U A;  1NUY A;  2QFL A;  3PUZ E;  1MPC A;  3BIH A;  5JEI A;  1M5F A;  1RKM A;  4P56 A;  1B52 A;  3K00 A;  2F7A A;  4H67 A;  4GX4 A;  5AA2 D;  1NV7 A;  3IJO B;  3ONM A;  3KJT A;  3RNN A;  5DYH A;  5J1D A;  1LBX A;  3EHU A;  1P1Q A;  3FVO A;  3CI8 A;  2UYE A;  2NWJ A;  3Q27 A;  1MDP 1;  2WEF A;  4FOR A;  5I59 B;  4O94 A;  1UTH B;  3TQW A;  1QW0 A;  2WKY A;  1PDA A;  3FXR A;  4OFJ A;  5I2K B;  3U94 A;  2CZI A;  4IO7 A;  3PUW E;  4RNS A;  5CMK A;  1AIV A;  1KWH A;  4XKN A;  2RF1 A;  3IOW A;  3MWB A;  1Q9D A;  4P9K A;  1AMF A;  4OA4 A;  4GXS B;  3UP9 A;  3A29 A;  4WKM A;  3TAJ A;  3MP1 A;  1Y3N A;  2NXO A;  2D21 A;  4LQ2 A;  3HO7 A;  3FXU A;  1IZ1 A;  3FGS A;  2OJT A;  5EHM A;  3TUS A;  4YKK A;  2B4L A;  1AOV A;  4G2Z A;  5DT6 A;  5F1Q A;  4ISU A;  3MVX A;  2X26 A;  4JSO A;  4YMA A;  5AA3 A;  3TFL A;  1BLF A;  4ESW A;  2HFB A;  4MH5 A;  4EXL A;  3KC0 A;  1B3H A;  1NV6 A;  4EDP A;  1M5C A;  1LBZ A;  3SZP A;  3VV5 A;  1VFE A;  2Y84 A;  1MQD A;  1LFI A;  3C34 A;  3MAM A;  2AL5 A;  1SPI A;  1US4 A;  4IGT A;  2QVR A;  1FTO A;  3MVW A;  3OEL A;  1LBB A;  4ELP A;  4GWX A;  2VP1 A;  3UIF A;  5ITO A;  1NV1 A;  3O29 A;  5BWJ A;  2Y5K A;  4EUO A;  3UA8 A;  1B32 A;  2M8C A;  4UAB A;  4OWD A;  1Y9U A;  1NH7 A;  4F3P A;  3ODB A;  3FXB A;  3GYY A;  5F24 A;  4G8H A;  3WAE A;  2Z8E A;  2I49 A;  4KYS A;  5H8F B;  4C0R A;  2CEX A;  3FIR A;  4HE0 A;  5ELV A;  2DXR A;  3I5O A;  4PFI A;  2ZMB A;  4X48 A;  2RIN A;  3HHG A;  2XX8 A;  4P8B A;  1IMF A;  1IMD A;  3C36 A;  4U4X A;  1JP4 A;  4ZZA A;  2UVG A;  1LFG A;  1EYJ A;  4P0I A;  1B4H A;  4NED A;  3MZ9 A;  2L5V A;  2Q2C A;  2XXR A;  3UOR A;  2O1M A;  2NUV A;  4XKQ A;  4PFT A;  3HPI A;  1B3F A;  1NNK A;  3FV1 A;  2HHM A;  4U23 A;  2B65 A;  3FZV A;  4BDL A;  3S9M C;  1HSL A;  4HCY A;  2KQZ A;  1S50 A;  2XA5 A;  5ET6 A;  3H4Z A;  4O3A A;  1YCJ A;  4N91 A;  5L9S A;  4ZS9 A;  2CEY A;  1VDW A;  3MST A;  3K0V A;  4F22 A;  1LB9 A;  5DW8 A;  3IOT A;  1B0L A;  1QUI A;  3IB1 A;  1SYI A;  1MY1 A;  3CVG A;  3FXQ A;  1LST A;  3HCQ A;  4PP0 A;  3H06 B;  3TYH A;  4JWX A;  4N81 A;  5CRY A;  4RPO A;  1N0T A;  4FED A;  4QRZ A;  3RT8 A;  3QK6 A;  1B1X A;  3TKD A;  4TLM B;  3SEU A;  4POX A;  1EZO A;  4FJP A;  3LSW A;  1D9V A;  2WX9 A;  1NV3 A;  2F36 A;  4ELR A;  3KN8 A;  1L5T A;  1R1N A;  5KDT B;  4O3B A;  2YJP A;  3BIG A;  1FPL A;  2CZL A;  5BUU A;  2V3Q A;  4F18 A;  1XT8 A;  4OTE A;  1MXX A;  5A5L A;  1PBQ A;  2QS3 A;  4GQO A;  5DTB A;  1BKA A;  5H8H B;  3RY3 A;  4ELO A;  4ELQ A;  5EQ8 A;  4P11 A;  3VVD A;  4GWU A;  3B6T A;  4HS7 A;  5H8N A;  3LR1 A;  2O84 X;  1DSN A;  1FQC A;  3HV1 A;  4DZ1 A;  2PFY A;  1SQY A;  3BFU A;  4N15 A;  3H6U A;  2F3B A;  4GIZ A;  4P1L A;  1N3X A;  1POY 1;  4GWS A;  3FBP A;  1LAG E;  5CBR A;  5EYH A;  1RDZ A;  4IB2 A;  1DMB A;  3E78 A;  5L8D A;  3W9W A;  1BIY A;  1I6B A;  5IZ3 A;  5IGA A;  2PMS A;  2F8D A;  2Z8D A;  1A55 A;  3IO4 A;  4MX6 A;  2R9J A;  4LQ5 A;  1FSA A;  4NMY A;  3RLF E;  1DCU A;  1AL3 A;  3LSF B;  4FAT A;  3IAZ A;  3V5A A;  1NNP A;  2WBD A;  1MH4 A;  2A5T A;  1S9T A;  2V93 A;  4Z7E A;  1KA1 A;  2Q88 A;  1WDN A;  2H4I A;  1OVT A;  4AB6 A;  1CB6 A;  3RUM A;  1R9Q A;  2ESN A;  1FBH A;  4N13 A;  4LON B;  4ESX A;  1DTZ A;  4XEQ A;  4I1D A;  4ZEB A;  2V3U A;  4PFB A;  2B4M A;  3CSG A;  4OVT A;  3UGW A;  4KYE A;  1XC1 A;  5TPA B;  1LLS A;  5DEX A;  1KZ8 A;  2P3N A;  4ZEF A;  2CMO A;  2QMX A;  2F3D A;  2DSF A;  3MVY A;  3FVK A;  4NTL A;  3K6U A;  2I4C A;  1IIW A;  2G93 A;  4TOZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...