4LATA

Crystal structure of phosphate abc transporter, periplasmic phosphate-binding protein psts 1 (pbp1) from streptococcus pneumoniae canada mdr_19a in complex with phosphate
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
260
structure length
260
Chain Sequence
ESITAVGSTALQPLVEVAADEFGTIHVGKTVNVQGGGSGTGLSQVQSGAVDIGNSDVFAEEKDGIDASALVDHKVAVAGLALIVNKEVDVDNLTTEQLRQIFIGEVTNWKEVGGKDLPISVINRAAGSGSRATFDTVIMEGQSAMQSQEQDSNGAVKSIVSKSPGAISYLSLTYIDDSVKSMKLNGYDLSPENISSNNWPLWSYEHMYTLGQPNELAAEFLNFVLSDETQEGIVKGLKYIPIKEMKVEKDAAGTVTVLEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Phosphate-binding protein PstS 1
publication title Crystal structure of phosphate ABC transporter, periplasmic phosphate-binding protein PstS 1 (PBP1) from Streptococcus pneumoniae Canada MDR_19A in complex with phosphate
rcsb
source organism Streptococcus pneumoniae
total genus 87
structure length 260
sequence length 260
ec nomenclature
pdb deposition date 2013-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4latA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4latA02
5I58A 3TQWA 4LP2B 5H8SA 5ICQA 4QSEA 3K01A 2D3IA 2YJPA 5AA4B 5HM4B 1IXCA 4ELRA 1R1NA 2UVJA 4RYAA 3MJNA 3MP1A 2FNCA 2XX9A 2AL5A 1MRPA 1UQWA 1MS7A 4QRZA 3SDFA 1S9TA 4RXLA 2ZYOA 3KSXA 3L6GA 1LB8A 1MPDA 3CFXA 1EH3A 5B70A 1MQJA 4RNSA 4XKRA 1B7HA 4F1VA 3FGSA 3K6XA 2WKYA 3QXMA 4YKJA 3KBRA 1LAGE 4HCYA 3UORA 4LA9A 3RTFB 2Q89A 4FAJA 1GR2A 3OD7A 1D9YA 3CVGA 1D4NA 2I6EA 3SKPA 3IJXB 2H5YA 3DM0A 4EQ7A 1UIVA 3TAJA 4ELQA 3VVFA 3PMVA 3C31A 1PB7A 3PPNA 5H8FA 4PFTA 2PT1A 4KHZE 2GHBA 3MZBA 2F6GA 4YKPA 4ZECA 2Q2AA 3GBBA 1B6HA 4NF4B 2O6AA 1JVYA 3W9WA 4U23A 4PP0A 5TPAA 3UA8A 1VE4A 4F19A 3EF7A 5L9OA 4I1DA 1JW1A 4EDPA 4H8IA 5JTYB 4X9TA 4OMBA 3O9PA 5F1QA 2DXRA 4DE8A 2B65A 3OMBA 4ESXA 3RGYA 4AB5A 2NUVA 3EHUA 3I6VA 4OETA 1LAFE 4POWA 2PMSA 4JSDA 3N94A 4JWYA 5CRYA 1Q1KA 2O7UA 1T0KA 4HTGA 3PUYE 3TCFA 1MXZA 4U4XA 4DXBA 1N3WA 1XS5A 1R6ZA 4ZE9A 3QUFA 3TODA 2QMWA 2UXAA 5CBRA 4TQUQ 4IO6A 3T9UA 1B58A 1WDNA 2OZZA 1Y1ZA 4U1OA 1JW5A 1QUIA 4IO4A 3MZ9A 2DVZA 3CG3A 1R9QA 5I2KA 4NF8A 3EHTA 2DWJA 1CE2A 3BBRA 3OSQA 2VP1A 1B1HA 2Y7IA 1LSTA 1B5JA 4I62A 1ATGA 4KYEA 4X48A 1B7ZA 2O69A 1DTGA 3S9NC 4G8NA 3K1MA 4LONB 2DOJA 3H3GA 3H4ZA 1DPEA 3B7DA 1IQ7A 1VFEA 2F7CA 4GFRA 1FTJA 3ECRA 1PB9A 2Q9TA 3QK6A 1LBCA 1IXIA 4GIZA 3N5LA 4Q8RA 1MQIA 3FASA 2ZYKA 3H03A 4FEBA 2ZNSA 1SYIA 3LSWA 1FQBA 2O1MA 3ONMA 4R73A 3KZGA 4EQ9A 3VLVA 5FHMA 3KN8A 2V93A 3JV9A 3T9HB 3SETA 4NMYA 2B3BA 1WVJA 4N07A 1P1UA 1JW4A 3G3KA 2X7PA 2ZYNA 1O63A 5ISUA 1I6QA 5EYFA 1MY0A 1IXGA 4XKNA 2OBGA 1B2HA 1MQHA 3FIRA 1A54A 3R26A 4NE4A 3IO4A 5IAIA 4OENA 4E0WA 4MF3A 5DVJA 3KSJA 1ZLQA 4M1VA 4G8MA 4ZEBA 4OZ9A 1MDQA 2I3WA 1QUKA 2Q88A 1BIYA 4U21A 3PMWA 1PB8A 3BKIB 4QHQA 4KYDA 3E9XA 2V3QA 3OO8A 5FTHA 1KWHA 4YKIA 4IY5A 1YTVA 2HZKA 4IO2A 2XXPA 2ONSA 4GL8A 5LOMA 2HAUA 2XXUA 1M5EA 2I0CA 5CMKA 5TP9A 2F6PA 1JQFA 2ZNTA 3VVDA 3FV2A 3Q26A 2QRYA 4O3CA 3HPIA 3EHSA 2VGQA 5A5XB 1ZIUA 3R7XA 1IEJA 4JB7A 4ESWA 3RT6B 5J1DA 4KYSA 2PT2A 5I59B 4NF5A 4G68A 3Q29A 4NEDA 2F5XA 4NF6A 4XKPA 4E0XA 2XXYA 2I4CA 3C9HA 1B5IA 1Y3NA 1RKMA 1B0LA 1B3EA 4L17A 5H8QA 3TTMA 3C34A 1VFDA 3IK6B 4G77A 1N76A 5CC2A 1GV8A 3PUVE 4YB7A 4BDNA 1QULA 1S7YA 4P11A 4OFOA 5CMCA 4X1BA 5AA3A 5KCJB 3U94A 3Q25A 1H76A 4F18A 4R6KA 4GF8A 3G3IA 3TTKA 2AYSA 4OEUA 3TUSA 5KDTB 3IAZA 4R9FA 1BP5A 1Y1MA 1UTBA 2O84X 1N84A 3EN3A 2HQ0A 3F11A 5EHSA 4Q5TA 5AE4A 3GLBA 1H45A 1SI1A 1TFDA 4AQ4A 4IB2A 1SYHA 4R72A 4PFUA 1RYOA 3V83A 3DP4A 1FTMA 2ZXTA 5I57B 3JZJA 2DS9A 2V3TA 3CSBA 3IR1A 1NH7A 2HFBA 2YLNA 2OLBA 1LFHA 2XX8A 4ZEIA 3IJOB 3EQ1A 3U93A 2XXTA 1QKBA 3MP8A 1MXYA 1RYXA 1A99A 4F1UA 3ZSFA 4FJPA 1TT1A 4F2OA 1NKXA 4ZDMA 1ZBMA 2CMOA 3TELA 1MQGA 4YB5A 1FTOA 3VE1B 2UVGA 2RF1A 1M5DA 1N04A 3V8XB 3PMXA 3OO9A 3DELB 1NMUA 2YPNA 3HO7A 2RC8A 1LFIA 3L6HA 1B05A 4LVQA 1EZPA 3GXAA 5DTBA 2DWAA 2KLFA 1QW0A 3MVZA 4MLQA 3B6WA 4K3FA 2CZLA 3TDJA 3K2DA 4BDLA 4HCWA 4RK9A 1MPCA 3PUXE 5KZTA 3OO7A 4G4PA 4OFJA 4DIGA 4R2FA 3HV1A 1DPPA 1AMFA 1H43A 3MQ9A 3OELA 1BLFA 1AL3A 2V25A 4ZEDA 4Q30B 1JNFA 3TCHA 5AA2B 3LSFB 4FE8A 1XHYA 2F34A 1WODA 2DP8A 3ZKLA 1IITA 4KPTA 4WKMA 3FXRA 3FVOA 3O29A 4X1DA 4IGRA 3MVXA 2DE3A 3RPWA 1MQDA 4ONYA 4IO3A 3QYTA 4EF1A 3HSTA 1P1OA 1US5A 1LAXA 3H6UA 5I58B 2HZLA 2ONRA 1B46A 3MP6A 5AA1A 4I9DA 3TTNA 1LLSA 3K00A 1A55A 3FZVA 3VLUA 4WXJA 3ILTB 4NWDA 4Z0IA 3D4CA 2PBWA 1P1WA 1MDP1 3B6TA 1URDA 2LAOA 4EQBA 1LCTA 2IEEA 4RPOA 3IOTA 4F2QA 5H8NA 3FVGA 2Z8DA 1N0TA 2QS3A 3IORA 2VHAA 2O7IA 1A40A 1FQEA 3QUJA 2HEUA 2ONKE 2VD3A 3G3GA 5L8DA 1B4HA 2XXIA 1A8EA 2UYFA 3IOWA 3W9VA 5H8HA 1MXVA 4JSOA 2O51A 1M5FA 2XHDA 3KOSA 4LQ2A 4LZ7A 4QFNA 4PFYA 4LUBA 5H8FB 1Z7ME 1YPNA 4GQOA 2DWIA 3H6VA 2Q2CA 2OWTA 2RC7A 3G3HA 3LUYA 1PBQA 4MLVA 1USYE 5I84A 2H25A 4ECFA 1B3FA 4GD5A 1MG1A 1OVBA 4H65A 3S2VA 1FQCA 4F31B 2DYXA 1D9VA 1Z7NE 5FHNA 3OSRA 3FXUA 3H7MA 5ELVA 5ICTA 4H8JA 2I49A 4OEVA 3E4RA 1NNFA 3SEXA 4POXA 5HBCA 1Y9UA 1QVSA 2XXHA 4C0RA 1TFAA 2FYIA 4ELPA 1MM6A 3OENA 3G7WA 2ANJA 2ALUA 1H44A 4GXSB 1B5HA 4C1TA 1URGA 2D5WA 3RQTA 3HHGA 4QSDA 2A5TB 3O66A 2XXQA 5TU0A 3RNNA 5I56A 4I8CA 2GH9A 4U22A 3DP6A 3CIJA 1XT8A 1ZTYA 5I2KB 1SI0A 4R2BA 3TZAA 4NF8B 3I5OA 4F3PA 2UYEA 4OWDA 3Q27A 4DLDA 4GWOA 3U92A 4YB6A 2HCAA 3UP9A 3LC8A 2OCUA 3PPPA 1NNTA 3T96B 1B51A 2H9BA 3UGWA 4F3SA 4BDRA 4H5FA 5I2NA 1AOVA 2AIXA 5CBSA 3RUMA 1IUDA 4TLLB 1LCFA 2F8DA 3DLNA 3THIA 1MXWA 4GOTA 1ANFA 2XXXA 1SQYA 4JDFA 3RY3A 2O68A 3N26A 1MY2A 1NL5A 1VR5A 2XXWA 2XD2A 1MXUA 1DTZA 3TCGA 3TQLA 4YAHX 3CG1A 2NXOA 4O3BA 5DEXB 1LBBA 2RCBA 3SEUA 1O64A 5FHOA 3K02A 3VV5A 1JEUA 3TMGA 4PFWA 4G2ZA 1S50A 3IB2A 1N7WA 4LQ5A 3IX1A 4QFPA 3VLWA 4N6PA 2NVUB 4H67A 5DVFA 3FD3A 2QSXA 5L9SA 1H3DA 3FATA 3RT8A 3N6UA 3MVYA 4F3BA 3O28A 5CMMA 4ZEKA 4FECA 3G3FA 2Z8EA 1JETA 2PYYA 3R6UA 2BJJX 2I58A 3K6UA 3QSLA 3CFZA 1SDXA 2X26A 3ZS6A 4IGTA 5AA2D 3C4MA 4PE5B 4O3AA 5AA4A 2DWHA 3U8QA 2PX1A 3K1NA 5CM6A 3UIFA 3CFLA 2ZYMA 3KN3A 4QFLA 5TP9B 2W7YA 3LBSA 3MVWA 3P7IA 4OFLA 2REJA 4XIGQ 1OQHA 3IOVA 1OLAA 4EUOA 5DT6A 3U72A 3KOTA 4OVJA 4JBZA 5IKBA 3T22A 1YAEA 2DXYA 3OXNA 2XD3A 3M3FA 3EPEA 3K6VA 4G68B 4U2RA 4YKKA 4OERA 1OLCA 2A5SA 4G68C 2F35A 3CI8A 3WAEA 2QS2A 3B6QA 4ZZEA 1B3HA 5JK4A 5H8QB 2RCAA 4AB6A 1NNPA 1SD3A 4OXVA 3SERA 2XX7A 1A7LA 1QJMA 4Z7EA 4F1YA 4GVOA 1J1NA 4H0WA 2I3VA 1ELJA 2DE4A 1B4ZA 2Y7RA 4UACA 2P0SA 1B3GA 5ITPA 1SBPA 4N13A 2FA7A 2V84A 1OMPA 3VXBA 1DMBA 4WEDA 1UTBB 1SVXB 3CSGA 1II5A 4NF4A 4TLMB 4ZEFA 1POTA 3IL1B 1BKAA 1EZ9A 3SEYA 3AXFA 2ABHA 1SW4A 2NWJA 3A09A 1UTHB 2DVCA 5JTYA 4Q0CA 2M8CA 1MY1A 1UIUA 4GRKA 3W15C 2RINA 3ODBA 4KD5A 2Y7PA 3M3KA 2H98A 1CB6A 3C33A 3PUWE 2HXWA 3HCQA 4YMBA 4JWOA 4RJZA 1IIWA 3S9LC 1Y3PA 3CR9A 4GXAA 4P0GA 1JEVA 3MAMA 1XVYA 3VDFA 1EZOA 3TTLA 4PQJA 4U1ZA 4DCXA 3M3LA 4EXKA 3E13X 2F36A 4DCYA 2G29A 1Y20A 3OEKA 1MXXA 2QL3A 1B9JA 2Y7WA 1ZMGA 3KJTA 5DYHA 2G93A 2I0BA 4R75A 1B52A 1MH3A 3D4GA 3PD9A 2VOZA 2ZMBA 4BLAA 2QS4A 2ZNUA 5K2YA 3ILUB 2IA4A 3H6TA 4JWXA 4ZE8A 4DXUA 1HSEA 3SESA 3VFJA 2E1SA 3A3CA 3FJGA 3GZGA 3LSXA 3SEVA 4PETA 3JYRA 3IOUA 3LSLA 4QF9A 1MY4A 3N6TA 2P2AA 3UN6A 4IO5A 1SW5A 3HHFA 3H06B 2Z22A 1LFGA 4IO7A 3MWBA 1JVXA 3I3VA 4R74A 4LZ8A 1FTKA 1M5CA 3GBAA 2D21A 3T66A 4EF2A 1EU8A 3USDA 3CRBA 5EHMA 1L5TA 3Q28A 1FCKA 1AH5A 3FVKA 3K0VA 3S9MC 3C35A 2R71A 1B40A 1ZJLA 1PBPA 3TPAA 1FQFA 1B3LA 3OOAA 4MFIA 4ZZAA 3TTRA 5ITOA 1URSA 2RC9A 4NTLA 4RA1A 4FATA 2A5TA 2QS1A 4NWCA 4ND9A 3IB0A 3KFMA 3FVNA 3HN0A 4UA8A 4GLIA 3PPQA 2AL4A 3LR1A 5B7DA 5TPAB 3RLFE 1M5BA 4U4SA 1YCJA 3FJ7A 3OEMA 3UK4A 2REGA 2HAVA 4R6HA 4H1XA 3K1PA 3PGFA 4EXLA 1LGBC 2GHAA 4F39A 2GFEA 1A8FA 3IB1A 4LZ5A 4M4GA 3S9EA 3S4UA 5H8NB 4KR5A 4OESA 3RN8A 3T9VA 5L9MA 5BWJA 1N3XA 1VSOA 2X7QA 1XOCA 1Q35A 2Q8JA 3U1OA 4R9GA 1GVCA 4XTCQ 4OHNA 1OQGA 1IZ1A 3O6HA 3PV0E 5H8HB 5JEIA 5A5XA 3SEWA 3IO6A 5F7VA 3RTWB 1OIBA 3A3UA 2F7AA 1Y3QA 3BFUA 5DEXA 4RPNA 1FQAA 5I59A 3TEPA 5K2XA 2DSFA 2RKMA 4JXIA 3E3KA 4BDQA 1FQDA 1US4A 2I48A 4HS7A 1AIVA 4OYVA 2P1SA 1FTLA 4MBPA 1B32A 1Y4TA 4FEDA 2DE2A 2OJTA 3KGCA 2Z8FA 4R6YA 4DZ1A 2F7BA 4BDMA 1NH8A 3T9XB 1TWYA 2DQVA 2H4IA 3MZ1A 4F22A 3G3JA 3KEIA 4QFOA 4QSCA 1LAHE 3QAXA 1FW0A 1GTKA 5KCJA 3QIMA 4LATA 3VXCA 3V89B 2Y7KA 1P1QA 1ZKBA 2XXRA 1OVTA 4KCCA 5KDTA 3H6WA 3O97A 4FORA 4P0IA 3T93B 1SW1A 3KJ7A 1ZU0A 3ZKKA 4ZS9A 4YU0A 3MPKA 1DOTA 1Y4CA 4GL0A 2PVUA 4YMAA 1P99A 1DSNA 3C36A 3PPRA 2QPQA 1MH4A 2H99A 2R6GE 1GGGA 1PDAA 2OWSA 2UVIA 4G8HA 2UVHA 2NOOA 3BFTA 4YZZA 4DDDA 4XXUA 4IY6A 5BUUA 5I57A 2V3UA 4ELOA 1F9BA 1R9LA 5I56B 3PD8A 1N7XA 3MBPA 4F29A 3PU5A 1XVXA 1TXFA 2XXVA 3K4UA 1D3KA 1XC1A 2Y84A 4YICA 3V5AA 4RY1A 3FUZA 3PPOA 3O2AA 3FJMA 5M2VA 1NFTA 2Z23A 1P1NA 5I2NB 4MH5A 1POY1 2O1LA 2QMXA 1MM7A 3VVEA 4BDOA 3TYHA 1QKAA 2I4BA 3KG2A 1SW2A 1MPBA 4H6DA 2R9JA 5CI5A 3MUQA 5CMBA 1MY3A 3PUZE 2F78A 3MW0A 5FTIA 4TOZA 2B3FA 1UTHA 1O7TA 3FV1A 1LB9A 4OTEA 1IXHA 5DVIA 1I6AA 3FXQA 2OK2A 4NF5B 3MC2A 4F3GA 3M8UA 4ISUA 4XKQA 4THIA 4NF6B 1USYH 1B0HA 1PEBA 2GRVA 4WEPA 3MPLA 5AA2A 2QJEA 2F97A 4C1UA 1PC3A 5HPQA 3TFLA 4RK2A 4H5GA 4KI0E 1BTJA 1I6BA 4OQOA 4KCDA 4KFQA 4KQPA 2E0SA 1NNKA 3DP8A 1I69A 4HW8A 4FIMA 3K6WA 1B7UA 3O6GA 1B1XA 1HSLA 3WAFA 3TKDA 3C32A 3KN7A 2THIA 1QUJA 4QFKA 2ESNA 3O6IA 3OO6A 1HSJA 4DXCA 2VD2A
chains in the Genus database with same CATH superfamily
5I58A 4NF0A 3TQWA 4LP2B 5H8SA 5ICQA 4QSEA 3K01A 2D3IA 2YJPA 5AA4B 5HM4B 1IXCA 4ELRA 1R1NA 2UVJA 4RYAA 3MJNA 3MP1A 2FNCA 2XX9A 2AL5A 1MRPA 2PFZA 1UQWA 1MS7A 4QRZA 3SDFA 1S9TA 4RXLA 2ZYOA 3KSXA 1NV0A 3L6GA 1LBZA 1LB8A 1MPDA 3CFXA 1EH3A 5B70A 1MQJA 4RNSA 4XKRA 1B7HA 4F1VA 3FGSA 3K6XA 2WKYA 3QXMA 2QVUA 4HE2A 4YKJA 3FXBA 3KBRA 1LAGE 4HCYA 3UORA 4LA9A 3RTFB 4NAPA 2Q89A 4N91A 4FAJA 1GR2A 3OD7A 1D9YA 3CVGA 1D4NA 2I6EA 4PAKA 3SKPA 4PC9A 4PAIA 3IJXB 2H5YA 3KC1A 3DM0A 4EQ7A 1UIVA 3TAJA 4ELQA 4GWUA 2BJIA 3VVFA 3PMVA 3C31A 1PB7A 4DI4B 3PPNA 5H8FA 4PFTA 2L5VA 2PT1A 4KHZE 2GHBA 3ROJA 3MZBA 2F6GA 4YKPA 4ZECA 2Q2AA 3GBBA 2FIXA 1B6HA 4NF4B 2O6AA 1JVYA 3W9WA 4U23A 4PP0A 5TPAA 3UA8A 1VE4A 2FBPA 4F19A 3EF7A 5L9OA 4I1DA 4P56A 1JW1A 4EDPA 4H8IA 5JTYB 4X9TA 4OMBA 3O9PA 5F1QA 2DXRA 4DE8A 2B65A 3OMBA 4ESXA 1FPKA 4GBVA 3RGYA 4AB5A 2JJKA 2NUVA 1NV3A 3EHUA 1IMEA 1KA1A 3I6VA 1G0HA 4OETA 1LAFE 4POWA 2PMSA 4JSDA 2F3BA 3N94A 2VT5A 4JWYA 5CRYA 1Q1KA 2O7UA 1T0KA 4HTGA 1EYIA 3PUYE 3TCFA 1FPJA 1MXZA 4U4XA 4DXBA 1N3WA 1XS5A 3KBZA 1R6ZA 4ZE9A 3QUFA 3TODA 2QMWA 2UXAA 5CBRA 4TQUQ 4IO6A 3T9UA 1B58A 1BK4A 1WDNA 2OZZA 1Y1ZA 4U1OA 1JW5A 4N6DA 1QUIA 4IO4A 3MZ9A 1FPGA 2DVZA 3CG3A 1R9QA 5I2KA 3SZPA 4NF8A 4XFEA 3EHTA 2DWJA 1CE2A 3BBRA 1XI6A 3OSQA 2VP1A 4GWWA 1B1HA 2Y7IA 1LSTA 1B5JA 2PFYA 4I62A 1ATGA 4KYEA 4X48A 1B7ZA 2O69A 1DTGA 3S9NC 4G8NA 4UABA 3K1MA 4LONB 2DOJA 3H3GA 3H4ZA 5DW8A 1DPEA 3B7DA 1IQ7A 1VFEA 2F7CA 4GFRA 1FTJA 3ECRA 1PB9A 2Q9TA 3QK6A 4P8BA 1LBCA 1IXIA 4GIZA 3N5LA 4PAFA 4Q8RA 1MQIA 3BIHA 3FASA 2ZYKA 3H03A 5ET5A 4FEBA 2ZNSA 5EQAA 1SYIA 3LSWA 1FQBA 2O1MA 3ONMA 4R73A 3KZGA 4EQ9A 3VLVA 5FHMA 3KN8A 2V93A 3JV9A 3T9HB 3SETA 4NMYA 2B3BA 1WVJA 5LTCA 2KR0A 4N07A 1P1UA 1JW4A 3G3KA 2X7PA 2ZYNA 1O63A 5ISUA 2XWOA 1I6QA 5EYFA 1MY0A 1IXGA 4XKNA 2OBGA 1B2HA 2CZIA 1MQHA 3FIRA 1A54A 3R26A 4NE4A 3IO4A 5IAIA 4OENA 4E0WA 1NUZA 3PTYA 4MF3A 5DVJA 3KSJA 1ZLQA 4M1VA 2MKZA 4G8MA 3QMFA 4ZEBA 4OZ9A 1MDQA 2I3WA 1QUKA 2Q88A 3KC0A 1BIYA 4U21A 3PMWA 1PB8A 3BKIB 4QHQA 4KYDA 2OWZA 1RDXA 3E9XA 2V3QA 3OO8A 5FTHA 5J16A 1KWHA 4YKIA 4IY5A 1YTVA 4AS4A 4OANA 3B8BA 2HZKA 4PFBA 4IO2A 2XXPA 2Q8MA 2ONSA 4GL8A 5LOMA 2HAUA 2XXUA 1M5EA 2I0CA 5CMKA 5TP9A 4N81A 2F6PA 1JQFA 2ZNTA 1NUXA 3VVDA 2CZHA 3FV2A 3Q26A 2QRYA 4O3CA 3HPIA 3EHSA 4NN3A 5EQ9A 2VGQA 4OVSA 5A5XB 4I40A 1ZIUA 3R7XA 1IEJA 4JB7A 4ESWA 3RT6B 5J1DA 4KYSA 2PT2A 5F24A 5I59B 4PFRA 4NF5A 4G68A 3Q29A 4NEDA 2QVRA 1FJ6A 2F5XA 4NF6A 4XKPA 4P1LA 4NHBA 4E0XA 2XXYA 2I4CA 3C9HA 1B5IA 1Y3NA 1RKMA 1B0LA 1B3EA 4L17A 1QGXA 5H8QA 3TTMA 2V4CA 3C34A 1VFDA 3IK6B 4G77A 1N76A 5CC2A 1GV8A 3PUVE 4YB7A 4BDNA 1QULA 4DI3D 4PDHA 1S7YA 5I7IA 4P11A 4OFOA 5CMCA 1NI9A 4X1BA 5AA3A 5KCJB 3U94A 4PDDA 4PF6A 3Q25A 1H76A 4F18A 4R6KA 4GF8A 3G3IA 3TTKA 2AYSA 4OEUA 3TUSA 5KDTB 3IAZA 4R9FA 1BP5A 1Y1MA 1UTBA 2O84X 1N84A 3EN3A 2HQ0A 3F11A 5EHSA 4Q5TA 4N17A 1NUWA 3RPLA 4H46A 5AE4A 3GLBA 1H45A 4JVIA 1K9YA 1SI1A 1TFDA 4AQ4A 4N15A 4IB2A 1SYHA 4R72A 4PFUA 1RYOA 1FSAA 3D1RA 3V83A 2CEXA 3DP4A 1FTMA 2ZXTA 5I57B 3JZJA 2DS9A 3GYYA 2V3TA 3CSBA 3IR1A 1NH7A 1FBGA 2HFBA 2YLNA 2OLBA 1LFHA 2XX8A 4ZEIA 3IJOB 3EQ1A 3U93A 2XXTA 1QKBA 3MP8A 1MXYA 1LBWA 1RYXA 1A99A 4F1UA 3ZSFA 4FJPA 4OVQA 1TT1A 4F2OA 1NKXA 1NV2A 4ZDMA 1ZBMA 4MAGA 2CMOA 3TELA 1MQGA 4YB5A 4PFIA 4MNPA 1RDZA 1FTOA 2WYKA 3VE1B 2UVGA 4I3EA 2RF1A 1M5DA 1N04A 3V8XB 3PMXA 3OO9A 1KZ8A 4MIJA 3DELB 1NMUA 2YPNA 1NV5A 3HO7A 2RC8A 3FBPA 1FBHA 4GX4A 1LFIA 3L6HA 1B05A 4LVQA 1EZPA 5T3JA 5ESYA 3GXAA 2DWAA 2KLFA 3MVZA 1QW0A 4MLQA 5DTBA 3B6WA 4K3FA 2CZLA 3TDJA 5FBPA 3K2DA 4BDLA 4HCWA 4RK9A 1MPCA 3PUXE 5KZTA 3OO7A 4G4PA 4OFJA 4DIGA 4R2FA 1INPA 3HV1A 1AMFA 1DPPA 1H43A 3MQ9A 3OELA 1BLFA 1AL3A 3RYDA 2V25A 2Q74A 4ZEDA 4Q30B 1JNFA 3TCHA 5AA2B 3LSFB 4FE8A 1XHYA 2F34A 1WODA 2DP8A 4G61A 1Q9DA 3ZKLA 1SPIA 1IITA 4KPTA 4WKMA 3FXRA 3FVOA 3O29A 4X1DA 3EKIA 4IGRA 3MVXA 2DE3A 3RPWA 1MQDA 4ONYA 4IO3A 3QYTA 2WYPA 4EF1A 3HSTA 1P1OA 1US5A 1LAXA 3H6UA 5I58B 2HZLA 2ONRA 1B46A 3MP6A 5AA1A 4I9DA 3TTNA 1LLSA 2B4LA 3K00A 1A55A 3FZVA 3VLUA 4WXJA 3ILTB 5I3SA 4NWDA 4Z0IA 3D4CA 2PBWA 1P1WA 1MDP1 3B6TA 4XF5A 1URDA 4OVTA 2LAOA 4EQBA 1LCTA 2IEEA 4RPOA 4PGPA 3IOTA 4F2QA 5H8NA 3FVGA 2Z8DA 5LDZA 1N0TA 2QS3A 3IORA 2VHAA 2O7IA 1A40A 1FQEA 3QUJA 4QBAA 2HEUA 2ONKE 2VD3A 3G3GA 5L8DA 1B4HA 2XXIA 1A8EA 2UYFA 3IOWA 3A29A 3U65A 2P3VA 3W9VA 5H8HA 1IMAA 1IMDA 1MXVA 4O8MA 4JSOA 1VDWA 2O51A 1M5FA 2XHDA 3KOSA 4LQ2A 4LZ7A 4QFNA 4PFYA 2FVZA 4LUBA 1LBYA 1K9ZA 5H8FB 4JVCA 1Z7ME 1YPNA 4GQOA 5ET6A 2DWIA 3H6VA 2Q2CA 1KA0A 2OWTA 2RC7A 3G3HA 3LUYA 1PBQA 4MLVA 1USYE 5I84A 2H25A 4GWSA 4ECFA 1B3FA 4GD5A 1MG1A 1OVBA 4H65A 3S2VA 1LBXA 2CZKA 1FQCA 4F31B 2DYXA 1D9VA 1Z7NE 5FHNA 4LN5A 3OSRA 3FXUA 1NV7A 3H7MA 5ELVA 5ICTA 4H8JA 2I49A 2Y5KA 4OEVA 3E4RA 1NNFA 1YYZA 3SEXA 4POXA 5HBCA 1D9QA 1Y9UA 1QVSA 4GWZA 2XXHA 4C0RA 1DBZA 1TFAA 2FYIA 4ELPA 1MM6A 3OENA 3G7WA 2ANJA 2ALUA 1H44A 4PF8A 4GXSB 1B5HA 4C1TA 1URGA 2D5WA 3RQTA 3HHGA 3T1BA 4QSDA 2A5TB 2FIEA 3O66A 2XXQA 5TU0A 1FBDA 3RNNA 5I56A 4I8CA 2GH9A 4U22A 3DP6A 3CIJA 4PBQA 1XT8A 1ZTYA 5I2KB 1SI0A 3BIGA 4N4UA 4R2BA 3TZAA 1G0IA 4NF8B 3I5OA 4F3PA 2UYEA 4OWDA 3Q27A 3MSTA 4DLDA 1FBPA 4GWOA 3U92A 4YB6A 2HCAA 1NV6A 3UP9A 3LC8A 2OCUA 3PPPA 5I5PA 1NNTA 2CEYA 3T96B 1B51A 2H9BA 3UGWA 4F3SA 4BDRA 4H5FA 4X8RA 5I2NA 1AOVA 1DCUA 2AIXA 5CBSA 3RUMA 1IUDA 4TLLB 1LCFA 2F8DA 3DLNA 3THIA 1MXWA 4GOTA 1ANFA 2XXXA 1SQYA 4GX6A 4JDFA 3RY3A 2O68A 3N26A 1MY2A 1NL5A 1VR5A 2XXWA 2XD2A 1MXUA 1DTZA 3TCGA 3TQLA 4YAHX 3CG1A 2NXOA 4O3BA 5DEXB 1LBBA 2RCBA 3SEUA 1O64A 5FHOA 3K02A 3VV5A 1JEUA 5EYGA 3TMGA 4PFWA 4PTKA 4G2ZA 4PGNA 1S50A 3IB2A 1N7WA 4LQ5A 1DK4A 3IX1A 4QFPA 3VLWA 4N6PA 2NVUB 4H67A 5DVFA 3FD3A 5ET7A 2QSXA 2KQZA 5L9SA 1H3DA 3FATA 3RT8A 3N6UA 5IZ3A 3E78A 3MVYA 4N8YA 4F3BA 3O28A 5CMMA 1YZ0A 4ZEKA 5EYHA 4FECA 3G3FA 2Z8EA 1JETA 2PYYA 3R6UA 2BJJX 2I58A 3K6UA 3QSLA 3CFZA 1SDXA 2X26A 3ZS6A 4I3YA 4IGTA 5AA2D 4HE1A 3C4MA 4PE5B 5IZ1A 4O3AA 5AA4A 2DWHA 2HXRA 3U8QA 2PX1A 3K1NA 5CM6A 3UIFA 3CFLA 2ZYMA 3KN3A 4QFLA 5TP9B 2W7YA 5IGAA 3LBSA 3MVWA 3P7IA 4OFLA 2REJA 4XIGQ 1OQHA 3IOVA 1OLAA 1FJ9A 4EUOA 5DT6A 3U72A 3KOTA 2XWIA 4OVJA 4JBZA 5IKBA 3LV0A 3T22A 1YAEA 2DXYA 3OXNA 2XD3A 3M3FA 3EPEA 3K6VA 2VPNA 4G68B 4U2RA 4YKKA 4OERA 1OLCA 2A5SA 4G68C 2F35A 4HE0A 2ZZWA 3CI8A 4OA4A 3WAEA 2QS2A 3B6QA 4ZZEA 1B3HA 5JK4A 5H8QB 2RCAA 4AB6A 1NNPA 1SD3A 4GX3A 4OXVA 3SERA 2XWVA 2XX7A 1A7LA 1QJMA 4Z7EA 4F1YA 1RDYA 4GVOA 4QXDA 1J1NA 4H0WA 2I3VA 1ELJA 2DE4A 1B4ZA 1FRPA 2Y7RA 4O94A 4UACA 2P0SA 1B3GA 5ITPA 1SBPA 4N13A 2FA7A 2V84A 1OMPA 4MNCA 3VXBA 1FPFA 1DMBA 4WEDA 1UTBB 1SVXB 3CSGA 1II5A 4NF4A 4TLMB 4ZEFA 1POTA 3IL1B 1BKAA 1EZ9A 3SEYA 3AXFA 2WX9A 2ABHA 1SW4A 2NWJA 3A09A 1UTHB 2DVCA 5JTYA 4Q0CA 2M8CA 1MY1A 1UIUA 3RPLB 4GRKA 3W15C 2RINA 3ODBA 4KD5A 2Y7PA 3M3KA 5ET8A 2H98A 1CB6A 3C33A 3PUWE 2HXWA 3HCQA 4YMBA 4JWOA 4RJZA 1IIWA 3S9LC 5IZZA 4NG7A 3IFCA 1Y3PA 3CR9A 4GXAA 4P0GA 1JEVA 2WBDA 1XVYA 3MAMA 3VDFA 1EZOA 3TTLA 4PQJA 4U1ZA 4DCXA 3M3LA 4EXKA 3E13X 2F36A 4IR8A 4DCYA 2G29A 1Y20A 2VPOA 3OEKA 1MXXA 2QL3A 3B50A 4MNIA 1B9JA 2R8TA 4P3LA 2Y7WA 1ZMGA 3KJTA 5DYHA 2G93A 2I0BA 4MX6A 4R75A 1B52A 1MH3A 1LEVA 3D4GA 3PD9A 2VOZA 2ZMBA 4BLAA 2QS4A 2ZNUA 5K2YA 3ILUB 2IA4A 3H6TA 4JWXA 4ZE8A 4DXUA 1IMCA 1HSEA 3SESA 3VFJA 3E79A 2E1SA 1NV1A 3A3CA 3FJGA 3GZGA 3LSXA 3SEVA 4PETA 4NGUA 4XEQA 3JYRA 3IOUA 3LSLA 4QF9A 1MY4A 3N6TA 2P2AA 2XA5A 4NX1A 3UN6A 4IO5A 1SW5A 3HHFA 3H06B 2Z22A 1LFGA 4IO7A 3MWBA 1JVXA 3I3VA 4R74A 4LZ8A 1FTKA 1M5CA 2WEFA 1JP4A 3GBAA 2D21A 3T66A 4EF2A 1EU8A 3USDA 3CRBA 5EHMA 1L5TA 3Q28A 1FCKA 1AH5A 3FVKA 1FPBA 3K0VA 3S9MC 4O7MA 3C35A 2R71A 4GWXA 1B40A 1ZJLA 1PBPA 1FQFA 3TPAA 1B3LA 3OOAA 4MFIA 4ZZAA 3TTRA 5ITOA 4MEVA 1URSA 2RC9A 2Y5LA 4NTLA 4RA1A 1FPLA 4FATA 2A5TA 2QS1A 4NWCA 5EQ8A 4ND9A 3IB0A 1IMFA 3CHGA 3KFMA 3FVNA 3HN0A 2QFLA 4PE3A 1CNQA 2PCRA 3T0JA 4UA8A 4GLIA 5EQ7A 4FBPA 2GQ1A 3PPQA 2AL4A 3LR1A 5B7DA 5TPAB 3RLFE 1M5BA 4U4SA 3IFAA 1YCJA 3FJ7A 3OEMA 2ZZVA 3UK4A 2REGA 2HAVA 4R6HA 4H1XA 4GBWA 3K1PA 3PGFA 2QVVA 4EXLA 1LGBC 4NQ8A 3ISPA 2GHAA 4F39A 1NV4A 2GFEA 4P9KA 1A8FA 3IB1A 4LZ5A 4M4GA 3S9EA 3S4UA 5H8NB 4KR5A 4OESA 3RN8A 3T9VA 4MJOA 5L9MA 2WBBA 2FHYA 5BWJA 1N3XA 1VSOA 2X7QA 1XOCA 5IM2A 1Q35A 2Q8JA 3U1OA 4R9GA 1GVCA 4PBHA 4XTCQ 4OHNA 1OQGA 4GWYA 1IZ1A 3O6HA 3PV0E 4H45A 5H8HB 5JEIA 4JVDA 5A5XA 3SEWA 3IO6A 5F7VA 3RTWB 1OIBA 3A3UA 2F7AA 1Y3QA 3BFUA 5DEXA 4RPNA 1FQAA 5I59A 3TEPA 2XWKA 5K2XA 2DSFA 2RKMA 4JXIA 2DDKA 3E3KA 4BDQA 1FQDA 1US4A 2I48A 4HS7A 1AIVA 4OYVA 2P1SA 1FTLA 4MBPA 2B4MA 1B32A 1Y4TA 4FEDA 2DE2A 2OJTA 1AWBA 3KGCA 2Z8FA 4R6YA 4DZ1A 4OVRA 2F7BA 4BDMA 1NH8A 3T9XB 1TWYA 2DQVA 2H4IA 3MZ1A 1LBVA 4F22A 3G3JA 3KEIA 4QFOA 4QSCA 1LAHE 3QAXA 1FW0A 1GTKA 4N6KA 5KCJA 3QIMA 4LATA 3VXCA 3V89B 2Y7KA 1P1QA 1ZKBA 2ZZXA 2XXRA 1OVTA 4KCCA 5KDTA 3H6WA 3O97A 4FORA 4P0IA 3T93B 1SW1A 3KJ7A 1ZU0A 3ZKKA 5A5LA 4ZS9A 4YU0A 1NUYA 3MPKA 1DOTA 1Y4CA 4GL0A 2PVUA 4MMPA 4YMAA 1P99A 4MCOA 1DSNA 2OX3A 4HXVA 3C36A 3PPRA 2QPQA 4KXPA 1MH4A 2H99A 2R6GE 1GGGA 1PDAA 2OWSA 1FTAA 2UVIA 4G8HA 2UVHA 2NOOA 3BFTA 4O7IA 4YZZA 4DDDA 4XXUA 1FBFA 2HPGA 4IY6A 1FPIA 5BUUA 5I57A 2V3UA 4ELOA 3LUZA 1F9BA 1R9LA 5I56B 1FBEA 3PD8A 1FPEA 4P1EA 4PCDA 1N7XA 3MBPA 4F29A 3PU5A 1XVXA 1TXFA 2XXVA 2F3DA 3K4UA 1D3KA 1XC1A 2Y84A 4N8GA 4YICA 4OVPA 3V5AA 4RY1A 3FUZA 3NOHA 1FBCA 3PPOA 3O2AA 2P3NA 3FJMA 5M2VA 1NFTA 2Z23A 1EYJA 1P1NA 5I2NB 4MH5A 1POY1 2O1LA 2QMXA 4AS5A 1MM7A 3VVEA 4BDOA 3TYHA 1QKAA 2I4BA 3KG2A 1SW2A 1MPBA 4H6DA 2R9JA 5CI5A 3MUQA 5CMBA 1MY3A 3PUZE 2F78A 3MW0A 5FTIA 4TOZA 2B3FA 1UTHA 1O7TA 3FV1A 1LB9A 1FPDA 3HFUA 4OTEA 1IXHA 5DVIA 1I6AA 3FXQA 2OK2A 4NF5B 3MC2A 4F3GA 3M8UA 4ISUA 4XKQA 4THIA 4NF6B 2XXKA 4P47A 1USYH 3MYUA 1B0HA 1PEBA 2GRVA 4WEPA 3MPLA 5AA2A 2QJEA 2F97A 4C1UA 1PC3A 5HPQA 3TFLA 1YXIA 2HHMA 4RK2A 4H5GA 4KI0E 1BTJA 1I6BA 4OQOA 4KCDA 4KFQA 4KQPA 1IMBA 2E0SA 5IZ3B 1NNKA 3DP8A 1I69A 4HW8A 4FIMA 3K6WA 1B7UA 3O6GA 1B1XA 4X04A 1HSLA 3WAFA 3TKDA 3C32A 3KN7A 2THIA 1QUJA 4QFKA 1EYKA 2ESNA 3O6IA 3OO6A 4MHFA 1HSJA 4DXCA 2VD2A
chains in the Genus database with same CATH topology
5I58A 3TQWA 4LP2B 5H8SA 5ICQA 4QSEA 3K01A 2D3IA 2YJPA 5AA4B 5HM4B 1IXCA 4ELRA 1R1NA 2UVJA 4RYAA 3MJNA 3MP1A 2FNCA 2XX9A 2AL5A 1MRPA 1UQWA 1MS7A 4QRZA 3SDFA 1S9TA 4RXLA 2ZYOA 3KSXA 3L6GA 1LB8A 1MPDA 3CFXA 1EH3A 5B70A 1MQJA 4RNSA 4XKRA 1B7HA 4F1VA 3FGSA 3K6XA 2WKYA 3QXMA 4YKJA 3KBRA 1LAGE 4HCYA 3UORA 4LA9A 3RTFB 2Q89A 4FAJA 1GR2A 3OD7A 1D9YA 3CVGA 1D4NA 2I6EA 3SKPA 3IJXB 2H5YA 3DM0A 4EQ7A 1UIVA 3TAJA 4ELQA 3VVFA 3PMVA 3C31A 1PB7A 3PPNA 5H8FA 4PFTA 2PT1A 4KHZE 2GHBA 3MZBA 2F6GA 4YKPA 4ZECA 2Q2AA 3GBBA 1B6HA 4NF4B 2O6AA 1JVYA 3W9WA 4U23A 4PP0A 5TPAA 3UA8A 1VE4A 4F19A 3EF7A 5L9OA 4I1DA 1JW1A 4EDPA 4H8IA 5JTYB 4X9TA 4OMBA 3O9PA 5F1QA 2DXRA 4DE8A 2B65A 3OMBA 4ESXA 3RGYA 4AB5A 2NUVA 3EHUA 3I6VA 4OETA 1LAFE 4POWA 2PMSA 4JSDA 3N94A 4JWYA 5CRYA 1Q1KA 2O7UA 1T0KA 4HTGA 3PUYE 3TCFA 1MXZA 4U4XA 4DXBA 1N3WA 1XS5A 1R6ZA 4ZE9A 3QUFA 3TODA 2QMWA 2UXAA 5CBRA 4TQUQ 4IO6A 3T9UA 1B58A 1WDNA 2OZZA 1Y1ZA 4U1OA 1JW5A 1QUIA 4IO4A 3MZ9A 2DVZA 3CG3A 1R9QA 5I2KA 4NF8A 3EHTA 2DWJA 1CE2A 3BBRA 3OSQA 2VP1A 1B1HA 2Y7IA 1LSTA 1B5JA 4I62A 1ATGA 4KYEA 4X48A 1B7ZA 2O69A 1DTGA 3S9NC 4G8NA 3K1MA 4LONB 2DOJA 3H3GA 3H4ZA 1DPEA 3B7DA 1IQ7A 1VFEA 2F7CA 4GFRA 1FTJA 3ECRA 1PB9A 2Q9TA 3QK6A 1LBCA 1IXIA 4GIZA 3N5LA 4Q8RA 1MQIA 3FASA 2ZYKA 3H03A 4FEBA 2ZNSA 1SYIA 3LSWA 1FQBA 2O1MA 3ONMA 4R73A 3KZGA 4EQ9A 3VLVA 5FHMA 3KN8A 2V93A 3JV9A 3T9HB 3SETA 4NMYA 2B3BA 1WVJA 4N07A 1P1UA 1JW4A 3G3KA 2X7PA 2ZYNA 1O63A 5ISUA 1I6QA 5EYFA 1MY0A 1IXGA 4XKNA 2OBGA 1B2HA 1MQHA 3FIRA 1A54A 3R26A 4NE4A 3IO4A 5IAIA 4OENA 4E0WA 4MF3A 5DVJA 3KSJA 1ZLQA 4M1VA 4G8MA 4ZEBA 4OZ9A 1MDQA 2I3WA 1QUKA 2Q88A 1BIYA 4U21A 3PMWA 1PB8A 3BKIB 4QHQA 4KYDA 3E9XA 2V3QA 3OO8A 5FTHA 1KWHA 4YKIA 4IY5A 1YTVA 2HZKA 4IO2A 2XXPA 2ONSA 4GL8A 5LOMA 2HAUA 2XXUA 1M5EA 2I0CA 5CMKA 5TP9A 2F6PA 1JQFA 2ZNTA 3VVDA 3FV2A 3Q26A 2QRYA 4O3CA 3HPIA 3EHSA 2VGQA 5A5XB 1ZIUA 3R7XA 1IEJA 4JB7A 4ESWA 3RT6B 5J1DA 4KYSA 2PT2A 5I59B 4NF5A 4G68A 3Q29A 4NEDA 2F5XA 4NF6A 4XKPA 4E0XA 2XXYA 2I4CA 3C9HA 1B5IA 1Y3NA 1RKMA 1B0LA 1B3EA 4L17A 5H8QA 3TTMA 3C34A 1VFDA 3IK6B 4G77A 1N76A 5CC2A 1GV8A 3PUVE 4YB7A 4BDNA 1QULA 1S7YA 4P11A 4OFOA 5CMCA 4X1BA 5AA3A 5KCJB 3U94A 3Q25A 1H76A 4F18A 4R6KA 4GF8A 3G3IA 3TTKA 2AYSA 4OEUA 3TUSA 5KDTB 3IAZA 4R9FA 1BP5A 1Y1MA 1UTBA 2O84X 1N84A 3EN3A 2HQ0A 3F11A 5EHSA 4Q5TA 5AE4A 3GLBA 1H45A 1SI1A 1TFDA 4AQ4A 4IB2A 1SYHA 4R72A 4PFUA 1RYOA 3V83A 3DP4A 1FTMA 2ZXTA 5I57B 3JZJA 2DS9A 2V3TA 3CSBA 3IR1A 1NH7A 2HFBA 2YLNA 2OLBA 1LFHA 2XX8A 4ZEIA 3IJOB 3EQ1A 3U93A 2XXTA 1QKBA 3MP8A 1MXYA 1RYXA 1A99A 4F1UA 3ZSFA 4FJPA 1TT1A 4F2OA 1NKXA 4ZDMA 1ZBMA 2CMOA 3TELA 1MQGA 4YB5A 1FTOA 3VE1B 2UVGA 2RF1A 1M5DA 1N04A 3V8XB 3PMXA 3OO9A 3DELB 1NMUA 2YPNA 3HO7A 2RC8A 1LFIA 3L6HA 1B05A 4LVQA 1EZPA 3GXAA 5DTBA 2DWAA 2KLFA 1QW0A 3MVZA 4MLQA 3B6WA 4K3FA 2CZLA 3TDJA 3K2DA 4BDLA 4HCWA 4RK9A 1MPCA 3PUXE 5KZTA 3OO7A 4G4PA 4OFJA 4DIGA 4R2FA 3HV1A 1DPPA 1AMFA 1H43A 3MQ9A 3OELA 1BLFA 1AL3A 2V25A 4ZEDA 4Q30B 1JNFA 3TCHA 5AA2B 3LSFB 4FE8A 1XHYA 2F34A 1WODA 2DP8A 3ZKLA 1IITA 4KPTA 4WKMA 3FXRA 3FVOA 3O29A 4X1DA 4IGRA 3MVXA 2DE3A 3RPWA 1MQDA 4ONYA 4IO3A 3QYTA 4EF1A 3HSTA 1P1OA 1US5A 1LAXA 3H6UA 5I58B 2HZLA 2ONRA 1B46A 3MP6A 5AA1A 4I9DA 3TTNA 1LLSA 3K00A 1A55A 3FZVA 3VLUA 4WXJA 3ILTB 4NWDA 4Z0IA 3D4CA 2PBWA 1P1WA 1MDP1 3B6TA 1URDA 2LAOA 4EQBA 1LCTA 2IEEA 4RPOA 3IOTA 4F2QA 5H8NA 3FVGA 2Z8DA 1N0TA 2QS3A 3IORA 2VHAA 2O7IA 1A40A 1FQEA 3QUJA 2HEUA 2ONKE 2VD3A 3G3GA 5L8DA 1B4HA 2XXIA 1A8EA 2UYFA 3IOWA 3W9VA 5H8HA 1MXVA 4JSOA 2O51A 1M5FA 2XHDA 3KOSA 4LQ2A 4LZ7A 4QFNA 4PFYA 4LUBA 5H8FB 1Z7ME 1YPNA 4GQOA 2DWIA 3H6VA 2Q2CA 2OWTA 2RC7A 3G3HA 3LUYA 1PBQA 4MLVA 1USYE 5I84A 2H25A 4ECFA 1B3FA 4GD5A 1MG1A 1OVBA 4H65A 3S2VA 1FQCA 4F31B 2DYXA 1D9VA 1Z7NE 5FHNA 3OSRA 3FXUA 3H7MA 5ELVA 5ICTA 4H8JA 2I49A 4OEVA 3E4RA 1NNFA 3SEXA 4POXA 5HBCA 1Y9UA 1QVSA 2XXHA 4C0RA 1TFAA 2FYIA 4ELPA 1MM6A 3OENA 3G7WA 2ANJA 2ALUA 1H44A 4GXSB 1B5HA 4C1TA 1URGA 2D5WA 3RQTA 3HHGA 4QSDA 2A5TB 3O66A 2XXQA 5TU0A 3RNNA 5I56A 4I8CA 2GH9A 4U22A 3DP6A 3CIJA 1XT8A 1ZTYA 5I2KB 1SI0A 4R2BA 3TZAA 4NF8B 3I5OA 4F3PA 2UYEA 4OWDA 3Q27A 4DLDA 4GWOA 3U92A 4YB6A 2HCAA 3UP9A 3LC8A 2OCUA 3PPPA 1NNTA 3T96B 1B51A 2H9BA 3UGWA 4F3SA 4BDRA 4H5FA 5I2NA 1AOVA 2AIXA 5CBSA 3RUMA 1IUDA 4TLLB 1LCFA 2F8DA 3DLNA 3THIA 1MXWA 4GOTA 1ANFA 2XXXA 1SQYA 4JDFA 3RY3A 2O68A 3N26A 1MY2A 1NL5A 1VR5A 2XXWA 2XD2A 1MXUA 1DTZA 3TCGA 3TQLA 4YAHX 3CG1A 2NXOA 4O3BA 5DEXB 1LBBA 2RCBA 3SEUA 1O64A 5FHOA 3K02A 3VV5A 1JEUA 3TMGA 4PFWA 4G2ZA 1S50A 3IB2A 1N7WA 4LQ5A 3IX1A 4QFPA 3VLWA 4N6PA 2NVUB 4H67A 5DVFA 3FD3A 2QSXA 5L9SA 1H3DA 3FATA 3RT8A 3N6UA 3MVYA 4F3BA 3O28A 5CMMA 4ZEKA 4FECA 3G3FA 2Z8EA 1JETA 2PYYA 3R6UA 2BJJX 2I58A 3K6UA 3QSLA 3CFZA 1SDXA 2X26A 3ZS6A 4IGTA 5AA2D 3C4MA 4PE5B 4O3AA 5AA4A 2DWHA 3U8QA 2PX1A 3K1NA 5CM6A 3UIFA 3CFLA 2ZYMA 3KN3A 4QFLA 5TP9B 2W7YA 3LBSA 3MVWA 3P7IA 4OFLA 2REJA 4XIGQ 1OQHA 3IOVA 1OLAA 4EUOA 5DT6A 3U72A 3KOTA 4OVJA 4JBZA 5IKBA 3T22A 1YAEA 2DXYA 3OXNA 2XD3A 3M3FA 3EPEA 3K6VA 4G68B 4U2RA 4YKKA 4OERA 1OLCA 2A5SA 4G68C 2F35A 3CI8A 3WAEA 2QS2A 3B6QA 4ZZEA 1B3HA 5JK4A 5H8QB 2RCAA 4AB6A 1NNPA 1SD3A 4OXVA 3SERA 2XX7A 1A7LA 1QJMA 4Z7EA 4F1YA 4GVOA 1J1NA 4H0WA 2I3VA 1ELJA 2DE4A 1B4ZA 2Y7RA 4UACA 2P0SA 1B3GA 5ITPA 1SBPA 4N13A 2FA7A 2V84A 1OMPA 3VXBA 1DMBA 4WEDA 1UTBB 1SVXB 3CSGA 1II5A 4NF4A 4TLMB 4ZEFA 1POTA 3IL1B 1BKAA 1EZ9A 3SEYA 3AXFA 2ABHA 1SW4A 2NWJA 3A09A 1UTHB 2DVCA 5JTYA 4Q0CA 2M8CA 1MY1A 1UIUA 4GRKA 3W15C 2RINA 3ODBA 4KD5A 2Y7PA 3M3KA 2H98A 1CB6A 3C33A 3PUWE 2HXWA 3HCQA 4YMBA 4JWOA 4RJZA 1IIWA 3S9LC 1Y3PA 3CR9A 4GXAA 4P0GA 1JEVA 3MAMA 1XVYA 3VDFA 1EZOA 3TTLA 4PQJA 4U1ZA 4DCXA 3M3LA 4EXKA 3E13X 2F36A 4DCYA 2G29A 1Y20A 3OEKA 1MXXA 2QL3A 1B9JA 2Y7WA 1ZMGA 3KJTA 5DYHA 2G93A 2I0BA 4R75A 1B52A 1MH3A 3D4GA 3PD9A 2VOZA 2ZMBA 4BLAA 2QS4A 2ZNUA 5K2YA 3ILUB 2IA4A 3H6TA 4JWXA 4ZE8A 4DXUA 1HSEA 3SESA 3VFJA 2E1SA 3A3CA 3FJGA 3GZGA 3LSXA 3SEVA 4PETA 3JYRA 3IOUA 3LSLA 4QF9A 1MY4A 3N6TA 2P2AA 3UN6A 4IO5A 1SW5A 3HHFA 3H06B 2Z22A 1LFGA 4IO7A 3MWBA 1JVXA 3I3VA 4R74A 4LZ8A 1FTKA 1M5CA 3GBAA 2D21A 3T66A 4EF2A 1EU8A 3USDA 3CRBA 5EHMA 1L5TA 3Q28A 1FCKA 1AH5A 3FVKA 3K0VA 3S9MC 3C35A 2R71A 1B40A 1ZJLA 1PBPA 3TPAA 1FQFA 1B3LA 3OOAA 4MFIA 4ZZAA 3TTRA 5ITOA 1URSA 2RC9A 4NTLA 4RA1A 4FATA 2A5TA 2QS1A 4NWCA 4ND9A 3IB0A 3KFMA 3FVNA 3HN0A 4UA8A 4GLIA 3PPQA 2AL4A 3LR1A 5B7DA 5TPAB 3RLFE 1M5BA 4U4SA 1YCJA 3FJ7A 3OEMA 3UK4A 2REGA 2HAVA 4R6HA 4H1XA 3K1PA 3PGFA 4EXLA 1LGBC 2GHAA 4F39A 2GFEA 1A8FA 3IB1A 4LZ5A 4M4GA 3S9EA 3S4UA 5H8NB 4KR5A 4OESA 3RN8A 3T9VA 5L9MA 5BWJA 1N3XA 1VSOA 2X7QA 1XOCA 1Q35A 2Q8JA 3U1OA 4R9GA 1GVCA 4XTCQ 4OHNA 1OQGA 1IZ1A 3O6HA 3PV0E 5H8HB 5JEIA 5A5XA 3SEWA 3IO6A 5F7VA 3RTWB 1OIBA 3A3UA 2F7AA 1Y3QA 3BFUA 5DEXA 4RPNA 1FQAA 5I59A 3TEPA 5K2XA 2DSFA 2RKMA 4JXIA 3E3KA 4BDQA 1FQDA 1US4A 2I48A 4HS7A 1AIVA 4OYVA 2P1SA 1FTLA 4MBPA 1B32A 1Y4TA 4FEDA 2DE2A 2OJTA 3KGCA 2Z8FA 4R6YA 4DZ1A 2F7BA 4BDMA 1NH8A 3T9XB 1TWYA 2DQVA 2H4IA 3MZ1A 4F22A 3G3JA 3KEIA 4QFOA 4QSCA 1LAHE 3QAXA 1FW0A 1GTKA 5KCJA 3QIMA 4LATA 3VXCA 3V89B 2Y7KA 1P1QA 1ZKBA 2XXRA 1OVTA 4KCCA 5KDTA 3H6WA 3O97A 4FORA 4P0IA 3T93B 1SW1A 3KJ7A 1ZU0A 3ZKKA 4ZS9A 4YU0A 3MPKA 1DOTA 1Y4CA 4GL0A 2PVUA 4YMAA 1P99A 1DSNA 3C36A 3PPRA 2QPQA 1MH4A 2H99A 2R6GE 1GGGA 1PDAA 2OWSA 2UVIA 4G8HA 2UVHA 2NOOA 3BFTA 4YZZA 4DDDA 4XXUA 4IY6A 5BUUA 5I57A 2V3UA 4ELOA 1F9BA 1R9LA 5I56B 3PD8A 1N7XA 3MBPA 4F29A 3PU5A 1XVXA 1TXFA 2XXVA 3K4UA 1D3KA 1XC1A 2Y84A 4YICA 3V5AA 4RY1A 3FUZA 3PPOA 3O2AA 3FJMA 5M2VA 1NFTA 2Z23A 1P1NA 5I2NB 4MH5A 1POY1 2O1LA 2QMXA 1MM7A 3VVEA 4BDOA 3TYHA 1QKAA 2I4BA 3KG2A 1SW2A 1MPBA 4H6DA 2R9JA 5CI5A 3MUQA 5CMBA 1MY3A 3PUZE 2F78A 3MW0A 5FTIA 4TOZA 2B3FA 1UTHA 1O7TA 3FV1A 1LB9A 4OTEA 1IXHA 5DVIA 1I6AA 3FXQA 2OK2A 4NF5B 3MC2A 4F3GA 3M8UA 4ISUA 4XKQA 4THIA 4NF6B 1USYH 1B0HA 1PEBA 2GRVA 4WEPA 3MPLA 5AA2A 2QJEA 2F97A 4C1UA 1PC3A 5HPQA 3TFLA 4RK2A 4H5GA 4KI0E 1BTJA 1I6BA 4OQOA 4KCDA 4KFQA 4KQPA 2E0SA 1NNKA 3DP8A 1I69A 4HW8A 4FIMA 3K6WA 1B7UA 3O6GA 1B1XA 1HSLA 3WAFA 3TKDA 3C32A 3KN7A 2THIA 1QUJA 4QFKA 2ESNA 3O6IA 3OO6A 1HSJA 4DXCA 2VD2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I58 A;  3TQW A;  4LP2 B;  5H8S A;  5ICQ A;  4QSE A;  3K01 A;  2D3I A;  2YJP A;  5AA4 B;  5HM4 B;  1IXC A;  4ELR A;  1R1N A;  2UVJ A;  4RYA A;  3MJN A;  3MP1 A;  2FNC A;  2XX9 A;  2AL5 A;  1MRP A;  1UQW A;  1MS7 A;  4QRZ A;  3SDF A;  1S9T A;  4RXL A;  2ZYO A;  3KSX A;  3L6G A;  1LB8 A;  1MPD A;  3CFX A;  1EH3 A;  5B70 A;  1MQJ A;  4RNS A;  4XKR A;  1B7H A;  4F1V A;  3FGS A;  3K6X A;  2WKY A;  3QXM A;  4YKJ A;  3KBR A;  1LAG E;  4HCY A;  3UOR A;  4LA9 A;  3RTF B;  2Q89 A;  4FAJ A;  1GR2 A;  3OD7 A;  1D9Y A;  3CVG A;  1D4N A;  2I6E A;  3SKP A;  3IJX B;  2H5Y A;  3DM0 A;  4EQ7 A;  1UIV A;  3TAJ A;  4ELQ A;  3VVF A;  3PMV A;  3C31 A;  1PB7 A;  3PPN A;  5H8F A;  4PFT A;  2PT1 A;  4KHZ E;  2GHB A;  3MZB A;  2F6G A;  4YKP A;  4ZEC A;  2Q2A A;  3GBB A;  1B6H A;  4NF4 B;  2O6A A;  1JVY A;  3W9W A;  4U23 A;  4PP0 A;  5TPA A;  3UA8 A;  1VE4 A;  4F19 A;  3EF7 A;  5L9O A;  4I1D A;  1JW1 A;  4EDP A;  4H8I A;  5JTY B;  4X9T A;  4OMB A;  3O9P A;  5F1Q A;  2DXR A;  4DE8 A;  2B65 A;  3OMB A;  4ESX A;  3RGY A;  4AB5 A;  2NUV A;  3EHU A;  3I6V A;  4OET A;  1LAF E;  4POW A;  2PMS A;  4JSD A;  3N94 A;  4JWY A;  5CRY A;  1Q1K A;  2O7U A;  1T0K A;  4HTG A;  3PUY E;  3TCF A;  1MXZ A;  4U4X A;  4DXB A;  1N3W A;  1XS5 A;  1R6Z A;  4ZE9 A;  3QUF A;  3TOD A;  2QMW A;  2UXA A;  5CBR A;  4TQU Q;  4IO6 A;  3T9U A;  1B58 A;  1WDN A;  2OZZ A;  1Y1Z A;  4U1O A;  1JW5 A;  1QUI A;  4IO4 A;  3MZ9 A;  2DVZ A;  3CG3 A;  1R9Q A;  5I2K A;  4NF8 A;  3EHT A;  2DWJ A;  1CE2 A;  3BBR A;  3OSQ A;  2VP1 A;  1B1H A;  2Y7I A;  1LST A;  1B5J A;  4I62 A;  1ATG A;  4KYE A;  4X48 A;  1B7Z A;  2O69 A;  1DTG A;  3S9N C;  4G8N A;  3K1M A;  4LON B;  2DOJ A;  3H3G A;  3H4Z A;  1DPE A;  3B7D A;  1IQ7 A;  1VFE A;  2F7C A;  4GFR A;  1FTJ A;  3ECR A;  1PB9 A;  2Q9T A;  3QK6 A;  1LBC A;  1IXI A;  4GIZ A;  3N5L A;  4Q8R A;  1MQI A;  3FAS A;  2ZYK A;  3H03 A;  4FEB A;  2ZNS A;  1SYI A;  3LSW A;  1FQB A;  2O1M A;  3ONM A;  4R73 A;  3KZG A;  4EQ9 A;  3VLV A;  5FHM A;  3KN8 A;  2V93 A;  3JV9 A;  3T9H B;  3SET A;  4NMY A;  2B3B A;  1WVJ A;  4N07 A;  1P1U A;  1JW4 A;  3G3K A;  2X7P A;  2ZYN A;  1O63 A;  5ISU A;  1I6Q A;  5EYF A;  1MY0 A;  1IXG A;  4XKN A;  2OBG A;  1B2H A;  1MQH A;  3FIR A;  1A54 A;  3R26 A;  4NE4 A;  3IO4 A;  5IAI A;  4OEN A;  4E0W A;  4MF3 A;  5DVJ A;  3KSJ A;  1ZLQ A;  4M1V A;  4G8M A;  4ZEB A;  4OZ9 A;  1MDQ A;  2I3W A;  1QUK A;  2Q88 A;  1BIY A;  4U21 A;  3PMW A;  1PB8 A;  3BKI B;  4QHQ A;  4KYD A;  3E9X A;  2V3Q A;  3OO8 A;  5FTH A;  1KWH A;  4YKI A;  4IY5 A;  1YTV A;  2HZK A;  4IO2 A;  2XXP A;  2ONS A;  4GL8 A;  5LOM A;  2HAU A;  2XXU A;  1M5E A;  2I0C A;  5CMK A;  5TP9 A;  2F6P A;  1JQF A;  2ZNT A;  3VVD A;  3FV2 A;  3Q26 A;  2QRY A;  4O3C A;  3HPI A;  3EHS A;  2VGQ A;  5A5X B;  1ZIU A;  3R7X A;  1IEJ A;  4JB7 A;  4ESW A;  3RT6 B;  5J1D A;  4KYS A;  2PT2 A;  5I59 B;  4NF5 A;  4G68 A;  3Q29 A;  4NED A;  2F5X A;  4NF6 A;  4XKP A;  4E0X A;  2XXY A;  2I4C A;  3C9H A;  1B5I A;  1Y3N A;  1RKM A;  1B0L A;  1B3E A;  4L17 A;  5H8Q A;  3TTM A;  3C34 A;  1VFD A;  3IK6 B;  4G77 A;  1N76 A;  5CC2 A;  1GV8 A;  3PUV E;  4YB7 A;  4BDN A;  1QUL A;  1S7Y A;  4P11 A;  4OFO A;  5CMC A;  4X1B A;  5AA3 A;  5KCJ B;  3U94 A;  3Q25 A;  1H76 A;  4F18 A;  4R6K A;  4GF8 A;  3G3I A;  3TTK A;  2AYS A;  4OEU A;  3TUS A;  5KDT B;  3IAZ A;  4R9F A;  1BP5 A;  1Y1M A;  1UTB A;  2O84 X;  1N84 A;  3EN3 A;  2HQ0 A;  3F11 A;  5EHS A;  4Q5T A;  5AE4 A;  3GLB A;  1H45 A;  1SI1 A;  1TFD A;  4AQ4 A;  4IB2 A;  1SYH A;  4R72 A;  4PFU A;  1RYO A;  3V83 A;  3DP4 A;  1FTM A;  2ZXT A;  5I57 B;  3JZJ A;  2DS9 A;  2V3T A;  3CSB A;  3IR1 A;  1NH7 A;  2HFB A;  2YLN A;  2OLB A;  1LFH A;  2XX8 A;  4ZEI A;  3IJO B;  3EQ1 A;  3U93 A;  2XXT A;  1QKB A;  3MP8 A;  1MXY A;  1RYX A;  1A99 A;  4F1U A;  3ZSF A;  4FJP A;  1TT1 A;  4F2O A;  1NKX A;  4ZDM A;  1ZBM A;  2CMO A;  3TEL A;  1MQG A;  4YB5 A;  1FTO A;  3VE1 B;  2UVG A;  2RF1 A;  1M5D A;  1N04 A;  3V8X B;  3PMX A;  3OO9 A;  3DEL B;  1NMU A;  2YPN A;  3HO7 A;  2RC8 A;  1LFI A;  3L6H A;  1B05 A;  4LVQ A;  1EZP A;  3GXA A;  5DTB A;  2DWA A;  2KLF A;  1QW0 A;  3MVZ A;  4MLQ A;  3B6W A;  4K3F A;  2CZL A;  3TDJ A;  3K2D A;  4BDL A;  4HCW A;  4RK9 A;  1MPC A;  3PUX E;  5KZT A;  3OO7 A;  4G4P A;  4OFJ A;  4DIG A;  4R2F A;  3HV1 A;  1DPP A;  1AMF A;  1H43 A;  3MQ9 A;  3OEL A;  1BLF A;  1AL3 A;  2V25 A;  4ZED A;  4Q30 B;  1JNF A;  3TCH A;  5AA2 B;  3LSF B;  4FE8 A;  1XHY A;  2F34 A;  1WOD A;  2DP8 A;  3ZKL A;  1IIT A;  4KPT A;  4WKM A;  3FXR A;  3FVO A;  3O29 A;  4X1D A;  4IGR A;  3MVX A;  2DE3 A;  3RPW A;  1MQD A;  4ONY A;  4IO3 A;  3QYT A;  4EF1 A;  3HST A;  1P1O A;  1US5 A;  1LAX A;  3H6U A;  5I58 B;  2HZL A;  2ONR A;  1B46 A;  3MP6 A;  5AA1 A;  4I9D A;  3TTN A;  1LLS A;  3K00 A;  1A55 A;  3FZV A;  3VLU A;  4WXJ A;  3ILT B;  4NWD A;  4Z0I A;  3D4C A;  2PBW A;  1P1W A;  1MDP 1;  3B6T A;  1URD A;  2LAO A;  4EQB A;  1LCT A;  2IEE A;  4RPO A;  3IOT A;  4F2Q A;  5H8N A;  3FVG A;  2Z8D A;  1N0T A;  2QS3 A;  3IOR A;  2VHA A;  2O7I A;  1A40 A;  1FQE A;  3QUJ A;  2HEU A;  2ONK E;  2VD3 A;  3G3G A;  5L8D A;  1B4H A;  2XXI A;  1A8E A;  2UYF A;  3IOW A;  3W9V A;  5H8H A;  1MXV A;  4JSO A;  2O51 A;  1M5F A;  2XHD A;  3KOS A;  4LQ2 A;  4LZ7 A;  4QFN A;  4PFY A;  4LUB A;  5H8F B;  1Z7M E;  1YPN A;  4GQO A;  2DWI A;  3H6V A;  2Q2C A;  2OWT A;  2RC7 A;  3G3H A;  3LUY A;  1PBQ A;  4MLV A;  1USY E;  5I84 A;  2H25 A;  4ECF A;  1B3F A;  4GD5 A;  1MG1 A;  1OVB A;  4H65 A;  3S2V A;  1FQC A;  4F31 B;  2DYX A;  1D9V A;  1Z7N E;  5FHN A;  3OSR A;  3FXU A;  3H7M A;  5ELV A;  5ICT A;  4H8J A;  2I49 A;  4OEV A;  3E4R A;  1NNF A;  3SEX A;  4POX A;  5HBC A;  1Y9U A;  1QVS A;  2XXH A;  4C0R A;  1TFA A;  2FYI A;  4ELP A;  1MM6 A;  3OEN A;  3G7W A;  2ANJ A;  2ALU A;  1H44 A;  4GXS B;  1B5H A;  4C1T A;  1URG A;  2D5W A;  3RQT A;  3HHG A;  4QSD A;  2A5T B;  3O66 A;  2XXQ A;  5TU0 A;  3RNN A;  5I56 A;  4I8C A;  2GH9 A;  4U22 A;  3DP6 A;  3CIJ A;  1XT8 A;  1ZTY A;  5I2K B;  1SI0 A;  4R2B A;  3TZA A;  4NF8 B;  3I5O A;  4F3P A;  2UYE A;  4OWD A;  3Q27 A;  4DLD A;  4GWO A;  3U92 A;  4YB6 A;  2HCA A;  3UP9 A;  3LC8 A;  2OCU A;  3PPP A;  1NNT A;  3T96 B;  1B51 A;  2H9B A;  3UGW A;  4F3S A;  4BDR A;  4H5F A;  5I2N A;  1AOV A;  2AIX A;  5CBS A;  3RUM A;  1IUD A;  4TLL B;  1LCF A;  2F8D A;  3DLN A;  3THI A;  1MXW A;  4GOT A;  1ANF A;  2XXX A;  1SQY A;  4JDF A;  3RY3 A;  2O68 A;  3N26 A;  1MY2 A;  1NL5 A;  1VR5 A;  2XXW A;  2XD2 A;  1MXU A;  1DTZ A;  3TCG A;  3TQL A;  4YAH X;  3CG1 A;  2NXO A;  4O3B A;  5DEX B;  1LBB A;  2RCB A;  3SEU A;  1O64 A;  5FHO A;  3K02 A;  3VV5 A;  1JEU A;  3TMG A;  4PFW A;  4G2Z A;  1S50 A;  3IB2 A;  1N7W A;  4LQ5 A;  3IX1 A;  4QFP A;  3VLW A;  4N6P A;  2NVU B;  4H67 A;  5DVF A;  3FD3 A;  2QSX A;  5L9S A;  1H3D A;  3FAT A;  3RT8 A;  3N6U A;  3MVY A;  4F3B A;  3O28 A;  5CMM A;  4ZEK A;  4FEC A;  3G3F A;  2Z8E A;  1JET A;  2PYY A;  3R6U A;  2BJJ X;  2I58 A;  3K6U A;  3QSL A;  3CFZ A;  1SDX A;  2X26 A;  3ZS6 A;  4IGT A;  5AA2 D;  3C4M A;  4PE5 B;  4O3A A;  5AA4 A;  2DWH A;  3U8Q A;  2PX1 A;  3K1N A;  5CM6 A;  3UIF A;  3CFL A;  2ZYM A;  3KN3 A;  4QFL A;  5TP9 B;  2W7Y A;  3LBS A;  3MVW A;  3P7I A;  4OFL A;  2REJ A;  4XIG Q;  1OQH A;  3IOV A;  1OLA A;  4EUO A;  5DT6 A;  3U72 A;  3KOT A;  4OVJ A;  4JBZ A;  5IKB A;  3T22 A;  1YAE A;  2DXY A;  3OXN A;  2XD3 A;  3M3F A;  3EPE A;  3K6V A;  4G68 B;  4U2R A;  4YKK A;  4OER A;  1OLC A;  2A5S A;  4G68 C;  2F35 A;  3CI8 A;  3WAE A;  2QS2 A;  3B6Q A;  4ZZE A;  1B3H A;  5JK4 A;  5H8Q B;  2RCA A;  4AB6 A;  1NNP A;  1SD3 A;  4OXV A;  3SER A;  2XX7 A;  1A7L A;  1QJM A;  4Z7E A;  4F1Y A;  4GVO A;  1J1N A;  4H0W A;  2I3V A;  1ELJ A;  2DE4 A;  1B4Z A;  2Y7R A;  4UAC A;  2P0S A;  1B3G A;  5ITP A;  1SBP A;  4N13 A;  2FA7 A;  2V84 A;  1OMP A;  3VXB A;  1DMB A;  4WED A;  1UTB B;  1SVX B;  3CSG A;  1II5 A;  4NF4 A;  4TLM B;  4ZEF A;  1POT A;  3IL1 B;  1BKA A;  1EZ9 A;  3SEY A;  3AXF A;  2ABH A;  1SW4 A;  2NWJ A;  3A09 A;  1UTH B;  2DVC A;  5JTY A;  4Q0C A;  2M8C A;  1MY1 A;  1UIU A;  4GRK A;  3W15 C;  2RIN A;  3ODB A;  4KD5 A;  2Y7P A;  3M3K A;  2H98 A;  1CB6 A;  3C33 A;  3PUW E;  2HXW A;  3HCQ A;  4YMB A;  4JWO A;  4RJZ A;  1IIW A;  3S9L C;  1Y3P A;  3CR9 A;  4GXA A;  4P0G A;  1JEV A;  3MAM A;  1XVY A;  3VDF A;  1EZO A;  3TTL A;  4PQJ A;  4U1Z A;  4DCX A;  3M3L A;  4EXK A;  3E13 X;  2F36 A;  4DCY A;  2G29 A;  1Y20 A;  3OEK A;  1MXX A;  2QL3 A;  1B9J A;  2Y7W A;  1ZMG A;  3KJT A;  5DYH A;  2G93 A;  2I0B A;  4R75 A;  1B52 A;  1MH3 A;  3D4G A;  3PD9 A;  2VOZ A;  2ZMB A;  4BLA A;  2QS4 A;  2ZNU A;  5K2Y A;  3ILU B;  2IA4 A;  3H6T A;  4JWX A;  4ZE8 A;  4DXU A;  1HSE A;  3SES A;  3VFJ A;  2E1S A;  3A3C A;  3FJG A;  3GZG A;  3LSX A;  3SEV A;  4PET A;  3JYR A;  3IOU A;  3LSL A;  4QF9 A;  1MY4 A;  3N6T A;  2P2A A;  3UN6 A;  4IO5 A;  1SW5 A;  3HHF A;  3H06 B;  2Z22 A;  1LFG A;  4IO7 A;  3MWB A;  1JVX A;  3I3V A;  4R74 A;  4LZ8 A;  1FTK A;  1M5C A;  3GBA A;  2D21 A;  3T66 A;  4EF2 A;  1EU8 A;  3USD A;  3CRB A;  5EHM A;  1L5T A;  3Q28 A;  1FCK A;  1AH5 A;  3FVK A;  3K0V A;  3S9M C;  3C35 A;  2R71 A;  1B40 A;  1ZJL A;  1PBP A;  3TPA A;  1FQF A;  1B3L A;  3OOA A;  4MFI A;  4ZZA A;  3TTR A;  5ITO A;  1URS A;  2RC9 A;  4NTL A;  4RA1 A;  4FAT A;  2A5T A;  2QS1 A;  4NWC A;  4ND9 A;  3IB0 A;  3KFM A;  3FVN A;  3HN0 A;  4UA8 A;  4GLI A;  3PPQ A;  2AL4 A;  3LR1 A;  5B7D A;  5TPA B;  3RLF E;  1M5B A;  4U4S A;  1YCJ A;  3FJ7 A;  3OEM A;  3UK4 A;  2REG A;  2HAV A;  4R6H A;  4H1X A;  3K1P A;  3PGF A;  4EXL A;  1LGB C;  2GHA A;  4F39 A;  2GFE A;  1A8F A;  3IB1 A;  4LZ5 A;  4M4G A;  3S9E A;  3S4U A;  5H8N B;  4KR5 A;  4OES A;  3RN8 A;  3T9V A;  5L9M A;  5BWJ A;  1N3X A;  1VSO A;  2X7Q A;  1XOC A;  1Q35 A;  2Q8J A;  3U1O A;  4R9G A;  1GVC A;  4XTC Q;  4OHN A;  1OQG A;  1IZ1 A;  3O6H A;  3PV0 E;  5H8H B;  5JEI A;  5A5X A;  3SEW A;  3IO6 A;  5F7V A;  3RTW B;  1OIB A;  3A3U A;  2F7A A;  1Y3Q A;  3BFU A;  5DEX A;  4RPN A;  1FQA A;  5I59 A;  3TEP A;  5K2X A;  2DSF A;  2RKM A;  4JXI A;  3E3K A;  4BDQ A;  1FQD A;  1US4 A;  2I48 A;  4HS7 A;  1AIV A;  4OYV A;  2P1S A;  1FTL A;  4MBP A;  1B32 A;  1Y4T A;  4FED A;  2DE2 A;  2OJT A;  3KGC A;  2Z8F A;  4R6Y A;  4DZ1 A;  2F7B A;  4BDM A;  1NH8 A;  3T9X B;  1TWY A;  2DQV A;  2H4I A;  3MZ1 A;  4F22 A;  3G3J A;  3KEI A;  4QFO A;  4QSC A;  1LAH E;  3QAX A;  1FW0 A;  1GTK A;  5KCJ A;  3QIM A;  4LAT A;  3VXC A;  3V89 B;  2Y7K A;  1P1Q A;  1ZKB A;  2XXR A;  1OVT A;  4KCC A;  5KDT A;  3H6W A;  3O97 A;  4FOR A;  4P0I A;  3T93 B;  1SW1 A;  3KJ7 A;  1ZU0 A;  3ZKK A;  4ZS9 A;  4YU0 A;  3MPK A;  1DOT A;  1Y4C A;  4GL0 A;  2PVU A;  4YMA A;  1P99 A;  1DSN A;  3C36 A;  3PPR A;  2QPQ A;  1MH4 A;  2H99 A;  2R6G E;  1GGG A;  1PDA A;  2OWS A;  2UVI A;  4G8H A;  2UVH A;  2NOO A;  3BFT A;  4YZZ A;  4DDD A;  4XXU A;  4IY6 A;  5BUU A;  5I57 A;  2V3U A;  4ELO A;  1F9B A;  1R9L A;  5I56 B;  3PD8 A;  1N7X A;  3MBP A;  4F29 A;  3PU5 A;  1XVX A;  1TXF A;  2XXV A;  3K4U A;  1D3K A;  1XC1 A;  2Y84 A;  4YIC A;  3V5A A;  4RY1 A;  3FUZ A;  3PPO A;  3O2A A;  3FJM A;  5M2V A;  1NFT A;  2Z23 A;  1P1N A;  5I2N B;  4MH5 A;  1POY 1;  2O1L A;  2QMX A;  1MM7 A;  3VVE A;  4BDO A;  3TYH A;  1QKA A;  2I4B A;  3KG2 A;  1SW2 A;  1MPB A;  4H6D A;  2R9J A;  5CI5 A;  3MUQ A;  5CMB A;  1MY3 A;  3PUZ E;  2F78 A;  3MW0 A;  5FTI A;  4TOZ A;  2B3F A;  1UTH A;  1O7T A;  3FV1 A;  1LB9 A;  4OTE A;  1IXH A;  5DVI A;  1I6A A;  3FXQ A;  2OK2 A;  4NF5 B;  3MC2 A;  4F3G A;  3M8U A;  4ISU A;  4XKQ A;  4THI A;  4NF6 B;  1USY H;  1B0H A;  1PEB A;  2GRV A;  4WEP A;  3MPL A;  5AA2 A;  2QJE A;  2F97 A;  4C1U A;  1PC3 A;  5HPQ A;  3TFL A;  4RK2 A;  4H5G A;  4KI0 E;  1BTJ A;  1I6B A;  4OQO A;  4KCD A;  4KFQ A;  4KQP A;  2E0S A;  1NNK A;  3DP8 A;  1I69 A;  4HW8 A;  4FIM A;  3K6W A;  1B7U A;  3O6G A;  1B1X A;  1HSL A;  3WAF A;  3TKD A;  3C32 A;  3KN7 A;  2THI A;  1QUJ A;  4QFK A;  2ESN A;  3O6I A;  3OO6 A;  1HSJ A;  4DXC A;  2VD2 A; 
#chains in the Genus database with same CATH topology
 5I58 A;  4NF0 A;  3TQW A;  4LP2 B;  5H8S A;  5ICQ A;  4QSE A;  3K01 A;  2D3I A;  2YJP A;  5AA4 B;  5HM4 B;  1IXC A;  4ELR A;  1R1N A;  2UVJ A;  4RYA A;  3MJN A;  3MP1 A;  2FNC A;  2XX9 A;  2AL5 A;  1MRP A;  2PFZ A;  1UQW A;  1MS7 A;  4QRZ A;  3SDF A;  1S9T A;  4RXL A;  2ZYO A;  3KSX A;  1NV0 A;  3L6G A;  1LBZ A;  1LB8 A;  1MPD A;  3CFX A;  1EH3 A;  5B70 A;  1MQJ A;  4RNS A;  4XKR A;  1B7H A;  4F1V A;  3FGS A;  3K6X A;  2WKY A;  3QXM A;  2QVU A;  4HE2 A;  4YKJ A;  3FXB A;  3KBR A;  1LAG E;  4HCY A;  3UOR A;  4LA9 A;  3RTF B;  4NAP A;  2Q89 A;  4N91 A;  4FAJ A;  1GR2 A;  3OD7 A;  1D9Y A;  3CVG A;  1D4N A;  2I6E A;  4PAK A;  3SKP A;  4PC9 A;  4PAI A;  3IJX B;  2H5Y A;  3KC1 A;  3DM0 A;  4EQ7 A;  1UIV A;  3TAJ A;  4ELQ A;  4GWU A;  2BJI A;  3VVF A;  3PMV A;  3C31 A;  1PB7 A;  4DI4 B;  3PPN A;  5H8F A;  4PFT A;  2L5V A;  2PT1 A;  4KHZ E;  2GHB A;  3ROJ A;  3MZB A;  2F6G A;  4YKP A;  4ZEC A;  2Q2A A;  3GBB A;  2FIX A;  1B6H A;  4NF4 B;  2O6A A;  1JVY A;  3W9W A;  4U23 A;  4PP0 A;  5TPA A;  3UA8 A;  1VE4 A;  2FBP A;  4F19 A;  3EF7 A;  5L9O A;  4I1D A;  4P56 A;  1JW1 A;  4EDP A;  4H8I A;  5JTY B;  4X9T A;  4OMB A;  3O9P A;  5F1Q A;  2DXR A;  4DE8 A;  2B65 A;  3OMB A;  4ESX A;  1FPK A;  4GBV A;  3RGY A;  4AB5 A;  2JJK A;  2NUV A;  1NV3 A;  3EHU A;  1IME A;  1KA1 A;  3I6V A;  1G0H A;  4OET A;  1LAF E;  4POW A;  2PMS A;  4JSD A;  2F3B A;  3N94 A;  2VT5 A;  4JWY A;  5CRY A;  1Q1K A;  2O7U A;  1T0K A;  4HTG A;  1EYI A;  3PUY E;  3TCF A;  1FPJ A;  1MXZ A;  4U4X A;  4DXB A;  1N3W A;  1XS5 A;  3KBZ A;  1R6Z A;  4ZE9 A;  3QUF A;  3TOD A;  2QMW A;  2UXA A;  5CBR A;  4TQU Q;  4IO6 A;  3T9U A;  1B58 A;  1BK4 A;  1WDN A;  2OZZ A;  1Y1Z A;  4U1O A;  1JW5 A;  4N6D A;  1QUI A;  4IO4 A;  3MZ9 A;  1FPG A;  2DVZ A;  3CG3 A;  1R9Q A;  5I2K A;  3SZP A;  4NF8 A;  4XFE A;  3EHT A;  2DWJ A;  1CE2 A;  3BBR A;  1XI6 A;  3OSQ A;  2VP1 A;  4GWW A;  1B1H A;  2Y7I A;  1LST A;  1B5J A;  2PFY A;  4I62 A;  1ATG A;  4KYE A;  4X48 A;  1B7Z A;  2O69 A;  1DTG A;  3S9N C;  4G8N A;  4UAB A;  3K1M A;  4LON B;  2DOJ A;  3H3G A;  3H4Z A;  5DW8 A;  1DPE A;  3B7D A;  1IQ7 A;  1VFE A;  2F7C A;  4GFR A;  1FTJ A;  3ECR A;  1PB9 A;  2Q9T A;  3QK6 A;  4P8B A;  1LBC A;  1IXI A;  4GIZ A;  3N5L A;  4PAF A;  4Q8R A;  1MQI A;  3BIH A;  3FAS A;  2ZYK A;  3H03 A;  5ET5 A;  4FEB A;  2ZNS A;  5EQA A;  1SYI A;  3LSW A;  1FQB A;  2O1M A;  3ONM A;  4R73 A;  3KZG A;  4EQ9 A;  3VLV A;  5FHM A;  3KN8 A;  2V93 A;  3JV9 A;  3T9H B;  3SET A;  4NMY A;  2B3B A;  1WVJ A;  5LTC A;  2KR0 A;  4N07 A;  1P1U A;  1JW4 A;  3G3K A;  2X7P A;  2ZYN A;  1O63 A;  5ISU A;  2XWO A;  1I6Q A;  5EYF A;  1MY0 A;  1IXG A;  4XKN A;  2OBG A;  1B2H A;  2CZI A;  1MQH A;  3FIR A;  1A54 A;  3R26 A;  4NE4 A;  3IO4 A;  5IAI A;  4OEN A;  4E0W A;  1NUZ A;  3PTY A;  4MF3 A;  5DVJ A;  3KSJ A;  1ZLQ A;  4M1V A;  2MKZ A;  4G8M A;  3QMF A;  4ZEB A;  4OZ9 A;  1MDQ A;  2I3W A;  1QUK A;  2Q88 A;  3KC0 A;  1BIY A;  4U21 A;  3PMW A;  1PB8 A;  3BKI B;  4QHQ A;  4KYD A;  2OWZ A;  1RDX A;  3E9X A;  2V3Q A;  3OO8 A;  5FTH A;  5J16 A;  1KWH A;  4YKI A;  4IY5 A;  1YTV A;  4AS4 A;  4OAN A;  3B8B A;  2HZK A;  4PFB A;  4IO2 A;  2XXP A;  2Q8M A;  2ONS A;  4GL8 A;  5LOM A;  2HAU A;  2XXU A;  1M5E A;  2I0C A;  5CMK A;  5TP9 A;  4N81 A;  2F6P A;  1JQF A;  2ZNT A;  1NUX A;  3VVD A;  2CZH A;  3FV2 A;  3Q26 A;  2QRY A;  4O3C A;  3HPI A;  3EHS A;  4NN3 A;  5EQ9 A;  2VGQ A;  4OVS A;  5A5X B;  4I40 A;  1ZIU A;  3R7X A;  1IEJ A;  4JB7 A;  4ESW A;  3RT6 B;  5J1D A;  4KYS A;  2PT2 A;  5F24 A;  5I59 B;  4PFR A;  4NF5 A;  4G68 A;  3Q29 A;  4NED A;  2QVR A;  1FJ6 A;  2F5X A;  4NF6 A;  4XKP A;  4P1L A;  4NHB A;  4E0X A;  2XXY A;  2I4C A;  3C9H A;  1B5I A;  1Y3N A;  1RKM A;  1B0L A;  1B3E A;  4L17 A;  1QGX A;  5H8Q A;  3TTM A;  2V4C A;  3C34 A;  1VFD A;  3IK6 B;  4G77 A;  1N76 A;  5CC2 A;  1GV8 A;  3PUV E;  4YB7 A;  4BDN A;  1QUL A;  4DI3 D;  4PDH A;  1S7Y A;  5I7I A;  4P11 A;  4OFO A;  5CMC A;  1NI9 A;  4X1B A;  5AA3 A;  5KCJ B;  3U94 A;  4PDD A;  4PF6 A;  3Q25 A;  1H76 A;  4F18 A;  4R6K A;  4GF8 A;  3G3I A;  3TTK A;  2AYS A;  4OEU A;  3TUS A;  5KDT B;  3IAZ A;  4R9F A;  1BP5 A;  1Y1M A;  1UTB A;  2O84 X;  1N84 A;  3EN3 A;  2HQ0 A;  3F11 A;  5EHS A;  4Q5T A;  4N17 A;  1NUW A;  3RPL A;  4H46 A;  5AE4 A;  3GLB A;  1H45 A;  4JVI A;  1K9Y A;  1SI1 A;  1TFD A;  4AQ4 A;  4N15 A;  4IB2 A;  1SYH A;  4R72 A;  4PFU A;  1RYO A;  1FSA A;  3D1R A;  3V83 A;  2CEX A;  3DP4 A;  1FTM A;  2ZXT A;  5I57 B;  3JZJ A;  2DS9 A;  3GYY A;  2V3T A;  3CSB A;  3IR1 A;  1NH7 A;  1FBG A;  2HFB A;  2YLN A;  2OLB A;  1LFH A;  2XX8 A;  4ZEI A;  3IJO B;  3EQ1 A;  3U93 A;  2XXT A;  1QKB A;  3MP8 A;  1MXY A;  1LBW A;  1RYX A;  1A99 A;  4F1U A;  3ZSF A;  4FJP A;  4OVQ A;  1TT1 A;  4F2O A;  1NKX A;  1NV2 A;  4ZDM A;  1ZBM A;  4MAG A;  2CMO A;  3TEL A;  1MQG A;  4YB5 A;  4PFI A;  4MNP A;  1RDZ A;  1FTO A;  2WYK A;  3VE1 B;  2UVG A;  4I3E A;  2RF1 A;  1M5D A;  1N04 A;  3V8X B;  3PMX A;  3OO9 A;  1KZ8 A;  4MIJ A;  3DEL B;  1NMU A;  2YPN A;  1NV5 A;  3HO7 A;  2RC8 A;  3FBP A;  1FBH A;  4GX4 A;  1LFI A;  3L6H A;  1B05 A;  4LVQ A;  1EZP A;  5T3J A;  5ESY A;  3GXA A;  2DWA A;  2KLF A;  3MVZ A;  1QW0 A;  4MLQ A;  5DTB A;  3B6W A;  4K3F A;  2CZL A;  3TDJ A;  5FBP A;  3K2D A;  4BDL A;  4HCW A;  4RK9 A;  1MPC A;  3PUX E;  5KZT A;  3OO7 A;  4G4P A;  4OFJ A;  4DIG A;  4R2F A;  1INP A;  3HV1 A;  1AMF A;  1DPP A;  1H43 A;  3MQ9 A;  3OEL A;  1BLF A;  1AL3 A;  3RYD A;  2V25 A;  2Q74 A;  4ZED A;  4Q30 B;  1JNF A;  3TCH A;  5AA2 B;  3LSF B;  4FE8 A;  1XHY A;  2F34 A;  1WOD A;  2DP8 A;  4G61 A;  1Q9D A;  3ZKL A;  1SPI A;  1IIT A;  4KPT A;  4WKM A;  3FXR A;  3FVO A;  3O29 A;  4X1D A;  3EKI A;  4IGR A;  3MVX A;  2DE3 A;  3RPW A;  1MQD A;  4ONY A;  4IO3 A;  3QYT A;  2WYP A;  4EF1 A;  3HST A;  1P1O A;  1US5 A;  1LAX A;  3H6U A;  5I58 B;  2HZL A;  2ONR A;  1B46 A;  3MP6 A;  5AA1 A;  4I9D A;  3TTN A;  1LLS A;  2B4L A;  3K00 A;  1A55 A;  3FZV A;  3VLU A;  4WXJ A;  3ILT B;  5I3S A;  4NWD A;  4Z0I A;  3D4C A;  2PBW A;  1P1W A;  1MDP 1;  3B6T A;  4XF5 A;  1URD A;  4OVT A;  2LAO A;  4EQB A;  1LCT A;  2IEE A;  4RPO A;  4PGP A;  3IOT A;  4F2Q A;  5H8N A;  3FVG A;  2Z8D A;  5LDZ A;  1N0T A;  2QS3 A;  3IOR A;  2VHA A;  2O7I A;  1A40 A;  1FQE A;  3QUJ A;  4QBA A;  2HEU A;  2ONK E;  2VD3 A;  3G3G A;  5L8D A;  1B4H A;  2XXI A;  1A8E A;  2UYF A;  3IOW A;  3A29 A;  3U65 A;  2P3V A;  3W9V A;  5H8H A;  1IMA A;  1IMD A;  1MXV A;  4O8M A;  4JSO A;  1VDW A;  2O51 A;  1M5F A;  2XHD A;  3KOS A;  4LQ2 A;  4LZ7 A;  4QFN A;  4PFY A;  2FVZ A;  4LUB A;  1LBY A;  1K9Z A;  5H8F B;  4JVC A;  1Z7M E;  1YPN A;  4GQO A;  5ET6 A;  2DWI A;  3H6V A;  2Q2C A;  1KA0 A;  2OWT A;  2RC7 A;  3G3H A;  3LUY A;  1PBQ A;  4MLV A;  1USY E;  5I84 A;  2H25 A;  4GWS A;  4ECF A;  1B3F A;  4GD5 A;  1MG1 A;  1OVB A;  4H65 A;  3S2V A;  1LBX A;  2CZK A;  1FQC A;  4F31 B;  2DYX A;  1D9V A;  1Z7N E;  5FHN A;  4LN5 A;  3OSR A;  3FXU A;  1NV7 A;  3H7M A;  5ELV A;  5ICT A;  4H8J A;  2I49 A;  2Y5K A;  4OEV A;  3E4R A;  1NNF A;  1YYZ A;  3SEX A;  4POX A;  5HBC A;  1D9Q A;  1Y9U A;  1QVS A;  4GWZ A;  2XXH A;  4C0R A;  1DBZ A;  1TFA A;  2FYI A;  4ELP A;  1MM6 A;  3OEN A;  3G7W A;  2ANJ A;  2ALU A;  1H44 A;  4PF8 A;  4GXS B;  1B5H A;  4C1T A;  1URG A;  2D5W A;  3RQT A;  3HHG A;  3T1B A;  4QSD A;  2A5T B;  2FIE A;  3O66 A;  2XXQ A;  5TU0 A;  1FBD A;  3RNN A;  5I56 A;  4I8C A;  2GH9 A;  4U22 A;  3DP6 A;  3CIJ A;  4PBQ A;  1XT8 A;  1ZTY A;  5I2K B;  1SI0 A;  3BIG A;  4N4U A;  4R2B A;  3TZA A;  1G0I A;  4NF8 B;  3I5O A;  4F3P A;  2UYE A;  4OWD A;  3Q27 A;  3MST A;  4DLD A;  1FBP A;  4GWO A;  3U92 A;  4YB6 A;  2HCA A;  1NV6 A;  3UP9 A;  3LC8 A;  2OCU A;  3PPP A;  5I5P A;  1NNT A;  2CEY A;  3T96 B;  1B51 A;  2H9B A;  3UGW A;  4F3S A;  4BDR A;  4H5F A;  4X8R A;  5I2N A;  1AOV A;  1DCU A;  2AIX A;  5CBS A;  3RUM A;  1IUD A;  4TLL B;  1LCF A;  2F8D A;  3DLN A;  3THI A;  1MXW A;  4GOT A;  1ANF A;  2XXX A;  1SQY A;  4GX6 A;  4JDF A;  3RY3 A;  2O68 A;  3N26 A;  1MY2 A;  1NL5 A;  1VR5 A;  2XXW A;  2XD2 A;  1MXU A;  1DTZ A;  3TCG A;  3TQL A;  4YAH X;  3CG1 A;  2NXO A;  4O3B A;  5DEX B;  1LBB A;  2RCB A;  3SEU A;  1O64 A;  5FHO A;  3K02 A;  3VV5 A;  1JEU A;  5EYG A;  3TMG A;  4PFW A;  4PTK A;  4G2Z A;  4PGN A;  1S50 A;  3IB2 A;  1N7W A;  4LQ5 A;  1DK4 A;  3IX1 A;  4QFP A;  3VLW A;  4N6P A;  2NVU B;  4H67 A;  5DVF A;  3FD3 A;  5ET7 A;  2QSX A;  2KQZ A;  5L9S A;  1H3D A;  3FAT A;  3RT8 A;  3N6U A;  5IZ3 A;  3E78 A;  3MVY A;  4N8Y A;  4F3B A;  3O28 A;  5CMM A;  1YZ0 A;  4ZEK A;  5EYH A;  4FEC A;  3G3F A;  2Z8E A;  1JET A;  2PYY A;  3R6U A;  2BJJ X;  2I58 A;  3K6U A;  3QSL A;  3CFZ A;  1SDX A;  2X26 A;  3ZS6 A;  4I3Y A;  4IGT A;  5AA2 D;  4HE1 A;  3C4M A;  4PE5 B;  5IZ1 A;  4O3A A;  5AA4 A;  2DWH A;  2HXR A;  3U8Q A;  2PX1 A;  3K1N A;  5CM6 A;  3UIF A;  3CFL A;  2ZYM A;  3KN3 A;  4QFL A;  5TP9 B;  2W7Y A;  5IGA A;  3LBS A;  3MVW A;  3P7I A;  4OFL A;  2REJ A;  4XIG Q;  1OQH A;  3IOV A;  1OLA A;  1FJ9 A;  4EUO A;  5DT6 A;  3U72 A;  3KOT A;  2XWI A;  4OVJ A;  4JBZ A;  5IKB A;  3LV0 A;  3T22 A;  1YAE A;  2DXY A;  3OXN A;  2XD3 A;  3M3F A;  3EPE A;  3K6V A;  2VPN A;  4G68 B;  4U2R A;  4YKK A;  4OER A;  1OLC A;  2A5S A;  4G68 C;  2F35 A;  4HE0 A;  2ZZW A;  3CI8 A;  4OA4 A;  3WAE A;  2QS2 A;  3B6Q A;  4ZZE A;  1B3H A;  5JK4 A;  5H8Q B;  2RCA A;  4AB6 A;  1NNP A;  1SD3 A;  4GX3 A;  4OXV A;  3SER A;  2XWV A;  2XX7 A;  1A7L A;  1QJM A;  4Z7E A;  4F1Y A;  1RDY A;  4GVO A;  4QXD A;  1J1N A;  4H0W A;  2I3V A;  1ELJ A;  2DE4 A;  1B4Z A;  1FRP A;  2Y7R A;  4O94 A;  4UAC A;  2P0S A;  1B3G A;  5ITP A;  1SBP A;  4N13 A;  2FA7 A;  2V84 A;  1OMP A;  4MNC A;  3VXB A;  1FPF A;  1DMB A;  4WED A;  1UTB B;  1SVX B;  3CSG A;  1II5 A;  4NF4 A;  4TLM B;  4ZEF A;  1POT A;  3IL1 B;  1BKA A;  1EZ9 A;  3SEY A;  3AXF A;  2WX9 A;  2ABH A;  1SW4 A;  2NWJ A;  3A09 A;  1UTH B;  2DVC A;  5JTY A;  4Q0C A;  2M8C A;  1MY1 A;  1UIU A;  3RPL B;  4GRK A;  3W15 C;  2RIN A;  3ODB A;  4KD5 A;  2Y7P A;  3M3K A;  5ET8 A;  2H98 A;  1CB6 A;  3C33 A;  3PUW E;  2HXW A;  3HCQ A;  4YMB A;  4JWO A;  4RJZ A;  1IIW A;  3S9L C;  5IZZ A;  4NG7 A;  3IFC A;  1Y3P A;  3CR9 A;  4GXA A;  4P0G A;  1JEV A;  2WBD A;  1XVY A;  3MAM A;  3VDF A;  1EZO A;  3TTL A;  4PQJ A;  4U1Z A;  4DCX A;  3M3L A;  4EXK A;  3E13 X;  2F36 A;  4IR8 A;  4DCY A;  2G29 A;  1Y20 A;  2VPO A;  3OEK A;  1MXX A;  2QL3 A;  3B50 A;  4MNI A;  1B9J A;  2R8T A;  4P3L A;  2Y7W A;  1ZMG A;  3KJT A;  5DYH A;  2G93 A;  2I0B A;  4MX6 A;  4R75 A;  1B52 A;  1MH3 A;  1LEV A;  3D4G A;  3PD9 A;  2VOZ A;  2ZMB A;  4BLA A;  2QS4 A;  2ZNU A;  5K2Y A;  3ILU B;  2IA4 A;  3H6T A;  4JWX A;  4ZE8 A;  4DXU A;  1IMC A;  1HSE A;  3SES A;  3VFJ A;  3E79 A;  2E1S A;  1NV1 A;  3A3C A;  3FJG A;  3GZG A;  3LSX A;  3SEV A;  4PET A;  4NGU A;  4XEQ A;  3JYR A;  3IOU A;  3LSL A;  4QF9 A;  1MY4 A;  3N6T A;  2P2A A;  2XA5 A;  4NX1 A;  3UN6 A;  4IO5 A;  1SW5 A;  3HHF A;  3H06 B;  2Z22 A;  1LFG A;  4IO7 A;  3MWB A;  1JVX A;  3I3V A;  4R74 A;  4LZ8 A;  1FTK A;  1M5C A;  2WEF A;  1JP4 A;  3GBA A;  2D21 A;  3T66 A;  4EF2 A;  1EU8 A;  3USD A;  3CRB A;  5EHM A;  1L5T A;  3Q28 A;  1FCK A;  1AH5 A;  3FVK A;  1FPB A;  3K0V A;  3S9M C;  4O7M A;  3C35 A;  2R71 A;  4GWX A;  1B40 A;  1ZJL A;  1PBP A;  1FQF A;  3TPA A;  1B3L A;  3OOA A;  4MFI A;  4ZZA A;  3TTR A;  5ITO A;  4MEV A;  1URS A;  2RC9 A;  2Y5L A;  4NTL A;  4RA1 A;  1FPL A;  4FAT A;  2A5T A;  2QS1 A;  4NWC A;  5EQ8 A;  4ND9 A;  3IB0 A;  1IMF A;  3CHG A;  3KFM A;  3FVN A;  3HN0 A;  2QFL A;  4PE3 A;  1CNQ A;  2PCR A;  3T0J A;  4UA8 A;  4GLI A;  5EQ7 A;  4FBP A;  2GQ1 A;  3PPQ A;  2AL4 A;  3LR1 A;  5B7D A;  5TPA B;  3RLF E;  1M5B A;  4U4S A;  3IFA A;  1YCJ A;  3FJ7 A;  3OEM A;  2ZZV A;  3UK4 A;  2REG A;  2HAV A;  4R6H A;  4H1X A;  4GBW A;  3K1P A;  3PGF A;  2QVV A;  4EXL A;  1LGB C;  4NQ8 A;  3ISP A;  2GHA A;  4F39 A;  1NV4 A;  2GFE A;  4P9K A;  1A8F A;  3IB1 A;  4LZ5 A;  4M4G A;  3S9E A;  3S4U A;  5H8N B;  4KR5 A;  4OES A;  3RN8 A;  3T9V A;  4MJO A;  5L9M A;  2WBB A;  2FHY A;  5BWJ A;  1N3X A;  1VSO A;  2X7Q A;  1XOC A;  5IM2 A;  1Q35 A;  2Q8J A;  3U1O A;  4R9G A;  1GVC A;  4PBH A;  4XTC Q;  4OHN A;  1OQG A;  4GWY A;  1IZ1 A;  3O6H A;  3PV0 E;  4H45 A;  5H8H B;  5JEI A;  4JVD A;  5A5X A;  3SEW A;  3IO6 A;  5F7V A;  3RTW B;  1OIB A;  3A3U A;  2F7A A;  1Y3Q A;  3BFU A;  5DEX A;  4RPN A;  1FQA A;  5I59 A;  3TEP A;  2XWK A;  5K2X A;  2DSF A;  2RKM A;  4JXI A;  2DDK A;  3E3K A;  4BDQ A;  1FQD A;  1US4 A;  2I48 A;  4HS7 A;  1AIV A;  4OYV A;  2P1S A;  1FTL A;  4MBP A;  2B4M A;  1B32 A;  1Y4T A;  4FED A;  2DE2 A;  2OJT A;  1AWB A;  3KGC A;  2Z8F A;  4R6Y A;  4DZ1 A;  4OVR A;  2F7B A;  4BDM A;  1NH8 A;  3T9X B;  1TWY A;  2DQV A;  2H4I A;  3MZ1 A;  1LBV A;  4F22 A;  3G3J A;  3KEI A;  4QFO A;  4QSC A;  1LAH E;  3QAX A;  1FW0 A;  1GTK A;  4N6K A;  5KCJ A;  3QIM A;  4LAT A;  3VXC A;  3V89 B;  2Y7K A;  1P1Q A;  1ZKB A;  2ZZX A;  2XXR A;  1OVT A;  4KCC A;  5KDT A;  3H6W A;  3O97 A;  4FOR A;  4P0I A;  3T93 B;  1SW1 A;  3KJ7 A;  1ZU0 A;  3ZKK A;  5A5L A;  4ZS9 A;  4YU0 A;  1NUY A;  3MPK A;  1DOT A;  1Y4C A;  4GL0 A;  2PVU A;  4MMP A;  4YMA A;  1P99 A;  4MCO A;  1DSN A;  2OX3 A;  4HXV A;  3C36 A;  3PPR A;  2QPQ A;  4KXP A;  1MH4 A;  2H99 A;  2R6G E;  1GGG A;  1PDA A;  2OWS A;  1FTA A;  2UVI A;  4G8H A;  2UVH A;  2NOO A;  3BFT A;  4O7I A;  4YZZ A;  4DDD A;  4XXU A;  1FBF A;  2HPG A;  4IY6 A;  1FPI A;  5BUU A;  5I57 A;  2V3U A;  4ELO A;  3LUZ A;  1F9B A;  1R9L A;  5I56 B;  1FBE A;  3PD8 A;  1FPE A;  4P1E A;  4PCD A;  1N7X A;  3MBP A;  4F29 A;  3PU5 A;  1XVX A;  1TXF A;  2XXV A;  2F3D A;  3K4U A;  1D3K A;  1XC1 A;  2Y84 A;  4N8G A;  4YIC A;  4OVP A;  3V5A A;  4RY1 A;  3FUZ A;  3NOH A;  1FBC A;  3PPO A;  3O2A A;  2P3N A;  3FJM A;  5M2V A;  1NFT A;  2Z23 A;  1EYJ A;  1P1N A;  5I2N B;  4MH5 A;  1POY 1;  2O1L A;  2QMX A;  4AS5 A;  1MM7 A;  3VVE A;  4BDO A;  3TYH A;  1QKA A;  2I4B A;  3KG2 A;  1SW2 A;  1MPB A;  4H6D A;  2R9J A;  5CI5 A;  3MUQ A;  5CMB A;  1MY3 A;  3PUZ E;  2F78 A;  3MW0 A;  5FTI A;  4TOZ A;  2B3F A;  1UTH A;  1O7T A;  3FV1 A;  1LB9 A;  1FPD A;  3HFU A;  4OTE A;  1IXH A;  5DVI A;  1I6A A;  3FXQ A;  2OK2 A;  4NF5 B;  3MC2 A;  4F3G A;  3M8U A;  4ISU A;  4XKQ A;  4THI A;  4NF6 B;  2XXK A;  4P47 A;  1USY H;  3MYU A;  1B0H A;  1PEB A;  2GRV A;  4WEP A;  3MPL A;  5AA2 A;  2QJE A;  2F97 A;  4C1U A;  1PC3 A;  5HPQ A;  3TFL A;  1YXI A;  2HHM A;  4RK2 A;  4H5G A;  4KI0 E;  1BTJ A;  1I6B A;  4OQO A;  4KCD A;  4KFQ A;  4KQP A;  1IMB A;  2E0S A;  5IZ3 B;  1NNK A;  3DP8 A;  1I69 A;  4HW8 A;  4FIM A;  3K6W A;  1B7U A;  3O6G A;  1B1X A;  4X04 A;  1HSL A;  3WAF A;  3TKD A;  3C32 A;  3KN7 A;  2THI A;  1QUJ A;  4QFK A;  1EYK A;  2ESN A;  3O6I A;  3OO6 A;  4MHF A;  1HSJ A;  4DXC A;  2VD2 A; 
#chains in the Genus database with same CATH homology
 5I58 A;  3TQW A;  4LP2 B;  5H8S A;  5ICQ A;  4QSE A;  3K01 A;  2D3I A;  2YJP A;  5AA4 B;  5HM4 B;  1IXC A;  4ELR A;  1R1N A;  2UVJ A;  4RYA A;  3MJN A;  3MP1 A;  2FNC A;  2XX9 A;  2AL5 A;  1MRP A;  1UQW A;  1MS7 A;  4QRZ A;  3SDF A;  1S9T A;  4RXL A;  2ZYO A;  3KSX A;  3L6G A;  1LB8 A;  1MPD A;  3CFX A;  1EH3 A;  5B70 A;  1MQJ A;  4RNS A;  4XKR A;  1B7H A;  4F1V A;  3FGS A;  3K6X A;  2WKY A;  3QXM A;  4YKJ A;  3KBR A;  1LAG E;  4HCY A;  3UOR A;  4LA9 A;  3RTF B;  2Q89 A;  4FAJ A;  1GR2 A;  3OD7 A;  1D9Y A;  3CVG A;  1D4N A;  2I6E A;  3SKP A;  3IJX B;  2H5Y A;  3DM0 A;  4EQ7 A;  1UIV A;  3TAJ A;  4ELQ A;  3VVF A;  3PMV A;  3C31 A;  1PB7 A;  3PPN A;  5H8F A;  4PFT A;  2PT1 A;  4KHZ E;  2GHB A;  3MZB A;  2F6G A;  4YKP A;  4ZEC A;  2Q2A A;  3GBB A;  1B6H A;  4NF4 B;  2O6A A;  1JVY A;  3W9W A;  4U23 A;  4PP0 A;  5TPA A;  3UA8 A;  1VE4 A;  4F19 A;  3EF7 A;  5L9O A;  4I1D A;  1JW1 A;  4EDP A;  4H8I A;  5JTY B;  4X9T A;  4OMB A;  3O9P A;  5F1Q A;  2DXR A;  4DE8 A;  2B65 A;  3OMB A;  4ESX A;  3RGY A;  4AB5 A;  2NUV A;  3EHU A;  3I6V A;  4OET A;  1LAF E;  4POW A;  2PMS A;  4JSD A;  3N94 A;  4JWY A;  5CRY A;  1Q1K A;  2O7U A;  1T0K A;  4HTG A;  3PUY E;  3TCF A;  1MXZ A;  4U4X A;  4DXB A;  1N3W A;  1XS5 A;  1R6Z A;  4ZE9 A;  3QUF A;  3TOD A;  2QMW A;  2UXA A;  5CBR A;  4TQU Q;  4IO6 A;  3T9U A;  1B58 A;  1WDN A;  2OZZ A;  1Y1Z A;  4U1O A;  1JW5 A;  1QUI A;  4IO4 A;  3MZ9 A;  2DVZ A;  3CG3 A;  1R9Q A;  5I2K A;  4NF8 A;  3EHT A;  2DWJ A;  1CE2 A;  3BBR A;  3OSQ A;  2VP1 A;  1B1H A;  2Y7I A;  1LST A;  1B5J A;  4I62 A;  1ATG A;  4KYE A;  4X48 A;  1B7Z A;  2O69 A;  1DTG A;  3S9N C;  4G8N A;  3K1M A;  4LON B;  2DOJ A;  3H3G A;  3H4Z A;  1DPE A;  3B7D A;  1IQ7 A;  1VFE A;  2F7C A;  4GFR A;  1FTJ A;  3ECR A;  1PB9 A;  2Q9T A;  3QK6 A;  1LBC A;  1IXI A;  4GIZ A;  3N5L A;  4Q8R A;  1MQI A;  3FAS A;  2ZYK A;  3H03 A;  4FEB A;  2ZNS A;  1SYI A;  3LSW A;  1FQB A;  2O1M A;  3ONM A;  4R73 A;  3KZG A;  4EQ9 A;  3VLV A;  5FHM A;  3KN8 A;  2V93 A;  3JV9 A;  3T9H B;  3SET A;  4NMY A;  2B3B A;  1WVJ A;  4N07 A;  1P1U A;  1JW4 A;  3G3K A;  2X7P A;  2ZYN A;  1O63 A;  5ISU A;  1I6Q A;  5EYF A;  1MY0 A;  1IXG A;  4XKN A;  2OBG A;  1B2H A;  1MQH A;  3FIR A;  1A54 A;  3R26 A;  4NE4 A;  3IO4 A;  5IAI A;  4OEN A;  4E0W A;  4MF3 A;  5DVJ A;  3KSJ A;  1ZLQ A;  4M1V A;  4G8M A;  4ZEB A;  4OZ9 A;  1MDQ A;  2I3W A;  1QUK A;  2Q88 A;  1BIY A;  4U21 A;  3PMW A;  1PB8 A;  3BKI B;  4QHQ A;  4KYD A;  3E9X A;  2V3Q A;  3OO8 A;  5FTH A;  1KWH A;  4YKI A;  4IY5 A;  1YTV A;  2HZK A;  4IO2 A;  2XXP A;  2ONS A;  4GL8 A;  5LOM A;  2HAU A;  2XXU A;  1M5E A;  2I0C A;  5CMK A;  5TP9 A;  2F6P A;  1JQF A;  2ZNT A;  3VVD A;  3FV2 A;  3Q26 A;  2QRY A;  4O3C A;  3HPI A;  3EHS A;  2VGQ A;  5A5X B;  1ZIU A;  3R7X A;  1IEJ A;  4JB7 A;  4ESW A;  3RT6 B;  5J1D A;  4KYS A;  2PT2 A;  5I59 B;  4NF5 A;  4G68 A;  3Q29 A;  4NED A;  2F5X A;  4NF6 A;  4XKP A;  4E0X A;  2XXY A;  2I4C A;  3C9H A;  1B5I A;  1Y3N A;  1RKM A;  1B0L A;  1B3E A;  4L17 A;  5H8Q A;  3TTM A;  3C34 A;  1VFD A;  3IK6 B;  4G77 A;  1N76 A;  5CC2 A;  1GV8 A;  3PUV E;  4YB7 A;  4BDN A;  1QUL A;  1S7Y A;  4P11 A;  4OFO A;  5CMC A;  4X1B A;  5AA3 A;  5KCJ B;  3U94 A;  3Q25 A;  1H76 A;  4F18 A;  4R6K A;  4GF8 A;  3G3I A;  3TTK A;  2AYS A;  4OEU A;  3TUS A;  5KDT B;  3IAZ A;  4R9F A;  1BP5 A;  1Y1M A;  1UTB A;  2O84 X;  1N84 A;  3EN3 A;  2HQ0 A;  3F11 A;  5EHS A;  4Q5T A;  5AE4 A;  3GLB A;  1H45 A;  1SI1 A;  1TFD A;  4AQ4 A;  4IB2 A;  1SYH A;  4R72 A;  4PFU A;  1RYO A;  3V83 A;  3DP4 A;  1FTM A;  2ZXT A;  5I57 B;  3JZJ A;  2DS9 A;  2V3T A;  3CSB A;  3IR1 A;  1NH7 A;  2HFB A;  2YLN A;  2OLB A;  1LFH A;  2XX8 A;  4ZEI A;  3IJO B;  3EQ1 A;  3U93 A;  2XXT A;  1QKB A;  3MP8 A;  1MXY A;  1RYX A;  1A99 A;  4F1U A;  3ZSF A;  4FJP A;  1TT1 A;  4F2O A;  1NKX A;  4ZDM A;  1ZBM A;  2CMO A;  3TEL A;  1MQG A;  4YB5 A;  1FTO A;  3VE1 B;  2UVG A;  2RF1 A;  1M5D A;  1N04 A;  3V8X B;  3PMX A;  3OO9 A;  3DEL B;  1NMU A;  2YPN A;  3HO7 A;  2RC8 A;  1LFI A;  3L6H A;  1B05 A;  4LVQ A;  1EZP A;  3GXA A;  5DTB A;  2DWA A;  2KLF A;  1QW0 A;  3MVZ A;  4MLQ A;  3B6W A;  4K3F A;  2CZL A;  3TDJ A;  3K2D A;  4BDL A;  4HCW A;  4RK9 A;  1MPC A;  3PUX E;  5KZT A;  3OO7 A;  4G4P A;  4OFJ A;  4DIG A;  4R2F A;  3HV1 A;  1DPP A;  1AMF A;  1H43 A;  3MQ9 A;  3OEL A;  1BLF A;  1AL3 A;  2V25 A;  4ZED A;  4Q30 B;  1JNF A;  3TCH A;  5AA2 B;  3LSF B;  4FE8 A;  1XHY A;  2F34 A;  1WOD A;  2DP8 A;  3ZKL A;  1IIT A;  4KPT A;  4WKM A;  3FXR A;  3FVO A;  3O29 A;  4X1D A;  4IGR A;  3MVX A;  2DE3 A;  3RPW A;  1MQD A;  4ONY A;  4IO3 A;  3QYT A;  4EF1 A;  3HST A;  1P1O A;  1US5 A;  1LAX A;  3H6U A;  5I58 B;  2HZL A;  2ONR A;  1B46 A;  3MP6 A;  5AA1 A;  4I9D A;  3TTN A;  1LLS A;  3K00 A;  1A55 A;  3FZV A;  3VLU A;  4WXJ A;  3ILT B;  4NWD A;  4Z0I A;  3D4C A;  2PBW A;  1P1W A;  1MDP 1;  3B6T A;  1URD A;  2LAO A;  4EQB A;  1LCT A;  2IEE A;  4RPO A;  3IOT A;  4F2Q A;  5H8N A;  3FVG A;  2Z8D A;  1N0T A;  2QS3 A;  3IOR A;  2VHA A;  2O7I A;  1A40 A;  1FQE A;  3QUJ A;  2HEU A;  2ONK E;  2VD3 A;  3G3G A;  5L8D A;  1B4H A;  2XXI A;  1A8E A;  2UYF A;  3IOW A;  3W9V A;  5H8H A;  1MXV A;  4JSO A;  2O51 A;  1M5F A;  2XHD A;  3KOS A;  4LQ2 A;  4LZ7 A;  4QFN A;  4PFY A;  4LUB A;  5H8F B;  1Z7M E;  1YPN A;  4GQO A;  2DWI A;  3H6V A;  2Q2C A;  2OWT A;  2RC7 A;  3G3H A;  3LUY A;  1PBQ A;  4MLV A;  1USY E;  5I84 A;  2H25 A;  4ECF A;  1B3F A;  4GD5 A;  1MG1 A;  1OVB A;  4H65 A;  3S2V A;  1FQC A;  4F31 B;  2DYX A;  1D9V A;  1Z7N E;  5FHN A;  3OSR A;  3FXU A;  3H7M A;  5ELV A;  5ICT A;  4H8J A;  2I49 A;  4OEV A;  3E4R A;  1NNF A;  3SEX A;  4POX A;  5HBC A;  1Y9U A;  1QVS A;  2XXH A;  4C0R A;  1TFA A;  2FYI A;  4ELP A;  1MM6 A;  3OEN A;  3G7W A;  2ANJ A;  2ALU A;  1H44 A;  4GXS B;  1B5H A;  4C1T A;  1URG A;  2D5W A;  3RQT A;  3HHG A;  4QSD A;  2A5T B;  3O66 A;  2XXQ A;  5TU0 A;  3RNN A;  5I56 A;  4I8C A;  2GH9 A;  4U22 A;  3DP6 A;  3CIJ A;  1XT8 A;  1ZTY A;  5I2K B;  1SI0 A;  4R2B A;  3TZA A;  4NF8 B;  3I5O A;  4F3P A;  2UYE A;  4OWD A;  3Q27 A;  4DLD A;  4GWO A;  3U92 A;  4YB6 A;  2HCA A;  3UP9 A;  3LC8 A;  2OCU A;  3PPP A;  1NNT A;  3T96 B;  1B51 A;  2H9B A;  3UGW A;  4F3S A;  4BDR A;  4H5F A;  5I2N A;  1AOV A;  2AIX A;  5CBS A;  3RUM A;  1IUD A;  4TLL B;  1LCF A;  2F8D A;  3DLN A;  3THI A;  1MXW A;  4GOT A;  1ANF A;  2XXX A;  1SQY A;  4JDF A;  3RY3 A;  2O68 A;  3N26 A;  1MY2 A;  1NL5 A;  1VR5 A;  2XXW A;  2XD2 A;  1MXU A;  1DTZ A;  3TCG A;  3TQL A;  4YAH X;  3CG1 A;  2NXO A;  4O3B A;  5DEX B;  1LBB A;  2RCB A;  3SEU A;  1O64 A;  5FHO A;  3K02 A;  3VV5 A;  1JEU A;  3TMG A;  4PFW A;  4G2Z A;  1S50 A;  3IB2 A;  1N7W A;  4LQ5 A;  3IX1 A;  4QFP A;  3VLW A;  4N6P A;  2NVU B;  4H67 A;  5DVF A;  3FD3 A;  2QSX A;  5L9S A;  1H3D A;  3FAT A;  3RT8 A;  3N6U A;  3MVY A;  4F3B A;  3O28 A;  5CMM A;  4ZEK A;  4FEC A;  3G3F A;  2Z8E A;  1JET A;  2PYY A;  3R6U A;  2BJJ X;  2I58 A;  3K6U A;  3QSL A;  3CFZ A;  1SDX A;  2X26 A;  3ZS6 A;  4IGT A;  5AA2 D;  3C4M A;  4PE5 B;  4O3A A;  5AA4 A;  2DWH A;  3U8Q A;  2PX1 A;  3K1N A;  5CM6 A;  3UIF A;  3CFL A;  2ZYM A;  3KN3 A;  4QFL A;  5TP9 B;  2W7Y A;  3LBS A;  3MVW A;  3P7I A;  4OFL A;  2REJ A;  4XIG Q;  1OQH A;  3IOV A;  1OLA A;  4EUO A;  5DT6 A;  3U72 A;  3KOT A;  4OVJ A;  4JBZ A;  5IKB A;  3T22 A;  1YAE A;  2DXY A;  3OXN A;  2XD3 A;  3M3F A;  3EPE A;  3K6V A;  4G68 B;  4U2R A;  4YKK A;  4OER A;  1OLC A;  2A5S A;  4G68 C;  2F35 A;  3CI8 A;  3WAE A;  2QS2 A;  3B6Q A;  4ZZE A;  1B3H A;  5JK4 A;  5H8Q B;  2RCA A;  4AB6 A;  1NNP A;  1SD3 A;  4OXV A;  3SER A;  2XX7 A;  1A7L A;  1QJM A;  4Z7E A;  4F1Y A;  4GVO A;  1J1N A;  4H0W A;  2I3V A;  1ELJ A;  2DE4 A;  1B4Z A;  2Y7R A;  4UAC A;  2P0S A;  1B3G A;  5ITP A;  1SBP A;  4N13 A;  2FA7 A;  2V84 A;  1OMP A;  3VXB A;  1DMB A;  4WED A;  1UTB B;  1SVX B;  3CSG A;  1II5 A;  4NF4 A;  4TLM B;  4ZEF A;  1POT A;  3IL1 B;  1BKA A;  1EZ9 A;  3SEY A;  3AXF A;  2ABH A;  1SW4 A;  2NWJ A;  3A09 A;  1UTH B;  2DVC A;  5JTY A;  4Q0C A;  2M8C A;  1MY1 A;  1UIU A;  4GRK A;  3W15 C;  2RIN A;  3ODB A;  4KD5 A;  2Y7P A;  3M3K A;  2H98 A;  1CB6 A;  3C33 A;  3PUW E;  2HXW A;  3HCQ A;  4YMB A;  4JWO A;  4RJZ A;  1IIW A;  3S9L C;  1Y3P A;  3CR9 A;  4GXA A;  4P0G A;  1JEV A;  3MAM A;  1XVY A;  3VDF A;  1EZO A;  3TTL A;  4PQJ A;  4U1Z A;  4DCX A;  3M3L A;  4EXK A;  3E13 X;  2F36 A;  4DCY A;  2G29 A;  1Y20 A;  3OEK A;  1MXX A;  2QL3 A;  1B9J A;  2Y7W A;  1ZMG A;  3KJT A;  5DYH A;  2G93 A;  2I0B A;  4R75 A;  1B52 A;  1MH3 A;  3D4G A;  3PD9 A;  2VOZ A;  2ZMB A;  4BLA A;  2QS4 A;  2ZNU A;  5K2Y A;  3ILU B;  2IA4 A;  3H6T A;  4JWX A;  4ZE8 A;  4DXU A;  1HSE A;  3SES A;  3VFJ A;  2E1S A;  3A3C A;  3FJG A;  3GZG A;  3LSX A;  3SEV A;  4PET A;  3JYR A;  3IOU A;  3LSL A;  4QF9 A;  1MY4 A;  3N6T A;  2P2A A;  3UN6 A;  4IO5 A;  1SW5 A;  3HHF A;  3H06 B;  2Z22 A;  1LFG A;  4IO7 A;  3MWB A;  1JVX A;  3I3V A;  4R74 A;  4LZ8 A;  1FTK A;  1M5C A;  3GBA A;  2D21 A;  3T66 A;  4EF2 A;  1EU8 A;  3USD A;  3CRB A;  5EHM A;  1L5T A;  3Q28 A;  1FCK A;  1AH5 A;  3FVK A;  3K0V A;  3S9M C;  3C35 A;  2R71 A;  1B40 A;  1ZJL A;  1PBP A;  3TPA A;  1FQF A;  1B3L A;  3OOA A;  4MFI A;  4ZZA A;  3TTR A;  5ITO A;  1URS A;  2RC9 A;  4NTL A;  4RA1 A;  4FAT A;  2A5T A;  2QS1 A;  4NWC A;  4ND9 A;  3IB0 A;  3KFM A;  3FVN A;  3HN0 A;  4UA8 A;  4GLI A;  3PPQ A;  2AL4 A;  3LR1 A;  5B7D A;  5TPA B;  3RLF E;  1M5B A;  4U4S A;  1YCJ A;  3FJ7 A;  3OEM A;  3UK4 A;  2REG A;  2HAV A;  4R6H A;  4H1X A;  3K1P A;  3PGF A;  4EXL A;  1LGB C;  2GHA A;  4F39 A;  2GFE A;  1A8F A;  3IB1 A;  4LZ5 A;  4M4G A;  3S9E A;  3S4U A;  5H8N B;  4KR5 A;  4OES A;  3RN8 A;  3T9V A;  5L9M A;  5BWJ A;  1N3X A;  1VSO A;  2X7Q A;  1XOC A;  1Q35 A;  2Q8J A;  3U1O A;  4R9G A;  1GVC A;  4XTC Q;  4OHN A;  1OQG A;  1IZ1 A;  3O6H A;  3PV0 E;  5H8H B;  5JEI A;  5A5X A;  3SEW A;  3IO6 A;  5F7V A;  3RTW B;  1OIB A;  3A3U A;  2F7A A;  1Y3Q A;  3BFU A;  5DEX A;  4RPN A;  1FQA A;  5I59 A;  3TEP A;  5K2X A;  2DSF A;  2RKM A;  4JXI A;  3E3K A;  4BDQ A;  1FQD A;  1US4 A;  2I48 A;  4HS7 A;  1AIV A;  4OYV A;  2P1S A;  1FTL A;  4MBP A;  1B32 A;  1Y4T A;  4FED A;  2DE2 A;  2OJT A;  3KGC A;  2Z8F A;  4R6Y A;  4DZ1 A;  2F7B A;  4BDM A;  1NH8 A;  3T9X B;  1TWY A;  2DQV A;  2H4I A;  3MZ1 A;  4F22 A;  3G3J A;  3KEI A;  4QFO A;  4QSC A;  1LAH E;  3QAX A;  1FW0 A;  1GTK A;  5KCJ A;  3QIM A;  4LAT A;  3VXC A;  3V89 B;  2Y7K A;  1P1Q A;  1ZKB A;  2XXR A;  1OVT A;  4KCC A;  5KDT A;  3H6W A;  3O97 A;  4FOR A;  4P0I A;  3T93 B;  1SW1 A;  3KJ7 A;  1ZU0 A;  3ZKK A;  4ZS9 A;  4YU0 A;  3MPK A;  1DOT A;  1Y4C A;  4GL0 A;  2PVU A;  4YMA A;  1P99 A;  1DSN A;  3C36 A;  3PPR A;  2QPQ A;  1MH4 A;  2H99 A;  2R6G E;  1GGG A;  1PDA A;  2OWS A;  2UVI A;  4G8H A;  2UVH A;  2NOO A;  3BFT A;  4YZZ A;  4DDD A;  4XXU A;  4IY6 A;  5BUU A;  5I57 A;  2V3U A;  4ELO A;  1F9B A;  1R9L A;  5I56 B;  3PD8 A;  1N7X A;  3MBP A;  4F29 A;  3PU5 A;  1XVX A;  1TXF A;  2XXV A;  3K4U A;  1D3K A;  1XC1 A;  2Y84 A;  4YIC A;  3V5A A;  4RY1 A;  3FUZ A;  3PPO A;  3O2A A;  3FJM A;  5M2V A;  1NFT A;  2Z23 A;  1P1N A;  5I2N B;  4MH5 A;  1POY 1;  2O1L A;  2QMX A;  1MM7 A;  3VVE A;  4BDO A;  3TYH A;  1QKA A;  2I4B A;  3KG2 A;  1SW2 A;  1MPB A;  4H6D A;  2R9J A;  5CI5 A;  3MUQ A;  5CMB A;  1MY3 A;  3PUZ E;  2F78 A;  3MW0 A;  5FTI A;  4TOZ A;  2B3F A;  1UTH A;  1O7T A;  3FV1 A;  1LB9 A;  4OTE A;  1IXH A;  5DVI A;  1I6A A;  3FXQ A;  2OK2 A;  4NF5 B;  3MC2 A;  4F3G A;  3M8U A;  4ISU A;  4XKQ A;  4THI A;  4NF6 B;  1USY H;  1B0H A;  1PEB A;  2GRV A;  4WEP A;  3MPL A;  5AA2 A;  2QJE A;  2F97 A;  4C1U A;  1PC3 A;  5HPQ A;  3TFL A;  4RK2 A;  4H5G A;  4KI0 E;  1BTJ A;  1I6B A;  4OQO A;  4KCD A;  4KFQ A;  4KQP A;  2E0S A;  1NNK A;  3DP8 A;  1I69 A;  4HW8 A;  4FIM A;  3K6W A;  1B7U A;  3O6G A;  1B1X A;  1HSL A;  3WAF A;  3TKD A;  3C32 A;  3KN7 A;  2THI A;  1QUJ A;  4QFK A;  2ESN A;  3O6I A;  3OO6 A;  1HSJ A;  4DXC A;  2VD2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...