4LATA

Crystal structure of phosphate abc transporter, periplasmic phosphate-binding protein psts 1 (pbp1) from streptococcus pneumoniae canada mdr_19a in complex with phosphate
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
260
structure length
260
Chain Sequence
b'ESITAVGSTALQPLVEVAADEFGTIHVGKTVNVQGGGSGTGLSQVQSGAVDIGNSDVFAEEKDGIDASALVDHKVAVAGLALIVNKEVDVDNLTTEQLRQIFIGEVTNWKEVGGKDLPISVINRAAGSGSRATFDTVIMEGQSAMQSQEQDSNGAVKSIVSKSPGAISYLSLTYIDDSVKSMKLNGYDLSPENISSNNWPLWSYEHMYTLGQPNELAAEFLNFVLSDETQEGIVKGLKYIPIKEMKVEKDAAGTVTVLEG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphate-binding protein PstS 1
publication title Crystal structure of phosphate ABC transporter, periplasmic phosphate-binding protein PstS 1 (PBP1) from Streptococcus pneumoniae Canada MDR_19A in complex with phosphate
rcsb
source organism Streptococcus pneumoniae
molecule tags Transport protein
total genus 87
structure length 260
sequence length 260
ec nomenclature
pdb deposition date 2013-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4latA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4latA02
4C1TA 4QFKA 3O66A 4OERA 4PFUA 1B40A 1XC1A 4QSCA 4GVOA 3G3GA 3KFMA 5DVJA 5TPAA 3Q25A 2OLBA 5H8SA 3EPEA 3UORA 1MM6A 2WKYA 3MC2A 1QVSA 3PPOA 1DSNA 4YKJA 4U4SA 3ODBA 1TWYA 2F7CA 3S4UA 4U2RA 2NVUB 2FA7A 1MQDA 1MPDA 4BLAA 1D3KA 4HCYA 1Z7ME 2F6GA 2ZNSA 3FJGA 2OWSA 2XXRA 3DM0A 3MVWA 4RJZA 1B5IA 4WXJA 3FD3A 1GGGA 2H4IA 3TTLA 2H9BA 5I59A 3MPKA 3SDFA 1NNPA 3KJ7A 1WDNA 3GBAA 3IOUA 4GIZA 1MXWA 3WAEA 4BDMA 1LBCA 2G29A 3LSFB 4OMBA 5AA2A 5AA2D 2I0BA 2XXWA 4P0IA 1LBBA 3CVGA 3RT8A 1SYHA 3MZ9A 1GTKA 1A55A 1AOVA 4R74A 2RKMA 1D9VA 3IO6A 1QW0A 1QULA 3PPPA 1LFGA 3BKIB 3TZAA 3G7WA 2AL4A 3HSTA 3G3IA 4H8JA 5DVIA 4JWYA 1LAHE 1O63A 1D9YA 2VP1A 2XXIA 2HEUA 3K2DA 1GR2A 4FE8A 2XXHA 4EQBA 3SEUA 4XXUA 2B3BA 3K4UA 2UVGA 4F29A 2GH9A 1H3DA 3FUZA 4IGRA 1IXCA 3IB1A 4NF6B 2Z23A 3E9XA 3TFLA 4LQ5A 2I4BA 1MXVA 4UACA 3M3FA 5F1QA 5JEIA 1HSEA 3U93A 4LP2B 4OQOA 3QUFA 4ZEIA 4YU0A 3EHTA 3B6QA 3ILTB 3KN3A 3PPNA 2I3WA 1KWHA 3FJ7A 1IITA 4AB5A 1PDAA 4HW8A 4OENA 4U4XA 4POWA 1R9QA 2ZNUA 4R72A 1LAFE 3N5LA 1S9TA 3W9VA 4IO6A 5H8HA 1FTMA 1OIBA 1IEJA 5BWJA 3TCGA 2OCUA 1B3LA 2Y7WA 3U94A 4LQ2A 4BDLA 4F3PA 1XT8A 4FEDA 4G68C 3KOSA 3D4GA 3B7DA 4JSDA 1NFTA 4F39A 5L9SA 5DYHA 1N84A 5DT6A 5AE4A 2QS3A 4NF4B 5EHMA 4YKPA 3PUWE 3TTRA 1II5A 4JXIA 2V3UA 2Q2CA 3HCQA 2UYEA 4GF8A 4DXBA 1JQFA 2ZYOA 5I57A 5TU0A 4OEVA 3QAXA 3V5AA 5CMKA 1PBPA 3VE1B 3K6UA 2I0CA 4G68A 2FYIA 4C0RA 4DXCA 3TTNA 2XXYA 5DTBA 1JEVA 3K00A 3N26A 2THIA 2I4CA 4U21A 2F7BA 4OXVA 4G8HA 3K6XA 3H6UA 4TOZA 2V84A 4Z7EA 2XXTA 3V8XB 5I56B 1BLFA 1MH3A 3KOTA 3G3JA 3K6WA 2A5TB 5L9OA 2D3IA 3CRBA 4YZZA 5CMBA 1LGBC 1PBQA 1B05A 3E13X 4IY6A 4LUBA 3T66A 2XD2A 1JETA 1QUJA 4NTLA 4F19A 4XKNA 4RA1A 1PEBA 2X7QA 1HSJA 4BDRA 3S9EA 2X7PA 3G3FA 4YMAA 3PMVA 1Y9UA 1MQIA 4I8CA 3O6GA 1UTHB 2Q8JA 4Q0CA 1B7UA 1B51A 5EYFA 4OFLA 1Q1KA 1B58A 1P1UA 4IY5A 4IO4A 1LCTA 1Y4TA 3IOVA 3OMBA 4FECA 2DQVA 1FCKA 2PX1A 3B6WA 2Y84A 2P1SA 2ZNTA 1S50A 4KYEA 1EH3A 4THIA 2NXOA 4ISUA 3EHSA 2QPQA 1IXHA 4H5FA 3IL1B 3L6HA 3PMXA 3QK6A 3OO7A 5TP9B 4ZEDA 3PGFA 1LAGE 1Z7NE 3CR9A 1O7TA 5M2VA 3KGCA 3OD7A 4KI0E 4F3SA 1EU8A 4GQOA 3TQLA 4KCDA 4L17A 4PE5B 3HHFA 3U72A 4RPNA 1IQ7A 4NF5B 1MM7A 1PB8A 1B2HA 3CG3A 1LAXA 1ATGA 1LB8A 1GVCA 5I2NB 4C1UA 4P11A 3CG1A 1XOCA 2W7YA 4F1YA 1FQFA 4YAHX 5L9MA 1P1NA 2GHAA 2LAOA 3ILUB 1EZOA 3MP6A 4QFNA 1JEUA 3UA8A 1IZ1A 4LATA 3LSLA 2DWIA 1NNKA 5FHMA 4X1DA 3H7MA 2IEEA 1CB6A 3B6TA 2ZYMA 1OLCA 4DIGA 4AQ4A 3FVKA 1YTVA 2NOOA 1SI0A 3TMGA 3RGYA 1QUKA 3K1NA 4KPTA 3PPRA 1MPCA 1B4HA 3MUQA 3K6VA 1FQDA 2DOJA 2VD2A 3RNNA 3GLBA 1RKMA 1UQWA 3U8QA 3TEPA 5FHOA 2F34A 2Z22A 5DEXB 1MS7A 1MY3A 2DE3A 4NF6A 4ZE9A 5CMMA 3IJOB 4TLMB 5CRYA 4EUOA 3S9MC 4ND9A 5F7VA 1QUIA 3KBRA 1SVXB 2OWTA 4OEUA 5ISUA 4EF2A 3RT6B 5B70A 3FJMA 3O9PA 5HBCA 1MY4A 3PUYE 4GL0A 1P1QA 4O3AA 1MDP1 4G2ZA 1MY2A 1N7XA 5KDTB 4FIMA 3PU5A 3K02A 3KN8A 3TTMA 4BDQA 2Q2AA 2RC7A 2VD3A 4HCWA 4MF3A 1B4ZA 2PT2A 2I49A 1I69A 4IO2A 3A09A 3K0VA 3CFZA 1FQCA 1P1OA 3D4CA 5FTIA 4I62A 1Y3QA 2AYSA 1P99A 4NF4A 1A8FA 5KCJB 4KQPA 1B7ZA 1B3EA 2ONKE 4H5GA 1SW1A 2DSFA 1S7YA 5L8DA 3CFLA 3LBSA 3T9UA 5BUUA 3T9XB 3O28A 2QMWA 3MWBA 1OLAA 4GFRA 1Y3PA 3OOAA 4DDDA 3MVYA 4R2FA 1URDA 2QS4A 4MLQA 4RNSA 2DWAA 4WKMA 1AMFA 3C32A 3OENA 1MH4A 4P0GA 4YMBA 3EQ1A 3L6GA 2O1LA 1SBPA 1VSOA 4QFOA 4DLDA 2E0SA 3A3CA 3SEYA 4N13A 3OO8A 3VXCA 1DTZA 2F78A 4Q5TA 1UIUA 4YB5A 1FQBA 4PFYA 2YLNA 1FQEA 3IJXB 3VLVA 4YKKA 4RPOA 4Q8RA 1ZLQA 5H8QB 4H6DA 3IB0A 3HO7A 3G3HA 3I5OA 2I48A 1YAEA 5AA3A 3R6UA 4KHZE 1MQGA 2RC9A 1POTA 5I2KB 3C4MA 1UTHA 1XVYA 1N7WA 5TPAB 3C31A 1H45A 5JTYB 1B3FA 3CIJA 4PQJA 2PBWA 4FEBA 5H8NB 3Q29A 3HV1A 3H6VA 3T93B 3TCFA 3S9LC 3Q26A 2Z8EA 2M8CA 1R1NA 1USYE 4Z0IA 2QS2A 3PUZE 2Y7RA 5A5XB 4R73A 1IXIA 4BDNA 4ELPA 2ANJA 4H8IA 1OMPA 4GL8A 4PP0A 4N07A 3KEIA 1Y1ZA 3BFTA 5TP9A 4U1ZA 3FV2A 1M5CA 3U1OA 3CSBA 3VLWA 4U23A 4JWXA 1MXUA 3KZGA 4Q30B 2ZYKA 2F6PA 3R7XA 4X1BA 3Q27A 2QS1A 3TCHA 1OVBA 1MG1A 3VVDA 2OK2A 1N04A 1VFEA 4KYSA 4FAJA 1B46A 4GD5A 5CC2A 2HZKA 1Q35A 3A3UA 1L5TA 2DWJA 3RUMA 1MXYA 1UTBB 1IXGA 2Z8DA 3DP6A 3PD9A 3T96B 4MH5A 4XTCQ 2GFEA 3GZGA 4G77A 3MBPA 4NE4A 5ICQA 3H6TA 3IOTA 4RK2A 4KFQA 4ELQA 5CBRA 4KR5A 4MBPA 1A8EA 1ELJA 3MQ9A 4TQUQ 4N6PA 4H67A 5ELVA 4DCYA 4ONYA 3MAMA 5CBSA 2KLFA 4OFJA 1FTLA 2VGQA 4E0WA 3RPWA 2DVZA 4JB7A 1JW1A 2F97A 4NMYA 4R6HA 3PV0E 4OVJA 3W9WA 4NF8B 4H1XA 2ONRA 2O51A 3ZKLA 2XXQA 4YICA 3F11A 4U22A 2D21A 1DOTA 4LA9A 3P7IA 4NWCA 2HCAA 3ZSFA 1SDXA 2OJTA 1ZIUA 4YKIA 2ZXTA 4WEPA 4F3BA 3H4ZA 3FV1A 4R9GA 1DMBA 4LZ8A 1B1XA 3FXRA 3OO9A 2V93A 3RLFE 5CM6A 3MZBA 4MFIA 3FXQA 4PFWA 4OWDA 2GHBA 4GRKA 3IAZA 5J1DA 1JW5A 4GWOA 3AXFA 4G4PA 4JWOA 5I58B 3MP1A 2RCBA 2CZLA 4OZ9A 3OEKA 3O29A 4IO5A 2ZYNA 1P1WA 2H99A 1BP5A 3DP8A 3H06B 2A5SA 3MVXA 2XXUA 5KDTA 3MP8A 1NH8A 3VV5A 2HAVA 2B65A 3OO6A 4R9FA 3LSWA 4ZDMA 3FIRA 4PFTA 4KYDA 3IB2A 1B0HA 3UP9A 3C34A 3QIMA 2UYFA 1JNFA 4F18A 2ONSA 3FATA 3KSJA 1BKAA 3QXMA 4NWDA 3FVNA 3SKPA 2I3VA 2RF1A 2VHAA 3QYTA 1B52A 2E1SA 1NH7A 1FTKA 4POXA 3BFUA 2QRYA 1A7LA 3E3KA 3SEWA 1MY0A 3T9HB 4X9TA 1SQYA 2X26A 2R71A 4OESA 1H44A 2HXWA 4EQ9A 4H65A 1ZBMA 2OZZA 4LZ7A 2I6EA 2RC8A 1CE2A 3PPQA 5H8FB 3K01A 3RTFB 2O6AA 4R2BA 2REJA 1MXXA 4R75A 1B6HA 3HHGA 1D4NA 1NMUA 1I6QA 2P0SA 2DS9A 4ZZAA 4I1DA 5I84A 4GXSB 2XD3A 2F7AA 2ABHA 1BTJA 2V3QA 4F22A 1ANFA 3SETA 5ICTA 1SW5A 1OVTA 3T22A 3WAFA 1M5DA 3T9VA 2V3TA 1B5JA 3PUVE 5H8QA 3RTWB 3CSGA 1A99A 2XX7A 1B3HA 2DXYA 5AA4B 1IIWA 4AB6A 2H25A 3GBBA 3ONMA 2YPNA 3TUSA 3Q28A 2UVIA 5I2KA 3PUXE 3I6VA 2Z8FA 2DXRA 3SESA 2XXPA 5JTYA 4O3BA 1M5BA 4JSOA 4ECFA 5KZTA 2UVHA 4OHNA 1TFDA 2DE4A 5H8NA 3N94A 4H0WA 2QL3A 1M5FA 4TLLB 1SW4A 3RN8A 1TFAA 2XHDA 2R9JA 1PC3A 3FVGA 5A5XA 1URGA 3TPAA 4LONB 4BDOA 2O69A 4I9DA 2UVJA 4QRZA 5CMCA 1UIVA 3ZS6A 1ZMGA 1US4A 3SEVA 3SERA 1EZ9A 1NL5A 1YCJA 3C33A 3USDA 4KCCA 5HPQA 4ZECA 2UXAA 4GOTA 2PT1A 1MQHA 3JZJA 2CMOA 1IUDA 3TQWA 5CI5A 3VDFA 1SD3A 1SI1A 2O84X 2I58A 3C35A 1B5HA 1H43A 2XXXA 3BBRA 2P2AA 2H5YA 4YB7A 1MDQA 1N0TA 3H03A 4UA8A 3M3KA 1UTBA 4F31B 4EDPA 3EN3A 4ZEKA 5I56A 4DE8A 2A5TA 1OQHA 3OSQA 1B0LA 3PMWA 2Y7IA 4OFOA 1POY1 4PETA 3W15C 2OBGA 4WEDA 1Y20A 1AL3A 3MZ1A 3R26A 3TKDA 3QSLA 4NF8A 4QSEA 3UGWA 4ELRA 5ITPA 1MXZA 1URSA 3EHUA 1MPBA 3TYHA 1EZPA 3KSXA 2HQ0A 1NNTA 1SW2A 2QJEA 4EXKA 1WVJA 3M8UA 2ESNA 1JVXA 5FTHA 3KJTA 2PYYA 3VLUA 3IR1A 1FW0A 3S9NC 4OTEA 2FNCA 2IA4A 3O6HA 3S2VA 1A54A 4JBZA 5HM4B 1TXFA 1FTJA 5I58A 3JV9A 5B7DA 4ZZEA 2YJPA 3SEXA 2DYXA 2F5XA 1B7HA 2DWHA 2Q9TA 4K3FA 5IAIA 4IGTA 4R6YA 4RK9A 3MPLA 1T0KA 1N3XA 1F9BA 4O3CA 4FATA 4FJPA 5I59B 4XKQA 1WODA 2RINA 4G8MA 3OELA 3RQTA 1DTGA 3MJNA 4NF5A 5AA2B 3UN6A 3U92A 1MQJA 1US5A 3THIA 4U1OA 3FGSA 1ZKBA 4DCXA 4IO7A 2D5WA 5I2NA 3C9HA 4ZE8A 3VFJA 1LLSA 2XX9A 3QUJA 2BJJX 3TDJA 3CFXA 1M5EA 4R6KA 5JK4A 4KD5A 4QFPA 2PVUA 1XHYA 3CI8A 3LUYA 4IO3A 3OEMA 4ZEFA 1TT1A 1VFDA 1QKBA 3HN0A 2F8DA 3O6IA 2H98A 1YPNA 1LFHA 3TELA 4XIGQ 4LVQA 1MY1A 1B3GA 3IOWA 4RYAA 1ZU0A 2XXVA 1XVXA 1I6AA 5H8FA 3O97A 4M1VA 4F1VA 2O1MA 3GXAA 4RY1A 1A40A 3JYRA 3OXNA 4ZEBA 1GV8A 4OYVA 3LC8A 2VOZA 4EF1A 3ECRA 4ZS9A 3V89B 3I3VA 3K1MA 1JVYA 4XKRA 3FXUA 5EHSA 2PMSA 3UK4A 4F2OA 1DPPA 4G8NA 1XS5A 5DEXA 3O2AA 1H76A 2DVCA 1N76A 3MVZA 3N6UA 1VR5A 2QSXA 2O7UA 3KN7A 3LSXA 4YB6A 1J1NA 4RXLA 4HS7A 1OQGA 4M4GA 4FORA 3N6TA 1ZJLA 2GRVA 4XKPA 1PB7A 2HZLA 4GLIA 5AA4A 3IX1A 3HPIA 3C36A 5H8HB 4ELOA 5K2XA 1O64A 5DVFA 3VVFA 1R9LA 3LR1A 3TAJA 1USYH 2R6GE 3TTKA 3DP4A 4HTGA 2QMXA 2REGA 4X48A 2AL5A 3IORA 2RCAA 1NNFA 1LCFA 4IB2A 2HFBA 3RY3A 1RYXA 1PB9A 1HSLA 4QFLA 1QJMA 3FVOA 2B3FA 2XX8A 3M3LA 1ZTYA 3H6WA 5I57B 5KCJA 3FZVA 4F2QA 1FQAA 3K1PA 3VXBA 2NWJA 4G68B 3ZKKA 1QKAA 4OETA 4DXUA 1VE4A 4ESXA 2G93A 3PD8A 2V25A 5FHNA 2Y7KA 2ALUA 3H3GA 3IK6B 1B9JA 4DZ1A 2F35A 4JDFA 4ESWA 4MLVA 1N3WA 3KG2A 3FASA 1LSTA 5IKBA 3OSRA 3VVEA 2O7IA 4QHQA 3MW0A 1I6BA 3DLNA 4QF9A 1JW4A 5AA1A 3G3KA 4EXLA 5K2YA 2HAUA 5ITOA 4F3GA 1B32A 3TODA 3IO4A 4F1UA 1LFIA 5LOMA 1DPEA 2DE2A 1SYIA 3EF7A 1MRPA 3UIFA 1B1HA 1AIVA 4LZ5A 3V83A 1RYOA 2ZMBA 2NUVA 4GXAA 2Q89A 4QSDA 1Y3NA 1R6ZA 4EQ7A 1Y1MA 2Q88A 2DP8A 3E4RA 2Y7PA 1NKXA 2AIXA 1Y4CA 2O68A 1FTOA 1AH5A 1BIYA 3DELB 4NEDA 1LB9A 2F36A 4E0XA
chains in the Genus database with same CATH superfamily
4C1TA 4QFKA 3O66A 2WBDA 4OERA 4PFUA 1B40A 1RDXA 2QVRA 1XC1A 4QSCA 4GVOA 3G3GA 3KFMA 1NV4A 5DVJA 5TPAA 3Q25A 2OLBA 5H8SA 3EPEA 2PCRA 3UORA 1MM6A 2WKYA 3MC2A 1QVSA 3PPOA 1DSNA 4YKJA 4U4SA 3ODBA 1TWYA 2F7CA 3S4UA 4GBVA 4U2RA 2NVUB 2FA7A 1MQDA 1MPDA 4BLAA 4PFBA 1D3KA 4PF6A 4HCYA 1Z7ME 5ET7A 2F6GA 2ZNSA 3FJGA 2OWSA 2XXRA 3DM0A 3MVWA 4RJZA 1B5IA 2FBPA 4WXJA 3FD3A 1GGGA 2H4IA 3TTLA 2H9BA 5I59A 3MPKA 3SDFA 1NNPA 3KJ7A 2HXRA 1WDNA 3GBAA 3IOUA 4XFEA 4GIZA 4JVIA 1MXWA 3WAEA 4BDMA 1LBCA 2G29A 2HHMA 3LSFB 4OMBA 5AA2A 5AA2D 2I0BA 2XXWA 4P0IA 1LBBA 3CVGA 3RT8A 1FPKA 1SYHA 3MZ9A 1D9QA 1GTKA 1A55A 1AOVA 4R74A 2RKMA 1D9VA 3IO6A 1QW0A 1QULA 3PPPA 1RDZA 2ZZVA 1LFGA 3BKIB 3TZAA 3G7WA 2AL4A 3HSTA 1NUZA 3G3IA 4H8JA 5DVIA 4JWYA 1LAHE 1O63A 1D9YA 2VP1A 2XXIA 3QMFA 4MNIA 2HEUA 3K2DA 1GR2A 4FE8A 4H46A 2XXHA 1LBYA 4EQBA 3SEUA 4XXUA 2B3BA 3K4UA 2UVGA 2XWVA 4P8BA 4F29A 2GH9A 1H3DA 3FUZA 4IGRA 1IXCA 3IB1A 4NF6B 2Z23A 3E9XA 3TFLA 4MX6A 4LQ5A 2I4BA 1MXVA 4UACA 2CEYA 3M3FA 5F1QA 5JEIA 2QVVA 1HSEA 3U93A 4LP2B 4OQOA 3QUFA 4ZEIA 4YU0A 4X04A 3EHTA 3B6QA 3ILTB 3KN3A 3PPNA 2I3WA 3LUZA 1KWHA 3FJ7A 1IITA 4AB5A 1PDAA 4HW8A 4OENA 4NAPA 4U4XA 4POWA 1R9QA 2ZNUA 4R72A 1LAFE 3N5LA 2FVZA 1S9TA 3W9VA 3D1RA 4IO6A 5H8HA 1FTMA 1OIBA 1IEJA 5BWJA 3TCGA 2OCUA 5I7IA 1B3LA 2Y7WA 3U94A 4LQ2A 4BDLA 4F3PA 1XT8A 4FEDA 4G68C 5F24A 3KOSA 5DW8A 3D4GA 3B7DA 4JSDA 1NFTA 4AS5A 4F39A 5L9SA 5DYHA 1N84A 1G0HA 5DT6A 5AE4A 2QS3A 4NF4B 5EHMA 4PDDA 4YKPA 3PUWE 3TTRA 1II5A 4JXIA 2V3UA 2Q2CA 3HCQA 2UYEA 1NV7A 4GF8A 4DXBA 1NI9A 1JQFA 2ZYOA 2WYPA 5I57A 5TU0A 4OEVA 3QAXA 3V5AA 5CMKA 2CZIA 1PBPA 1NV5A 3VE1B 3K6UA 2I0CA 4G68A 4O94A 2FYIA 4C0RA 4DXCA 3TTNA 5T3JA 3B50A 2L5VA 2XXYA 4N15A 5DTBA 1JEVA 3K00A 3N26A 2THIA 2I4CA 4MHFA 4U21A 1K9ZA 2F7BA 4OXVA 4PCDA 4G8HA 3IFAA 3K6XA 3H6UA 4TOZA 2V84A 4MNPA 4Z7EA 2XXTA 3V8XB 5I56B 2WYKA 1BLFA 1MH3A 3KOTA 3G3JA 3K6WA 4OVSA 2A5TB 3A29A 5L9OA 5ESYA 2D3IA 3CRBA 4YZZA 5CMBA 1LGBC 1PBQA 1B05A 3E13X 4IY6A 4LUBA 1VDWA 3T66A 5ET6A 2XD2A 1JETA 1QUJA 4NTLA 1AWBA 4F19A 4XKNA 4RA1A 1PEBA 2X7QA 1HSJA 4BDRA 2P3VA 3S9EA 2X7PA 3G3FA 4YMAA 3PMVA 5IGAA 1Y9UA 1MQIA 4GX3A 4I8CA 2VPNA 3U65A 3RPLA 4GWWA 3O6GA 1UTHB 2Q8JA 4Q0CA 1B7UA 1B51A 4OA4A 4P3LA 5EYFA 4OFLA 1Q1KA 4N4UA 1B58A 1P1UA 4IY5A 4IO4A 1LCTA 1Y4TA 3IOVA 3OMBA 4FECA 2DQVA 1FCKA 2PX1A 3B6WA 2Y84A 2P1SA 2ZNTA 1S50A 4KYEA 1EH3A 4X8RA 4THIA 2NXOA 4ISUA 3EHSA 5EQ9A 2QPQA 4H5FA 3IL1B 1IXHA 3L6HA 3PMXA 3QK6A 3OO7A 5TP9B 4ZEDA 3PGFA 1LAGE 1Z7NE 3CR9A 1O7TA 5M2VA 2KR0A 3KGCA 3OD7A 4KI0E 4PTKA 4F3SA 1EU8A 4GQOA 3TQLA 4KCDA 2HPGA 1IMAA 3HHFA 4L17A 4PE5B 3U72A 4RPNA 1IQ7A 4NF5B 1MM7A 1PB8A 4O7IA 1B2HA 3CG3A 1LAXA 4OVQA 1ATGA 1LB8A 1GVCA 1SPIA 5I2NB 4C1UA 4P11A 3CG1A 1XOCA 3E78A 2W7YA 4F1YA 1FQFA 4YAHX 5L9MA 1P1NA 2GHAA 2LAOA 1BK4A 3ILUB 1EZOA 4LN5A 3MP6A 4QFNA 1JEUA 3UA8A 1IZ1A 4LATA 1FPJA 3LSLA 2DWIA 1NNKA 1FTAA 1DCUA 5FHMA 4X1DA 3H7MA 2IEEA 1CB6A 3B6TA 2CZKA 2ZYMA 1OLCA 4DIGA 4AQ4A 1G0IA 3FVKA 2DDKA 1YTVA 2NOOA 3MSTA 1SI0A 3TMGA 3RGYA 1QUKA 3K1NA 4KPTA 3PPRA 1MPCA 1B4HA 3MUQA 3K6VA 1FQDA 2DOJA 2VD2A 3RNNA 3GLBA 1RKMA 1UQWA 3U8QA 4KXPA 3TEPA 4FBPA 5FHOA 2F34A 2Z22A 5DEXB 1MS7A 4GWUA 1MY3A 2DE3A 4NF6A 1QGXA 4ZE9A 5CMMA 3IJOB 4TLMB 5ET8A 5CRYA 4EUOA 3S9MC 4ND9A 5F7VA 2OWZA 1QUIA 5J16A 3KBRA 1SVXB 2OWTA 4OEUA 5ISUA 4EF2A 3RT6B 1IMEA 5B70A 4QBAA 3FJMA 3O9PA 2Y5KA 5HBCA 4MNCA 1MY4A 3PUYE 4GL0A 1P1QA 4O3AA 1MDP1 4G2ZA 1MY2A 1N7XA 5KDTB 4FIMA 3PU5A 3K02A 3KN8A 3TTMA 4BDQA 2Q2AA 2RC7A 2VD3A 4HCWA 4MF3A 1B4ZA 2PT2A 2I49A 1I69A 4IO2A 3A09A 3K0VA 3CFZA 1FQCA 1P1OA 4JVDA 4I3EA 3D4CA 5FTIA 4I62A 1Y3QA 2AYSA 1P99A 4NF4A 1A8FA 5KCJB 4KQPA 1B7ZA 1B3EA 2ONKE 4H5GA 1SW1A 2DSFA 1S7YA 5L8DA 3CFLA 3LBSA 3T9UA 5BUUA 3T9XB 3O28A 2QMWA 3MWBA 4N8YA 1OLAA 4GFRA 1Y3PA 3OOAA 1FPDA 4DDDA 3MVYA 4R2FA 1URDA 4WKMA 1CNQA 2QS4A 2DWAA 4MLQA 4RNSA 4N6DA 1AMFA 3C32A 3OENA 1MH4A 1K9YA 4P0GA 4GBWA 4YMBA 1NV1A 4PF8A 3EQ1A 3L6GA 2O1LA 1SBPA 4MMPA 1VSOA 4N6KA 4QFOA 4DLDA 2E0SA 3A3CA 3SEYA 4N13A 3OO8A 3VXCA 1DTZA 2F78A 4Q5TA 1UIUA 4YB5A 2XXKA 1NV3A 1FQBA 4PFYA 1KA0A 2YLNA 1FQEA 3IJXB 3VLVA 4YKKA 4NF0A 2BJIA 4RPOA 1EYIA 2Q74A 4Q8RA 2XWOA 1ZLQA 5EQAA 5H8QB 4AS4A 4H6DA 1LBWA 3IB0A 1NUWA 3HO7A 3G3HA 3T0JA 3I5OA 2I48A 2PFYA 2ZZXA 1YAEA 5AA3A 3R6UA 4KHZE 1MQGA 2RC9A 1POTA 4NGUA 5I2KB 3C4MA 1UTHA 1XVYA 1FBHA 1N7WA 5TPAB 3C31A 1LBZA 1H45A 5JTYB 1FBPA 1B3FA 3CIJA 1NV6A 4PQJA 2Q8MA 2PBWA 4FEBA 5H8NB 3Q29A 3HV1A 3H6VA 2F3BA 3T93B 3TCFA 3S9LC 3Q26A 2Z8EA 1FBFA 1FRPA 2M8CA 2PFZA 4N17A 1R1NA 1USYE 4Z0IA 2QS2A 2B4LA 3PUZE 2Y7RA 5A5XB 4R73A 1IXIA 4BDNA 4ELPA 2ANJA 4H8IA 1OMPA 4GL8A 1LBVA 4PP0A 4N07A 3KEIA 4NQ8A 1Y1ZA 3BFTA 5TP9A 4U1ZA 3FV2A 2CEXA 1M5CA 3U1OA 3CSBA 3VLWA 4U23A 4JWXA 1MXUA 5IZ3A 3KZGA 4Q30B 2ZYKA 2F6PA 3R7XA 4X1BA 4HE2A 3BIGA 3Q27A 2QS1A 3TCHA 2XWIA 1OVBA 1IMBA 3KC0A 1MG1A 3VVDA 2OK2A 1N04A 1VFEA 5EYGA 4KYSA 4FAJA 1B46A 4GD5A 5I5PA 5CC2A 2HZKA 1FBGA 1Q35A 3A3UA 1L5TA 2DWJA 3RUMA 1MXYA 1UTBB 1IXGA 2Z8DA 3DP6A 3PD9A 3T96B 4MH5A 4XTCQ 2GFEA 3GZGA 4I40A 4G77A 3MBPA 4NE4A 5ICQA 3H6TA 3IOTA 4RK2A 4KFQA 4ELQA 5CBRA 4KR5A 4MBPA 1A8EA 1ELJA 3MQ9A 4TQUQ 2VPOA 4N6PA 1NUYA 4H67A 5ELVA 4DCYA 4ONYA 3MAMA 5CBSA 2KLFA 3IFCA 4OFJA 1FTLA 2VGQA 4E0WA 3RPWA 2DVZA 4JB7A 3HFUA 2WEFA 1JW1A 2F97A 4NMYA 4R6HA 3PV0E 4OVJA 3W9WA 2B4MA 4NF8B 4H1XA 2ONRA 2O51A 4OVRA 3ZKLA 3SZPA 2XXQA 4YICA 1EYKA 3F11A 4U22A 2D21A 1DOTA 4LA9A 3P7IA 4NWCA 4N91A 1DK4A 2HCAA 3ZSFA 1SDXA 2OJTA 1ZIUA 4YKIA 2ZXTA 4WEPA 4F3BA 3H4ZA 3FV1A 4R9GA 2WBBA 1DMBA 4LZ8A 1B1XA 3FXRA 3ISPA 3OO9A 2V93A 3FBPA 3RLFE 5A5LA 5CM6A 3MZBA 4MFIA 3FXQA 4PFWA 4NN3A 4OWDA 2GHBA 4GRKA 3IAZA 5J1DA 1JW5A 4GWOA 3AXFA 4G4PA 4JWOA 5I58B 3MP1A 2RCBA 2CZLA 4OZ9A 3OEKA 3O29A 4IO5A 2ZYNA 1P1WA 2H99A 1BP5A 3DP8A 3H06B 2A5SA 3MVXA 2XXUA 5KDTA 1FJ9A 3B8BA 3MP8A 1YZ0A 1NH8A 3VV5A 2HAVA 2B65A 4GWYA 3OO6A 1RDYA 4R9FA 3LSWA 5EYHA 4ZDMA 3FIRA 4PFTA 2KQZA 4KYDA 2OX3A 3IB2A 4GWZA 1B0HA 3UP9A 1EYJA 3C34A 3QIMA 2UYFA 1JNFA 4F18A 2FIEA 2ONSA 3FATA 3KSJA 1YYZA 1BKAA 3QXMA 2JJKA 4NWDA 3FVNA 3SKPA 2P3NA 2I3VA 2RF1A 2VHAA 5IZ1A 3QYTA 1B52A 2E1SA 1NH7A 1FTKA 4POXA 3BFUA 2QRYA 1A7LA 3E3KA 3SEWA 4H45A 1MY0A 3T9HB 4X9TA 1SQYA 2X26A 2R71A 4OESA 1H44A 2HXWA 4EQ9A 4H65A 1ZBMA 2OZZA 4LZ7A 2I6EA 2RC8A 1LEVA 4OVPA 1CE2A 3PPQA 5H8FB 3K01A 4PFIA 3RTFB 2O6AA 1FBDA 4R2BA 2REJA 1MXXA 4R75A 1B6HA 3HHGA 1D4NA 1NMUA 1I6QA 2P0SA 2DS9A 4ZZAA 4I1DA 5I84A 4GXSB 2XD3A 2F7AA 2ABHA 1BTJA 2V3QA 4F22A 1ANFA 3SETA 5ICTA 1SW5A 1OVTA 3T22A 3WAFA 5ET5A 1M5DA 3T9VA 2V3TA 2QVUA 1B5JA 3PUVE 4OANA 5H8QA 2GQ1A 3RTWB 3CSGA 1A99A 2XX7A 1B3HA 2DXYA 5AA4B 1IIWA 4AB6A 2H25A 3GBBA 3ONMA 2YPNA 3TUSA 3Q28A 2ZZWA 2UVIA 5I2KA 3PUXE 4PAFA 3I6VA 2Z8FA 2DXRA 3SESA 2XXPA 5JTYA 4O3BA 1JP4A 1M5BA 4MIJA 4JSOA 4ECFA 5KZTA 2UVHA 4OHNA 1TFDA 2DE4A 5H8NA 3N94A 4H0WA 4P9KA 2QL3A 1M5FA 4TLLB 1SW4A 3RN8A 1TFAA 2XHDA 4DI4B 5FBPA 1FBEA 2R9JA 1PC3A 5IZZA 3FVGA 5A5XA 1URGA 3TPAA 4LONB 4BDOA 2O69A 5EQ7A 4GWSA 4I9DA 2UVJA 4N8GA 4QRZA 1FJ6A 5CMCA 1UIVA 4UABA 3ZS6A 1ZMGA 4DI3D 1US4A 3SEVA 3SERA 1EZ9A 4PBHA 1NL5A 1YCJA 3C33A 3USDA 4KCCA 5HPQA 4ZECA 4PBQA 2UXAA 4GOTA 2PT1A 1MQHA 4PFRA 3JZJA 2CMOA 1IUDA 4PC9A 3TQWA 5CI5A 3KBZA 3VDFA 1SD3A 1SI1A 2O84X 2I58A 3C35A 1B5HA 4OVTA 4HXVA 1H43A 2XXXA 1KA1A 3BBRA 2P2AA 4MAGA 2H5YA 4XEQA 4YB7A 1MDQA 1N0TA 4P47A 3H03A 4UA8A 3M3KA 1UTBA 3FXBA 4F31B 4EDPA 3EN3A 4ZEKA 5I56A 2VT5A 4DE8A 2MKZA 2A5TA 1OQHA 3OSQA 1B0LA 3PMWA 2Y7IA 4OFOA 4MCOA 1POY1 3KC1A 5LDZA 4PETA 3W15C 2OBGA 2R8TA 4WEDA 1Y20A 1AL3A 3MZ1A 3R26A 3TKDA 3QSLA 4NF8A 4QSEA 3UGWA 4ELRA 5ITPA 1MXZA 1XI6A 1URSA 3EHUA 1MPBA 4PAIA 3TYHA 4O7MA 1EZPA 3KSXA 4PDHA 2HQ0A 1NNTA 2QFLA 1SW2A 2QJEA 4EXKA 1WVJA 3M8UA 2ESNA 1JVXA 5FTHA 3KJTA 2PYYA 3VLUA 3IR1A 1FW0A 3S9NC 4OTEA 2FNCA 2IA4A 3O6HA 3S2VA 1A54A 4NX1A 4JBZA 5HM4B 1TXFA 1FTJA 5I58A 4MJOA 3JV9A 5B7DA 1KZ8A 4ZZEA 1INPA 2YJPA 3SEXA 2DYXA 2F5XA 1B7HA 2DWHA 2Q9TA 4K3FA 5IAIA 4IGTA 4R6YA 4RK9A 1YXIA 3MPLA 1T0KA 1N3XA 1F9BA 4O3CA 4FATA 4FJPA 5I59B 4XKQA 1FPGA 1WODA 2RINA 4G8MA 3OELA 1IMDA 3RQTA 1DTGA 3EKIA 3MJNA 4NF5A 5AA2B 3UN6A 2XWKA 4O8MA 3U92A 1MQJA 1US5A 2F3DA 4HE0A 3THIA 4U1OA 3FGSA 1ZKBA 4DCXA 4IO7A 5LTCA 2D5WA 5I2NA 3C9HA 4ZE8A 3VFJA 1LLSA 3T1BA 2XX9A 3QUJA 2BJJX 3TDJA 4QXDA 3CFXA 1M5EA 4R6KA 5JK4A 4KD5A 4QFPA 2PVUA 5I3SA 1XHYA 3CI8A 3LUYA 4IO3A 3OEMA 4ZEFA 1TT1A 1VFDA 2FIXA 1QKBA 3HN0A 4NHBA 2F8DA 3O6IA 2H98A 1YPNA 1LFHA 3TELA 1FPLA 4XIGQ 4LVQA 3GYYA 1MY1A 1B3GA 1FPFA 3IOWA 4RYAA 1ZU0A 2XXVA 1XVXA 1I6AA 5H8FA 3O97A 3CHGA 4M1VA 3ROJA 4F1VA 2O1MA 3GXAA 4RY1A 1A40A 3JYRA 3OXNA 4ZEBA 1GV8A 4OYVA 3LC8A 2VOZA 3ECRA 3V89B 4ZS9A 4EF1A 3I3VA 3K1MA 1JVYA 4XKRA 3FXUA 5EHSA 2PMSA 3UK4A 4F2OA 1DPPA 4G8NA 1Q9DA 1XS5A 5DEXA 3O2AA 1H76A 2DVCA 1N76A 3MVZA 3N6UA 1VR5A 2QSXA 2O7UA 3KN7A 3LSXA 4YB6A 1J1NA 4RXLA 4HE1A 4HS7A 1OQGA 4G61A 4M4GA 4FORA 3N6TA 1ZJLA 3PTYA 3LV0A 2GRVA 4XKPA 1PB7A 2HZLA 4GLIA 5AA4A 3IX1A 3HPIA 2Y5LA 3C36A 5H8HB 4ELOA 5K2XA 3MYUA 1O64A 4GX6A 5DVFA 4I3YA 3VVFA 1FSAA 2V4CA 2FHYA 2XA5A 1R9LA 3LR1A 3TAJA 1USYH 2R6GE 3TTKA 3DP4A 1DBZA 4PGPA 4HTGA 1FPEA 2QMXA 2REGA 3RYDA 4X48A 2AL5A 3IORA 2RCAA 1NNFA 4PE3A 1LCFA 4IB2A 2HFBA 1IMCA 3RY3A 1RYXA 1PB9A 1HSLA 4QFLA 4P1LA 1QJMA 3FVOA 2B3FA 2XX8A 3NOHA 4GWXA 5IZ3B 3M3LA 1ZTYA 3H6WA 5I57B 5KCJA 3FZVA 4F2QA 1FQAA 1NV0A 3K1PA 3VXBA 2NWJA 4G68B 4N81A 3ZKKA 1NV2A 1QKAA 4OETA 4DXUA 1VE4A 4ESXA 2G93A 3PD8A 2V25A 5FHNA 3E79A 2Y7KA 4IR8A 2ALUA 3H3GA 3IK6B 1B9JA 4DZ1A 2F35A 4JDFA 4JVCA 4ESWA 4MLVA 1N3WA 4P1EA 1LBXA 4MEVA 1FBCA 3FASA 3KG2A 1LSTA 5IKBA 3OSRA 5IM2A 4XF5A 3VVEA 3BIHA 2O7IA 4QHQA 3MW0A 1I6BA 4NG7A 1FPBA 3DLNA 4QF9A 4PGNA 1JW4A 5AA1A 3G3KA 4EXLA 5K2YA 2HAUA 5ITOA 4F3GA 1B32A 3TODA 3IO4A 4F1UA 1LFIA 5LOMA 1DPEA 2DE2A 1SYIA 2CZHA 3EF7A 1MRPA 3UIFA 1B1HA 1AIVA 4LZ5A 3V83A 1RYOA 4P56A 1NUXA 2ZMBA 2NUVA 4GXAA 2Q89A 2WX9A 4QSDA 1Y3NA 1R6ZA 4EQ7A 1Y1MA 2Q88A 2DP8A 3E4RA 3RPLB 2Y7PA 1FPIA 1NKXA 2AIXA 4PAKA 4GX4A 1Y4CA 5EQ8A 2O68A 1IMFA 1FTOA 1AH5A 1BIYA 3DELB 4NEDA 1LB9A 2F36A 4E0XA
chains in the Genus database with same CATH topology
4C1TA 4QFKA 3O66A 4OERA 4PFUA 1B40A 1XC1A 4QSCA 4GVOA 3G3GA 3KFMA 5DVJA 5TPAA 3Q25A 2OLBA 5H8SA 3EPEA 3UORA 1MM6A 2WKYA 3MC2A 1QVSA 3PPOA 1DSNA 4YKJA 4U4SA 3ODBA 1TWYA 2F7CA 3S4UA 4U2RA 2NVUB 2FA7A 1MQDA 1MPDA 4BLAA 1D3KA 4HCYA 1Z7ME 2F6GA 2ZNSA 3FJGA 2OWSA 2XXRA 3DM0A 3MVWA 4RJZA 1B5IA 4WXJA 3FD3A 1GGGA 2H4IA 3TTLA 2H9BA 5I59A 3MPKA 3SDFA 1NNPA 3KJ7A 1WDNA 3GBAA 3IOUA 4GIZA 1MXWA 3WAEA 4BDMA 1LBCA 2G29A 3LSFB 4OMBA 5AA2A 5AA2D 2I0BA 2XXWA 4P0IA 1LBBA 3CVGA 3RT8A 1SYHA 3MZ9A 1GTKA 1A55A 1AOVA 4R74A 2RKMA 1D9VA 3IO6A 1QW0A 1QULA 3PPPA 1LFGA 3BKIB 3TZAA 3G7WA 2AL4A 3HSTA 3G3IA 4H8JA 5DVIA 4JWYA 1LAHE 1O63A 1D9YA 2VP1A 2XXIA 2HEUA 3K2DA 1GR2A 4FE8A 2XXHA 4EQBA 3SEUA 4XXUA 2B3BA 3K4UA 2UVGA 4F29A 2GH9A 1H3DA 3FUZA 4IGRA 1IXCA 3IB1A 4NF6B 2Z23A 3E9XA 3TFLA 4LQ5A 2I4BA 1MXVA 4UACA 3M3FA 5F1QA 5JEIA 1HSEA 3U93A 4LP2B 4OQOA 3QUFA 4ZEIA 4YU0A 3EHTA 3B6QA 3ILTB 3KN3A 3PPNA 2I3WA 1KWHA 3FJ7A 1IITA 4AB5A 1PDAA 4HW8A 4OENA 4U4XA 4POWA 1R9QA 2ZNUA 4R72A 1LAFE 3N5LA 1S9TA 3W9VA 4IO6A 5H8HA 1FTMA 1OIBA 1IEJA 5BWJA 3TCGA 2OCUA 1B3LA 2Y7WA 3U94A 4LQ2A 4BDLA 4F3PA 1XT8A 4FEDA 4G68C 3KOSA 3D4GA 3B7DA 4JSDA 1NFTA 4F39A 5L9SA 5DYHA 1N84A 5DT6A 5AE4A 2QS3A 4NF4B 5EHMA 4YKPA 3PUWE 3TTRA 1II5A 4JXIA 2V3UA 2Q2CA 3HCQA 2UYEA 4GF8A 4DXBA 1JQFA 2ZYOA 5I57A 5TU0A 4OEVA 3QAXA 3V5AA 5CMKA 1PBPA 3VE1B 3K6UA 2I0CA 4G68A 2FYIA 4C0RA 4DXCA 3TTNA 2XXYA 5DTBA 1JEVA 3K00A 3N26A 2THIA 2I4CA 4U21A 2F7BA 4OXVA 4G8HA 3K6XA 3H6UA 4TOZA 2V84A 4Z7EA 2XXTA 3V8XB 5I56B 1BLFA 1MH3A 3KOTA 3G3JA 3K6WA 2A5TB 5L9OA 2D3IA 3CRBA 4YZZA 5CMBA 1LGBC 1PBQA 1B05A 3E13X 4IY6A 4LUBA 3T66A 2XD2A 1JETA 1QUJA 4NTLA 4F19A 4XKNA 4RA1A 1PEBA 2X7QA 1HSJA 4BDRA 3S9EA 2X7PA 3G3FA 4YMAA 3PMVA 1Y9UA 1MQIA 4I8CA 3O6GA 1UTHB 2Q8JA 4Q0CA 1B7UA 1B51A 5EYFA 4OFLA 1Q1KA 1B58A 1P1UA 4IY5A 4IO4A 1LCTA 1Y4TA 3IOVA 3OMBA 4FECA 2DQVA 1FCKA 2PX1A 3B6WA 2Y84A 2P1SA 2ZNTA 1S50A 4KYEA 1EH3A 4THIA 2NXOA 4ISUA 3EHSA 2QPQA 1IXHA 4H5FA 3IL1B 3L6HA 3PMXA 3QK6A 3OO7A 5TP9B 4ZEDA 3PGFA 1LAGE 1Z7NE 3CR9A 1O7TA 5M2VA 3KGCA 3OD7A 4KI0E 4F3SA 1EU8A 4GQOA 3TQLA 4KCDA 4L17A 4PE5B 3HHFA 3U72A 4RPNA 1IQ7A 4NF5B 1MM7A 1PB8A 1B2HA 3CG3A 1LAXA 1ATGA 1LB8A 1GVCA 5I2NB 4C1UA 4P11A 3CG1A 1XOCA 2W7YA 4F1YA 1FQFA 4YAHX 5L9MA 1P1NA 2GHAA 2LAOA 3ILUB 1EZOA 3MP6A 4QFNA 1JEUA 3UA8A 1IZ1A 4LATA 3LSLA 2DWIA 1NNKA 5FHMA 4X1DA 3H7MA 2IEEA 1CB6A 3B6TA 2ZYMA 1OLCA 4DIGA 4AQ4A 3FVKA 1YTVA 2NOOA 1SI0A 3TMGA 3RGYA 1QUKA 3K1NA 4KPTA 3PPRA 1MPCA 1B4HA 3MUQA 3K6VA 1FQDA 2DOJA 2VD2A 3RNNA 3GLBA 1RKMA 1UQWA 3U8QA 3TEPA 5FHOA 2F34A 2Z22A 5DEXB 1MS7A 1MY3A 2DE3A 4NF6A 4ZE9A 5CMMA 3IJOB 4TLMB 5CRYA 4EUOA 3S9MC 4ND9A 5F7VA 1QUIA 3KBRA 1SVXB 2OWTA 4OEUA 5ISUA 4EF2A 3RT6B 5B70A 3FJMA 3O9PA 5HBCA 1MY4A 3PUYE 4GL0A 1P1QA 4O3AA 1MDP1 4G2ZA 1MY2A 1N7XA 5KDTB 4FIMA 3PU5A 3K02A 3KN8A 3TTMA 4BDQA 2Q2AA 2RC7A 2VD3A 4HCWA 4MF3A 1B4ZA 2PT2A 2I49A 1I69A 4IO2A 3A09A 3K0VA 3CFZA 1FQCA 1P1OA 3D4CA 5FTIA 4I62A 1Y3QA 2AYSA 1P99A 4NF4A 1A8FA 5KCJB 4KQPA 1B7ZA 1B3EA 2ONKE 4H5GA 1SW1A 2DSFA 1S7YA 5L8DA 3CFLA 3LBSA 3T9UA 5BUUA 3T9XB 3O28A 2QMWA 3MWBA 1OLAA 4GFRA 1Y3PA 3OOAA 4DDDA 3MVYA 4R2FA 1URDA 2QS4A 4MLQA 4RNSA 2DWAA 4WKMA 1AMFA 3C32A 3OENA 1MH4A 4P0GA 4YMBA 3EQ1A 3L6GA 2O1LA 1SBPA 1VSOA 4QFOA 4DLDA 2E0SA 3A3CA 3SEYA 4N13A 3OO8A 3VXCA 1DTZA 2F78A 4Q5TA 1UIUA 4YB5A 1FQBA 4PFYA 2YLNA 1FQEA 3IJXB 3VLVA 4YKKA 4RPOA 4Q8RA 1ZLQA 5H8QB 4H6DA 3IB0A 3HO7A 3G3HA 3I5OA 2I48A 1YAEA 5AA3A 3R6UA 4KHZE 1MQGA 2RC9A 1POTA 5I2KB 3C4MA 1UTHA 1XVYA 1N7WA 5TPAB 3C31A 1H45A 5JTYB 1B3FA 3CIJA 4PQJA 2PBWA 4FEBA 5H8NB 3Q29A 3HV1A 3H6VA 3T93B 3TCFA 3S9LC 3Q26A 2Z8EA 2M8CA 1R1NA 1USYE 4Z0IA 2QS2A 3PUZE 2Y7RA 5A5XB 4R73A 1IXIA 4BDNA 4ELPA 2ANJA 4H8IA 1OMPA 4GL8A 4PP0A 4N07A 3KEIA 1Y1ZA 3BFTA 5TP9A 4U1ZA 3FV2A 1M5CA 3U1OA 3CSBA 3VLWA 4U23A 4JWXA 1MXUA 3KZGA 4Q30B 2ZYKA 2F6PA 3R7XA 4X1BA 3Q27A 2QS1A 3TCHA 1OVBA 1MG1A 3VVDA 2OK2A 1N04A 1VFEA 4KYSA 4FAJA 1B46A 4GD5A 5CC2A 2HZKA 1Q35A 3A3UA 1L5TA 2DWJA 3RUMA 1MXYA 1UTBB 1IXGA 2Z8DA 3DP6A 3PD9A 3T96B 4MH5A 4XTCQ 2GFEA 3GZGA 4G77A 3MBPA 4NE4A 5ICQA 3H6TA 3IOTA 4RK2A 4KFQA 4ELQA 5CBRA 4KR5A 4MBPA 1A8EA 1ELJA 3MQ9A 4TQUQ 4N6PA 4H67A 5ELVA 4DCYA 4ONYA 3MAMA 5CBSA 2KLFA 4OFJA 1FTLA 2VGQA 4E0WA 3RPWA 2DVZA 4JB7A 1JW1A 2F97A 4NMYA 4R6HA 3PV0E 4OVJA 3W9WA 4NF8B 4H1XA 2ONRA 2O51A 3ZKLA 2XXQA 4YICA 3F11A 4U22A 2D21A 1DOTA 4LA9A 3P7IA 4NWCA 2HCAA 3ZSFA 1SDXA 2OJTA 1ZIUA 4YKIA 2ZXTA 4WEPA 4F3BA 3H4ZA 3FV1A 4R9GA 1DMBA 4LZ8A 1B1XA 3FXRA 3OO9A 2V93A 3RLFE 5CM6A 3MZBA 4MFIA 3FXQA 4PFWA 4OWDA 2GHBA 4GRKA 3IAZA 5J1DA 1JW5A 4GWOA 3AXFA 4G4PA 4JWOA 5I58B 3MP1A 2RCBA 2CZLA 4OZ9A 3OEKA 3O29A 4IO5A 2ZYNA 1P1WA 2H99A 1BP5A 3DP8A 3H06B 2A5SA 3MVXA 2XXUA 5KDTA 3MP8A 1NH8A 3VV5A 2HAVA 2B65A 3OO6A 4R9FA 3LSWA 4ZDMA 3FIRA 4PFTA 4KYDA 3IB2A 1B0HA 3UP9A 3C34A 3QIMA 2UYFA 1JNFA 4F18A 2ONSA 3FATA 3KSJA 1BKAA 3QXMA 4NWDA 3FVNA 3SKPA 2I3VA 2RF1A 2VHAA 3QYTA 1B52A 2E1SA 1NH7A 1FTKA 4POXA 3BFUA 2QRYA 1A7LA 3E3KA 3SEWA 1MY0A 3T9HB 4X9TA 1SQYA 2X26A 2R71A 4OESA 1H44A 2HXWA 4EQ9A 4H65A 1ZBMA 2OZZA 4LZ7A 2I6EA 2RC8A 1CE2A 3PPQA 5H8FB 3K01A 3RTFB 2O6AA 4R2BA 2REJA 1MXXA 4R75A 1B6HA 3HHGA 1D4NA 1NMUA 1I6QA 2P0SA 2DS9A 4ZZAA 4I1DA 5I84A 4GXSB 2XD3A 2F7AA 2ABHA 1BTJA 2V3QA 4F22A 1ANFA 3SETA 5ICTA 1SW5A 1OVTA 3T22A 3WAFA 1M5DA 3T9VA 2V3TA 1B5JA 3PUVE 5H8QA 3RTWB 3CSGA 1A99A 2XX7A 1B3HA 2DXYA 5AA4B 1IIWA 4AB6A 2H25A 3GBBA 3ONMA 2YPNA 3TUSA 3Q28A 2UVIA 5I2KA 3PUXE 3I6VA 2Z8FA 2DXRA 3SESA 2XXPA 5JTYA 4O3BA 1M5BA 4JSOA 4ECFA 5KZTA 2UVHA 4OHNA 1TFDA 2DE4A 5H8NA 3N94A 4H0WA 2QL3A 1M5FA 4TLLB 1SW4A 3RN8A 1TFAA 2XHDA 2R9JA 1PC3A 3FVGA 5A5XA 1URGA 3TPAA 4LONB 4BDOA 2O69A 4I9DA 2UVJA 4QRZA 5CMCA 1UIVA 3ZS6A 1ZMGA 1US4A 3SEVA 3SERA 1EZ9A 1NL5A 1YCJA 3C33A 3USDA 4KCCA 5HPQA 4ZECA 2UXAA 4GOTA 2PT1A 1MQHA 3JZJA 2CMOA 1IUDA 3TQWA 5CI5A 3VDFA 1SD3A 1SI1A 2O84X 2I58A 3C35A 1B5HA 1H43A 2XXXA 3BBRA 2P2AA 2H5YA 4YB7A 1MDQA 1N0TA 3H03A 4UA8A 3M3KA 1UTBA 4F31B 4EDPA 3EN3A 4ZEKA 5I56A 4DE8A 2A5TA 1OQHA 3OSQA 1B0LA 3PMWA 2Y7IA 4OFOA 1POY1 4PETA 3W15C 2OBGA 4WEDA 1Y20A 1AL3A 3MZ1A 3R26A 3TKDA 3QSLA 4NF8A 4QSEA 3UGWA 4ELRA 5ITPA 1MXZA 1URSA 3EHUA 1MPBA 3TYHA 1EZPA 3KSXA 2HQ0A 1NNTA 1SW2A 2QJEA 4EXKA 1WVJA 3M8UA 2ESNA 1JVXA 5FTHA 3KJTA 2PYYA 3VLUA 3IR1A 1FW0A 3S9NC 4OTEA 2FNCA 2IA4A 3O6HA 3S2VA 1A54A 4JBZA 5HM4B 1TXFA 1FTJA 5I58A 3JV9A 5B7DA 4ZZEA 2YJPA 3SEXA 2DYXA 2F5XA 1B7HA 2DWHA 2Q9TA 4K3FA 5IAIA 4IGTA 4R6YA 4RK9A 3MPLA 1T0KA 1N3XA 1F9BA 4O3CA 4FATA 4FJPA 5I59B 4XKQA 1WODA 2RINA 4G8MA 3OELA 3RQTA 1DTGA 3MJNA 4NF5A 5AA2B 3UN6A 3U92A 1MQJA 1US5A 3THIA 4U1OA 3FGSA 1ZKBA 4DCXA 4IO7A 2D5WA 5I2NA 3C9HA 4ZE8A 3VFJA 1LLSA 2XX9A 3QUJA 2BJJX 3TDJA 3CFXA 1M5EA 4R6KA 5JK4A 4KD5A 4QFPA 2PVUA 1XHYA 3CI8A 3LUYA 4IO3A 3OEMA 4ZEFA 1TT1A 1VFDA 1QKBA 3HN0A 2F8DA 3O6IA 2H98A 1YPNA 1LFHA 3TELA 4XIGQ 4LVQA 1MY1A 1B3GA 3IOWA 4RYAA 1ZU0A 2XXVA 1XVXA 1I6AA 5H8FA 3O97A 4M1VA 4F1VA 2O1MA 3GXAA 4RY1A 1A40A 3JYRA 3OXNA 4ZEBA 1GV8A 4OYVA 3LC8A 2VOZA 4EF1A 3ECRA 4ZS9A 3V89B 3I3VA 3K1MA 1JVYA 4XKRA 3FXUA 5EHSA 2PMSA 3UK4A 4F2OA 1DPPA 4G8NA 1XS5A 5DEXA 3O2AA 1H76A 2DVCA 1N76A 3MVZA 3N6UA 1VR5A 2QSXA 2O7UA 3KN7A 3LSXA 4YB6A 1J1NA 4RXLA 4HS7A 1OQGA 4M4GA 4FORA 3N6TA 1ZJLA 2GRVA 4XKPA 1PB7A 2HZLA 4GLIA 5AA4A 3IX1A 3HPIA 3C36A 5H8HB 4ELOA 5K2XA 1O64A 5DVFA 3VVFA 1R9LA 3LR1A 3TAJA 1USYH 2R6GE 3TTKA 3DP4A 4HTGA 2QMXA 2REGA 4X48A 2AL5A 3IORA 2RCAA 1NNFA 1LCFA 4IB2A 2HFBA 3RY3A 1RYXA 1PB9A 1HSLA 4QFLA 1QJMA 3FVOA 2B3FA 2XX8A 3M3LA 1ZTYA 3H6WA 5I57B 5KCJA 3FZVA 4F2QA 1FQAA 3K1PA 3VXBA 2NWJA 4G68B 3ZKKA 1QKAA 4OETA 4DXUA 1VE4A 4ESXA 2G93A 3PD8A 2V25A 5FHNA 2Y7KA 2ALUA 3H3GA 3IK6B 1B9JA 4DZ1A 2F35A 4JDFA 4ESWA 4MLVA 1N3WA 3KG2A 3FASA 1LSTA 5IKBA 3OSRA 3VVEA 2O7IA 4QHQA 3MW0A 1I6BA 3DLNA 4QF9A 1JW4A 5AA1A 3G3KA 4EXLA 5K2YA 2HAUA 5ITOA 4F3GA 1B32A 3TODA 3IO4A 4F1UA 1LFIA 5LOMA 1DPEA 2DE2A 1SYIA 3EF7A 1MRPA 3UIFA 1B1HA 1AIVA 4LZ5A 3V83A 1RYOA 2ZMBA 2NUVA 4GXAA 2Q89A 4QSDA 1Y3NA 1R6ZA 4EQ7A 1Y1MA 2Q88A 2DP8A 3E4RA 2Y7PA 1NKXA 2AIXA 1Y4CA 2O68A 1FTOA 1AH5A 1BIYA 3DELB 4NEDA 1LB9A 2F36A 4E0XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C1T A;  4QFK A;  3O66 A;  4OER A;  4PFU A;  1B40 A;  1XC1 A;  4QSC A;  4GVO A;  3G3G A;  3KFM A;  5DVJ A;  5TPA A;  3Q25 A;  2OLB A;  5H8S A;  3EPE A;  3UOR A;  1MM6 A;  2WKY A;  3MC2 A;  1QVS A;  3PPO A;  1DSN A;  4YKJ A;  4U4S A;  3ODB A;  1TWY A;  2F7C A;  3S4U A;  4U2R A;  2NVU B;  2FA7 A;  1MQD A;  1MPD A;  4BLA A;  1D3K A;  4HCY A;  1Z7M E;  2F6G A;  2ZNS A;  3FJG A;  2OWS A;  2XXR A;  3DM0 A;  3MVW A;  4RJZ A;  1B5I A;  4WXJ A;  3FD3 A;  1GGG A;  2H4I A;  3TTL A;  2H9B A;  5I59 A;  3MPK A;  3SDF A;  1NNP A;  3KJ7 A;  1WDN A;  3GBA A;  3IOU A;  4GIZ A;  1MXW A;  3WAE A;  4BDM A;  1LBC A;  2G29 A;  3LSF B;  4OMB A;  5AA2 A;  5AA2 D;  2I0B A;  2XXW A;  4P0I A;  1LBB A;  3CVG A;  3RT8 A;  1SYH A;  3MZ9 A;  1GTK A;  1A55 A;  1AOV A;  4R74 A;  2RKM A;  1D9V A;  3IO6 A;  1QW0 A;  1QUL A;  3PPP A;  1LFG A;  3BKI B;  3TZA A;  3G7W A;  2AL4 A;  3HST A;  3G3I A;  4H8J A;  5DVI A;  4JWY A;  1LAH E;  1O63 A;  1D9Y A;  2VP1 A;  2XXI A;  2HEU A;  3K2D A;  1GR2 A;  4FE8 A;  2XXH A;  4EQB A;  3SEU A;  4XXU A;  2B3B A;  3K4U A;  2UVG A;  4F29 A;  2GH9 A;  1H3D A;  3FUZ A;  4IGR A;  1IXC A;  3IB1 A;  4NF6 B;  2Z23 A;  3E9X A;  3TFL A;  4LQ5 A;  2I4B A;  1MXV A;  4UAC A;  3M3F A;  5F1Q A;  5JEI A;  1HSE A;  3U93 A;  4LP2 B;  4OQO A;  3QUF A;  4ZEI A;  4YU0 A;  3EHT A;  3B6Q A;  3ILT B;  3KN3 A;  3PPN A;  2I3W A;  1KWH A;  3FJ7 A;  1IIT A;  4AB5 A;  1PDA A;  4HW8 A;  4OEN A;  4U4X A;  4POW A;  1R9Q A;  2ZNU A;  4R72 A;  1LAF E;  3N5L A;  1S9T A;  3W9V A;  4IO6 A;  5H8H A;  1FTM A;  1OIB A;  1IEJ A;  5BWJ A;  3TCG A;  2OCU A;  1B3L A;  2Y7W A;  3U94 A;  4LQ2 A;  4BDL A;  4F3P A;  1XT8 A;  4FED A;  4G68 C;  3KOS A;  3D4G A;  3B7D A;  4JSD A;  1NFT A;  4F39 A;  5L9S A;  5DYH A;  1N84 A;  5DT6 A;  5AE4 A;  2QS3 A;  4NF4 B;  5EHM A;  4YKP A;  3PUW E;  3TTR A;  1II5 A;  4JXI A;  2V3U A;  2Q2C A;  3HCQ A;  2UYE A;  4GF8 A;  4DXB A;  1JQF A;  2ZYO A;  5I57 A;  5TU0 A;  4OEV A;  3QAX A;  3V5A A;  5CMK A;  1PBP A;  3VE1 B;  3K6U A;  2I0C A;  4G68 A;  2FYI A;  4C0R A;  4DXC A;  3TTN A;  2XXY A;  5DTB A;  1JEV A;  3K00 A;  3N26 A;  2THI A;  2I4C A;  4U21 A;  2F7B A;  4OXV A;  4G8H A;  3K6X A;  3H6U A;  4TOZ A;  2V84 A;  4Z7E A;  2XXT A;  3V8X B;  5I56 B;  1BLF A;  1MH3 A;  3KOT A;  3G3J A;  3K6W A;  2A5T B;  5L9O A;  2D3I A;  3CRB A;  4YZZ A;  5CMB A;  1LGB C;  1PBQ A;  1B05 A;  3E13 X;  4IY6 A;  4LUB A;  3T66 A;  2XD2 A;  1JET A;  1QUJ A;  4NTL A;  4F19 A;  4XKN A;  4RA1 A;  1PEB A;  2X7Q A;  1HSJ A;  4BDR A;  3S9E A;  2X7P A;  3G3F A;  4YMA A;  3PMV A;  1Y9U A;  1MQI A;  4I8C A;  3O6G A;  1UTH B;  2Q8J A;  4Q0C A;  1B7U A;  1B51 A;  5EYF A;  4OFL A;  1Q1K A;  1B58 A;  1P1U A;  4IY5 A;  4IO4 A;  1LCT A;  1Y4T A;  3IOV A;  3OMB A;  4FEC A;  2DQV A;  1FCK A;  2PX1 A;  3B6W A;  2Y84 A;  2P1S A;  2ZNT A;  1S50 A;  4KYE A;  1EH3 A;  4THI A;  2NXO A;  4ISU A;  3EHS A;  2QPQ A;  1IXH A;  4H5F A;  3IL1 B;  3L6H A;  3PMX A;  3QK6 A;  3OO7 A;  5TP9 B;  4ZED A;  3PGF A;  1LAG E;  1Z7N E;  3CR9 A;  1O7T A;  5M2V A;  3KGC A;  3OD7 A;  4KI0 E;  4F3S A;  1EU8 A;  4GQO A;  3TQL A;  4KCD A;  4L17 A;  4PE5 B;  3HHF A;  3U72 A;  4RPN A;  1IQ7 A;  4NF5 B;  1MM7 A;  1PB8 A;  1B2H A;  3CG3 A;  1LAX A;  1ATG A;  1LB8 A;  1GVC A;  5I2N B;  4C1U A;  4P11 A;  3CG1 A;  1XOC A;  2W7Y A;  4F1Y A;  1FQF A;  4YAH X;  5L9M A;  1P1N A;  2GHA A;  2LAO A;  3ILU B;  1EZO A;  3MP6 A;  4QFN A;  1JEU A;  3UA8 A;  1IZ1 A;  4LAT A;  3LSL A;  2DWI A;  1NNK A;  5FHM A;  4X1D A;  3H7M A;  2IEE A;  1CB6 A;  3B6T A;  2ZYM A;  1OLC A;  4DIG A;  4AQ4 A;  3FVK A;  1YTV A;  2NOO A;  1SI0 A;  3TMG A;  3RGY A;  1QUK A;  3K1N A;  4KPT A;  3PPR A;  1MPC A;  1B4H A;  3MUQ A;  3K6V A;  1FQD A;  2DOJ A;  2VD2 A;  3RNN A;  3GLB A;  1RKM A;  1UQW A;  3U8Q A;  3TEP A;  5FHO A;  2F34 A;  2Z22 A;  5DEX B;  1MS7 A;  1MY3 A;  2DE3 A;  4NF6 A;  4ZE9 A;  5CMM A;  3IJO B;  4TLM B;  5CRY A;  4EUO A;  3S9M C;  4ND9 A;  5F7V A;  1QUI A;  3KBR A;  1SVX B;  2OWT A;  4OEU A;  5ISU A;  4EF2 A;  3RT6 B;  5B70 A;  3FJM A;  3O9P A;  5HBC A;  1MY4 A;  3PUY E;  4GL0 A;  1P1Q A;  4O3A A;  1MDP 1;  4G2Z A;  1MY2 A;  1N7X A;  5KDT B;  4FIM A;  3PU5 A;  3K02 A;  3KN8 A;  3TTM A;  4BDQ A;  2Q2A A;  2RC7 A;  2VD3 A;  4HCW A;  4MF3 A;  1B4Z A;  2PT2 A;  2I49 A;  1I69 A;  4IO2 A;  3A09 A;  3K0V A;  3CFZ A;  1FQC A;  1P1O A;  3D4C A;  5FTI A;  4I62 A;  1Y3Q A;  2AYS A;  1P99 A;  4NF4 A;  1A8F A;  5KCJ B;  4KQP A;  1B7Z A;  1B3E A;  2ONK E;  4H5G A;  1SW1 A;  2DSF A;  1S7Y A;  5L8D A;  3CFL A;  3LBS A;  3T9U A;  5BUU A;  3T9X B;  3O28 A;  2QMW A;  3MWB A;  1OLA A;  4GFR A;  1Y3P A;  3OOA A;  4DDD A;  3MVY A;  4R2F A;  1URD A;  2QS4 A;  4MLQ A;  4RNS A;  2DWA A;  4WKM A;  1AMF A;  3C32 A;  3OEN A;  1MH4 A;  4P0G A;  4YMB A;  3EQ1 A;  3L6G A;  2O1L A;  1SBP A;  1VSO A;  4QFO A;  4DLD A;  2E0S A;  3A3C A;  3SEY A;  4N13 A;  3OO8 A;  3VXC A;  1DTZ A;  2F78 A;  4Q5T A;  1UIU A;  4YB5 A;  1FQB A;  4PFY A;  2YLN A;  1FQE A;  3IJX B;  3VLV A;  4YKK A;  4RPO A;  4Q8R A;  1ZLQ A;  5H8Q B;  4H6D A;  3IB0 A;  3HO7 A;  3G3H A;  3I5O A;  2I48 A;  1YAE A;  5AA3 A;  3R6U A;  4KHZ E;  1MQG A;  2RC9 A;  1POT A;  5I2K B;  3C4M A;  1UTH A;  1XVY A;  1N7W A;  5TPA B;  3C31 A;  1H45 A;  5JTY B;  1B3F A;  3CIJ A;  4PQJ A;  2PBW A;  4FEB A;  5H8N B;  3Q29 A;  3HV1 A;  3H6V A;  3T93 B;  3TCF A;  3S9L C;  3Q26 A;  2Z8E A;  2M8C A;  1R1N A;  1USY E;  4Z0I A;  2QS2 A;  3PUZ E;  2Y7R A;  5A5X B;  4R73 A;  1IXI A;  4BDN A;  4ELP A;  2ANJ A;  4H8I A;  1OMP A;  4GL8 A;  4PP0 A;  4N07 A;  3KEI A;  1Y1Z A;  3BFT A;  5TP9 A;  4U1Z A;  3FV2 A;  1M5C A;  3U1O A;  3CSB A;  3VLW A;  4U23 A;  4JWX A;  1MXU A;  3KZG A;  4Q30 B;  2ZYK A;  2F6P A;  3R7X A;  4X1B A;  3Q27 A;  2QS1 A;  3TCH A;  1OVB A;  1MG1 A;  3VVD A;  2OK2 A;  1N04 A;  1VFE A;  4KYS A;  4FAJ A;  1B46 A;  4GD5 A;  5CC2 A;  2HZK A;  1Q35 A;  3A3U A;  1L5T A;  2DWJ A;  3RUM A;  1MXY A;  1UTB B;  1IXG A;  2Z8D A;  3DP6 A;  3PD9 A;  3T96 B;  4MH5 A;  4XTC Q;  2GFE A;  3GZG A;  4G77 A;  3MBP A;  4NE4 A;  5ICQ A;  3H6T A;  3IOT A;  4RK2 A;  4KFQ A;  4ELQ A;  5CBR A;  4KR5 A;  4MBP A;  1A8E A;  1ELJ A;  3MQ9 A;  4TQU Q;  4N6P A;  4H67 A;  5ELV A;  4DCY A;  4ONY A;  3MAM A;  5CBS A;  2KLF A;  4OFJ A;  1FTL A;  2VGQ A;  4E0W A;  3RPW A;  2DVZ A;  4JB7 A;  1JW1 A;  2F97 A;  4NMY A;  4R6H A;  3PV0 E;  4OVJ A;  3W9W A;  4NF8 B;  4H1X A;  2ONR A;  2O51 A;  3ZKL A;  2XXQ A;  4YIC A;  3F11 A;  4U22 A;  2D21 A;  1DOT A;  4LA9 A;  3P7I A;  4NWC A;  2HCA A;  3ZSF A;  1SDX A;  2OJT A;  1ZIU A;  4YKI A;  2ZXT A;  4WEP A;  4F3B A;  3H4Z A;  3FV1 A;  4R9G A;  1DMB A;  4LZ8 A;  1B1X A;  3FXR A;  3OO9 A;  2V93 A;  3RLF E;  5CM6 A;  3MZB A;  4MFI A;  3FXQ A;  4PFW A;  4OWD A;  2GHB A;  4GRK A;  3IAZ A;  5J1D A;  1JW5 A;  4GWO A;  3AXF A;  4G4P A;  4JWO A;  5I58 B;  3MP1 A;  2RCB A;  2CZL A;  4OZ9 A;  3OEK A;  3O29 A;  4IO5 A;  2ZYN A;  1P1W A;  2H99 A;  1BP5 A;  3DP8 A;  3H06 B;  2A5S A;  3MVX A;  2XXU A;  5KDT A;  3MP8 A;  1NH8 A;  3VV5 A;  2HAV A;  2B65 A;  3OO6 A;  4R9F A;  3LSW A;  4ZDM A;  3FIR A;  4PFT A;  4KYD A;  3IB2 A;  1B0H A;  3UP9 A;  3C34 A;  3QIM A;  2UYF A;  1JNF A;  4F18 A;  2ONS A;  3FAT A;  3KSJ A;  1BKA A;  3QXM A;  4NWD A;  3FVN A;  3SKP A;  2I3V A;  2RF1 A;  2VHA A;  3QYT A;  1B52 A;  2E1S A;  1NH7 A;  1FTK A;  4POX A;  3BFU A;  2QRY A;  1A7L A;  3E3K A;  3SEW A;  1MY0 A;  3T9H B;  4X9T A;  1SQY A;  2X26 A;  2R71 A;  4OES A;  1H44 A;  2HXW A;  4EQ9 A;  4H65 A;  1ZBM A;  2OZZ A;  4LZ7 A;  2I6E A;  2RC8 A;  1CE2 A;  3PPQ A;  5H8F B;  3K01 A;  3RTF B;  2O6A A;  4R2B A;  2REJ A;  1MXX A;  4R75 A;  1B6H A;  3HHG A;  1D4N A;  1NMU A;  1I6Q A;  2P0S A;  2DS9 A;  4ZZA A;  4I1D A;  5I84 A;  4GXS B;  2XD3 A;  2F7A A;  2ABH A;  1BTJ A;  2V3Q A;  4F22 A;  1ANF A;  3SET A;  5ICT A;  1SW5 A;  1OVT A;  3T22 A;  3WAF A;  1M5D A;  3T9V A;  2V3T A;  1B5J A;  3PUV E;  5H8Q A;  3RTW B;  3CSG A;  1A99 A;  2XX7 A;  1B3H A;  2DXY A;  5AA4 B;  1IIW A;  4AB6 A;  2H25 A;  3GBB A;  3ONM A;  2YPN A;  3TUS A;  3Q28 A;  2UVI A;  5I2K A;  3PUX E;  3I6V A;  2Z8F A;  2DXR A;  3SES A;  2XXP A;  5JTY A;  4O3B A;  1M5B A;  4JSO A;  4ECF A;  5KZT A;  2UVH A;  4OHN A;  1TFD A;  2DE4 A;  5H8N A;  3N94 A;  4H0W A;  2QL3 A;  1M5F A;  4TLL B;  1SW4 A;  3RN8 A;  1TFA A;  2XHD A;  2R9J A;  1PC3 A;  3FVG A;  5A5X A;  1URG A;  3TPA A;  4LON B;  4BDO A;  2O69 A;  4I9D A;  2UVJ A;  4QRZ A;  5CMC A;  1UIV A;  3ZS6 A;  1ZMG A;  1US4 A;  3SEV A;  3SER A;  1EZ9 A;  1NL5 A;  1YCJ A;  3C33 A;  3USD A;  4KCC A;  5HPQ A;  4ZEC A;  2UXA A;  4GOT A;  2PT1 A;  1MQH A;  3JZJ A;  2CMO A;  1IUD A;  3TQW A;  5CI5 A;  3VDF A;  1SD3 A;  1SI1 A;  2O84 X;  2I58 A;  3C35 A;  1B5H A;  1H43 A;  2XXX A;  3BBR A;  2P2A A;  2H5Y A;  4YB7 A;  1MDQ A;  1N0T A;  3H03 A;  4UA8 A;  3M3K A;  1UTB A;  4F31 B;  4EDP A;  3EN3 A;  4ZEK A;  5I56 A;  4DE8 A;  2A5T A;  1OQH A;  3OSQ A;  1B0L A;  3PMW A;  2Y7I A;  4OFO A;  1POY 1;  4PET A;  3W15 C;  2OBG A;  4WED A;  1Y20 A;  1AL3 A;  3MZ1 A;  3R26 A;  3TKD A;  3QSL A;  4NF8 A;  4QSE A;  3UGW A;  4ELR A;  5ITP A;  1MXZ A;  1URS A;  3EHU A;  1MPB A;  3TYH A;  1EZP A;  3KSX A;  2HQ0 A;  1NNT A;  1SW2 A;  2QJE A;  4EXK A;  1WVJ A;  3M8U A;  2ESN A;  1JVX A;  5FTH A;  3KJT A;  2PYY A;  3VLU A;  3IR1 A;  1FW0 A;  3S9N C;  4OTE A;  2FNC A;  2IA4 A;  3O6H A;  3S2V A;  1A54 A;  4JBZ A;  5HM4 B;  1TXF A;  1FTJ A;  5I58 A;  3JV9 A;  5B7D A;  4ZZE A;  2YJP A;  3SEX A;  2DYX A;  2F5X A;  1B7H A;  2DWH A;  2Q9T A;  4K3F A;  5IAI A;  4IGT A;  4R6Y A;  4RK9 A;  3MPL A;  1T0K A;  1N3X A;  1F9B A;  4O3C A;  4FAT A;  4FJP A;  5I59 B;  4XKQ A;  1WOD A;  2RIN A;  4G8M A;  3OEL A;  3RQT A;  1DTG A;  3MJN A;  4NF5 A;  5AA2 B;  3UN6 A;  3U92 A;  1MQJ A;  1US5 A;  3THI A;  4U1O A;  3FGS A;  1ZKB A;  4DCX A;  4IO7 A;  2D5W A;  5I2N A;  3C9H A;  4ZE8 A;  3VFJ A;  1LLS A;  2XX9 A;  3QUJ A;  2BJJ X;  3TDJ A;  3CFX A;  1M5E A;  4R6K A;  5JK4 A;  4KD5 A;  4QFP A;  2PVU A;  1XHY A;  3CI8 A;  3LUY A;  4IO3 A;  3OEM A;  4ZEF A;  1TT1 A;  1VFD A;  1QKB A;  3HN0 A;  2F8D A;  3O6I A;  2H98 A;  1YPN A;  1LFH A;  3TEL A;  4XIG Q;  4LVQ A;  1MY1 A;  1B3G A;  3IOW A;  4RYA A;  1ZU0 A;  2XXV A;  1XVX A;  1I6A A;  5H8F A;  3O97 A;  4M1V A;  4F1V A;  2O1M A;  3GXA A;  4RY1 A;  1A40 A;  3JYR A;  3OXN A;  4ZEB A;  1GV8 A;  4OYV A;  3LC8 A;  2VOZ A;  4EF1 A;  3ECR A;  4ZS9 A;  3V89 B;  3I3V A;  3K1M A;  1JVY A;  4XKR A;  3FXU A;  5EHS A;  2PMS A;  3UK4 A;  4F2O A;  1DPP A;  4G8N A;  1XS5 A;  5DEX A;  3O2A A;  1H76 A;  2DVC A;  1N76 A;  3MVZ A;  3N6U A;  1VR5 A;  2QSX A;  2O7U A;  3KN7 A;  3LSX A;  4YB6 A;  1J1N A;  4RXL A;  4HS7 A;  1OQG A;  4M4G A;  4FOR A;  3N6T A;  1ZJL A;  2GRV A;  4XKP A;  1PB7 A;  2HZL A;  4GLI A;  5AA4 A;  3IX1 A;  3HPI A;  3C36 A;  5H8H B;  4ELO A;  5K2X A;  1O64 A;  5DVF A;  3VVF A;  1R9L A;  3LR1 A;  3TAJ A;  1USY H;  2R6G E;  3TTK A;  3DP4 A;  4HTG A;  2QMX A;  2REG A;  4X48 A;  2AL5 A;  3IOR A;  2RCA A;  1NNF A;  1LCF A;  4IB2 A;  2HFB A;  3RY3 A;  1RYX A;  1PB9 A;  1HSL A;  4QFL A;  1QJM A;  3FVO A;  2B3F A;  2XX8 A;  3M3L A;  1ZTY A;  3H6W A;  5I57 B;  5KCJ A;  3FZV A;  4F2Q A;  1FQA A;  3K1P A;  3VXB A;  2NWJ A;  4G68 B;  3ZKK A;  1QKA A;  4OET A;  4DXU A;  1VE4 A;  4ESX A;  2G93 A;  3PD8 A;  2V25 A;  5FHN A;  2Y7K A;  2ALU A;  3H3G A;  3IK6 B;  1B9J A;  4DZ1 A;  2F35 A;  4JDF A;  4ESW A;  4MLV A;  1N3W A;  3KG2 A;  3FAS A;  1LST A;  5IKB A;  3OSR A;  3VVE A;  2O7I A;  4QHQ A;  3MW0 A;  1I6B A;  3DLN A;  4QF9 A;  1JW4 A;  5AA1 A;  3G3K A;  4EXL A;  5K2Y A;  2HAU A;  5ITO A;  4F3G A;  1B32 A;  3TOD A;  3IO4 A;  4F1U A;  1LFI A;  5LOM A;  1DPE A;  2DE2 A;  1SYI A;  3EF7 A;  1MRP A;  3UIF A;  1B1H A;  1AIV A;  4LZ5 A;  3V83 A;  1RYO A;  2ZMB A;  2NUV A;  4GXA A;  2Q89 A;  4QSD A;  1Y3N A;  1R6Z A;  4EQ7 A;  1Y1M A;  2Q88 A;  2DP8 A;  3E4R A;  2Y7P A;  1NKX A;  2AIX A;  1Y4C A;  2O68 A;  1FTO A;  1AH5 A;  1BIY A;  3DEL B;  4NED A;  1LB9 A;  2F36 A;  4E0X A; 
#chains in the Genus database with same CATH topology
 4C1T A;  4QFK A;  3O66 A;  2WBD A;  4OER A;  4PFU A;  1B40 A;  1RDX A;  2QVR A;  1XC1 A;  4QSC A;  4GVO A;  3G3G A;  3KFM A;  1NV4 A;  5DVJ A;  5TPA A;  3Q25 A;  2OLB A;  5H8S A;  3EPE A;  2PCR A;  3UOR A;  1MM6 A;  2WKY A;  3MC2 A;  1QVS A;  3PPO A;  1DSN A;  4YKJ A;  4U4S A;  3ODB A;  1TWY A;  2F7C A;  3S4U A;  4GBV A;  4U2R A;  2NVU B;  2FA7 A;  1MQD A;  1MPD A;  4BLA A;  4PFB A;  1D3K A;  4PF6 A;  4HCY A;  1Z7M E;  5ET7 A;  2F6G A;  2ZNS A;  3FJG A;  2OWS A;  2XXR A;  3DM0 A;  3MVW A;  4RJZ A;  1B5I A;  2FBP A;  4WXJ A;  3FD3 A;  1GGG A;  2H4I A;  3TTL A;  2H9B A;  5I59 A;  3MPK A;  3SDF A;  1NNP A;  3KJ7 A;  2HXR A;  1WDN A;  3GBA A;  3IOU A;  4XFE A;  4GIZ A;  4JVI A;  1MXW A;  3WAE A;  4BDM A;  1LBC A;  2G29 A;  2HHM A;  3LSF B;  4OMB A;  5AA2 A;  5AA2 D;  2I0B A;  2XXW A;  4P0I A;  1LBB A;  3CVG A;  3RT8 A;  1FPK A;  1SYH A;  3MZ9 A;  1D9Q A;  1GTK A;  1A55 A;  1AOV A;  4R74 A;  2RKM A;  1D9V A;  3IO6 A;  1QW0 A;  1QUL A;  3PPP A;  1RDZ A;  2ZZV A;  1LFG A;  3BKI B;  3TZA A;  3G7W A;  2AL4 A;  3HST A;  1NUZ A;  3G3I A;  4H8J A;  5DVI A;  4JWY A;  1LAH E;  1O63 A;  1D9Y A;  2VP1 A;  2XXI A;  3QMF A;  4MNI A;  2HEU A;  3K2D A;  1GR2 A;  4FE8 A;  4H46 A;  2XXH A;  1LBY A;  4EQB A;  3SEU A;  4XXU A;  2B3B A;  3K4U A;  2UVG A;  2XWV A;  4P8B A;  4F29 A;  2GH9 A;  1H3D A;  3FUZ A;  4IGR A;  1IXC A;  3IB1 A;  4NF6 B;  2Z23 A;  3E9X A;  3TFL A;  4MX6 A;  4LQ5 A;  2I4B A;  1MXV A;  4UAC A;  2CEY A;  3M3F A;  5F1Q A;  5JEI A;  2QVV A;  1HSE A;  3U93 A;  4LP2 B;  4OQO A;  3QUF A;  4ZEI A;  4YU0 A;  4X04 A;  3EHT A;  3B6Q A;  3ILT B;  3KN3 A;  3PPN A;  2I3W A;  3LUZ A;  1KWH A;  3FJ7 A;  1IIT A;  4AB5 A;  1PDA A;  4HW8 A;  4OEN A;  4NAP A;  4U4X A;  4POW A;  1R9Q A;  2ZNU A;  4R72 A;  1LAF E;  3N5L A;  2FVZ A;  1S9T A;  3W9V A;  3D1R A;  4IO6 A;  5H8H A;  1FTM A;  1OIB A;  1IEJ A;  5BWJ A;  3TCG A;  2OCU A;  5I7I A;  1B3L A;  2Y7W A;  3U94 A;  4LQ2 A;  4BDL A;  4F3P A;  1XT8 A;  4FED A;  4G68 C;  5F24 A;  3KOS A;  5DW8 A;  3D4G A;  3B7D A;  4JSD A;  1NFT A;  4AS5 A;  4F39 A;  5L9S A;  5DYH A;  1N84 A;  1G0H A;  5DT6 A;  5AE4 A;  2QS3 A;  4NF4 B;  5EHM A;  4PDD A;  4YKP A;  3PUW E;  3TTR A;  1II5 A;  4JXI A;  2V3U A;  2Q2C A;  3HCQ A;  2UYE A;  1NV7 A;  4GF8 A;  4DXB A;  1NI9 A;  1JQF A;  2ZYO A;  2WYP A;  5I57 A;  5TU0 A;  4OEV A;  3QAX A;  3V5A A;  5CMK A;  2CZI A;  1PBP A;  1NV5 A;  3VE1 B;  3K6U A;  2I0C A;  4G68 A;  4O94 A;  2FYI A;  4C0R A;  4DXC A;  3TTN A;  5T3J A;  3B50 A;  2L5V A;  2XXY A;  4N15 A;  5DTB A;  1JEV A;  3K00 A;  3N26 A;  2THI A;  2I4C A;  4MHF A;  4U21 A;  1K9Z A;  2F7B A;  4OXV A;  4PCD A;  4G8H A;  3IFA A;  3K6X A;  3H6U A;  4TOZ A;  2V84 A;  4MNP A;  4Z7E A;  2XXT A;  3V8X B;  5I56 B;  2WYK A;  1BLF A;  1MH3 A;  3KOT A;  3G3J A;  3K6W A;  4OVS A;  2A5T B;  3A29 A;  5L9O A;  5ESY A;  2D3I A;  3CRB A;  4YZZ A;  5CMB A;  1LGB C;  1PBQ A;  1B05 A;  3E13 X;  4IY6 A;  4LUB A;  1VDW A;  3T66 A;  5ET6 A;  2XD2 A;  1JET A;  1QUJ A;  4NTL A;  1AWB A;  4F19 A;  4XKN A;  4RA1 A;  1PEB A;  2X7Q A;  1HSJ A;  4BDR A;  2P3V A;  3S9E A;  2X7P A;  3G3F A;  4YMA A;  3PMV A;  5IGA A;  1Y9U A;  1MQI A;  4GX3 A;  4I8C A;  2VPN A;  3U65 A;  3RPL A;  4GWW A;  3O6G A;  1UTH B;  2Q8J A;  4Q0C A;  1B7U A;  1B51 A;  4OA4 A;  4P3L A;  5EYF A;  4OFL A;  1Q1K A;  4N4U A;  1B58 A;  1P1U A;  4IY5 A;  4IO4 A;  1LCT A;  1Y4T A;  3IOV A;  3OMB A;  4FEC A;  2DQV A;  1FCK A;  2PX1 A;  3B6W A;  2Y84 A;  2P1S A;  2ZNT A;  1S50 A;  4KYE A;  1EH3 A;  4X8R A;  4THI A;  2NXO A;  4ISU A;  3EHS A;  5EQ9 A;  2QPQ A;  4H5F A;  3IL1 B;  1IXH A;  3L6H A;  3PMX A;  3QK6 A;  3OO7 A;  5TP9 B;  4ZED A;  3PGF A;  1LAG E;  1Z7N E;  3CR9 A;  1O7T A;  5M2V A;  2KR0 A;  3KGC A;  3OD7 A;  4KI0 E;  4PTK A;  4F3S A;  1EU8 A;  4GQO A;  3TQL A;  4KCD A;  2HPG A;  1IMA A;  3HHF A;  4L17 A;  4PE5 B;  3U72 A;  4RPN A;  1IQ7 A;  4NF5 B;  1MM7 A;  1PB8 A;  4O7I A;  1B2H A;  3CG3 A;  1LAX A;  4OVQ A;  1ATG A;  1LB8 A;  1GVC A;  1SPI A;  5I2N B;  4C1U A;  4P11 A;  3CG1 A;  1XOC A;  3E78 A;  2W7Y A;  4F1Y A;  1FQF A;  4YAH X;  5L9M A;  1P1N A;  2GHA A;  2LAO A;  1BK4 A;  3ILU B;  1EZO A;  4LN5 A;  3MP6 A;  4QFN A;  1JEU A;  3UA8 A;  1IZ1 A;  4LAT A;  1FPJ A;  3LSL A;  2DWI A;  1NNK A;  1FTA A;  1DCU A;  5FHM A;  4X1D A;  3H7M A;  2IEE A;  1CB6 A;  3B6T A;  2CZK A;  2ZYM A;  1OLC A;  4DIG A;  4AQ4 A;  1G0I A;  3FVK A;  2DDK A;  1YTV A;  2NOO A;  3MST A;  1SI0 A;  3TMG A;  3RGY A;  1QUK A;  3K1N A;  4KPT A;  3PPR A;  1MPC A;  1B4H A;  3MUQ A;  3K6V A;  1FQD A;  2DOJ A;  2VD2 A;  3RNN A;  3GLB A;  1RKM A;  1UQW A;  3U8Q A;  4KXP A;  3TEP A;  4FBP A;  5FHO A;  2F34 A;  2Z22 A;  5DEX B;  1MS7 A;  4GWU A;  1MY3 A;  2DE3 A;  4NF6 A;  1QGX A;  4ZE9 A;  5CMM A;  3IJO B;  4TLM B;  5ET8 A;  5CRY A;  4EUO A;  3S9M C;  4ND9 A;  5F7V A;  2OWZ A;  1QUI A;  5J16 A;  3KBR A;  1SVX B;  2OWT A;  4OEU A;  5ISU A;  4EF2 A;  3RT6 B;  1IME A;  5B70 A;  4QBA A;  3FJM A;  3O9P A;  2Y5K A;  5HBC A;  4MNC A;  1MY4 A;  3PUY E;  4GL0 A;  1P1Q A;  4O3A A;  1MDP 1;  4G2Z A;  1MY2 A;  1N7X A;  5KDT B;  4FIM A;  3PU5 A;  3K02 A;  3KN8 A;  3TTM A;  4BDQ A;  2Q2A A;  2RC7 A;  2VD3 A;  4HCW A;  4MF3 A;  1B4Z A;  2PT2 A;  2I49 A;  1I69 A;  4IO2 A;  3A09 A;  3K0V A;  3CFZ A;  1FQC A;  1P1O A;  4JVD A;  4I3E A;  3D4C A;  5FTI A;  4I62 A;  1Y3Q A;  2AYS A;  1P99 A;  4NF4 A;  1A8F A;  5KCJ B;  4KQP A;  1B7Z A;  1B3E A;  2ONK E;  4H5G A;  1SW1 A;  2DSF A;  1S7Y A;  5L8D A;  3CFL A;  3LBS A;  3T9U A;  5BUU A;  3T9X B;  3O28 A;  2QMW A;  3MWB A;  4N8Y A;  1OLA A;  4GFR A;  1Y3P A;  3OOA A;  1FPD A;  4DDD A;  3MVY A;  4R2F A;  1URD A;  4WKM A;  1CNQ A;  2QS4 A;  2DWA A;  4MLQ A;  4RNS A;  4N6D A;  1AMF A;  3C32 A;  3OEN A;  1MH4 A;  1K9Y A;  4P0G A;  4GBW A;  4YMB A;  1NV1 A;  4PF8 A;  3EQ1 A;  3L6G A;  2O1L A;  1SBP A;  4MMP A;  1VSO A;  4N6K A;  4QFO A;  4DLD A;  2E0S A;  3A3C A;  3SEY A;  4N13 A;  3OO8 A;  3VXC A;  1DTZ A;  2F78 A;  4Q5T A;  1UIU A;  4YB5 A;  2XXK A;  1NV3 A;  1FQB A;  4PFY A;  1KA0 A;  2YLN A;  1FQE A;  3IJX B;  3VLV A;  4YKK A;  4NF0 A;  2BJI A;  4RPO A;  1EYI A;  2Q74 A;  4Q8R A;  2XWO A;  1ZLQ A;  5EQA A;  5H8Q B;  4AS4 A;  4H6D A;  1LBW A;  3IB0 A;  1NUW A;  3HO7 A;  3G3H A;  3T0J A;  3I5O A;  2I48 A;  2PFY A;  2ZZX A;  1YAE A;  5AA3 A;  3R6U A;  4KHZ E;  1MQG A;  2RC9 A;  1POT A;  4NGU A;  5I2K B;  3C4M A;  1UTH A;  1XVY A;  1FBH A;  1N7W A;  5TPA B;  3C31 A;  1LBZ A;  1H45 A;  5JTY B;  1FBP A;  1B3F A;  3CIJ A;  1NV6 A;  4PQJ A;  2Q8M A;  2PBW A;  4FEB A;  5H8N B;  3Q29 A;  3HV1 A;  3H6V A;  2F3B A;  3T93 B;  3TCF A;  3S9L C;  3Q26 A;  2Z8E A;  1FBF A;  1FRP A;  2M8C A;  2PFZ A;  4N17 A;  1R1N A;  1USY E;  4Z0I A;  2QS2 A;  2B4L A;  3PUZ E;  2Y7R A;  5A5X B;  4R73 A;  1IXI A;  4BDN A;  4ELP A;  2ANJ A;  4H8I A;  1OMP A;  4GL8 A;  1LBV A;  4PP0 A;  4N07 A;  3KEI A;  4NQ8 A;  1Y1Z A;  3BFT A;  5TP9 A;  4U1Z A;  3FV2 A;  2CEX A;  1M5C A;  3U1O A;  3CSB A;  3VLW A;  4U23 A;  4JWX A;  1MXU A;  5IZ3 A;  3KZG A;  4Q30 B;  2ZYK A;  2F6P A;  3R7X A;  4X1B A;  4HE2 A;  3BIG A;  3Q27 A;  2QS1 A;  3TCH A;  2XWI A;  1OVB A;  1IMB A;  3KC0 A;  1MG1 A;  3VVD A;  2OK2 A;  1N04 A;  1VFE A;  5EYG A;  4KYS A;  4FAJ A;  1B46 A;  4GD5 A;  5I5P A;  5CC2 A;  2HZK A;  1FBG A;  1Q35 A;  3A3U A;  1L5T A;  2DWJ A;  3RUM A;  1MXY A;  1UTB B;  1IXG A;  2Z8D A;  3DP6 A;  3PD9 A;  3T96 B;  4MH5 A;  4XTC Q;  2GFE A;  3GZG A;  4I40 A;  4G77 A;  3MBP A;  4NE4 A;  5ICQ A;  3H6T A;  3IOT A;  4RK2 A;  4KFQ A;  4ELQ A;  5CBR A;  4KR5 A;  4MBP A;  1A8E A;  1ELJ A;  3MQ9 A;  4TQU Q;  2VPO A;  4N6P A;  1NUY A;  4H67 A;  5ELV A;  4DCY A;  4ONY A;  3MAM A;  5CBS A;  2KLF A;  3IFC A;  4OFJ A;  1FTL A;  2VGQ A;  4E0W A;  3RPW A;  2DVZ A;  4JB7 A;  3HFU A;  2WEF A;  1JW1 A;  2F97 A;  4NMY A;  4R6H A;  3PV0 E;  4OVJ A;  3W9W A;  2B4M A;  4NF8 B;  4H1X A;  2ONR A;  2O51 A;  4OVR A;  3ZKL A;  3SZP A;  2XXQ A;  4YIC A;  1EYK A;  3F11 A;  4U22 A;  2D21 A;  1DOT A;  4LA9 A;  3P7I A;  4NWC A;  4N91 A;  1DK4 A;  2HCA A;  3ZSF A;  1SDX A;  2OJT A;  1ZIU A;  4YKI A;  2ZXT A;  4WEP A;  4F3B A;  3H4Z A;  3FV1 A;  4R9G A;  2WBB A;  1DMB A;  4LZ8 A;  1B1X A;  3FXR A;  3ISP A;  3OO9 A;  2V93 A;  3FBP A;  3RLF E;  5A5L A;  5CM6 A;  3MZB A;  4MFI A;  3FXQ A;  4PFW A;  4NN3 A;  4OWD A;  2GHB A;  4GRK A;  3IAZ A;  5J1D A;  1JW5 A;  4GWO A;  3AXF A;  4G4P A;  4JWO A;  5I58 B;  3MP1 A;  2RCB A;  2CZL A;  4OZ9 A;  3OEK A;  3O29 A;  4IO5 A;  2ZYN A;  1P1W A;  2H99 A;  1BP5 A;  3DP8 A;  3H06 B;  2A5S A;  3MVX A;  2XXU A;  5KDT A;  1FJ9 A;  3B8B A;  3MP8 A;  1YZ0 A;  1NH8 A;  3VV5 A;  2HAV A;  2B65 A;  4GWY A;  3OO6 A;  1RDY A;  4R9F A;  3LSW A;  5EYH A;  4ZDM A;  3FIR A;  4PFT A;  2KQZ A;  4KYD A;  2OX3 A;  3IB2 A;  4GWZ A;  1B0H A;  3UP9 A;  1EYJ A;  3C34 A;  3QIM A;  2UYF A;  1JNF A;  4F18 A;  2FIE A;  2ONS A;  3FAT A;  3KSJ A;  1YYZ A;  1BKA A;  3QXM A;  2JJK A;  4NWD A;  3FVN A;  3SKP A;  2P3N A;  2I3V A;  2RF1 A;  2VHA A;  5IZ1 A;  3QYT A;  1B52 A;  2E1S A;  1NH7 A;  1FTK A;  4POX A;  3BFU A;  2QRY A;  1A7L A;  3E3K A;  3SEW A;  4H45 A;  1MY0 A;  3T9H B;  4X9T A;  1SQY A;  2X26 A;  2R71 A;  4OES A;  1H44 A;  2HXW A;  4EQ9 A;  4H65 A;  1ZBM A;  2OZZ A;  4LZ7 A;  2I6E A;  2RC8 A;  1LEV A;  4OVP A;  1CE2 A;  3PPQ A;  5H8F B;  3K01 A;  4PFI A;  3RTF B;  2O6A A;  1FBD A;  4R2B A;  2REJ A;  1MXX A;  4R75 A;  1B6H A;  3HHG A;  1D4N A;  1NMU A;  1I6Q A;  2P0S A;  2DS9 A;  4ZZA A;  4I1D A;  5I84 A;  4GXS B;  2XD3 A;  2F7A A;  2ABH A;  1BTJ A;  2V3Q A;  4F22 A;  1ANF A;  3SET A;  5ICT A;  1SW5 A;  1OVT A;  3T22 A;  3WAF A;  5ET5 A;  1M5D A;  3T9V A;  2V3T A;  2QVU A;  1B5J A;  3PUV E;  4OAN A;  5H8Q A;  2GQ1 A;  3RTW B;  3CSG A;  1A99 A;  2XX7 A;  1B3H A;  2DXY A;  5AA4 B;  1IIW A;  4AB6 A;  2H25 A;  3GBB A;  3ONM A;  2YPN A;  3TUS A;  3Q28 A;  2ZZW A;  2UVI A;  5I2K A;  3PUX E;  4PAF A;  3I6V A;  2Z8F A;  2DXR A;  3SES A;  2XXP A;  5JTY A;  4O3B A;  1JP4 A;  1M5B A;  4MIJ A;  4JSO A;  4ECF A;  5KZT A;  2UVH A;  4OHN A;  1TFD A;  2DE4 A;  5H8N A;  3N94 A;  4H0W A;  4P9K A;  2QL3 A;  1M5F A;  4TLL B;  1SW4 A;  3RN8 A;  1TFA A;  2XHD A;  4DI4 B;  5FBP A;  1FBE A;  2R9J A;  1PC3 A;  5IZZ A;  3FVG A;  5A5X A;  1URG A;  3TPA A;  4LON B;  4BDO A;  2O69 A;  5EQ7 A;  4GWS A;  4I9D A;  2UVJ A;  4N8G A;  4QRZ A;  1FJ6 A;  5CMC A;  1UIV A;  4UAB A;  3ZS6 A;  1ZMG A;  4DI3 D;  1US4 A;  3SEV A;  3SER A;  1EZ9 A;  4PBH A;  1NL5 A;  1YCJ A;  3C33 A;  3USD A;  4KCC A;  5HPQ A;  4ZEC A;  4PBQ A;  2UXA A;  4GOT A;  2PT1 A;  1MQH A;  4PFR A;  3JZJ A;  2CMO A;  1IUD A;  4PC9 A;  3TQW A;  5CI5 A;  3KBZ A;  3VDF A;  1SD3 A;  1SI1 A;  2O84 X;  2I58 A;  3C35 A;  1B5H A;  4OVT A;  4HXV A;  1H43 A;  2XXX A;  1KA1 A;  3BBR A;  2P2A A;  4MAG A;  2H5Y A;  4XEQ A;  4YB7 A;  1MDQ A;  1N0T A;  4P47 A;  3H03 A;  4UA8 A;  3M3K A;  1UTB A;  3FXB A;  4F31 B;  4EDP A;  3EN3 A;  4ZEK A;  5I56 A;  2VT5 A;  4DE8 A;  2MKZ A;  2A5T A;  1OQH A;  3OSQ A;  1B0L A;  3PMW A;  2Y7I A;  4OFO A;  4MCO A;  1POY 1;  3KC1 A;  5LDZ A;  4PET A;  3W15 C;  2OBG A;  2R8T A;  4WED A;  1Y20 A;  1AL3 A;  3MZ1 A;  3R26 A;  3TKD A;  3QSL A;  4NF8 A;  4QSE A;  3UGW A;  4ELR A;  5ITP A;  1MXZ A;  1XI6 A;  1URS A;  3EHU A;  1MPB A;  4PAI A;  3TYH A;  4O7M A;  1EZP A;  3KSX A;  4PDH A;  2HQ0 A;  1NNT A;  2QFL A;  1SW2 A;  2QJE A;  4EXK A;  1WVJ A;  3M8U A;  2ESN A;  1JVX A;  5FTH A;  3KJT A;  2PYY A;  3VLU A;  3IR1 A;  1FW0 A;  3S9N C;  4OTE A;  2FNC A;  2IA4 A;  3O6H A;  3S2V A;  1A54 A;  4NX1 A;  4JBZ A;  5HM4 B;  1TXF A;  1FTJ A;  5I58 A;  4MJO A;  3JV9 A;  5B7D A;  1KZ8 A;  4ZZE A;  1INP A;  2YJP A;  3SEX A;  2DYX A;  2F5X A;  1B7H A;  2DWH A;  2Q9T A;  4K3F A;  5IAI A;  4IGT A;  4R6Y A;  4RK9 A;  1YXI A;  3MPL A;  1T0K A;  1N3X A;  1F9B A;  4O3C A;  4FAT A;  4FJP A;  5I59 B;  4XKQ A;  1FPG A;  1WOD A;  2RIN A;  4G8M A;  3OEL A;  1IMD A;  3RQT A;  1DTG A;  3EKI A;  3MJN A;  4NF5 A;  5AA2 B;  3UN6 A;  2XWK A;  4O8M A;  3U92 A;  1MQJ A;  1US5 A;  2F3D A;  4HE0 A;  3THI A;  4U1O A;  3FGS A;  1ZKB A;  4DCX A;  4IO7 A;  5LTC A;  2D5W A;  5I2N A;  3C9H A;  4ZE8 A;  3VFJ A;  1LLS A;  3T1B A;  2XX9 A;  3QUJ A;  2BJJ X;  3TDJ A;  4QXD A;  3CFX A;  1M5E A;  4R6K A;  5JK4 A;  4KD5 A;  4QFP A;  2PVU A;  5I3S A;  1XHY A;  3CI8 A;  3LUY A;  4IO3 A;  3OEM A;  4ZEF A;  1TT1 A;  1VFD A;  2FIX A;  1QKB A;  3HN0 A;  4NHB A;  2F8D A;  3O6I A;  2H98 A;  1YPN A;  1LFH A;  3TEL A;  1FPL A;  4XIG Q;  4LVQ A;  3GYY A;  1MY1 A;  1B3G A;  1FPF A;  3IOW A;  4RYA A;  1ZU0 A;  2XXV A;  1XVX A;  1I6A A;  5H8F A;  3O97 A;  3CHG A;  4M1V A;  3ROJ A;  4F1V A;  2O1M A;  3GXA A;  4RY1 A;  1A40 A;  3JYR A;  3OXN A;  4ZEB A;  1GV8 A;  4OYV A;  3LC8 A;  2VOZ A;  3ECR A;  3V89 B;  4ZS9 A;  4EF1 A;  3I3V A;  3K1M A;  1JVY A;  4XKR A;  3FXU A;  5EHS A;  2PMS A;  3UK4 A;  4F2O A;  1DPP A;  4G8N A;  1Q9D A;  1XS5 A;  5DEX A;  3O2A A;  1H76 A;  2DVC A;  1N76 A;  3MVZ A;  3N6U A;  1VR5 A;  2QSX A;  2O7U A;  3KN7 A;  3LSX A;  4YB6 A;  1J1N A;  4RXL A;  4HE1 A;  4HS7 A;  1OQG A;  4G61 A;  4M4G A;  4FOR A;  3N6T A;  1ZJL A;  3PTY A;  3LV0 A;  2GRV A;  4XKP A;  1PB7 A;  2HZL A;  4GLI A;  5AA4 A;  3IX1 A;  3HPI A;  2Y5L A;  3C36 A;  5H8H B;  4ELO A;  5K2X A;  3MYU A;  1O64 A;  4GX6 A;  5DVF A;  4I3Y A;  3VVF A;  1FSA A;  2V4C A;  2FHY A;  2XA5 A;  1R9L A;  3LR1 A;  3TAJ A;  1USY H;  2R6G E;  3TTK A;  3DP4 A;  1DBZ A;  4PGP A;  4HTG A;  1FPE A;  2QMX A;  2REG A;  3RYD A;  4X48 A;  2AL5 A;  3IOR A;  2RCA A;  1NNF A;  4PE3 A;  1LCF A;  4IB2 A;  2HFB A;  1IMC A;  3RY3 A;  1RYX A;  1PB9 A;  1HSL A;  4QFL A;  4P1L A;  1QJM A;  3FVO A;  2B3F A;  2XX8 A;  3NOH A;  4GWX A;  5IZ3 B;  3M3L A;  1ZTY A;  3H6W A;  5I57 B;  5KCJ A;  3FZV A;  4F2Q A;  1FQA A;  1NV0 A;  3K1P A;  3VXB A;  2NWJ A;  4G68 B;  4N81 A;  3ZKK A;  1NV2 A;  1QKA A;  4OET A;  4DXU A;  1VE4 A;  4ESX A;  2G93 A;  3PD8 A;  2V25 A;  5FHN A;  3E79 A;  2Y7K A;  4IR8 A;  2ALU A;  3H3G A;  3IK6 B;  1B9J A;  4DZ1 A;  2F35 A;  4JDF A;  4JVC A;  4ESW A;  4MLV A;  1N3W A;  4P1E A;  1LBX A;  4MEV A;  1FBC A;  3FAS A;  3KG2 A;  1LST A;  5IKB A;  3OSR A;  5IM2 A;  4XF5 A;  3VVE A;  3BIH A;  2O7I A;  4QHQ A;  3MW0 A;  1I6B A;  4NG7 A;  1FPB A;  3DLN A;  4QF9 A;  4PGN A;  1JW4 A;  5AA1 A;  3G3K A;  4EXL A;  5K2Y A;  2HAU A;  5ITO A;  4F3G A;  1B32 A;  3TOD A;  3IO4 A;  4F1U A;  1LFI A;  5LOM A;  1DPE A;  2DE2 A;  1SYI A;  2CZH A;  3EF7 A;  1MRP A;  3UIF A;  1B1H A;  1AIV A;  4LZ5 A;  3V83 A;  1RYO A;  4P56 A;  1NUX A;  2ZMB A;  2NUV A;  4GXA A;  2Q89 A;  2WX9 A;  4QSD A;  1Y3N A;  1R6Z A;  4EQ7 A;  1Y1M A;  2Q88 A;  2DP8 A;  3E4R A;  3RPL B;  2Y7P A;  1FPI A;  1NKX A;  2AIX A;  4PAK A;  4GX4 A;  1Y4C A;  5EQ8 A;  2O68 A;  1IMF A;  1FTO A;  1AH5 A;  1BIY A;  3DEL B;  4NED A;  1LB9 A;  2F36 A;  4E0X A; 
#chains in the Genus database with same CATH homology
 4C1T A;  4QFK A;  3O66 A;  4OER A;  4PFU A;  1B40 A;  1XC1 A;  4QSC A;  4GVO A;  3G3G A;  3KFM A;  5DVJ A;  5TPA A;  3Q25 A;  2OLB A;  5H8S A;  3EPE A;  3UOR A;  1MM6 A;  2WKY A;  3MC2 A;  1QVS A;  3PPO A;  1DSN A;  4YKJ A;  4U4S A;  3ODB A;  1TWY A;  2F7C A;  3S4U A;  4U2R A;  2NVU B;  2FA7 A;  1MQD A;  1MPD A;  4BLA A;  1D3K A;  4HCY A;  1Z7M E;  2F6G A;  2ZNS A;  3FJG A;  2OWS A;  2XXR A;  3DM0 A;  3MVW A;  4RJZ A;  1B5I A;  4WXJ A;  3FD3 A;  1GGG A;  2H4I A;  3TTL A;  2H9B A;  5I59 A;  3MPK A;  3SDF A;  1NNP A;  3KJ7 A;  1WDN A;  3GBA A;  3IOU A;  4GIZ A;  1MXW A;  3WAE A;  4BDM A;  1LBC A;  2G29 A;  3LSF B;  4OMB A;  5AA2 A;  5AA2 D;  2I0B A;  2XXW A;  4P0I A;  1LBB A;  3CVG A;  3RT8 A;  1SYH A;  3MZ9 A;  1GTK A;  1A55 A;  1AOV A;  4R74 A;  2RKM A;  1D9V A;  3IO6 A;  1QW0 A;  1QUL A;  3PPP A;  1LFG A;  3BKI B;  3TZA A;  3G7W A;  2AL4 A;  3HST A;  3G3I A;  4H8J A;  5DVI A;  4JWY A;  1LAH E;  1O63 A;  1D9Y A;  2VP1 A;  2XXI A;  2HEU A;  3K2D A;  1GR2 A;  4FE8 A;  2XXH A;  4EQB A;  3SEU A;  4XXU A;  2B3B A;  3K4U A;  2UVG A;  4F29 A;  2GH9 A;  1H3D A;  3FUZ A;  4IGR A;  1IXC A;  3IB1 A;  4NF6 B;  2Z23 A;  3E9X A;  3TFL A;  4LQ5 A;  2I4B A;  1MXV A;  4UAC A;  3M3F A;  5F1Q A;  5JEI A;  1HSE A;  3U93 A;  4LP2 B;  4OQO A;  3QUF A;  4ZEI A;  4YU0 A;  3EHT A;  3B6Q A;  3ILT B;  3KN3 A;  3PPN A;  2I3W A;  1KWH A;  3FJ7 A;  1IIT A;  4AB5 A;  1PDA A;  4HW8 A;  4OEN A;  4U4X A;  4POW A;  1R9Q A;  2ZNU A;  4R72 A;  1LAF E;  3N5L A;  1S9T A;  3W9V A;  4IO6 A;  5H8H A;  1FTM A;  1OIB A;  1IEJ A;  5BWJ A;  3TCG A;  2OCU A;  1B3L A;  2Y7W A;  3U94 A;  4LQ2 A;  4BDL A;  4F3P A;  1XT8 A;  4FED A;  4G68 C;  3KOS A;  3D4G A;  3B7D A;  4JSD A;  1NFT A;  4F39 A;  5L9S A;  5DYH A;  1N84 A;  5DT6 A;  5AE4 A;  2QS3 A;  4NF4 B;  5EHM A;  4YKP A;  3PUW E;  3TTR A;  1II5 A;  4JXI A;  2V3U A;  2Q2C A;  3HCQ A;  2UYE A;  4GF8 A;  4DXB A;  1JQF A;  2ZYO A;  5I57 A;  5TU0 A;  4OEV A;  3QAX A;  3V5A A;  5CMK A;  1PBP A;  3VE1 B;  3K6U A;  2I0C A;  4G68 A;  2FYI A;  4C0R A;  4DXC A;  3TTN A;  2XXY A;  5DTB A;  1JEV A;  3K00 A;  3N26 A;  2THI A;  2I4C A;  4U21 A;  2F7B A;  4OXV A;  4G8H A;  3K6X A;  3H6U A;  4TOZ A;  2V84 A;  4Z7E A;  2XXT A;  3V8X B;  5I56 B;  1BLF A;  1MH3 A;  3KOT A;  3G3J A;  3K6W A;  2A5T B;  5L9O A;  2D3I A;  3CRB A;  4YZZ A;  5CMB A;  1LGB C;  1PBQ A;  1B05 A;  3E13 X;  4IY6 A;  4LUB A;  3T66 A;  2XD2 A;  1JET A;  1QUJ A;  4NTL A;  4F19 A;  4XKN A;  4RA1 A;  1PEB A;  2X7Q A;  1HSJ A;  4BDR A;  3S9E A;  2X7P A;  3G3F A;  4YMA A;  3PMV A;  1Y9U A;  1MQI A;  4I8C A;  3O6G A;  1UTH B;  2Q8J A;  4Q0C A;  1B7U A;  1B51 A;  5EYF A;  4OFL A;  1Q1K A;  1B58 A;  1P1U A;  4IY5 A;  4IO4 A;  1LCT A;  1Y4T A;  3IOV A;  3OMB A;  4FEC A;  2DQV A;  1FCK A;  2PX1 A;  3B6W A;  2Y84 A;  2P1S A;  2ZNT A;  1S50 A;  4KYE A;  1EH3 A;  4THI A;  2NXO A;  4ISU A;  3EHS A;  2QPQ A;  1IXH A;  4H5F A;  3IL1 B;  3L6H A;  3PMX A;  3QK6 A;  3OO7 A;  5TP9 B;  4ZED A;  3PGF A;  1LAG E;  1Z7N E;  3CR9 A;  1O7T A;  5M2V A;  3KGC A;  3OD7 A;  4KI0 E;  4F3S A;  1EU8 A;  4GQO A;  3TQL A;  4KCD A;  4L17 A;  4PE5 B;  3HHF A;  3U72 A;  4RPN A;  1IQ7 A;  4NF5 B;  1MM7 A;  1PB8 A;  1B2H A;  3CG3 A;  1LAX A;  1ATG A;  1LB8 A;  1GVC A;  5I2N B;  4C1U A;  4P11 A;  3CG1 A;  1XOC A;  2W7Y A;  4F1Y A;  1FQF A;  4YAH X;  5L9M A;  1P1N A;  2GHA A;  2LAO A;  3ILU B;  1EZO A;  3MP6 A;  4QFN A;  1JEU A;  3UA8 A;  1IZ1 A;  4LAT A;  3LSL A;  2DWI A;  1NNK A;  5FHM A;  4X1D A;  3H7M A;  2IEE A;  1CB6 A;  3B6T A;  2ZYM A;  1OLC A;  4DIG A;  4AQ4 A;  3FVK A;  1YTV A;  2NOO A;  1SI0 A;  3TMG A;  3RGY A;  1QUK A;  3K1N A;  4KPT A;  3PPR A;  1MPC A;  1B4H A;  3MUQ A;  3K6V A;  1FQD A;  2DOJ A;  2VD2 A;  3RNN A;  3GLB A;  1RKM A;  1UQW A;  3U8Q A;  3TEP A;  5FHO A;  2F34 A;  2Z22 A;  5DEX B;  1MS7 A;  1MY3 A;  2DE3 A;  4NF6 A;  4ZE9 A;  5CMM A;  3IJO B;  4TLM B;  5CRY A;  4EUO A;  3S9M C;  4ND9 A;  5F7V A;  1QUI A;  3KBR A;  1SVX B;  2OWT A;  4OEU A;  5ISU A;  4EF2 A;  3RT6 B;  5B70 A;  3FJM A;  3O9P A;  5HBC A;  1MY4 A;  3PUY E;  4GL0 A;  1P1Q A;  4O3A A;  1MDP 1;  4G2Z A;  1MY2 A;  1N7X A;  5KDT B;  4FIM A;  3PU5 A;  3K02 A;  3KN8 A;  3TTM A;  4BDQ A;  2Q2A A;  2RC7 A;  2VD3 A;  4HCW A;  4MF3 A;  1B4Z A;  2PT2 A;  2I49 A;  1I69 A;  4IO2 A;  3A09 A;  3K0V A;  3CFZ A;  1FQC A;  1P1O A;  3D4C A;  5FTI A;  4I62 A;  1Y3Q A;  2AYS A;  1P99 A;  4NF4 A;  1A8F A;  5KCJ B;  4KQP A;  1B7Z A;  1B3E A;  2ONK E;  4H5G A;  1SW1 A;  2DSF A;  1S7Y A;  5L8D A;  3CFL A;  3LBS A;  3T9U A;  5BUU A;  3T9X B;  3O28 A;  2QMW A;  3MWB A;  1OLA A;  4GFR A;  1Y3P A;  3OOA A;  4DDD A;  3MVY A;  4R2F A;  1URD A;  2QS4 A;  4MLQ A;  4RNS A;  2DWA A;  4WKM A;  1AMF A;  3C32 A;  3OEN A;  1MH4 A;  4P0G A;  4YMB A;  3EQ1 A;  3L6G A;  2O1L A;  1SBP A;  1VSO A;  4QFO A;  4DLD A;  2E0S A;  3A3C A;  3SEY A;  4N13 A;  3OO8 A;  3VXC A;  1DTZ A;  2F78 A;  4Q5T A;  1UIU A;  4YB5 A;  1FQB A;  4PFY A;  2YLN A;  1FQE A;  3IJX B;  3VLV A;  4YKK A;  4RPO A;  4Q8R A;  1ZLQ A;  5H8Q B;  4H6D A;  3IB0 A;  3HO7 A;  3G3H A;  3I5O A;  2I48 A;  1YAE A;  5AA3 A;  3R6U A;  4KHZ E;  1MQG A;  2RC9 A;  1POT A;  5I2K B;  3C4M A;  1UTH A;  1XVY A;  1N7W A;  5TPA B;  3C31 A;  1H45 A;  5JTY B;  1B3F A;  3CIJ A;  4PQJ A;  2PBW A;  4FEB A;  5H8N B;  3Q29 A;  3HV1 A;  3H6V A;  3T93 B;  3TCF A;  3S9L C;  3Q26 A;  2Z8E A;  2M8C A;  1R1N A;  1USY E;  4Z0I A;  2QS2 A;  3PUZ E;  2Y7R A;  5A5X B;  4R73 A;  1IXI A;  4BDN A;  4ELP A;  2ANJ A;  4H8I A;  1OMP A;  4GL8 A;  4PP0 A;  4N07 A;  3KEI A;  1Y1Z A;  3BFT A;  5TP9 A;  4U1Z A;  3FV2 A;  1M5C A;  3U1O A;  3CSB A;  3VLW A;  4U23 A;  4JWX A;  1MXU A;  3KZG A;  4Q30 B;  2ZYK A;  2F6P A;  3R7X A;  4X1B A;  3Q27 A;  2QS1 A;  3TCH A;  1OVB A;  1MG1 A;  3VVD A;  2OK2 A;  1N04 A;  1VFE A;  4KYS A;  4FAJ A;  1B46 A;  4GD5 A;  5CC2 A;  2HZK A;  1Q35 A;  3A3U A;  1L5T A;  2DWJ A;  3RUM A;  1MXY A;  1UTB B;  1IXG A;  2Z8D A;  3DP6 A;  3PD9 A;  3T96 B;  4MH5 A;  4XTC Q;  2GFE A;  3GZG A;  4G77 A;  3MBP A;  4NE4 A;  5ICQ A;  3H6T A;  3IOT A;  4RK2 A;  4KFQ A;  4ELQ A;  5CBR A;  4KR5 A;  4MBP A;  1A8E A;  1ELJ A;  3MQ9 A;  4TQU Q;  4N6P A;  4H67 A;  5ELV A;  4DCY A;  4ONY A;  3MAM A;  5CBS A;  2KLF A;  4OFJ A;  1FTL A;  2VGQ A;  4E0W A;  3RPW A;  2DVZ A;  4JB7 A;  1JW1 A;  2F97 A;  4NMY A;  4R6H A;  3PV0 E;  4OVJ A;  3W9W A;  4NF8 B;  4H1X A;  2ONR A;  2O51 A;  3ZKL A;  2XXQ A;  4YIC A;  3F11 A;  4U22 A;  2D21 A;  1DOT A;  4LA9 A;  3P7I A;  4NWC A;  2HCA A;  3ZSF A;  1SDX A;  2OJT A;  1ZIU A;  4YKI A;  2ZXT A;  4WEP A;  4F3B A;  3H4Z A;  3FV1 A;  4R9G A;  1DMB A;  4LZ8 A;  1B1X A;  3FXR A;  3OO9 A;  2V93 A;  3RLF E;  5CM6 A;  3MZB A;  4MFI A;  3FXQ A;  4PFW A;  4OWD A;  2GHB A;  4GRK A;  3IAZ A;  5J1D A;  1JW5 A;  4GWO A;  3AXF A;  4G4P A;  4JWO A;  5I58 B;  3MP1 A;  2RCB A;  2CZL A;  4OZ9 A;  3OEK A;  3O29 A;  4IO5 A;  2ZYN A;  1P1W A;  2H99 A;  1BP5 A;  3DP8 A;  3H06 B;  2A5S A;  3MVX A;  2XXU A;  5KDT A;  3MP8 A;  1NH8 A;  3VV5 A;  2HAV A;  2B65 A;  3OO6 A;  4R9F A;  3LSW A;  4ZDM A;  3FIR A;  4PFT A;  4KYD A;  3IB2 A;  1B0H A;  3UP9 A;  3C34 A;  3QIM A;  2UYF A;  1JNF A;  4F18 A;  2ONS A;  3FAT A;  3KSJ A;  1BKA A;  3QXM A;  4NWD A;  3FVN A;  3SKP A;  2I3V A;  2RF1 A;  2VHA A;  3QYT A;  1B52 A;  2E1S A;  1NH7 A;  1FTK A;  4POX A;  3BFU A;  2QRY A;  1A7L A;  3E3K A;  3SEW A;  1MY0 A;  3T9H B;  4X9T A;  1SQY A;  2X26 A;  2R71 A;  4OES A;  1H44 A;  2HXW A;  4EQ9 A;  4H65 A;  1ZBM A;  2OZZ A;  4LZ7 A;  2I6E A;  2RC8 A;  1CE2 A;  3PPQ A;  5H8F B;  3K01 A;  3RTF B;  2O6A A;  4R2B A;  2REJ A;  1MXX A;  4R75 A;  1B6H A;  3HHG A;  1D4N A;  1NMU A;  1I6Q A;  2P0S A;  2DS9 A;  4ZZA A;  4I1D A;  5I84 A;  4GXS B;  2XD3 A;  2F7A A;  2ABH A;  1BTJ A;  2V3Q A;  4F22 A;  1ANF A;  3SET A;  5ICT A;  1SW5 A;  1OVT A;  3T22 A;  3WAF A;  1M5D A;  3T9V A;  2V3T A;  1B5J A;  3PUV E;  5H8Q A;  3RTW B;  3CSG A;  1A99 A;  2XX7 A;  1B3H A;  2DXY A;  5AA4 B;  1IIW A;  4AB6 A;  2H25 A;  3GBB A;  3ONM A;  2YPN A;  3TUS A;  3Q28 A;  2UVI A;  5I2K A;  3PUX E;  3I6V A;  2Z8F A;  2DXR A;  3SES A;  2XXP A;  5JTY A;  4O3B A;  1M5B A;  4JSO A;  4ECF A;  5KZT A;  2UVH A;  4OHN A;  1TFD A;  2DE4 A;  5H8N A;  3N94 A;  4H0W A;  2QL3 A;  1M5F A;  4TLL B;  1SW4 A;  3RN8 A;  1TFA A;  2XHD A;  2R9J A;  1PC3 A;  3FVG A;  5A5X A;  1URG A;  3TPA A;  4LON B;  4BDO A;  2O69 A;  4I9D A;  2UVJ A;  4QRZ A;  5CMC A;  1UIV A;  3ZS6 A;  1ZMG A;  1US4 A;  3SEV A;  3SER A;  1EZ9 A;  1NL5 A;  1YCJ A;  3C33 A;  3USD A;  4KCC A;  5HPQ A;  4ZEC A;  2UXA A;  4GOT A;  2PT1 A;  1MQH A;  3JZJ A;  2CMO A;  1IUD A;  3TQW A;  5CI5 A;  3VDF A;  1SD3 A;  1SI1 A;  2O84 X;  2I58 A;  3C35 A;  1B5H A;  1H43 A;  2XXX A;  3BBR A;  2P2A A;  2H5Y A;  4YB7 A;  1MDQ A;  1N0T A;  3H03 A;  4UA8 A;  3M3K A;  1UTB A;  4F31 B;  4EDP A;  3EN3 A;  4ZEK A;  5I56 A;  4DE8 A;  2A5T A;  1OQH A;  3OSQ A;  1B0L A;  3PMW A;  2Y7I A;  4OFO A;  1POY 1;  4PET A;  3W15 C;  2OBG A;  4WED A;  1Y20 A;  1AL3 A;  3MZ1 A;  3R26 A;  3TKD A;  3QSL A;  4NF8 A;  4QSE A;  3UGW A;  4ELR A;  5ITP A;  1MXZ A;  1URS A;  3EHU A;  1MPB A;  3TYH A;  1EZP A;  3KSX A;  2HQ0 A;  1NNT A;  1SW2 A;  2QJE A;  4EXK A;  1WVJ A;  3M8U A;  2ESN A;  1JVX A;  5FTH A;  3KJT A;  2PYY A;  3VLU A;  3IR1 A;  1FW0 A;  3S9N C;  4OTE A;  2FNC A;  2IA4 A;  3O6H A;  3S2V A;  1A54 A;  4JBZ A;  5HM4 B;  1TXF A;  1FTJ A;  5I58 A;  3JV9 A;  5B7D A;  4ZZE A;  2YJP A;  3SEX A;  2DYX A;  2F5X A;  1B7H A;  2DWH A;  2Q9T A;  4K3F A;  5IAI A;  4IGT A;  4R6Y A;  4RK9 A;  3MPL A;  1T0K A;  1N3X A;  1F9B A;  4O3C A;  4FAT A;  4FJP A;  5I59 B;  4XKQ A;  1WOD A;  2RIN A;  4G8M A;  3OEL A;  3RQT A;  1DTG A;  3MJN A;  4NF5 A;  5AA2 B;  3UN6 A;  3U92 A;  1MQJ A;  1US5 A;  3THI A;  4U1O A;  3FGS A;  1ZKB A;  4DCX A;  4IO7 A;  2D5W A;  5I2N A;  3C9H A;  4ZE8 A;  3VFJ A;  1LLS A;  2XX9 A;  3QUJ A;  2BJJ X;  3TDJ A;  3CFX A;  1M5E A;  4R6K A;  5JK4 A;  4KD5 A;  4QFP A;  2PVU A;  1XHY A;  3CI8 A;  3LUY A;  4IO3 A;  3OEM A;  4ZEF A;  1TT1 A;  1VFD A;  1QKB A;  3HN0 A;  2F8D A;  3O6I A;  2H98 A;  1YPN A;  1LFH A;  3TEL A;  4XIG Q;  4LVQ A;  1MY1 A;  1B3G A;  3IOW A;  4RYA A;  1ZU0 A;  2XXV A;  1XVX A;  1I6A A;  5H8F A;  3O97 A;  4M1V A;  4F1V A;  2O1M A;  3GXA A;  4RY1 A;  1A40 A;  3JYR A;  3OXN A;  4ZEB A;  1GV8 A;  4OYV A;  3LC8 A;  2VOZ A;  4EF1 A;  3ECR A;  4ZS9 A;  3V89 B;  3I3V A;  3K1M A;  1JVY A;  4XKR A;  3FXU A;  5EHS A;  2PMS A;  3UK4 A;  4F2O A;  1DPP A;  4G8N A;  1XS5 A;  5DEX A;  3O2A A;  1H76 A;  2DVC A;  1N76 A;  3MVZ A;  3N6U A;  1VR5 A;  2QSX A;  2O7U A;  3KN7 A;  3LSX A;  4YB6 A;  1J1N A;  4RXL A;  4HS7 A;  1OQG A;  4M4G A;  4FOR A;  3N6T A;  1ZJL A;  2GRV A;  4XKP A;  1PB7 A;  2HZL A;  4GLI A;  5AA4 A;  3IX1 A;  3HPI A;  3C36 A;  5H8H B;  4ELO A;  5K2X A;  1O64 A;  5DVF A;  3VVF A;  1R9L A;  3LR1 A;  3TAJ A;  1USY H;  2R6G E;  3TTK A;  3DP4 A;  4HTG A;  2QMX A;  2REG A;  4X48 A;  2AL5 A;  3IOR A;  2RCA A;  1NNF A;  1LCF A;  4IB2 A;  2HFB A;  3RY3 A;  1RYX A;  1PB9 A;  1HSL A;  4QFL A;  1QJM A;  3FVO A;  2B3F A;  2XX8 A;  3M3L A;  1ZTY A;  3H6W A;  5I57 B;  5KCJ A;  3FZV A;  4F2Q A;  1FQA A;  3K1P A;  3VXB A;  2NWJ A;  4G68 B;  3ZKK A;  1QKA A;  4OET A;  4DXU A;  1VE4 A;  4ESX A;  2G93 A;  3PD8 A;  2V25 A;  5FHN A;  2Y7K A;  2ALU A;  3H3G A;  3IK6 B;  1B9J A;  4DZ1 A;  2F35 A;  4JDF A;  4ESW A;  4MLV A;  1N3W A;  3KG2 A;  3FAS A;  1LST A;  5IKB A;  3OSR A;  3VVE A;  2O7I A;  4QHQ A;  3MW0 A;  1I6B A;  3DLN A;  4QF9 A;  1JW4 A;  5AA1 A;  3G3K A;  4EXL A;  5K2Y A;  2HAU A;  5ITO A;  4F3G A;  1B32 A;  3TOD A;  3IO4 A;  4F1U A;  1LFI A;  5LOM A;  1DPE A;  2DE2 A;  1SYI A;  3EF7 A;  1MRP A;  3UIF A;  1B1H A;  1AIV A;  4LZ5 A;  3V83 A;  1RYO A;  2ZMB A;  2NUV A;  4GXA A;  2Q89 A;  4QSD A;  1Y3N A;  1R6Z A;  4EQ7 A;  1Y1M A;  2Q88 A;  2DP8 A;  3E4R A;  2Y7P A;  1NKX A;  2AIX A;  1Y4C A;  2O68 A;  1FTO A;  1AH5 A;  1BIY A;  3DEL B;  4NED A;  1LB9 A;  2F36 A;  4E0X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...