4LATA

Crystal structure of phosphate abc transporter, periplasmic phosphate-binding protein psts 1 (pbp1) from streptococcus pneumoniae canada mdr_19a in complex with phosphate
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
260
structure length
260
Chain Sequence
ESITAVGSTALQPLVEVAADEFGTIHVGKTVNVQGGGSGTGLSQVQSGAVDIGNSDVFAEEKDGIDASALVDHKVAVAGLALIVNKEVDVDNLTTEQLRQIFIGEVTNWKEVGGKDLPISVINRAAGSGSRATFDTVIMEGQSAMQSQEQDSNGAVKSIVSKSPGAISYLSLTYIDDSVKSMKLNGYDLSPENISSNNWPLWSYEHMYTLGQPNELAAEFLNFVLSDETQEGIVKGLKYIPIKEMKVEKDAAGTVTVLEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of phosphate ABC transporter, periplasmic phosphate-binding protein PstS 1 (PBP1) from Streptococcus pneumoniae Canada MDR_19A in complex with phosphate
rcsb
source organism Streptococcus pneumoniae
molecule tags Transport protein
molecule keywords Phosphate-binding protein PstS 1
total genus 87
structure length 260
sequence length 260
ec nomenclature
pdb deposition date 2013-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4latA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4latA02
5I56A 3U93A 3SDFA 3MVXA 4ZE9A 4GLIA 1VE4A 2P2AA 3S9MC 2WKYA 3N26A 1NNPA 3MQ9A 1ZU0A 5FTHA 2REJA 1P1NA 4EXLA 2QS1A 1QUIA 2G29A 5AA1A 1URSA 1Z7NE 3LBSA 5TPAA 2I4CA 4Q8RA 1TFAA 1B0HA 2DP8A 1BLFA 3H4ZA 3Q27A 2G93A 3TZAA 4F18A 3B6WA 3TMGA 2AL4A 4KD5A 4R6KA 3CG1A 3T9UA 4BDLA 4JDFA 1MQGA 1Y1ZA 4ISUA 3E4RA 5JEIA 3TCGA 3MWBA 4LUBA 3VLWA 4XIGQ 3DLNA 1NH7A 3ZKLA 4ZZAA 1NNFA 1P1OA 3TELA 1S9TA 4DCXA 4ONYA 1LB9A 2I0BA 2PMSA 3PV0E 1WVJA 3OEKA 2ONSA 3D4CA 2NWJA 3PMXA 3QAXA 4QRZA 4LATA 4G77A 3OOAA 1D4NA 5H8SA 5I59A 5IAIA 2DSFA 3IO4A 4GF8A 3VLUA 3K6WA 4TQUQ 4ELPA 2E1SA 3EHUA 1B4ZA 1MM6A 3MP1A 2D5WA 1A8FA 2Y7PA 4GRKA 4YKPA 1R9QA 2NVUB 2UYFA 3CIJA 5J1DA 1AL3A 1MQDA 4R6HA 5BWJA 2DVCA 2O7IA 4OMBA 3DP6A 1ZMGA 2RF1A 2DWAA 4U4XA 1FTOA 3O6GA 4I1DA 1B52A 2DOJA 2RCAA 3K1MA 4XKPA 1B0LA 5H8HB 3CSBA 3K00A 3MPKA 4OFLA 1R6ZA 4U23A 4HCWA 1NNKA 4ZEIA 2DQVA 2XXRA 1MPCA 4NF4A 1P1UA 3S9EA 4POWA 4OWDA 1Z7ME 3V8XB 3C32A 3JYRA 4RYAA 3Q28A 4G4PA 2VOZA 3N94A 2YLNA 2XXQA 5H8FA 2DXYA 4OQOA 5FHMA 2XX9A 3KBRA 2A5TB 2Q8JA 3T22A 4DXCA 1B9JA 3Q26A 1LCFA 5DEXA 1UTHB 2ZXTA 3T93B 1I6BA 1IITA 2Y7WA 1H3DA 4R2FA 3UIFA 4IY5A 2CMOA 1FQAA 1GGGA 2KLFA 2QS2A 4QFLA 2XXXA 2O1LA 3CFZA 3H06B 1N3WA 4NE4A 2H98A 2HZLA 2QS4A 4OENA 4QFOA 5ITOA 1UTBA 2W7YA 3MAMA 2OCUA 4YKJA 4F1YA 2THIA 4G8HA 5CBRA 4IO2A 4H6DA 2NOOA 5K2XA 1B3LA 1I6AA 1LAHE 4PP0A 1LFHA 2AL5A 2PYYA 4C1TA 1N76A 3HHFA 4FAJA 4LA9A 1B5JA 3LR1A 2VD3A 3E9XA 3M3FA 4XKRA 4O3BA 3ZKKA 3KEIA 1B6HA 1QVSA 1ZKBA 1MQJA 1GR2A 2DE2A 3FGSA 1HSJA 3A3CA 3GBAA 3HV1A 3U8QA 5ICQA 4BDOA 1LB8A 4UA8A 2UXAA 4H67A 2ZNSA 1MDQA 5HBCA 2XXWA 1OMPA 2F34A 4GQOA 4HCYA 3IO6A 3LC8A 4IO3A 4H8JA 1IXIA 3SEXA 3TEPA 1PC3A 3KZGA 3TAJA 4F3SA 2PVUA 3QIMA 3G3IA 2ONKE 3DP8A 1MXWA 3I3VA 4YKKA 3KN7A 2ALUA 1MH3A 3QYTA 1YPNA 3TQWA 3BFUA 1N3XA 5EYFA 3ECRA 4FECA 1USYE 4NF5B 1OQGA 4LZ5A 4U1ZA 3FVNA 1A8EA 1VFEA 4IO4A 1WODA 5BUUA 3OO9A 3C36A 3CSGA 4WKMA 3ZSFA 1B40A 1B51A 2DWIA 3OMBA 4DXUA 1LSTA 2XXYA 4JWYA 4XKQA 4C0RA 3PGFA 1Q35A 1OIBA 5L9MA 1Y1MA 1P99A 4E0WA 4EXKA 1QKBA 2RC9A 3IORA 3KG2A 3PUYE 4JBZA 5I2KA 3T66A 2I4BA 4XKNA 2B65A 5M2VA 4NMYA 5DVJA 2I3VA 1WDNA 5JK4A 4R2BA 2HAUA 3LSFB 3QXMA 4QSEA 4X1DA 1Y3NA 3BKIB 2HZKA 2QL3A 1Y3QA 4GOTA 3W9VA 5AA3A 1IQ7A 1MG1A 4MH5A 4KI0E 3RQTA 4PETA 2O69A 1VFDA 3HO7A 4KYDA 5CBSA 5JTYA 2Z23A 1PB7A 3I5OA 4O3CA 4U4SA 3A09A 4FE8A 3SEUA 3CVGA 1L5TA 5L9OA 3Q29A 1FCKA 4ZEFA 2ZYNA 4IB2A 3FXUA 3Q25A 3MBPA 3KGCA 4I62A 3VDFA 1AIVA 3L6HA 3TQLA 3FIRA 3UN6A 1SYHA 3JV9A 4JB7A 4NF5A 5B70A 1UIVA 3HPIA 1MXZA 3FZVA 2F78A 3K0VA 1A40A 3IJOB 3KSJA 3MC2A 2F36A 1FTKA 1DTGA 1SI0A 2HAVA 4GXSB 1XOCA 2VD2A 3HN0A 3MZBA 4ELRA 5I84A 1P1WA 4N07A 3EF7A 1POTA 4PFUA 3CI8A 1MXXA 1TXFA 1ZLQA 3RY3A 1MS7A 2I48A 5I57B 3TTMA 1D9VA 5CMCA 1QUKA 1OLCA 3D4GA 4DZ1A 3I6VA 2F7AA 2B3FA 3HCQA 4JSDA 4G8NA 1B5HA 1RYXA 3OSRA 4RPNA 5I57A 2VP1A 1F9BA 2F7BA 3RPWA 4AQ4A 4EDPA 5LOMA 3IOUA 2E0SA 4MF3A 3RNNA 5CC2A 3MVWA 3G3GA 1B7HA 2QRYA 3FJGA 1OVBA 1DOTA 3LSXA 1MY1A 3PUZE 4POXA 1DSNA 2Y7IA 4Z0IA 1MY3A 5EHMA 3A3UA 4R73A 2UVJA 4RA1A 3RT8A 5CMKA 2XXIA 2RINA 4BDRA 4MFIA 3SETA 2Y7KA 4OETA 1O64A 3ONMA 3G3HA 1SBPA 3M8UA 3PD8A 3SERA 4ELQA 1QJMA 2OWSA 1N7WA 2IA4A 5DTBA 4WEPA 4JXIA 4X9TA 5FHOA 1LLSA 4OEVA 5KDTA 5DT6A 3ILTB 1PEBA 2B3BA 1TWYA 3ILUB 3SEWA 2UVHA 2GFEA 3K4UA 4TOZA 3UP9A 2A5SA 1A54A 4YZZA 3VVFA 4ZEDA 2XHDA 1AH5A 5TP9B 3W9WA 2O51A 3V5AA 3O2AA 4YMAA 4QSDA 2O6AA 1LAGE 2V25A 4GIZA 4YB7A 3RN8A 3CG3A 3K02A 3LSLA 5K2YA 2V93A 3PPRA 4YAHX 3SESA 4GVOA 1H43A 1B58A 1QKAA 2GRVA 2Z8FA 5H8HA 2FA7A 5I56B 2ZNUA 4ZEKA 3T9VA 4AB5A 5L9SA 1J1NA 2ZYKA 4H5GA 3H6UA 3MPLA 4FEDA 4RXLA 1EU8A 1LFGA 1ZJLA 4G68C 5IKBA 1MXVA 2VGQA 4LZ8A 3IAZA 1SW4A 2AIXA 4G68B 3G3JA 3K6VA 3PD9A 2FYIA 4MLQA 1NNTA 3SEYA 3S4UA 1B7ZA 4IO6A 3EPEA 1PBQA 4FEBA 1ELJA 4YU0A 3T9HB 3R7XA 4M1VA 1US4A 4OFJA 2PT2A 2H4IA 5I2KB 1IIWA 4KFQA 5FTIA 5KCJA 1H44A 1USYH 2GH9A 3QUJA 4RK9A 3RLFE 5DVFA 1BP5A 5AA2A 1QW0A 3VXBA 4FORA 1B46A 4P11A 1POY1 3IOVA 3PU5A 5KCJB 3TODA 5CI5A 3B7DA 4ESWA 1B1XA 1XC1A 4KHZE 4NF8B 3GBBA 4QHQA 3EHSA 3RT6B 2QMWA 3VVDA 3RTFB 1B3HA 3H03A 5CMBA 1GVCA 4EUOA 2X26A 1M5EA 4U21A 1SVXB 4X1BA 2R6GE 1OQHA 1A7LA 4GWOA 3MP6A 1A55A 2HQ0A 2OK2A 3PMWA 5I58B 1B5IA 2Q88A 1N0TA 4OXVA 1EZ9A 1R1NA 4I9DA 1B32A 3UORA 1LGBC 3MJNA 3VXCA 4DIGA 4HTGA 1B3GA 1NFTA 1DPPA 5I58A 3TUSA 2PBWA 1NMUA 3KN3A 5HM4B 4KYEA 1JW5A 4X48A 3RGYA 4EQBA 5F1QA 4TLMB 1QULA 2X7PA 3USDA 3DP4A 4H8IA 3SKPA 5HPQA 2I3WA 1MXYA 2HCAA 3VE1B 2O68A 1A99A 1ANFA 4NWCA 5AA2B 1GTKA 4EF2A 3VVEA 2FNCA 2HEUA 2RC8A 3DM0A 1N84A 4R6YA 2Z22A 4Q30B 4QFPA 4FJPA 4RJZA 2Z8DA 2F6PA 4P0IA 1AMFA 3TTLA 4JSOA 4BDQA 3S9NC 1B1HA 3MUQA 1SW5A 2XD3A 1FTJA 3FV1A 3BBRA 1EZOA 4F22A 1B4HA 4G2ZA 4OYVA 3R26A 4TLLB 1N7XA 2AYSA 2V3UA 4YB5A 3O6IA 5I2NB 1D9YA 1DMBA 2R71A 1UQWA 5DEXB 2F7CA 3JZJA 2Q2AA 1GV8A 3TCHA 1NH8A 2QJEA 3KN8A 2Q2CA 2REGA 2ZNTA 2D21A 2P1SA 3KFMA 3G3FA 4GL8A 1T0KA 4NF6A 1BTJA 3C35A 3E3KA 2PT1A 3UK4A 3FUZA 4JWOA 3CFLA 4PFYA 1SI1A 3O28A 4H1XA 1IXHA 4NF6B 2XX8A 2BJJX 4H5FA 4PFTA 1UIUA 2F35A 4LZ7A 4ND9A 1H76A 3FXQA 1TT1A 2H25A 3HHGA 1NKXA 4OTEA 4WEDA 4YB6A 3KOSA 2RC7A 3IB0A 4K3FA 4ZEBA 5ELVA 1ZTYA 4Q5TA 4OZ9A 1Y4CA 3O29A 2OWTA 1S7YA 2I49A 2XXUA 4G8MA 1YCJA 1IXGA 2GHBA 1JEVA 4MBPA 4F39A 3OXNA 4OHNA 3T96B 5AA4B 3PPPA 1JVXA 3RUMA 4N13A 4BDNA 4IGRA 3S2VA 3VV5A 2ABHA 5H8QB 1UTHA 1B3FA 1MY2A 2UYEA 2XXHA 3IB1A 1MRPA 5H8NB 2ZMBA 2IEEA 1MQIA 3FXRA 4ZDMA 5I2NA 5KZTA 1XHYA 2H99A 3LSWA 4PFWA 2F5XA 3C34A 5TPAB 5B7DA 3S9LC 2ZYMA 4HS7A 3K2DA 3HSTA 3OO7A 3O6HA 5L8DA 4GXAA 2I6EA 1HSLA 3FJ7A 4U22A 2RCBA 3OENA 4LVQA 5AA4A 4IO7A 1Q1KA 4R9GA 1PDAA 4UACA 1DPEA 1XVYA 2CZLA 4DE8A 3H6VA 5F7VA 4F31B 4H0WA 3QUFA 1YAEA 4O3AA 1I69A 1JQFA 1US5A 2Q9TA 3MVYA 1H45A 4ZE8A 4C1UA 2YPNA 4NF8A 4E0XA 5KDTB 3PPOA 1PB9A 3CRBA 3SEVA 4NTLA 3P7IA 4IO5A 3DELB 2DWJA 4R9FA 3EN3A 3FD3A 3VFJA 4DCYA 3U92A 3V83A 2DE3A 2OBGA 3FJMA 3IK6B 2YJPA 1B3EA 1JETA 3K6XA 2V3TA 1LFIA 4ZS9A 4EQ9A 4F3BA 1HSEA 1JNFA 1IZ1A 4ESXA 2QS3A 2ZYOA 3FASA 3T9XB 2HXWA 2UVGA 2F6GA 3TTRA 4FATA 2Y7RA 5AE4A 2O1MA 4LQ5A 3TKDA 4F3GA 3TTNA 1ZBMA 1B7UA 1EH3A 3C4MA 5H8QA 5A5XB 2XX7A 3F11A 3H3GA 3C33A 5CMMA 3RTWB 4KYSA 2Z8EA 4KCDA 4OEUA 1IUDA 1CB6A 1DTZA 3B6QA 4DXBA 4F3PA 1FQCA 4YMBA 1M5BA 4OFOA 2OLBA 4U2RA 3IB2A 3UA8A 4KR5A 2I0CA 2X7QA 3KJ7A 1QUJA 2H5YA 4R74A 3C31A 1Y9UA 3EHTA 1MM7A 1B2HA 1P1QA 2H9BA 2XXVA 3OELA 4H65A 3PPNA 4NF4B 1FW0A 1Y4TA 2ANJA 2Q89A 1LCTA 4EF1A 1O63A 4LQ2A 3OO8A 2P0SA 3FV2A 4F2QA 4OVJA 2A5TA 1AOVA 3CFXA 3FVGA 1MY0A 1OVTA 1N04A 3IOWA 4KPTA 3L6GA 4R75A 1JW1A 3TTKA 4F1VA 1MPDA 3H6TA 2PX1A 3MP8A 4FIMA 4M4GA 3B6TA 4P0GA 1JEUA 1FQFA 1MPBA 1YTVA 2ESNA 3R6UA 3TDJA 4F1UA 3TPAA 3PMVA 1BKAA 2UVIA 4LP2B 3GXAA 4QSCA 3ZS6A 3IX1A 1S50A 3BFTA 1I6QA 1SW1A 3G3KA 5A5XA 1XVXA 1PBPA 3U1OA 2DYXA 2O7UA 3O97A 1MXUA 3LUYA 2QSXA 4LONB 3PUVE 5EHSA 1OLAA 3M3LA 3CR9A 3E13X 3OSQA 4ZZEA 1UTBB 3TYHA 2F8DA 3O66A 4RPOA 4BDMA 3QSLA 3W15C 3UGWA 5JTYB 1EZPA 1O7TA 3U94A 1FQBA 2V3QA 3WAFA 1R9LA 3M3KA 4EQ7A 3OEMA 1SD3A 1URDA 1MDP1 2RKMA 1IXCA 4IGTA 2HFBA 2DXRA 4I8CA 4OERA 3FATA 5ITPA 1MH4A 2ONRA 3PUWE 3TFLA 3K01A 4THIA 2DWHA 4GL0A 5TU0A 4PE5B 1NL5A 1CE2A 1M5FA 3K1NA 3MZ1A 5H8FB 3WAEA 1SYIA 2Y84A 5CM6A 1FQDA 4YICA 3KOTA 3KSXA 1LAFE 1VR5A 1MQHA 4G68A 4N6PA 2D3IA 3N6TA 1RYOA 2R9JA 3U72A 4KCCA 4WXJA 4OESA 4F2OA 2NXOA 3KJTA 4MLVA 4YKIA 1SW2A 3O9PA 3MW0A 1RKMA 1ZIUA 4QF9A 5FHNA 3V89B 1FTMA 2LAOA 3H7MA 4RNSA 1II5A 1JVYA 4R72A 4U1OA 3TCFA 1MY4A 3FVOA 2M8CA 4QFNA 3VLVA 4GFRA 1JW4A 5ICTA 1ATGA 3N5LA 1VSOA 3ODBA 5CRYA 3PPQA 4RK2A 3K6UA 2NUVA 2DVZA 4NWDA 2QMXA 2VHAA 2XXTA 3IOTA 3OD7A 3QK6A 3MZ9A 4NEDA 3N6UA 4XXUA 4F29A 4DDDA 1LBCA 2OJTA 3MVZA 1SDXA 3PUXE 5AA2D 2V84A 3H6WA 4IY6A 1M5DA 2GHAA 4JWXA 4L17A 4BLAA 4ELOA 5DYHA 4ECFA 2DS9A 2XXPA 3IJXB 4KQPA 5DVIA 1SQYA 2O84X 2OZZA 3C9HA 3AXFA 1FTLA 4RY1A 4HW8A 4Z7EA 1TFDA 4Q0CA 4DLDA 1FQEA 1IEJA 1XT8A 1XS5A 2DE4A 3IR1A 3OO6A 4GD5A 4QFKA 1KWHA 2XD2A 3FVKA 4ZECA 2F97A 2QPQA 3GLBA 5TP9A 1BIYA 2I58A 1LAXA 3IL1B 1LBBA 1D3KA 3EQ1A 5H8NA 3THIA 1M5CA 4AB6A 4F19A 5I59B 3G7WA 5ISUA 3GZGA 1URGA 1Y20A 1Y3PA 3K1PA 4PQJA 4XTCQ 1PB8A 1B05A
chains in the Genus database with same CATH superfamily
5I56A 4GLIA 1XI6A 4EXLA 2QS1A 2G29A 1Z7NE 4UABA 2I4CA 2DP8A 3TZAA 2XWIA 4F18A 4KD5A 1Y1ZA 1K9ZA 3E4RA 3MWBA 4XIGQ 3DLNA 1NH7A 3ZKLA 4DCXA 1S9TA 2PMSA 2QVVA 3PV0E 1WVJA 2ONSA 3D4CA 5IAIA 3IO4A 4GF8A 3K6WA 1KA1A 1R9QA 4MEVA 1AL3A 1MQDA 4H46A 4PGNA 4P3LA 1NV7A 4NF0A 1P1UA 4G4PA 5H8FA 2DXYA 3T22A 3KBRA 3T93B 4N91A 2Y7WA 3UIFA 2CMOA 1FQAA 2HXRA 2O1LA 4OENA 3MAMA 2ZZVA 4F1YA 4G8HA 4IO2A 5K2XA 1FPGA 1LAHE 4PP0A 3HHFA 1B5JA 2WYKA 1B6HA 1ZKBA 1MQJA 3FGSA 1HSJA 3A3CA 3HV1A 4JVCA 2UXAA 2XXWA 4IO3A 3SEXA 3TEPA 1PC3A 4P8BA 2PVUA 3QIMA 2CZHA 4YKKA 3QYTA 1YPNA 1OQGA 4GWZA 2XWOA 4IO4A 1WODA 4O94A 5A5LA 2KR0A 1LSTA 2XXYA 1Q35A 4E0WA 1Y1MA 5I2KA 5ESYA 4XKNA 4NMYA 5DVJA 2I3VA 2QFLA 2HAUA 3RPLA 3IFCA 1FJ9A 4QSEA 2HZKA 4GOTA 1Y3QA 4KI0E 1VFDA 4KYDA 3I5OA 4MNCA 5L9OA 1YZ0A 1L5TA 4ZEFA 1FCKA 4I62A 3JV9A 1UIVA 3HPIA 3K0VA 3KSJA 1A40A 3IJOB 2VD2A 3U65A 4PFUA 1POTA 3CI8A 1NV0A 1FPDA 3TTMA 1D9VA 1OLCA 4JVDA 1B5HA 4RPNA 5I57A 3RPWA 4OFLA 4P11A 1MY1A 4Z0IA 4RA1A 2RINA 3G3HA 1IMAA 3SERA 4MNPA 4O7MA 1QJMA 2OWSA 1NUXA 4OEVA 5KDTA 2B3BA 4TOZA 3K4UA 3V5AA 4QSDA 3RN8A 1H43A 5I5PA 1J1NA 2ZYKA 2VGQA 3K6VA 3PD9A 2FYIA 3SEYA 4PAIA 3S4UA 3EPEA 1PBQA 4PDHA 4YU0A 2H4IA 1IIWA 5FTIA 1USYH 4RK9A 5DVFA 1QW0A 1B46A 1POY1 3B7DA 4ESWA 4KHZE 3GBBA 1FBEA 4X8RA 1B3HA 2P3NA 2X26A 1M5EA 3MP6A 3B8BA 2HQ0A 2WBBA 1N0TA 4I9DA 3MJNA 5I58A 3TUSA 2QVRA 2PBWA 2PCRA 3GYYA 4TLMB 3DP4A 4H8IA 2O68A 2F3DA 1GTKA 4EF2A 5T3JA 2HEUA 2RC8A 3DM0A 1N84A 2Z22A 4QFPA 2Z8DA 2F6PA 4P0IA 3TTLA 3MUQA 1SW5A 1FTJA 4F22A 4TLLB 5I2NB 1GV8A 1DMBA 2Q2AA 3KN8A 2Q2CA 2D21A 4GX3A 4GL8A 3E3KA 3E78A 3UK4A 3CFLA 1SI1A 2XX8A 1UIUA 4F3SA 4MHFA 5ELVA 1ZTYA 2OWTA 2I49A 4F39A 1YCJA 3OXNA 4OHNA 3T96B 3PPPA 3RUMA 4N13A 4IGRA 5H8NB 1MRPA 2ZMBA 5I2NA 5KZTA 1FTAA 3LSWA 2F5XA 3S9LC 2ZYMA 1LBYA 3HSTA 3OO7A 5AA4A 4PBHA 1DPEA 1YAEA 1I69A 4P1LA 2YPNA 5IZZA 4IO5A 3DELB 4DCYA 4R9FA 3VFJA 2XWKA 3IK6B 2YJPA 1JETA 2V3TA 1LFIA 1JNFA 4ESXA 4I3YA 2F3BA 2UVGA 2F6GA 5AE4A 2O1MA 3TKDA 5IZ1A 1DTZA 3B6QA 4GX4A 4F3PA 2OLBA 3UA8A 2X7QA 3KJ7A 1JP4A 4H65A 2XXVA 1FW0A 4EF1A 4IR8A 1O63A 2P0SA 4F2QA 2B4MA 2MKZA 1N04A 3TTKA 3MP8A 3B6TA 1JEUA 3TDJA 3TPAA 1S50A 1SW1A 2ZZWA 1MXUA 3E79A 3M3LA 3CR9A 3O66A 1EZPA 3U94A 1FQBA 3WAFA 3M3KA 1URDA 4I8CA 2RKMA 1IXCA 4OERA 3TFLA 4THIA 5TU0A 1CE2A 3K1NA 3MZ1A 2Y84A 3KOTA 1VR5A 4G68A 1EYKA 4PDDA 2NXOA 1SW2A 4N81A 4R72A 4RK2A 2NUVA 4NWDA 2XXTA 4XXUA 4DDDA 1SDXA 4L17A 1M5DA 2GHAA 4BLAA 2XXPA 1SQYA 3AXFA 1FTLA 1TFDA 1FQEA 1BK4A 1IEJA 1XT8A 1FRPA 3FVKA 1IMCA 3GLBA 1BIYA 1LBBA 4F19A 3GZGA 1NUWA 1URGA 1Y3PA 1PB8A 1B05A 3U93A 3SDFA 4ZE9A 2P2AA 3MQ9A 5AA1A 1QUIA 1URSA 5TPAA 1TFAA 3Q27A 3TMGA 2AL4A 4BDLA 5JEIA 4LUBA 4ZZAA 3TELA 1NV5A 2I0BA 2NWJA 3OOAA 1D4NA 5H8SA 1FPJA 3MP1A 2BJIA 1A8FA 4PTKA 2UYFA 4R6HA 5BWJA 1ZMGA 1FTOA 2DDKA 2DOJA 1R6ZA 4N6KA 1NNKA 1MPCA 4NF4A 4POWA 4OWDA 1Z7ME 3C32A 4RYAA 3Q28A 3Q26A 1UTHB 2ZXTA 1H3DA 1GGGA 3H06B 1N3WA 2H98A 1G0IA 1UTBA 5EYHA 2OCUA 4YKJA 4GWWA 2NOOA 2PYYA 3LR1A 1QVSA 1EYIA 3GBAA 4BDOA 1LB8A 4UA8A 1LEVA 2F34A 4HCYA 3T1BA 2JJKA 2ONKE 1MXWA 3I3VA 4QBAA 1N3XA 3ECRA 1USYE 4I3EA 1A8EA 3OO9A 3C36A 3ZSFA 1B40A 4XF5A 3OMBA 4JWYA 5J1DA 1P99A 1NV4A 1QKBA 3KG2A 3PUYE 3T66A 2I4BA 2B65A 2VPOA 5ET6A 3BIGA 3QXMA 4X1DA 1MG1A 4AS4A 3HO7A 5CBSA 2Z23A 1PB7A 3A09A 3Q29A 4X04A 4IB2A 3FXUA 5I3SA 5B70A 3BIHA 3FZVA 1FTKA 1DTGA 1SI0A 1XOCA 3HN0A 5I84A 1P1WA 3EF7A 5I57B 2F7AA 2B3FA 3HCQA 4G8NA 2F7BA 5LOMA 2E0SA 3G3GA 1Q9DA 2XA5A 1OVBA 5ITOA 1DSNA 1MY3A 5EHMA 4R73A 3FBPA 3RT8A 5CMKA 4BDRA 4OETA 1SBPA 4ELQA 4P1EA 1N7WA 4WEPA 4JXIA 3ROJA 4PAKA 5FHOA 5DT6A 1TWYA 2UVHA 2GFEA 1NUZA 4ZEDA 3W9WA 2O51A 4YB7A 3CG3A 5EQ8A 2V93A 3PPRA 1QKAA 3T9VA 4ZEKA 4OVRA 5L9SA 4H5GA 4FEDA 1EU8A 4G68C 2AIXA 4G68B 4MLQA 1NNTA 4FEBA 1ELJA 3T9HB 3R7XA 4KFQA 5AA2A 1BP5A 1DCUA 3VXBA 4FORA 3TODA 4N4UA 4NF8B 3KC0A 2QMWA 3RTFB 3H03A 1GVCA 1SPIA 1SVXB 4U21A 4X1BA 5I58B 1B5IA 2Q88A 4OXVA 3UORA 1LGBC 4HXVA 1NMUA 3KN3A 1YYZA 1JW5A 3RGYA 1QULA 5HPQA 2Y5KA 1MXYA 2HCAA 3NOHA 5AA2B 4RJZA 3SZPA 1EZOA 1B4HA 4G2ZA 1N7XA 2AYSA 1D9YA 1UQWA 4MAGA 1NH8A 3MYUA 2ZNTA 1T0KA 2WYPA 3FUZA 4JWOA 1IXHA 2BJJX 1TT1A 4ZEBA 2RC7A 3IB0A 4Q5TA 4OZ9A 4OANA 1S7YA 1JVXA 5H8QB 2UYEA 2XXHA 1MQIA 2H99A 4PFWA 5TPAB 5B7DA 5L8DA 4U22A 3OENA 1Q1KA 4HE2A 5F7VA 1US5A 1JQFA 3MVYA 1H45A 5KDTB 3CRBA 3SEVA 4NTLA 3EN3A 3FD3A 2DE3A 1B3EA 1HSEA 2Q74A 5IGAA 5EYGA 2HXWA 4LQ5A 4F3GA 3TTNA 1EH3A 5FBPA 5H8QA 5A5XB 2XX7A 3F11A 5CMMA 4DI3D 4PBQA 4DXBA 4PF6A 1FQCA 4U2RA 2I0CA 4R74A 3C31A 1Y9UA 2H9BA 1P1QA 4NF4B 4LQ2A 3OO8A 3FV2A 1AOVA 3FVGA 1FQFA 1YTVA 3PMVA 4QSCA 3ZS6A 1I6QA 5A5XA 3LUYA 3PUVE 3D1RA 1OLAA 3E13X 3TYHA 3QSLA 3W15C 1MDP1 2QVUA 2DXRA 4NAPA 5ITPA 2HPGA 4OVSA 3K01A 2DWHA 4GL0A 1NL5A 4PF8A 5CM6A 5LTCA 4YICA 1LAFE 4O7IA 4NG7A 4WXJA 4MMPA 4OESA 3O9PA 3MW0A 1RKMA 1LBXA 5FHNA 3CHGA 3H7MA 4RNSA 2ZZXA 4QFNA 1IMDA 1ATGA 1VSOA 2VHAA 3QK6A 3IOTA 3MZ9A 3N6UA 2OJTA 3PUXE 3H6WA 3B50A 5DVIA 2OZZA 4HW8A 1FBPA 3OO6A 3IR1A 1XS5A 2QPQA 3EQ1A 5H8NA 5ISUA 5I59B 3K1PA 4XTCQ 3MVXA 1VE4A 3S9MC 2REJA 3LBSA 4Q8RA 4GBWA 3B6WA 4AS5A 3CG1A 3T9UA 4HE1A 1MQGA 1NV3A 4ISUA 2B4LA 1NNFA 1P1OA 4ONYA 3PMXA 3QAXA 4G77A 2VT5A 5I59A 3VLUA 4TQUQ 4ELPA 1MM6A 2D5WA 3IFAA 4GRKA 1IMEA 5J16A 3CIJA 4GWYA 2O7IA 4OMBA 3O6GA 4I1DA 2CZKA 2RCAA 3K1MA 1B0LA 3MPKA 4U23A 4HCWA 4ZEIA 2DQVA 1VDWA 4PC9A 3JYRA 2VOZA 4OQOA 2XX9A 1RDZA 2A5TB 4DXCA 1LCFA 4JVIA 1NI9A 5DEXA 1IITA 1IMFA 4R2FA 4IY5A 2KLFA 2QS2A 2XXXA 4NE4A 3CFZA 2HZLA 2QS4A 2W7YA 5CBRA 2OX3A 4H6DA 1B3LA 2PFZA 4C1TA 4LA9A 1K9YA 2VD3A 3E9XA 4XKRA 4O3BA 1EYJA 2DE2A 4H67A 2ZNSA 5HBCA 3LC8A 4H8JA 3TAJA 1INPA 3BFUA 5F24A 4NF5B 4LZ5A 4U1ZA 3FVNA 1VFEA 3CSGA 4WKMA 4XKQA 4C0RA 4EXKA 3PGFA 5L9MA 4JBZA 4GWXA 5M2VA 4OVPA 5JK4A 1DBZA 4R2BA 2QL3A 3RQTA 4PETA 2O69A 5IZ3B 1FSAA 5JTYA 3SEUA 3EKIA 4FE8A 3CVGA 1AIVA 2ZYNA 3Q25A 3KGCA 3TQLA 3UN6A 4NF5A 2FVZA 2F78A 2F36A 4ELRA 4N07A 1TXFA 1MS7A 5CMCA 4NHBA 3D4GA 3I6VA 1F9BA 1FBCA 4AQ4A 3IOUA 4MF3A 3RNNA 1B7HA 2QRYA 3FJGA 3LSXA 1DOTA 3PUZE 2Y7IA 3A3UA 2UVJA 2CZIA 2Y7KA 1O64A 3M8UA 3PD8A 4X9TA 2A5SA 1A54A 4YZZA 3VVFA 1AH5A 2O6AA 2V25A 1FPBA 3K02A 5K2YA 3LSLA 4QXDA 3SESA 4GVOA 1B58A 5H8HA 4N6DA 3H6UA 3MPLA 1LFGA 5IKBA 4LZ8A 1NV6A 1SW4A 3G3JA 1B7ZA 4IO6A 4M1VA 1US4A 4OFJA 5I2KB 3QUJA 3PU5A 5KCJB 5CI5A 3EHSA 3VVDA 4EUOA 2R6GE 4GWOA 1A55A 2OK2A 3PMWA 3VXCA 4HTGA 1QGXA 5HM4B 4KYEA 4GBVA 2L5VA 2X7PA 4MCOA 3SKPA 2I3WA 1A99A 1LBZA 3HFUA 4NWCA 4FJPA 1AMFA 4BDQA 4JSOA 3S9NC 1B1HA 3FV1A 2XD3A 3BBRA 3R26A 4O8MA 2F7CA 3JZJA 2QJEA 2P1SA 3C35A 2PT1A 4PFYA 4NF6B 2XWVA 4H5FA 2F35A 4LZ7A 4WEDA 1H76A 2H25A 1NKXA 4OTEA 3KOSA 1Y4CA 3O29A 4G8MA 2XXUA 1IXGA 2GHBA 2ABHA 4NQ8A 1B3FA 2IEEA 3FXRA 3C34A 3K2DA 3O6HA 4GXAA 2I6EA 3FJ7A 2RCBA 1PDAA 1AWBA 4DE8A 4F31B 4H0WA 3QUFA 4ZE8A 4O3AA 2Q9TA 4C1UA 2R8TA 1PB9A 3P7IA 2DWJA 4MIJA 2OBGA 4ZS9A 4F3BA 2QS3A 3T9XB 2Y7RA 1B7UA 4KYSA 4KCDA 4OEUA 1IUDA 1CB6A 2WBDA 4MJOA 4KR5A 2H5YA 2CEYA 4YKIA 4PGPA 1Y4TA 2ANJA 4GWUA 2Q89A 4PFRA 2A5TA 3CFXA 1MY0A 1OVTA 4KPTA 3IOWA 3L6GA 4R75A 1MPDA 4M4GA 2PX1A 4P0GA 3RPLB 2ESNA 2UVIA 3IX1A 1PBPA 2DYXA 2O7UA 2QSXA 4LONB 1LBWA 3OSQA 4ZZEA 2F8DA 4RPOA 5JTYB 2V3QA 1SD3A 4IGTA 4H45A 1MH4A 2ONRA 3T0JA 1SYIA 2D3IA 3N6TA 1RYOA 2R9JA 3U72A 4MLVA 4QF9A 3V89B 1ZIUA 2LAOA 1JVYA 3PTYA 3TCFA 1MY4A 2M8CA 3N5LA 3ODBA 3PPQA 2QMXA 4NEDA 1LBCA 3MVZA 5IM2A 2V84A 5DYHA 4ECFA 2DS9A 4KQPA 2O84X 3C9HA 4Q0CA 4DLDA 4GD5A 3KBZA 1KWHA 2XD2A 4ZECA 1LAXA 3IL1B 4AB6A 1M5CA 3G7WA 4PQJA 2WKYA 3N26A 1NNPA 4P56A 1ZU0A 4PCDA 5FTHA 1P1NA 2P3VA 4PE3A 1B0HA 1BLFA 3H4ZA 2G93A 3QMFA 4R6KA 2FIXA 4JDFA 3TCGA 3VLWA 1LB9A 3OEKA 4QRZA 4LATA 2DSFA 3LUZA 2E1SA 3EHUA 1B4ZA 1FPLA 2Y7PA 4YKPA 2NVUB 2DVCA 3DP6A 3LV0A 2RF1A 2DWAA 4U4XA 1B52A 5H8HB 4XKPA 3CSBA 3K00A 3FXBA 2XXRA 3S9EA 3V8XB 3N94A 2YLNA 2XXQA 5FHMA 2Q8JA 1B9JA 4XEQA 5ET8A 1I6BA 1FPKA 4QFLA 5I7IA 4QFOA 5LDZA 2THIA 1I6AA 1LFHA 2AL5A 1N76A 4FAJA 4GWSA 3M3FA 3ZKKA 3KEIA 4G61A 1GR2A 5ICQA 4N8GA 3U8QA 1D9QA 2WX9A 1MDQA 1NV1A 3UP9A 1OMPA 4GQOA 3IO6A 1IXIA 3KZGA 2Y5LA 1FBDA 3G3IA 3DP8A 3KN7A 1FPFA 1MH3A 2ALUA 3TQWA 5EYFA 4FECA 1B51A 2DWIA 4DXUA 1OIBA 2RC9A 3IORA 4FBPA 1DK4A 1WDNA 3LSFB 1Y3NA 3BKIB 3W9VA 2Q8MA 5AA3A 1IQ7A 4MH5A 4O3CA 4U4SA 3MBPA 3VDFA 3L6HA 3FIRA 1SYHA 4JB7A 4KXPA 1MXZA 2VPNA 3MC2A 2HAVA 4GXSB 2FHYA 3MZBA 1MXXA 1ZLQA 3RY3A 4PAFA 2I48A 4DZ1A 1QUKA 4JSDA 1RYXA 3OSRA 2VP1A 5EQAA 4EDPA 5CC2A 3MVWA 4POXA 2XXIA 4MFIA 3SETA 4NN3A 3ONMA 4DI4B 5DTBA 2IA4A 1LLSA 3ILTB 1PEBA 3ILUB 3SEWA 2KQZA 2XHDA 5TP9B 4PFBA 3O2AA 4YMAA 1LAGE 4GIZA 4YAHX 2Z8FA 2GRVA 2FA7A 5I56B 2ZNUA 4AB5A 1G0HA 4RXLA 1ZJLA 5EQ9A 2XXKA 1MXVA 3IAZA 2PT2A 5KCJA 1H44A 2OWZA 2GH9A 3RLFE 3ISPA 4MX6A 3IOVA 4OA4A 1B1XA 1XC1A 4QHQA 3RT6B 5CMBA 5ET5A 1OQHA 1A7LA 2V4CA 5DW8A 1EZ9A 1R1NA 4DIGA 1B32A 5ET7A 1B3GA 1NFTA 1DPPA 4P47A 5EQ7A 4X48A 4EQBA 5F1QA 3USDA 2GQ1A 1CNQA 1KA0A 1FBGA 2HHMA 3VE1B 1ANFA 4LN5A 3VVEA 2FNCA 4R6YA 2CEXA 4PFIA 4Q30B 4OYVA 2V3UA 4NX1A 4YB5A 3O6IA 3TCHA 2R71A 5DEXB 5IZ3A 2FBPA 2REGA 3KFMA 3G3FA 4NF6A 1BTJA 3O28A 4H1XA 4PFTA 4ND9A 3FXQA 3HHGA 4YB6A 4I40A 4K3FA 4MBPA 1JEVA 1RDYA 3KC1A 4BDNA 3S2VA 3VV5A 4OVQA 1UTHA 3IB1A 1MY2A 1FPEA 4ZDMA 4N17A 1XHYA 2WEFA 4N15A 4HS7A 1HSLA 4LVQA 4IO7A 4OVTA 4R9GA 4UACA 1XVYA 2CZLA 3H6VA 5AA4B 4E0XA 4NF8A 3PPOA 3A29A 1IMBA 3U92A 1KZ8A 3V83A 3FJMA 3K6XA 1FJ6A 1NUYA 4EQ9A 1IZ1A 2ZYOA 3FASA 1NV2A 3TTRA 4FATA 1ZBMA 1RDXA 3C4MA 3H3GA 3C33A 3RTWB 2Z8EA 2FIEA 4YMBA 1LBVA 1M5BA 4OFOA 3IB2A 1QUJA 3EHTA 1MM7A 1B2HA 3OELA 3PPNA 1LCTA 4NGUA 3RYDA 4OVJA 4XFEA 1JW1A 4F1VA 3H6TA 4FIMA 1MPBA 3R6UA 4F1UA 1BKAA 4LP2B 3GXAA 1FBFA 4GX6A 3BFTA 3G3KA 1XVXA 3U1OA 3O97A 1FPIA 5EHSA 1UTBB 4BDMA 3UGWA 1O7TA 3MSTA 1R9LA 4EQ7A 3OEMA 2HFBA 3FATA 4P9KA 3PUWE 4PE5B 3WAEA 1M5FA 5H8FB 1FQDA 3KSXA 1MQHA 4N6PA 4KCCA 4F2OA 3KJTA 1FTMA 1II5A 4U1OA 3VLVA 3FVOA 4GFRA 1JW4A 5ICTA 5CRYA 3K6UA 2DVZA 3OD7A 4F29A 5AA2D 4IY6A 4JWXA 4ELOA 3IJXB 4HE0A 4RY1A 4Z7EA 1FBHA 4N8YA 4QFKA 2DE4A 1YXIA 4MNIA 2F97A 5TP9A 2I58A 3THIA 1D3KA 1Y20A 2PFYA 5BUUA
chains in the Genus database with same CATH topology
5I56A 3U93A 3SDFA 3MVXA 4ZE9A 4GLIA 1VE4A 2P2AA 3S9MC 2WKYA 3N26A 1NNPA 3MQ9A 1ZU0A 5FTHA 2REJA 1P1NA 4EXLA 2QS1A 1QUIA 2G29A 5AA1A 1URSA 1Z7NE 3LBSA 5TPAA 2I4CA 4Q8RA 1TFAA 1B0HA 2DP8A 1BLFA 3H4ZA 3Q27A 2G93A 3TZAA 4F18A 3B6WA 3TMGA 2AL4A 4KD5A 4R6KA 3CG1A 3T9UA 4BDLA 4JDFA 1MQGA 1Y1ZA 4ISUA 3E4RA 5JEIA 3TCGA 3MWBA 4LUBA 3VLWA 4XIGQ 3DLNA 1NH7A 3ZKLA 4ZZAA 1NNFA 1P1OA 3TELA 1S9TA 4DCXA 4ONYA 1LB9A 2I0BA 2PMSA 3PV0E 1WVJA 3OEKA 2ONSA 3D4CA 2NWJA 3PMXA 3QAXA 4QRZA 4LATA 4G77A 3OOAA 1D4NA 5H8SA 5I59A 5IAIA 2DSFA 3IO4A 4GF8A 3VLUA 3K6WA 4TQUQ 4ELPA 2E1SA 3EHUA 1B4ZA 1MM6A 3MP1A 2D5WA 1A8FA 2Y7PA 4GRKA 4YKPA 1R9QA 2NVUB 2UYFA 3CIJA 5J1DA 1AL3A 1MQDA 4R6HA 5BWJA 2DVCA 2O7IA 4OMBA 3DP6A 1ZMGA 2RF1A 2DWAA 4U4XA 1FTOA 3O6GA 4I1DA 1B52A 2DOJA 2RCAA 3K1MA 4XKPA 1B0LA 5H8HB 3CSBA 3K00A 3MPKA 4OFLA 1R6ZA 4U23A 4HCWA 1NNKA 4ZEIA 2DQVA 2XXRA 1MPCA 4NF4A 1P1UA 3S9EA 4POWA 4OWDA 1Z7ME 3V8XB 3C32A 3JYRA 4RYAA 3Q28A 4G4PA 2VOZA 3N94A 2YLNA 2XXQA 5H8FA 2DXYA 4OQOA 5FHMA 2XX9A 3KBRA 2A5TB 2Q8JA 3T22A 4DXCA 1B9JA 3Q26A 1LCFA 5DEXA 1UTHB 2ZXTA 3T93B 1I6BA 1IITA 2Y7WA 1H3DA 4R2FA 3UIFA 4IY5A 2CMOA 1FQAA 1GGGA 2KLFA 2QS2A 4QFLA 2XXXA 2O1LA 3CFZA 3H06B 1N3WA 4NE4A 2H98A 2HZLA 2QS4A 4OENA 4QFOA 5ITOA 1UTBA 2W7YA 3MAMA 2OCUA 4YKJA 4F1YA 2THIA 4G8HA 5CBRA 4IO2A 4H6DA 2NOOA 5K2XA 1B3LA 1I6AA 1LAHE 4PP0A 1LFHA 2AL5A 2PYYA 4C1TA 1N76A 3HHFA 4FAJA 4LA9A 1B5JA 3LR1A 2VD3A 3E9XA 3M3FA 4XKRA 4O3BA 3ZKKA 3KEIA 1B6HA 1QVSA 1ZKBA 1MQJA 1GR2A 2DE2A 3FGSA 1HSJA 3A3CA 3GBAA 3HV1A 3U8QA 5ICQA 4BDOA 1LB8A 4UA8A 2UXAA 4H67A 2ZNSA 1MDQA 5HBCA 2XXWA 1OMPA 2F34A 4GQOA 4HCYA 3IO6A 3LC8A 4IO3A 4H8JA 1IXIA 3SEXA 3TEPA 1PC3A 3KZGA 3TAJA 4F3SA 2PVUA 3QIMA 3G3IA 2ONKE 3DP8A 1MXWA 3I3VA 4YKKA 3KN7A 2ALUA 1MH3A 3QYTA 1YPNA 3TQWA 3BFUA 1N3XA 5EYFA 3ECRA 4FECA 1USYE 4NF5B 1OQGA 4LZ5A 4U1ZA 3FVNA 1A8EA 1VFEA 4IO4A 1WODA 5BUUA 3OO9A 3C36A 3CSGA 4WKMA 3ZSFA 1B40A 1B51A 2DWIA 3OMBA 4DXUA 1LSTA 2XXYA 4JWYA 4XKQA 4C0RA 3PGFA 1Q35A 1OIBA 5L9MA 1Y1MA 1P99A 4E0WA 4EXKA 1QKBA 2RC9A 3IORA 3KG2A 3PUYE 4JBZA 5I2KA 3T66A 2I4BA 4XKNA 2B65A 5M2VA 4NMYA 5DVJA 2I3VA 1WDNA 5JK4A 4R2BA 2HAUA 3LSFB 3QXMA 4QSEA 4X1DA 1Y3NA 3BKIB 2HZKA 2QL3A 1Y3QA 4GOTA 3W9VA 5AA3A 1IQ7A 1MG1A 4MH5A 4KI0E 3RQTA 4PETA 2O69A 1VFDA 3HO7A 4KYDA 5CBSA 5JTYA 2Z23A 1PB7A 3I5OA 4O3CA 4U4SA 3A09A 4FE8A 3SEUA 3CVGA 1L5TA 5L9OA 3Q29A 1FCKA 4ZEFA 2ZYNA 4IB2A 3FXUA 3Q25A 3MBPA 3KGCA 4I62A 3VDFA 1AIVA 3L6HA 3TQLA 3FIRA 3UN6A 1SYHA 3JV9A 4JB7A 4NF5A 5B70A 1UIVA 3HPIA 1MXZA 3FZVA 2F78A 3K0VA 1A40A 3IJOB 3KSJA 3MC2A 2F36A 1FTKA 1DTGA 1SI0A 2HAVA 4GXSB 1XOCA 2VD2A 3HN0A 3MZBA 4ELRA 5I84A 1P1WA 4N07A 3EF7A 1POTA 4PFUA 3CI8A 1MXXA 1TXFA 1ZLQA 3RY3A 1MS7A 2I48A 5I57B 3TTMA 1D9VA 5CMCA 1QUKA 1OLCA 3D4GA 4DZ1A 3I6VA 2F7AA 2B3FA 3HCQA 4JSDA 4G8NA 1B5HA 1RYXA 3OSRA 4RPNA 5I57A 2VP1A 1F9BA 2F7BA 3RPWA 4AQ4A 4EDPA 5LOMA 3IOUA 2E0SA 4MF3A 3RNNA 5CC2A 3MVWA 3G3GA 1B7HA 2QRYA 3FJGA 1OVBA 1DOTA 3LSXA 1MY1A 3PUZE 4POXA 1DSNA 2Y7IA 4Z0IA 1MY3A 5EHMA 3A3UA 4R73A 2UVJA 4RA1A 3RT8A 5CMKA 2XXIA 2RINA 4BDRA 4MFIA 3SETA 2Y7KA 4OETA 1O64A 3ONMA 3G3HA 1SBPA 3M8UA 3PD8A 3SERA 4ELQA 1QJMA 2OWSA 1N7WA 2IA4A 5DTBA 4WEPA 4JXIA 4X9TA 5FHOA 1LLSA 4OEVA 5KDTA 5DT6A 3ILTB 1PEBA 2B3BA 1TWYA 3ILUB 3SEWA 2UVHA 2GFEA 3K4UA 4TOZA 3UP9A 2A5SA 1A54A 4YZZA 3VVFA 4ZEDA 2XHDA 1AH5A 5TP9B 3W9WA 2O51A 3V5AA 3O2AA 4YMAA 4QSDA 2O6AA 1LAGE 2V25A 4GIZA 4YB7A 3RN8A 3CG3A 3K02A 3LSLA 5K2YA 2V93A 3PPRA 4YAHX 3SESA 4GVOA 1H43A 1B58A 1QKAA 2GRVA 2Z8FA 5H8HA 2FA7A 5I56B 2ZNUA 4ZEKA 3T9VA 4AB5A 5L9SA 1J1NA 2ZYKA 4H5GA 3H6UA 3MPLA 4FEDA 4RXLA 1EU8A 1LFGA 1ZJLA 4G68C 5IKBA 1MXVA 2VGQA 4LZ8A 3IAZA 1SW4A 2AIXA 4G68B 3G3JA 3K6VA 3PD9A 2FYIA 4MLQA 1NNTA 3SEYA 3S4UA 1B7ZA 4IO6A 3EPEA 1PBQA 4FEBA 1ELJA 4YU0A 3T9HB 3R7XA 4M1VA 1US4A 4OFJA 2PT2A 2H4IA 5I2KB 1IIWA 4KFQA 5FTIA 5KCJA 1H44A 1USYH 2GH9A 3QUJA 4RK9A 3RLFE 5DVFA 1BP5A 5AA2A 1QW0A 3VXBA 4FORA 1B46A 4P11A 1POY1 3IOVA 3PU5A 5KCJB 3TODA 5CI5A 3B7DA 4ESWA 1B1XA 1XC1A 4KHZE 4NF8B 3GBBA 4QHQA 3EHSA 3RT6B 2QMWA 3VVDA 3RTFB 1B3HA 3H03A 5CMBA 1GVCA 4EUOA 2X26A 1M5EA 4U21A 1SVXB 4X1BA 2R6GE 1OQHA 1A7LA 4GWOA 3MP6A 1A55A 2HQ0A 2OK2A 3PMWA 5I58B 1B5IA 2Q88A 1N0TA 4OXVA 1EZ9A 1R1NA 4I9DA 1B32A 3UORA 1LGBC 3MJNA 3VXCA 4DIGA 4HTGA 1B3GA 1NFTA 1DPPA 5I58A 3TUSA 2PBWA 1NMUA 3KN3A 5HM4B 4KYEA 1JW5A 4X48A 3RGYA 4EQBA 5F1QA 4TLMB 1QULA 2X7PA 3USDA 3DP4A 4H8IA 3SKPA 5HPQA 2I3WA 1MXYA 2HCAA 3VE1B 2O68A 1A99A 1ANFA 4NWCA 5AA2B 1GTKA 4EF2A 3VVEA 2FNCA 2HEUA 2RC8A 3DM0A 1N84A 4R6YA 2Z22A 4Q30B 4QFPA 4FJPA 4RJZA 2Z8DA 2F6PA 4P0IA 1AMFA 3TTLA 4JSOA 4BDQA 3S9NC 1B1HA 3MUQA 1SW5A 2XD3A 1FTJA 3FV1A 3BBRA 1EZOA 4F22A 1B4HA 4G2ZA 4OYVA 3R26A 4TLLB 1N7XA 2AYSA 2V3UA 4YB5A 3O6IA 5I2NB 1D9YA 1DMBA 2R71A 1UQWA 5DEXB 2F7CA 3JZJA 2Q2AA 1GV8A 3TCHA 1NH8A 2QJEA 3KN8A 2Q2CA 2REGA 2ZNTA 2D21A 2P1SA 3KFMA 3G3FA 4GL8A 1T0KA 4NF6A 1BTJA 3C35A 3E3KA 2PT1A 3UK4A 3FUZA 4JWOA 3CFLA 4PFYA 1SI1A 3O28A 4H1XA 1IXHA 4NF6B 2XX8A 2BJJX 4H5FA 4PFTA 1UIUA 2F35A 4LZ7A 4ND9A 1H76A 3FXQA 1TT1A 2H25A 3HHGA 1NKXA 4OTEA 4WEDA 4YB6A 3KOSA 2RC7A 3IB0A 4K3FA 4ZEBA 5ELVA 1ZTYA 4Q5TA 4OZ9A 1Y4CA 3O29A 2OWTA 1S7YA 2I49A 2XXUA 4G8MA 1YCJA 1IXGA 2GHBA 1JEVA 4MBPA 4F39A 3OXNA 4OHNA 3T96B 5AA4B 3PPPA 1JVXA 3RUMA 4N13A 4BDNA 4IGRA 3S2VA 3VV5A 2ABHA 5H8QB 1UTHA 1B3FA 1MY2A 2UYEA 2XXHA 3IB1A 1MRPA 5H8NB 2ZMBA 2IEEA 1MQIA 3FXRA 4ZDMA 5I2NA 5KZTA 1XHYA 2H99A 3LSWA 4PFWA 2F5XA 3C34A 5TPAB 5B7DA 3S9LC 2ZYMA 4HS7A 3K2DA 3HSTA 3OO7A 3O6HA 5L8DA 4GXAA 2I6EA 1HSLA 3FJ7A 4U22A 2RCBA 3OENA 4LVQA 5AA4A 4IO7A 1Q1KA 4R9GA 1PDAA 4UACA 1DPEA 1XVYA 2CZLA 4DE8A 3H6VA 5F7VA 4F31B 4H0WA 3QUFA 1YAEA 4O3AA 1I69A 1JQFA 1US5A 2Q9TA 3MVYA 1H45A 4ZE8A 4C1UA 2YPNA 4NF8A 4E0XA 5KDTB 3PPOA 1PB9A 3CRBA 3SEVA 4NTLA 3P7IA 4IO5A 3DELB 2DWJA 4R9FA 3EN3A 3FD3A 3VFJA 4DCYA 3U92A 3V83A 2DE3A 2OBGA 3FJMA 3IK6B 2YJPA 1B3EA 1JETA 3K6XA 2V3TA 1LFIA 4ZS9A 4EQ9A 4F3BA 1HSEA 1JNFA 1IZ1A 4ESXA 2QS3A 2ZYOA 3FASA 3T9XB 2HXWA 2UVGA 2F6GA 3TTRA 4FATA 2Y7RA 5AE4A 2O1MA 4LQ5A 3TKDA 4F3GA 3TTNA 1ZBMA 1B7UA 1EH3A 3C4MA 5H8QA 5A5XB 2XX7A 3F11A 3H3GA 3C33A 5CMMA 3RTWB 4KYSA 2Z8EA 4KCDA 4OEUA 1IUDA 1CB6A 1DTZA 3B6QA 4DXBA 4F3PA 1FQCA 4YMBA 1M5BA 4OFOA 2OLBA 4U2RA 3IB2A 3UA8A 4KR5A 2I0CA 2X7QA 3KJ7A 1QUJA 2H5YA 4R74A 3C31A 1Y9UA 3EHTA 1MM7A 1B2HA 1P1QA 2H9BA 2XXVA 3OELA 4H65A 3PPNA 4NF4B 1FW0A 1Y4TA 2ANJA 2Q89A 1LCTA 4EF1A 1O63A 4LQ2A 3OO8A 2P0SA 3FV2A 4F2QA 4OVJA 2A5TA 1AOVA 3CFXA 3FVGA 1MY0A 1OVTA 1N04A 3IOWA 4KPTA 3L6GA 4R75A 1JW1A 3TTKA 4F1VA 1MPDA 3H6TA 2PX1A 3MP8A 4FIMA 4M4GA 3B6TA 4P0GA 1JEUA 1FQFA 1MPBA 1YTVA 2ESNA 3R6UA 3TDJA 4F1UA 3TPAA 3PMVA 1BKAA 2UVIA 4LP2B 3GXAA 4QSCA 3ZS6A 3IX1A 1S50A 3BFTA 1I6QA 1SW1A 3G3KA 5A5XA 1XVXA 1PBPA 3U1OA 2DYXA 2O7UA 3O97A 1MXUA 3LUYA 2QSXA 4LONB 3PUVE 5EHSA 1OLAA 3M3LA 3CR9A 3E13X 3OSQA 4ZZEA 1UTBB 3TYHA 2F8DA 3O66A 4RPOA 4BDMA 3QSLA 3W15C 3UGWA 5JTYB 1EZPA 1O7TA 3U94A 1FQBA 2V3QA 3WAFA 1R9LA 3M3KA 4EQ7A 3OEMA 1SD3A 1URDA 1MDP1 2RKMA 1IXCA 4IGTA 2HFBA 2DXRA 4I8CA 4OERA 3FATA 5ITPA 1MH4A 2ONRA 3PUWE 3TFLA 3K01A 4THIA 2DWHA 4GL0A 5TU0A 4PE5B 1NL5A 1CE2A 1M5FA 3K1NA 3MZ1A 5H8FB 3WAEA 1SYIA 2Y84A 5CM6A 1FQDA 4YICA 3KOTA 3KSXA 1LAFE 1VR5A 1MQHA 4G68A 4N6PA 2D3IA 3N6TA 1RYOA 2R9JA 3U72A 4KCCA 4WXJA 4OESA 4F2OA 2NXOA 3KJTA 4MLVA 4YKIA 1SW2A 3O9PA 3MW0A 1RKMA 1ZIUA 4QF9A 5FHNA 3V89B 1FTMA 2LAOA 3H7MA 4RNSA 1II5A 1JVYA 4R72A 4U1OA 3TCFA 1MY4A 3FVOA 2M8CA 4QFNA 3VLVA 4GFRA 1JW4A 5ICTA 1ATGA 3N5LA 1VSOA 3ODBA 5CRYA 3PPQA 4RK2A 3K6UA 2NUVA 2DVZA 4NWDA 2QMXA 2VHAA 2XXTA 3IOTA 3OD7A 3QK6A 3MZ9A 4NEDA 3N6UA 4XXUA 4F29A 4DDDA 1LBCA 2OJTA 3MVZA 1SDXA 3PUXE 5AA2D 2V84A 3H6WA 4IY6A 1M5DA 2GHAA 4JWXA 4L17A 4BLAA 4ELOA 5DYHA 4ECFA 2DS9A 2XXPA 3IJXB 4KQPA 5DVIA 1SQYA 2O84X 2OZZA 3C9HA 3AXFA 1FTLA 4RY1A 4HW8A 4Z7EA 1TFDA 4Q0CA 4DLDA 1FQEA 1IEJA 1XT8A 1XS5A 2DE4A 3IR1A 3OO6A 4GD5A 4QFKA 1KWHA 2XD2A 3FVKA 4ZECA 2F97A 2QPQA 3GLBA 5TP9A 1BIYA 2I58A 1LAXA 3IL1B 1LBBA 1D3KA 3EQ1A 5H8NA 3THIA 1M5CA 4AB6A 4F19A 5I59B 3G7WA 5ISUA 3GZGA 1URGA 1Y20A 1Y3PA 3K1PA 4PQJA 4XTCQ 1PB8A 1B05A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I56 A;  3U93 A;  3SDF A;  3MVX A;  4ZE9 A;  4GLI A;  1VE4 A;  2P2A A;  3S9M C;  2WKY A;  3N26 A;  1NNP A;  3MQ9 A;  1ZU0 A;  5FTH A;  2REJ A;  1P1N A;  4EXL A;  2QS1 A;  1QUI A;  2G29 A;  5AA1 A;  1URS A;  1Z7N E;  3LBS A;  5TPA A;  2I4C A;  4Q8R A;  1TFA A;  1B0H A;  2DP8 A;  1BLF A;  3H4Z A;  3Q27 A;  2G93 A;  3TZA A;  4F18 A;  3B6W A;  3TMG A;  2AL4 A;  4KD5 A;  4R6K A;  3CG1 A;  3T9U A;  4BDL A;  4JDF A;  1MQG A;  1Y1Z A;  4ISU A;  3E4R A;  5JEI A;  3TCG A;  3MWB A;  4LUB A;  3VLW A;  4XIG Q;  3DLN A;  1NH7 A;  3ZKL A;  4ZZA A;  1NNF A;  1P1O A;  3TEL A;  1S9T A;  4DCX A;  4ONY A;  1LB9 A;  2I0B A;  2PMS A;  3PV0 E;  1WVJ A;  3OEK A;  2ONS A;  3D4C A;  2NWJ A;  3PMX A;  3QAX A;  4QRZ A;  4LAT A;  4G77 A;  3OOA A;  1D4N A;  5H8S A;  5I59 A;  5IAI A;  2DSF A;  3IO4 A;  4GF8 A;  3VLU A;  3K6W A;  4TQU Q;  4ELP A;  2E1S A;  3EHU A;  1B4Z A;  1MM6 A;  3MP1 A;  2D5W A;  1A8F A;  2Y7P A;  4GRK A;  4YKP A;  1R9Q A;  2NVU B;  2UYF A;  3CIJ A;  5J1D A;  1AL3 A;  1MQD A;  4R6H A;  5BWJ A;  2DVC A;  2O7I A;  4OMB A;  3DP6 A;  1ZMG A;  2RF1 A;  2DWA A;  4U4X A;  1FTO A;  3O6G A;  4I1D A;  1B52 A;  2DOJ A;  2RCA A;  3K1M A;  4XKP A;  1B0L A;  5H8H B;  3CSB A;  3K00 A;  3MPK A;  4OFL A;  1R6Z A;  4U23 A;  4HCW A;  1NNK A;  4ZEI A;  2DQV A;  2XXR A;  1MPC A;  4NF4 A;  1P1U A;  3S9E A;  4POW A;  4OWD A;  1Z7M E;  3V8X B;  3C32 A;  3JYR A;  4RYA A;  3Q28 A;  4G4P A;  2VOZ A;  3N94 A;  2YLN A;  2XXQ A;  5H8F A;  2DXY A;  4OQO A;  5FHM A;  2XX9 A;  3KBR A;  2A5T B;  2Q8J A;  3T22 A;  4DXC A;  1B9J A;  3Q26 A;  1LCF A;  5DEX A;  1UTH B;  2ZXT A;  3T93 B;  1I6B A;  1IIT A;  2Y7W A;  1H3D A;  4R2F A;  3UIF A;  4IY5 A;  2CMO A;  1FQA A;  1GGG A;  2KLF A;  2QS2 A;  4QFL A;  2XXX A;  2O1L A;  3CFZ A;  3H06 B;  1N3W A;  4NE4 A;  2H98 A;  2HZL A;  2QS4 A;  4OEN A;  4QFO A;  5ITO A;  1UTB A;  2W7Y A;  3MAM A;  2OCU A;  4YKJ A;  4F1Y A;  2THI A;  4G8H A;  5CBR A;  4IO2 A;  4H6D A;  2NOO A;  5K2X A;  1B3L A;  1I6A A;  1LAH E;  4PP0 A;  1LFH A;  2AL5 A;  2PYY A;  4C1T A;  1N76 A;  3HHF A;  4FAJ A;  4LA9 A;  1B5J A;  3LR1 A;  2VD3 A;  3E9X A;  3M3F A;  4XKR A;  4O3B A;  3ZKK A;  3KEI A;  1B6H A;  1QVS A;  1ZKB A;  1MQJ A;  1GR2 A;  2DE2 A;  3FGS A;  1HSJ A;  3A3C A;  3GBA A;  3HV1 A;  3U8Q A;  5ICQ A;  4BDO A;  1LB8 A;  4UA8 A;  2UXA A;  4H67 A;  2ZNS A;  1MDQ A;  5HBC A;  2XXW A;  1OMP A;  2F34 A;  4GQO A;  4HCY A;  3IO6 A;  3LC8 A;  4IO3 A;  4H8J A;  1IXI A;  3SEX A;  3TEP A;  1PC3 A;  3KZG A;  3TAJ A;  4F3S A;  2PVU A;  3QIM A;  3G3I A;  2ONK E;  3DP8 A;  1MXW A;  3I3V A;  4YKK A;  3KN7 A;  2ALU A;  1MH3 A;  3QYT A;  1YPN A;  3TQW A;  3BFU A;  1N3X A;  5EYF A;  3ECR A;  4FEC A;  1USY E;  4NF5 B;  1OQG A;  4LZ5 A;  4U1Z A;  3FVN A;  1A8E A;  1VFE A;  4IO4 A;  1WOD A;  5BUU A;  3OO9 A;  3C36 A;  3CSG A;  4WKM A;  3ZSF A;  1B40 A;  1B51 A;  2DWI A;  3OMB A;  4DXU A;  1LST A;  2XXY A;  4JWY A;  4XKQ A;  4C0R A;  3PGF A;  1Q35 A;  1OIB A;  5L9M A;  1Y1M A;  1P99 A;  4E0W A;  4EXK A;  1QKB A;  2RC9 A;  3IOR A;  3KG2 A;  3PUY E;  4JBZ A;  5I2K A;  3T66 A;  2I4B A;  4XKN A;  2B65 A;  5M2V A;  4NMY A;  5DVJ A;  2I3V A;  1WDN A;  5JK4 A;  4R2B A;  2HAU A;  3LSF B;  3QXM A;  4QSE A;  4X1D A;  1Y3N A;  3BKI B;  2HZK A;  2QL3 A;  1Y3Q A;  4GOT A;  3W9V A;  5AA3 A;  1IQ7 A;  1MG1 A;  4MH5 A;  4KI0 E;  3RQT A;  4PET A;  2O69 A;  1VFD A;  3HO7 A;  4KYD A;  5CBS A;  5JTY A;  2Z23 A;  1PB7 A;  3I5O A;  4O3C A;  4U4S A;  3A09 A;  4FE8 A;  3SEU A;  3CVG A;  1L5T A;  5L9O A;  3Q29 A;  1FCK A;  4ZEF A;  2ZYN A;  4IB2 A;  3FXU A;  3Q25 A;  3MBP A;  3KGC A;  4I62 A;  3VDF A;  1AIV A;  3L6H A;  3TQL A;  3FIR A;  3UN6 A;  1SYH A;  3JV9 A;  4JB7 A;  4NF5 A;  5B70 A;  1UIV A;  3HPI A;  1MXZ A;  3FZV A;  2F78 A;  3K0V A;  1A40 A;  3IJO B;  3KSJ A;  3MC2 A;  2F36 A;  1FTK A;  1DTG A;  1SI0 A;  2HAV A;  4GXS B;  1XOC A;  2VD2 A;  3HN0 A;  3MZB A;  4ELR A;  5I84 A;  1P1W A;  4N07 A;  3EF7 A;  1POT A;  4PFU A;  3CI8 A;  1MXX A;  1TXF A;  1ZLQ A;  3RY3 A;  1MS7 A;  2I48 A;  5I57 B;  3TTM A;  1D9V A;  5CMC A;  1QUK A;  1OLC A;  3D4G A;  4DZ1 A;  3I6V A;  2F7A A;  2B3F A;  3HCQ A;  4JSD A;  4G8N A;  1B5H A;  1RYX A;  3OSR A;  4RPN A;  5I57 A;  2VP1 A;  1F9B A;  2F7B A;  3RPW A;  4AQ4 A;  4EDP A;  5LOM A;  3IOU A;  2E0S A;  4MF3 A;  3RNN A;  5CC2 A;  3MVW A;  3G3G A;  1B7H A;  2QRY A;  3FJG A;  1OVB A;  1DOT A;  3LSX A;  1MY1 A;  3PUZ E;  4POX A;  1DSN A;  2Y7I A;  4Z0I A;  1MY3 A;  5EHM A;  3A3U A;  4R73 A;  2UVJ A;  4RA1 A;  3RT8 A;  5CMK A;  2XXI A;  2RIN A;  4BDR A;  4MFI A;  3SET A;  2Y7K A;  4OET A;  1O64 A;  3ONM A;  3G3H A;  1SBP A;  3M8U A;  3PD8 A;  3SER A;  4ELQ A;  1QJM A;  2OWS A;  1N7W A;  2IA4 A;  5DTB A;  4WEP A;  4JXI A;  4X9T A;  5FHO A;  1LLS A;  4OEV A;  5KDT A;  5DT6 A;  3ILT B;  1PEB A;  2B3B A;  1TWY A;  3ILU B;  3SEW A;  2UVH A;  2GFE A;  3K4U A;  4TOZ A;  3UP9 A;  2A5S A;  1A54 A;  4YZZ A;  3VVF A;  4ZED A;  2XHD A;  1AH5 A;  5TP9 B;  3W9W A;  2O51 A;  3V5A A;  3O2A A;  4YMA A;  4QSD A;  2O6A A;  1LAG E;  2V25 A;  4GIZ A;  4YB7 A;  3RN8 A;  3CG3 A;  3K02 A;  3LSL A;  5K2Y A;  2V93 A;  3PPR A;  4YAH X;  3SES A;  4GVO A;  1H43 A;  1B58 A;  1QKA A;  2GRV A;  2Z8F A;  5H8H A;  2FA7 A;  5I56 B;  2ZNU A;  4ZEK A;  3T9V A;  4AB5 A;  5L9S A;  1J1N A;  2ZYK A;  4H5G A;  3H6U A;  3MPL A;  4FED A;  4RXL A;  1EU8 A;  1LFG A;  1ZJL A;  4G68 C;  5IKB A;  1MXV A;  2VGQ A;  4LZ8 A;  3IAZ A;  1SW4 A;  2AIX A;  4G68 B;  3G3J A;  3K6V A;  3PD9 A;  2FYI A;  4MLQ A;  1NNT A;  3SEY A;  3S4U A;  1B7Z A;  4IO6 A;  3EPE A;  1PBQ A;  4FEB A;  1ELJ A;  4YU0 A;  3T9H B;  3R7X A;  4M1V A;  1US4 A;  4OFJ A;  2PT2 A;  2H4I A;  5I2K B;  1IIW A;  4KFQ A;  5FTI A;  5KCJ A;  1H44 A;  1USY H;  2GH9 A;  3QUJ A;  4RK9 A;  3RLF E;  5DVF A;  1BP5 A;  5AA2 A;  1QW0 A;  3VXB A;  4FOR A;  1B46 A;  4P11 A;  1POY 1;  3IOV A;  3PU5 A;  5KCJ B;  3TOD A;  5CI5 A;  3B7D A;  4ESW A;  1B1X A;  1XC1 A;  4KHZ E;  4NF8 B;  3GBB A;  4QHQ A;  3EHS A;  3RT6 B;  2QMW A;  3VVD A;  3RTF B;  1B3H A;  3H03 A;  5CMB A;  1GVC A;  4EUO A;  2X26 A;  1M5E A;  4U21 A;  1SVX B;  4X1B A;  2R6G E;  1OQH A;  1A7L A;  4GWO A;  3MP6 A;  1A55 A;  2HQ0 A;  2OK2 A;  3PMW A;  5I58 B;  1B5I A;  2Q88 A;  1N0T A;  4OXV A;  1EZ9 A;  1R1N A;  4I9D A;  1B32 A;  3UOR A;  1LGB C;  3MJN A;  3VXC A;  4DIG A;  4HTG A;  1B3G A;  1NFT A;  1DPP A;  5I58 A;  3TUS A;  2PBW A;  1NMU A;  3KN3 A;  5HM4 B;  4KYE A;  1JW5 A;  4X48 A;  3RGY A;  4EQB A;  5F1Q A;  4TLM B;  1QUL A;  2X7P A;  3USD A;  3DP4 A;  4H8I A;  3SKP A;  5HPQ A;  2I3W A;  1MXY A;  2HCA A;  3VE1 B;  2O68 A;  1A99 A;  1ANF A;  4NWC A;  5AA2 B;  1GTK A;  4EF2 A;  3VVE A;  2FNC A;  2HEU A;  2RC8 A;  3DM0 A;  1N84 A;  4R6Y A;  2Z22 A;  4Q30 B;  4QFP A;  4FJP A;  4RJZ A;  2Z8D A;  2F6P A;  4P0I A;  1AMF A;  3TTL A;  4JSO A;  4BDQ A;  3S9N C;  1B1H A;  3MUQ A;  1SW5 A;  2XD3 A;  1FTJ A;  3FV1 A;  3BBR A;  1EZO A;  4F22 A;  1B4H A;  4G2Z A;  4OYV A;  3R26 A;  4TLL B;  1N7X A;  2AYS A;  2V3U A;  4YB5 A;  3O6I A;  5I2N B;  1D9Y A;  1DMB A;  2R71 A;  1UQW A;  5DEX B;  2F7C A;  3JZJ A;  2Q2A A;  1GV8 A;  3TCH A;  1NH8 A;  2QJE A;  3KN8 A;  2Q2C A;  2REG A;  2ZNT A;  2D21 A;  2P1S A;  3KFM A;  3G3F A;  4GL8 A;  1T0K A;  4NF6 A;  1BTJ A;  3C35 A;  3E3K A;  2PT1 A;  3UK4 A;  3FUZ A;  4JWO A;  3CFL A;  4PFY A;  1SI1 A;  3O28 A;  4H1X A;  1IXH A;  4NF6 B;  2XX8 A;  2BJJ X;  4H5F A;  4PFT A;  1UIU A;  2F35 A;  4LZ7 A;  4ND9 A;  1H76 A;  3FXQ A;  1TT1 A;  2H25 A;  3HHG A;  1NKX A;  4OTE A;  4WED A;  4YB6 A;  3KOS A;  2RC7 A;  3IB0 A;  4K3F A;  4ZEB A;  5ELV A;  1ZTY A;  4Q5T A;  4OZ9 A;  1Y4C A;  3O29 A;  2OWT A;  1S7Y A;  2I49 A;  2XXU A;  4G8M A;  1YCJ A;  1IXG A;  2GHB A;  1JEV A;  4MBP A;  4F39 A;  3OXN A;  4OHN A;  3T96 B;  5AA4 B;  3PPP A;  1JVX A;  3RUM A;  4N13 A;  4BDN A;  4IGR A;  3S2V A;  3VV5 A;  2ABH A;  5H8Q B;  1UTH A;  1B3F A;  1MY2 A;  2UYE A;  2XXH A;  3IB1 A;  1MRP A;  5H8N B;  2ZMB A;  2IEE A;  1MQI A;  3FXR A;  4ZDM A;  5I2N A;  5KZT A;  1XHY A;  2H99 A;  3LSW A;  4PFW A;  2F5X A;  3C34 A;  5TPA B;  5B7D A;  3S9L C;  2ZYM A;  4HS7 A;  3K2D A;  3HST A;  3OO7 A;  3O6H A;  5L8D A;  4GXA A;  2I6E A;  1HSL A;  3FJ7 A;  4U22 A;  2RCB A;  3OEN A;  4LVQ A;  5AA4 A;  4IO7 A;  1Q1K A;  4R9G A;  1PDA A;  4UAC A;  1DPE A;  1XVY A;  2CZL A;  4DE8 A;  3H6V A;  5F7V A;  4F31 B;  4H0W A;  3QUF A;  1YAE A;  4O3A A;  1I69 A;  1JQF A;  1US5 A;  2Q9T A;  3MVY A;  1H45 A;  4ZE8 A;  4C1U A;  2YPN A;  4NF8 A;  4E0X A;  5KDT B;  3PPO A;  1PB9 A;  3CRB A;  3SEV A;  4NTL A;  3P7I A;  4IO5 A;  3DEL B;  2DWJ A;  4R9F A;  3EN3 A;  3FD3 A;  3VFJ A;  4DCY A;  3U92 A;  3V83 A;  2DE3 A;  2OBG A;  3FJM A;  3IK6 B;  2YJP A;  1B3E A;  1JET A;  3K6X A;  2V3T A;  1LFI A;  4ZS9 A;  4EQ9 A;  4F3B A;  1HSE A;  1JNF A;  1IZ1 A;  4ESX A;  2QS3 A;  2ZYO A;  3FAS A;  3T9X B;  2HXW A;  2UVG A;  2F6G A;  3TTR A;  4FAT A;  2Y7R A;  5AE4 A;  2O1M A;  4LQ5 A;  3TKD A;  4F3G A;  3TTN A;  1ZBM A;  1B7U A;  1EH3 A;  3C4M A;  5H8Q A;  5A5X B;  2XX7 A;  3F11 A;  3H3G A;  3C33 A;  5CMM A;  3RTW B;  4KYS A;  2Z8E A;  4KCD A;  4OEU A;  1IUD A;  1CB6 A;  1DTZ A;  3B6Q A;  4DXB A;  4F3P A;  1FQC A;  4YMB A;  1M5B A;  4OFO A;  2OLB A;  4U2R A;  3IB2 A;  3UA8 A;  4KR5 A;  2I0C A;  2X7Q A;  3KJ7 A;  1QUJ A;  2H5Y A;  4R74 A;  3C31 A;  1Y9U A;  3EHT A;  1MM7 A;  1B2H A;  1P1Q A;  2H9B A;  2XXV A;  3OEL A;  4H65 A;  3PPN A;  4NF4 B;  1FW0 A;  1Y4T A;  2ANJ A;  2Q89 A;  1LCT A;  4EF1 A;  1O63 A;  4LQ2 A;  3OO8 A;  2P0S A;  3FV2 A;  4F2Q A;  4OVJ A;  2A5T A;  1AOV A;  3CFX A;  3FVG A;  1MY0 A;  1OVT A;  1N04 A;  3IOW A;  4KPT A;  3L6G A;  4R75 A;  1JW1 A;  3TTK A;  4F1V A;  1MPD A;  3H6T A;  2PX1 A;  3MP8 A;  4FIM A;  4M4G A;  3B6T A;  4P0G A;  1JEU A;  1FQF A;  1MPB A;  1YTV A;  2ESN A;  3R6U A;  3TDJ A;  4F1U A;  3TPA A;  3PMV A;  1BKA A;  2UVI A;  4LP2 B;  3GXA A;  4QSC A;  3ZS6 A;  3IX1 A;  1S50 A;  3BFT A;  1I6Q A;  1SW1 A;  3G3K A;  5A5X A;  1XVX A;  1PBP A;  3U1O A;  2DYX A;  2O7U A;  3O97 A;  1MXU A;  3LUY A;  2QSX A;  4LON B;  3PUV E;  5EHS A;  1OLA A;  3M3L A;  3CR9 A;  3E13 X;  3OSQ A;  4ZZE A;  1UTB B;  3TYH A;  2F8D A;  3O66 A;  4RPO A;  4BDM A;  3QSL A;  3W15 C;  3UGW A;  5JTY B;  1EZP A;  1O7T A;  3U94 A;  1FQB A;  2V3Q A;  3WAF A;  1R9L A;  3M3K A;  4EQ7 A;  3OEM A;  1SD3 A;  1URD A;  1MDP 1;  2RKM A;  1IXC A;  4IGT A;  2HFB A;  2DXR A;  4I8C A;  4OER A;  3FAT A;  5ITP A;  1MH4 A;  2ONR A;  3PUW E;  3TFL A;  3K01 A;  4THI A;  2DWH A;  4GL0 A;  5TU0 A;  4PE5 B;  1NL5 A;  1CE2 A;  1M5F A;  3K1N A;  3MZ1 A;  5H8F B;  3WAE A;  1SYI A;  2Y84 A;  5CM6 A;  1FQD A;  4YIC A;  3KOT A;  3KSX A;  1LAF E;  1VR5 A;  1MQH A;  4G68 A;  4N6P A;  2D3I A;  3N6T A;  1RYO A;  2R9J A;  3U72 A;  4KCC A;  4WXJ A;  4OES A;  4F2O A;  2NXO A;  3KJT A;  4MLV A;  4YKI A;  1SW2 A;  3O9P A;  3MW0 A;  1RKM A;  1ZIU A;  4QF9 A;  5FHN A;  3V89 B;  1FTM A;  2LAO A;  3H7M A;  4RNS A;  1II5 A;  1JVY A;  4R72 A;  4U1O A;  3TCF A;  1MY4 A;  3FVO A;  2M8C A;  4QFN A;  3VLV A;  4GFR A;  1JW4 A;  5ICT A;  1ATG A;  3N5L A;  1VSO A;  3ODB A;  5CRY A;  3PPQ A;  4RK2 A;  3K6U A;  2NUV A;  2DVZ A;  4NWD A;  2QMX A;  2VHA A;  2XXT A;  3IOT A;  3OD7 A;  3QK6 A;  3MZ9 A;  4NED A;  3N6U A;  4XXU A;  4F29 A;  4DDD A;  1LBC A;  2OJT A;  3MVZ A;  1SDX A;  3PUX E;  5AA2 D;  2V84 A;  3H6W A;  4IY6 A;  1M5D A;  2GHA A;  4JWX A;  4L17 A;  4BLA A;  4ELO A;  5DYH A;  4ECF A;  2DS9 A;  2XXP A;  3IJX B;  4KQP A;  5DVI A;  1SQY A;  2O84 X;  2OZZ A;  3C9H A;  3AXF A;  1FTL A;  4RY1 A;  4HW8 A;  4Z7E A;  1TFD A;  4Q0C A;  4DLD A;  1FQE A;  1IEJ A;  1XT8 A;  1XS5 A;  2DE4 A;  3IR1 A;  3OO6 A;  4GD5 A;  4QFK A;  1KWH A;  2XD2 A;  3FVK A;  4ZEC A;  2F97 A;  2QPQ A;  3GLB A;  5TP9 A;  1BIY A;  2I58 A;  1LAX A;  3IL1 B;  1LBB A;  1D3K A;  3EQ1 A;  5H8N A;  3THI A;  1M5C A;  4AB6 A;  4F19 A;  5I59 B;  3G7W A;  5ISU A;  3GZG A;  1URG A;  1Y20 A;  1Y3P A;  3K1P A;  4PQJ A;  4XTC Q;  1PB8 A;  1B05 A; 
#chains in the Genus database with same CATH topology
 5I56 A;  4GLI A;  1XI6 A;  4EXL A;  2QS1 A;  2G29 A;  1Z7N E;  4UAB A;  2I4C A;  2DP8 A;  3TZA A;  2XWI A;  4F18 A;  4KD5 A;  1Y1Z A;  1K9Z A;  3E4R A;  3MWB A;  4XIG Q;  3DLN A;  1NH7 A;  3ZKL A;  4DCX A;  1S9T A;  2PMS A;  2QVV A;  3PV0 E;  1WVJ A;  2ONS A;  3D4C A;  5IAI A;  3IO4 A;  4GF8 A;  3K6W A;  1KA1 A;  1R9Q A;  4MEV A;  1AL3 A;  1MQD A;  4H46 A;  4PGN A;  4P3L A;  1NV7 A;  4NF0 A;  1P1U A;  4G4P A;  5H8F A;  2DXY A;  3T22 A;  3KBR A;  3T93 B;  4N91 A;  2Y7W A;  3UIF A;  2CMO A;  1FQA A;  2HXR A;  2O1L A;  4OEN A;  3MAM A;  2ZZV A;  4F1Y A;  4G8H A;  4IO2 A;  5K2X A;  1FPG A;  1LAH E;  4PP0 A;  3HHF A;  1B5J A;  2WYK A;  1B6H A;  1ZKB A;  1MQJ A;  3FGS A;  1HSJ A;  3A3C A;  3HV1 A;  4JVC A;  2UXA A;  2XXW A;  4IO3 A;  3SEX A;  3TEP A;  1PC3 A;  4P8B A;  2PVU A;  3QIM A;  2CZH A;  4YKK A;  3QYT A;  1YPN A;  1OQG A;  4GWZ A;  2XWO A;  4IO4 A;  1WOD A;  4O94 A;  5A5L A;  2KR0 A;  1LST A;  2XXY A;  1Q35 A;  4E0W A;  1Y1M A;  5I2K A;  5ESY A;  4XKN A;  4NMY A;  5DVJ A;  2I3V A;  2QFL A;  2HAU A;  3RPL A;  3IFC A;  1FJ9 A;  4QSE A;  2HZK A;  4GOT A;  1Y3Q A;  4KI0 E;  1VFD A;  4KYD A;  3I5O A;  4MNC A;  5L9O A;  1YZ0 A;  1L5T A;  4ZEF A;  1FCK A;  4I62 A;  3JV9 A;  1UIV A;  3HPI A;  3K0V A;  3KSJ A;  1A40 A;  3IJO B;  2VD2 A;  3U65 A;  4PFU A;  1POT A;  3CI8 A;  1NV0 A;  1FPD A;  3TTM A;  1D9V A;  1OLC A;  4JVD A;  1B5H A;  4RPN A;  5I57 A;  3RPW A;  4OFL A;  4P11 A;  1MY1 A;  4Z0I A;  4RA1 A;  2RIN A;  3G3H A;  1IMA A;  3SER A;  4MNP A;  4O7M A;  1QJM A;  2OWS A;  1NUX A;  4OEV A;  5KDT A;  2B3B A;  4TOZ A;  3K4U A;  3V5A A;  4QSD A;  3RN8 A;  1H43 A;  5I5P A;  1J1N A;  2ZYK A;  2VGQ A;  3K6V A;  3PD9 A;  2FYI A;  3SEY A;  4PAI A;  3S4U A;  3EPE A;  1PBQ A;  4PDH A;  4YU0 A;  2H4I A;  1IIW A;  5FTI A;  1USY H;  4RK9 A;  5DVF A;  1QW0 A;  1B46 A;  1POY 1;  3B7D A;  4ESW A;  4KHZ E;  3GBB A;  1FBE A;  4X8R A;  1B3H A;  2P3N A;  2X26 A;  1M5E A;  3MP6 A;  3B8B A;  2HQ0 A;  2WBB A;  1N0T A;  4I9D A;  3MJN A;  5I58 A;  3TUS A;  2QVR A;  2PBW A;  2PCR A;  3GYY A;  4TLM B;  3DP4 A;  4H8I A;  2O68 A;  2F3D A;  1GTK A;  4EF2 A;  5T3J A;  2HEU A;  2RC8 A;  3DM0 A;  1N84 A;  2Z22 A;  4QFP A;  2Z8D A;  2F6P A;  4P0I A;  3TTL A;  3MUQ A;  1SW5 A;  1FTJ A;  4F22 A;  4TLL B;  5I2N B;  1GV8 A;  1DMB A;  2Q2A A;  3KN8 A;  2Q2C A;  2D21 A;  4GX3 A;  4GL8 A;  3E3K A;  3E78 A;  3UK4 A;  3CFL A;  1SI1 A;  2XX8 A;  1UIU A;  4F3S A;  4MHF A;  5ELV A;  1ZTY A;  2OWT A;  2I49 A;  4F39 A;  1YCJ A;  3OXN A;  4OHN A;  3T96 B;  3PPP A;  3RUM A;  4N13 A;  4IGR A;  5H8N B;  1MRP A;  2ZMB A;  5I2N A;  5KZT A;  1FTA A;  3LSW A;  2F5X A;  3S9L C;  2ZYM A;  1LBY A;  3HST A;  3OO7 A;  5AA4 A;  4PBH A;  1DPE A;  1YAE A;  1I69 A;  4P1L A;  2YPN A;  5IZZ A;  4IO5 A;  3DEL B;  4DCY A;  4R9F A;  3VFJ A;  2XWK A;  3IK6 B;  2YJP A;  1JET A;  2V3T A;  1LFI A;  1JNF A;  4ESX A;  4I3Y A;  2F3B A;  2UVG A;  2F6G A;  5AE4 A;  2O1M A;  3TKD A;  5IZ1 A;  1DTZ A;  3B6Q A;  4GX4 A;  4F3P A;  2OLB A;  3UA8 A;  2X7Q A;  3KJ7 A;  1JP4 A;  4H65 A;  2XXV A;  1FW0 A;  4EF1 A;  4IR8 A;  1O63 A;  2P0S A;  4F2Q A;  2B4M A;  2MKZ A;  1N04 A;  3TTK A;  3MP8 A;  3B6T A;  1JEU A;  3TDJ A;  3TPA A;  1S50 A;  1SW1 A;  2ZZW A;  1MXU A;  3E79 A;  3M3L A;  3CR9 A;  3O66 A;  1EZP A;  3U94 A;  1FQB A;  3WAF A;  3M3K A;  1URD A;  4I8C A;  2RKM A;  1IXC A;  4OER A;  3TFL A;  4THI A;  5TU0 A;  1CE2 A;  3K1N A;  3MZ1 A;  2Y84 A;  3KOT A;  1VR5 A;  4G68 A;  1EYK A;  4PDD A;  2NXO A;  1SW2 A;  4N81 A;  4R72 A;  4RK2 A;  2NUV A;  4NWD A;  2XXT A;  4XXU A;  4DDD A;  1SDX A;  4L17 A;  1M5D A;  2GHA A;  4BLA A;  2XXP A;  1SQY A;  3AXF A;  1FTL A;  1TFD A;  1FQE A;  1BK4 A;  1IEJ A;  1XT8 A;  1FRP A;  3FVK A;  1IMC A;  3GLB A;  1BIY A;  1LBB A;  4F19 A;  3GZG A;  1NUW A;  1URG A;  1Y3P A;  1PB8 A;  1B05 A;  3U93 A;  3SDF A;  4ZE9 A;  2P2A A;  3MQ9 A;  5AA1 A;  1QUI A;  1URS A;  5TPA A;  1TFA A;  3Q27 A;  3TMG A;  2AL4 A;  4BDL A;  5JEI A;  4LUB A;  4ZZA A;  3TEL A;  1NV5 A;  2I0B A;  2NWJ A;  3OOA A;  1D4N A;  5H8S A;  1FPJ A;  3MP1 A;  2BJI A;  1A8F A;  4PTK A;  2UYF A;  4R6H A;  5BWJ A;  1ZMG A;  1FTO A;  2DDK A;  2DOJ A;  1R6Z A;  4N6K A;  1NNK A;  1MPC A;  4NF4 A;  4POW A;  4OWD A;  1Z7M E;  3C32 A;  4RYA A;  3Q28 A;  3Q26 A;  1UTH B;  2ZXT A;  1H3D A;  1GGG A;  3H06 B;  1N3W A;  2H98 A;  1G0I A;  1UTB A;  5EYH A;  2OCU A;  4YKJ A;  4GWW A;  2NOO A;  2PYY A;  3LR1 A;  1QVS A;  1EYI A;  3GBA A;  4BDO A;  1LB8 A;  4UA8 A;  1LEV A;  2F34 A;  4HCY A;  3T1B A;  2JJK A;  2ONK E;  1MXW A;  3I3V A;  4QBA A;  1N3X A;  3ECR A;  1USY E;  4I3E A;  1A8E A;  3OO9 A;  3C36 A;  3ZSF A;  1B40 A;  4XF5 A;  3OMB A;  4JWY A;  5J1D A;  1P99 A;  1NV4 A;  1QKB A;  3KG2 A;  3PUY E;  3T66 A;  2I4B A;  2B65 A;  2VPO A;  5ET6 A;  3BIG A;  3QXM A;  4X1D A;  1MG1 A;  4AS4 A;  3HO7 A;  5CBS A;  2Z23 A;  1PB7 A;  3A09 A;  3Q29 A;  4X04 A;  4IB2 A;  3FXU A;  5I3S A;  5B70 A;  3BIH A;  3FZV A;  1FTK A;  1DTG A;  1SI0 A;  1XOC A;  3HN0 A;  5I84 A;  1P1W A;  3EF7 A;  5I57 B;  2F7A A;  2B3F A;  3HCQ A;  4G8N A;  2F7B A;  5LOM A;  2E0S A;  3G3G A;  1Q9D A;  2XA5 A;  1OVB A;  5ITO A;  1DSN A;  1MY3 A;  5EHM A;  4R73 A;  3FBP A;  3RT8 A;  5CMK A;  4BDR A;  4OET A;  1SBP A;  4ELQ A;  4P1E A;  1N7W A;  4WEP A;  4JXI A;  3ROJ A;  4PAK A;  5FHO A;  5DT6 A;  1TWY A;  2UVH A;  2GFE A;  1NUZ A;  4ZED A;  3W9W A;  2O51 A;  4YB7 A;  3CG3 A;  5EQ8 A;  2V93 A;  3PPR A;  1QKA A;  3T9V A;  4ZEK A;  4OVR A;  5L9S A;  4H5G A;  4FED A;  1EU8 A;  4G68 C;  2AIX A;  4G68 B;  4MLQ A;  1NNT A;  4FEB A;  1ELJ A;  3T9H B;  3R7X A;  4KFQ A;  5AA2 A;  1BP5 A;  1DCU A;  3VXB A;  4FOR A;  3TOD A;  4N4U A;  4NF8 B;  3KC0 A;  2QMW A;  3RTF B;  3H03 A;  1GVC A;  1SPI A;  1SVX B;  4U21 A;  4X1B A;  5I58 B;  1B5I A;  2Q88 A;  4OXV A;  3UOR A;  1LGB C;  4HXV A;  1NMU A;  3KN3 A;  1YYZ A;  1JW5 A;  3RGY A;  1QUL A;  5HPQ A;  2Y5K A;  1MXY A;  2HCA A;  3NOH A;  5AA2 B;  4RJZ A;  3SZP A;  1EZO A;  1B4H A;  4G2Z A;  1N7X A;  2AYS A;  1D9Y A;  1UQW A;  4MAG A;  1NH8 A;  3MYU A;  2ZNT A;  1T0K A;  2WYP A;  3FUZ A;  4JWO A;  1IXH A;  2BJJ X;  1TT1 A;  4ZEB A;  2RC7 A;  3IB0 A;  4Q5T A;  4OZ9 A;  4OAN A;  1S7Y A;  1JVX A;  5H8Q B;  2UYE A;  2XXH A;  1MQI A;  2H99 A;  4PFW A;  5TPA B;  5B7D A;  5L8D A;  4U22 A;  3OEN A;  1Q1K A;  4HE2 A;  5F7V A;  1US5 A;  1JQF A;  3MVY A;  1H45 A;  5KDT B;  3CRB A;  3SEV A;  4NTL A;  3EN3 A;  3FD3 A;  2DE3 A;  1B3E A;  1HSE A;  2Q74 A;  5IGA A;  5EYG A;  2HXW A;  4LQ5 A;  4F3G A;  3TTN A;  1EH3 A;  5FBP A;  5H8Q A;  5A5X B;  2XX7 A;  3F11 A;  5CMM A;  4DI3 D;  4PBQ A;  4DXB A;  4PF6 A;  1FQC A;  4U2R A;  2I0C A;  4R74 A;  3C31 A;  1Y9U A;  2H9B A;  1P1Q A;  4NF4 B;  4LQ2 A;  3OO8 A;  3FV2 A;  1AOV A;  3FVG A;  1FQF A;  1YTV A;  3PMV A;  4QSC A;  3ZS6 A;  1I6Q A;  5A5X A;  3LUY A;  3PUV E;  3D1R A;  1OLA A;  3E13 X;  3TYH A;  3QSL A;  3W15 C;  1MDP 1;  2QVU A;  2DXR A;  4NAP A;  5ITP A;  2HPG A;  4OVS A;  3K01 A;  2DWH A;  4GL0 A;  1NL5 A;  4PF8 A;  5CM6 A;  5LTC A;  4YIC A;  1LAF E;  4O7I A;  4NG7 A;  4WXJ A;  4MMP A;  4OES A;  3O9P A;  3MW0 A;  1RKM A;  1LBX A;  5FHN A;  3CHG A;  3H7M A;  4RNS A;  2ZZX A;  4QFN A;  1IMD A;  1ATG A;  1VSO A;  2VHA A;  3QK6 A;  3IOT A;  3MZ9 A;  3N6U A;  2OJT A;  3PUX E;  3H6W A;  3B50 A;  5DVI A;  2OZZ A;  4HW8 A;  1FBP A;  3OO6 A;  3IR1 A;  1XS5 A;  2QPQ A;  3EQ1 A;  5H8N A;  5ISU A;  5I59 B;  3K1P A;  4XTC Q;  3MVX A;  1VE4 A;  3S9M C;  2REJ A;  3LBS A;  4Q8R A;  4GBW A;  3B6W A;  4AS5 A;  3CG1 A;  3T9U A;  4HE1 A;  1MQG A;  1NV3 A;  4ISU A;  2B4L A;  1NNF A;  1P1O A;  4ONY A;  3PMX A;  3QAX A;  4G77 A;  2VT5 A;  5I59 A;  3VLU A;  4TQU Q;  4ELP A;  1MM6 A;  2D5W A;  3IFA A;  4GRK A;  1IME A;  5J16 A;  3CIJ A;  4GWY A;  2O7I A;  4OMB A;  3O6G A;  4I1D A;  2CZK A;  2RCA A;  3K1M A;  1B0L A;  3MPK A;  4U23 A;  4HCW A;  4ZEI A;  2DQV A;  1VDW A;  4PC9 A;  3JYR A;  2VOZ A;  4OQO A;  2XX9 A;  1RDZ A;  2A5T B;  4DXC A;  1LCF A;  4JVI A;  1NI9 A;  5DEX A;  1IIT A;  1IMF A;  4R2F A;  4IY5 A;  2KLF A;  2QS2 A;  2XXX A;  4NE4 A;  3CFZ A;  2HZL A;  2QS4 A;  2W7Y A;  5CBR A;  2OX3 A;  4H6D A;  1B3L A;  2PFZ A;  4C1T A;  4LA9 A;  1K9Y A;  2VD3 A;  3E9X A;  4XKR A;  4O3B A;  1EYJ A;  2DE2 A;  4H67 A;  2ZNS A;  5HBC A;  3LC8 A;  4H8J A;  3TAJ A;  1INP A;  3BFU A;  5F24 A;  4NF5 B;  4LZ5 A;  4U1Z A;  3FVN A;  1VFE A;  3CSG A;  4WKM A;  4XKQ A;  4C0R A;  4EXK A;  3PGF A;  5L9M A;  4JBZ A;  4GWX A;  5M2V A;  4OVP A;  5JK4 A;  1DBZ A;  4R2B A;  2QL3 A;  3RQT A;  4PET A;  2O69 A;  5IZ3 B;  1FSA A;  5JTY A;  3SEU A;  3EKI A;  4FE8 A;  3CVG A;  1AIV A;  2ZYN A;  3Q25 A;  3KGC A;  3TQL A;  3UN6 A;  4NF5 A;  2FVZ A;  2F78 A;  2F36 A;  4ELR A;  4N07 A;  1TXF A;  1MS7 A;  5CMC A;  4NHB A;  3D4G A;  3I6V A;  1F9B A;  1FBC A;  4AQ4 A;  3IOU A;  4MF3 A;  3RNN A;  1B7H A;  2QRY A;  3FJG A;  3LSX A;  1DOT A;  3PUZ E;  2Y7I A;  3A3U A;  2UVJ A;  2CZI A;  2Y7K A;  1O64 A;  3M8U A;  3PD8 A;  4X9T A;  2A5S A;  1A54 A;  4YZZ A;  3VVF A;  1AH5 A;  2O6A A;  2V25 A;  1FPB A;  3K02 A;  5K2Y A;  3LSL A;  4QXD A;  3SES A;  4GVO A;  1B58 A;  5H8H A;  4N6D A;  3H6U A;  3MPL A;  1LFG A;  5IKB A;  4LZ8 A;  1NV6 A;  1SW4 A;  3G3J A;  1B7Z A;  4IO6 A;  4M1V A;  1US4 A;  4OFJ A;  5I2K B;  3QUJ A;  3PU5 A;  5KCJ B;  5CI5 A;  3EHS A;  3VVD A;  4EUO A;  2R6G E;  4GWO A;  1A55 A;  2OK2 A;  3PMW A;  3VXC A;  4HTG A;  1QGX A;  5HM4 B;  4KYE A;  4GBV A;  2L5V A;  2X7P A;  4MCO A;  3SKP A;  2I3W A;  1A99 A;  1LBZ A;  3HFU A;  4NWC A;  4FJP A;  1AMF A;  4BDQ A;  4JSO A;  3S9N C;  1B1H A;  3FV1 A;  2XD3 A;  3BBR A;  3R26 A;  4O8M A;  2F7C A;  3JZJ A;  2QJE A;  2P1S A;  3C35 A;  2PT1 A;  4PFY A;  4NF6 B;  2XWV A;  4H5F A;  2F35 A;  4LZ7 A;  4WED A;  1H76 A;  2H25 A;  1NKX A;  4OTE A;  3KOS A;  1Y4C A;  3O29 A;  4G8M A;  2XXU A;  1IXG A;  2GHB A;  2ABH A;  4NQ8 A;  1B3F A;  2IEE A;  3FXR A;  3C34 A;  3K2D A;  3O6H A;  4GXA A;  2I6E A;  3FJ7 A;  2RCB A;  1PDA A;  1AWB A;  4DE8 A;  4F31 B;  4H0W A;  3QUF A;  4ZE8 A;  4O3A A;  2Q9T A;  4C1U A;  2R8T A;  1PB9 A;  3P7I A;  2DWJ A;  4MIJ A;  2OBG A;  4ZS9 A;  4F3B A;  2QS3 A;  3T9X B;  2Y7R A;  1B7U A;  4KYS A;  4KCD A;  4OEU A;  1IUD A;  1CB6 A;  2WBD A;  4MJO A;  4KR5 A;  2H5Y A;  2CEY A;  4YKI A;  4PGP A;  1Y4T A;  2ANJ A;  4GWU A;  2Q89 A;  4PFR A;  2A5T A;  3CFX A;  1MY0 A;  1OVT A;  4KPT A;  3IOW A;  3L6G A;  4R75 A;  1MPD A;  4M4G A;  2PX1 A;  4P0G A;  3RPL B;  2ESN A;  2UVI A;  3IX1 A;  1PBP A;  2DYX A;  2O7U A;  2QSX A;  4LON B;  1LBW A;  3OSQ A;  4ZZE A;  2F8D A;  4RPO A;  5JTY B;  2V3Q A;  1SD3 A;  4IGT A;  4H45 A;  1MH4 A;  2ONR A;  3T0J A;  1SYI A;  2D3I A;  3N6T A;  1RYO A;  2R9J A;  3U72 A;  4MLV A;  4QF9 A;  3V89 B;  1ZIU A;  2LAO A;  1JVY A;  3PTY A;  3TCF A;  1MY4 A;  2M8C A;  3N5L A;  3ODB A;  3PPQ A;  2QMX A;  4NED A;  1LBC A;  3MVZ A;  5IM2 A;  2V84 A;  5DYH A;  4ECF A;  2DS9 A;  4KQP A;  2O84 X;  3C9H A;  4Q0C A;  4DLD A;  4GD5 A;  3KBZ A;  1KWH A;  2XD2 A;  4ZEC A;  1LAX A;  3IL1 B;  4AB6 A;  1M5C A;  3G7W A;  4PQJ A;  2WKY A;  3N26 A;  1NNP A;  4P56 A;  1ZU0 A;  4PCD A;  5FTH A;  1P1N A;  2P3V A;  4PE3 A;  1B0H A;  1BLF A;  3H4Z A;  2G93 A;  3QMF A;  4R6K A;  2FIX A;  4JDF A;  3TCG A;  3VLW A;  1LB9 A;  3OEK A;  4QRZ A;  4LAT A;  2DSF A;  3LUZ A;  2E1S A;  3EHU A;  1B4Z A;  1FPL A;  2Y7P A;  4YKP A;  2NVU B;  2DVC A;  3DP6 A;  3LV0 A;  2RF1 A;  2DWA A;  4U4X A;  1B52 A;  5H8H B;  4XKP A;  3CSB A;  3K00 A;  3FXB A;  2XXR A;  3S9E A;  3V8X B;  3N94 A;  2YLN A;  2XXQ A;  5FHM A;  2Q8J A;  1B9J A;  4XEQ A;  5ET8 A;  1I6B A;  1FPK A;  4QFL A;  5I7I A;  4QFO A;  5LDZ A;  2THI A;  1I6A A;  1LFH A;  2AL5 A;  1N76 A;  4FAJ A;  4GWS A;  3M3F A;  3ZKK A;  3KEI A;  4G61 A;  1GR2 A;  5ICQ A;  4N8G A;  3U8Q A;  1D9Q A;  2WX9 A;  1MDQ A;  1NV1 A;  3UP9 A;  1OMP A;  4GQO A;  3IO6 A;  1IXI A;  3KZG A;  2Y5L A;  1FBD A;  3G3I A;  3DP8 A;  3KN7 A;  1FPF A;  1MH3 A;  2ALU A;  3TQW A;  5EYF A;  4FEC A;  1B51 A;  2DWI A;  4DXU A;  1OIB A;  2RC9 A;  3IOR A;  4FBP A;  1DK4 A;  1WDN A;  3LSF B;  1Y3N A;  3BKI B;  3W9V A;  2Q8M A;  5AA3 A;  1IQ7 A;  4MH5 A;  4O3C A;  4U4S A;  3MBP A;  3VDF A;  3L6H A;  3FIR A;  1SYH A;  4JB7 A;  4KXP A;  1MXZ A;  2VPN A;  3MC2 A;  2HAV A;  4GXS B;  2FHY A;  3MZB A;  1MXX A;  1ZLQ A;  3RY3 A;  4PAF A;  2I48 A;  4DZ1 A;  1QUK A;  4JSD A;  1RYX A;  3OSR A;  2VP1 A;  5EQA A;  4EDP A;  5CC2 A;  3MVW A;  4POX A;  2XXI A;  4MFI A;  3SET A;  4NN3 A;  3ONM A;  4DI4 B;  5DTB A;  2IA4 A;  1LLS A;  3ILT B;  1PEB A;  3ILU B;  3SEW A;  2KQZ A;  2XHD A;  5TP9 B;  4PFB A;  3O2A A;  4YMA A;  1LAG E;  4GIZ A;  4YAH X;  2Z8F A;  2GRV A;  2FA7 A;  5I56 B;  2ZNU A;  4AB5 A;  1G0H A;  4RXL A;  1ZJL A;  5EQ9 A;  2XXK A;  1MXV A;  3IAZ A;  2PT2 A;  5KCJ A;  1H44 A;  2OWZ A;  2GH9 A;  3RLF E;  3ISP A;  4MX6 A;  3IOV A;  4OA4 A;  1B1X A;  1XC1 A;  4QHQ A;  3RT6 B;  5CMB A;  5ET5 A;  1OQH A;  1A7L A;  2V4C A;  5DW8 A;  1EZ9 A;  1R1N A;  4DIG A;  1B32 A;  5ET7 A;  1B3G A;  1NFT A;  1DPP A;  4P47 A;  5EQ7 A;  4X48 A;  4EQB A;  5F1Q A;  3USD A;  2GQ1 A;  1CNQ A;  1KA0 A;  1FBG A;  2HHM A;  3VE1 B;  1ANF A;  4LN5 A;  3VVE A;  2FNC A;  4R6Y A;  2CEX A;  4PFI A;  4Q30 B;  4OYV A;  2V3U A;  4NX1 A;  4YB5 A;  3O6I A;  3TCH A;  2R71 A;  5DEX B;  5IZ3 A;  2FBP A;  2REG A;  3KFM A;  3G3F A;  4NF6 A;  1BTJ A;  3O28 A;  4H1X A;  4PFT A;  4ND9 A;  3FXQ A;  3HHG A;  4YB6 A;  4I40 A;  4K3F A;  4MBP A;  1JEV A;  1RDY A;  3KC1 A;  4BDN A;  3S2V A;  3VV5 A;  4OVQ A;  1UTH A;  3IB1 A;  1MY2 A;  1FPE A;  4ZDM A;  4N17 A;  1XHY A;  2WEF A;  4N15 A;  4HS7 A;  1HSL A;  4LVQ A;  4IO7 A;  4OVT A;  4R9G A;  4UAC A;  1XVY A;  2CZL A;  3H6V A;  5AA4 B;  4E0X A;  4NF8 A;  3PPO A;  3A29 A;  1IMB A;  3U92 A;  1KZ8 A;  3V83 A;  3FJM A;  3K6X A;  1FJ6 A;  1NUY A;  4EQ9 A;  1IZ1 A;  2ZYO A;  3FAS A;  1NV2 A;  3TTR A;  4FAT A;  1ZBM A;  1RDX A;  3C4M A;  3H3G A;  3C33 A;  3RTW B;  2Z8E A;  2FIE A;  4YMB A;  1LBV A;  1M5B A;  4OFO A;  3IB2 A;  1QUJ A;  3EHT A;  1MM7 A;  1B2H A;  3OEL A;  3PPN A;  1LCT A;  4NGU A;  3RYD A;  4OVJ A;  4XFE A;  1JW1 A;  4F1V A;  3H6T A;  4FIM A;  1MPB A;  3R6U A;  4F1U A;  1BKA A;  4LP2 B;  3GXA A;  1FBF A;  4GX6 A;  3BFT A;  3G3K A;  1XVX A;  3U1O A;  3O97 A;  1FPI A;  5EHS A;  1UTB B;  4BDM A;  3UGW A;  1O7T A;  3MST A;  1R9L A;  4EQ7 A;  3OEM A;  2HFB A;  3FAT A;  4P9K A;  3PUW E;  4PE5 B;  3WAE A;  1M5F A;  5H8F B;  1FQD A;  3KSX A;  1MQH A;  4N6P A;  4KCC A;  4F2O A;  3KJT A;  1FTM A;  1II5 A;  4U1O A;  3VLV A;  3FVO A;  4GFR A;  1JW4 A;  5ICT A;  5CRY A;  3K6U A;  2DVZ A;  3OD7 A;  4F29 A;  5AA2 D;  4IY6 A;  4JWX A;  4ELO A;  3IJX B;  4HE0 A;  4RY1 A;  4Z7E A;  1FBH A;  4N8Y A;  4QFK A;  2DE4 A;  1YXI A;  4MNI A;  2F97 A;  5TP9 A;  2I58 A;  3THI A;  1D3K A;  1Y20 A;  2PFY A;  5BUU A; 
#chains in the Genus database with same CATH homology
 5I56 A;  3U93 A;  3SDF A;  3MVX A;  4ZE9 A;  4GLI A;  1VE4 A;  2P2A A;  3S9M C;  2WKY A;  3N26 A;  1NNP A;  3MQ9 A;  1ZU0 A;  5FTH A;  2REJ A;  1P1N A;  4EXL A;  2QS1 A;  1QUI A;  2G29 A;  5AA1 A;  1URS A;  1Z7N E;  3LBS A;  5TPA A;  2I4C A;  4Q8R A;  1TFA A;  1B0H A;  2DP8 A;  1BLF A;  3H4Z A;  3Q27 A;  2G93 A;  3TZA A;  4F18 A;  3B6W A;  3TMG A;  2AL4 A;  4KD5 A;  4R6K A;  3CG1 A;  3T9U A;  4BDL A;  4JDF A;  1MQG A;  1Y1Z A;  4ISU A;  3E4R A;  5JEI A;  3TCG A;  3MWB A;  4LUB A;  3VLW A;  4XIG Q;  3DLN A;  1NH7 A;  3ZKL A;  4ZZA A;  1NNF A;  1P1O A;  3TEL A;  1S9T A;  4DCX A;  4ONY A;  1LB9 A;  2I0B A;  2PMS A;  3PV0 E;  1WVJ A;  3OEK A;  2ONS A;  3D4C A;  2NWJ A;  3PMX A;  3QAX A;  4QRZ A;  4LAT A;  4G77 A;  3OOA A;  1D4N A;  5H8S A;  5I59 A;  5IAI A;  2DSF A;  3IO4 A;  4GF8 A;  3VLU A;  3K6W A;  4TQU Q;  4ELP A;  2E1S A;  3EHU A;  1B4Z A;  1MM6 A;  3MP1 A;  2D5W A;  1A8F A;  2Y7P A;  4GRK A;  4YKP A;  1R9Q A;  2NVU B;  2UYF A;  3CIJ A;  5J1D A;  1AL3 A;  1MQD A;  4R6H A;  5BWJ A;  2DVC A;  2O7I A;  4OMB A;  3DP6 A;  1ZMG A;  2RF1 A;  2DWA A;  4U4X A;  1FTO A;  3O6G A;  4I1D A;  1B52 A;  2DOJ A;  2RCA A;  3K1M A;  4XKP A;  1B0L A;  5H8H B;  3CSB A;  3K00 A;  3MPK A;  4OFL A;  1R6Z A;  4U23 A;  4HCW A;  1NNK A;  4ZEI A;  2DQV A;  2XXR A;  1MPC A;  4NF4 A;  1P1U A;  3S9E A;  4POW A;  4OWD A;  1Z7M E;  3V8X B;  3C32 A;  3JYR A;  4RYA A;  3Q28 A;  4G4P A;  2VOZ A;  3N94 A;  2YLN A;  2XXQ A;  5H8F A;  2DXY A;  4OQO A;  5FHM A;  2XX9 A;  3KBR A;  2A5T B;  2Q8J A;  3T22 A;  4DXC A;  1B9J A;  3Q26 A;  1LCF A;  5DEX A;  1UTH B;  2ZXT A;  3T93 B;  1I6B A;  1IIT A;  2Y7W A;  1H3D A;  4R2F A;  3UIF A;  4IY5 A;  2CMO A;  1FQA A;  1GGG A;  2KLF A;  2QS2 A;  4QFL A;  2XXX A;  2O1L A;  3CFZ A;  3H06 B;  1N3W A;  4NE4 A;  2H98 A;  2HZL A;  2QS4 A;  4OEN A;  4QFO A;  5ITO A;  1UTB A;  2W7Y A;  3MAM A;  2OCU A;  4YKJ A;  4F1Y A;  2THI A;  4G8H A;  5CBR A;  4IO2 A;  4H6D A;  2NOO A;  5K2X A;  1B3L A;  1I6A A;  1LAH E;  4PP0 A;  1LFH A;  2AL5 A;  2PYY A;  4C1T A;  1N76 A;  3HHF A;  4FAJ A;  4LA9 A;  1B5J A;  3LR1 A;  2VD3 A;  3E9X A;  3M3F A;  4XKR A;  4O3B A;  3ZKK A;  3KEI A;  1B6H A;  1QVS A;  1ZKB A;  1MQJ A;  1GR2 A;  2DE2 A;  3FGS A;  1HSJ A;  3A3C A;  3GBA A;  3HV1 A;  3U8Q A;  5ICQ A;  4BDO A;  1LB8 A;  4UA8 A;  2UXA A;  4H67 A;  2ZNS A;  1MDQ A;  5HBC A;  2XXW A;  1OMP A;  2F34 A;  4GQO A;  4HCY A;  3IO6 A;  3LC8 A;  4IO3 A;  4H8J A;  1IXI A;  3SEX A;  3TEP A;  1PC3 A;  3KZG A;  3TAJ A;  4F3S A;  2PVU A;  3QIM A;  3G3I A;  2ONK E;  3DP8 A;  1MXW A;  3I3V A;  4YKK A;  3KN7 A;  2ALU A;  1MH3 A;  3QYT A;  1YPN A;  3TQW A;  3BFU A;  1N3X A;  5EYF A;  3ECR A;  4FEC A;  1USY E;  4NF5 B;  1OQG A;  4LZ5 A;  4U1Z A;  3FVN A;  1A8E A;  1VFE A;  4IO4 A;  1WOD A;  5BUU A;  3OO9 A;  3C36 A;  3CSG A;  4WKM A;  3ZSF A;  1B40 A;  1B51 A;  2DWI A;  3OMB A;  4DXU A;  1LST A;  2XXY A;  4JWY A;  4XKQ A;  4C0R A;  3PGF A;  1Q35 A;  1OIB A;  5L9M A;  1Y1M A;  1P99 A;  4E0W A;  4EXK A;  1QKB A;  2RC9 A;  3IOR A;  3KG2 A;  3PUY E;  4JBZ A;  5I2K A;  3T66 A;  2I4B A;  4XKN A;  2B65 A;  5M2V A;  4NMY A;  5DVJ A;  2I3V A;  1WDN A;  5JK4 A;  4R2B A;  2HAU A;  3LSF B;  3QXM A;  4QSE A;  4X1D A;  1Y3N A;  3BKI B;  2HZK A;  2QL3 A;  1Y3Q A;  4GOT A;  3W9V A;  5AA3 A;  1IQ7 A;  1MG1 A;  4MH5 A;  4KI0 E;  3RQT A;  4PET A;  2O69 A;  1VFD A;  3HO7 A;  4KYD A;  5CBS A;  5JTY A;  2Z23 A;  1PB7 A;  3I5O A;  4O3C A;  4U4S A;  3A09 A;  4FE8 A;  3SEU A;  3CVG A;  1L5T A;  5L9O A;  3Q29 A;  1FCK A;  4ZEF A;  2ZYN A;  4IB2 A;  3FXU A;  3Q25 A;  3MBP A;  3KGC A;  4I62 A;  3VDF A;  1AIV A;  3L6H A;  3TQL A;  3FIR A;  3UN6 A;  1SYH A;  3JV9 A;  4JB7 A;  4NF5 A;  5B70 A;  1UIV A;  3HPI A;  1MXZ A;  3FZV A;  2F78 A;  3K0V A;  1A40 A;  3IJO B;  3KSJ A;  3MC2 A;  2F36 A;  1FTK A;  1DTG A;  1SI0 A;  2HAV A;  4GXS B;  1XOC A;  2VD2 A;  3HN0 A;  3MZB A;  4ELR A;  5I84 A;  1P1W A;  4N07 A;  3EF7 A;  1POT A;  4PFU A;  3CI8 A;  1MXX A;  1TXF A;  1ZLQ A;  3RY3 A;  1MS7 A;  2I48 A;  5I57 B;  3TTM A;  1D9V A;  5CMC A;  1QUK A;  1OLC A;  3D4G A;  4DZ1 A;  3I6V A;  2F7A A;  2B3F A;  3HCQ A;  4JSD A;  4G8N A;  1B5H A;  1RYX A;  3OSR A;  4RPN A;  5I57 A;  2VP1 A;  1F9B A;  2F7B A;  3RPW A;  4AQ4 A;  4EDP A;  5LOM A;  3IOU A;  2E0S A;  4MF3 A;  3RNN A;  5CC2 A;  3MVW A;  3G3G A;  1B7H A;  2QRY A;  3FJG A;  1OVB A;  1DOT A;  3LSX A;  1MY1 A;  3PUZ E;  4POX A;  1DSN A;  2Y7I A;  4Z0I A;  1MY3 A;  5EHM A;  3A3U A;  4R73 A;  2UVJ A;  4RA1 A;  3RT8 A;  5CMK A;  2XXI A;  2RIN A;  4BDR A;  4MFI A;  3SET A;  2Y7K A;  4OET A;  1O64 A;  3ONM A;  3G3H A;  1SBP A;  3M8U A;  3PD8 A;  3SER A;  4ELQ A;  1QJM A;  2OWS A;  1N7W A;  2IA4 A;  5DTB A;  4WEP A;  4JXI A;  4X9T A;  5FHO A;  1LLS A;  4OEV A;  5KDT A;  5DT6 A;  3ILT B;  1PEB A;  2B3B A;  1TWY A;  3ILU B;  3SEW A;  2UVH A;  2GFE A;  3K4U A;  4TOZ A;  3UP9 A;  2A5S A;  1A54 A;  4YZZ A;  3VVF A;  4ZED A;  2XHD A;  1AH5 A;  5TP9 B;  3W9W A;  2O51 A;  3V5A A;  3O2A A;  4YMA A;  4QSD A;  2O6A A;  1LAG E;  2V25 A;  4GIZ A;  4YB7 A;  3RN8 A;  3CG3 A;  3K02 A;  3LSL A;  5K2Y A;  2V93 A;  3PPR A;  4YAH X;  3SES A;  4GVO A;  1H43 A;  1B58 A;  1QKA A;  2GRV A;  2Z8F A;  5H8H A;  2FA7 A;  5I56 B;  2ZNU A;  4ZEK A;  3T9V A;  4AB5 A;  5L9S A;  1J1N A;  2ZYK A;  4H5G A;  3H6U A;  3MPL A;  4FED A;  4RXL A;  1EU8 A;  1LFG A;  1ZJL A;  4G68 C;  5IKB A;  1MXV A;  2VGQ A;  4LZ8 A;  3IAZ A;  1SW4 A;  2AIX A;  4G68 B;  3G3J A;  3K6V A;  3PD9 A;  2FYI A;  4MLQ A;  1NNT A;  3SEY A;  3S4U A;  1B7Z A;  4IO6 A;  3EPE A;  1PBQ A;  4FEB A;  1ELJ A;  4YU0 A;  3T9H B;  3R7X A;  4M1V A;  1US4 A;  4OFJ A;  2PT2 A;  2H4I A;  5I2K B;  1IIW A;  4KFQ A;  5FTI A;  5KCJ A;  1H44 A;  1USY H;  2GH9 A;  3QUJ A;  4RK9 A;  3RLF E;  5DVF A;  1BP5 A;  5AA2 A;  1QW0 A;  3VXB A;  4FOR A;  1B46 A;  4P11 A;  1POY 1;  3IOV A;  3PU5 A;  5KCJ B;  3TOD A;  5CI5 A;  3B7D A;  4ESW A;  1B1X A;  1XC1 A;  4KHZ E;  4NF8 B;  3GBB A;  4QHQ A;  3EHS A;  3RT6 B;  2QMW A;  3VVD A;  3RTF B;  1B3H A;  3H03 A;  5CMB A;  1GVC A;  4EUO A;  2X26 A;  1M5E A;  4U21 A;  1SVX B;  4X1B A;  2R6G E;  1OQH A;  1A7L A;  4GWO A;  3MP6 A;  1A55 A;  2HQ0 A;  2OK2 A;  3PMW A;  5I58 B;  1B5I A;  2Q88 A;  1N0T A;  4OXV A;  1EZ9 A;  1R1N A;  4I9D A;  1B32 A;  3UOR A;  1LGB C;  3MJN A;  3VXC A;  4DIG A;  4HTG A;  1B3G A;  1NFT A;  1DPP A;  5I58 A;  3TUS A;  2PBW A;  1NMU A;  3KN3 A;  5HM4 B;  4KYE A;  1JW5 A;  4X48 A;  3RGY A;  4EQB A;  5F1Q A;  4TLM B;  1QUL A;  2X7P A;  3USD A;  3DP4 A;  4H8I A;  3SKP A;  5HPQ A;  2I3W A;  1MXY A;  2HCA A;  3VE1 B;  2O68 A;  1A99 A;  1ANF A;  4NWC A;  5AA2 B;  1GTK A;  4EF2 A;  3VVE A;  2FNC A;  2HEU A;  2RC8 A;  3DM0 A;  1N84 A;  4R6Y A;  2Z22 A;  4Q30 B;  4QFP A;  4FJP A;  4RJZ A;  2Z8D A;  2F6P A;  4P0I A;  1AMF A;  3TTL A;  4JSO A;  4BDQ A;  3S9N C;  1B1H A;  3MUQ A;  1SW5 A;  2XD3 A;  1FTJ A;  3FV1 A;  3BBR A;  1EZO A;  4F22 A;  1B4H A;  4G2Z A;  4OYV A;  3R26 A;  4TLL B;  1N7X A;  2AYS A;  2V3U A;  4YB5 A;  3O6I A;  5I2N B;  1D9Y A;  1DMB A;  2R71 A;  1UQW A;  5DEX B;  2F7C A;  3JZJ A;  2Q2A A;  1GV8 A;  3TCH A;  1NH8 A;  2QJE A;  3KN8 A;  2Q2C A;  2REG A;  2ZNT A;  2D21 A;  2P1S A;  3KFM A;  3G3F A;  4GL8 A;  1T0K A;  4NF6 A;  1BTJ A;  3C35 A;  3E3K A;  2PT1 A;  3UK4 A;  3FUZ A;  4JWO A;  3CFL A;  4PFY A;  1SI1 A;  3O28 A;  4H1X A;  1IXH A;  4NF6 B;  2XX8 A;  2BJJ X;  4H5F A;  4PFT A;  1UIU A;  2F35 A;  4LZ7 A;  4ND9 A;  1H76 A;  3FXQ A;  1TT1 A;  2H25 A;  3HHG A;  1NKX A;  4OTE A;  4WED A;  4YB6 A;  3KOS A;  2RC7 A;  3IB0 A;  4K3F A;  4ZEB A;  5ELV A;  1ZTY A;  4Q5T A;  4OZ9 A;  1Y4C A;  3O29 A;  2OWT A;  1S7Y A;  2I49 A;  2XXU A;  4G8M A;  1YCJ A;  1IXG A;  2GHB A;  1JEV A;  4MBP A;  4F39 A;  3OXN A;  4OHN A;  3T96 B;  5AA4 B;  3PPP A;  1JVX A;  3RUM A;  4N13 A;  4BDN A;  4IGR A;  3S2V A;  3VV5 A;  2ABH A;  5H8Q B;  1UTH A;  1B3F A;  1MY2 A;  2UYE A;  2XXH A;  3IB1 A;  1MRP A;  5H8N B;  2ZMB A;  2IEE A;  1MQI A;  3FXR A;  4ZDM A;  5I2N A;  5KZT A;  1XHY A;  2H99 A;  3LSW A;  4PFW A;  2F5X A;  3C34 A;  5TPA B;  5B7D A;  3S9L C;  2ZYM A;  4HS7 A;  3K2D A;  3HST A;  3OO7 A;  3O6H A;  5L8D A;  4GXA A;  2I6E A;  1HSL A;  3FJ7 A;  4U22 A;  2RCB A;  3OEN A;  4LVQ A;  5AA4 A;  4IO7 A;  1Q1K A;  4R9G A;  1PDA A;  4UAC A;  1DPE A;  1XVY A;  2CZL A;  4DE8 A;  3H6V A;  5F7V A;  4F31 B;  4H0W A;  3QUF A;  1YAE A;  4O3A A;  1I69 A;  1JQF A;  1US5 A;  2Q9T A;  3MVY A;  1H45 A;  4ZE8 A;  4C1U A;  2YPN A;  4NF8 A;  4E0X A;  5KDT B;  3PPO A;  1PB9 A;  3CRB A;  3SEV A;  4NTL A;  3P7I A;  4IO5 A;  3DEL B;  2DWJ A;  4R9F A;  3EN3 A;  3FD3 A;  3VFJ A;  4DCY A;  3U92 A;  3V83 A;  2DE3 A;  2OBG A;  3FJM A;  3IK6 B;  2YJP A;  1B3E A;  1JET A;  3K6X A;  2V3T A;  1LFI A;  4ZS9 A;  4EQ9 A;  4F3B A;  1HSE A;  1JNF A;  1IZ1 A;  4ESX A;  2QS3 A;  2ZYO A;  3FAS A;  3T9X B;  2HXW A;  2UVG A;  2F6G A;  3TTR A;  4FAT A;  2Y7R A;  5AE4 A;  2O1M A;  4LQ5 A;  3TKD A;  4F3G A;  3TTN A;  1ZBM A;  1B7U A;  1EH3 A;  3C4M A;  5H8Q A;  5A5X B;  2XX7 A;  3F11 A;  3H3G A;  3C33 A;  5CMM A;  3RTW B;  4KYS A;  2Z8E A;  4KCD A;  4OEU A;  1IUD A;  1CB6 A;  1DTZ A;  3B6Q A;  4DXB A;  4F3P A;  1FQC A;  4YMB A;  1M5B A;  4OFO A;  2OLB A;  4U2R A;  3IB2 A;  3UA8 A;  4KR5 A;  2I0C A;  2X7Q A;  3KJ7 A;  1QUJ A;  2H5Y A;  4R74 A;  3C31 A;  1Y9U A;  3EHT A;  1MM7 A;  1B2H A;  1P1Q A;  2H9B A;  2XXV A;  3OEL A;  4H65 A;  3PPN A;  4NF4 B;  1FW0 A;  1Y4T A;  2ANJ A;  2Q89 A;  1LCT A;  4EF1 A;  1O63 A;  4LQ2 A;  3OO8 A;  2P0S A;  3FV2 A;  4F2Q A;  4OVJ A;  2A5T A;  1AOV A;  3CFX A;  3FVG A;  1MY0 A;  1OVT A;  1N04 A;  3IOW A;  4KPT A;  3L6G A;  4R75 A;  1JW1 A;  3TTK A;  4F1V A;  1MPD A;  3H6T A;  2PX1 A;  3MP8 A;  4FIM A;  4M4G A;  3B6T A;  4P0G A;  1JEU A;  1FQF A;  1MPB A;  1YTV A;  2ESN A;  3R6U A;  3TDJ A;  4F1U A;  3TPA A;  3PMV A;  1BKA A;  2UVI A;  4LP2 B;  3GXA A;  4QSC A;  3ZS6 A;  3IX1 A;  1S50 A;  3BFT A;  1I6Q A;  1SW1 A;  3G3K A;  5A5X A;  1XVX A;  1PBP A;  3U1O A;  2DYX A;  2O7U A;  3O97 A;  1MXU A;  3LUY A;  2QSX A;  4LON B;  3PUV E;  5EHS A;  1OLA A;  3M3L A;  3CR9 A;  3E13 X;  3OSQ A;  4ZZE A;  1UTB B;  3TYH A;  2F8D A;  3O66 A;  4RPO A;  4BDM A;  3QSL A;  3W15 C;  3UGW A;  5JTY B;  1EZP A;  1O7T A;  3U94 A;  1FQB A;  2V3Q A;  3WAF A;  1R9L A;  3M3K A;  4EQ7 A;  3OEM A;  1SD3 A;  1URD A;  1MDP 1;  2RKM A;  1IXC A;  4IGT A;  2HFB A;  2DXR A;  4I8C A;  4OER A;  3FAT A;  5ITP A;  1MH4 A;  2ONR A;  3PUW E;  3TFL A;  3K01 A;  4THI A;  2DWH A;  4GL0 A;  5TU0 A;  4PE5 B;  1NL5 A;  1CE2 A;  1M5F A;  3K1N A;  3MZ1 A;  5H8F B;  3WAE A;  1SYI A;  2Y84 A;  5CM6 A;  1FQD A;  4YIC A;  3KOT A;  3KSX A;  1LAF E;  1VR5 A;  1MQH A;  4G68 A;  4N6P A;  2D3I A;  3N6T A;  1RYO A;  2R9J A;  3U72 A;  4KCC A;  4WXJ A;  4OES A;  4F2O A;  2NXO A;  3KJT A;  4MLV A;  4YKI A;  1SW2 A;  3O9P A;  3MW0 A;  1RKM A;  1ZIU A;  4QF9 A;  5FHN A;  3V89 B;  1FTM A;  2LAO A;  3H7M A;  4RNS A;  1II5 A;  1JVY A;  4R72 A;  4U1O A;  3TCF A;  1MY4 A;  3FVO A;  2M8C A;  4QFN A;  3VLV A;  4GFR A;  1JW4 A;  5ICT A;  1ATG A;  3N5L A;  1VSO A;  3ODB A;  5CRY A;  3PPQ A;  4RK2 A;  3K6U A;  2NUV A;  2DVZ A;  4NWD A;  2QMX A;  2VHA A;  2XXT A;  3IOT A;  3OD7 A;  3QK6 A;  3MZ9 A;  4NED A;  3N6U A;  4XXU A;  4F29 A;  4DDD A;  1LBC A;  2OJT A;  3MVZ A;  1SDX A;  3PUX E;  5AA2 D;  2V84 A;  3H6W A;  4IY6 A;  1M5D A;  2GHA A;  4JWX A;  4L17 A;  4BLA A;  4ELO A;  5DYH A;  4ECF A;  2DS9 A;  2XXP A;  3IJX B;  4KQP A;  5DVI A;  1SQY A;  2O84 X;  2OZZ A;  3C9H A;  3AXF A;  1FTL A;  4RY1 A;  4HW8 A;  4Z7E A;  1TFD A;  4Q0C A;  4DLD A;  1FQE A;  1IEJ A;  1XT8 A;  1XS5 A;  2DE4 A;  3IR1 A;  3OO6 A;  4GD5 A;  4QFK A;  1KWH A;  2XD2 A;  3FVK A;  4ZEC A;  2F97 A;  2QPQ A;  3GLB A;  5TP9 A;  1BIY A;  2I58 A;  1LAX A;  3IL1 B;  1LBB A;  1D3K A;  3EQ1 A;  5H8N A;  3THI A;  1M5C A;  4AB6 A;  4F19 A;  5I59 B;  3G7W A;  5ISU A;  3GZG A;  1URG A;  1Y20 A;  1Y3P A;  3K1P A;  4PQJ A;  4XTC Q;  1PB8 A;  1B05 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...