4LATA

Crystal structure of phosphate abc transporter, periplasmic phosphate-binding protein psts 1 (pbp1) from streptococcus pneumoniae canada mdr_19a in complex with phosphate
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
260
structure length
260
Chain Sequence
ESITAVGSTALQPLVEVAADEFGTIHVGKTVNVQGGGSGTGLSQVQSGAVDIGNSDVFAEEKDGIDASALVDHKVAVAGLALIVNKEVDVDNLTTEQLRQIFIGEVTNWKEVGGKDLPISVINRAAGSGSRATFDTVIMEGQSAMQSQEQDSNGAVKSIVSKSPGAISYLSLTYIDDSVKSMKLNGYDLSPENISSNNWPLWSYEHMYTLGQPNELAAEFLNFVLSDETQEGIVKGLKYIPIKEMKVEKDAAGTVTVLEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphate-binding protein PstS 1
publication title Crystal structure of phosphate ABC transporter, periplasmic phosphate-binding protein PstS 1 (PBP1) from Streptococcus pneumoniae Canada MDR_19A in complex with phosphate
rcsb
source organism Streptococcus pneumoniae
molecule tags Transport protein
total genus 87
structure length 260
sequence length 260
ec nomenclature
pdb deposition date 2013-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4latA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4latA02
2E0SA 1Y1ZA 4IO3A 4NE4A 3TTLA 1YTVA 3EF7A 1Y4CA 1USYH 3C31A 5H8FB 4XKQA 1OLCA 3IX1A 1LAXA 1B3EA 1LCFA 4OEVA 2O68A 4GF8A 4F2QA 3D4GA 5H8NB 1QKAA 1R9LA 2Q88A 3FIRA 1YAEA 2ONRA 2I0BA 2VD3A 2PX1A 3QUJA 4KYEA 1RYXA 4YMBA 3OO7A 4UA8A 1Z7ME 4H67A 4F2OA 5I59A 2A5TA 1IXHA 2PVUA 3PD9A 1JNFA 5AA4A 3C33A 4PP0A 2W7YA 1LB9A 3U94A 5EHSA 3IB2A 1ANFA 3UP9A 3PUXE 2RC8A 4RYAA 4X1DA 1B6HA 3M3FA 4X1BA 1ZIUA 5KDTB 1ZKBA 2QMXA 1ELJA 3TQLA 5CMKA 4IO4A 4XKPA 5A5XA 3CFXA 4H6DA 3H6WA 4QSEA 3FVOA 4ND9A 4H0WA 2PMSA 4BDMA 1IEJA 2E1SA 2M8CA 3F11A 4FECA 3SESA 3MWBA 4PFUA 2DXYA 3ILTB 1XVYA 4EQ7A 2ZYNA 4YKPA 1IXIA 3K6WA 1FQDA 4G68A 3U1OA 4KD5A 1MXWA 2Q89A 3HV1A 3U93A 1B4HA 1VE4A 1AIVA 1FTJA 2QRYA 4QRZA 2GFEA 1TT1A 2I58A 1N3XA 1IUDA 3IOWA 3OO9A 1FQEA 5I59B 4QFKA 3S9LC 2A5TB 2F36A 3A3CA 5AA4B 2I4CA 1HSJA 4OQOA 2OWSA 4FE8A 3ZS6A 4IGRA 3TTKA 4R2BA 2UVGA 4F1VA 2V3QA 3DLNA 3CI8A 1TFAA 1MM6A 3IR1A 1YCJA 2D21A 3T22A 1LAHE 5A5XB 4ELOA 1H44A 4U4XA 1FQAA 2QS1A 1B3LA 1P99A 4ESWA 1O64A 3HHGA 3L6HA 1LFGA 1SI0A 1NNKA 3MPLA 3TTMA 1MXVA 3I5OA 2REJA 4FEBA 5K2XA 5EYFA 2OCUA 3S9MC 2IEEA 3MJNA 4GL0A 3FVNA 1HSLA 1NNTA 4H5FA 2GHBA 3VE1B 4JWOA 4G68B 4Z0IA 4ZZAA 3TYHA 3I6VA 5I2KA 1MY3A 3H4ZA 3PU5A 4ZE9A 5L9OA 3MVWA 5H8QA 4GD5A 4QFOA 1CB6A 2O7UA 1MPBA 2RKMA 3B6WA 4XXUA 3OO8A 3RUMA 1B4ZA 1ATGA 3DM0A 4Q30B 1FTMA 1R6ZA 3TCGA 1XOCA 3OEMA 2XX7A 2P1SA 1OMPA 3FATA 3VXBA 2CZLA 3OD7A 1XS5A 1OVTA 1P1NA 2O84X 4U23A 1LAGE 2XXXA 1A8FA 2X7PA 1ZU0A 1A7LA 2H4IA 4WXJA 2Y7WA 1BLFA 2ZYKA 4OWDA 1JETA 5JK4A 2GHAA 1DOTA 3OOAA 4QFPA 1P1QA 1MY4A 2GH9A 3M8UA 5DVIA 4QF9A 5ISUA 5I56A 5AA3A 2AL5A 3GXAA 4QSDA 2I6EA 1LSTA 5I2KB 3KSXA 4F19A 1EZPA 1DPPA 3E4RA 5H8QB 4M4GA 3ZSFA 1O7TA 4MLVA 3N26A 3EHSA 2DVCA 1Z7NE 1B9JA 2VGQA 4U1ZA 1QKBA 4I1DA 1URGA 4H65A 2UYFA 4FIMA 4JSDA 4N6PA 2Y7IA 1B3HA 4RK2A 3G3HA 1SVXB 1LB8A 2XXPA 2DWAA 2OJTA 2X7QA 2UVHA 1NH8A 3KN8A 1B1XA 2THIA 1GR2A 4PFTA 1XT8A 2ALUA 3HN0A 3SKPA 1MXUA 3PD8A 2V25A 3IOVA 3THIA 2DQVA 3OO6A 3PPOA 2OBGA 3MVXA 4LZ7A 4ZS9A 4RA1A 1FQFA 1MY2A 4I9DA 1B3FA 2ANJA 3GBBA 4DE8A 4ZEKA 4R6KA 5I56B 3PGFA 3CVGA 3VXCA 4DCYA 1ZLQA 1QULA 1B5IA 3I3VA 4NMYA 2XXTA 3KJTA 4BDNA 3PUVE 3OMBA 2XX8A 1F9BA 3PV0E 2GRVA 2DP8A 2PT1A 5TU0A 1M5BA 3MZBA 3K1PA 3G3GA 3Q25A 4PFYA 3FGSA 4JWYA 4PETA 3U72A 2DVZA 3QK6A 3TODA 1MDP1 3H3GA 3ODBA 3B7DA 1KWHA 5AA1A 4R6HA 3EQ1A 4Q0CA 2Y7PA 5DEXA 3MP8A 1UTHA 3TTRA 2ZNSA 1NNPA 3S9NC 2O51A 1I6BA 3UN6A 2FNCA 3OENA 3TMGA 1P1WA 3H6UA 3ECRA 3UIFA 3VVDA 3VDFA 3IL1B 2ESNA 3FZVA 4R72A 3C36A 3C4MA 1RKMA 4YZZA 3KZGA 5I2NA 4OERA 4L17A 3FJ7A 4JDFA 1MS7A 4TOZA 4F3SA 3BBRA 1A40A 1MPDA 2F78A 4O3AA 4DDDA 1MY0A 2H9BA 4TLLB 5HM4B 1UTBA 2Z22A 3ILUB 4MLQA 4YKIA 3DP4A 5TP9A 3PUYE 4FJPA 1Y3QA 3PUZE 4THIA 2I49A 3V5AA 4GVOA 2V93A 3ZKKA 2HAUA 1CE2A 2O1MA 3CFZA 3RY3A 2PBWA 3N5LA 2FA7A 1B05A 4P0IA 5I84A 1B2HA 1B51A 4YB7A 1M5CA 3PMXA 4E0WA 2ZYMA 1S50A 5DEXB 4G8MA 4KCCA 2HXWA 4JSOA 1UTHB 3DP6A 2F6PA 3M3KA 3IJOB 4AQ4A 4ELRA 3BKIB 4X9TA 5F1QA 5CRYA 1SYHA 3EN3A 3E13X 4F1UA 4IGTA 1MXZA 5I2NB 4P11A 4OMBA 3K02A 1VFEA 4U21A 2QJEA 1N7XA 3KN7A 3RN8A 2NXOA 3V89B 3TCHA 1UTBB 1DSNA 5DT6A 1H76A 5B70A 2B3BA 3K0VA 2XD3A 3M3LA 4OETA 3FJMA 5TP9B 4OHNA 1NFTA 2Y7KA 3K1NA 3O66A 3HCQA 3MP6A 1IQ7A 4R9FA 5JEIA 2RINA 3AXFA 1B32A 3LUYA 4LQ2A 5IAIA 4EQ9A 4GRKA 4H5GA 4GIZA 3MZ9A 2OWTA 4F39A 3MVYA 1JEVA 3SEYA 4I8CA 1S7YA 4OFLA 2QSXA 1LAFE 5H8SA 3S2VA 4MFIA 4PFWA 3TELA 2H5YA 2F6GA 3T66A 3V83A 3FV1A 3DP8A 5AA2D 3P7IA 1MQHA 2Q2AA 5CMMA 5I57A 1IITA 2NOOA 3Q28A 1PBQA 1B5JA 1PB7A 4DZ1A 5L9SA 2A5SA 3S9EA 5AA2A 4R74A 5KZTA 4H8JA 4Z7EA 4OENA 4KFQA 3TUSA 1TXFA 3JZJA 4OTEA 4KPTA 1EU8A 1A54A 2QMWA 4OESA 1NKXA 4LUBA 3R26A 3OEKA 1FQCA 3RPWA 5AE4A 3IAZA 4F22A 4RJZA 1PB8A 2ZNTA 3TTNA 3O28A 1HSEA 2OK2A 4GL8A 4U22A 2KLFA 3T9XB 1DTGA 3GLBA 3VLVA 2Z23A 3KGCA 3FV2A 3W9VA 2HAVA 1OVBA 5JTYA 1LBBA 4HS7A 2NVUB 3QXMA 4Q8RA 1BIYA 1OLAA 1D9YA 3SETA 4Q5TA 2AYSA 1B40A 3DELB 4LA9A 4OVJA 3IOTA 1B0HA 1LBCA 4JB7A 4F31B 4E0XA 4DLDA 5I57B 5LOMA 2D5WA 2F34A 2O1LA 1NNFA 2QS4A 1US4A 5AA2B 3H7MA 4NEDA 4TQUQ 2HQ0A 3FVKA 1LCTA 4DXBA 3GZGA 4YAHX 1MQDA 2QL3A 2R6GE 4YKJA 3S4UA 4EF2A 1Y4TA 2ONSA 3H06B 1GTKA 1I6QA 1I69A 4H8IA 3E9XA 3FVGA 1SBPA 3L6GA 3RQTA 1JW4A 4KQPA 2HZKA 4R6YA 5H8HA 4BLAA 4EF1A 1SYIA 1PBPA 4XTCQ 3MC2A 3IORA 4GOTA 2O6AA 3FJGA 2RCAA 1R1NA 1FCKA 3FXQA 4X48A 1PDAA 4EQBA 3FASA 4G77A 4KI0E 1S9TA 1M5FA 4GQOA 5KCJA 3RTWB 5B7DA 4AB5A 1ZBMA 2QS2A 4RY1A 2NUVA 5JTYB 2XXHA 3PUWE 2G29A 3UGWA 4BDOA 3VFJA 3HO7A 1SD3A 4EDPA 1GVCA 5TPAA 4O3CA 2XXIA 2YPNA 2FYIA 1ZTYA 3U92A 4H1XA 5DTBA 3EHUA 5CBSA 4U1OA 3SDFA 4IO5A 5BWJA 3SEVA 1AH5A 1B0LA 1B1HA 1B3GA 4YB6A 3SEUA 1QUJA 4OXVA 3BFUA 3O6HA 1MM7A 3H03A 2X26A 4C0RA 3T9UA 3BFTA 1EZ9A 1T0KA 1Y3NA 1Y1MA 4KCDA 2H99A 4NTLA 5H8HB 3V8XB 4LONB 5CBRA 3MPKA 2V84A 5DVFA 4R2FA 4RXLA 5FTIA 2ZXTA 4R75A 2R71A 4ZEBA 4YU0A 3OXNA 4NF5A 5KCJB 1POY1 5CI5A 2F7BA 1XVXA 1A55A 1WVJA 5HBCA 3TCFA 2VOZA 1SDXA 4WKMA 3FXUA 4NWDA 3O6GA 3FXRA 1QUKA 2VD2A 4F3BA 5TPAB 3RLFE 3G3FA 3VV5A 1MXXA 1JVXA 1PEBA 1YPNA 4HCYA 4POXA 3N94A 1VR5A 3O29A 2XXWA 4ISUA 1I6AA 4BDLA 2Y7RA 2D3IA 4HCWA 5CC2A 3MUQA 3E3KA 4YMAA 4C1UA 3K4UA 2Z8DA 2DXRA 4POWA 2DYXA 1GV8A 2F7AA 4HW8A 1PB9A 3C34A 3HSTA 2DSFA 4MH5A 1QJMA 1SQYA 3LSXA 2OLBA 4NWCA 2V3UA 1ZJLA 4NF8A 4BDRA 4GXAA 3PMWA 4K3FA 4LVQA 4XIGQ 3KOTA 3LC8A 4NF5B 1Y3PA 1QVSA 4LZ8A 2R9JA 1B5HA 3Q26A 4OZ9A 1EZOA 2ZYOA 4QFNA 2QS3A 1B7HA 1A99A 2HCAA 3SEWA 4DCXA 2NWJA 4XKNA 1LLSA 3LSFB 3RTFB 3MAMA 1Q35A 5FHNA 3LR1A 2UVIA 4DXUA 4JXIA 3ZKLA 3A3UA 1D9VA 3W15C 4F29A 4TLMB 1B52A 3IOUA 1N04A 3KOSA 3PPPA 4O3BA 1M5EA 1UQWA 3ONMA 1P1OA 3KSJA 4FORA 3UK4A 5I58A 1BKAA 2Z8FA 4OYVA 4IO2A 2H98A 2UXAA 2HFBA 5CM6A 3H6VA 5ITPA 3PPNA 5BUUA 2YJPA 3W9WA 3QUFA 5DYHA 3SEXA 2F5XA 4NF8B 1PC3A 5EHMA 4KYSA 1MH4A 4GWOA 4LZ5A 1OQHA 4MF3A 3O2AA 3RT6B 1MQIA 4RPOA 3TKDA 1SW1A 3WAFA 2YLNA 1NL5A 3MP1A 3FUZA 3TQWA 1JQFA 2VHAA 1US5A 5DVJA 4FATA 2AIXA 2I0CA 1IXGA 4PQJA 1B7UA 4LP2B 1OIBA 3G3IA 5IKBA 1AMFA 3CSGA 2RC9A 3QAXA 3VLUA 3CG3A 3TPAA 2V3TA 3B6TA 2P0SA 2DWHA 2ABHA 5I58B 1ZMGA 5FTHA 4EXKA 1Q1KA 4IO7A 5FHOA 2DS9A 4ELPA 5FHMA 3IO4A 1L5TA 1JEUA 4F18A 3K1MA 3LSLA 1B7ZA 1RYOA 3JV9A 2G93A 4JWXA 3MQ9A 3O6IA 3C9HA 4WEDA 3B6QA 4F1YA 2QPQA 4ESXA 1USYE 4G4PA 2OZZA 2XXRA 4EXLA 1BTJA 4UACA 3T9HB 5M2VA 3K01A 1SW4A 1AL3A 5F7VA 1WODA 3USDA 3G7WA 4YICA 4I62A 4YB5A 5K2YA 1UIUA 1BP5A 1URSA 3TZAA 3CG1A 3HPIA 2DE4A 3A09A 2I48A 1SW5A 1R9QA 2I4BA 4PE5B 1P1UA 3O97A 3WAEA 3TFLA 1AOVA 2F7CA 4YKKA 4QFLA 3CRBA 2RCBA 4IY6A 2UYEA 3SERA 2Q8JA 4NF6A 4ONYA 4QSCA 4GLIA 3K6VA 1H45A 1IXCA 4F3GA 3U8QA 4N07A 1VFDA 5HPQA 2UVJA 2HZLA 3T96B 1QW0A 3T9VA 1JW5A 3HHFA 3PPRA 2B65A 3CR9A 1SI1A 1XC1A 2HEUA 3C32A 1O63A 3PMVA 3KJ7A 2WKYA 3QIMA 4F3PA 2LAOA 5CMCA 1FTLA 4R9GA 3MW0A 3K2DA 2F97A 1M5DA 4ZEFA 3EPEA 1LGBC 4ZZEA 4RK9A 1Y20A 2IA4A 3IJXB 4ZECA 3O9PA 4FEDA 1TFDA 4DIGA 3TEPA 3K00A 1XHYA 1IIWA 5L8DA 1MQJA 3VVFA 3KBRA 4ZEDA 2PT2A 3IK6B 2I3VA 1B46A 3MVZA 5ITOA 2DE2A 4G8HA 3MZ1A 4P0GA 3R6UA 4C1TA 4IB2A 1DMBA 3QSLA 3LBSA 2REGA 4G2ZA 1D4NA 1MDQA 3IB0A 2XXYA 3LSWA 4N13A 2PYYA 4KHZE 3OELA 1SW2A 4NF6B 1N3WA 2DE3A 1UIVA 1MQGA 2DOJA 4RPNA 5CMBA 1FQBA 4JBZA 2I3WA 2XX9A 1MH3A 2DWJA 3RGYA 3OSQA 3QYTA 3KN3A 1WDNA 4KR5A 2P2AA 1TWYA 2XXUA 1OQGA 3N6UA 4M1VA 2Q9TA 2XD2A 3C35A 2O69A 1D3KA 3VVEA 3Q27A 1H43A 2CMOA 4QHQA 3G3JA 2ZMBA 4NF4A 1MRPA 4GFRA 1N7WA 3IO6A 5ELVA 4OEUA 2Z8EA 3Q29A 5ICTA 1A8EA 1B58A 4R73A 4OFOA 3H6TA 3KFMA 2Q2CA 1Y9UA 3CIJA 4EUOA 4IY5A 3UORA 1H3DA 1DTZA 2XXQA 3KG2A 4KYDA 5ICQA 4BDQA 2ZNUA 5L9MA 3TDJA 4OFJA 3R7XA 3T93B 4ECFA 1DPEA 2Y84A 3PPQA 1MG1A 4WEPA 4FAJA 3GBAA 3OSRA 3CFLA 2DWIA 1FTOA 3K6UA 4ZEIA 3UA8A 4U2RA 1LFIA 2ONKE 1MY1A 4DXCA 4AB6A 4HTGA 4G68C 3VLWA 1NH7A 4MBPA 5H8FA 2F8DA 3K6XA 4XKRA 3KEIA 1FTKA 4IO6A 3JYRA 2RC7A 5H8NA 1JVYA 4NF4B 4ELQA 2XXVA 4G8NA 1MPCA 1EH3A 3EHTA 1MXYA 2AL4A 3TAJA 2RF1A 1POTA 2F35A 3G3KA 3CSBA 3RNNA 1VSOA 1J1NA 3IB1A 1N0TA 4ZDMA 2O7IA 1NMUA 3D4CA 2VP1A 1GGGA 1IZ1A 4LQ5A 3RT8A 1QUIA 4LATA 2XHDA 5J1DA 3FD3A 2H25A 1URDA 4GXSB 3MBPA 1N84A 2B3FA 3N6TA 4ZE8A 2BJJX 5KDTA 1JW1A 4U4SA 1FW0A 1LFHA 4RNSA 1N76A 1II5A
chains in the Genus database with same CATH superfamily
2KQZA 2B4LA 4N8GA 2E0SA 1Y1ZA 4IO3A 4NE4A 4NG7A 3TTLA 1YTVA 3EF7A 1Y4CA 1USYH 3C31A 5H8FB 4XKQA 1OLCA 3IX1A 1LAXA 1B3EA 1VDWA 1LCFA 4OEVA 2O68A 4GF8A 4F2QA 1NUXA 3D4GA 5H8NB 1QKAA 1R9LA 4O7MA 2Q88A 3FIRA 1YAEA 2ONRA 2I0BA 2VD3A 2PX1A 3QUJA 4KYEA 5I5PA 1RYXA 4YMBA 3OO7A 4UA8A 1NV1A 1Z7ME 4H67A 4F2OA 1YYZA 5I59A 2A5TA 1IXHA 2PVUA 3PD9A 1JNFA 5AA4A 3C33A 4PP0A 2W7YA 1LB9A 3U94A 5EHSA 3IB2A 1ANFA 4PAKA 2FIXA 3UP9A 3PUXE 2RC8A 4RYAA 4X1DA 1B6HA 3M3FA 4X1BA 2XWOA 1ZIUA 5KDTB 1ZKBA 2QMXA 1ELJA 3TQLA 5CMKA 4IO4A 4XKPA 5A5XA 3CFXA 1IMEA 4H6DA 3H6WA 4PF8A 4QSEA 3FVOA 5FBPA 4ND9A 4H0WA 2PMSA 4BDMA 1IEJA 2E1SA 5F24A 2M8CA 2CEXA 3F11A 4MHFA 4FECA 3SESA 2FVZA 3MWBA 4PFUA 2DXYA 3ILTB 1XVYA 4EQ7A 2ZYNA 4YKPA 1IXIA 3K6WA 1FQDA 4G68A 3U1OA 4KD5A 1MXWA 2KR0A 2Q89A 3HV1A 3U93A 1B4HA 4QBAA 1VE4A 1AIVA 1QGXA 1FTJA 2QRYA 4QRZA 2GFEA 1FBGA 1TT1A 2I58A 1N3XA 1IUDA 3IOWA 3OO9A 1FQEA 5I59B 4QFKA 3S9LC 2A5TB 3KBZA 2F36A 3A3CA 2Q8MA 5AA4B 2I4CA 4O94A 1HSJA 4OQOA 2OWSA 4FE8A 3ZS6A 4OVTA 4IGRA 3TTKA 4R2BA 2UVGA 4F1VA 2V3QA 3DLNA 3CI8A 1TFAA 2F3DA 1MM6A 3IR1A 1YCJA 3B8BA 2D21A 3T22A 3CHGA 1LAHE 5J16A 5A5XB 4ELOA 1H44A 4U4XA 1FQAA 2QS1A 5IZZA 1B3LA 1FPJA 1P99A 4ESWA 3FXBA 1O64A 3HHGA 3L6HA 1LFGA 1SI0A 1NNKA 3EKIA 3MPLA 3TTMA 1MXVA 3I5OA 2XWKA 2REJA 4FEBA 5K2XA 5EYFA 2OCUA 3S9MC 2IEEA 3MJNA 4GL0A 3FVNA 1HSLA 1NNTA 4H5FA 2GHBA 3VE1B 4JWOA 3A29A 4G68B 4Z0IA 4ZZAA 3TYHA 1FPIA 3I6VA 5I2KA 1MY3A 3H4ZA 3PU5A 4ZE9A 5ET8A 5L9OA 3MVWA 5H8QA 4GD5A 4QFOA 4DI4B 1CB6A 2O7UA 1MPBA 2RKMA 3B6WA 4XXUA 3OO8A 3RUMA 1B4ZA 4Q30B 1ATGA 3DM0A 1FTMA 2F3BA 4GWWA 4O8MA 1R6ZA 3TCGA 2VPOA 1XOCA 3OEMA 2XX7A 2P1SA 4OVPA 1OMPA 3FATA 3VXBA 2CZLA 3OD7A 1XS5A 4P1LA 1OVTA 1P1NA 2O84X 1IMFA 4U23A 1LAGE 2XXXA 1A8FA 2X7PA 1ZU0A 4PC9A 1A7LA 5EYHA 2H4IA 4WXJA 2Y7WA 1BLFA 2ZYKA 4OWDA 1JETA 5JK4A 2VPNA 4MMPA 2GHAA 3QMFA 1DOTA 3OOAA 4QFPA 1P1QA 1MY4A 2GH9A 3M8UA 4PFBA 5DVIA 4QF9A 1LBXA 3BIHA 3RYDA 5ISUA 4G61A 5I56A 5AA3A 4XFEA 2AL5A 3GXAA 4QSDA 2I6EA 1LSTA 5I2KB 3KSXA 5A5LA 4F19A 1EZPA 1DPPA 3E4RA 5H8QB 3ROJA 4M4GA 3ZSFA 1FBEA 1O7TA 4MLVA 3N26A 4GBWA 3EHSA 2DVCA 1Z7NE 1B9JA 2VGQA 4U1ZA 1QKBA 3SZPA 4I1DA 1URGA 4H65A 2UYFA 1IMBA 4FIMA 4JSDA 4N6PA 2Y7IA 1B3HA 4RK2A 3G3HA 1SVXB 1LB8A 4N6KA 2XXPA 2DWAA 2OJTA 2X7QA 2FBPA 2UVHA 1NH8A 2QFLA 3KN8A 1B1XA 2THIA 1GR2A 4PFTA 1XT8A 2ALUA 3HN0A 3SKPA 1MXUA 3PD8A 2V25A 4OANA 3IOVA 3THIA 2DQVA 3OO6A 3PPOA 4P9KA 4GWYA 2OBGA 1FBFA 3MVXA 4LZ7A 1NV0A 4ZS9A 2MKZA 4JVDA 4RA1A 1FQFA 1MY2A 4I9DA 1B3FA 2ANJA 3GBBA 4DE8A 4PGNA 4ZEKA 4R6KA 5I56B 3PGFA 3CVGA 3VXCA 4H46A 4DCYA 1FBPA 1FJ6A 1ZLQA 1QULA 1B5IA 3I3VA 4NMYA 2XXTA 3KJTA 4BDNA 3PUVE 3OMBA 2XX8A 1F9BA 3PV0E 2GRVA 2DP8A 2PT1A 5TU0A 1M5BA 3MZBA 3K1PA 4PBHA 3G3GA 3Q25A 3GYYA 4PFYA 3FGSA 4JWYA 4PETA 3IFAA 3U72A 2DVZA 3QK6A 3TODA 1MDP1 2OWZA 3H3GA 3ODBA 3B7DA 1KWHA 4HE0A 5AA1A 4R6HA 3EQ1A 4Q0CA 2Y7PA 5DEXA 3MP8A 1UTHA 3TTRA 2ZNSA 1SPIA 2ZZWA 1NNPA 3S9NC 2O51A 1I6BA 3UN6A 2FNCA 3OENA 3TMGA 1P1WA 3H6UA 3ECRA 3UIFA 3VVDA 3VDFA 3IL1B 1EYIA 2ESNA 3FZVA 4R72A 3C36A 3C4MA 1RKMA 4YZZA 1FPFA 3KZGA 5I2NA 4OERA 1EYJA 4L17A 3FJ7A 4JDFA 1MS7A 2WBDA 4TOZA 4F3SA 4GWSA 5IZ3A 3BBRA 1A40A 1MPDA 2F78A 4O3AA 4DDDA 1MY0A 2H9BA 4TLLB 5HM4B 1UTBA 2Z22A 3ILUB 4MLQA 4YKIA 3DP4A 5TP9A 4IR8A 3PUYE 4FJPA 1Y3QA 3PUZE 4THIA 2I49A 3V5AA 4GVOA 4JVIA 4X8RA 2WYKA 2V93A 3ZKKA 2HAUA 1CE2A 2O1MA 3CFZA 5IZ1A 4NAPA 3RY3A 2PBWA 3N5LA 2FA7A 1B05A 4P0IA 5I84A 4PFRA 5IGAA 1B2HA 1NV4A 1B51A 4YB7A 1M5CA 3PMXA 4E0WA 3KC0A 4N6DA 2ZYMA 1S50A 5DEXB 4G8MA 4KCCA 2HXWA 4JSOA 1UTHB 4NF0A 3DP6A 2F6PA 3M3KA 2P3VA 3IJOB 4AQ4A 4ELRA 4N15A 3BKIB 4X9TA 5F1QA 5CRYA 1SYHA 3EN3A 3E13X 3LUZA 4F1UA 4IGTA 1MXZA 5I2NB 4P3LA 4P11A 4OMBA 3K02A 1VFEA 4U21A 2QJEA 5IZ3B 1N7XA 3KN7A 4I40A 3RN8A 2NXOA 3V89B 3TCHA 4GWXA 1K9ZA 1UTBB 1DSNA 5DT6A 1H76A 5B70A 2B3BA 2P3NA 3K0VA 2QVRA 1FBHA 2JJKA 4OETA 2XD3A 3M3LA 3FJMA 5TP9B 4OHNA 1NFTA 2Y7KA 2WBBA 3K1NA 3O66A 3HCQA 3MP6A 1IQ7A 4R9FA 5JEIA 4LN5A 2RINA 3AXFA 1B32A 1XI6A 3LUYA 4LQ2A 5IAIA 4EQ9A 4GRKA 1DK4A 4GIZA 3MZ9A 4H5GA 2OWTA 4F39A 3MVYA 1JEVA 3SEYA 4I8CA 1S7YA 4OFLA 2QSXA 1LAFE 5H8SA 1DBZA 1FPBA 3S2VA 4MFIA 4PFWA 2Y5KA 3TELA 2H5YA 2F6GA 3T66A 3V83A 3FV1A 3DP8A 5AA2D 3P7IA 1MQHA 2Q2AA 5CMMA 5I57A 2R8TA 3B50A 1IITA 2L5VA 2NOOA 3Q28A 1PBQA 1B5JA 1PB7A 4DZ1A 5L9SA 5ET6A 2A5SA 3S9EA 5AA2A 4R74A 5KZTA 4H8JA 1K9YA 2PFYA 4Z7EA 4OVQA 4OENA 4KFQA 3TUSA 1TXFA 3JZJA 5T3JA 4OTEA 2Q74A 4KPTA 1EU8A 1A54A 4NX1A 2QMWA 4OESA 4I3EA 1NKXA 4LUBA 3R26A 3OEKA 1FQCA 3RPWA 5AE4A 3IAZA 4F22A 4RJZA 1PB8A 2ZNTA 3TTNA 3O28A 1HSEA 2OK2A 4AS5A 4GL8A 4U22A 2KLFA 3T9XB 1DTGA 3GLBA 3VLVA 2Z23A 3KGCA 1NI9A 3FV2A 4PTKA 3W9VA 2HAVA 1OVBA 5JTYA 1LBBA 4HS7A 3D1RA 2NVUB 3QXMA 1NUYA 4Q8RA 1BIYA 1OLAA 1D9YA 3SETA 4Q5TA 2AYSA 1B40A 3DELB 4LA9A 4OVJA 3IOTA 1B0HA 1LBCA 4JB7A 4F31B 4E0XA 4DLDA 5I57B 5EQAA 5LOMA 1Q9DA 2D5WA 2F34A 2O1LA 1NNFA 1NUZA 2QS4A 4P56A 1US4A 1NV3A 5AA2B 3H7MA 4NEDA 4TQUQ 1LBVA 2HQ0A 1EYKA 2WYPA 1FTAA 1KA0A 3FVKA 1LCTA 2XWVA 1D9QA 4DXBA 3GZGA 4YAHX 1MQDA 2QL3A 2R6GE 4YKJA 3S4UA 4EF2A 1Y4TA 2ONSA 3H06B 1GTKA 1I6QA 4MNIA 1I69A 4H8IA 3E9XA 3FVGA 1SBPA 4PE3A 3L6GA 3RQTA 1JW4A 4KQPA 2HZKA 4R6YA 5H8HA 4BLAA 4EF1A 2OX3A 1SYIA 1PBPA 3BIGA 4XTCQ 3MC2A 3IORA 3LV0A 2GQ1A 2O6AA 1FSAA 4GOTA 3FJGA 4N8YA 2RCAA 1R1NA 1FCKA 2VT5A 1LEVA 4NGUA 3FXQA 4X48A 1PDAA 4EQBA 3FASA 4G77A 4KI0E 1S9TA 1M5FA 4GQOA 5KCJA 3RTWB 5B7DA 4AB5A 1ZBMA 2QS2A 4RY1A 2NUVA 5JTYB 2XXHA 1NV5A 3ISPA 3PUWE 4FBPA 2G29A 4HE2A 3UGWA 1IMAA 2ZZVA 4BDOA 3VFJA 3HO7A 1SD3A 4EDPA 1GVCA 5TPAA 4O3CA 2XXIA 2YPNA 2FYIA 1ZTYA 3U92A 4H1XA 5DTBA 3EHUA 5EQ7A 5CBSA 4U1OA 3SDFA 4HE1A 4IO5A 5BWJA 4PFIA 3SEVA 1AH5A 1AWBA 1B0LA 1G0IA 1B1HA 4AS4A 1B3GA 4YB6A 3SEUA 1QUJA 4MAGA 4OXVA 4PCDA 3BFUA 3O6HA 1MM7A 3H03A 2X26A 4MEVA 4C0RA 3T9UA 3BFTA 1EZ9A 4P1EA 1T0KA 1Y3NA 1Y1MA 4KCDA 2H99A 4NN3A 4MCOA 4NTLA 5H8HB 3V8XB 2V4CA 4LONB 5CBRA 3MPKA 4PF6A 2V84A 5DVFA 4R2FA 5EQ8A 4RXLA 5FTIA 2ZXTA 2DDKA 4R75A 2R71A 1FPKA 4ZEBA 4YU0A 1G0HA 3OXNA 4NF5A 5KCJB 1POY1 5CI5A 2F7BA 1XVXA 1A55A 1WVJA 5HBCA 4OVSA 1BK4A 3TCFA 2VOZA 1SDXA 4WKMA 3FXUA 4NWDA 3O6GA 3FXRA 1QUKA 2VD2A 4F3BA 5TPAB 4PBQA 3RLFE 3G3FA 3VV5A 1MXXA 1JVXA 1PEBA 1YPNA 4HCYA 4POXA 1DCUA 3N94A 1VR5A 3O29A 4PGPA 2XXWA 4ISUA 1I6AA 3NOHA 4BDLA 2Y7RA 2D3IA 4HCWA 5CC2A 3MUQA 3U65A 3E3KA 4YMAA 4C1UA 3MYUA 3K4UA 2Z8DA 2DXRA 5IM2A 4POWA 2DYXA 4GWUA 1GV8A 3E78A 2F7AA 4HW8A 1PB9A 3C34A 3HSTA 2DSFA 3PTYA 3IFCA 4MH5A 1QJMA 1SQYA 3LSXA 2OLBA 4NWCA 2V3UA 1ZJLA 4NF8A 5LTCA 4BDRA 1FPLA 4GXAA 3PMWA 4K3FA 4LVQA 4XIGQ 3KOTA 3LC8A 4NF5B 1FRPA 1Y3PA 1QVSA 4LZ8A 2R9JA 1B5HA 3Q26A 4OZ9A 1EZOA 2ZYOA 4QFNA 2QS3A 1B7HA 1A99A 2HCAA 3RPLB 3SEWA 4DCXA 2FHYA 2NWJA 4XKNA 4GX4A 1LLSA 3LSFB 4PAIA 3RTFB 3MAMA 2CZIA 1Q35A 5FHNA 3LR1A 2UVIA 4DXUA 4JXIA 3ZKLA 3A3UA 1JP4A 3FBPA 2BJIA 1D9VA 3W15C 4F29A 4I3YA 4NQ8A 4TLMB 1B52A 3IOUA 1N04A 3KOSA 3PPPA 4O3BA 1M5EA 1UQWA 3ONMA 1P1OA 3KSJA 4FORA 3UK4A 5I58A 1BKAA 3E79A 2Z8FA 4OYVA 4IO2A 2WX9A 4N17A 2H98A 2UXAA 2HFBA 4UABA 5CM6A 2XA5A 3H6VA 5ITPA 3PPNA 5BUUA 2YJPA 3W9WA 3QUFA 5DYHA 4XEQA 3SEXA 2F5XA 4NF8B 1PC3A 2B4MA 5EHMA 4KYSA 1MH4A 4GWOA 4LZ5A 1OQHA 4MF3A 3O2AA 2WEFA 3RT6B 1MQIA 2PCRA 1YXIA 4RPOA 1NV2A 4GBVA 3TKDA 1SW1A 3WAFA 4PDHA 2YLNA 4HXVA 1NL5A 4MNPA 3MP1A 3FUZA 3TQWA 1JQFA 2VHAA 1US5A 5DVJA 3T0JA 4FATA 4PDDA 1INPA 2AIXA 1YZ0A 4MNCA 1KZ8A 2I0CA 1IXGA 4PQJA 1B7UA 4LP2B 1OIBA 3G3IA 5IKBA 1AMFA 3CSGA 2RC9A 3QAXA 3VLUA 4MIJA 3CG3A 3TPAA 2V3TA 3B6TA 2P0SA 2DWHA 2ABHA 5I58B 1ZMGA 5FTHA 4EXKA 1Q1KA 4IO7A 1LBYA 2DS9A 5FHOA 4ELPA 5FHMA 3IO4A 1L5TA 1JEUA 3KC1A 2QVUA 4F18A 3K1MA 3LSLA 1B7ZA 1RYOA 3JV9A 5I7IA 5ET7A 2G93A 4JWXA 3MQ9A 3O6IA 3C9HA 4WEDA 2CZKA 3B6QA 4F1YA 2QPQA 4ESXA 1USYE 4G4PA 2OZZA 2XXRA 4EXLA 1BTJA 4UACA 3T9HB 5M2VA 3K01A 1SW4A 1AL3A 5F7VA 1WODA 3USDA 3G7WA 4KXPA 4YICA 4I62A 2XWIA 4YB5A 5K2YA 1UIUA 1BP5A 1URSA 3TZAA 3CG1A 3HPIA 2DE4A 4DI3D 3A09A 2I48A 1SW5A 1R9QA 2I4BA 4OVRA 4PE5B 1P1UA 3O97A 3WAEA 3TFLA 1AOVA 2F7CA 4YKKA 4QFLA 3CRBA 2RCBA 4IY6A 2UYEA 3SERA 1RDYA 2Q8JA 4NF6A 1RDZA 4ONYA 4QSCA 5EQ9A 4GLIA 3K6VA 1FPEA 2HXRA 1H45A 1NV7A 4N81A 1IXCA 4F3GA 3U8QA 4N07A 1VFDA 5HPQA 2UVJA 2HZLA 4GX6A 3T96B 1QW0A 3T9VA 1JW5A 3HHFA 3PPRA 5ESYA 2B65A 3CR9A 1SI1A 1XC1A 2HEUA 3C32A 4MX6A 1FBCA 1O63A 3PMVA 1FBDA 3KJ7A 1FPGA 2WKYA 3QIMA 4F3PA 2LAOA 5CMCA 1FTLA 4R9GA 3MW0A 3K2DA 2F97A 1M5DA 4ZEFA 3EPEA 1LGBC 4ZZEA 4RK9A 1Y20A 2IA4A 3IJXB 4ZECA 3O9PA 4FEDA 4NHBA 1TFDA 4DIGA 3TEPA 3K00A 1XHYA 1IIWA 5L8DA 1MQJA 3VVFA 3KBRA 4ZEDA 2PT2A 3IK6B 2I3VA 1B46A 3MVZA 5ITOA 2DE2A 2CZHA 2HPGA 4G8HA 3MZ1A 4P0GA 5DW8A 3R6UA 4C1TA 4IB2A 1DMBA 3QSLA 3LBSA 2REGA 4G2ZA 1D4NA 1MDQA 3IB0A 2XXYA 3LSWA 4N13A 2PYYA 4KHZE 3OELA 1SW2A 4NF6B 3MSTA 1N3WA 2DE3A 1UIVA 1MQGA 4MJOA 2DOJA 4RPNA 5CMBA 1FQBA 4JBZA 2I3WA 2XX9A 1MH3A 2DWJA 3RGYA 3OSQA 1RDXA 3QYTA 3KN3A 1WDNA 4KR5A 2P2AA 1TWYA 1IMCA 2XXUA 1OQGA 3N6UA 4M1VA 2Q9TA 2XD2A 3C35A 2HHMA 2FIEA 2O69A 1D3KA 1IMDA 3VVEA 3Q27A 1H43A 2CMOA 4QHQA 3G3JA 4GWZA 2ZMBA 4NF4A 1MRPA 4GFRA 1N7WA 3IO6A 5ELVA 2PFZA 4OEUA 2Z8EA 3Q29A 5ICTA 1A8EA 1NUWA 1B58A 4GX3A 4R73A 4OFOA 3H6TA 3KFMA 2Q2CA 1Y9UA 3CIJA 4EUOA 4IY5A 3UORA 1H3DA 1DTZA 4QXDA 2XXQA 3KG2A 2Y5LA 4H45A 4KYDA 5ICQA 4BDQA 5EYGA 2ZNUA 5L9MA 3TDJA 4OA4A 4PAFA 4OFJA 3R7XA 3T93B 4ECFA 4N91A 1DPEA 2Y84A 3PPQA 1MG1A 4WEPA 4FAJA 5LDZA 3GBAA 3OSRA 3RPLA 3CFLA 2DWIA 4JVCA 1FTOA 3K6UA 1CNQA 4ZEIA 3UA8A 1LBWA 4U2RA 1LFIA 4XF5A 2ONKE 1MY1A 1NV6A 4DXCA 4AB6A 4HTGA 4G68C 3VLWA 1NH7A 2QVVA 4MBPA 2XXKA 5H8FA 2F8DA 3K6XA 4XKRA 3KEIA 1FTKA 4IO6A 3JYRA 2RC7A 5H8NA 1JVYA 4NF4B 4ELQA 2ZZXA 2XXVA 4G8NA 2CEYA 1MPCA 1EH3A 5I3SA 3EHTA 1MXYA 2AL4A 3TAJA 2RF1A 1POTA 2F35A 3G3KA 3CSBA 3RNNA 1VSOA 1J1NA 4X04A 3T1BA 3IB1A 1KA1A 1FJ9A 1N0TA 4ZDMA 2O7IA 1NMUA 3D4CA 2VP1A 1GGGA 1IZ1A 4LQ5A 5ET5A 3RT8A 1QUIA 4LATA 3HFUA 2XHDA 5J1DA 3FD3A 2H25A 1URDA 4GXSB 1FPDA 4P47A 3MBPA 1N84A 2B3FA 4O7IA 3N6TA 4ZE8A 4P8BA 2BJJX 5KDTA 1LBZA 1JW1A 4U4SA 1FW0A 1LFHA 4RNSA 1N76A 1II5A 4N4UA
chains in the Genus database with same CATH topology
2E0SA 1Y1ZA 4IO3A 4NE4A 3TTLA 1YTVA 3EF7A 1Y4CA 1USYH 3C31A 5H8FB 4XKQA 1OLCA 3IX1A 1LAXA 1B3EA 1LCFA 4OEVA 2O68A 4GF8A 4F2QA 3D4GA 5H8NB 1QKAA 1R9LA 2Q88A 3FIRA 1YAEA 2ONRA 2I0BA 2VD3A 2PX1A 3QUJA 4KYEA 1RYXA 4YMBA 3OO7A 4UA8A 1Z7ME 4H67A 4F2OA 5I59A 2A5TA 1IXHA 2PVUA 3PD9A 1JNFA 5AA4A 3C33A 4PP0A 2W7YA 1LB9A 3U94A 5EHSA 3IB2A 1ANFA 3UP9A 3PUXE 2RC8A 4RYAA 4X1DA 1B6HA 3M3FA 4X1BA 1ZIUA 5KDTB 1ZKBA 2QMXA 1ELJA 3TQLA 5CMKA 4IO4A 4XKPA 5A5XA 3CFXA 4H6DA 3H6WA 4QSEA 3FVOA 4ND9A 4H0WA 2PMSA 4BDMA 1IEJA 2E1SA 2M8CA 3F11A 4FECA 3SESA 3MWBA 4PFUA 2DXYA 3ILTB 1XVYA 4EQ7A 2ZYNA 4YKPA 1IXIA 3K6WA 1FQDA 4G68A 3U1OA 4KD5A 1MXWA 2Q89A 3HV1A 3U93A 1B4HA 1VE4A 1AIVA 1FTJA 2QRYA 4QRZA 2GFEA 1TT1A 2I58A 1N3XA 1IUDA 3IOWA 3OO9A 1FQEA 5I59B 4QFKA 3S9LC 2A5TB 2F36A 3A3CA 5AA4B 2I4CA 1HSJA 4OQOA 2OWSA 4FE8A 3ZS6A 4IGRA 3TTKA 4R2BA 2UVGA 4F1VA 2V3QA 3DLNA 3CI8A 1TFAA 1MM6A 3IR1A 1YCJA 2D21A 3T22A 1LAHE 5A5XB 4ELOA 1H44A 4U4XA 1FQAA 2QS1A 1B3LA 1P99A 4ESWA 1O64A 3HHGA 3L6HA 1LFGA 1SI0A 1NNKA 3MPLA 3TTMA 1MXVA 3I5OA 2REJA 4FEBA 5K2XA 5EYFA 2OCUA 3S9MC 2IEEA 3MJNA 4GL0A 3FVNA 1HSLA 1NNTA 4H5FA 2GHBA 3VE1B 4JWOA 4G68B 4Z0IA 4ZZAA 3TYHA 3I6VA 5I2KA 1MY3A 3H4ZA 3PU5A 4ZE9A 5L9OA 3MVWA 5H8QA 4GD5A 4QFOA 1CB6A 2O7UA 1MPBA 2RKMA 3B6WA 4XXUA 3OO8A 3RUMA 1B4ZA 1ATGA 3DM0A 4Q30B 1FTMA 1R6ZA 3TCGA 1XOCA 3OEMA 2XX7A 2P1SA 1OMPA 3FATA 3VXBA 2CZLA 3OD7A 1XS5A 1OVTA 1P1NA 2O84X 4U23A 1LAGE 2XXXA 1A8FA 2X7PA 1ZU0A 1A7LA 2H4IA 4WXJA 2Y7WA 1BLFA 2ZYKA 4OWDA 1JETA 5JK4A 2GHAA 1DOTA 3OOAA 4QFPA 1P1QA 1MY4A 2GH9A 3M8UA 5DVIA 4QF9A 5ISUA 5I56A 5AA3A 2AL5A 3GXAA 4QSDA 2I6EA 1LSTA 5I2KB 3KSXA 4F19A 1EZPA 1DPPA 3E4RA 5H8QB 4M4GA 3ZSFA 1O7TA 4MLVA 3N26A 3EHSA 2DVCA 1Z7NE 1B9JA 2VGQA 4U1ZA 1QKBA 4I1DA 1URGA 4H65A 2UYFA 4FIMA 4JSDA 4N6PA 2Y7IA 1B3HA 4RK2A 3G3HA 1SVXB 1LB8A 2XXPA 2DWAA 2OJTA 2X7QA 2UVHA 1NH8A 3KN8A 1B1XA 2THIA 1GR2A 4PFTA 1XT8A 2ALUA 3HN0A 3SKPA 1MXUA 3PD8A 2V25A 3IOVA 3THIA 2DQVA 3OO6A 3PPOA 2OBGA 3MVXA 4LZ7A 4ZS9A 4RA1A 1FQFA 1MY2A 4I9DA 1B3FA 2ANJA 3GBBA 4DE8A 4ZEKA 4R6KA 5I56B 3PGFA 3CVGA 3VXCA 4DCYA 1ZLQA 1QULA 1B5IA 3I3VA 4NMYA 2XXTA 3KJTA 4BDNA 3PUVE 3OMBA 2XX8A 1F9BA 3PV0E 2GRVA 2DP8A 2PT1A 5TU0A 1M5BA 3MZBA 3K1PA 3G3GA 3Q25A 4PFYA 3FGSA 4JWYA 4PETA 3U72A 2DVZA 3QK6A 3TODA 1MDP1 3H3GA 3ODBA 3B7DA 1KWHA 5AA1A 4R6HA 3EQ1A 4Q0CA 2Y7PA 5DEXA 3MP8A 1UTHA 3TTRA 2ZNSA 1NNPA 3S9NC 2O51A 1I6BA 3UN6A 2FNCA 3OENA 3TMGA 1P1WA 3H6UA 3ECRA 3UIFA 3VVDA 3VDFA 3IL1B 2ESNA 3FZVA 4R72A 3C36A 3C4MA 1RKMA 4YZZA 3KZGA 5I2NA 4OERA 4L17A 3FJ7A 4JDFA 1MS7A 4TOZA 4F3SA 3BBRA 1A40A 1MPDA 2F78A 4O3AA 4DDDA 1MY0A 2H9BA 4TLLB 5HM4B 1UTBA 2Z22A 3ILUB 4MLQA 4YKIA 3DP4A 5TP9A 3PUYE 4FJPA 1Y3QA 3PUZE 4THIA 2I49A 3V5AA 4GVOA 2V93A 3ZKKA 2HAUA 1CE2A 2O1MA 3CFZA 3RY3A 2PBWA 3N5LA 2FA7A 1B05A 4P0IA 5I84A 1B2HA 1B51A 4YB7A 1M5CA 3PMXA 4E0WA 2ZYMA 1S50A 5DEXB 4G8MA 4KCCA 2HXWA 4JSOA 1UTHB 3DP6A 2F6PA 3M3KA 3IJOB 4AQ4A 4ELRA 3BKIB 4X9TA 5F1QA 5CRYA 1SYHA 3EN3A 3E13X 4F1UA 4IGTA 1MXZA 5I2NB 4P11A 4OMBA 3K02A 1VFEA 4U21A 2QJEA 1N7XA 3KN7A 3RN8A 2NXOA 3V89B 3TCHA 1UTBB 1DSNA 5DT6A 1H76A 5B70A 2B3BA 3K0VA 2XD3A 3M3LA 4OETA 3FJMA 5TP9B 4OHNA 1NFTA 2Y7KA 3K1NA 3O66A 3HCQA 3MP6A 1IQ7A 4R9FA 5JEIA 2RINA 3AXFA 1B32A 3LUYA 4LQ2A 5IAIA 4EQ9A 4GRKA 4H5GA 4GIZA 3MZ9A 2OWTA 4F39A 3MVYA 1JEVA 3SEYA 4I8CA 1S7YA 4OFLA 2QSXA 1LAFE 5H8SA 3S2VA 4MFIA 4PFWA 3TELA 2H5YA 2F6GA 3T66A 3V83A 3FV1A 3DP8A 5AA2D 3P7IA 1MQHA 2Q2AA 5CMMA 5I57A 1IITA 2NOOA 3Q28A 1PBQA 1B5JA 1PB7A 4DZ1A 5L9SA 2A5SA 3S9EA 5AA2A 4R74A 5KZTA 4H8JA 4Z7EA 4OENA 4KFQA 3TUSA 1TXFA 3JZJA 4OTEA 4KPTA 1EU8A 1A54A 2QMWA 4OESA 1NKXA 4LUBA 3R26A 3OEKA 1FQCA 3RPWA 5AE4A 3IAZA 4F22A 4RJZA 1PB8A 2ZNTA 3TTNA 3O28A 1HSEA 2OK2A 4GL8A 4U22A 2KLFA 3T9XB 1DTGA 3GLBA 3VLVA 2Z23A 3KGCA 3FV2A 3W9VA 2HAVA 1OVBA 5JTYA 1LBBA 4HS7A 2NVUB 3QXMA 4Q8RA 1BIYA 1OLAA 1D9YA 3SETA 4Q5TA 2AYSA 1B40A 3DELB 4LA9A 4OVJA 3IOTA 1B0HA 1LBCA 4JB7A 4F31B 4E0XA 4DLDA 5I57B 5LOMA 2D5WA 2F34A 2O1LA 1NNFA 2QS4A 1US4A 5AA2B 3H7MA 4NEDA 4TQUQ 2HQ0A 3FVKA 1LCTA 4DXBA 3GZGA 4YAHX 1MQDA 2QL3A 2R6GE 4YKJA 3S4UA 4EF2A 1Y4TA 2ONSA 3H06B 1GTKA 1I6QA 1I69A 4H8IA 3E9XA 3FVGA 1SBPA 3L6GA 3RQTA 1JW4A 4KQPA 2HZKA 4R6YA 5H8HA 4BLAA 4EF1A 1SYIA 1PBPA 4XTCQ 3MC2A 3IORA 4GOTA 2O6AA 3FJGA 2RCAA 1R1NA 1FCKA 3FXQA 4X48A 1PDAA 4EQBA 3FASA 4G77A 4KI0E 1S9TA 1M5FA 4GQOA 5KCJA 3RTWB 5B7DA 4AB5A 1ZBMA 2QS2A 4RY1A 2NUVA 5JTYB 2XXHA 3PUWE 2G29A 3UGWA 4BDOA 3VFJA 3HO7A 1SD3A 4EDPA 1GVCA 5TPAA 4O3CA 2XXIA 2YPNA 2FYIA 1ZTYA 3U92A 4H1XA 5DTBA 3EHUA 5CBSA 4U1OA 3SDFA 4IO5A 5BWJA 3SEVA 1AH5A 1B0LA 1B1HA 1B3GA 4YB6A 3SEUA 1QUJA 4OXVA 3BFUA 3O6HA 1MM7A 3H03A 2X26A 4C0RA 3T9UA 3BFTA 1EZ9A 1T0KA 1Y3NA 1Y1MA 4KCDA 2H99A 4NTLA 5H8HB 3V8XB 4LONB 5CBRA 3MPKA 2V84A 5DVFA 4R2FA 4RXLA 5FTIA 2ZXTA 4R75A 2R71A 4ZEBA 4YU0A 3OXNA 4NF5A 5KCJB 1POY1 5CI5A 2F7BA 1XVXA 1A55A 1WVJA 5HBCA 3TCFA 2VOZA 1SDXA 4WKMA 3FXUA 4NWDA 3O6GA 3FXRA 1QUKA 2VD2A 4F3BA 5TPAB 3RLFE 3G3FA 3VV5A 1MXXA 1JVXA 1PEBA 1YPNA 4HCYA 4POXA 3N94A 1VR5A 3O29A 2XXWA 4ISUA 1I6AA 4BDLA 2Y7RA 2D3IA 4HCWA 5CC2A 3MUQA 3E3KA 4YMAA 4C1UA 3K4UA 2Z8DA 2DXRA 4POWA 2DYXA 1GV8A 2F7AA 4HW8A 1PB9A 3C34A 3HSTA 2DSFA 4MH5A 1QJMA 1SQYA 3LSXA 2OLBA 4NWCA 2V3UA 1ZJLA 4NF8A 4BDRA 4GXAA 3PMWA 4K3FA 4LVQA 4XIGQ 3KOTA 3LC8A 4NF5B 1Y3PA 1QVSA 4LZ8A 2R9JA 1B5HA 3Q26A 4OZ9A 1EZOA 2ZYOA 4QFNA 2QS3A 1B7HA 1A99A 2HCAA 3SEWA 4DCXA 2NWJA 4XKNA 1LLSA 3LSFB 3RTFB 3MAMA 1Q35A 5FHNA 3LR1A 2UVIA 4DXUA 4JXIA 3ZKLA 3A3UA 1D9VA 3W15C 4F29A 4TLMB 1B52A 3IOUA 1N04A 3KOSA 3PPPA 4O3BA 1M5EA 1UQWA 3ONMA 1P1OA 3KSJA 4FORA 3UK4A 5I58A 1BKAA 2Z8FA 4OYVA 4IO2A 2H98A 2UXAA 2HFBA 5CM6A 3H6VA 5ITPA 3PPNA 5BUUA 2YJPA 3W9WA 3QUFA 5DYHA 3SEXA 2F5XA 4NF8B 1PC3A 5EHMA 4KYSA 1MH4A 4GWOA 4LZ5A 1OQHA 4MF3A 3O2AA 3RT6B 1MQIA 4RPOA 3TKDA 1SW1A 3WAFA 2YLNA 1NL5A 3MP1A 3FUZA 3TQWA 1JQFA 2VHAA 1US5A 5DVJA 4FATA 2AIXA 2I0CA 1IXGA 4PQJA 1B7UA 4LP2B 1OIBA 3G3IA 5IKBA 1AMFA 3CSGA 2RC9A 3QAXA 3VLUA 3CG3A 3TPAA 2V3TA 3B6TA 2P0SA 2DWHA 2ABHA 5I58B 1ZMGA 5FTHA 4EXKA 1Q1KA 4IO7A 5FHOA 2DS9A 4ELPA 5FHMA 3IO4A 1L5TA 1JEUA 4F18A 3K1MA 3LSLA 1B7ZA 1RYOA 3JV9A 2G93A 4JWXA 3MQ9A 3O6IA 3C9HA 4WEDA 3B6QA 4F1YA 2QPQA 4ESXA 1USYE 4G4PA 2OZZA 2XXRA 4EXLA 1BTJA 4UACA 3T9HB 5M2VA 3K01A 1SW4A 1AL3A 5F7VA 1WODA 3USDA 3G7WA 4YICA 4I62A 4YB5A 5K2YA 1UIUA 1BP5A 1URSA 3TZAA 3CG1A 3HPIA 2DE4A 3A09A 2I48A 1SW5A 1R9QA 2I4BA 4PE5B 1P1UA 3O97A 3WAEA 3TFLA 1AOVA 2F7CA 4YKKA 4QFLA 3CRBA 2RCBA 4IY6A 2UYEA 3SERA 2Q8JA 4NF6A 4ONYA 4QSCA 4GLIA 3K6VA 1H45A 1IXCA 4F3GA 3U8QA 4N07A 1VFDA 5HPQA 2UVJA 2HZLA 3T96B 1QW0A 3T9VA 1JW5A 3HHFA 3PPRA 2B65A 3CR9A 1SI1A 1XC1A 2HEUA 3C32A 1O63A 3PMVA 3KJ7A 2WKYA 3QIMA 4F3PA 2LAOA 5CMCA 1FTLA 4R9GA 3MW0A 3K2DA 2F97A 1M5DA 4ZEFA 3EPEA 1LGBC 4ZZEA 4RK9A 1Y20A 2IA4A 3IJXB 4ZECA 3O9PA 4FEDA 1TFDA 4DIGA 3TEPA 3K00A 1XHYA 1IIWA 5L8DA 1MQJA 3VVFA 3KBRA 4ZEDA 2PT2A 3IK6B 2I3VA 1B46A 3MVZA 5ITOA 2DE2A 4G8HA 3MZ1A 4P0GA 3R6UA 4C1TA 4IB2A 1DMBA 3QSLA 3LBSA 2REGA 4G2ZA 1D4NA 1MDQA 3IB0A 2XXYA 3LSWA 4N13A 2PYYA 4KHZE 3OELA 1SW2A 4NF6B 1N3WA 2DE3A 1UIVA 1MQGA 2DOJA 4RPNA 5CMBA 1FQBA 4JBZA 2I3WA 2XX9A 1MH3A 2DWJA 3RGYA 3OSQA 3QYTA 3KN3A 1WDNA 4KR5A 2P2AA 1TWYA 2XXUA 1OQGA 3N6UA 4M1VA 2Q9TA 2XD2A 3C35A 2O69A 1D3KA 3VVEA 3Q27A 1H43A 2CMOA 4QHQA 3G3JA 2ZMBA 4NF4A 1MRPA 4GFRA 1N7WA 3IO6A 5ELVA 4OEUA 2Z8EA 3Q29A 5ICTA 1A8EA 1B58A 4R73A 4OFOA 3H6TA 3KFMA 2Q2CA 1Y9UA 3CIJA 4EUOA 4IY5A 3UORA 1H3DA 1DTZA 2XXQA 3KG2A 4KYDA 5ICQA 4BDQA 2ZNUA 5L9MA 3TDJA 4OFJA 3R7XA 3T93B 4ECFA 1DPEA 2Y84A 3PPQA 1MG1A 4WEPA 4FAJA 3GBAA 3OSRA 3CFLA 2DWIA 1FTOA 3K6UA 4ZEIA 3UA8A 4U2RA 1LFIA 2ONKE 1MY1A 4DXCA 4AB6A 4HTGA 4G68C 3VLWA 1NH7A 4MBPA 5H8FA 2F8DA 3K6XA 4XKRA 3KEIA 1FTKA 4IO6A 3JYRA 2RC7A 5H8NA 1JVYA 4NF4B 4ELQA 2XXVA 4G8NA 1MPCA 1EH3A 3EHTA 1MXYA 2AL4A 3TAJA 2RF1A 1POTA 2F35A 3G3KA 3CSBA 3RNNA 1VSOA 1J1NA 3IB1A 1N0TA 4ZDMA 2O7IA 1NMUA 3D4CA 2VP1A 1GGGA 1IZ1A 4LQ5A 3RT8A 1QUIA 4LATA 2XHDA 5J1DA 3FD3A 2H25A 1URDA 4GXSB 3MBPA 1N84A 2B3FA 3N6TA 4ZE8A 2BJJX 5KDTA 1JW1A 4U4SA 1FW0A 1LFHA 4RNSA 1N76A 1II5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E0S A;  1Y1Z A;  4IO3 A;  4NE4 A;  3TTL A;  1YTV A;  3EF7 A;  1Y4C A;  1USY H;  3C31 A;  5H8F B;  4XKQ A;  1OLC A;  3IX1 A;  1LAX A;  1B3E A;  1LCF A;  4OEV A;  2O68 A;  4GF8 A;  4F2Q A;  3D4G A;  5H8N B;  1QKA A;  1R9L A;  2Q88 A;  3FIR A;  1YAE A;  2ONR A;  2I0B A;  2VD3 A;  2PX1 A;  3QUJ A;  4KYE A;  1RYX A;  4YMB A;  3OO7 A;  4UA8 A;  1Z7M E;  4H67 A;  4F2O A;  5I59 A;  2A5T A;  1IXH A;  2PVU A;  3PD9 A;  1JNF A;  5AA4 A;  3C33 A;  4PP0 A;  2W7Y A;  1LB9 A;  3U94 A;  5EHS A;  3IB2 A;  1ANF A;  3UP9 A;  3PUX E;  2RC8 A;  4RYA A;  4X1D A;  1B6H A;  3M3F A;  4X1B A;  1ZIU A;  5KDT B;  1ZKB A;  2QMX A;  1ELJ A;  3TQL A;  5CMK A;  4IO4 A;  4XKP A;  5A5X A;  3CFX A;  4H6D A;  3H6W A;  4QSE A;  3FVO A;  4ND9 A;  4H0W A;  2PMS A;  4BDM A;  1IEJ A;  2E1S A;  2M8C A;  3F11 A;  4FEC A;  3SES A;  3MWB A;  4PFU A;  2DXY A;  3ILT B;  1XVY A;  4EQ7 A;  2ZYN A;  4YKP A;  1IXI A;  3K6W A;  1FQD A;  4G68 A;  3U1O A;  4KD5 A;  1MXW A;  2Q89 A;  3HV1 A;  3U93 A;  1B4H A;  1VE4 A;  1AIV A;  1FTJ A;  2QRY A;  4QRZ A;  2GFE A;  1TT1 A;  2I58 A;  1N3X A;  1IUD A;  3IOW A;  3OO9 A;  1FQE A;  5I59 B;  4QFK A;  3S9L C;  2A5T B;  2F36 A;  3A3C A;  5AA4 B;  2I4C A;  1HSJ A;  4OQO A;  2OWS A;  4FE8 A;  3ZS6 A;  4IGR A;  3TTK A;  4R2B A;  2UVG A;  4F1V A;  2V3Q A;  3DLN A;  3CI8 A;  1TFA A;  1MM6 A;  3IR1 A;  1YCJ A;  2D21 A;  3T22 A;  1LAH E;  5A5X B;  4ELO A;  1H44 A;  4U4X A;  1FQA A;  2QS1 A;  1B3L A;  1P99 A;  4ESW A;  1O64 A;  3HHG A;  3L6H A;  1LFG A;  1SI0 A;  1NNK A;  3MPL A;  3TTM A;  1MXV A;  3I5O A;  2REJ A;  4FEB A;  5K2X A;  5EYF A;  2OCU A;  3S9M C;  2IEE A;  3MJN A;  4GL0 A;  3FVN A;  1HSL A;  1NNT A;  4H5F A;  2GHB A;  3VE1 B;  4JWO A;  4G68 B;  4Z0I A;  4ZZA A;  3TYH A;  3I6V A;  5I2K A;  1MY3 A;  3H4Z A;  3PU5 A;  4ZE9 A;  5L9O A;  3MVW A;  5H8Q A;  4GD5 A;  4QFO A;  1CB6 A;  2O7U A;  1MPB A;  2RKM A;  3B6W A;  4XXU A;  3OO8 A;  3RUM A;  1B4Z A;  1ATG A;  3DM0 A;  4Q30 B;  1FTM A;  1R6Z A;  3TCG A;  1XOC A;  3OEM A;  2XX7 A;  2P1S A;  1OMP A;  3FAT A;  3VXB A;  2CZL A;  3OD7 A;  1XS5 A;  1OVT A;  1P1N A;  2O84 X;  4U23 A;  1LAG E;  2XXX A;  1A8F A;  2X7P A;  1ZU0 A;  1A7L A;  2H4I A;  4WXJ A;  2Y7W A;  1BLF A;  2ZYK A;  4OWD A;  1JET A;  5JK4 A;  2GHA A;  1DOT A;  3OOA A;  4QFP A;  1P1Q A;  1MY4 A;  2GH9 A;  3M8U A;  5DVI A;  4QF9 A;  5ISU A;  5I56 A;  5AA3 A;  2AL5 A;  3GXA A;  4QSD A;  2I6E A;  1LST A;  5I2K B;  3KSX A;  4F19 A;  1EZP A;  1DPP A;  3E4R A;  5H8Q B;  4M4G A;  3ZSF A;  1O7T A;  4MLV A;  3N26 A;  3EHS A;  2DVC A;  1Z7N E;  1B9J A;  2VGQ A;  4U1Z A;  1QKB A;  4I1D A;  1URG A;  4H65 A;  2UYF A;  4FIM A;  4JSD A;  4N6P A;  2Y7I A;  1B3H A;  4RK2 A;  3G3H A;  1SVX B;  1LB8 A;  2XXP A;  2DWA A;  2OJT A;  2X7Q A;  2UVH A;  1NH8 A;  3KN8 A;  1B1X A;  2THI A;  1GR2 A;  4PFT A;  1XT8 A;  2ALU A;  3HN0 A;  3SKP A;  1MXU A;  3PD8 A;  2V25 A;  3IOV A;  3THI A;  2DQV A;  3OO6 A;  3PPO A;  2OBG A;  3MVX A;  4LZ7 A;  4ZS9 A;  4RA1 A;  1FQF A;  1MY2 A;  4I9D A;  1B3F A;  2ANJ A;  3GBB A;  4DE8 A;  4ZEK A;  4R6K A;  5I56 B;  3PGF A;  3CVG A;  3VXC A;  4DCY A;  1ZLQ A;  1QUL A;  1B5I A;  3I3V A;  4NMY A;  2XXT A;  3KJT A;  4BDN A;  3PUV E;  3OMB A;  2XX8 A;  1F9B A;  3PV0 E;  2GRV A;  2DP8 A;  2PT1 A;  5TU0 A;  1M5B A;  3MZB A;  3K1P A;  3G3G A;  3Q25 A;  4PFY A;  3FGS A;  4JWY A;  4PET A;  3U72 A;  2DVZ A;  3QK6 A;  3TOD A;  1MDP 1;  3H3G A;  3ODB A;  3B7D A;  1KWH A;  5AA1 A;  4R6H A;  3EQ1 A;  4Q0C A;  2Y7P A;  5DEX A;  3MP8 A;  1UTH A;  3TTR A;  2ZNS A;  1NNP A;  3S9N C;  2O51 A;  1I6B A;  3UN6 A;  2FNC A;  3OEN A;  3TMG A;  1P1W A;  3H6U A;  3ECR A;  3UIF A;  3VVD A;  3VDF A;  3IL1 B;  2ESN A;  3FZV A;  4R72 A;  3C36 A;  3C4M A;  1RKM A;  4YZZ A;  3KZG A;  5I2N A;  4OER A;  4L17 A;  3FJ7 A;  4JDF A;  1MS7 A;  4TOZ A;  4F3S A;  3BBR A;  1A40 A;  1MPD A;  2F78 A;  4O3A A;  4DDD A;  1MY0 A;  2H9B A;  4TLL B;  5HM4 B;  1UTB A;  2Z22 A;  3ILU B;  4MLQ A;  4YKI A;  3DP4 A;  5TP9 A;  3PUY E;  4FJP A;  1Y3Q A;  3PUZ E;  4THI A;  2I49 A;  3V5A A;  4GVO A;  2V93 A;  3ZKK A;  2HAU A;  1CE2 A;  2O1M A;  3CFZ A;  3RY3 A;  2PBW A;  3N5L A;  2FA7 A;  1B05 A;  4P0I A;  5I84 A;  1B2H A;  1B51 A;  4YB7 A;  1M5C A;  3PMX A;  4E0W A;  2ZYM A;  1S50 A;  5DEX B;  4G8M A;  4KCC A;  2HXW A;  4JSO A;  1UTH B;  3DP6 A;  2F6P A;  3M3K A;  3IJO B;  4AQ4 A;  4ELR A;  3BKI B;  4X9T A;  5F1Q A;  5CRY A;  1SYH A;  3EN3 A;  3E13 X;  4F1U A;  4IGT A;  1MXZ A;  5I2N B;  4P11 A;  4OMB A;  3K02 A;  1VFE A;  4U21 A;  2QJE A;  1N7X A;  3KN7 A;  3RN8 A;  2NXO A;  3V89 B;  3TCH A;  1UTB B;  1DSN A;  5DT6 A;  1H76 A;  5B70 A;  2B3B A;  3K0V A;  2XD3 A;  3M3L A;  4OET A;  3FJM A;  5TP9 B;  4OHN A;  1NFT A;  2Y7K A;  3K1N A;  3O66 A;  3HCQ A;  3MP6 A;  1IQ7 A;  4R9F A;  5JEI A;  2RIN A;  3AXF A;  1B32 A;  3LUY A;  4LQ2 A;  5IAI A;  4EQ9 A;  4GRK A;  4H5G A;  4GIZ A;  3MZ9 A;  2OWT A;  4F39 A;  3MVY A;  1JEV A;  3SEY A;  4I8C A;  1S7Y A;  4OFL A;  2QSX A;  1LAF E;  5H8S A;  3S2V A;  4MFI A;  4PFW A;  3TEL A;  2H5Y A;  2F6G A;  3T66 A;  3V83 A;  3FV1 A;  3DP8 A;  5AA2 D;  3P7I A;  1MQH A;  2Q2A A;  5CMM A;  5I57 A;  1IIT A;  2NOO A;  3Q28 A;  1PBQ A;  1B5J A;  1PB7 A;  4DZ1 A;  5L9S A;  2A5S A;  3S9E A;  5AA2 A;  4R74 A;  5KZT A;  4H8J A;  4Z7E A;  4OEN A;  4KFQ A;  3TUS A;  1TXF A;  3JZJ A;  4OTE A;  4KPT A;  1EU8 A;  1A54 A;  2QMW A;  4OES A;  1NKX A;  4LUB A;  3R26 A;  3OEK A;  1FQC A;  3RPW A;  5AE4 A;  3IAZ A;  4F22 A;  4RJZ A;  1PB8 A;  2ZNT A;  3TTN A;  3O28 A;  1HSE A;  2OK2 A;  4GL8 A;  4U22 A;  2KLF A;  3T9X B;  1DTG A;  3GLB A;  3VLV A;  2Z23 A;  3KGC A;  3FV2 A;  3W9V A;  2HAV A;  1OVB A;  5JTY A;  1LBB A;  4HS7 A;  2NVU B;  3QXM A;  4Q8R A;  1BIY A;  1OLA A;  1D9Y A;  3SET A;  4Q5T A;  2AYS A;  1B40 A;  3DEL B;  4LA9 A;  4OVJ A;  3IOT A;  1B0H A;  1LBC A;  4JB7 A;  4F31 B;  4E0X A;  4DLD A;  5I57 B;  5LOM A;  2D5W A;  2F34 A;  2O1L A;  1NNF A;  2QS4 A;  1US4 A;  5AA2 B;  3H7M A;  4NED A;  4TQU Q;  2HQ0 A;  3FVK A;  1LCT A;  4DXB A;  3GZG A;  4YAH X;  1MQD A;  2QL3 A;  2R6G E;  4YKJ A;  3S4U A;  4EF2 A;  1Y4T A;  2ONS A;  3H06 B;  1GTK A;  1I6Q A;  1I69 A;  4H8I A;  3E9X A;  3FVG A;  1SBP A;  3L6G A;  3RQT A;  1JW4 A;  4KQP A;  2HZK A;  4R6Y A;  5H8H A;  4BLA A;  4EF1 A;  1SYI A;  1PBP A;  4XTC Q;  3MC2 A;  3IOR A;  4GOT A;  2O6A A;  3FJG A;  2RCA A;  1R1N A;  1FCK A;  3FXQ A;  4X48 A;  1PDA A;  4EQB A;  3FAS A;  4G77 A;  4KI0 E;  1S9T A;  1M5F A;  4GQO A;  5KCJ A;  3RTW B;  5B7D A;  4AB5 A;  1ZBM A;  2QS2 A;  4RY1 A;  2NUV A;  5JTY B;  2XXH A;  3PUW E;  2G29 A;  3UGW A;  4BDO A;  3VFJ A;  3HO7 A;  1SD3 A;  4EDP A;  1GVC A;  5TPA A;  4O3C A;  2XXI A;  2YPN A;  2FYI A;  1ZTY A;  3U92 A;  4H1X A;  5DTB A;  3EHU A;  5CBS A;  4U1O A;  3SDF A;  4IO5 A;  5BWJ A;  3SEV A;  1AH5 A;  1B0L A;  1B1H A;  1B3G A;  4YB6 A;  3SEU A;  1QUJ A;  4OXV A;  3BFU A;  3O6H A;  1MM7 A;  3H03 A;  2X26 A;  4C0R A;  3T9U A;  3BFT A;  1EZ9 A;  1T0K A;  1Y3N A;  1Y1M A;  4KCD A;  2H99 A;  4NTL A;  5H8H B;  3V8X B;  4LON B;  5CBR A;  3MPK A;  2V84 A;  5DVF A;  4R2F A;  4RXL A;  5FTI A;  2ZXT A;  4R75 A;  2R71 A;  4ZEB A;  4YU0 A;  3OXN A;  4NF5 A;  5KCJ B;  1POY 1;  5CI5 A;  2F7B A;  1XVX A;  1A55 A;  1WVJ A;  5HBC A;  3TCF A;  2VOZ A;  1SDX A;  4WKM A;  3FXU A;  4NWD A;  3O6G A;  3FXR A;  1QUK A;  2VD2 A;  4F3B A;  5TPA B;  3RLF E;  3G3F A;  3VV5 A;  1MXX A;  1JVX A;  1PEB A;  1YPN A;  4HCY A;  4POX A;  3N94 A;  1VR5 A;  3O29 A;  2XXW A;  4ISU A;  1I6A A;  4BDL A;  2Y7R A;  2D3I A;  4HCW A;  5CC2 A;  3MUQ A;  3E3K A;  4YMA A;  4C1U A;  3K4U A;  2Z8D A;  2DXR A;  4POW A;  2DYX A;  1GV8 A;  2F7A A;  4HW8 A;  1PB9 A;  3C34 A;  3HST A;  2DSF A;  4MH5 A;  1QJM A;  1SQY A;  3LSX A;  2OLB A;  4NWC A;  2V3U A;  1ZJL A;  4NF8 A;  4BDR A;  4GXA A;  3PMW A;  4K3F A;  4LVQ A;  4XIG Q;  3KOT A;  3LC8 A;  4NF5 B;  1Y3P A;  1QVS A;  4LZ8 A;  2R9J A;  1B5H A;  3Q26 A;  4OZ9 A;  1EZO A;  2ZYO A;  4QFN A;  2QS3 A;  1B7H A;  1A99 A;  2HCA A;  3SEW A;  4DCX A;  2NWJ A;  4XKN A;  1LLS A;  3LSF B;  3RTF B;  3MAM A;  1Q35 A;  5FHN A;  3LR1 A;  2UVI A;  4DXU A;  4JXI A;  3ZKL A;  3A3U A;  1D9V A;  3W15 C;  4F29 A;  4TLM B;  1B52 A;  3IOU A;  1N04 A;  3KOS A;  3PPP A;  4O3B A;  1M5E A;  1UQW A;  3ONM A;  1P1O A;  3KSJ A;  4FOR A;  3UK4 A;  5I58 A;  1BKA A;  2Z8F A;  4OYV A;  4IO2 A;  2H98 A;  2UXA A;  2HFB A;  5CM6 A;  3H6V A;  5ITP A;  3PPN A;  5BUU A;  2YJP A;  3W9W A;  3QUF A;  5DYH A;  3SEX A;  2F5X A;  4NF8 B;  1PC3 A;  5EHM A;  4KYS A;  1MH4 A;  4GWO A;  4LZ5 A;  1OQH A;  4MF3 A;  3O2A A;  3RT6 B;  1MQI A;  4RPO A;  3TKD A;  1SW1 A;  3WAF A;  2YLN A;  1NL5 A;  3MP1 A;  3FUZ A;  3TQW A;  1JQF A;  2VHA A;  1US5 A;  5DVJ A;  4FAT A;  2AIX A;  2I0C A;  1IXG A;  4PQJ A;  1B7U A;  4LP2 B;  1OIB A;  3G3I A;  5IKB A;  1AMF A;  3CSG A;  2RC9 A;  3QAX A;  3VLU A;  3CG3 A;  3TPA A;  2V3T A;  3B6T A;  2P0S A;  2DWH A;  2ABH A;  5I58 B;  1ZMG A;  5FTH A;  4EXK A;  1Q1K A;  4IO7 A;  5FHO A;  2DS9 A;  4ELP A;  5FHM A;  3IO4 A;  1L5T A;  1JEU A;  4F18 A;  3K1M A;  3LSL A;  1B7Z A;  1RYO A;  3JV9 A;  2G93 A;  4JWX A;  3MQ9 A;  3O6I A;  3C9H A;  4WED A;  3B6Q A;  4F1Y A;  2QPQ A;  4ESX A;  1USY E;  4G4P A;  2OZZ A;  2XXR A;  4EXL A;  1BTJ A;  4UAC A;  3T9H B;  5M2V A;  3K01 A;  1SW4 A;  1AL3 A;  5F7V A;  1WOD A;  3USD A;  3G7W A;  4YIC A;  4I62 A;  4YB5 A;  5K2Y A;  1UIU A;  1BP5 A;  1URS A;  3TZA A;  3CG1 A;  3HPI A;  2DE4 A;  3A09 A;  2I48 A;  1SW5 A;  1R9Q A;  2I4B A;  4PE5 B;  1P1U A;  3O97 A;  3WAE A;  3TFL A;  1AOV A;  2F7C A;  4YKK A;  4QFL A;  3CRB A;  2RCB A;  4IY6 A;  2UYE A;  3SER A;  2Q8J A;  4NF6 A;  4ONY A;  4QSC A;  4GLI A;  3K6V A;  1H45 A;  1IXC A;  4F3G A;  3U8Q A;  4N07 A;  1VFD A;  5HPQ A;  2UVJ A;  2HZL A;  3T96 B;  1QW0 A;  3T9V A;  1JW5 A;  3HHF A;  3PPR A;  2B65 A;  3CR9 A;  1SI1 A;  1XC1 A;  2HEU A;  3C32 A;  1O63 A;  3PMV A;  3KJ7 A;  2WKY A;  3QIM A;  4F3P A;  2LAO A;  5CMC A;  1FTL A;  4R9G A;  3MW0 A;  3K2D A;  2F97 A;  1M5D A;  4ZEF A;  3EPE A;  1LGB C;  4ZZE A;  4RK9 A;  1Y20 A;  2IA4 A;  3IJX B;  4ZEC A;  3O9P A;  4FED A;  1TFD A;  4DIG A;  3TEP A;  3K00 A;  1XHY A;  1IIW A;  5L8D A;  1MQJ A;  3VVF A;  3KBR A;  4ZED A;  2PT2 A;  3IK6 B;  2I3V A;  1B46 A;  3MVZ A;  5ITO A;  2DE2 A;  4G8H A;  3MZ1 A;  4P0G A;  3R6U A;  4C1T A;  4IB2 A;  1DMB A;  3QSL A;  3LBS A;  2REG A;  4G2Z A;  1D4N A;  1MDQ A;  3IB0 A;  2XXY A;  3LSW A;  4N13 A;  2PYY A;  4KHZ E;  3OEL A;  1SW2 A;  4NF6 B;  1N3W A;  2DE3 A;  1UIV A;  1MQG A;  2DOJ A;  4RPN A;  5CMB A;  1FQB A;  4JBZ A;  2I3W A;  2XX9 A;  1MH3 A;  2DWJ A;  3RGY A;  3OSQ A;  3QYT A;  3KN3 A;  1WDN A;  4KR5 A;  2P2A A;  1TWY A;  2XXU A;  1OQG A;  3N6U A;  4M1V A;  2Q9T A;  2XD2 A;  3C35 A;  2O69 A;  1D3K A;  3VVE A;  3Q27 A;  1H43 A;  2CMO A;  4QHQ A;  3G3J A;  2ZMB A;  4NF4 A;  1MRP A;  4GFR A;  1N7W A;  3IO6 A;  5ELV A;  4OEU A;  2Z8E A;  3Q29 A;  5ICT A;  1A8E A;  1B58 A;  4R73 A;  4OFO A;  3H6T A;  3KFM A;  2Q2C A;  1Y9U A;  3CIJ A;  4EUO A;  4IY5 A;  3UOR A;  1H3D A;  1DTZ A;  2XXQ A;  3KG2 A;  4KYD A;  5ICQ A;  4BDQ A;  2ZNU A;  5L9M A;  3TDJ A;  4OFJ A;  3R7X A;  3T93 B;  4ECF A;  1DPE A;  2Y84 A;  3PPQ A;  1MG1 A;  4WEP A;  4FAJ A;  3GBA A;  3OSR A;  3CFL A;  2DWI A;  1FTO A;  3K6U A;  4ZEI A;  3UA8 A;  4U2R A;  1LFI A;  2ONK E;  1MY1 A;  4DXC A;  4AB6 A;  4HTG A;  4G68 C;  3VLW A;  1NH7 A;  4MBP A;  5H8F A;  2F8D A;  3K6X A;  4XKR A;  3KEI A;  1FTK A;  4IO6 A;  3JYR A;  2RC7 A;  5H8N A;  1JVY A;  4NF4 B;  4ELQ A;  2XXV A;  4G8N A;  1MPC A;  1EH3 A;  3EHT A;  1MXY A;  2AL4 A;  3TAJ A;  2RF1 A;  1POT A;  2F35 A;  3G3K A;  3CSB A;  3RNN A;  1VSO A;  1J1N A;  3IB1 A;  1N0T A;  4ZDM A;  2O7I A;  1NMU A;  3D4C A;  2VP1 A;  1GGG A;  1IZ1 A;  4LQ5 A;  3RT8 A;  1QUI A;  4LAT A;  2XHD A;  5J1D A;  3FD3 A;  2H25 A;  1URD A;  4GXS B;  3MBP A;  1N84 A;  2B3F A;  3N6T A;  4ZE8 A;  2BJJ X;  5KDT A;  1JW1 A;  4U4S A;  1FW0 A;  1LFH A;  4RNS A;  1N76 A;  1II5 A; 
#chains in the Genus database with same CATH topology
 2KQZ A;  2B4L A;  4N8G A;  2E0S A;  1Y1Z A;  4IO3 A;  4NE4 A;  4NG7 A;  3TTL A;  1YTV A;  3EF7 A;  1Y4C A;  1USY H;  3C31 A;  5H8F B;  4XKQ A;  1OLC A;  3IX1 A;  1LAX A;  1B3E A;  1VDW A;  1LCF A;  4OEV A;  2O68 A;  4GF8 A;  4F2Q A;  1NUX A;  3D4G A;  5H8N B;  1QKA A;  1R9L A;  4O7M A;  2Q88 A;  3FIR A;  1YAE A;  2ONR A;  2I0B A;  2VD3 A;  2PX1 A;  3QUJ A;  4KYE A;  5I5P A;  1RYX A;  4YMB A;  3OO7 A;  4UA8 A;  1NV1 A;  1Z7M E;  4H67 A;  4F2O A;  1YYZ A;  5I59 A;  2A5T A;  1IXH A;  2PVU A;  3PD9 A;  1JNF A;  5AA4 A;  3C33 A;  4PP0 A;  2W7Y A;  1LB9 A;  3U94 A;  5EHS A;  3IB2 A;  1ANF A;  4PAK A;  2FIX A;  3UP9 A;  3PUX E;  2RC8 A;  4RYA A;  4X1D A;  1B6H A;  3M3F A;  4X1B A;  2XWO A;  1ZIU A;  5KDT B;  1ZKB A;  2QMX A;  1ELJ A;  3TQL A;  5CMK A;  4IO4 A;  4XKP A;  5A5X A;  3CFX A;  1IME A;  4H6D A;  3H6W A;  4PF8 A;  4QSE A;  3FVO A;  5FBP A;  4ND9 A;  4H0W A;  2PMS A;  4BDM A;  1IEJ A;  2E1S A;  5F24 A;  2M8C A;  2CEX A;  3F11 A;  4MHF A;  4FEC A;  3SES A;  2FVZ A;  3MWB A;  4PFU A;  2DXY A;  3ILT B;  1XVY A;  4EQ7 A;  2ZYN A;  4YKP A;  1IXI A;  3K6W A;  1FQD A;  4G68 A;  3U1O A;  4KD5 A;  1MXW A;  2KR0 A;  2Q89 A;  3HV1 A;  3U93 A;  1B4H A;  4QBA A;  1VE4 A;  1AIV A;  1QGX A;  1FTJ A;  2QRY A;  4QRZ A;  2GFE A;  1FBG A;  1TT1 A;  2I58 A;  1N3X A;  1IUD A;  3IOW A;  3OO9 A;  1FQE A;  5I59 B;  4QFK A;  3S9L C;  2A5T B;  3KBZ A;  2F36 A;  3A3C A;  2Q8M A;  5AA4 B;  2I4C A;  4O94 A;  1HSJ A;  4OQO A;  2OWS A;  4FE8 A;  3ZS6 A;  4OVT A;  4IGR A;  3TTK A;  4R2B A;  2UVG A;  4F1V A;  2V3Q A;  3DLN A;  3CI8 A;  1TFA A;  2F3D A;  1MM6 A;  3IR1 A;  1YCJ A;  3B8B A;  2D21 A;  3T22 A;  3CHG A;  1LAH E;  5J16 A;  5A5X B;  4ELO A;  1H44 A;  4U4X A;  1FQA A;  2QS1 A;  5IZZ A;  1B3L A;  1FPJ A;  1P99 A;  4ESW A;  3FXB A;  1O64 A;  3HHG A;  3L6H A;  1LFG A;  1SI0 A;  1NNK A;  3EKI A;  3MPL A;  3TTM A;  1MXV A;  3I5O A;  2XWK A;  2REJ A;  4FEB A;  5K2X A;  5EYF A;  2OCU A;  3S9M C;  2IEE A;  3MJN A;  4GL0 A;  3FVN A;  1HSL A;  1NNT A;  4H5F A;  2GHB A;  3VE1 B;  4JWO A;  3A29 A;  4G68 B;  4Z0I A;  4ZZA A;  3TYH A;  1FPI A;  3I6V A;  5I2K A;  1MY3 A;  3H4Z A;  3PU5 A;  4ZE9 A;  5ET8 A;  5L9O A;  3MVW A;  5H8Q A;  4GD5 A;  4QFO A;  4DI4 B;  1CB6 A;  2O7U A;  1MPB A;  2RKM A;  3B6W A;  4XXU A;  3OO8 A;  3RUM A;  1B4Z A;  4Q30 B;  1ATG A;  3DM0 A;  1FTM A;  2F3B A;  4GWW A;  4O8M A;  1R6Z A;  3TCG A;  2VPO A;  1XOC A;  3OEM A;  2XX7 A;  2P1S A;  4OVP A;  1OMP A;  3FAT A;  3VXB A;  2CZL A;  3OD7 A;  1XS5 A;  4P1L A;  1OVT A;  1P1N A;  2O84 X;  1IMF A;  4U23 A;  1LAG E;  2XXX A;  1A8F A;  2X7P A;  1ZU0 A;  4PC9 A;  1A7L A;  5EYH A;  2H4I A;  4WXJ A;  2Y7W A;  1BLF A;  2ZYK A;  4OWD A;  1JET A;  5JK4 A;  2VPN A;  4MMP A;  2GHA A;  3QMF A;  1DOT A;  3OOA A;  4QFP A;  1P1Q A;  1MY4 A;  2GH9 A;  3M8U A;  4PFB A;  5DVI A;  4QF9 A;  1LBX A;  3BIH A;  3RYD A;  5ISU A;  4G61 A;  5I56 A;  5AA3 A;  4XFE A;  2AL5 A;  3GXA A;  4QSD A;  2I6E A;  1LST A;  5I2K B;  3KSX A;  5A5L A;  4F19 A;  1EZP A;  1DPP A;  3E4R A;  5H8Q B;  3ROJ A;  4M4G A;  3ZSF A;  1FBE A;  1O7T A;  4MLV A;  3N26 A;  4GBW A;  3EHS A;  2DVC A;  1Z7N E;  1B9J A;  2VGQ A;  4U1Z A;  1QKB A;  3SZP A;  4I1D A;  1URG A;  4H65 A;  2UYF A;  1IMB A;  4FIM A;  4JSD A;  4N6P A;  2Y7I A;  1B3H A;  4RK2 A;  3G3H A;  1SVX B;  1LB8 A;  4N6K A;  2XXP A;  2DWA A;  2OJT A;  2X7Q A;  2FBP A;  2UVH A;  1NH8 A;  2QFL A;  3KN8 A;  1B1X A;  2THI A;  1GR2 A;  4PFT A;  1XT8 A;  2ALU A;  3HN0 A;  3SKP A;  1MXU A;  3PD8 A;  2V25 A;  4OAN A;  3IOV A;  3THI A;  2DQV A;  3OO6 A;  3PPO A;  4P9K A;  4GWY A;  2OBG A;  1FBF A;  3MVX A;  4LZ7 A;  1NV0 A;  4ZS9 A;  2MKZ A;  4JVD A;  4RA1 A;  1FQF A;  1MY2 A;  4I9D A;  1B3F A;  2ANJ A;  3GBB A;  4DE8 A;  4PGN A;  4ZEK A;  4R6K A;  5I56 B;  3PGF A;  3CVG A;  3VXC A;  4H46 A;  4DCY A;  1FBP A;  1FJ6 A;  1ZLQ A;  1QUL A;  1B5I A;  3I3V A;  4NMY A;  2XXT A;  3KJT A;  4BDN A;  3PUV E;  3OMB A;  2XX8 A;  1F9B A;  3PV0 E;  2GRV A;  2DP8 A;  2PT1 A;  5TU0 A;  1M5B A;  3MZB A;  3K1P A;  4PBH A;  3G3G A;  3Q25 A;  3GYY A;  4PFY A;  3FGS A;  4JWY A;  4PET A;  3IFA A;  3U72 A;  2DVZ A;  3QK6 A;  3TOD A;  1MDP 1;  2OWZ A;  3H3G A;  3ODB A;  3B7D A;  1KWH A;  4HE0 A;  5AA1 A;  4R6H A;  3EQ1 A;  4Q0C A;  2Y7P A;  5DEX A;  3MP8 A;  1UTH A;  3TTR A;  2ZNS A;  1SPI A;  2ZZW A;  1NNP A;  3S9N C;  2O51 A;  1I6B A;  3UN6 A;  2FNC A;  3OEN A;  3TMG A;  1P1W A;  3H6U A;  3ECR A;  3UIF A;  3VVD A;  3VDF A;  3IL1 B;  1EYI A;  2ESN A;  3FZV A;  4R72 A;  3C36 A;  3C4M A;  1RKM A;  4YZZ A;  1FPF A;  3KZG A;  5I2N A;  4OER A;  1EYJ A;  4L17 A;  3FJ7 A;  4JDF A;  1MS7 A;  2WBD A;  4TOZ A;  4F3S A;  4GWS A;  5IZ3 A;  3BBR A;  1A40 A;  1MPD A;  2F78 A;  4O3A A;  4DDD A;  1MY0 A;  2H9B A;  4TLL B;  5HM4 B;  1UTB A;  2Z22 A;  3ILU B;  4MLQ A;  4YKI A;  3DP4 A;  5TP9 A;  4IR8 A;  3PUY E;  4FJP A;  1Y3Q A;  3PUZ E;  4THI A;  2I49 A;  3V5A A;  4GVO A;  4JVI A;  4X8R A;  2WYK A;  2V93 A;  3ZKK A;  2HAU A;  1CE2 A;  2O1M A;  3CFZ A;  5IZ1 A;  4NAP A;  3RY3 A;  2PBW A;  3N5L A;  2FA7 A;  1B05 A;  4P0I A;  5I84 A;  4PFR A;  5IGA A;  1B2H A;  1NV4 A;  1B51 A;  4YB7 A;  1M5C A;  3PMX A;  4E0W A;  3KC0 A;  4N6D A;  2ZYM A;  1S50 A;  5DEX B;  4G8M A;  4KCC A;  2HXW A;  4JSO A;  1UTH B;  4NF0 A;  3DP6 A;  2F6P A;  3M3K A;  2P3V A;  3IJO B;  4AQ4 A;  4ELR A;  4N15 A;  3BKI B;  4X9T A;  5F1Q A;  5CRY A;  1SYH A;  3EN3 A;  3E13 X;  3LUZ A;  4F1U A;  4IGT A;  1MXZ A;  5I2N B;  4P3L A;  4P11 A;  4OMB A;  3K02 A;  1VFE A;  4U21 A;  2QJE A;  5IZ3 B;  1N7X A;  3KN7 A;  4I40 A;  3RN8 A;  2NXO A;  3V89 B;  3TCH A;  4GWX A;  1K9Z A;  1UTB B;  1DSN A;  5DT6 A;  1H76 A;  5B70 A;  2B3B A;  2P3N A;  3K0V A;  2QVR A;  1FBH A;  2JJK A;  4OET A;  2XD3 A;  3M3L A;  3FJM A;  5TP9 B;  4OHN A;  1NFT A;  2Y7K A;  2WBB A;  3K1N A;  3O66 A;  3HCQ A;  3MP6 A;  1IQ7 A;  4R9F A;  5JEI A;  4LN5 A;  2RIN A;  3AXF A;  1B32 A;  1XI6 A;  3LUY A;  4LQ2 A;  5IAI A;  4EQ9 A;  4GRK A;  1DK4 A;  4GIZ A;  3MZ9 A;  4H5G A;  2OWT A;  4F39 A;  3MVY A;  1JEV A;  3SEY A;  4I8C A;  1S7Y A;  4OFL A;  2QSX A;  1LAF E;  5H8S A;  1DBZ A;  1FPB A;  3S2V A;  4MFI A;  4PFW A;  2Y5K A;  3TEL A;  2H5Y A;  2F6G A;  3T66 A;  3V83 A;  3FV1 A;  3DP8 A;  5AA2 D;  3P7I A;  1MQH A;  2Q2A A;  5CMM A;  5I57 A;  2R8T A;  3B50 A;  1IIT A;  2L5V A;  2NOO A;  3Q28 A;  1PBQ A;  1B5J A;  1PB7 A;  4DZ1 A;  5L9S A;  5ET6 A;  2A5S A;  3S9E A;  5AA2 A;  4R74 A;  5KZT A;  4H8J A;  1K9Y A;  2PFY A;  4Z7E A;  4OVQ A;  4OEN A;  4KFQ A;  3TUS A;  1TXF A;  3JZJ A;  5T3J A;  4OTE A;  2Q74 A;  4KPT A;  1EU8 A;  1A54 A;  4NX1 A;  2QMW A;  4OES A;  4I3E A;  1NKX A;  4LUB A;  3R26 A;  3OEK A;  1FQC A;  3RPW A;  5AE4 A;  3IAZ A;  4F22 A;  4RJZ A;  1PB8 A;  2ZNT A;  3TTN A;  3O28 A;  1HSE A;  2OK2 A;  4AS5 A;  4GL8 A;  4U22 A;  2KLF A;  3T9X B;  1DTG A;  3GLB A;  3VLV A;  2Z23 A;  3KGC A;  1NI9 A;  3FV2 A;  4PTK A;  3W9V A;  2HAV A;  1OVB A;  5JTY A;  1LBB A;  4HS7 A;  3D1R A;  2NVU B;  3QXM A;  1NUY A;  4Q8R A;  1BIY A;  1OLA A;  1D9Y A;  3SET A;  4Q5T A;  2AYS A;  1B40 A;  3DEL B;  4LA9 A;  4OVJ A;  3IOT A;  1B0H A;  1LBC A;  4JB7 A;  4F31 B;  4E0X A;  4DLD A;  5I57 B;  5EQA A;  5LOM A;  1Q9D A;  2D5W A;  2F34 A;  2O1L A;  1NNF A;  1NUZ A;  2QS4 A;  4P56 A;  1US4 A;  1NV3 A;  5AA2 B;  3H7M A;  4NED A;  4TQU Q;  1LBV A;  2HQ0 A;  1EYK A;  2WYP A;  1FTA A;  1KA0 A;  3FVK A;  1LCT A;  2XWV A;  1D9Q A;  4DXB A;  3GZG A;  4YAH X;  1MQD A;  2QL3 A;  2R6G E;  4YKJ A;  3S4U A;  4EF2 A;  1Y4T A;  2ONS A;  3H06 B;  1GTK A;  1I6Q A;  4MNI A;  1I69 A;  4H8I A;  3E9X A;  3FVG A;  1SBP A;  4PE3 A;  3L6G A;  3RQT A;  1JW4 A;  4KQP A;  2HZK A;  4R6Y A;  5H8H A;  4BLA A;  4EF1 A;  2OX3 A;  1SYI A;  1PBP A;  3BIG A;  4XTC Q;  3MC2 A;  3IOR A;  3LV0 A;  2GQ1 A;  2O6A A;  1FSA A;  4GOT A;  3FJG A;  4N8Y A;  2RCA A;  1R1N A;  1FCK A;  2VT5 A;  1LEV A;  4NGU A;  3FXQ A;  4X48 A;  1PDA A;  4EQB A;  3FAS A;  4G77 A;  4KI0 E;  1S9T A;  1M5F A;  4GQO A;  5KCJ A;  3RTW B;  5B7D A;  4AB5 A;  1ZBM A;  2QS2 A;  4RY1 A;  2NUV A;  5JTY B;  2XXH A;  1NV5 A;  3ISP A;  3PUW E;  4FBP A;  2G29 A;  4HE2 A;  3UGW A;  1IMA A;  2ZZV A;  4BDO A;  3VFJ A;  3HO7 A;  1SD3 A;  4EDP A;  1GVC A;  5TPA A;  4O3C A;  2XXI A;  2YPN A;  2FYI A;  1ZTY A;  3U92 A;  4H1X A;  5DTB A;  3EHU A;  5EQ7 A;  5CBS A;  4U1O A;  3SDF A;  4HE1 A;  4IO5 A;  5BWJ A;  4PFI A;  3SEV A;  1AH5 A;  1AWB A;  1B0L A;  1G0I A;  1B1H A;  4AS4 A;  1B3G A;  4YB6 A;  3SEU A;  1QUJ A;  4MAG A;  4OXV A;  4PCD A;  3BFU A;  3O6H A;  1MM7 A;  3H03 A;  2X26 A;  4MEV A;  4C0R A;  3T9U A;  3BFT A;  1EZ9 A;  4P1E A;  1T0K A;  1Y3N A;  1Y1M A;  4KCD A;  2H99 A;  4NN3 A;  4MCO A;  4NTL A;  5H8H B;  3V8X B;  2V4C A;  4LON B;  5CBR A;  3MPK A;  4PF6 A;  2V84 A;  5DVF A;  4R2F A;  5EQ8 A;  4RXL A;  5FTI A;  2ZXT A;  2DDK A;  4R75 A;  2R71 A;  1FPK A;  4ZEB A;  4YU0 A;  1G0H A;  3OXN A;  4NF5 A;  5KCJ B;  1POY 1;  5CI5 A;  2F7B A;  1XVX A;  1A55 A;  1WVJ A;  5HBC A;  4OVS A;  1BK4 A;  3TCF A;  2VOZ A;  1SDX A;  4WKM A;  3FXU A;  4NWD A;  3O6G A;  3FXR A;  1QUK A;  2VD2 A;  4F3B A;  5TPA B;  4PBQ A;  3RLF E;  3G3F A;  3VV5 A;  1MXX A;  1JVX A;  1PEB A;  1YPN A;  4HCY A;  4POX A;  1DCU A;  3N94 A;  1VR5 A;  3O29 A;  4PGP A;  2XXW A;  4ISU A;  1I6A A;  3NOH A;  4BDL A;  2Y7R A;  2D3I A;  4HCW A;  5CC2 A;  3MUQ A;  3U65 A;  3E3K A;  4YMA A;  4C1U A;  3MYU A;  3K4U A;  2Z8D A;  2DXR A;  5IM2 A;  4POW A;  2DYX A;  4GWU A;  1GV8 A;  3E78 A;  2F7A A;  4HW8 A;  1PB9 A;  3C34 A;  3HST A;  2DSF A;  3PTY A;  3IFC A;  4MH5 A;  1QJM A;  1SQY A;  3LSX A;  2OLB A;  4NWC A;  2V3U A;  1ZJL A;  4NF8 A;  5LTC A;  4BDR A;  1FPL A;  4GXA A;  3PMW A;  4K3F A;  4LVQ A;  4XIG Q;  3KOT A;  3LC8 A;  4NF5 B;  1FRP A;  1Y3P A;  1QVS A;  4LZ8 A;  2R9J A;  1B5H A;  3Q26 A;  4OZ9 A;  1EZO A;  2ZYO A;  4QFN A;  2QS3 A;  1B7H A;  1A99 A;  2HCA A;  3RPL B;  3SEW A;  4DCX A;  2FHY A;  2NWJ A;  4XKN A;  4GX4 A;  1LLS A;  3LSF B;  4PAI A;  3RTF B;  3MAM A;  2CZI A;  1Q35 A;  5FHN A;  3LR1 A;  2UVI A;  4DXU A;  4JXI A;  3ZKL A;  3A3U A;  1JP4 A;  3FBP A;  2BJI A;  1D9V A;  3W15 C;  4F29 A;  4I3Y A;  4NQ8 A;  4TLM B;  1B52 A;  3IOU A;  1N04 A;  3KOS A;  3PPP A;  4O3B A;  1M5E A;  1UQW A;  3ONM A;  1P1O A;  3KSJ A;  4FOR A;  3UK4 A;  5I58 A;  1BKA A;  3E79 A;  2Z8F A;  4OYV A;  4IO2 A;  2WX9 A;  4N17 A;  2H98 A;  2UXA A;  2HFB A;  4UAB A;  5CM6 A;  2XA5 A;  3H6V A;  5ITP A;  3PPN A;  5BUU A;  2YJP A;  3W9W A;  3QUF A;  5DYH A;  4XEQ A;  3SEX A;  2F5X A;  4NF8 B;  1PC3 A;  2B4M A;  5EHM A;  4KYS A;  1MH4 A;  4GWO A;  4LZ5 A;  1OQH A;  4MF3 A;  3O2A A;  2WEF A;  3RT6 B;  1MQI A;  2PCR A;  1YXI A;  4RPO A;  1NV2 A;  4GBV A;  3TKD A;  1SW1 A;  3WAF A;  4PDH A;  2YLN A;  4HXV A;  1NL5 A;  4MNP A;  3MP1 A;  3FUZ A;  3TQW A;  1JQF A;  2VHA A;  1US5 A;  5DVJ A;  3T0J A;  4FAT A;  4PDD A;  1INP A;  2AIX A;  1YZ0 A;  4MNC A;  1KZ8 A;  2I0C A;  1IXG A;  4PQJ A;  1B7U A;  4LP2 B;  1OIB A;  3G3I A;  5IKB A;  1AMF A;  3CSG A;  2RC9 A;  3QAX A;  3VLU A;  4MIJ A;  3CG3 A;  3TPA A;  2V3T A;  3B6T A;  2P0S A;  2DWH A;  2ABH A;  5I58 B;  1ZMG A;  5FTH A;  4EXK A;  1Q1K A;  4IO7 A;  1LBY A;  2DS9 A;  5FHO A;  4ELP A;  5FHM A;  3IO4 A;  1L5T A;  1JEU A;  3KC1 A;  2QVU A;  4F18 A;  3K1M A;  3LSL A;  1B7Z A;  1RYO A;  3JV9 A;  5I7I A;  5ET7 A;  2G93 A;  4JWX A;  3MQ9 A;  3O6I A;  3C9H A;  4WED A;  2CZK A;  3B6Q A;  4F1Y A;  2QPQ A;  4ESX A;  1USY E;  4G4P A;  2OZZ A;  2XXR A;  4EXL A;  1BTJ A;  4UAC A;  3T9H B;  5M2V A;  3K01 A;  1SW4 A;  1AL3 A;  5F7V A;  1WOD A;  3USD A;  3G7W A;  4KXP A;  4YIC A;  4I62 A;  2XWI A;  4YB5 A;  5K2Y A;  1UIU A;  1BP5 A;  1URS A;  3TZA A;  3CG1 A;  3HPI A;  2DE4 A;  4DI3 D;  3A09 A;  2I48 A;  1SW5 A;  1R9Q A;  2I4B A;  4OVR A;  4PE5 B;  1P1U A;  3O97 A;  3WAE A;  3TFL A;  1AOV A;  2F7C A;  4YKK A;  4QFL A;  3CRB A;  2RCB A;  4IY6 A;  2UYE A;  3SER A;  1RDY A;  2Q8J A;  4NF6 A;  1RDZ A;  4ONY A;  4QSC A;  5EQ9 A;  4GLI A;  3K6V A;  1FPE A;  2HXR A;  1H45 A;  1NV7 A;  4N81 A;  1IXC A;  4F3G A;  3U8Q A;  4N07 A;  1VFD A;  5HPQ A;  2UVJ A;  2HZL A;  4GX6 A;  3T96 B;  1QW0 A;  3T9V A;  1JW5 A;  3HHF A;  3PPR A;  5ESY A;  2B65 A;  3CR9 A;  1SI1 A;  1XC1 A;  2HEU A;  3C32 A;  4MX6 A;  1FBC A;  1O63 A;  3PMV A;  1FBD A;  3KJ7 A;  1FPG A;  2WKY A;  3QIM A;  4F3P A;  2LAO A;  5CMC A;  1FTL A;  4R9G A;  3MW0 A;  3K2D A;  2F97 A;  1M5D A;  4ZEF A;  3EPE A;  1LGB C;  4ZZE A;  4RK9 A;  1Y20 A;  2IA4 A;  3IJX B;  4ZEC A;  3O9P A;  4FED A;  4NHB A;  1TFD A;  4DIG A;  3TEP A;  3K00 A;  1XHY A;  1IIW A;  5L8D A;  1MQJ A;  3VVF A;  3KBR A;  4ZED A;  2PT2 A;  3IK6 B;  2I3V A;  1B46 A;  3MVZ A;  5ITO A;  2DE2 A;  2CZH A;  2HPG A;  4G8H A;  3MZ1 A;  4P0G A;  5DW8 A;  3R6U A;  4C1T A;  4IB2 A;  1DMB A;  3QSL A;  3LBS A;  2REG A;  4G2Z A;  1D4N A;  1MDQ A;  3IB0 A;  2XXY A;  3LSW A;  4N13 A;  2PYY A;  4KHZ E;  3OEL A;  1SW2 A;  4NF6 B;  3MST A;  1N3W A;  2DE3 A;  1UIV A;  1MQG A;  4MJO A;  2DOJ A;  4RPN A;  5CMB A;  1FQB A;  4JBZ A;  2I3W A;  2XX9 A;  1MH3 A;  2DWJ A;  3RGY A;  3OSQ A;  1RDX A;  3QYT A;  3KN3 A;  1WDN A;  4KR5 A;  2P2A A;  1TWY A;  1IMC A;  2XXU A;  1OQG A;  3N6U A;  4M1V A;  2Q9T A;  2XD2 A;  3C35 A;  2HHM A;  2FIE A;  2O69 A;  1D3K A;  1IMD A;  3VVE A;  3Q27 A;  1H43 A;  2CMO A;  4QHQ A;  3G3J A;  4GWZ A;  2ZMB A;  4NF4 A;  1MRP A;  4GFR A;  1N7W A;  3IO6 A;  5ELV A;  2PFZ A;  4OEU A;  2Z8E A;  3Q29 A;  5ICT A;  1A8E A;  1NUW A;  1B58 A;  4GX3 A;  4R73 A;  4OFO A;  3H6T A;  3KFM A;  2Q2C A;  1Y9U A;  3CIJ A;  4EUO A;  4IY5 A;  3UOR A;  1H3D A;  1DTZ A;  4QXD A;  2XXQ A;  3KG2 A;  2Y5L A;  4H45 A;  4KYD A;  5ICQ A;  4BDQ A;  5EYG A;  2ZNU A;  5L9M A;  3TDJ A;  4OA4 A;  4PAF A;  4OFJ A;  3R7X A;  3T93 B;  4ECF A;  4N91 A;  1DPE A;  2Y84 A;  3PPQ A;  1MG1 A;  4WEP A;  4FAJ A;  5LDZ A;  3GBA A;  3OSR A;  3RPL A;  3CFL A;  2DWI A;  4JVC A;  1FTO A;  3K6U A;  1CNQ A;  4ZEI A;  3UA8 A;  1LBW A;  4U2R A;  1LFI A;  4XF5 A;  2ONK E;  1MY1 A;  1NV6 A;  4DXC A;  4AB6 A;  4HTG A;  4G68 C;  3VLW A;  1NH7 A;  2QVV A;  4MBP A;  2XXK A;  5H8F A;  2F8D A;  3K6X A;  4XKR A;  3KEI A;  1FTK A;  4IO6 A;  3JYR A;  2RC7 A;  5H8N A;  1JVY A;  4NF4 B;  4ELQ A;  2ZZX A;  2XXV A;  4G8N A;  2CEY A;  1MPC A;  1EH3 A;  5I3S A;  3EHT A;  1MXY A;  2AL4 A;  3TAJ A;  2RF1 A;  1POT A;  2F35 A;  3G3K A;  3CSB A;  3RNN A;  1VSO A;  1J1N A;  4X04 A;  3T1B A;  3IB1 A;  1KA1 A;  1FJ9 A;  1N0T A;  4ZDM A;  2O7I A;  1NMU A;  3D4C A;  2VP1 A;  1GGG A;  1IZ1 A;  4LQ5 A;  5ET5 A;  3RT8 A;  1QUI A;  4LAT A;  3HFU A;  2XHD A;  5J1D A;  3FD3 A;  2H25 A;  1URD A;  4GXS B;  1FPD A;  4P47 A;  3MBP A;  1N84 A;  2B3F A;  4O7I A;  3N6T A;  4ZE8 A;  4P8B A;  2BJJ X;  5KDT A;  1LBZ A;  1JW1 A;  4U4S A;  1FW0 A;  1LFH A;  4RNS A;  1N76 A;  1II5 A;  4N4U A; 
#chains in the Genus database with same CATH homology
 2E0S A;  1Y1Z A;  4IO3 A;  4NE4 A;  3TTL A;  1YTV A;  3EF7 A;  1Y4C A;  1USY H;  3C31 A;  5H8F B;  4XKQ A;  1OLC A;  3IX1 A;  1LAX A;  1B3E A;  1LCF A;  4OEV A;  2O68 A;  4GF8 A;  4F2Q A;  3D4G A;  5H8N B;  1QKA A;  1R9L A;  2Q88 A;  3FIR A;  1YAE A;  2ONR A;  2I0B A;  2VD3 A;  2PX1 A;  3QUJ A;  4KYE A;  1RYX A;  4YMB A;  3OO7 A;  4UA8 A;  1Z7M E;  4H67 A;  4F2O A;  5I59 A;  2A5T A;  1IXH A;  2PVU A;  3PD9 A;  1JNF A;  5AA4 A;  3C33 A;  4PP0 A;  2W7Y A;  1LB9 A;  3U94 A;  5EHS A;  3IB2 A;  1ANF A;  3UP9 A;  3PUX E;  2RC8 A;  4RYA A;  4X1D A;  1B6H A;  3M3F A;  4X1B A;  1ZIU A;  5KDT B;  1ZKB A;  2QMX A;  1ELJ A;  3TQL A;  5CMK A;  4IO4 A;  4XKP A;  5A5X A;  3CFX A;  4H6D A;  3H6W A;  4QSE A;  3FVO A;  4ND9 A;  4H0W A;  2PMS A;  4BDM A;  1IEJ A;  2E1S A;  2M8C A;  3F11 A;  4FEC A;  3SES A;  3MWB A;  4PFU A;  2DXY A;  3ILT B;  1XVY A;  4EQ7 A;  2ZYN A;  4YKP A;  1IXI A;  3K6W A;  1FQD A;  4G68 A;  3U1O A;  4KD5 A;  1MXW A;  2Q89 A;  3HV1 A;  3U93 A;  1B4H A;  1VE4 A;  1AIV A;  1FTJ A;  2QRY A;  4QRZ A;  2GFE A;  1TT1 A;  2I58 A;  1N3X A;  1IUD A;  3IOW A;  3OO9 A;  1FQE A;  5I59 B;  4QFK A;  3S9L C;  2A5T B;  2F36 A;  3A3C A;  5AA4 B;  2I4C A;  1HSJ A;  4OQO A;  2OWS A;  4FE8 A;  3ZS6 A;  4IGR A;  3TTK A;  4R2B A;  2UVG A;  4F1V A;  2V3Q A;  3DLN A;  3CI8 A;  1TFA A;  1MM6 A;  3IR1 A;  1YCJ A;  2D21 A;  3T22 A;  1LAH E;  5A5X B;  4ELO A;  1H44 A;  4U4X A;  1FQA A;  2QS1 A;  1B3L A;  1P99 A;  4ESW A;  1O64 A;  3HHG A;  3L6H A;  1LFG A;  1SI0 A;  1NNK A;  3MPL A;  3TTM A;  1MXV A;  3I5O A;  2REJ A;  4FEB A;  5K2X A;  5EYF A;  2OCU A;  3S9M C;  2IEE A;  3MJN A;  4GL0 A;  3FVN A;  1HSL A;  1NNT A;  4H5F A;  2GHB A;  3VE1 B;  4JWO A;  4G68 B;  4Z0I A;  4ZZA A;  3TYH A;  3I6V A;  5I2K A;  1MY3 A;  3H4Z A;  3PU5 A;  4ZE9 A;  5L9O A;  3MVW A;  5H8Q A;  4GD5 A;  4QFO A;  1CB6 A;  2O7U A;  1MPB A;  2RKM A;  3B6W A;  4XXU A;  3OO8 A;  3RUM A;  1B4Z A;  1ATG A;  3DM0 A;  4Q30 B;  1FTM A;  1R6Z A;  3TCG A;  1XOC A;  3OEM A;  2XX7 A;  2P1S A;  1OMP A;  3FAT A;  3VXB A;  2CZL A;  3OD7 A;  1XS5 A;  1OVT A;  1P1N A;  2O84 X;  4U23 A;  1LAG E;  2XXX A;  1A8F A;  2X7P A;  1ZU0 A;  1A7L A;  2H4I A;  4WXJ A;  2Y7W A;  1BLF A;  2ZYK A;  4OWD A;  1JET A;  5JK4 A;  2GHA A;  1DOT A;  3OOA A;  4QFP A;  1P1Q A;  1MY4 A;  2GH9 A;  3M8U A;  5DVI A;  4QF9 A;  5ISU A;  5I56 A;  5AA3 A;  2AL5 A;  3GXA A;  4QSD A;  2I6E A;  1LST A;  5I2K B;  3KSX A;  4F19 A;  1EZP A;  1DPP A;  3E4R A;  5H8Q B;  4M4G A;  3ZSF A;  1O7T A;  4MLV A;  3N26 A;  3EHS A;  2DVC A;  1Z7N E;  1B9J A;  2VGQ A;  4U1Z A;  1QKB A;  4I1D A;  1URG A;  4H65 A;  2UYF A;  4FIM A;  4JSD A;  4N6P A;  2Y7I A;  1B3H A;  4RK2 A;  3G3H A;  1SVX B;  1LB8 A;  2XXP A;  2DWA A;  2OJT A;  2X7Q A;  2UVH A;  1NH8 A;  3KN8 A;  1B1X A;  2THI A;  1GR2 A;  4PFT A;  1XT8 A;  2ALU A;  3HN0 A;  3SKP A;  1MXU A;  3PD8 A;  2V25 A;  3IOV A;  3THI A;  2DQV A;  3OO6 A;  3PPO A;  2OBG A;  3MVX A;  4LZ7 A;  4ZS9 A;  4RA1 A;  1FQF A;  1MY2 A;  4I9D A;  1B3F A;  2ANJ A;  3GBB A;  4DE8 A;  4ZEK A;  4R6K A;  5I56 B;  3PGF A;  3CVG A;  3VXC A;  4DCY A;  1ZLQ A;  1QUL A;  1B5I A;  3I3V A;  4NMY A;  2XXT A;  3KJT A;  4BDN A;  3PUV E;  3OMB A;  2XX8 A;  1F9B A;  3PV0 E;  2GRV A;  2DP8 A;  2PT1 A;  5TU0 A;  1M5B A;  3MZB A;  3K1P A;  3G3G A;  3Q25 A;  4PFY A;  3FGS A;  4JWY A;  4PET A;  3U72 A;  2DVZ A;  3QK6 A;  3TOD A;  1MDP 1;  3H3G A;  3ODB A;  3B7D A;  1KWH A;  5AA1 A;  4R6H A;  3EQ1 A;  4Q0C A;  2Y7P A;  5DEX A;  3MP8 A;  1UTH A;  3TTR A;  2ZNS A;  1NNP A;  3S9N C;  2O51 A;  1I6B A;  3UN6 A;  2FNC A;  3OEN A;  3TMG A;  1P1W A;  3H6U A;  3ECR A;  3UIF A;  3VVD A;  3VDF A;  3IL1 B;  2ESN A;  3FZV A;  4R72 A;  3C36 A;  3C4M A;  1RKM A;  4YZZ A;  3KZG A;  5I2N A;  4OER A;  4L17 A;  3FJ7 A;  4JDF A;  1MS7 A;  4TOZ A;  4F3S A;  3BBR A;  1A40 A;  1MPD A;  2F78 A;  4O3A A;  4DDD A;  1MY0 A;  2H9B A;  4TLL B;  5HM4 B;  1UTB A;  2Z22 A;  3ILU B;  4MLQ A;  4YKI A;  3DP4 A;  5TP9 A;  3PUY E;  4FJP A;  1Y3Q A;  3PUZ E;  4THI A;  2I49 A;  3V5A A;  4GVO A;  2V93 A;  3ZKK A;  2HAU A;  1CE2 A;  2O1M A;  3CFZ A;  3RY3 A;  2PBW A;  3N5L A;  2FA7 A;  1B05 A;  4P0I A;  5I84 A;  1B2H A;  1B51 A;  4YB7 A;  1M5C A;  3PMX A;  4E0W A;  2ZYM A;  1S50 A;  5DEX B;  4G8M A;  4KCC A;  2HXW A;  4JSO A;  1UTH B;  3DP6 A;  2F6P A;  3M3K A;  3IJO B;  4AQ4 A;  4ELR A;  3BKI B;  4X9T A;  5F1Q A;  5CRY A;  1SYH A;  3EN3 A;  3E13 X;  4F1U A;  4IGT A;  1MXZ A;  5I2N B;  4P11 A;  4OMB A;  3K02 A;  1VFE A;  4U21 A;  2QJE A;  1N7X A;  3KN7 A;  3RN8 A;  2NXO A;  3V89 B;  3TCH A;  1UTB B;  1DSN A;  5DT6 A;  1H76 A;  5B70 A;  2B3B A;  3K0V A;  2XD3 A;  3M3L A;  4OET A;  3FJM A;  5TP9 B;  4OHN A;  1NFT A;  2Y7K A;  3K1N A;  3O66 A;  3HCQ A;  3MP6 A;  1IQ7 A;  4R9F A;  5JEI A;  2RIN A;  3AXF A;  1B32 A;  3LUY A;  4LQ2 A;  5IAI A;  4EQ9 A;  4GRK A;  4H5G A;  4GIZ A;  3MZ9 A;  2OWT A;  4F39 A;  3MVY A;  1JEV A;  3SEY A;  4I8C A;  1S7Y A;  4OFL A;  2QSX A;  1LAF E;  5H8S A;  3S2V A;  4MFI A;  4PFW A;  3TEL A;  2H5Y A;  2F6G A;  3T66 A;  3V83 A;  3FV1 A;  3DP8 A;  5AA2 D;  3P7I A;  1MQH A;  2Q2A A;  5CMM A;  5I57 A;  1IIT A;  2NOO A;  3Q28 A;  1PBQ A;  1B5J A;  1PB7 A;  4DZ1 A;  5L9S A;  2A5S A;  3S9E A;  5AA2 A;  4R74 A;  5KZT A;  4H8J A;  4Z7E A;  4OEN A;  4KFQ A;  3TUS A;  1TXF A;  3JZJ A;  4OTE A;  4KPT A;  1EU8 A;  1A54 A;  2QMW A;  4OES A;  1NKX A;  4LUB A;  3R26 A;  3OEK A;  1FQC A;  3RPW A;  5AE4 A;  3IAZ A;  4F22 A;  4RJZ A;  1PB8 A;  2ZNT A;  3TTN A;  3O28 A;  1HSE A;  2OK2 A;  4GL8 A;  4U22 A;  2KLF A;  3T9X B;  1DTG A;  3GLB A;  3VLV A;  2Z23 A;  3KGC A;  3FV2 A;  3W9V A;  2HAV A;  1OVB A;  5JTY A;  1LBB A;  4HS7 A;  2NVU B;  3QXM A;  4Q8R A;  1BIY A;  1OLA A;  1D9Y A;  3SET A;  4Q5T A;  2AYS A;  1B40 A;  3DEL B;  4LA9 A;  4OVJ A;  3IOT A;  1B0H A;  1LBC A;  4JB7 A;  4F31 B;  4E0X A;  4DLD A;  5I57 B;  5LOM A;  2D5W A;  2F34 A;  2O1L A;  1NNF A;  2QS4 A;  1US4 A;  5AA2 B;  3H7M A;  4NED A;  4TQU Q;  2HQ0 A;  3FVK A;  1LCT A;  4DXB A;  3GZG A;  4YAH X;  1MQD A;  2QL3 A;  2R6G E;  4YKJ A;  3S4U A;  4EF2 A;  1Y4T A;  2ONS A;  3H06 B;  1GTK A;  1I6Q A;  1I69 A;  4H8I A;  3E9X A;  3FVG A;  1SBP A;  3L6G A;  3RQT A;  1JW4 A;  4KQP A;  2HZK A;  4R6Y A;  5H8H A;  4BLA A;  4EF1 A;  1SYI A;  1PBP A;  4XTC Q;  3MC2 A;  3IOR A;  4GOT A;  2O6A A;  3FJG A;  2RCA A;  1R1N A;  1FCK A;  3FXQ A;  4X48 A;  1PDA A;  4EQB A;  3FAS A;  4G77 A;  4KI0 E;  1S9T A;  1M5F A;  4GQO A;  5KCJ A;  3RTW B;  5B7D A;  4AB5 A;  1ZBM A;  2QS2 A;  4RY1 A;  2NUV A;  5JTY B;  2XXH A;  3PUW E;  2G29 A;  3UGW A;  4BDO A;  3VFJ A;  3HO7 A;  1SD3 A;  4EDP A;  1GVC A;  5TPA A;  4O3C A;  2XXI A;  2YPN A;  2FYI A;  1ZTY A;  3U92 A;  4H1X A;  5DTB A;  3EHU A;  5CBS A;  4U1O A;  3SDF A;  4IO5 A;  5BWJ A;  3SEV A;  1AH5 A;  1B0L A;  1B1H A;  1B3G A;  4YB6 A;  3SEU A;  1QUJ A;  4OXV A;  3BFU A;  3O6H A;  1MM7 A;  3H03 A;  2X26 A;  4C0R A;  3T9U A;  3BFT A;  1EZ9 A;  1T0K A;  1Y3N A;  1Y1M A;  4KCD A;  2H99 A;  4NTL A;  5H8H B;  3V8X B;  4LON B;  5CBR A;  3MPK A;  2V84 A;  5DVF A;  4R2F A;  4RXL A;  5FTI A;  2ZXT A;  4R75 A;  2R71 A;  4ZEB A;  4YU0 A;  3OXN A;  4NF5 A;  5KCJ B;  1POY 1;  5CI5 A;  2F7B A;  1XVX A;  1A55 A;  1WVJ A;  5HBC A;  3TCF A;  2VOZ A;  1SDX A;  4WKM A;  3FXU A;  4NWD A;  3O6G A;  3FXR A;  1QUK A;  2VD2 A;  4F3B A;  5TPA B;  3RLF E;  3G3F A;  3VV5 A;  1MXX A;  1JVX A;  1PEB A;  1YPN A;  4HCY A;  4POX A;  3N94 A;  1VR5 A;  3O29 A;  2XXW A;  4ISU A;  1I6A A;  4BDL A;  2Y7R A;  2D3I A;  4HCW A;  5CC2 A;  3MUQ A;  3E3K A;  4YMA A;  4C1U A;  3K4U A;  2Z8D A;  2DXR A;  4POW A;  2DYX A;  1GV8 A;  2F7A A;  4HW8 A;  1PB9 A;  3C34 A;  3HST A;  2DSF A;  4MH5 A;  1QJM A;  1SQY A;  3LSX A;  2OLB A;  4NWC A;  2V3U A;  1ZJL A;  4NF8 A;  4BDR A;  4GXA A;  3PMW A;  4K3F A;  4LVQ A;  4XIG Q;  3KOT A;  3LC8 A;  4NF5 B;  1Y3P A;  1QVS A;  4LZ8 A;  2R9J A;  1B5H A;  3Q26 A;  4OZ9 A;  1EZO A;  2ZYO A;  4QFN A;  2QS3 A;  1B7H A;  1A99 A;  2HCA A;  3SEW A;  4DCX A;  2NWJ A;  4XKN A;  1LLS A;  3LSF B;  3RTF B;  3MAM A;  1Q35 A;  5FHN A;  3LR1 A;  2UVI A;  4DXU A;  4JXI A;  3ZKL A;  3A3U A;  1D9V A;  3W15 C;  4F29 A;  4TLM B;  1B52 A;  3IOU A;  1N04 A;  3KOS A;  3PPP A;  4O3B A;  1M5E A;  1UQW A;  3ONM A;  1P1O A;  3KSJ A;  4FOR A;  3UK4 A;  5I58 A;  1BKA A;  2Z8F A;  4OYV A;  4IO2 A;  2H98 A;  2UXA A;  2HFB A;  5CM6 A;  3H6V A;  5ITP A;  3PPN A;  5BUU A;  2YJP A;  3W9W A;  3QUF A;  5DYH A;  3SEX A;  2F5X A;  4NF8 B;  1PC3 A;  5EHM A;  4KYS A;  1MH4 A;  4GWO A;  4LZ5 A;  1OQH A;  4MF3 A;  3O2A A;  3RT6 B;  1MQI A;  4RPO A;  3TKD A;  1SW1 A;  3WAF A;  2YLN A;  1NL5 A;  3MP1 A;  3FUZ A;  3TQW A;  1JQF A;  2VHA A;  1US5 A;  5DVJ A;  4FAT A;  2AIX A;  2I0C A;  1IXG A;  4PQJ A;  1B7U A;  4LP2 B;  1OIB A;  3G3I A;  5IKB A;  1AMF A;  3CSG A;  2RC9 A;  3QAX A;  3VLU A;  3CG3 A;  3TPA A;  2V3T A;  3B6T A;  2P0S A;  2DWH A;  2ABH A;  5I58 B;  1ZMG A;  5FTH A;  4EXK A;  1Q1K A;  4IO7 A;  5FHO A;  2DS9 A;  4ELP A;  5FHM A;  3IO4 A;  1L5T A;  1JEU A;  4F18 A;  3K1M A;  3LSL A;  1B7Z A;  1RYO A;  3JV9 A;  2G93 A;  4JWX A;  3MQ9 A;  3O6I A;  3C9H A;  4WED A;  3B6Q A;  4F1Y A;  2QPQ A;  4ESX A;  1USY E;  4G4P A;  2OZZ A;  2XXR A;  4EXL A;  1BTJ A;  4UAC A;  3T9H B;  5M2V A;  3K01 A;  1SW4 A;  1AL3 A;  5F7V A;  1WOD A;  3USD A;  3G7W A;  4YIC A;  4I62 A;  4YB5 A;  5K2Y A;  1UIU A;  1BP5 A;  1URS A;  3TZA A;  3CG1 A;  3HPI A;  2DE4 A;  3A09 A;  2I48 A;  1SW5 A;  1R9Q A;  2I4B A;  4PE5 B;  1P1U A;  3O97 A;  3WAE A;  3TFL A;  1AOV A;  2F7C A;  4YKK A;  4QFL A;  3CRB A;  2RCB A;  4IY6 A;  2UYE A;  3SER A;  2Q8J A;  4NF6 A;  4ONY A;  4QSC A;  4GLI A;  3K6V A;  1H45 A;  1IXC A;  4F3G A;  3U8Q A;  4N07 A;  1VFD A;  5HPQ A;  2UVJ A;  2HZL A;  3T96 B;  1QW0 A;  3T9V A;  1JW5 A;  3HHF A;  3PPR A;  2B65 A;  3CR9 A;  1SI1 A;  1XC1 A;  2HEU A;  3C32 A;  1O63 A;  3PMV A;  3KJ7 A;  2WKY A;  3QIM A;  4F3P A;  2LAO A;  5CMC A;  1FTL A;  4R9G A;  3MW0 A;  3K2D A;  2F97 A;  1M5D A;  4ZEF A;  3EPE A;  1LGB C;  4ZZE A;  4RK9 A;  1Y20 A;  2IA4 A;  3IJX B;  4ZEC A;  3O9P A;  4FED A;  1TFD A;  4DIG A;  3TEP A;  3K00 A;  1XHY A;  1IIW A;  5L8D A;  1MQJ A;  3VVF A;  3KBR A;  4ZED A;  2PT2 A;  3IK6 B;  2I3V A;  1B46 A;  3MVZ A;  5ITO A;  2DE2 A;  4G8H A;  3MZ1 A;  4P0G A;  3R6U A;  4C1T A;  4IB2 A;  1DMB A;  3QSL A;  3LBS A;  2REG A;  4G2Z A;  1D4N A;  1MDQ A;  3IB0 A;  2XXY A;  3LSW A;  4N13 A;  2PYY A;  4KHZ E;  3OEL A;  1SW2 A;  4NF6 B;  1N3W A;  2DE3 A;  1UIV A;  1MQG A;  2DOJ A;  4RPN A;  5CMB A;  1FQB A;  4JBZ A;  2I3W A;  2XX9 A;  1MH3 A;  2DWJ A;  3RGY A;  3OSQ A;  3QYT A;  3KN3 A;  1WDN A;  4KR5 A;  2P2A A;  1TWY A;  2XXU A;  1OQG A;  3N6U A;  4M1V A;  2Q9T A;  2XD2 A;  3C35 A;  2O69 A;  1D3K A;  3VVE A;  3Q27 A;  1H43 A;  2CMO A;  4QHQ A;  3G3J A;  2ZMB A;  4NF4 A;  1MRP A;  4GFR A;  1N7W A;  3IO6 A;  5ELV A;  4OEU A;  2Z8E A;  3Q29 A;  5ICT A;  1A8E A;  1B58 A;  4R73 A;  4OFO A;  3H6T A;  3KFM A;  2Q2C A;  1Y9U A;  3CIJ A;  4EUO A;  4IY5 A;  3UOR A;  1H3D A;  1DTZ A;  2XXQ A;  3KG2 A;  4KYD A;  5ICQ A;  4BDQ A;  2ZNU A;  5L9M A;  3TDJ A;  4OFJ A;  3R7X A;  3T93 B;  4ECF A;  1DPE A;  2Y84 A;  3PPQ A;  1MG1 A;  4WEP A;  4FAJ A;  3GBA A;  3OSR A;  3CFL A;  2DWI A;  1FTO A;  3K6U A;  4ZEI A;  3UA8 A;  4U2R A;  1LFI A;  2ONK E;  1MY1 A;  4DXC A;  4AB6 A;  4HTG A;  4G68 C;  3VLW A;  1NH7 A;  4MBP A;  5H8F A;  2F8D A;  3K6X A;  4XKR A;  3KEI A;  1FTK A;  4IO6 A;  3JYR A;  2RC7 A;  5H8N A;  1JVY A;  4NF4 B;  4ELQ A;  2XXV A;  4G8N A;  1MPC A;  1EH3 A;  3EHT A;  1MXY A;  2AL4 A;  3TAJ A;  2RF1 A;  1POT A;  2F35 A;  3G3K A;  3CSB A;  3RNN A;  1VSO A;  1J1N A;  3IB1 A;  1N0T A;  4ZDM A;  2O7I A;  1NMU A;  3D4C A;  2VP1 A;  1GGG A;  1IZ1 A;  4LQ5 A;  3RT8 A;  1QUI A;  4LAT A;  2XHD A;  5J1D A;  3FD3 A;  2H25 A;  1URD A;  4GXS B;  3MBP A;  1N84 A;  2B3F A;  3N6T A;  4ZE8 A;  2BJJ X;  5KDT A;  1JW1 A;  4U4S A;  1FW0 A;  1LFH A;  4RNS A;  1N76 A;  1II5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...