2F5XA

Structure of periplasmic binding protein bugd
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
299
structure length
299
Chain Sequence
YPERPVNMVVPFAAGGPTDNVARSLAESMRPTLGETVVVENKGGAGGTIGTTQVARAQPDGYSILLMHAGFSTAPSLYKNPGYEPYTSFEPIGLVVDVPMTIIARGDFPPNNIKELAEYVKKNADKISLANAGIGAASHLCGTMLVEALGVNLLTIPYKGTAPAMNDLLGKQVDLMCDQTTNTTQQITSGKVKAYAVTSLKRVPTLPDLPTMDESGYKGFEVGIWHGMWAPKGTPKPVVDKLVKSLQAGLADPKFQERMKQLGAEVLTNEANPEALQAKVKQQVPQWAELFKKAGVEKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BugD
publication title Crystal Structure of Bordetella pertussis BugD Solute Receptor Unveils the Basis of Ligand Binding in a New Family of Periplasmic Binding Proteins
pubmed doi rcsb
source organism Bordetella pertussis tohama i
molecule tags Transport protein
total genus 88
structure length 299
sequence length 299
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03401 TctC Tripartite tricarboxylate transporter family receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2f5xA02
3.40.190.150 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2f5xA01
3PMXA 4UACA 4YZZA 2GFEA 2GHAA 3EHTA 2OK2A 3VXCA 1FTJA 4R2BA 3G3IA 1JVYA 4RJZA 4XKQA 5L9SA 2NOOA 2OLBA 3FVKA 3Q28A 1AOVA 3CFZA 5F1QA 2AIXA 4O3CA 1IZ1A 2O69A 2LAOA 2F35A 2QRYA 3TCFA 3ZS6A 1OLAA 2Z22A 3MUQA 4GRKA 4PFTA 4ZZAA 5CI5A 1D4NA 3V8XB 3RGYA 2X7QA 1LBCA 4H1XA 3GBAA 4DXBA 3ILTB 3H6WA 1ZMGA 2Q89A 3E3KA 5KDTA 3FD3A 3QK6A 3K6WA 3TUSA 1LAFE 4IB2A 4OFOA 3TQLA 2DE4A 4GF8A 5H8FA 2O7IA 4IO2A 4FAJA 1P1OA 4XKNA 4QFOA 2ZYMA 1GTKA 1P1NA 4Z7EA 4EXKA 4Q30B 5JTYB 4RY1A 4ZE8A 4H5FA 5CBSA 2A5TB 2DVZA 4TOZA 1QKBA 1SYHA 1D9VA 4RK9A 4YB7A 3H4ZA 4E0XA 3JYRA 3JZJA 1PBQA 4RPNA 3VVFA 2DQVA 3ZSFA 4YKJA 2Y7IA 1A54A 4EF2A 5DT6A 4XIGQ 4I9DA 4R74A 1ZTYA 1MPDA 4OMBA 1LFGA 3ILUB 4R72A 2KLFA 3FXRA 1FQEA 3WAFA 4NF6B 2F34A 1FQFA 4ZEFA 1JQFA 1Q35A 1RKMA 3CG3A 1WVJA 4H67A 3V89B 5TPAA 2DWIA 3IR1A 3TCHA 3N94A 1TXFA 2AL5A 4U21A 4OENA 2YLNA 1JNFA 2H25A 3RTFB 1FTMA 2XX8A 5FHMA 3W9WA 1Q1KA 4F22A 4OFJA 5I2KB 5F7VA 3QXMA 1FCKA 4JB7A 2D3IA 1M5BA 1IEJA 4TLMB 3Q29A 2X7PA 3DP4A 2H98A 2DWHA 1MXUA 4Q0CA 2XXTA 3UA8A 5CMCA 2I4CA 2ZYNA 1YCJA 1GVCA 4GXAA 3MVWA 3O97A 1MQHA 4TQUQ 3TDJA 2F78A 2I3WA 4N07A 3PMWA 3EHUA 1M5CA 1B2HA 1B1XA 2ONRA 4F1YA 3IJXB 3PPNA 2AL4A 1N3WA 3PPPA 2DYXA 2R71A 2O84X 3N5LA 3U94A 4EQ9A 4GIZA 4YU0A 1EH3A 2RC9A 4QF9A 1TWYA 3SEVA 3QIMA 3CG1A 3G3GA 3ZKKA 2F5XA 2Y7KA 4FJPA 4IGTA 3T22A 1M5EA 5M2VA 5HBCA 3FV2A 3KJ7A 2B3FA 3PUYE 2Q2AA 3FIRA 3CRBA 1JEVA 1GR2A 3O6GA 1LFHA 5TPAB 4GL0A 3TEPA 4YKPA 4OWDA 3LSFB 1PB9A 4OHNA 2OWTA 3HO7A 3M3KA 3C35A 3MPKA 2O51A 1DPPA 2Q9TA 3VV5A 3O2AA 1FTOA 4C0RA 1N3XA 4ESWA 3HHFA 3EN3A 2ZXTA 3S9MC 1Y3QA 1LB9A 2OZZA 5I56B 4MFIA 3KJTA 4QFKA 4IO5A 3S9EA 2F7CA 4KPTA 2YPNA 3K1MA 4YKIA 2Y7RA 4HW8A 2VD3A 1MXVA 3MZ9A 3O6IA 3C4MA 2UVJA 5ELVA 4GQOA 5ITOA 1IXHA 4LA9A 4LUBA 3I5OA 4FE8A 1UTBA 3OO7A 5KZTA 2Z8DA 3GZGA 2DOJA 2UVIA 4BDLA 2Z8FA 2RF1A 3QSLA 1QUJA 4YB5A 5DVFA 1B52A 3CFLA 1PBPA 1SW4A 2PT1A 3RPWA 3RTWB 1NH7A 3A3UA 4U2RA 4NE4A 2Q8JA 3KFMA 5AA2D 3TTRA 4Q8RA 3DP8A 3U92A 4OETA 1OVTA 4LP2B 4ZEIA 4G68C 2O68A 4OERA 5FTIA 3PD9A 1IITA 5LOMA 1DPEA 1Y3PA 1XC1A 4ELOA 3U72A 4IO4A 2ZYOA 3TTNA 1N84A 2G29A 2P1SA 5I58B 4HCWA 3UN6A 3IK6B 4LZ5A 5I57A 3E13X 1UTHA 4BDRA 1NMUA 2THIA 5TP9A 1SBPA 1SW5A 2CZLA 3QUFA 3L6HA 1B4HA 4NF8A 2HQ0A 3KOTA 3L6GA 4QFLA 2AYSA 5L9OA 3O29A 4OESA 1FW0A 3HHGA 3PPOA 4ZECA 4DIGA 1I69A 2I4BA 4QSCA 3IO4A 5DTBA 3CSGA 3FJ7A 2FA7A 1MXZA 4R6YA 4U1ZA 4ECFA 3T9UA 2QJEA 1POTA 2XHDA 1FQBA 1AH5A 3UK4A 4G8MA 1MY3A 5EHMA 5IKBA 1SDXA 4G68A 2B65A 4ZS9A 3T96B 1MQDA 4MH5A 3K0VA 4DCXA 3TKDA 1A40A 3CFXA 4QHQA 3OOAA 4GXSB 1SI1A 5DVJA 2H9BA 1HSEA 5KCJB 3RNNA 2Q88A 4NF4B 2VOZA 2QMWA 4X1DA 1EZPA 2XXWA 5I2NB 1GV8A 4G4PA 2PBWA 4KQPA 5AA4B 3S4UA 1RYXA 3VVDA 1POY1 4HS7A 3RLFE 3PUXE 1B7HA 3G3KA 1B1HA 3DLNA 5I84A 3T66A 2ZMBA 3C34A 2REJA 3R7XA 1HSLA 4YKKA 1UTHB 1KWHA 4Q5TA 2OWSA 5H8NB 3IB1A 5TP9B 2ALUA 2DXYA 2XXUA 1JW4A 4G2ZA 2QS2A 2HZKA 5CMKA 3KN7A 2ABHA 2XXVA 4RA1A 1EZOA 3VFJA 3U1OA 3WAEA 3DP6A 1ZJLA 1BIYA 1MY0A 4FIMA 1M5FA 2PMSA 4L17A 1R9QA 2F7AA 1US5A 1Y20A 3EHSA 1LAHE 4G8HA 3U8QA 3IAZA 1FTLA 3KN3A 1PC3A 3UIFA 3KGCA 3H06B 4ND9A 1NH8A 4PFUA 1QKAA 4LZ8A 5H8HA 3RUMA 3FJMA 3IORA 4G68B 3RQTA 1SYIA 3OSRA 1VE4A 3KSXA 3ECRA 4BDQA 5ICTA 1B05A 3SEUA 4JDFA 1MY2A 1S9TA 1F9BA 2REGA 2Y84A 1NL5A 4RK2A 3EF7A 3T9HB 1PDAA 3OO8A 1OQGA 4XKPA 3H6VA 2IA4A 3G3JA 1WDNA 2HXWA 4WEDA 2IEEA 2ZNTA 3RT6B 5IAIA 1N0TA 4F29A 5HPQA 4LQ2A 3UP9A 3IO6A 4Z0IA 3IOVA 1D9YA 4ZZEA 2F8DA 2I0CA 2XX9A 1XS5A 3LSLA 4C1UA 3S2VA 1B32A 4JXIA 5KDTB 1MH3A 1QVSA 5ICQA 3K4UA 3U93A 3VLVA 1DTZA 2VP1A 4ONYA 4R9GA 4DLDA 3K02A 4JWXA 4LONB 1ZU0A 3OEKA 5H8FB 1P1QA 2PT2A 3OD7A 2ANJA 1MPBA 4PETA 1M5DA 1Y3NA 2I0BA 2DE3A 2HZLA 1B3LA 1USYE 3SERA 1VFDA 3BFUA 5CMMA 4O3AA 2UVHA 1XT8A 2HAUA 5BWJA 1MDQA 3QAXA 1QW0A 3MVYA 3MVZA 2ONSA 4OEUA 1LSTA 4U4SA 3IOWA 3H3GA 1Z7NE 4POXA 1H45A 4F19A 2CMOA 3O66A 3FVNA 4NWCA 2RC7A 2XD2A 3MBPA 1DSNA 3OO6A 1Z7ME 4RYAA 2XXQA 3EQ1A 4LQ5A 1MY4A 3IOTA 4GVOA 1N7WA 3OENA 4F3SA 1ZIUA 2RKMA 1YAEA 4OEVA 4I1DA 1O63A 4FATA 4GFRA 3D4CA 1Y9UA 2VD2A 2NVUB 1QULA 2DWAA 1RYOA 1I6QA 5K2XA 3T9VA 5CM6A 3SDFA 4FECA 3H7MA 3TFLA 1MXYA 3AXFA 3G3HA 4ESXA 4IO6A 5EYFA 3MJNA 1PB8A 1NNKA 3PUWE 4RXLA 4KR5A 1URGA 4GLIA 1OIBA 3C9HA 2ZNSA 5CBRA 2ZYKA 3LSWA 1NKXA 4N6PA 4F31B 4OQOA 1H44A 1DTGA 4PFYA 1OQHA 1US4A 4THIA 5DEXA 4KHZE 5H8QA 1HSJA 4X48A 2Q2CA 1T0KA 3K1PA 5FHNA 1R9LA 1H43A 3TTLA 2DP8A 4YB6A 1PEBA 4DE8A 1UIUA 4F3BA 3TTKA 2RCBA 4RNSA 5L9MA 1A99A 3V5AA 4R6KA 4IY6A 3RN8A 3TYHA 1MQJA 1MXWA 2I6EA 4OTEA 1IIWA 5DVIA 5DYHA 3F11A 4YICA 3KG2A 4KYDA 3GLBA 1B40A 3RT8A 3HPIA 4ELQA 4YMBA 4QRZA 3TQWA 3SETA 3GBBA 4JSOA 2OBGA 1UIVA 1XOCA 2RINA 3I3VA 4ZEDA 3BFTA 4N13A 4POWA 3K6VA 1ELJA 3UGWA 2ZNUA 3Q27A 2GHBA 4UA8A 1B3FA 2O7UA 2Z23A 4OYVA 5AA3A 3TTMA 5JK4A 1QJMA 2G93A 4NF5A 1MQGA 1B3EA 3FXQA 3Q26A 5H8SA 3A09A 2DXRA 4GD5A 4BLAA 4GL8A 3SEYA 2F6PA 3O28A 4DCYA 3M3FA 1VSOA 1I6BA 5AA2A 2NWJA 4QFNA 3PPQA 3OMBA 1MQIA 1S7YA 1MDP1 2QS1A 3USDA 1IXCA 1H76A 5HM4B 3H6UA 4G77A 3VDFA 5DEXB 5H8QB 1FQAA 5JTYA 4KI0E 4R75A 1II5A 2DE2A 3OO9A 4WKMA 5TU0A 2W7YA 1R1NA 2A5TA 4IY5A 2H4IA 3G7WA 3PPRA 4KD5A 1LGBC 2DSFA 1B3GA 1LAXA 5ISUA 3V83A 4F1UA 3QUJA 4DXCA 4P0GA 4AB6A 3QYTA 1MRPA 3B7DA 4X9TA 1LB8A 2PX1A 1DOTA 3G3FA 2QS4A 2RC8A 3CR9A 2O6AA 1P1UA 1R6ZA 2O1MA 1MY1A 1UTBB 4JBZA 3MP1A 1JETA 4G8NA 2V3TA 2DVCA 1XVXA 4FORA 4NTLA 2P2AA 2HEUA 3SKPA 1S50A 4ZE9A 3MC2A 3T9XB 3IOUA 1IUDA 4XKRA 4MBPA 1CB6A 4NF6A 4R2FA 2Z8EA 2XD3A 2QSXA 3VXBA 2V3QA 4NF5B 4IGRA 4XXUA 1I6AA 5J1DA 1MM6A 4H65A 4FEBA 3N26A 2XXRA 1WODA 2XXIA 3HV1A 3ONMA 1A7LA 3ODBA 2XXYA 1USYH 3VLUA 3K00A 3EPEA 3PMVA 4KCDA 1FQCA 3MPLA 4R9FA 4NWDA 5AA2B 3FASA 2E1SA 3MZBA 2UYFA 3FV1A 3MWBA 1FTKA 2X26A 1SW2A 3OELA 2HCAA 5I57B 3CVGA 4FEDA 1N76A 3PU5A 1LCTA 1MPCA 3LSXA 5I2KA 3SESA 3TMGA 4DZ1A 1Y1MA 1XVYA 1JVXA 4KCCA 1JW5A 1Y4TA 4NF8B 3MAMA 4QSDA 2B3BA 3TCGA 5A5XA 3O6HA 2FYIA 2R6GE 4BDOA 3GXAA 3IL1B 4U4XA 4ZEKA 4HTGA 4KFQA 4ZEBA 2HAVA 1OMPA 2VHAA 3B6QA 5FTHA 4O3BA 3TPAA 3O9PA 4H6DA 4WXJA 4ISUA 1MXXA 3W15C 1B9JA 2F97A 3C32A 4F2QA 2Y7PA 2RCAA 2FNCA 2V84A 3FATA 2O1LA 4HCYA 3KOSA 3BBRA 2A5SA 1IQ7A 2P0SA 1SW1A 1URSA 1LLSA 1B5JA 2YJPA 3KZGA 2XX7A 4M1VA 2H5YA 5FHOA 3K1NA 1L5TA 3FJGA 3KBRA 2QMXA 1N04A 2QL3A 4TLLB 1FQDA 1LBBA 1LAGE 4MLVA 3S9NC 3PUVE 3E4RA 2OCUA 3SEWA 4NMYA 2I3VA 3SEXA 1AL3A 3M3LA 4EDPA 4AB5A 1YPNA 1MS7A 1N7XA 3H6TA 2H99A 4GWOA 5JEIA 1SI0A 3ZKLA 3K01A 4P0IA 1B7UA 1JEUA 4EF1A 3T93B 4LATA 1B4ZA 1MG1A 1XHYA 1A55A 3VE1B 2PVUA 1J1NA 3PUZE 1QUKA 4U1OA 2DS9A 4H0WA 5CC2A 1TT1A 5I56A 2XXXA 4H5GA 1B0LA 2UVGA 4PP0A 4EQ7A 4EUOA 2DWJA 1SVXB 1LFIA 2V25A 3A3CA 3I6VA 3PD8A 4BDNA 4KYEA 2NXOA 3BKIB 2QS3A 4IO7A 3HN0A 3KSJA 4DDDA 4ELPA 2F36A 3B6TA 5K2YA 1UQWA 1VR5A 1NNTA 1GGGA 3H03A 3M8UA 4F18A 5A5XB 2M8CA 1NFTA 4AQ4A 1QUIA 1NNPA 4XTCQ 3DELB 3CIJA 3OEMA 4JSDA 1PB7A 1BP5A 3MQ9A 1NNFA 4MLQA 1IXGA 5CMBA 3Q25A 4U23A 3FXUA 5H8HB 1O64A 4EXLA 3VLWA 2WKYA 4K3FA 2GRVA 1H3DA 3FGSA 3KEIA 3TELA 4PFWA 3FUZA 4OFLA 3IB2A 1B5IA 2PYYA 1ZLQA 5AE4A 1Y4CA 2VGQA 2D5WA 2I58A 3THIA 1B6HA 5L8DA 4YMAA 3LBSA 1OLCA 3HCQA 1D3KA 2OJTA 1ATGA 4F2OA 3C33A 5I58A 4X1BA 2NUVA 4OZ9A 2E0SA 1SD3A 3VVEA 4JWYA 4U22A 5B70A 4LVQA 4MF3A 4PE5B 3E9XA 1AMFA 1MH4A 1O7TA 4C1TA 1AIVA 2HFBA 1EZ9A 3C31A 4QFPA 3RY3A 4H8JA 3K6XA 1B46A 4F3PA 3B6WA 5B7DA 3UORA 2ONKE 5I59A 3HSTA 4RPOA 1B7ZA 2BJJX 4LZ7A 1TFDA 2QPQA 3P7IA 3KN8A 1EU8A 3IX1A 3S9LC 2V93A 3MW0A 3FVOA 1DMBA 2ESNA 1P99A 2F6GA 3DM0A 2D21A 4IO3A 2XXHA 3MZ1A 4DXUA 1BKAA 4E0WA 3IJOB 2I48A 3TODA 3PGFA 5CRYA 3TAJA 4GOTA 2GH9A 3K2DA 4ZDMA 4WEPA 1B58A 2UYEA 5AA1A 4ELRA 1Y1ZA 4R73A 4M4GA 3MP8A 4OVJA 2V3UA 4QSEA 3FZVA 5KCJA 1SQYA 4NF4A 1JW1A 3CI8A 3LR1A 1YTVA 1A8FA 5I2NA 3FVGA 3R26A 3MVXA 3OXNA 1VFEA 1MM7A 1TFAA 4KYSA 1P1WA 4F39A 5AA4A 4NEDA 3OSQA 4JWOA 2Y7WA 3LUYA 2I49A 4PQJA 1BLFA 1A8EA 1B3HA 1CE2A 1B5HA 1URDA 4F1VA 4YAHX 3D4GA 3JV9A 3K6UA 3TZAA 2R9JA 2XXPA 1ZKBA 4R6HA 2F7BA 2UXAA 4H8IA 5H8NA 5ITPA 5EHSA 1ANFA 4OXVA 4EQBA 3R6UA 4I62A 3MP6A 3C36A 4BDMA 3N6TA 4P11A 4I8CA 3CSBA 3W9VA 5BUUA 1OVBA 1B51A 4F3GA 1B0HA 1BTJA 3N6UA 3LC8A 5I59B 1LCFA 3PV0E 3IB0A 1IXIA 1ZBMA
chains in the Genus database with same CATH superfamily
3PMXA 4UACA 4YZZA 2GFEA 2GHAA 3EHTA 4MNIA 2OK2A 3VXCA 1FTJA 4R2BA 3G3IA 1JVYA 4RJZA 4XKQA 5L9SA 2NOOA 2OLBA 3FVKA 3Q28A 4N6DA 2WEFA 1AOVA 3CFZA 5F1QA 2AIXA 4O3CA 1IZ1A 2O69A 2HXRA 2LAOA 1FPEA 2XXKA 2F35A 2QRYA 3TCFA 3ZS6A 1OLAA 2Z22A 3MUQA 4GRKA 4PFTA 4ZZAA 5CI5A 1D4NA 3V8XB 4PAKA 1INPA 3RGYA 2X7QA 1DBZA 1LBCA 4H1XA 3GBAA 4DXBA 3ILTB 3H6WA 1ZMGA 2Q89A 3E3KA 5KDTA 3FD3A 3QK6A 3K6WA 5I5PA 3TUSA 1LAFE 4IB2A 4OFOA 3TQLA 3E79A 2DE4A 4GF8A 5H8FA 2O7IA 1FJ9A 4IO2A 4FAJA 1P1OA 1K9ZA 4XKNA 4QFOA 2ZYMA 5DW8A 1GTKA 1P1NA 4Z7EA 4EXKA 2VPOA 4Q30B 5JTYB 4RY1A 4ZE8A 1NV5A 1FJ6A 4H5FA 5CBSA 2A5TB 4O8MA 2DVZA 1FBGA 1NUXA 4TOZA 1QKBA 1SYHA 1D9VA 3KC0A 4RK9A 2CEXA 4YB7A 3H4ZA 4E0XA 3JYRA 3JZJA 1PBQA 3B8BA 4RPNA 3VVFA 4FBPA 2DQVA 4PGPA 3ZSFA 4YKJA 2Y7IA 1A54A 4EF2A 5DT6A 2CZIA 4XIGQ 4JVIA 4I9DA 1LBVA 2VPNA 4R74A 1ZTYA 4PF6A 1MPDA 4OMBA 1LFGA 3RPLA 2GQ1A 3ILUB 4R72A 2KLFA 3T1BA 3FXRA 1FQEA 5ET6A 3WAFA 4N17A 3B50A 4NF6B 2F34A 1FQFA 4ZEFA 1JQFA 1Q35A 1RKMA 3CG3A 1WVJA 4H67A 1VDWA 3QMFA 4GWYA 3V89B 5TPAA 2DWIA 3IR1A 3TCHA 3N94A 1TXFA 2AL5A 4U21A 4OENA 2YLNA 2ZZXA 1NV3A 1JNFA 2H25A 4UABA 3RTFB 1FTMA 2XX8A 5FHMA 1EYIA 3W9WA 1Q1KA 4PCDA 4G61A 2WX9A 4F22A 4OFJA 5I2KB 5F7VA 3QXMA 1FCKA 4O94A 4JB7A 2D3IA 2XWIA 1M5BA 1IEJA 4TLMB 2HPGA 3Q29A 2X7PA 3DP4A 2H98A 2DWHA 2F3BA 4XEQA 1MXUA 4Q0CA 2XXTA 3UA8A 1RDZA 5CMCA 2I4CA 2ZYNA 1YCJA 1GVCA 4GXAA 2KQZA 3MVWA 3O97A 1MQHA 4TQUQ 3TDJA 2F78A 2I3WA 4N07A 3PMWA 3EHUA 1YXIA 1M5CA 1B2HA 1B1XA 2ONRA 4F1YA 3IJXB 3PPNA 2QVUA 3MSTA 2AL4A 1N3WA 4N6KA 3PPPA 2DYXA 2R71A 2O84X 3N5LA 5LDZA 3U94A 4EQ9A 4GIZA 4YU0A 1EH3A 2RC9A 4N8YA 4QF9A 3RPLB 1TWYA 3SEVA 3QIMA 2Y5LA 3CG1A 3G3GA 3ZKKA 1NV7A 2F5XA 2Y7KA 4FJPA 4HE1A 4IGTA 4GBVA 3T22A 1M5EA 5M2VA 5HBCA 3FV2A 3KJ7A 2B3FA 3PUYE 2Q2AA 3FIRA 3CRBA 1JEVA 1GR2A 3O6GA 1LFHA 5TPAB 4GL0A 3TEPA 4YKPA 4OWDA 1NI9A 3LSFB 1PB9A 4OHNA 2OWTA 4O7IA 3HO7A 3M3KA 3C35A 3MPKA 2O51A 1DPPA 2Q9TA 3VV5A 3O2AA 1FTOA 4C0RA 1N3XA 4ESWA 3HHFA 3EN3A 2ZXTA 4OA4A 3S9MC 1LB9A 1Y3QA 2OZZA 5I56B 4MFIA 3KJTA 4QFKA 4IO5A 3S9EA 2F7CA 4KPTA 2YPNA 3K1MA 4YKIA 2Y7RA 4HW8A 2VD3A 1MXVA 3MZ9A 3O6IA 3C4MA 2UVJA 5ELVA 3BIGA 4GQOA 5ET8A 5ITOA 1IXHA 4LA9A 4LUBA 3I5OA 4FE8A 1UTBA 3OO7A 5KZTA 5EQAA 2Z8DA 3GZGA 2DOJA 1LBZA 2UVIA 4BDLA 1K9YA 3T0JA 2Z8FA 2RF1A 3QSLA 1QUJA 4YB5A 5DVFA 1B52A 3CFLA 1PBPA 4NHBA 1SW4A 2PT1A 3RPWA 3RTWB 1NH7A 3A3UA 4U2RA 4NE4A 4NQ8A 1IMEA 2Q8JA 3KFMA 5AA2D 2Q8MA 3TTRA 4Q8RA 4HE0A 3DP8A 3U92A 4OETA 1OVTA 4LP2B 4ZEIA 4G68C 2O68A 4OERA 3EKIA 5FTIA 3U65A 3PD9A 1IITA 5LOMA 1DPEA 1Y3PA 1XC1A 4ELOA 3U72A 4IO4A 2ZYOA 3TTNA 1N84A 2G29A 2P1SA 5I58B 4HCWA 3UN6A 3IK6B 4LZ5A 5I57A 3E13X 1UTHA 4BDRA 1FPKA 1NMUA 4MIJA 2THIA 2QVVA 5TP9A 4XF5A 1LBXA 1SBPA 1SW5A 2CZLA 3QUFA 3L6HA 1B4HA 4NF8A 2HQ0A 3KOTA 3L6GA 4QFLA 4MX6A 2AYSA 5L9OA 3O29A 4OESA 2QVRA 1FW0A 3HHGA 3PPOA 4ZECA 4DIGA 1I69A 2I4BA 4QSCA 3IO4A 5DTBA 3CSGA 3FJ7A 2FA7A 1FBDA 1MXZA 4R6YA 4U1ZA 4ECFA 3T9UA 2QJEA 1POTA 2XHDA 1NV2A 4O7MA 1FQBA 1AH5A 3UK4A 4G8MA 1FBPA 1MY3A 5EHMA 5IKBA 1SDXA 4G68A 2B65A 4ZS9A 3T96B 1G0IA 1MQDA 4MH5A 3K0VA 4DCXA 2PFYA 3TKDA 1A40A 1FPLA 1YZ0A 3CFXA 4QHQA 2DDKA 4GBWA 3OOAA 4GXSB 1QGXA 1SI1A 5DVJA 2H9BA 1HSEA 5KCJB 3RNNA 2Q88A 4NF4B 2VOZA 2QMWA 2XWKA 4X1DA 1EZPA 2XXWA 5I2NB 1GV8A 4G4PA 4N81A 2PBWA 4PDHA 4KQPA 1FRPA 5AA4B 3S4UA 1RYXA 3VVDA 4GX3A 1XI6A 1POY1 4NG7A 4HS7A 3RLFE 4PGNA 3PUXE 1B7HA 3G3KA 1B1HA 3DLNA 5I84A 3T66A 2ZMBA 3C34A 2REJA 1EYJA 3R7XA 1HSLA 4YKKA 1UTHB 1KWHA 4Q5TA 2OWSA 5H8NB 3IB1A 5TP9B 2ALUA 1BK4A 1LBWA 2DXYA 2XXUA 2JJKA 1JW4A 4G2ZA 5I7IA 4P1EA 2QS2A 2HZKA 5CMKA 3KN7A 5EYHA 4IR8A 2ABHA 2XXVA 4RA1A 2WYPA 3VFJA 1EZOA 3U1OA 3WAEA 3DP6A 1ZJLA 1BIYA 1MY0A 4FIMA 1M5FA 2PMSA 1D9QA 4L17A 1R9QA 2F7AA 2FHYA 1US5A 1Y20A 4LN5A 3EHSA 1LAHE 4G8HA 3U8QA 3IAZA 1FTLA 3KN3A 1PC3A 3UIFA 3KGCA 4ND9A 3H06B 4NGUA 1NH8A 4PFUA 1QKAA 4LZ8A 5H8HA 3RUMA 3FJMA 3IORA 4G68B 3RQTA 1SYIA 3OSRA 1VE4A 3KSXA 3ECRA 4BDQA 5ICTA 3KBZA 1RDXA 1B05A 3SEUA 4JDFA 1MY2A 1S9TA 1F9BA 2REGA 2Y84A 4OVRA 1NL5A 4RK2A 3EF7A 3T9HB 1PDAA 3OO8A 1OQGA 4PF8A 4XKPA 3H6VA 2IA4A 3G3JA 1WDNA 2HXWA 4WEDA 2IEEA 2ZNTA 3RT6B 5IAIA 1N0TA 4F29A 2OWZA 4N15A 5HPQA 4LQ2A 2FIEA 3UP9A 3IO6A 1FSAA 4Z0IA 3IOVA 1D9YA 3IFCA 4ZZEA 2F8DA 2I0CA 2XX9A 1XS5A 3LSLA 4GWSA 4C1UA 3S2VA 1B32A 4JXIA 5KDTB 1NV4A 1MH3A 1QVSA 5ICQA 4NN3A 3K4UA 3ISPA 3U93A 3VLVA 1DTZA 2VP1A 4ONYA 4R9GA 4DLDA 3K02A 4JWXA 4LONB 1ZU0A 3OEKA 5H8FB 1P1QA 2PT2A 3OD7A 2ANJA 1IMAA 1MPBA 4PETA 1M5DA 2ZZVA 1Y3NA 2I0BA 2DE3A 2HZLA 1B3LA 1USYE 1FBFA 3SERA 1VFDA 3BFUA 2FIXA 5CMMA 4O3AA 2UVHA 1XT8A 1FTAA 2WBBA 1FPGA 5I3SA 2HAUA 5BWJA 1MDQA 3QAXA 1QW0A 3MVYA 3MVZA 2ONSA 1KZ8A 1LSTA 4OEUA 4OVPA 4U4SA 3IOWA 3H3GA 1Z7NE 4POXA 1H45A 4F19A 2CMOA 3O66A 3FVNA 4NWCA 2RC7A 2XD2A 3MBPA 1DSNA 3FXBA 3OO6A 1G0HA 1Z7ME 4RYAA 2XXQA 3E78A 5EQ7A 3EQ1A 4LQ5A 1MY4A 4MNCA 3IOTA 4GVOA 1N7WA 3OENA 4F3SA 3D1RA 1ZIUA 2RKMA 3BIHA 1YAEA 4OEVA 4I1DA 1O63A 5IM2A 4FATA 4GFRA 3D4CA 4DI4B 1Y9UA 2VD2A 2NVUB 1QULA 2DWAA 1RYOA 1I6QA 5K2XA 3T9VA 5CM6A 3SDFA 4FECA 3H7MA 3TFLA 1MXYA 3AXFA 3G3HA 4ESXA 4IO6A 5EYFA 3MJNA 1PB8A 1NNKA 3PUWE 1RDYA 4RXLA 4KR5A 1URGA 4GLIA 4OVQA 1OIBA 3C9HA 3GYYA 2ZNSA 5CBRA 2ZYKA 3LSWA 1NKXA 4N6PA 4F31B 4OQOA 1H44A 1DTGA 4PFYA 1OQHA 1US4A 4MAGA 4THIA 5DEXA 4KHZE 5H8QA 3LUZA 1HSJA 4X48A 2Q2CA 1T0KA 3K1PA 5FHNA 1R9LA 5IZZA 1H43A 3TTLA 2DP8A 4YB6A 1PEBA 4PDDA 4DE8A 1UIUA 4F3BA 3TTKA 2RCBA 4RNSA 5L9MA 1A99A 3V5AA 4R6KA 4IY6A 3RN8A 3TYHA 1MQJA 1MXWA 2I6EA 4OTEA 1IIWA 5DVIA 5DYHA 3F11A 4HE2A 4YICA 2V4CA 3KG2A 4KYDA 3GLBA 1B40A 3RT8A 3HPIA 1FPIA 1NUYA 4ELQA 4YMBA 4QRZA 3TQWA 1NUWA 3SETA 3GBBA 4JSOA 2OBGA 1UIVA 1XOCA 2RINA 3I3VA 4ZEDA 3BFTA 4N13A 4POWA 3K6VA 1ELJA 3UGWA 2ZNUA 3Q27A 2GHBA 1CNQA 4PTKA 4UA8A 1B3FA 2O7UA 2Z23A 1IMBA 4OYVA 5AA3A 3TTMA 5JK4A 1QJMA 1Q9DA 4QBAA 1FBCA 2G93A 4NF5A 4X04A 1MQGA 1B3EA 3FXQA 3Q26A 5H8SA 3A09A 2DXRA 4GD5A 4BLAA 4GL8A 3SEYA 2F6PA 3O28A 4DCYA 3M3FA 4PE3A 1VSOA 1I6BA 5AA2A 2NWJA 4QFNA 3PPQA 3OMBA 1MQIA 2QFLA 1S7YA 1MDP1 2QS1A 3USDA 1IMCA 1LEVA 1IXCA 2XWOA 1H76A 5HM4B 3H6UA 2PFZA 4AS4A 4G77A 3VDFA 5DEXB 5H8QB 1FQAA 5JTYA 4KI0E 4R75A 1II5A 2DE2A 3OO9A 4JVCA 4WKMA 5TU0A 2W7YA 1R1NA 2A5TA 1FPJA 4IY5A 2H4IA 3G7WA 3PPRA 4KD5A 1LGBC 2DSFA 1B3GA 1LAXA 4I40A 5ISUA 3V83A 4F1UA 3QUJA 4DXCA 4P0GA 4GX6A 4AB6A 2FBPA 1MRPA 3B7DA 3QYTA 4X9TA 1LB8A 2PX1A 1DOTA 3G3FA 5T3JA 1DK4A 2QS4A 2RC8A 4P9KA 4P47A 3CR9A 2O6AA 1P1UA 4P56A 1R6ZA 2O1MA 1MY1A 1UTBB 4JBZA 3MP1A 1JETA 4JVDA 4G8NA 2V3TA 2DVCA 1XVXA 4FORA 4NTLA 2P2AA 5IZ3A 2L5VA 2HEUA 3SKPA 1S50A 4ZE9A 1DCUA 3MC2A 5J16A 3T9XB 3IOUA 1IUDA 4XKRA 4MBPA 3HFUA 1CB6A 4NF6A 4R2FA 1LBYA 2Z8EA 2XD3A 2QSXA 4N4UA 3VXBA 2V3QA 4NF5B 4IGRA 4XXUA 1I6AA 5J1DA 1MM6A 4H65A 4FEBA 3N26A 2XXRA 5F24A 1WODA 2XXIA 3HV1A 3ONMA 1A7LA 3ODBA 2Y5KA 2R8TA 2XXYA 1USYH 2MKZA 3VLUA 3CHGA 3K00A 3EPEA 3PMVA 4PAFA 4KCDA 1FPBA 1FQCA 5A5LA 3MPLA 4R9FA 4NWDA 5AA2B 4GWUA 3FASA 2E1SA 3MZBA 2UYFA 2CZKA 3A29A 3FV1A 3MWBA 1FTKA 2X26A 1SW2A 3OELA 2HCAA 5I57B 3CVGA 4FEDA 1N76A 3PU5A 1LCTA 1MPCA 3LSXA 4X8RA 5I2KA 3SESA 3TMGA 4DZ1A 1Y1MA 1XVYA 1JVXA 4KCCA 1JW5A 1Y4TA 4NF8B 3MAMA 1JP4A 4QSDA 2B3BA 3TCGA 4AS5A 5A5XA 3O6HA 2FYIA 2R6GE 4BDOA 3GXAA 3IL1B 4QXDA 3MYUA 4U4XA 4ZEKA 4HTGA 4KFQA 4ZEBA 2HAVA 1OMPA 2VHAA 2WYKA 3B6QA 5FTHA 4O3BA 3TPAA 3O9PA 4P1LA 4H6DA 4WXJA 4ISUA 1MXXA 4N91A 3W15C 1B9JA 2F97A 3C32A 4F2QA 2KR0A 2Y7PA 2RCAA 2FNCA 2V84A 3FATA 2O1LA 4HCYA 3KOSA 3BBRA 2A5SA 1IQ7A 2P0SA 1SW1A 3PTYA 1URSA 1LLSA 1B5JA 2YJPA 3KZGA 2XX7A 2OX3A 4M1VA 2H5YA 5FHOA 3K1NA 4GWXA 5ET5A 1L5TA 3FJGA 3KBRA 5IZ3B 2QMXA 1N04A 2QL3A 4TLLB 1FQDA 4HXVA 1IMDA 1EYKA 1LBBA 1LAGE 4MLVA 3S9NC 3PUVE 3E4RA 4OANA 2OCUA 4NMYA 2I3VA 3SEWA 3SEXA 1AL3A 3M3LA 4EDPA 4AB5A 1YPNA 5LTCA 4I3YA 1MS7A 1N7XA 3H6TA 2H99A 4GWOA 5JEIA 4GWWA 2ZZWA 1SI0A 3ZKLA 1FBHA 3K01A 4P0IA 1B7UA 1JEUA 4EF1A 3T93B 4LATA 1B4ZA 1MG1A 1XHYA 1NUZA 1A55A 3VE1B 2PVUA 1J1NA 3PUZE 4MCOA 1QUKA 4U1OA 2DS9A 4H0WA 5CC2A 1TT1A 5I56A 2XXXA 4H5GA 1B0LA 2UVGA 4PP0A 4PBHA 4EQ7A 4EUOA 2DWJA 1SVXB 1LFIA 2V25A 3A3CA 4DI3D 3I6VA 3PD8A 4BDNA 2PCRA 3IFAA 4KYEA 2NXOA 3BKIB 2B4LA 2QS3A 4IO7A 3HN0A 3KSJA 4DDDA 4ELPA 2F36A 3B6TA 5K2YA 1UQWA 1VR5A 1NNTA 1GGGA 4P8BA 3H03A 3M8UA 4F18A 5A5XB 2M8CA 5EYGA 3ROJA 5EQ9A 1NFTA 4AQ4A 1FPFA 4MJOA 1QUIA 1NNPA 4XTCQ 3DELB 3CIJA 3OEMA 4JSDA 1PB7A 1BP5A 3MQ9A 1NNFA 4XFEA 4MLQA 1IXGA 5CMBA 3RYDA 3Q25A 5ESYA 4U23A 3FXUA 5H8HB 1O64A 4EXLA 3VLWA 4PFBA 2WKYA 4K3FA 2GRVA 4MEVA 1H3DA 3FGSA 3KEIA 3TELA 4PFWA 3FUZA 1FBEA 4OFLA 3IB2A 1B5IA 2PYYA 1ZLQA 5AE4A 1Y4CA 2VGQA 4OVSA 5IGAA 2D5WA 2I58A 3THIA 1B6HA 5L8DA 4YMAA 3LBSA 1OLCA 3HCQA 3NOHA 1D3KA 2OJTA 2CZHA 1ATGA 4F2OA 2XA5A 3C33A 4PFIA 4X1BA 5I58A 2NUVA 5EQ8A 4OZ9A 4I3EA 2E0SA 1SD3A 3VVEA 4JWYA 3SZPA 4U22A 4GWZA 5B70A 2P3NA 4LVQA 4MF3A 4PE5B 3E9XA 4GX4A 1AMFA 1MH4A 1O7TA 4C1TA 1AIVA 2HFBA 1EZ9A 3C31A 4QFPA 3RY3A 4H8JA 3K6XA 1B46A 4F3PA 3B6WA 1NV0A 5B7DA 3UORA 2ONKE 5I59A 5ET7A 3HSTA 4OVTA 4RPOA 1B7ZA 2BJJX 4LZ7A 1TFDA 2QPQA 1KA0A 3P7IA 3KN8A 1EU8A 2HHMA 4P3LA 2B4MA 3IX1A 3S9LC 2V93A 3MW0A 3FVOA 4MHFA 1SPIA 1DMBA 2ESNA 1P99A 4PFRA 2F6GA 3DM0A 2D21A 4KXPA 1IMFA 4PC9A 4IO3A 2XXHA 3MZ1A 1NV1A 4PAIA 1FPDA 4DXUA 1BKAA 5FBPA 4E0WA 3IJOB 2I48A 3TODA 3PGFA 5CRYA 1YYZA 2XWVA 3TAJA 4GOTA 2WBDA 2GH9A 3K2DA 4ZDMA 4WEPA 1B58A 2UYEA 5AA1A 2BJIA 4ELRA 1Y1ZA 4R73A 4PBQA 2F3DA 4NX1A 4M4GA 1NV6A 3LV0A 3MP8A 4OVJA 2V3UA 4QSEA 3FZVA 5KCJA 1SQYA 2FVZA 4NF4A 1JW1A 3CI8A 3LR1A 4H45A 1KA1A 4H46A 1YTVA 2VT5A 1A8FA 4NAPA 5I2NA 4MMPA 3FVGA 3R26A 3MVXA 3OXNA 1VFEA 1MM7A 1TFAA 4KYSA 1P1WA 4F39A 5AA4A 4NEDA 3OSQA 4JWOA 2Y7WA 3LUYA 2I49A 2Q74A 4PQJA 1BLFA 1A8EA 1B3HA 1CE2A 1B5HA 1URDA 1AWBA 4F1VA 4YAHX 3D4GA 3JV9A 3K6UA 3TZAA 4MNPA 2R9JA 2XXPA 1ZKBA 4R6HA 2F7BA 2UXAA 4H8IA 5H8NA 5ITPA 5EHSA 1ANFA 4OXVA 4EQBA 2P3VA 3R6UA 4I62A 3MP6A 3C36A 4BDMA 3N6TA 4P11A 4I8CA 3CSBA 3W9VA 5BUUA 1OVBA 1B51A 4F3GA 1B0HA 1BTJA 3N6UA 3LC8A 5I59B 2CEYA 5IZ1A 4NF0A 1LCFA 3KC1A 3PV0E 3IB0A 1IXIA 4N8GA 1ZBMA 3FBPA
chains in the Genus database with same CATH topology
3PMXA 4UACA 4YZZA 2GFEA 2GHAA 3EHTA 4MNIA 2OK2A 3VXCA 1FTJA 4R2BA 3G3IA 1JVYA 4RJZA 4XKQA 5L9SA 2NOOA 2OLBA 3FVKA 3Q28A 4N6DA 2WEFA 1AOVA 3CFZA 5F1QA 2AIXA 4O3CA 1IZ1A 2O69A 2HXRA 2LAOA 1FPEA 2XXKA 2F35A 2QRYA 3TCFA 3ZS6A 1OLAA 2Z22A 3MUQA 4GRKA 4PFTA 4ZZAA 5CI5A 1D4NA 3V8XB 4PAKA 1INPA 3RGYA 2X7QA 1DBZA 1LBCA 4H1XA 3GBAA 4DXBA 3ILTB 3H6WA 1ZMGA 2Q89A 3E3KA 5KDTA 3FD3A 3QK6A 3K6WA 5I5PA 3TUSA 1LAFE 4IB2A 4OFOA 3TQLA 3E79A 2DE4A 4GF8A 5H8FA 2O7IA 1FJ9A 4IO2A 4FAJA 1P1OA 1K9ZA 4XKNA 4QFOA 2ZYMA 5DW8A 1GTKA 1P1NA 4Z7EA 4EXKA 2VPOA 4Q30B 5JTYB 4RY1A 4ZE8A 1NV5A 1FJ6A 4H5FA 5CBSA 2A5TB 4O8MA 2DVZA 1FBGA 1NUXA 4TOZA 1QKBA 1SYHA 1D9VA 3KC0A 4RK9A 2CEXA 4YB7A 3H4ZA 4E0XA 3JYRA 3JZJA 1PBQA 3B8BA 4RPNA 3VVFA 4FBPA 2DQVA 4PGPA 3ZSFA 4YKJA 2Y7IA 1A54A 4EF2A 5DT6A 2CZIA 4XIGQ 4JVIA 4I9DA 1LBVA 2VPNA 4R74A 1ZTYA 4PF6A 1MPDA 4OMBA 1LFGA 3RPLA 2GQ1A 3ILUB 4R72A 2KLFA 3T1BA 3FXRA 1FQEA 5ET6A 3WAFA 4N17A 3B50A 4NF6B 2F34A 1FQFA 4ZEFA 1JQFA 1Q35A 1RKMA 3CG3A 1WVJA 4H67A 1VDWA 3QMFA 4GWYA 3V89B 5TPAA 2DWIA 3IR1A 3TCHA 3N94A 1TXFA 2AL5A 4U21A 4OENA 2YLNA 2ZZXA 1NV3A 1JNFA 2H25A 3RTFB 4UABA 1FTMA 2XX8A 5FHMA 1EYIA 3W9WA 1Q1KA 4PCDA 4G61A 2WX9A 4F22A 4OFJA 5I2KB 5F7VA 3QXMA 1FCKA 4O94A 4JB7A 2D3IA 2XWIA 1M5BA 1IEJA 4TLMB 2HPGA 3Q29A 2X7PA 3DP4A 2H98A 2DWHA 2F3BA 4XEQA 1MXUA 4Q0CA 2XXTA 3UA8A 1RDZA 5CMCA 2I4CA 2ZYNA 1YCJA 1GVCA 4GXAA 2KQZA 3MVWA 3O97A 1MQHA 4TQUQ 3TDJA 2F78A 2I3WA 4N07A 3PMWA 3EHUA 1YXIA 1M5CA 1B2HA 1B1XA 2ONRA 4F1YA 3IJXB 3PPNA 2QVUA 3MSTA 2AL4A 1N3WA 4N6KA 3PPPA 2DYXA 2R71A 2O84X 3N5LA 5LDZA 3U94A 4EQ9A 4GIZA 4YU0A 1EH3A 2RC9A 4N8YA 4QF9A 3RPLB 1TWYA 3SEVA 3QIMA 2Y5LA 3CG1A 3G3GA 3ZKKA 2F5XA 2Y7KA 4FJPA 1NV7A 4HE1A 4IGTA 4GBVA 3T22A 1M5EA 5M2VA 5HBCA 3FV2A 3KJ7A 2B3FA 3PUYE 2Q2AA 3FIRA 3CRBA 1JEVA 1GR2A 3O6GA 1LFHA 5TPAB 4GL0A 3TEPA 4YKPA 4OWDA 1NI9A 3LSFB 1PB9A 4OHNA 2OWTA 4O7IA 3HO7A 3M3KA 3C35A 3MPKA 2O51A 1DPPA 2Q9TA 3VV5A 3O2AA 1FTOA 4C0RA 1N3XA 4ESWA 3HHFA 3EN3A 2ZXTA 3S9MC 4OA4A 1Y3QA 1LB9A 2OZZA 5I56B 4MFIA 3KJTA 4QFKA 4IO5A 3S9EA 2F7CA 4KPTA 2YPNA 3K1MA 4YKIA 2Y7RA 4HW8A 2VD3A 1MXVA 3MZ9A 3O6IA 3C4MA 2UVJA 5ELVA 3BIGA 4GQOA 5ITOA 5ET8A 1IXHA 4LA9A 4LUBA 3I5OA 4FE8A 1UTBA 3OO7A 5KZTA 5EQAA 2Z8DA 3GZGA 2DOJA 1LBZA 2UVIA 4BDLA 1K9YA 3T0JA 2Z8FA 2RF1A 3QSLA 1QUJA 4YB5A 5DVFA 1B52A 3CFLA 1PBPA 4NHBA 1SW4A 2PT1A 3RPWA 3RTWB 1NH7A 3A3UA 4U2RA 4NE4A 4NQ8A 2Q8JA 1IMEA 3KFMA 5AA2D 2Q8MA 3TTRA 4Q8RA 4HE0A 3DP8A 3U92A 4OETA 1OVTA 4LP2B 4ZEIA 4G68C 2O68A 4OERA 5FTIA 3EKIA 3U65A 3PD9A 1IITA 5LOMA 1DPEA 1Y3PA 1XC1A 4ELOA 3U72A 4IO4A 2ZYOA 3TTNA 1N84A 2G29A 2P1SA 5I58B 4HCWA 3UN6A 3IK6B 4LZ5A 5I57A 3E13X 1UTHA 4BDRA 1FPKA 1NMUA 4MIJA 2THIA 2QVVA 5TP9A 4XF5A 1LBXA 1SBPA 1SW5A 2CZLA 3QUFA 3L6HA 1B4HA 4NF8A 2HQ0A 3KOTA 3L6GA 4QFLA 4MX6A 2AYSA 5L9OA 3O29A 4OESA 2QVRA 1FW0A 3HHGA 3PPOA 4ZECA 4DIGA 1I69A 2I4BA 4QSCA 3IO4A 5DTBA 3CSGA 3FJ7A 2FA7A 1FBDA 1MXZA 4R6YA 4U1ZA 4ECFA 3T9UA 2QJEA 1POTA 2XHDA 1NV2A 4O7MA 1FQBA 1AH5A 3UK4A 4G8MA 1FBPA 1MY3A 5EHMA 5IKBA 1SDXA 4G68A 2B65A 4ZS9A 3T96B 1G0IA 1MQDA 4MH5A 3K0VA 4DCXA 2PFYA 3TKDA 1A40A 1FPLA 1YZ0A 3CFXA 4QHQA 2DDKA 4GBWA 3OOAA 4GXSB 1QGXA 1SI1A 5DVJA 2H9BA 1HSEA 5KCJB 3RNNA 2Q88A 4NF4B 2VOZA 2QMWA 2XWKA 4X1DA 1EZPA 2XXWA 5I2NB 1GV8A 4G4PA 4N81A 2PBWA 4PDHA 4KQPA 1FRPA 5AA4B 3S4UA 1RYXA 3VVDA 4GX3A 1XI6A 1POY1 4NG7A 4HS7A 3RLFE 4PGNA 3PUXE 1B7HA 3G3KA 1B1HA 3DLNA 5I84A 3T66A 2ZMBA 3C34A 2REJA 1EYJA 3R7XA 1HSLA 4YKKA 1UTHB 1KWHA 4Q5TA 2OWSA 5H8NB 3IB1A 5TP9B 2ALUA 1BK4A 1LBWA 2DXYA 2XXUA 2JJKA 1JW4A 4G2ZA 5I7IA 4P1EA 2QS2A 2HZKA 5CMKA 3KN7A 5EYHA 4IR8A 2ABHA 2XXVA 4RA1A 1EZOA 3VFJA 2WYPA 3U1OA 3WAEA 3DP6A 1ZJLA 1BIYA 1MY0A 4FIMA 1M5FA 2PMSA 1D9QA 4L17A 1R9QA 2F7AA 2FHYA 1US5A 1Y20A 4LN5A 3EHSA 1LAHE 4G8HA 3U8QA 3IAZA 1FTLA 3KN3A 1PC3A 3UIFA 3KGCA 3H06B 4ND9A 4NGUA 1NH8A 4PFUA 1QKAA 4LZ8A 5H8HA 3RUMA 3FJMA 3IORA 4G68B 3RQTA 1SYIA 3OSRA 1VE4A 3KSXA 3ECRA 4BDQA 5ICTA 3KBZA 1RDXA 1B05A 3SEUA 4JDFA 1MY2A 1S9TA 1F9BA 2REGA 2Y84A 4OVRA 1NL5A 4RK2A 3EF7A 3T9HB 1PDAA 3OO8A 1OQGA 4PF8A 4XKPA 3H6VA 2IA4A 3G3JA 1WDNA 2HXWA 4WEDA 2IEEA 2ZNTA 3RT6B 5IAIA 1N0TA 4F29A 2OWZA 4N15A 5HPQA 4LQ2A 2FIEA 3UP9A 3IO6A 1FSAA 4Z0IA 3IOVA 1D9YA 3IFCA 4ZZEA 2F8DA 2I0CA 2XX9A 1XS5A 3LSLA 4GWSA 4C1UA 3S2VA 1B32A 4JXIA 5KDTB 1NV4A 1MH3A 1QVSA 5ICQA 4NN3A 3K4UA 3U93A 3ISPA 3VLVA 1DTZA 2VP1A 4ONYA 4R9GA 4DLDA 3K02A 4JWXA 4LONB 1ZU0A 3OEKA 5H8FB 1P1QA 2PT2A 3OD7A 2ANJA 1IMAA 1MPBA 4PETA 1M5DA 2ZZVA 1Y3NA 2I0BA 2DE3A 2HZLA 1B3LA 1USYE 3SERA 1FBFA 1VFDA 3BFUA 2FIXA 5CMMA 4O3AA 2UVHA 1XT8A 1FTAA 2WBBA 1FPGA 5I3SA 2HAUA 5BWJA 1MDQA 3QAXA 1QW0A 3MVYA 3MVZA 2ONSA 4OEUA 1LSTA 1KZ8A 4OVPA 4U4SA 3IOWA 3H3GA 1Z7NE 4POXA 1H45A 4F19A 2CMOA 3O66A 3FVNA 4NWCA 2RC7A 2XD2A 3MBPA 1DSNA 3FXBA 3OO6A 1G0HA 1Z7ME 4RYAA 2XXQA 3E78A 5EQ7A 3EQ1A 4LQ5A 1MY4A 4MNCA 3IOTA 4GVOA 1N7WA 3OENA 4F3SA 3D1RA 1ZIUA 2RKMA 3BIHA 1YAEA 4OEVA 4I1DA 1O63A 5IM2A 4FATA 4GFRA 3D4CA 4DI4B 1Y9UA 2VD2A 2NVUB 1QULA 2DWAA 1RYOA 1I6QA 5K2XA 3T9VA 5CM6A 3SDFA 4FECA 3H7MA 3TFLA 1MXYA 3AXFA 3G3HA 4ESXA 4IO6A 5EYFA 3MJNA 1PB8A 1NNKA 3PUWE 1RDYA 4RXLA 4KR5A 1URGA 4GLIA 4OVQA 1OIBA 3C9HA 3GYYA 2ZNSA 5CBRA 2ZYKA 3LSWA 1NKXA 4N6PA 4F31B 4OQOA 1H44A 1DTGA 4PFYA 1OQHA 1US4A 4MAGA 4THIA 5DEXA 4KHZE 5H8QA 3LUZA 1HSJA 4X48A 2Q2CA 1T0KA 3K1PA 5FHNA 1R9LA 5IZZA 1H43A 3TTLA 2DP8A 4YB6A 1PEBA 4PDDA 4DE8A 1UIUA 4F3BA 3TTKA 2RCBA 4RNSA 5L9MA 1A99A 3V5AA 4R6KA 4IY6A 3RN8A 3TYHA 1MQJA 1MXWA 2I6EA 4OTEA 1IIWA 5DVIA 5DYHA 3F11A 4HE2A 4YICA 2V4CA 3KG2A 4KYDA 3GLBA 1B40A 3RT8A 3HPIA 1FPIA 4ELQA 1NUYA 4YMBA 4QRZA 3TQWA 1NUWA 3SETA 3GBBA 4JSOA 2OBGA 1UIVA 1XOCA 2RINA 3I3VA 4ZEDA 3BFTA 4N13A 4POWA 3K6VA 1ELJA 3UGWA 2ZNUA 3Q27A 2GHBA 1CNQA 4PTKA 4UA8A 1B3FA 2O7UA 2Z23A 4OYVA 1IMBA 5AA3A 3TTMA 5JK4A 1QJMA 1Q9DA 4QBAA 1FBCA 2G93A 4NF5A 4X04A 1MQGA 1B3EA 3FXQA 3Q26A 5H8SA 3A09A 2DXRA 4GD5A 4BLAA 4GL8A 3SEYA 2F6PA 3O28A 4DCYA 3M3FA 4PE3A 1VSOA 1I6BA 5AA2A 2NWJA 4QFNA 3PPQA 3OMBA 1MQIA 2QFLA 1S7YA 1MDP1 2QS1A 3USDA 1IMCA 1LEVA 1IXCA 2XWOA 1H76A 5HM4B 3H6UA 2PFZA 4AS4A 4G77A 3VDFA 5DEXB 5H8QB 1FQAA 5JTYA 4KI0E 4R75A 1II5A 2DE2A 3OO9A 4WKMA 4JVCA 5TU0A 2W7YA 1R1NA 2A5TA 1FPJA 4IY5A 2H4IA 3G7WA 3PPRA 4KD5A 1LGBC 2DSFA 1B3GA 1LAXA 4I40A 5ISUA 3V83A 4F1UA 3QUJA 4DXCA 4P0GA 4AB6A 4GX6A 3QYTA 1MRPA 3B7DA 2FBPA 4X9TA 1LB8A 2PX1A 1DOTA 3G3FA 5T3JA 1DK4A 2QS4A 2RC8A 4P9KA 4P47A 3CR9A 2O6AA 1P1UA 4P56A 1R6ZA 2O1MA 1MY1A 1UTBB 4JBZA 3MP1A 1JETA 4JVDA 4G8NA 2V3TA 2DVCA 1XVXA 4FORA 4NTLA 2P2AA 5IZ3A 2L5VA 2HEUA 3SKPA 1S50A 4ZE9A 1DCUA 3MC2A 5J16A 3T9XB 3IOUA 1IUDA 4XKRA 4MBPA 3HFUA 1CB6A 4NF6A 4R2FA 1LBYA 2Z8EA 2XD3A 2QSXA 3VXBA 4N4UA 2V3QA 4NF5B 4IGRA 4XXUA 1I6AA 5J1DA 1MM6A 4H65A 4FEBA 3N26A 2XXRA 5F24A 1WODA 2XXIA 3HV1A 3ONMA 1A7LA 3ODBA 2Y5KA 2XXYA 2R8TA 1USYH 2MKZA 3VLUA 3CHGA 3K00A 3EPEA 3PMVA 4PAFA 4KCDA 1FPBA 1FQCA 5A5LA 3MPLA 4R9FA 4NWDA 5AA2B 4GWUA 3FASA 2E1SA 3MZBA 2UYFA 2CZKA 3A29A 3FV1A 3MWBA 1FTKA 2X26A 1SW2A 3OELA 2HCAA 5I57B 3CVGA 4FEDA 1N76A 3PU5A 1LCTA 1MPCA 3LSXA 4X8RA 5I2KA 3SESA 3TMGA 4DZ1A 1Y1MA 1XVYA 1JVXA 4KCCA 1JW5A 1Y4TA 4NF8B 3MAMA 1JP4A 4QSDA 2B3BA 3TCGA 5A5XA 4AS5A 3O6HA 2FYIA 2R6GE 4BDOA 3GXAA 3IL1B 4QXDA 3MYUA 4U4XA 4ZEKA 4HTGA 4KFQA 4ZEBA 2HAVA 1OMPA 2VHAA 2WYKA 3B6QA 5FTHA 4O3BA 3TPAA 3O9PA 4P1LA 4H6DA 4WXJA 4ISUA 1MXXA 4N91A 3W15C 1B9JA 2F97A 3C32A 4F2QA 2KR0A 2Y7PA 2RCAA 2FNCA 2V84A 3FATA 2O1LA 4HCYA 3KOSA 3BBRA 2A5SA 1IQ7A 2P0SA 1SW1A 3PTYA 1URSA 1LLSA 1B5JA 2YJPA 3KZGA 2XX7A 2OX3A 4M1VA 2H5YA 5FHOA 3K1NA 4GWXA 5ET5A 1L5TA 3FJGA 3KBRA 5IZ3B 2QMXA 1N04A 2QL3A 4TLLB 1FQDA 4HXVA 1IMDA 1EYKA 1LBBA 1LAGE 4MLVA 3S9NC 3PUVE 3E4RA 4OANA 2OCUA 3SEWA 4NMYA 2I3VA 3SEXA 1AL3A 3M3LA 4EDPA 4AB5A 1YPNA 5LTCA 4I3YA 1MS7A 1N7XA 3H6TA 2H99A 4GWOA 5JEIA 4GWWA 2ZZWA 1SI0A 3ZKLA 1FBHA 3K01A 4P0IA 1B7UA 1JEUA 4EF1A 3T93B 4LATA 1B4ZA 1MG1A 1XHYA 1NUZA 1A55A 3VE1B 2PVUA 1J1NA 3PUZE 4MCOA 1QUKA 4U1OA 2DS9A 4H0WA 5CC2A 1TT1A 5I56A 2XXXA 4H5GA 1B0LA 2UVGA 4PP0A 4PBHA 4EQ7A 4EUOA 2DWJA 1SVXB 1LFIA 2V25A 3A3CA 4DI3D 3I6VA 3PD8A 4BDNA 2PCRA 3IFAA 4KYEA 2NXOA 3BKIB 2B4LA 2QS3A 4IO7A 3HN0A 3KSJA 4DDDA 4ELPA 2F36A 3B6TA 5K2YA 1UQWA 1VR5A 1NNTA 1GGGA 4P8BA 3H03A 3M8UA 4F18A 5A5XB 2M8CA 5EYGA 3ROJA 5EQ9A 1NFTA 4AQ4A 1FPFA 4MJOA 1QUIA 1NNPA 4XTCQ 3DELB 3CIJA 3OEMA 4JSDA 1PB7A 1BP5A 3MQ9A 1NNFA 4XFEA 4MLQA 1IXGA 5CMBA 3RYDA 3Q25A 5ESYA 4U23A 3FXUA 5H8HB 1O64A 4EXLA 3VLWA 4PFBA 2WKYA 4K3FA 2GRVA 4MEVA 1H3DA 3FGSA 3KEIA 3TELA 4PFWA 3FUZA 1FBEA 4OFLA 3IB2A 1B5IA 2PYYA 1ZLQA 5AE4A 1Y4CA 2VGQA 4OVSA 5IGAA 2D5WA 2I58A 3THIA 1B6HA 5L8DA 4YMAA 3LBSA 1OLCA 3HCQA 3NOHA 1D3KA 2OJTA 2CZHA 1ATGA 4F2OA 2XA5A 3C33A 5I58A 4X1BA 4PFIA 2NUVA 5EQ8A 4OZ9A 4I3EA 2E0SA 1SD3A 3VVEA 4JWYA 3SZPA 4U22A 5B70A 4GWZA 2P3NA 4LVQA 4MF3A 4PE5B 3E9XA 4GX4A 1AMFA 1MH4A 1O7TA 4C1TA 1AIVA 2HFBA 1EZ9A 3C31A 4QFPA 3RY3A 4H8JA 3K6XA 1B46A 4F3PA 3B6WA 5B7DA 1NV0A 3UORA 2ONKE 5I59A 5ET7A 3HSTA 4OVTA 4RPOA 1B7ZA 2BJJX 4LZ7A 1TFDA 2QPQA 1KA0A 3P7IA 3KN8A 1EU8A 2HHMA 4P3LA 2B4MA 3IX1A 3S9LC 2V93A 3MW0A 3FVOA 4MHFA 1SPIA 1DMBA 2ESNA 1P99A 4PFRA 2F6GA 3DM0A 2D21A 4KXPA 1IMFA 4PC9A 4IO3A 2XXHA 3MZ1A 1NV1A 4PAIA 1FPDA 4DXUA 1BKAA 5FBPA 4E0WA 3IJOB 2I48A 3TODA 3PGFA 5CRYA 1YYZA 2XWVA 3TAJA 4GOTA 2WBDA 2GH9A 3K2DA 4ZDMA 4WEPA 1B58A 2UYEA 5AA1A 4ELRA 2BJIA 1Y1ZA 4R73A 4PBQA 2F3DA 4NX1A 4M4GA 1NV6A 3MP8A 3LV0A 4OVJA 2V3UA 4QSEA 3FZVA 5KCJA 1SQYA 2FVZA 4NF4A 1JW1A 3CI8A 3LR1A 4H45A 1KA1A 4H46A 1YTVA 2VT5A 1A8FA 4NAPA 5I2NA 4MMPA 3FVGA 3R26A 3MVXA 3OXNA 1VFEA 1MM7A 1TFAA 4KYSA 1P1WA 4F39A 5AA4A 4NEDA 3OSQA 4JWOA 2Y7WA 3LUYA 2I49A 2Q74A 4PQJA 1BLFA 1A8EA 1B3HA 1CE2A 1B5HA 1URDA 1AWBA 4F1VA 4YAHX 3D4GA 3JV9A 3K6UA 3TZAA 4MNPA 2R9JA 2XXPA 1ZKBA 4R6HA 2F7BA 2UXAA 4H8IA 5H8NA 5ITPA 5EHSA 1ANFA 4OXVA 4EQBA 2P3VA 3R6UA 4I62A 3MP6A 3C36A 4BDMA 3N6TA 4P11A 4I8CA 3CSBA 3W9VA 5BUUA 1OVBA 1B51A 4F3GA 1B0HA 1BTJA 3N6UA 3LC8A 5I59B 2CEYA 5IZ1A 4NF0A 1LCFA 3PV0E 3KC1A 3IB0A 1IXIA 4N8GA 1ZBMA 3FBPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PMX A;  4UAC A;  4YZZ A;  2GFE A;  2GHA A;  3EHT A;  2OK2 A;  3VXC A;  1FTJ A;  4R2B A;  3G3I A;  1JVY A;  4RJZ A;  4XKQ A;  5L9S A;  2NOO A;  2OLB A;  3FVK A;  3Q28 A;  1AOV A;  3CFZ A;  5F1Q A;  2AIX A;  4O3C A;  1IZ1 A;  2O69 A;  2LAO A;  2F35 A;  2QRY A;  3TCF A;  3ZS6 A;  1OLA A;  2Z22 A;  3MUQ A;  4GRK A;  4PFT A;  4ZZA A;  5CI5 A;  1D4N A;  3V8X B;  3RGY A;  2X7Q A;  1LBC A;  4H1X A;  3GBA A;  4DXB A;  3ILT B;  3H6W A;  1ZMG A;  2Q89 A;  3E3K A;  5KDT A;  3FD3 A;  3QK6 A;  3K6W A;  3TUS A;  1LAF E;  4IB2 A;  4OFO A;  3TQL A;  2DE4 A;  4GF8 A;  5H8F A;  2O7I A;  4IO2 A;  4FAJ A;  1P1O A;  4XKN A;  4QFO A;  2ZYM A;  1GTK A;  1P1N A;  4Z7E A;  4EXK A;  4Q30 B;  5JTY B;  4RY1 A;  4ZE8 A;  4H5F A;  5CBS A;  2A5T B;  2DVZ A;  4TOZ A;  1QKB A;  1SYH A;  1D9V A;  4RK9 A;  4YB7 A;  3H4Z A;  4E0X A;  3JYR A;  3JZJ A;  1PBQ A;  4RPN A;  3VVF A;  2DQV A;  3ZSF A;  4YKJ A;  2Y7I A;  1A54 A;  4EF2 A;  5DT6 A;  4XIG Q;  4I9D A;  4R74 A;  1ZTY A;  1MPD A;  4OMB A;  1LFG A;  3ILU B;  4R72 A;  2KLF A;  3FXR A;  1FQE A;  3WAF A;  4NF6 B;  2F34 A;  1FQF A;  4ZEF A;  1JQF A;  1Q35 A;  1RKM A;  3CG3 A;  1WVJ A;  4H67 A;  3V89 B;  5TPA A;  2DWI A;  3IR1 A;  3TCH A;  3N94 A;  1TXF A;  2AL5 A;  4U21 A;  4OEN A;  2YLN A;  1JNF A;  2H25 A;  3RTF B;  1FTM A;  2XX8 A;  5FHM A;  3W9W A;  1Q1K A;  4F22 A;  4OFJ A;  5I2K B;  5F7V A;  3QXM A;  1FCK A;  4JB7 A;  2D3I A;  1M5B A;  1IEJ A;  4TLM B;  3Q29 A;  2X7P A;  3DP4 A;  2H98 A;  2DWH A;  1MXU A;  4Q0C A;  2XXT A;  3UA8 A;  5CMC A;  2I4C A;  2ZYN A;  1YCJ A;  1GVC A;  4GXA A;  3MVW A;  3O97 A;  1MQH A;  4TQU Q;  3TDJ A;  2F78 A;  2I3W A;  4N07 A;  3PMW A;  3EHU A;  1M5C A;  1B2H A;  1B1X A;  2ONR A;  4F1Y A;  3IJX B;  3PPN A;  2AL4 A;  1N3W A;  3PPP A;  2DYX A;  2R71 A;  2O84 X;  3N5L A;  3U94 A;  4EQ9 A;  4GIZ A;  4YU0 A;  1EH3 A;  2RC9 A;  4QF9 A;  1TWY A;  3SEV A;  3QIM A;  3CG1 A;  3G3G A;  3ZKK A;  2F5X A;  2Y7K A;  4FJP A;  4IGT A;  3T22 A;  1M5E A;  5M2V A;  5HBC A;  3FV2 A;  3KJ7 A;  2B3F A;  3PUY E;  2Q2A A;  3FIR A;  3CRB A;  1JEV A;  1GR2 A;  3O6G A;  1LFH A;  5TPA B;  4GL0 A;  3TEP A;  4YKP A;  4OWD A;  3LSF B;  1PB9 A;  4OHN A;  2OWT A;  3HO7 A;  3M3K A;  3C35 A;  3MPK A;  2O51 A;  1DPP A;  2Q9T A;  3VV5 A;  3O2A A;  1FTO A;  4C0R A;  1N3X A;  4ESW A;  3HHF A;  3EN3 A;  2ZXT A;  3S9M C;  1Y3Q A;  1LB9 A;  2OZZ A;  5I56 B;  4MFI A;  3KJT A;  4QFK A;  4IO5 A;  3S9E A;  2F7C A;  4KPT A;  2YPN A;  3K1M A;  4YKI A;  2Y7R A;  4HW8 A;  2VD3 A;  1MXV A;  3MZ9 A;  3O6I A;  3C4M A;  2UVJ A;  5ELV A;  4GQO A;  5ITO A;  1IXH A;  4LA9 A;  4LUB A;  3I5O A;  4FE8 A;  1UTB A;  3OO7 A;  5KZT A;  2Z8D A;  3GZG A;  2DOJ A;  2UVI A;  4BDL A;  2Z8F A;  2RF1 A;  3QSL A;  1QUJ A;  4YB5 A;  5DVF A;  1B52 A;  3CFL A;  1PBP A;  1SW4 A;  2PT1 A;  3RPW A;  3RTW B;  1NH7 A;  3A3U A;  4U2R A;  4NE4 A;  2Q8J A;  3KFM A;  5AA2 D;  3TTR A;  4Q8R A;  3DP8 A;  3U92 A;  4OET A;  1OVT A;  4LP2 B;  4ZEI A;  4G68 C;  2O68 A;  4OER A;  5FTI A;  3PD9 A;  1IIT A;  5LOM A;  1DPE A;  1Y3P A;  1XC1 A;  4ELO A;  3U72 A;  4IO4 A;  2ZYO A;  3TTN A;  1N84 A;  2G29 A;  2P1S A;  5I58 B;  4HCW A;  3UN6 A;  3IK6 B;  4LZ5 A;  5I57 A;  3E13 X;  1UTH A;  4BDR A;  1NMU A;  2THI A;  5TP9 A;  1SBP A;  1SW5 A;  2CZL A;  3QUF A;  3L6H A;  1B4H A;  4NF8 A;  2HQ0 A;  3KOT A;  3L6G A;  4QFL A;  2AYS A;  5L9O A;  3O29 A;  4OES A;  1FW0 A;  3HHG A;  3PPO A;  4ZEC A;  4DIG A;  1I69 A;  2I4B A;  4QSC A;  3IO4 A;  5DTB A;  3CSG A;  3FJ7 A;  2FA7 A;  1MXZ A;  4R6Y A;  4U1Z A;  4ECF A;  3T9U A;  2QJE A;  1POT A;  2XHD A;  1FQB A;  1AH5 A;  3UK4 A;  4G8M A;  1MY3 A;  5EHM A;  5IKB A;  1SDX A;  4G68 A;  2B65 A;  4ZS9 A;  3T96 B;  1MQD A;  4MH5 A;  3K0V A;  4DCX A;  3TKD A;  1A40 A;  3CFX A;  4QHQ A;  3OOA A;  4GXS B;  1SI1 A;  5DVJ A;  2H9B A;  1HSE A;  5KCJ B;  3RNN A;  2Q88 A;  4NF4 B;  2VOZ A;  2QMW A;  4X1D A;  1EZP A;  2XXW A;  5I2N B;  1GV8 A;  4G4P A;  2PBW A;  4KQP A;  5AA4 B;  3S4U A;  1RYX A;  3VVD A;  1POY 1;  4HS7 A;  3RLF E;  3PUX E;  1B7H A;  3G3K A;  1B1H A;  3DLN A;  5I84 A;  3T66 A;  2ZMB A;  3C34 A;  2REJ A;  3R7X A;  1HSL A;  4YKK A;  1UTH B;  1KWH A;  4Q5T A;  2OWS A;  5H8N B;  3IB1 A;  5TP9 B;  2ALU A;  2DXY A;  2XXU A;  1JW4 A;  4G2Z A;  2QS2 A;  2HZK A;  5CMK A;  3KN7 A;  2ABH A;  2XXV A;  4RA1 A;  1EZO A;  3VFJ A;  3U1O A;  3WAE A;  3DP6 A;  1ZJL A;  1BIY A;  1MY0 A;  4FIM A;  1M5F A;  2PMS A;  4L17 A;  1R9Q A;  2F7A A;  1US5 A;  1Y20 A;  3EHS A;  1LAH E;  4G8H A;  3U8Q A;  3IAZ A;  1FTL A;  3KN3 A;  1PC3 A;  3UIF A;  3KGC A;  3H06 B;  4ND9 A;  1NH8 A;  4PFU A;  1QKA A;  4LZ8 A;  5H8H A;  3RUM A;  3FJM A;  3IOR A;  4G68 B;  3RQT A;  1SYI A;  3OSR A;  1VE4 A;  3KSX A;  3ECR A;  4BDQ A;  5ICT A;  1B05 A;  3SEU A;  4JDF A;  1MY2 A;  1S9T A;  1F9B A;  2REG A;  2Y84 A;  1NL5 A;  4RK2 A;  3EF7 A;  3T9H B;  1PDA A;  3OO8 A;  1OQG A;  4XKP A;  3H6V A;  2IA4 A;  3G3J A;  1WDN A;  2HXW A;  4WED A;  2IEE A;  2ZNT A;  3RT6 B;  5IAI A;  1N0T A;  4F29 A;  5HPQ A;  4LQ2 A;  3UP9 A;  3IO6 A;  4Z0I A;  3IOV A;  1D9Y A;  4ZZE A;  2F8D A;  2I0C A;  2XX9 A;  1XS5 A;  3LSL A;  4C1U A;  3S2V A;  1B32 A;  4JXI A;  5KDT B;  1MH3 A;  1QVS A;  5ICQ A;  3K4U A;  3U93 A;  3VLV A;  1DTZ A;  2VP1 A;  4ONY A;  4R9G A;  4DLD A;  3K02 A;  4JWX A;  4LON B;  1ZU0 A;  3OEK A;  5H8F B;  1P1Q A;  2PT2 A;  3OD7 A;  2ANJ A;  1MPB A;  4PET A;  1M5D A;  1Y3N A;  2I0B A;  2DE3 A;  2HZL A;  1B3L A;  1USY E;  3SER A;  1VFD A;  3BFU A;  5CMM A;  4O3A A;  2UVH A;  1XT8 A;  2HAU A;  5BWJ A;  1MDQ A;  3QAX A;  1QW0 A;  3MVY A;  3MVZ A;  2ONS A;  4OEU A;  1LST A;  4U4S A;  3IOW A;  3H3G A;  1Z7N E;  4POX A;  1H45 A;  4F19 A;  2CMO A;  3O66 A;  3FVN A;  4NWC A;  2RC7 A;  2XD2 A;  3MBP A;  1DSN A;  3OO6 A;  1Z7M E;  4RYA A;  2XXQ A;  3EQ1 A;  4LQ5 A;  1MY4 A;  3IOT A;  4GVO A;  1N7W A;  3OEN A;  4F3S A;  1ZIU A;  2RKM A;  1YAE A;  4OEV A;  4I1D A;  1O63 A;  4FAT A;  4GFR A;  3D4C A;  1Y9U A;  2VD2 A;  2NVU B;  1QUL A;  2DWA A;  1RYO A;  1I6Q A;  5K2X A;  3T9V A;  5CM6 A;  3SDF A;  4FEC A;  3H7M A;  3TFL A;  1MXY A;  3AXF A;  3G3H A;  4ESX A;  4IO6 A;  5EYF A;  3MJN A;  1PB8 A;  1NNK A;  3PUW E;  4RXL A;  4KR5 A;  1URG A;  4GLI A;  1OIB A;  3C9H A;  2ZNS A;  5CBR A;  2ZYK A;  3LSW A;  1NKX A;  4N6P A;  4F31 B;  4OQO A;  1H44 A;  1DTG A;  4PFY A;  1OQH A;  1US4 A;  4THI A;  5DEX A;  4KHZ E;  5H8Q A;  1HSJ A;  4X48 A;  2Q2C A;  1T0K A;  3K1P A;  5FHN A;  1R9L A;  1H43 A;  3TTL A;  2DP8 A;  4YB6 A;  1PEB A;  4DE8 A;  1UIU A;  4F3B A;  3TTK A;  2RCB A;  4RNS A;  5L9M A;  1A99 A;  3V5A A;  4R6K A;  4IY6 A;  3RN8 A;  3TYH A;  1MQJ A;  1MXW A;  2I6E A;  4OTE A;  1IIW A;  5DVI A;  5DYH A;  3F11 A;  4YIC A;  3KG2 A;  4KYD A;  3GLB A;  1B40 A;  3RT8 A;  3HPI A;  4ELQ A;  4YMB A;  4QRZ A;  3TQW A;  3SET A;  3GBB A;  4JSO A;  2OBG A;  1UIV A;  1XOC A;  2RIN A;  3I3V A;  4ZED A;  3BFT A;  4N13 A;  4POW A;  3K6V A;  1ELJ A;  3UGW A;  2ZNU A;  3Q27 A;  2GHB A;  4UA8 A;  1B3F A;  2O7U A;  2Z23 A;  4OYV A;  5AA3 A;  3TTM A;  5JK4 A;  1QJM A;  2G93 A;  4NF5 A;  1MQG A;  1B3E A;  3FXQ A;  3Q26 A;  5H8S A;  3A09 A;  2DXR A;  4GD5 A;  4BLA A;  4GL8 A;  3SEY A;  2F6P A;  3O28 A;  4DCY A;  3M3F A;  1VSO A;  1I6B A;  5AA2 A;  2NWJ A;  4QFN A;  3PPQ A;  3OMB A;  1MQI A;  1S7Y A;  1MDP 1;  2QS1 A;  3USD A;  1IXC A;  1H76 A;  5HM4 B;  3H6U A;  4G77 A;  3VDF A;  5DEX B;  5H8Q B;  1FQA A;  5JTY A;  4KI0 E;  4R75 A;  1II5 A;  2DE2 A;  3OO9 A;  4WKM A;  5TU0 A;  2W7Y A;  1R1N A;  2A5T A;  4IY5 A;  2H4I A;  3G7W A;  3PPR A;  4KD5 A;  1LGB C;  2DSF A;  1B3G A;  1LAX A;  5ISU A;  3V83 A;  4F1U A;  3QUJ A;  4DXC A;  4P0G A;  4AB6 A;  3QYT A;  1MRP A;  3B7D A;  4X9T A;  1LB8 A;  2PX1 A;  1DOT A;  3G3F A;  2QS4 A;  2RC8 A;  3CR9 A;  2O6A A;  1P1U A;  1R6Z A;  2O1M A;  1MY1 A;  1UTB B;  4JBZ A;  3MP1 A;  1JET A;  4G8N A;  2V3T A;  2DVC A;  1XVX A;  4FOR A;  4NTL A;  2P2A A;  2HEU A;  3SKP A;  1S50 A;  4ZE9 A;  3MC2 A;  3T9X B;  3IOU A;  1IUD A;  4XKR A;  4MBP A;  1CB6 A;  4NF6 A;  4R2F A;  2Z8E A;  2XD3 A;  2QSX A;  3VXB A;  2V3Q A;  4NF5 B;  4IGR A;  4XXU A;  1I6A A;  5J1D A;  1MM6 A;  4H65 A;  4FEB A;  3N26 A;  2XXR A;  1WOD A;  2XXI A;  3HV1 A;  3ONM A;  1A7L A;  3ODB A;  2XXY A;  1USY H;  3VLU A;  3K00 A;  3EPE A;  3PMV A;  4KCD A;  1FQC A;  3MPL A;  4R9F A;  4NWD A;  5AA2 B;  3FAS A;  2E1S A;  3MZB A;  2UYF A;  3FV1 A;  3MWB A;  1FTK A;  2X26 A;  1SW2 A;  3OEL A;  2HCA A;  5I57 B;  3CVG A;  4FED A;  1N76 A;  3PU5 A;  1LCT A;  1MPC A;  3LSX A;  5I2K A;  3SES A;  3TMG A;  4DZ1 A;  1Y1M A;  1XVY A;  1JVX A;  4KCC A;  1JW5 A;  1Y4T A;  4NF8 B;  3MAM A;  4QSD A;  2B3B A;  3TCG A;  5A5X A;  3O6H A;  2FYI A;  2R6G E;  4BDO A;  3GXA A;  3IL1 B;  4U4X A;  4ZEK A;  4HTG A;  4KFQ A;  4ZEB A;  2HAV A;  1OMP A;  2VHA A;  3B6Q A;  5FTH A;  4O3B A;  3TPA A;  3O9P A;  4H6D A;  4WXJ A;  4ISU A;  1MXX A;  3W15 C;  1B9J A;  2F97 A;  3C32 A;  4F2Q A;  2Y7P A;  2RCA A;  2FNC A;  2V84 A;  3FAT A;  2O1L A;  4HCY A;  3KOS A;  3BBR A;  2A5S A;  1IQ7 A;  2P0S A;  1SW1 A;  1URS A;  1LLS A;  1B5J A;  2YJP A;  3KZG A;  2XX7 A;  4M1V A;  2H5Y A;  5FHO A;  3K1N A;  1L5T A;  3FJG A;  3KBR A;  2QMX A;  1N04 A;  2QL3 A;  4TLL B;  1FQD A;  1LBB A;  1LAG E;  4MLV A;  3S9N C;  3PUV E;  3E4R A;  2OCU A;  3SEW A;  4NMY A;  2I3V A;  3SEX A;  1AL3 A;  3M3L A;  4EDP A;  4AB5 A;  1YPN A;  1MS7 A;  1N7X A;  3H6T A;  2H99 A;  4GWO A;  5JEI A;  1SI0 A;  3ZKL A;  3K01 A;  4P0I A;  1B7U A;  1JEU A;  4EF1 A;  3T93 B;  4LAT A;  1B4Z A;  1MG1 A;  1XHY A;  1A55 A;  3VE1 B;  2PVU A;  1J1N A;  3PUZ E;  1QUK A;  4U1O A;  2DS9 A;  4H0W A;  5CC2 A;  1TT1 A;  5I56 A;  2XXX A;  4H5G A;  1B0L A;  2UVG A;  4PP0 A;  4EQ7 A;  4EUO A;  2DWJ A;  1SVX B;  1LFI A;  2V25 A;  3A3C A;  3I6V A;  3PD8 A;  4BDN A;  4KYE A;  2NXO A;  3BKI B;  2QS3 A;  4IO7 A;  3HN0 A;  3KSJ A;  4DDD A;  4ELP A;  2F36 A;  3B6T A;  5K2Y A;  1UQW A;  1VR5 A;  1NNT A;  1GGG A;  3H03 A;  3M8U A;  4F18 A;  5A5X B;  2M8C A;  1NFT A;  4AQ4 A;  1QUI A;  1NNP A;  4XTC Q;  3DEL B;  3CIJ A;  3OEM A;  4JSD A;  1PB7 A;  1BP5 A;  3MQ9 A;  1NNF A;  4MLQ A;  1IXG A;  5CMB A;  3Q25 A;  4U23 A;  3FXU A;  5H8H B;  1O64 A;  4EXL A;  3VLW A;  2WKY A;  4K3F A;  2GRV A;  1H3D A;  3FGS A;  3KEI A;  3TEL A;  4PFW A;  3FUZ A;  4OFL A;  3IB2 A;  1B5I A;  2PYY A;  1ZLQ A;  5AE4 A;  1Y4C A;  2VGQ A;  2D5W A;  2I58 A;  3THI A;  1B6H A;  5L8D A;  4YMA A;  3LBS A;  1OLC A;  3HCQ A;  1D3K A;  2OJT A;  1ATG A;  4F2O A;  3C33 A;  5I58 A;  4X1B A;  2NUV A;  4OZ9 A;  2E0S A;  1SD3 A;  3VVE A;  4JWY A;  4U22 A;  5B70 A;  4LVQ A;  4MF3 A;  4PE5 B;  3E9X A;  1AMF A;  1MH4 A;  1O7T A;  4C1T A;  1AIV A;  2HFB A;  1EZ9 A;  3C31 A;  4QFP A;  3RY3 A;  4H8J A;  3K6X A;  1B46 A;  4F3P A;  3B6W A;  5B7D A;  3UOR A;  2ONK E;  5I59 A;  3HST A;  4RPO A;  1B7Z A;  2BJJ X;  4LZ7 A;  1TFD A;  2QPQ A;  3P7I A;  3KN8 A;  1EU8 A;  3IX1 A;  3S9L C;  2V93 A;  3MW0 A;  3FVO A;  1DMB A;  2ESN A;  1P99 A;  2F6G A;  3DM0 A;  2D21 A;  4IO3 A;  2XXH A;  3MZ1 A;  4DXU A;  1BKA A;  4E0W A;  3IJO B;  2I48 A;  3TOD A;  3PGF A;  5CRY A;  3TAJ A;  4GOT A;  2GH9 A;  3K2D A;  4ZDM A;  4WEP A;  1B58 A;  2UYE A;  5AA1 A;  4ELR A;  1Y1Z A;  4R73 A;  4M4G A;  3MP8 A;  4OVJ A;  2V3U A;  4QSE A;  3FZV A;  5KCJ A;  1SQY A;  4NF4 A;  1JW1 A;  3CI8 A;  3LR1 A;  1YTV A;  1A8F A;  5I2N A;  3FVG A;  3R26 A;  3MVX A;  3OXN A;  1VFE A;  1MM7 A;  1TFA A;  4KYS A;  1P1W A;  4F39 A;  5AA4 A;  4NED A;  3OSQ A;  4JWO A;  2Y7W A;  3LUY A;  2I49 A;  4PQJ A;  1BLF A;  1A8E A;  1B3H A;  1CE2 A;  1B5H A;  1URD A;  4F1V A;  4YAH X;  3D4G A;  3JV9 A;  3K6U A;  3TZA A;  2R9J A;  2XXP A;  1ZKB A;  4R6H A;  2F7B A;  2UXA A;  4H8I A;  5H8N A;  5ITP A;  5EHS A;  1ANF A;  4OXV A;  4EQB A;  3R6U A;  4I62 A;  3MP6 A;  3C36 A;  4BDM A;  3N6T A;  4P11 A;  4I8C A;  3CSB A;  3W9V A;  5BUU A;  1OVB A;  1B51 A;  4F3G A;  1B0H A;  1BTJ A;  3N6U A;  3LC8 A;  5I59 B;  1LCF A;  3PV0 E;  3IB0 A;  1IXI A;  1ZBM A; 
#chains in the Genus database with same CATH topology
 3PMX A;  4UAC A;  4YZZ A;  2GFE A;  2GHA A;  3EHT A;  4MNI A;  2OK2 A;  3VXC A;  1FTJ A;  4R2B A;  3G3I A;  1JVY A;  4RJZ A;  4XKQ A;  5L9S A;  2NOO A;  2OLB A;  3FVK A;  3Q28 A;  4N6D A;  2WEF A;  1AOV A;  3CFZ A;  5F1Q A;  2AIX A;  4O3C A;  1IZ1 A;  2O69 A;  2HXR A;  2LAO A;  1FPE A;  2XXK A;  2F35 A;  2QRY A;  3TCF A;  3ZS6 A;  1OLA A;  2Z22 A;  3MUQ A;  4GRK A;  4PFT A;  4ZZA A;  5CI5 A;  1D4N A;  3V8X B;  4PAK A;  1INP A;  3RGY A;  2X7Q A;  1DBZ A;  1LBC A;  4H1X A;  3GBA A;  4DXB A;  3ILT B;  3H6W A;  1ZMG A;  2Q89 A;  3E3K A;  5KDT A;  3FD3 A;  3QK6 A;  3K6W A;  5I5P A;  3TUS A;  1LAF E;  4IB2 A;  4OFO A;  3TQL A;  3E79 A;  2DE4 A;  4GF8 A;  5H8F A;  2O7I A;  1FJ9 A;  4IO2 A;  4FAJ A;  1P1O A;  1K9Z A;  4XKN A;  4QFO A;  2ZYM A;  5DW8 A;  1GTK A;  1P1N A;  4Z7E A;  4EXK A;  2VPO A;  4Q30 B;  5JTY B;  4RY1 A;  4ZE8 A;  1NV5 A;  1FJ6 A;  4H5F A;  5CBS A;  2A5T B;  4O8M A;  2DVZ A;  1FBG A;  1NUX A;  4TOZ A;  1QKB A;  1SYH A;  1D9V A;  3KC0 A;  4RK9 A;  2CEX A;  4YB7 A;  3H4Z A;  4E0X A;  3JYR A;  3JZJ A;  1PBQ A;  3B8B A;  4RPN A;  3VVF A;  4FBP A;  2DQV A;  4PGP A;  3ZSF A;  4YKJ A;  2Y7I A;  1A54 A;  4EF2 A;  5DT6 A;  2CZI A;  4XIG Q;  4JVI A;  4I9D A;  1LBV A;  2VPN A;  4R74 A;  1ZTY A;  4PF6 A;  1MPD A;  4OMB A;  1LFG A;  3RPL A;  2GQ1 A;  3ILU B;  4R72 A;  2KLF A;  3T1B A;  3FXR A;  1FQE A;  5ET6 A;  3WAF A;  4N17 A;  3B50 A;  4NF6 B;  2F34 A;  1FQF A;  4ZEF A;  1JQF A;  1Q35 A;  1RKM A;  3CG3 A;  1WVJ A;  4H67 A;  1VDW A;  3QMF A;  4GWY A;  3V89 B;  5TPA A;  2DWI A;  3IR1 A;  3TCH A;  3N94 A;  1TXF A;  2AL5 A;  4U21 A;  4OEN A;  2YLN A;  2ZZX A;  1NV3 A;  1JNF A;  2H25 A;  4UAB A;  3RTF B;  1FTM A;  2XX8 A;  5FHM A;  1EYI A;  3W9W A;  1Q1K A;  4PCD A;  4G61 A;  2WX9 A;  4F22 A;  4OFJ A;  5I2K B;  5F7V A;  3QXM A;  1FCK A;  4O94 A;  4JB7 A;  2D3I A;  2XWI A;  1M5B A;  1IEJ A;  4TLM B;  2HPG A;  3Q29 A;  2X7P A;  3DP4 A;  2H98 A;  2DWH A;  2F3B A;  4XEQ A;  1MXU A;  4Q0C A;  2XXT A;  3UA8 A;  1RDZ A;  5CMC A;  2I4C A;  2ZYN A;  1YCJ A;  1GVC A;  4GXA A;  2KQZ A;  3MVW A;  3O97 A;  1MQH A;  4TQU Q;  3TDJ A;  2F78 A;  2I3W A;  4N07 A;  3PMW A;  3EHU A;  1YXI A;  1M5C A;  1B2H A;  1B1X A;  2ONR A;  4F1Y A;  3IJX B;  3PPN A;  2QVU A;  3MST A;  2AL4 A;  1N3W A;  4N6K A;  3PPP A;  2DYX A;  2R71 A;  2O84 X;  3N5L A;  5LDZ A;  3U94 A;  4EQ9 A;  4GIZ A;  4YU0 A;  1EH3 A;  2RC9 A;  4N8Y A;  4QF9 A;  3RPL B;  1TWY A;  3SEV A;  3QIM A;  2Y5L A;  3CG1 A;  3G3G A;  3ZKK A;  1NV7 A;  2F5X A;  2Y7K A;  4FJP A;  4HE1 A;  4IGT A;  4GBV A;  3T22 A;  1M5E A;  5M2V A;  5HBC A;  3FV2 A;  3KJ7 A;  2B3F A;  3PUY E;  2Q2A A;  3FIR A;  3CRB A;  1JEV A;  1GR2 A;  3O6G A;  1LFH A;  5TPA B;  4GL0 A;  3TEP A;  4YKP A;  4OWD A;  1NI9 A;  3LSF B;  1PB9 A;  4OHN A;  2OWT A;  4O7I A;  3HO7 A;  3M3K A;  3C35 A;  3MPK A;  2O51 A;  1DPP A;  2Q9T A;  3VV5 A;  3O2A A;  1FTO A;  4C0R A;  1N3X A;  4ESW A;  3HHF A;  3EN3 A;  2ZXT A;  4OA4 A;  3S9M C;  1LB9 A;  1Y3Q A;  2OZZ A;  5I56 B;  4MFI A;  3KJT A;  4QFK A;  4IO5 A;  3S9E A;  2F7C A;  4KPT A;  2YPN A;  3K1M A;  4YKI A;  2Y7R A;  4HW8 A;  2VD3 A;  1MXV A;  3MZ9 A;  3O6I A;  3C4M A;  2UVJ A;  5ELV A;  3BIG A;  4GQO A;  5ET8 A;  5ITO A;  1IXH A;  4LA9 A;  4LUB A;  3I5O A;  4FE8 A;  1UTB A;  3OO7 A;  5KZT A;  5EQA A;  2Z8D A;  3GZG A;  2DOJ A;  1LBZ A;  2UVI A;  4BDL A;  1K9Y A;  3T0J A;  2Z8F A;  2RF1 A;  3QSL A;  1QUJ A;  4YB5 A;  5DVF A;  1B52 A;  3CFL A;  1PBP A;  4NHB A;  1SW4 A;  2PT1 A;  3RPW A;  3RTW B;  1NH7 A;  3A3U A;  4U2R A;  4NE4 A;  4NQ8 A;  1IME A;  2Q8J A;  3KFM A;  5AA2 D;  2Q8M A;  3TTR A;  4Q8R A;  4HE0 A;  3DP8 A;  3U92 A;  4OET A;  1OVT A;  4LP2 B;  4ZEI A;  4G68 C;  2O68 A;  4OER A;  3EKI A;  5FTI A;  3U65 A;  3PD9 A;  1IIT A;  5LOM A;  1DPE A;  1Y3P A;  1XC1 A;  4ELO A;  3U72 A;  4IO4 A;  2ZYO A;  3TTN A;  1N84 A;  2G29 A;  2P1S A;  5I58 B;  4HCW A;  3UN6 A;  3IK6 B;  4LZ5 A;  5I57 A;  3E13 X;  1UTH A;  4BDR A;  1FPK A;  1NMU A;  4MIJ A;  2THI A;  2QVV A;  5TP9 A;  4XF5 A;  1LBX A;  1SBP A;  1SW5 A;  2CZL A;  3QUF A;  3L6H A;  1B4H A;  4NF8 A;  2HQ0 A;  3KOT A;  3L6G A;  4QFL A;  4MX6 A;  2AYS A;  5L9O A;  3O29 A;  4OES A;  2QVR A;  1FW0 A;  3HHG A;  3PPO A;  4ZEC A;  4DIG A;  1I69 A;  2I4B A;  4QSC A;  3IO4 A;  5DTB A;  3CSG A;  3FJ7 A;  2FA7 A;  1FBD A;  1MXZ A;  4R6Y A;  4U1Z A;  4ECF A;  3T9U A;  2QJE A;  1POT A;  2XHD A;  1NV2 A;  4O7M A;  1FQB A;  1AH5 A;  3UK4 A;  4G8M A;  1FBP A;  1MY3 A;  5EHM A;  5IKB A;  1SDX A;  4G68 A;  2B65 A;  4ZS9 A;  3T96 B;  1G0I A;  1MQD A;  4MH5 A;  3K0V A;  4DCX A;  2PFY A;  3TKD A;  1A40 A;  1FPL A;  1YZ0 A;  3CFX A;  4QHQ A;  2DDK A;  4GBW A;  3OOA A;  4GXS B;  1QGX A;  1SI1 A;  5DVJ A;  2H9B A;  1HSE A;  5KCJ B;  3RNN A;  2Q88 A;  4NF4 B;  2VOZ A;  2QMW A;  2XWK A;  4X1D A;  1EZP A;  2XXW A;  5I2N B;  1GV8 A;  4G4P A;  4N81 A;  2PBW A;  4PDH A;  4KQP A;  1FRP A;  5AA4 B;  3S4U A;  1RYX A;  3VVD A;  4GX3 A;  1XI6 A;  1POY 1;  4NG7 A;  4HS7 A;  3RLF E;  4PGN A;  3PUX E;  1B7H A;  3G3K A;  1B1H A;  3DLN A;  5I84 A;  3T66 A;  2ZMB A;  3C34 A;  2REJ A;  1EYJ A;  3R7X A;  1HSL A;  4YKK A;  1UTH B;  1KWH A;  4Q5T A;  2OWS A;  5H8N B;  3IB1 A;  5TP9 B;  2ALU A;  1BK4 A;  1LBW A;  2DXY A;  2XXU A;  2JJK A;  1JW4 A;  4G2Z A;  5I7I A;  4P1E A;  2QS2 A;  2HZK A;  5CMK A;  3KN7 A;  5EYH A;  4IR8 A;  2ABH A;  2XXV A;  4RA1 A;  2WYP A;  3VFJ A;  1EZO A;  3U1O A;  3WAE A;  3DP6 A;  1ZJL A;  1BIY A;  1MY0 A;  4FIM A;  1M5F A;  2PMS A;  1D9Q A;  4L17 A;  1R9Q A;  2F7A A;  2FHY A;  1US5 A;  1Y20 A;  4LN5 A;  3EHS A;  1LAH E;  4G8H A;  3U8Q A;  3IAZ A;  1FTL A;  3KN3 A;  1PC3 A;  3UIF A;  3KGC A;  4ND9 A;  3H06 B;  4NGU A;  1NH8 A;  4PFU A;  1QKA A;  4LZ8 A;  5H8H A;  3RUM A;  3FJM A;  3IOR A;  4G68 B;  3RQT A;  1SYI A;  3OSR A;  1VE4 A;  3KSX A;  3ECR A;  4BDQ A;  5ICT A;  3KBZ A;  1RDX A;  1B05 A;  3SEU A;  4JDF A;  1MY2 A;  1S9T A;  1F9B A;  2REG A;  2Y84 A;  4OVR A;  1NL5 A;  4RK2 A;  3EF7 A;  3T9H B;  1PDA A;  3OO8 A;  1OQG A;  4PF8 A;  4XKP A;  3H6V A;  2IA4 A;  3G3J A;  1WDN A;  2HXW A;  4WED A;  2IEE A;  2ZNT A;  3RT6 B;  5IAI A;  1N0T A;  4F29 A;  2OWZ A;  4N15 A;  5HPQ A;  4LQ2 A;  2FIE A;  3UP9 A;  3IO6 A;  1FSA A;  4Z0I A;  3IOV A;  1D9Y A;  3IFC A;  4ZZE A;  2F8D A;  2I0C A;  2XX9 A;  1XS5 A;  3LSL A;  4GWS A;  4C1U A;  3S2V A;  1B32 A;  4JXI A;  5KDT B;  1NV4 A;  1MH3 A;  1QVS A;  5ICQ A;  4NN3 A;  3K4U A;  3ISP A;  3U93 A;  3VLV A;  1DTZ A;  2VP1 A;  4ONY A;  4R9G A;  4DLD A;  3K02 A;  4JWX A;  4LON B;  1ZU0 A;  3OEK A;  5H8F B;  1P1Q A;  2PT2 A;  3OD7 A;  2ANJ A;  1IMA A;  1MPB A;  4PET A;  1M5D A;  2ZZV A;  1Y3N A;  2I0B A;  2DE3 A;  2HZL A;  1B3L A;  1USY E;  1FBF A;  3SER A;  1VFD A;  3BFU A;  2FIX A;  5CMM A;  4O3A A;  2UVH A;  1XT8 A;  1FTA A;  2WBB A;  1FPG A;  5I3S A;  2HAU A;  5BWJ A;  1MDQ A;  3QAX A;  1QW0 A;  3MVY A;  3MVZ A;  2ONS A;  1KZ8 A;  1LST A;  4OEU A;  4OVP A;  4U4S A;  3IOW A;  3H3G A;  1Z7N E;  4POX A;  1H45 A;  4F19 A;  2CMO A;  3O66 A;  3FVN A;  4NWC A;  2RC7 A;  2XD2 A;  3MBP A;  1DSN A;  3FXB A;  3OO6 A;  1G0H A;  1Z7M E;  4RYA A;  2XXQ A;  3E78 A;  5EQ7 A;  3EQ1 A;  4LQ5 A;  1MY4 A;  4MNC A;  3IOT A;  4GVO A;  1N7W A;  3OEN A;  4F3S A;  3D1R A;  1ZIU A;  2RKM A;  3BIH A;  1YAE A;  4OEV A;  4I1D A;  1O63 A;  5IM2 A;  4FAT A;  4GFR A;  3D4C A;  4DI4 B;  1Y9U A;  2VD2 A;  2NVU B;  1QUL A;  2DWA A;  1RYO A;  1I6Q A;  5K2X A;  3T9V A;  5CM6 A;  3SDF A;  4FEC A;  3H7M A;  3TFL A;  1MXY A;  3AXF A;  3G3H A;  4ESX A;  4IO6 A;  5EYF A;  3MJN A;  1PB8 A;  1NNK A;  3PUW E;  1RDY A;  4RXL A;  4KR5 A;  1URG A;  4GLI A;  4OVQ A;  1OIB A;  3C9H A;  3GYY A;  2ZNS A;  5CBR A;  2ZYK A;  3LSW A;  1NKX A;  4N6P A;  4F31 B;  4OQO A;  1H44 A;  1DTG A;  4PFY A;  1OQH A;  1US4 A;  4MAG A;  4THI A;  5DEX A;  4KHZ E;  5H8Q A;  3LUZ A;  1HSJ A;  4X48 A;  2Q2C A;  1T0K A;  3K1P A;  5FHN A;  1R9L A;  5IZZ A;  1H43 A;  3TTL A;  2DP8 A;  4YB6 A;  1PEB A;  4PDD A;  4DE8 A;  1UIU A;  4F3B A;  3TTK A;  2RCB A;  4RNS A;  5L9M A;  1A99 A;  3V5A A;  4R6K A;  4IY6 A;  3RN8 A;  3TYH A;  1MQJ A;  1MXW A;  2I6E A;  4OTE A;  1IIW A;  5DVI A;  5DYH A;  3F11 A;  4HE2 A;  4YIC A;  2V4C A;  3KG2 A;  4KYD A;  3GLB A;  1B40 A;  3RT8 A;  3HPI A;  1FPI A;  1NUY A;  4ELQ A;  4YMB A;  4QRZ A;  3TQW A;  1NUW A;  3SET A;  3GBB A;  4JSO A;  2OBG A;  1UIV A;  1XOC A;  2RIN A;  3I3V A;  4ZED A;  3BFT A;  4N13 A;  4POW A;  3K6V A;  1ELJ A;  3UGW A;  2ZNU A;  3Q27 A;  2GHB A;  1CNQ A;  4PTK A;  4UA8 A;  1B3F A;  2O7U A;  2Z23 A;  1IMB A;  4OYV A;  5AA3 A;  3TTM A;  5JK4 A;  1QJM A;  1Q9D A;  4QBA A;  1FBC A;  2G93 A;  4NF5 A;  4X04 A;  1MQG A;  1B3E A;  3FXQ A;  3Q26 A;  5H8S A;  3A09 A;  2DXR A;  4GD5 A;  4BLA A;  4GL8 A;  3SEY A;  2F6P A;  3O28 A;  4DCY A;  3M3F A;  4PE3 A;  1VSO A;  1I6B A;  5AA2 A;  2NWJ A;  4QFN A;  3PPQ A;  3OMB A;  1MQI A;  2QFL A;  1S7Y A;  1MDP 1;  2QS1 A;  3USD A;  1IMC A;  1LEV A;  1IXC A;  2XWO A;  1H76 A;  5HM4 B;  3H6U A;  2PFZ A;  4AS4 A;  4G77 A;  3VDF A;  5DEX B;  5H8Q B;  1FQA A;  5JTY A;  4KI0 E;  4R75 A;  1II5 A;  2DE2 A;  3OO9 A;  4JVC A;  4WKM A;  5TU0 A;  2W7Y A;  1R1N A;  2A5T A;  1FPJ A;  4IY5 A;  2H4I A;  3G7W A;  3PPR A;  4KD5 A;  1LGB C;  2DSF A;  1B3G A;  1LAX A;  4I40 A;  5ISU A;  3V83 A;  4F1U A;  3QUJ A;  4DXC A;  4P0G A;  4GX6 A;  4AB6 A;  2FBP A;  1MRP A;  3B7D A;  3QYT A;  4X9T A;  1LB8 A;  2PX1 A;  1DOT A;  3G3F A;  5T3J A;  1DK4 A;  2QS4 A;  2RC8 A;  4P9K A;  4P47 A;  3CR9 A;  2O6A A;  1P1U A;  4P56 A;  1R6Z A;  2O1M A;  1MY1 A;  1UTB B;  4JBZ A;  3MP1 A;  1JET A;  4JVD A;  4G8N A;  2V3T A;  2DVC A;  1XVX A;  4FOR A;  4NTL A;  2P2A A;  5IZ3 A;  2L5V A;  2HEU A;  3SKP A;  1S50 A;  4ZE9 A;  1DCU A;  3MC2 A;  5J16 A;  3T9X B;  3IOU A;  1IUD A;  4XKR A;  4MBP A;  3HFU A;  1CB6 A;  4NF6 A;  4R2F A;  1LBY A;  2Z8E A;  2XD3 A;  2QSX A;  4N4U A;  3VXB A;  2V3Q A;  4NF5 B;  4IGR A;  4XXU A;  1I6A A;  5J1D A;  1MM6 A;  4H65 A;  4FEB A;  3N26 A;  2XXR A;  5F24 A;  1WOD A;  2XXI A;  3HV1 A;  3ONM A;  1A7L A;  3ODB A;  2Y5K A;  2R8T A;  2XXY A;  1USY H;  2MKZ A;  3VLU A;  3CHG A;  3K00 A;  3EPE A;  3PMV A;  4PAF A;  4KCD A;  1FPB A;  1FQC A;  5A5L A;  3MPL A;  4R9F A;  4NWD A;  5AA2 B;  4GWU A;  3FAS A;  2E1S A;  3MZB A;  2UYF A;  2CZK A;  3A29 A;  3FV1 A;  3MWB A;  1FTK A;  2X26 A;  1SW2 A;  3OEL A;  2HCA A;  5I57 B;  3CVG A;  4FED A;  1N76 A;  3PU5 A;  1LCT A;  1MPC A;  3LSX A;  4X8R A;  5I2K A;  3SES A;  3TMG A;  4DZ1 A;  1Y1M A;  1XVY A;  1JVX A;  4KCC A;  1JW5 A;  1Y4T A;  4NF8 B;  3MAM A;  1JP4 A;  4QSD A;  2B3B A;  3TCG A;  4AS5 A;  5A5X A;  3O6H A;  2FYI A;  2R6G E;  4BDO A;  3GXA A;  3IL1 B;  4QXD A;  3MYU A;  4U4X A;  4ZEK A;  4HTG A;  4KFQ A;  4ZEB A;  2HAV A;  1OMP A;  2VHA A;  2WYK A;  3B6Q A;  5FTH A;  4O3B A;  3TPA A;  3O9P A;  4P1L A;  4H6D A;  4WXJ A;  4ISU A;  1MXX A;  4N91 A;  3W15 C;  1B9J A;  2F97 A;  3C32 A;  4F2Q A;  2KR0 A;  2Y7P A;  2RCA A;  2FNC A;  2V84 A;  3FAT A;  2O1L A;  4HCY A;  3KOS A;  3BBR A;  2A5S A;  1IQ7 A;  2P0S A;  1SW1 A;  3PTY A;  1URS A;  1LLS A;  1B5J A;  2YJP A;  3KZG A;  2XX7 A;  2OX3 A;  4M1V A;  2H5Y A;  5FHO A;  3K1N A;  4GWX A;  5ET5 A;  1L5T A;  3FJG A;  3KBR A;  5IZ3 B;  2QMX A;  1N04 A;  2QL3 A;  4TLL B;  1FQD A;  4HXV A;  1IMD A;  1EYK A;  1LBB A;  1LAG E;  4MLV A;  3S9N C;  3PUV E;  3E4R A;  4OAN A;  2OCU A;  4NMY A;  2I3V A;  3SEW A;  3SEX A;  1AL3 A;  3M3L A;  4EDP A;  4AB5 A;  1YPN A;  5LTC A;  4I3Y A;  1MS7 A;  1N7X A;  3H6T A;  2H99 A;  4GWO A;  5JEI A;  4GWW A;  2ZZW A;  1SI0 A;  3ZKL A;  1FBH A;  3K01 A;  4P0I A;  1B7U A;  1JEU A;  4EF1 A;  3T93 B;  4LAT A;  1B4Z A;  1MG1 A;  1XHY A;  1NUZ A;  1A55 A;  3VE1 B;  2PVU A;  1J1N A;  3PUZ E;  4MCO A;  1QUK A;  4U1O A;  2DS9 A;  4H0W A;  5CC2 A;  1TT1 A;  5I56 A;  2XXX A;  4H5G A;  1B0L A;  2UVG A;  4PP0 A;  4PBH A;  4EQ7 A;  4EUO A;  2DWJ A;  1SVX B;  1LFI A;  2V25 A;  3A3C A;  4DI3 D;  3I6V A;  3PD8 A;  4BDN A;  2PCR A;  3IFA A;  4KYE A;  2NXO A;  3BKI B;  2B4L A;  2QS3 A;  4IO7 A;  3HN0 A;  3KSJ A;  4DDD A;  4ELP A;  2F36 A;  3B6T A;  5K2Y A;  1UQW A;  1VR5 A;  1NNT A;  1GGG A;  4P8B A;  3H03 A;  3M8U A;  4F18 A;  5A5X B;  2M8C A;  5EYG A;  3ROJ A;  5EQ9 A;  1NFT A;  4AQ4 A;  1FPF A;  4MJO A;  1QUI A;  1NNP A;  4XTC Q;  3DEL B;  3CIJ A;  3OEM A;  4JSD A;  1PB7 A;  1BP5 A;  3MQ9 A;  1NNF A;  4XFE A;  4MLQ A;  1IXG A;  5CMB A;  3RYD A;  3Q25 A;  5ESY A;  4U23 A;  3FXU A;  5H8H B;  1O64 A;  4EXL A;  3VLW A;  4PFB A;  2WKY A;  4K3F A;  2GRV A;  4MEV A;  1H3D A;  3FGS A;  3KEI A;  3TEL A;  4PFW A;  3FUZ A;  1FBE A;  4OFL A;  3IB2 A;  1B5I A;  2PYY A;  1ZLQ A;  5AE4 A;  1Y4C A;  2VGQ A;  4OVS A;  5IGA A;  2D5W A;  2I58 A;  3THI A;  1B6H A;  5L8D A;  4YMA A;  3LBS A;  1OLC A;  3HCQ A;  3NOH A;  1D3K A;  2OJT A;  2CZH A;  1ATG A;  4F2O A;  2XA5 A;  3C33 A;  4PFI A;  4X1B A;  5I58 A;  2NUV A;  5EQ8 A;  4OZ9 A;  4I3E A;  2E0S A;  1SD3 A;  3VVE A;  4JWY A;  3SZP A;  4U22 A;  4GWZ A;  5B70 A;  2P3N A;  4LVQ A;  4MF3 A;  4PE5 B;  3E9X A;  4GX4 A;  1AMF A;  1MH4 A;  1O7T A;  4C1T A;  1AIV A;  2HFB A;  1EZ9 A;  3C31 A;  4QFP A;  3RY3 A;  4H8J A;  3K6X A;  1B46 A;  4F3P A;  3B6W A;  1NV0 A;  5B7D A;  3UOR A;  2ONK E;  5I59 A;  5ET7 A;  3HST A;  4OVT A;  4RPO A;  1B7Z A;  2BJJ X;  4LZ7 A;  1TFD A;  2QPQ A;  1KA0 A;  3P7I A;  3KN8 A;  1EU8 A;  2HHM A;  4P3L A;  2B4M A;  3IX1 A;  3S9L C;  2V93 A;  3MW0 A;  3FVO A;  4MHF A;  1SPI A;  1DMB A;  2ESN A;  1P99 A;  4PFR A;  2F6G A;  3DM0 A;  2D21 A;  4KXP A;  1IMF A;  4PC9 A;  4IO3 A;  2XXH A;  3MZ1 A;  1NV1 A;  4PAI A;  1FPD A;  4DXU A;  1BKA A;  5FBP A;  4E0W A;  3IJO B;  2I48 A;  3TOD A;  3PGF A;  5CRY A;  1YYZ A;  2XWV A;  3TAJ A;  4GOT A;  2WBD A;  2GH9 A;  3K2D A;  4ZDM A;  4WEP A;  1B58 A;  2UYE A;  5AA1 A;  2BJI A;  4ELR A;  1Y1Z A;  4R73 A;  4PBQ A;  2F3D A;  4NX1 A;  4M4G A;  1NV6 A;  3LV0 A;  3MP8 A;  4OVJ A;  2V3U A;  4QSE A;  3FZV A;  5KCJ A;  1SQY A;  2FVZ A;  4NF4 A;  1JW1 A;  3CI8 A;  3LR1 A;  4H45 A;  1KA1 A;  4H46 A;  1YTV A;  2VT5 A;  1A8F A;  4NAP A;  5I2N A;  4MMP A;  3FVG A;  3R26 A;  3MVX A;  3OXN A;  1VFE A;  1MM7 A;  1TFA A;  4KYS A;  1P1W A;  4F39 A;  5AA4 A;  4NED A;  3OSQ A;  4JWO A;  2Y7W A;  3LUY A;  2I49 A;  2Q74 A;  4PQJ A;  1BLF A;  1A8E A;  1B3H A;  1CE2 A;  1B5H A;  1URD A;  1AWB A;  4F1V A;  4YAH X;  3D4G A;  3JV9 A;  3K6U A;  3TZA A;  4MNP A;  2R9J A;  2XXP A;  1ZKB A;  4R6H A;  2F7B A;  2UXA A;  4H8I A;  5H8N A;  5ITP A;  5EHS A;  1ANF A;  4OXV A;  4EQB A;  2P3V A;  3R6U A;  4I62 A;  3MP6 A;  3C36 A;  4BDM A;  3N6T A;  4P11 A;  4I8C A;  3CSB A;  3W9V A;  5BUU A;  1OVB A;  1B51 A;  4F3G A;  1B0H A;  1BTJ A;  3N6U A;  3LC8 A;  5I59 B;  2CEY A;  5IZ1 A;  4NF0 A;  1LCF A;  3KC1 A;  3PV0 E;  3IB0 A;  1IXI A;  4N8G A;  1ZBM A;  3FBP A; 
#chains in the Genus database with same CATH homology
 3PMX A;  4UAC A;  4YZZ A;  2GFE A;  2GHA A;  3EHT A;  4MNI A;  2OK2 A;  3VXC A;  1FTJ A;  4R2B A;  3G3I A;  1JVY A;  4RJZ A;  4XKQ A;  5L9S A;  2NOO A;  2OLB A;  3FVK A;  3Q28 A;  4N6D A;  2WEF A;  1AOV A;  3CFZ A;  5F1Q A;  2AIX A;  4O3C A;  1IZ1 A;  2O69 A;  2HXR A;  2LAO A;  1FPE A;  2XXK A;  2F35 A;  2QRY A;  3TCF A;  3ZS6 A;  1OLA A;  2Z22 A;  3MUQ A;  4GRK A;  4PFT A;  4ZZA A;  5CI5 A;  1D4N A;  3V8X B;  4PAK A;  1INP A;  3RGY A;  2X7Q A;  1DBZ A;  1LBC A;  4H1X A;  3GBA A;  4DXB A;  3ILT B;  3H6W A;  1ZMG A;  2Q89 A;  3E3K A;  5KDT A;  3FD3 A;  3QK6 A;  3K6W A;  5I5P A;  3TUS A;  1LAF E;  4IB2 A;  4OFO A;  3TQL A;  3E79 A;  2DE4 A;  4GF8 A;  5H8F A;  2O7I A;  1FJ9 A;  4IO2 A;  4FAJ A;  1P1O A;  1K9Z A;  4XKN A;  4QFO A;  2ZYM A;  5DW8 A;  1GTK A;  1P1N A;  4Z7E A;  4EXK A;  2VPO A;  4Q30 B;  5JTY B;  4RY1 A;  4ZE8 A;  1NV5 A;  1FJ6 A;  4H5F A;  5CBS A;  2A5T B;  4O8M A;  2DVZ A;  1FBG A;  1NUX A;  4TOZ A;  1QKB A;  1SYH A;  1D9V A;  3KC0 A;  4RK9 A;  2CEX A;  4YB7 A;  3H4Z A;  4E0X A;  3JYR A;  3JZJ A;  1PBQ A;  3B8B A;  4RPN A;  3VVF A;  4FBP A;  2DQV A;  4PGP A;  3ZSF A;  4YKJ A;  2Y7I A;  1A54 A;  4EF2 A;  5DT6 A;  2CZI A;  4XIG Q;  4JVI A;  4I9D A;  1LBV A;  2VPN A;  4R74 A;  1ZTY A;  4PF6 A;  1MPD A;  4OMB A;  1LFG A;  3RPL A;  2GQ1 A;  3ILU B;  4R72 A;  2KLF A;  3T1B A;  3FXR A;  1FQE A;  5ET6 A;  3WAF A;  4N17 A;  3B50 A;  4NF6 B;  2F34 A;  1FQF A;  4ZEF A;  1JQF A;  1Q35 A;  1RKM A;  3CG3 A;  1WVJ A;  4H67 A;  1VDW A;  3QMF A;  4GWY A;  3V89 B;  5TPA A;  2DWI A;  3IR1 A;  3TCH A;  3N94 A;  1TXF A;  2AL5 A;  4U21 A;  4OEN A;  2YLN A;  2ZZX A;  1NV3 A;  1JNF A;  2H25 A;  3RTF B;  4UAB A;  1FTM A;  2XX8 A;  5FHM A;  1EYI A;  3W9W A;  1Q1K A;  4PCD A;  4G61 A;  2WX9 A;  4F22 A;  4OFJ A;  5I2K B;  5F7V A;  3QXM A;  1FCK A;  4O94 A;  4JB7 A;  2D3I A;  2XWI A;  1M5B A;  1IEJ A;  4TLM B;  2HPG A;  3Q29 A;  2X7P A;  3DP4 A;  2H98 A;  2DWH A;  2F3B A;  4XEQ A;  1MXU A;  4Q0C A;  2XXT A;  3UA8 A;  1RDZ A;  5CMC A;  2I4C A;  2ZYN A;  1YCJ A;  1GVC A;  4GXA A;  2KQZ A;  3MVW A;  3O97 A;  1MQH A;  4TQU Q;  3TDJ A;  2F78 A;  2I3W A;  4N07 A;  3PMW A;  3EHU A;  1YXI A;  1M5C A;  1B2H A;  1B1X A;  2ONR A;  4F1Y A;  3IJX B;  3PPN A;  2QVU A;  3MST A;  2AL4 A;  1N3W A;  4N6K A;  3PPP A;  2DYX A;  2R71 A;  2O84 X;  3N5L A;  5LDZ A;  3U94 A;  4EQ9 A;  4GIZ A;  4YU0 A;  1EH3 A;  2RC9 A;  4N8Y A;  4QF9 A;  3RPL B;  1TWY A;  3SEV A;  3QIM A;  2Y5L A;  3CG1 A;  3G3G A;  3ZKK A;  2F5X A;  2Y7K A;  4FJP A;  1NV7 A;  4HE1 A;  4IGT A;  4GBV A;  3T22 A;  1M5E A;  5M2V A;  5HBC A;  3FV2 A;  3KJ7 A;  2B3F A;  3PUY E;  2Q2A A;  3FIR A;  3CRB A;  1JEV A;  1GR2 A;  3O6G A;  1LFH A;  5TPA B;  4GL0 A;  3TEP A;  4YKP A;  4OWD A;  1NI9 A;  3LSF B;  1PB9 A;  4OHN A;  2OWT A;  4O7I A;  3HO7 A;  3M3K A;  3C35 A;  3MPK A;  2O51 A;  1DPP A;  2Q9T A;  3VV5 A;  3O2A A;  1FTO A;  4C0R A;  1N3X A;  4ESW A;  3HHF A;  3EN3 A;  2ZXT A;  3S9M C;  4OA4 A;  1Y3Q A;  1LB9 A;  2OZZ A;  5I56 B;  4MFI A;  3KJT A;  4QFK A;  4IO5 A;  3S9E A;  2F7C A;  4KPT A;  2YPN A;  3K1M A;  4YKI A;  2Y7R A;  4HW8 A;  2VD3 A;  1MXV A;  3MZ9 A;  3O6I A;  3C4M A;  2UVJ A;  5ELV A;  3BIG A;  4GQO A;  5ITO A;  5ET8 A;  1IXH A;  4LA9 A;  4LUB A;  3I5O A;  4FE8 A;  1UTB A;  3OO7 A;  5KZT A;  5EQA A;  2Z8D A;  3GZG A;  2DOJ A;  1LBZ A;  2UVI A;  4BDL A;  1K9Y A;  3T0J A;  2Z8F A;  2RF1 A;  3QSL A;  1QUJ A;  4YB5 A;  5DVF A;  1B52 A;  3CFL A;  1PBP A;  4NHB A;  1SW4 A;  2PT1 A;  3RPW A;  3RTW B;  1NH7 A;  3A3U A;  4U2R A;  4NE4 A;  4NQ8 A;  2Q8J A;  1IME A;  3KFM A;  5AA2 D;  2Q8M A;  3TTR A;  4Q8R A;  4HE0 A;  3DP8 A;  3U92 A;  4OET A;  1OVT A;  4LP2 B;  4ZEI A;  4G68 C;  2O68 A;  4OER A;  5FTI A;  3EKI A;  3U65 A;  3PD9 A;  1IIT A;  5LOM A;  1DPE A;  1Y3P A;  1XC1 A;  4ELO A;  3U72 A;  4IO4 A;  2ZYO A;  3TTN A;  1N84 A;  2G29 A;  2P1S A;  5I58 B;  4HCW A;  3UN6 A;  3IK6 B;  4LZ5 A;  5I57 A;  3E13 X;  1UTH A;  4BDR A;  1FPK A;  1NMU A;  4MIJ A;  2THI A;  2QVV A;  5TP9 A;  4XF5 A;  1LBX A;  1SBP A;  1SW5 A;  2CZL A;  3QUF A;  3L6H A;  1B4H A;  4NF8 A;  2HQ0 A;  3KOT A;  3L6G A;  4QFL A;  4MX6 A;  2AYS A;  5L9O A;  3O29 A;  4OES A;  2QVR A;  1FW0 A;  3HHG A;  3PPO A;  4ZEC A;  4DIG A;  1I69 A;  2I4B A;  4QSC A;  3IO4 A;  5DTB A;  3CSG A;  3FJ7 A;  2FA7 A;  1FBD A;  1MXZ A;  4R6Y A;  4U1Z A;  4ECF A;  3T9U A;  2QJE A;  1POT A;  2XHD A;  1NV2 A;  4O7M A;  1FQB A;  1AH5 A;  3UK4 A;  4G8M A;  1FBP A;  1MY3 A;  5EHM A;  5IKB A;  1SDX A;  4G68 A;  2B65 A;  4ZS9 A;  3T96 B;  1G0I A;  1MQD A;  4MH5 A;  3K0V A;  4DCX A;  2PFY A;  3TKD A;  1A40 A;  1FPL A;  1YZ0 A;  3CFX A;  4QHQ A;  2DDK A;  4GBW A;  3OOA A;  4GXS B;  1QGX A;  1SI1 A;  5DVJ A;  2H9B A;  1HSE A;  5KCJ B;  3RNN A;  2Q88 A;  4NF4 B;  2VOZ A;  2QMW A;  2XWK A;  4X1D A;  1EZP A;  2XXW A;  5I2N B;  1GV8 A;  4G4P A;  4N81 A;  2PBW A;  4PDH A;  4KQP A;  1FRP A;  5AA4 B;  3S4U A;  1RYX A;  3VVD A;  4GX3 A;  1XI6 A;  1POY 1;  4NG7 A;  4HS7 A;  3RLF E;  4PGN A;  3PUX E;  1B7H A;  3G3K A;  1B1H A;  3DLN A;  5I84 A;  3T66 A;  2ZMB A;  3C34 A;  2REJ A;  1EYJ A;  3R7X A;  1HSL A;  4YKK A;  1UTH B;  1KWH A;  4Q5T A;  2OWS A;  5H8N B;  3IB1 A;  5TP9 B;  2ALU A;  1BK4 A;  1LBW A;  2DXY A;  2XXU A;  2JJK A;  1JW4 A;  4G2Z A;  5I7I A;  4P1E A;  2QS2 A;  2HZK A;  5CMK A;  3KN7 A;  5EYH A;  4IR8 A;  2ABH A;  2XXV A;  4RA1 A;  1EZO A;  3VFJ A;  2WYP A;  3U1O A;  3WAE A;  3DP6 A;  1ZJL A;  1BIY A;  1MY0 A;  4FIM A;  1M5F A;  2PMS A;  1D9Q A;  4L17 A;  1R9Q A;  2F7A A;  2FHY A;  1US5 A;  1Y20 A;  4LN5 A;  3EHS A;  1LAH E;  4G8H A;  3U8Q A;  3IAZ A;  1FTL A;  3KN3 A;  1PC3 A;  3UIF A;  3KGC A;  3H06 B;  4ND9 A;  4NGU A;  1NH8 A;  4PFU A;  1QKA A;  4LZ8 A;  5H8H A;  3RUM A;  3FJM A;  3IOR A;  4G68 B;  3RQT A;  1SYI A;  3OSR A;  1VE4 A;  3KSX A;  3ECR A;  4BDQ A;  5ICT A;  3KBZ A;  1RDX A;  1B05 A;  3SEU A;  4JDF A;  1MY2 A;  1S9T A;  1F9B A;  2REG A;  2Y84 A;  4OVR A;  1NL5 A;  4RK2 A;  3EF7 A;  3T9H B;  1PDA A;  3OO8 A;  1OQG A;  4PF8 A;  4XKP A;  3H6V A;  2IA4 A;  3G3J A;  1WDN A;  2HXW A;  4WED A;  2IEE A;  2ZNT A;  3RT6 B;  5IAI A;  1N0T A;  4F29 A;  2OWZ A;  4N15 A;  5HPQ A;  4LQ2 A;  2FIE A;  3UP9 A;  3IO6 A;  1FSA A;  4Z0I A;  3IOV A;  1D9Y A;  3IFC A;  4ZZE A;  2F8D A;  2I0C A;  2XX9 A;  1XS5 A;  3LSL A;  4GWS A;  4C1U A;  3S2V A;  1B32 A;  4JXI A;  5KDT B;  1NV4 A;  1MH3 A;  1QVS A;  5ICQ A;  4NN3 A;  3K4U A;  3U93 A;  3ISP A;  3VLV A;  1DTZ A;  2VP1 A;  4ONY A;  4R9G A;  4DLD A;  3K02 A;  4JWX A;  4LON B;  1ZU0 A;  3OEK A;  5H8F B;  1P1Q A;  2PT2 A;  3OD7 A;  2ANJ A;  1IMA A;  1MPB A;  4PET A;  1M5D A;  2ZZV A;  1Y3N A;  2I0B A;  2DE3 A;  2HZL A;  1B3L A;  1USY E;  3SER A;  1FBF A;  1VFD A;  3BFU A;  2FIX A;  5CMM A;  4O3A A;  2UVH A;  1XT8 A;  1FTA A;  2WBB A;  1FPG A;  5I3S A;  2HAU A;  5BWJ A;  1MDQ A;  3QAX A;  1QW0 A;  3MVY A;  3MVZ A;  2ONS A;  4OEU A;  1LST A;  1KZ8 A;  4OVP A;  4U4S A;  3IOW A;  3H3G A;  1Z7N E;  4POX A;  1H45 A;  4F19 A;  2CMO A;  3O66 A;  3FVN A;  4NWC A;  2RC7 A;  2XD2 A;  3MBP A;  1DSN A;  3FXB A;  3OO6 A;  1G0H A;  1Z7M E;  4RYA A;  2XXQ A;  3E78 A;  5EQ7 A;  3EQ1 A;  4LQ5 A;  1MY4 A;  4MNC A;  3IOT A;  4GVO A;  1N7W A;  3OEN A;  4F3S A;  3D1R A;  1ZIU A;  2RKM A;  3BIH A;  1YAE A;  4OEV A;  4I1D A;  1O63 A;  5IM2 A;  4FAT A;  4GFR A;  3D4C A;  4DI4 B;  1Y9U A;  2VD2 A;  2NVU B;  1QUL A;  2DWA A;  1RYO A;  1I6Q A;  5K2X A;  3T9V A;  5CM6 A;  3SDF A;  4FEC A;  3H7M A;  3TFL A;  1MXY A;  3AXF A;  3G3H A;  4ESX A;  4IO6 A;  5EYF A;  3MJN A;  1PB8 A;  1NNK A;  3PUW E;  1RDY A;  4RXL A;  4KR5 A;  1URG A;  4GLI A;  4OVQ A;  1OIB A;  3C9H A;  3GYY A;  2ZNS A;  5CBR A;  2ZYK A;  3LSW A;  1NKX A;  4N6P A;  4F31 B;  4OQO A;  1H44 A;  1DTG A;  4PFY A;  1OQH A;  1US4 A;  4MAG A;  4THI A;  5DEX A;  4KHZ E;  5H8Q A;  3LUZ A;  1HSJ A;  4X48 A;  2Q2C A;  1T0K A;  3K1P A;  5FHN A;  1R9L A;  5IZZ A;  1H43 A;  3TTL A;  2DP8 A;  4YB6 A;  1PEB A;  4PDD A;  4DE8 A;  1UIU A;  4F3B A;  3TTK A;  2RCB A;  4RNS A;  5L9M A;  1A99 A;  3V5A A;  4R6K A;  4IY6 A;  3RN8 A;  3TYH A;  1MQJ A;  1MXW A;  2I6E A;  4OTE A;  1IIW A;  5DVI A;  5DYH A;  3F11 A;  4HE2 A;  4YIC A;  2V4C A;  3KG2 A;  4KYD A;  3GLB A;  1B40 A;  3RT8 A;  3HPI A;  1FPI A;  4ELQ A;  1NUY A;  4YMB A;  4QRZ A;  3TQW A;  1NUW A;  3SET A;  3GBB A;  4JSO A;  2OBG A;  1UIV A;  1XOC A;  2RIN A;  3I3V A;  4ZED A;  3BFT A;  4N13 A;  4POW A;  3K6V A;  1ELJ A;  3UGW A;  2ZNU A;  3Q27 A;  2GHB A;  1CNQ A;  4PTK A;  4UA8 A;  1B3F A;  2O7U A;  2Z23 A;  4OYV A;  1IMB A;  5AA3 A;  3TTM A;  5JK4 A;  1QJM A;  1Q9D A;  4QBA A;  1FBC A;  2G93 A;  4NF5 A;  4X04 A;  1MQG A;  1B3E A;  3FXQ A;  3Q26 A;  5H8S A;  3A09 A;  2DXR A;  4GD5 A;  4BLA A;  4GL8 A;  3SEY A;  2F6P A;  3O28 A;  4DCY A;  3M3F A;  4PE3 A;  1VSO A;  1I6B A;  5AA2 A;  2NWJ A;  4QFN A;  3PPQ A;  3OMB A;  1MQI A;  2QFL A;  1S7Y A;  1MDP 1;  2QS1 A;  3USD A;  1IMC A;  1LEV A;  1IXC A;  2XWO A;  1H76 A;  5HM4 B;  3H6U A;  2PFZ A;  4AS4 A;  4G77 A;  3VDF A;  5DEX B;  5H8Q B;  1FQA A;  5JTY A;  4KI0 E;  4R75 A;  1II5 A;  2DE2 A;  3OO9 A;  4WKM A;  4JVC A;  5TU0 A;  2W7Y A;  1R1N A;  2A5T A;  1FPJ A;  4IY5 A;  2H4I A;  3G7W A;  3PPR A;  4KD5 A;  1LGB C;  2DSF A;  1B3G A;  1LAX A;  4I40 A;  5ISU A;  3V83 A;  4F1U A;  3QUJ A;  4DXC A;  4P0G A;  4AB6 A;  4GX6 A;  3QYT A;  1MRP A;  3B7D A;  2FBP A;  4X9T A;  1LB8 A;  2PX1 A;  1DOT A;  3G3F A;  5T3J A;  1DK4 A;  2QS4 A;  2RC8 A;  4P9K A;  4P47 A;  3CR9 A;  2O6A A;  1P1U A;  4P56 A;  1R6Z A;  2O1M A;  1MY1 A;  1UTB B;  4JBZ A;  3MP1 A;  1JET A;  4JVD A;  4G8N A;  2V3T A;  2DVC A;  1XVX A;  4FOR A;  4NTL A;  2P2A A;  5IZ3 A;  2L5V A;  2HEU A;  3SKP A;  1S50 A;  4ZE9 A;  1DCU A;  3MC2 A;  5J16 A;  3T9X B;  3IOU A;  1IUD A;  4XKR A;  4MBP A;  3HFU A;  1CB6 A;  4NF6 A;  4R2F A;  1LBY A;  2Z8E A;  2XD3 A;  2QSX A;  3VXB A;  4N4U A;  2V3Q A;  4NF5 B;  4IGR A;  4XXU A;  1I6A A;  5J1D A;  1MM6 A;  4H65 A;  4FEB A;  3N26 A;  2XXR A;  5F24 A;  1WOD A;  2XXI A;  3HV1 A;  3ONM A;  1A7L A;  3ODB A;  2Y5K A;  2XXY A;  2R8T A;  1USY H;  2MKZ A;  3VLU A;  3CHG A;  3K00 A;  3EPE A;  3PMV A;  4PAF A;  4KCD A;  1FPB A;  1FQC A;  5A5L A;  3MPL A;  4R9F A;  4NWD A;  5AA2 B;  4GWU A;  3FAS A;  2E1S A;  3MZB A;  2UYF A;  2CZK A;  3A29 A;  3FV1 A;  3MWB A;  1FTK A;  2X26 A;  1SW2 A;  3OEL A;  2HCA A;  5I57 B;  3CVG A;  4FED A;  1N76 A;  3PU5 A;  1LCT A;  1MPC A;  3LSX A;  4X8R A;  5I2K A;  3SES A;  3TMG A;  4DZ1 A;  1Y1M A;  1XVY A;  1JVX A;  4KCC A;  1JW5 A;  1Y4T A;  4NF8 B;  3MAM A;  1JP4 A;  4QSD A;  2B3B A;  3TCG A;  5A5X A;  4AS5 A;  3O6H A;  2FYI A;  2R6G E;  4BDO A;  3GXA A;  3IL1 B;  4QXD A;  3MYU A;  4U4X A;  4ZEK A;  4HTG A;  4KFQ A;  4ZEB A;  2HAV A;  1OMP A;  2VHA A;  2WYK A;  3B6Q A;  5FTH A;  4O3B A;  3TPA A;  3O9P A;  4P1L A;  4H6D A;  4WXJ A;  4ISU A;  1MXX A;  4N91 A;  3W15 C;  1B9J A;  2F97 A;  3C32 A;  4F2Q A;  2KR0 A;  2Y7P A;  2RCA A;  2FNC A;  2V84 A;  3FAT A;  2O1L A;  4HCY A;  3KOS A;  3BBR A;  2A5S A;  1IQ7 A;  2P0S A;  1SW1 A;  3PTY A;  1URS A;  1LLS A;  1B5J A;  2YJP A;  3KZG A;  2XX7 A;  2OX3 A;  4M1V A;  2H5Y A;  5FHO A;  3K1N A;  4GWX A;  5ET5 A;  1L5T A;  3FJG A;  3KBR A;  5IZ3 B;  2QMX A;  1N04 A;  2QL3 A;  4TLL B;  1FQD A;  4HXV A;  1IMD A;  1EYK A;  1LBB A;  1LAG E;  4MLV A;  3S9N C;  3PUV E;  3E4R A;  4OAN A;  2OCU A;  3SEW A;  4NMY A;  2I3V A;  3SEX A;  1AL3 A;  3M3L A;  4EDP A;  4AB5 A;  1YPN A;  5LTC A;  4I3Y A;  1MS7 A;  1N7X A;  3H6T A;  2H99 A;  4GWO A;  5JEI A;  4GWW A;  2ZZW A;  1SI0 A;  3ZKL A;  1FBH A;  3K01 A;  4P0I A;  1B7U A;  1JEU A;  4EF1 A;  3T93 B;  4LAT A;  1B4Z A;  1MG1 A;  1XHY A;  1NUZ A;  1A55 A;  3VE1 B;  2PVU A;  1J1N A;  3PUZ E;  4MCO A;  1QUK A;  4U1O A;  2DS9 A;  4H0W A;  5CC2 A;  1TT1 A;  5I56 A;  2XXX A;  4H5G A;  1B0L A;  2UVG A;  4PP0 A;  4PBH A;  4EQ7 A;  4EUO A;  2DWJ A;  1SVX B;  1LFI A;  2V25 A;  3A3C A;  4DI3 D;  3I6V A;  3PD8 A;  4BDN A;  2PCR A;  3IFA A;  4KYE A;  2NXO A;  3BKI B;  2B4L A;  2QS3 A;  4IO7 A;  3HN0 A;  3KSJ A;  4DDD A;  4ELP A;  2F36 A;  3B6T A;  5K2Y A;  1UQW A;  1VR5 A;  1NNT A;  1GGG A;  4P8B A;  3H03 A;  3M8U A;  4F18 A;  5A5X B;  2M8C A;  5EYG A;  3ROJ A;  5EQ9 A;  1NFT A;  4AQ4 A;  1FPF A;  4MJO A;  1QUI A;  1NNP A;  4XTC Q;  3DEL B;  3CIJ A;  3OEM A;  4JSD A;  1PB7 A;  1BP5 A;  3MQ9 A;  1NNF A;  4XFE A;  4MLQ A;  1IXG A;  5CMB A;  3RYD A;  3Q25 A;  5ESY A;  4U23 A;  3FXU A;  5H8H B;  1O64 A;  4EXL A;  3VLW A;  4PFB A;  2WKY A;  4K3F A;  2GRV A;  4MEV A;  1H3D A;  3FGS A;  3KEI A;  3TEL A;  4PFW A;  3FUZ A;  1FBE A;  4OFL A;  3IB2 A;  1B5I A;  2PYY A;  1ZLQ A;  5AE4 A;  1Y4C A;  2VGQ A;  4OVS A;  5IGA A;  2D5W A;  2I58 A;  3THI A;  1B6H A;  5L8D A;  4YMA A;  3LBS A;  1OLC A;  3HCQ A;  3NOH A;  1D3K A;  2OJT A;  2CZH A;  1ATG A;  4F2O A;  2XA5 A;  3C33 A;  5I58 A;  4X1B A;  4PFI A;  2NUV A;  5EQ8 A;  4OZ9 A;  4I3E A;  2E0S A;  1SD3 A;  3VVE A;  4JWY A;  3SZP A;  4U22 A;  5B70 A;  4GWZ A;  2P3N A;  4LVQ A;  4MF3 A;  4PE5 B;  3E9X A;  4GX4 A;  1AMF A;  1MH4 A;  1O7T A;  4C1T A;  1AIV A;  2HFB A;  1EZ9 A;  3C31 A;  4QFP A;  3RY3 A;  4H8J A;  3K6X A;  1B46 A;  4F3P A;  3B6W A;  5B7D A;  1NV0 A;  3UOR A;  2ONK E;  5I59 A;  5ET7 A;  3HST A;  4OVT A;  4RPO A;  1B7Z A;  2BJJ X;  4LZ7 A;  1TFD A;  2QPQ A;  1KA0 A;  3P7I A;  3KN8 A;  1EU8 A;  2HHM A;  4P3L A;  2B4M A;  3IX1 A;  3S9L C;  2V93 A;  3MW0 A;  3FVO A;  4MHF A;  1SPI A;  1DMB A;  2ESN A;  1P99 A;  4PFR A;  2F6G A;  3DM0 A;  2D21 A;  4KXP A;  1IMF A;  4PC9 A;  4IO3 A;  2XXH A;  3MZ1 A;  1NV1 A;  4PAI A;  1FPD A;  4DXU A;  1BKA A;  5FBP A;  4E0W A;  3IJO B;  2I48 A;  3TOD A;  3PGF A;  5CRY A;  1YYZ A;  2XWV A;  3TAJ A;  4GOT A;  2WBD A;  2GH9 A;  3K2D A;  4ZDM A;  4WEP A;  1B58 A;  2UYE A;  5AA1 A;  4ELR A;  2BJI A;  1Y1Z A;  4R73 A;  4PBQ A;  2F3D A;  4NX1 A;  4M4G A;  1NV6 A;  3MP8 A;  3LV0 A;  4OVJ A;  2V3U A;  4QSE A;  3FZV A;  5KCJ A;  1SQY A;  2FVZ A;  4NF4 A;  1JW1 A;  3CI8 A;  3LR1 A;  4H45 A;  1KA1 A;  4H46 A;  1YTV A;  2VT5 A;  1A8F A;  4NAP A;  5I2N A;  4MMP A;  3FVG A;  3R26 A;  3MVX A;  3OXN A;  1VFE A;  1MM7 A;  1TFA A;  4KYS A;  1P1W A;  4F39 A;  5AA4 A;  4NED A;  3OSQ A;  4JWO A;  2Y7W A;  3LUY A;  2I49 A;  2Q74 A;  4PQJ A;  1BLF A;  1A8E A;  1B3H A;  1CE2 A;  1B5H A;  1URD A;  1AWB A;  4F1V A;  4YAH X;  3D4G A;  3JV9 A;  3K6U A;  3TZA A;  4MNP A;  2R9J A;  2XXP A;  1ZKB A;  4R6H A;  2F7B A;  2UXA A;  4H8I A;  5H8N A;  5ITP A;  5EHS A;  1ANF A;  4OXV A;  4EQB A;  2P3V A;  3R6U A;  4I62 A;  3MP6 A;  3C36 A;  4BDM A;  3N6T A;  4P11 A;  4I8C A;  3CSB A;  3W9V A;  5BUU A;  1OVB A;  1B51 A;  4F3G A;  1B0H A;  1BTJ A;  3N6U A;  3LC8 A;  5I59 B;  2CEY A;  5IZ1 A;  4NF0 A;  1LCF A;  3PV0 E;  3KC1 A;  3IB0 A;  1IXI A;  4N8G A;  1ZBM A;  3FBP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...