4LATA

Crystal structure of phosphate abc transporter, periplasmic phosphate-binding protein psts 1 (pbp1) from streptococcus pneumoniae canada mdr_19a in complex with phosphate
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
260
structure length
260
Chain Sequence
ESITAVGSTALQPLVEVAADEFGTIHVGKTVNVQGGGSGTGLSQVQSGAVDIGNSDVFAEEKDGIDASALVDHKVAVAGLALIVNKEVDVDNLTTEQLRQIFIGEVTNWKEVGGKDLPISVINRAAGSGSRATFDTVIMEGQSAMQSQEQDSNGAVKSIVSKSPGAISYLSLTYIDDSVKSMKLNGYDLSPENISSNNWPLWSYEHMYTLGQPNELAAEFLNFVLSDETQEGIVKGLKYIPIKEMKVEKDAAGTVTVLEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of phosphate ABC transporter, periplasmic phosphate-binding protein PstS 1 (PBP1) from Streptococcus pneumoniae Canada MDR_19A in complex with phosphate
rcsb
source organism Streptococcus pneumoniae
molecule tags Transport protein
molecule keywords Phosphate-binding protein PstS 1
total genus 87
structure length 260
sequence length 260
ec nomenclature
pdb deposition date 2013-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4latA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4latA02
3RQTA 2PT1A 3OEMA 3RLFE 3THIA 1R6ZA 1B3GA 1UQWA 4EQ9A 3MUQA 2XXWA 1US5A 3IR1A 3CFZA 1LFIA 3LSLA 1HSLA 3FVGA 3KN3A 3N26A 1ZJLA 4L17A 5EHMA 3ODBA 5TPAA 4YKPA 3SEUA 5HPQA 4LUBA 1EZOA 3IOWA 3OO7A 1URSA 4IGTA 3T9HB 4PFWA 1DSNA 1KWHA 1N3WA 3M3KA 4R74A 3G3FA 3TAJA 3IAZA 2V25A 2I6EA 4GLIA 2A5TA 3OO9A 5AA2A 5I57A 3K0VA 2O1MA 4OYVA 5H8NA 3VFJA 1AIVA 1JNFA 1DPPA 2HFBA 1MRPA 2RF1A 1B3EA 3E13X 3ECRA 5CMKA 1Z7ME 4ELOA 4RY1A 2E0SA 2H25A 3UGWA 1B2HA 3S9NC 1MXZA 3HN0A 5J1DA 2DVCA 3O2AA 1SVXB 1FQCA 2XHDA 1LAXA 4IY6A 1B3LA 2CMOA 2F35A 3H6WA 5KDTA 4YU0A 1TWYA 5F7VA 5H8HB 3U92A 1NH8A 2QPQA 3H6UA 1XVYA 1NFTA 4OXVA 4U21A 1FTOA 1LB8A 2VD3A 3MP6A 4LVQA 2ZYMA 4IB2A 3QIMA 3TTKA 1IXGA 3GBAA 3ZS6A 4PE5B 4FAJA 5I59B 1NNPA 1QVSA 3MC2A 1MQDA 4NTLA 4JWOA 5I2NB 1QUIA 3C35A 3PUZE 2XXPA 5I58A 3RTFB 4NF6B 4QFKA 4OVJA 3MQ9A 1LAGE 2DE4A 4X9TA 3UA8A 1ZMGA 1B7ZA 3TKDA 1BTJA 4H6DA 4C1TA 1R9QA 1OQHA 3OENA 4NF6A 1AOVA 5CMCA 4RYAA 1P1WA 4DZ1A 5H8HA 4ZEKA 1TFAA 2PX1A 3PGFA 3K00A 2ZYNA 3WAEA 2Z23A 1D9YA 4I1DA 2Y84A 3ONMA 2RC7A 1PBPA 1B40A 2D3IA 2DWJA 3ILTB 3O9PA 5DEXA 5DVIA 2F78A 3TCGA 3FJMA 1TFDA 4AQ4A 5I2KA 3CR9A 3DP4A 4G68B 3T9VA 5A5XA 1N04A 4RK9A 1B5JA 3IJOB 2RC8A 4H5GA 4NF4A 5DEXB 2HAUA 3VXBA 4EDPA 3V8XB 4F39A 2ZNUA 3KOSA 3BBRA 1FTJA 1H44A 3U93A 1IXIA 4DDDA 2FNCA 3VE1B 5TU0A 4BDMA 1ZTYA 3JV9A 4RA1A 4DXUA 3D4CA 3OSRA 3M8UA 2Q9TA 2X7QA 1HSJA 3MZBA 1POTA 5I58B 1BKAA 5H8NB 1B0LA 4MFIA 2I48A 5AE4A 3PUYE 4PFUA 1FW0A 1OQGA 1D3KA 2NUVA 2B65A 3DP8A 4R6HA 1II5A 2DXRA 2H9BA 3K4UA 3VXCA 3SEXA 5BWJA 1OMPA 4U1OA 5CRYA 1N76A 3QUFA 3TTLA 4DIGA 2F97A 1JW4A 4KYDA 1SYIA 3O29A 1XS5A 5LOMA 3CIJA 1O7TA 1VFDA 3EF7A 3PU5A 2IA4A 2NVUB 1YAEA 4P11A 2A5SA 3TTMA 4BDRA 2UVIA 4ZEFA 4HW8A 1MPDA 1Y1ZA 4H67A 1VFEA 4F3BA 2Q2CA 3TZAA 2QS3A 1LCTA 2DS9A 3OD7A 1L5TA 4AB5A 1PEBA 3FD3A 3IOTA 2Z22A 3FJ7A 4IO6A 4KYEA 4O3AA 4O3BA 5L9SA 3H03A 4X1BA 2OCUA 4IY5A 3TTRA 3T93B 3MVXA 3VV5A 1B32A 4K3FA 4GVOA 3IO4A 1Y3QA 2I3VA 4XKQA 1QULA 5HM4B 4IO3A 3FASA 3CFLA 1I6BA 3TDJA 2XXRA 4KCDA 4JB7A 4R9FA 4YB7A 5ITPA 3OOAA 4X48A 1B46A 2DP8A 1NH7A 3O6IA 5M2VA 3O28A 5K2YA 3UK4A 2QL3A 2H98A 1PC3A 1SYHA 2DXYA 2I4CA 2ONSA 4JWXA 2REJA 3VVEA 1SD3A 3EQ1A 3SEWA 4Z7EA 4ZEBA 1XOCA 3IB0A 4OFOA 4Q5TA 4QSDA 5I56A 4FECA 2P2AA 2VHAA 1Y20A 1OVBA 1URGA 4QRZA 3W15C 1B0HA 3K02A 1A54A 1ZLQA 1MY0A 1SI0A 2PVUA 1DTZA 4BDNA 1B4HA 1N0TA 4LZ8A 5FHMA 2DQVA 3LSWA 3MZ1A 1WODA 1N3XA 1NL5A 2RC9A 3C36A 4NWDA 4O3CA 4YKKA 4EQ7A 2UVGA 2DWAA 1OLCA 4OHNA 4PP0A 3H6TA 1RKMA 4U23A 3BFTA 1TXFA 3Q27A 5H8QB 5ISUA 3TQWA 2XXHA 3KJ7A 3DP6A 3PD9A 3N6UA 5F1QA 4LATA 4F3GA 1B05A 4F1VA 3LBSA 3VVFA 2V3UA 2W7YA 1SQYA 2ZNSA 2VD2A 4F22A 2DE2A 3K6UA 1P99A 2F36A 3W9WA 1M5DA 3KSJA 5H8SA 3SERA 4GOTA 2ALUA 3H3GA 3I5OA 1PB7A 1SBPA 4GL8A 4NWCA 1FQDA 4OTEA 4G2ZA 4R72A 3L6HA 4F2QA 4I9DA 3E4RA 4YMBA 2DVZA 2AL4A 2M8CA 3B6WA 4M1VA 3SEYA 2HCAA 2QS4A 4KI0E 4JSDA 1MH4A 2XX8A 1B1HA 2X7PA 4GQOA 2Z8DA 3C4MA 3O66A 5KCJA 3KEIA 1MPCA 3HV1A 4GF8A 4KCCA 3ZKKA 3MVWA 3IB2A 1VE4A 1M5EA 2UYFA 2V84A 3OSQA 1A8FA 2DWIA 3G3GA 4ONYA 3PPQA 4XXUA 2ABHA 4ELPA 2QMWA 2XXUA 3FJGA 1S50A 4TOZA 3EPEA 4WXJA 2G93A 1QJMA 1MM7A 3TCFA 3S9LC 3MP1A 1Q1KA 3FVKA 5CMMA 3QAXA 3MP8A 1CB6A 4RXLA 4NF5A 5TP9A 1IITA 4ECFA 1MY4A 2XXIA 4JWYA 1BLFA 5CI5A 4I8CA 5AA4A 1XT8A 3KN7A 1PDAA 1ELJA 2YPNA 5JEIA 2D21A 4OQOA 1MQHA 1EZ9A 3R26A 4LONB 1A7LA 2FYIA 5H8QA 4NF8A 1QKBA 5B7DA 1GTKA 1UIUA 3FUZA 3DM0A 3VLUA 2ZXTA 1SW1A 4OESA 3P7IA 4GFRA 1B6HA 3PUVE 1MQJA 2XX7A 3DELB 3C9HA 4FIMA 4H8JA 3KOTA 4G68A 1FTKA 1ZIUA 3K6XA 4NMYA 4OZ9A 2P0SA 1N7WA 1FQFA 3IO6A 4MLVA 1PB8A 2PBWA 5ELVA 5I2KB 5AA1A 3VLVA 3W9VA 1TT1A 4XKPA 4MH5A 4G8HA 2NOOA 4Q8RA 3LC8A 3MBPA 2XXXA 1AL3A 2H99A 2D5WA 3BKIB 3H4ZA 5I56B 1H45A 3A3UA 5JK4A 3T96B 2OWSA 4H8IA 1UTBB 4RPNA 4GD5A 4JSOA 1WVJA 4H5FA 5AA3A 3IX1A 5L8DA 2H4IA 4MBPA 4KQPA 4NE4A 4U22A 3UN6A 2O6AA 1B9JA 2X26A 4EXLA 3EHTA 3LSFB 4G68C 3CSGA 4QHQA 4U2RA 1IQ7A 2PYYA 3WAFA 5H8FB 3MPKA 2VGQA 3F11A 1JQFA 1LGBC 5CM6A 4YICA 1IIWA 2RINA 3SESA 4XTCQ 2Y7KA 3TTNA 3G3HA 4ESXA 5K2XA 1O64A 2Y7WA 2DWHA 3IORA 3OMBA 1PB9A 4Q0CA 1MXWA 1ATGA 3V5AA 3FVOA 4ESWA 1LCFA 3MW0A 3ZKLA 2DSFA 1MPBA 3QUJA 3CI8A 3EN3A 2RCBA 3RN8A 3TMGA 4FEDA 3IJXB 4KD5A 4ZEIA 4ZECA 5CMBA 4ND9A 3TODA 1DOTA 4THIA 3SDFA 1B3FA 4X1DA 3BFUA 4OFJA 3FXQA 3TCHA 4HCWA 3S4UA 1RYXA 1MM6A 1SW5A 1UIVA 2V93A 1UTHA 2XXVA 3K01A 1YTVA 3N94A 4N07A 4F19A 1XHYA 5DYHA 5B70A 2NWJA 1AH5A 2FA7A 3VDFA 4NF5B 4EF2A 4IGRA 4RJZA 5I57B 1B7UA 4LP2B 1PBQA 2O7IA 2PMSA 3HCQA 3LR1A 4G77A 5H8FA 5TPAB 1USYH 2ZYOA 3FGSA 4GXAA 3KJTA 2GH9A 4U1ZA 1A40A 4LQ2A 1MQGA 2RCAA 3SEVA 1NMUA 3PMWA 4GRKA 4I62A 2OZZA 3C32A 1EU8A 1FTMA 1MXVA 2I49A 3MAMA 3CFXA 1LLSA 4LQ5A 4N6PA 1UTHB 1YPNA 3R6UA 4NF4B 3H7MA 2ZNTA 3U94A 4C0RA 5CBRA 2F6GA 4JDFA 2V3QA 3I3VA 5EHSA 2QMXA 1IXHA 1H3DA 3PMVA 4TLMB 1DPEA 4XKRA 3T22A 3TQLA 3C31A 4WEPA 5ITOA 2ONRA 2QSXA 1LFGA 1IUDA 1SDXA 2YJPA 2XD3A 3K6VA 1I6AA 3IOUA 4GWOA 3KZGA 4QSEA 1LFHA 2A5TB 2I4BA 4DXBA 4R2FA 5I84A 4KPTA 1XC1A 1FCKA 2XX9A 1OVTA 4MF3A 3TELA 2HEUA 5HBCA 4YZZA 2Q8JA 3USDA 1GR2A 3TEPA 4H65A 5DT6A 2CZLA 4NF8B 2DYXA 1MDQA 3E3KA 4FATA 5FTIA 2OJTA 4F18A 4QSCA 1I6QA 1JW1A 1BP5A 1EH3A 2O51A 3IL1B 4OENA 4YKJA 4BLAA 4JXIA 1EZPA 5ICTA 2H5YA 2DE3A 1LBCA 1MXYA 1MXUA 1ZBMA 1S7YA 2OBGA 3JYRA 3O6HA 1ZU0A 2O1LA 1O63A 3T66A 2HZLA 2ESNA 2UVJA 3DLNA 4GL0A 4F31B 1GVCA 4HTGA 3CVGA 3EHSA 4QFOA 3TFLA 1GV8A 3FXRA 3V89B 3Q29A 2I0CA 3PPOA 1H43A 3MWBA 3OXNA 4OFLA 3PUXE 3EHUA 4M4GA 4R6KA 3VLWA 3VVDA 2WKYA 4KFQA 1DTGA 4H1XA 1B4ZA 2I0BA 4DLDA 4TLLB 2F8DA 3U1OA 2O84X 2F34A 3C34A 4E0XA 1FTLA 1I69A 3B6QA 3C33A 3HPIA 3KN8A 4KYSA 4R2BA 4EXKA 1B52A 5AA4B 1T0KA 3M3FA 1A99A 5TP9B 4YKIA 3QYTA 1NKXA 3FVNA 4OWDA 2Y7PA 5IKBA 3CG1A 3FV2A 4UA8A 3MZ9A 2IEEA 3PPNA 1QW0A 4MLQA 1B51A 3CRBA 2PT2A 3E9XA 1P1UA 2ONKE 2HXWA 4QFNA 3S2VA 1URDA 2QJEA 1LBBA 2F5XA 2THIA 3QK6A 4N13A 1Y9UA 4Z0IA 2UXAA 4EUOA 3Q25A 2VP1A 1Y4CA 3R7XA 4DE8A 2YLNA 5L9OA 2B3BA 3B7DA 4FE8A 2KLFA 1JVXA 4GIZA 4P0IA 2V3TA 5I59A 3KBRA 4EQBA 1M5CA 2QS1A 2HQ0A 3RPWA 1B1XA 3QXMA 5KCJB 2ANJA 1Y4TA 2ZMBA 1NNFA 1JEVA 3IK6B 1SW2A 3I6VA 3PMXA 4YB5A 1US4A 3RNNA 4P0GA 3TPAA 1B5HA 3A3CA 1ANFA 2UYEA 3PV0E 4G8MA 2Q89A 1LAFE 4OEUA 4OEVA 1QUKA 4ZZEA 3RT6B 4ELQA 4F3SA 2R6GE 1Q35A 1Y3NA 4ZDMA 3LUYA 1LB9A 3KG2A 4POXA 1M5BA 2RKMA 2XD2A 3G3KA 3RUMA 4ZEDA 2O7UA 3UIFA 3KGCA 3PPRA 2F7AA 4G8NA 5ICQA 3N6TA 1D4NA 3HSTA 4YB6A 5BUUA 3V83A 2AIXA 5AA2B 3K1MA 2OK2A 3FZVA 4U4SA 5FHOA 4LZ7A 3G3JA 4DCYA 4E0WA 4DXCA 5KZTA 4WEDA 3UP9A 4R6YA 5FTHA 3AXFA 2Y7IA 4JBZA 1R1NA 1J1NA 1HSEA 2Q88A 3GBBA 3KFMA 3SKPA 4DCXA 1P1QA 5JTYA 1B5IA 5DVFA 5IAIA 3H6VA 4PFTA 1M5FA 1VSOA 4OERA 3HHGA 1FQEA 4Q30B 4TQUQ 4ISUA 4YAHX 3RT8A 5AA2D 1UTBA 3Q28A 3GZGA 1IXCA 2XXQA 2ZYKA 3KSXA 3N5LA 5FHNA 2Z8EA 3FXUA 1DMBA 1MY2A 1R9LA 4HCYA 4C1UA 3FATA 1JVYA 1LAHE 1Y3PA 2OWTA 2BJJX 3A09A 1F9BA 1B58A 1A8EA 1FQAA 3ILUB 3PPPA 2AL5A 1OIBA 4ZE8A 2B3FA 1IZ1A 1RYOA 2GHAA 4QFLA 1FQBA 3G7WA 3S9EA 4XKNA 3MPLA 2QRYA 1P1OA 1USYE 1MDP1 1POY1 1QKAA 3QSLA 3K2DA 1ZKBA 4ELRA 4R73A 3MVZA 4YMAA 1N7XA 3FIRA 3OO6A 2NXOA 1MQIA 2REGA 2HAVA 5JTYB 3D4GA 2Z8FA 3OELA 4RK2A 4IO4A 1IEJA 3HO7A 3TYHA 4F1YA 3IB1A 3L6GA 3OO8A 1A55A 4UACA 3OEKA 3PUWE 3MVYA 2OLBA 4BDLA 1N84A 4PETA 1LSTA 2O69A 3GLBA 3RY3A 2R71A 3S9MC 2F7CA 2F6PA 2XXYA 4HS7A 2DOJA 2I3WA 3CG3A 3O6GA 5CBSA 1OLAA 5A5XB 3B6TA 1SW4A 2GHBA 3T9UA 2Q2AA 3U8QA 4EF1A 1P1NA 4IO5A 3UORA 2I58A 3TUSA 4BDOA 3ZSFA 2O68A 2R9JA 1NNKA 1MXXA 3G3IA 1MS7A 3K1PA 4F2OA 1VR5A 2UVHA 4LA9A 3LSXA 4H0WA 4KR5A 4WKMA 1MY1A 5L9MA 4PFYA 3U72A 2G29A 1MH3A 3HHFA 4AB6A 2XXTA 4F29A 3Q26A 1MY3A 2GRVA 3CSBA 1Z7NE 1S9TA 4ZS9A 4F1UA 1JETA 3H06B 5KDTB 4PQJA 1QUJA 1WDNA 5DTBA 4ZZAA 1JW5A 4QF9A 2F7BA 1CE2A 2QS2A 3O97A 3T9XB 1H76A 1MG1A 3FV1A 3SETA 4GXSB 4F3PA 5I2NA 4OMBA 4XIGQ 4G4PA 4BDQA 1JEUA 2GFEA 1B7HA 2HZKA 4NEDA 4POWA 4R75A 4RNSA 4RPOA 5DVJA 3GXAA 2E1SA 4R9GA 3RGYA 5EYFA 3PD8A 1SI1A 4KHZE 4FORA 4QFPA 3RTWB 3K1NA 4IO7A 1B3HA 2Y7RA 3MJNA 1D9VA 1XVXA 4OETA 3K6WA 4FJPA 1BIYA 4IO2A 4LZ5A 5CC2A 3JZJA 1AMFA 1Y1MA 2VOZA 2AYSA 1NNTA 2P1SA 4FEBA 1GGGA 1YCJA 2LAOA 3M3LA 4ZE9A 3IOVA 4U4XA
chains in the Genus database with same CATH superfamily
3OEMA 3THIA 1UQWA 3MUQA 2KQZA 1US5A 3IR1A 5HPQA 1EZOA 2OWZA 4PF8A 2A5TA 3T0JA 2O1MA 1NV4A 3ECRA 1DPPA 1MXZA 2DVCA 3H6WA 5KDTA 1INPA 5H8HB 2QPQA 4OXVA 3H6UA 4LVQA 3TTKA 3MP6A 2ZYMA 4NTLA 4JWOA 3UA8A 4GX3A 4H6DA 4C1TA 1OQHA 3OENA 1P1WA 5H8HA 3ISPA 1TFAA 2ZYNA 5DEXA 4AQ4A 5A5XA 1N04A 1FPIA 1B5JA 4F39A 2CZKA 3BBRA 3GYYA 3VE1B 4BDMA 4RA1A 4GWZA 3M8UA 1POTA 5AE4A 4PFUA 1OQGA 2B65A 2DXRA 4FBPA 1OMPA 5CRYA 3QUFA 3TTLA 1JW4A 1O7TA 1FBGA 4BDRA 1Y1ZA 4F3BA 1L5TA 2Z22A 4IO6A 4X1BA 4XKQA 3FASA 1I6BA 5ITPA 4NF0A 3O28A 2QL3A 4PAFA 2I4CA 4JWXA 5ET8A 5I56A 3BIHA 4QRZA 1DCUA 3W15C 1SI0A 2PVUA 4BDNA 1B4HA 4LZ8A 3MZ1A 1NL5A 4NWDA 4OHNA 4PP0A 3BFTA 1TXFA 5H8QB 5F1QA 2ZNSA 2VD2A 5H8SA 1EYIA 4GL8A 4F2QA 3QMFA 2M8CA 3B6WA 1MH4A 3BIGA 2Z8DA 3O66A 5KCJA 3HV1A 3ZKKA 4OVSA 1M5EA 3OSQA 1A8FA 2DWIA 1FPEA 2V4CA 2ABHA 4PGPA 4XXUA 1LBWA 3FJGA 5IGAA 1QJMA 3S9LC 1Q1KA 2ZZWA 2B4MA 1MY4A 2D21A 4OQOA 2FYIA 5H8QA 4NF8A 1GTKA 1UIUA 3VLUA 3DM0A 1FTAA 1B6HA 1MQJA 3DELB 3C9HA 1FTKA 4OZ9A 1N7WA 4MLVA 1TT1A 2NOOA 3FBPA 1AL3A 2D5WA 3BKIB 5I56B 4H8IA 1UTBB 4GD5A 5F24A 5AA3A 3HFUA 2O6AA 4EXLA 4QHQA 2PYYA 1IMDA 5CM6A 4YICA 2CEXA 1IIWA 1JP4A 2RINA 2Y7KA 1O64A 2DWHA 3FVOA 3QUJA 3SDFA 1B3FA 5A5LA 1FPLA 4OFJA 3S4UA 3N94A 1YXIA 2XXVA 1YTVA 3VDFA 4IGRA 1B7UA 4LP2B 3HCQA 2PMSA 3LR1A 3FGSA 4GXAA 2CEYA 4U1ZA 2RCAA 3MAMA 1MXVA 4N6PA 5J1DA 1YPNA 2QMXA 3PMVA 3TQLA 4AS4A 3K6VA 3KZGA 4QSEA 1LFHA 4R2FA 1FCKA 1OVTA 3TELA 5HBCA 2Q8JA 1GR2A 2CZLA 1XI6A 1MDQA 2Y5KA 1EZPA 2DE3A 1LBCA 1NUYA 3JYRA 2UVJA 3DLNA 4XEQA 1FBDA 2GQ1A 3CVGA 3TFLA 1NV1A 4OFLA 3OXNA 3VVDA 2O84X 4E0XA 3RPLA 3HPIA 4KYSA 3CG1A 3FV2A 2IEEA 4MLQA 3CRBA 5EYGA 2HXWA 2VPOA 2QJEA 4BLAA 4EUOA 2THIA 4N13A 1Y4CA 5L9OA 2B3BA 5I59A 4EQBA 5KCJB 2ZMBA 3IK6B 4OEVA 4OEUA 3LV0A 2DDKA 5LTCA 4LN5A 2XD2A 5AA2B 4GX4A 4DXCA 4LZ7A 3AXFA 3GBBA 1B5IA 1M5FA 1VSOA 4MCOA 3RT8A 4YAHX 4ISUA 5AA2D 3N5LA 1R9LA 1Y3PA 4N6DA 3ILUB 4UABA 1IZ1A 3G7WA 3MPLA 2QRYA 3K2DA 3MVZA 1N7XA 3OO6A 4GX6A 3HO7A 4XF5A 3TYHA 5ET6A 1A55A 2OLBA 1N84A 3RY3A 2R71A 2XXYA 4HS7A 3O6GA 3B6TA 2GHBA 4MEVA 3TUSA 4BDOA 2JJKA 4LA9A 4WKMA 3U72A 2G29A 4F29A 3CSBA 1Z7NE 1JETA 4PQJA 4QF9A 1H76A 3FV1A 4GXSB 5I2NA 4OMBA 4G4PA 4BDQA 1JEUA 2HZKA 3RGYA 2E1SA 4R9GA 5EYFA 3PD8A 4FORA 4IO2A 1AMFA 2AYSA 4ZE9A 4U4XA 2PT1A 5IM2A 3CFZA 1HSLA 3FVGA 5EHMA 2PFYA 5TPAA 4YKPA 4LUBA 3OO7A 4P1LA 1DSNA 3M3KA 4R74A 3IFCA 3IAZA 4GLIA 2I6EA 1MRPA 3E13X 1B3EA 5CMKA 1Z7ME 2H25A 4PAKA 4P9KA 1B3LA 2F35A 5I5PA 1XVYA 3GBAA 4PE5B 1IMAA 3C35A 5EQAA 4NF6B 4OVJA 3MQ9A 2FHYA 4MHFA 4MNCA 5CMCA 4O7IA 3PGFA 3WAEA 2Z23A 4OVPA 1PBPA 3FJMA 5I2KA 3DP4A 2FVZA 4NF4A 3U93A 2Q74A 2FNCA 4NHBA 5TU0A 3JV9A 4DXUA 1HSJA 5I58B 4N8GA 1B0LA 3PUYE 2NUVA 4R6HA 1II5A 3K4UA 3SEXA 1SYIA 3O29A 1XS5A 5LOMA 3CIJA 3EF7A 2NVUB 2UVIA 4HW8A 4OA4A 4H67A 1LCTA 3OD7A 3FJ7A 2OCUA 1FPJA 3T93B 3VV5A 1NUZA 1Q9DA 4GVOA 3KC1A 4PBHA 4R9FA 1B46A 1NH7A 3O6IA 4O7MA 5K2YA 3UK4A 2ONSA 2REJA 3EQ1A 4OFOA 4Q5TA 4QSDA 3K02A 1A54A 4OANA 4JVIA 3E79A 5FHMA 3LSWA 2HPGA 3C36A 1EYKA 4EQ7A 1RKMA 3TQWA 3LBSA 4F22A 2DE2A 4N15A 1M5DA 3KSJA 3SERA 4GWWA 3H3GA 1PB7A 4R72A 1FQDA 3L6HA 4YMBA 4HE1A 1B1HA 2X7PA 3MVWA 2V84A 3PPQA 1NV2A 2QMWA 2XXUA 1S50A 4WXJA 1MM7A 3MP1A 3FVKA 3QAXA 2WX9A 1CB6A 4NF5A 5TP9A 1IITA 2XXIA 5CI5A 1BLFA 4I8CA 3KN7A 2YPNA 4LONB 1A7LA 3PUVE 2XX7A 4G68A 5CC2A 2P0SA 5AA1A 5ELVA 4MH5A 4Q8RA 2QVRA 3A3UA 5JK4A 3T96B 2OWSA 4NGUA 4RPNA 3IX1A 2H4IA 2OX3A 4KQPA 1FSAA 2X26A 3LSFB 4OVRA 3CSGA 1IQ7A 5H8FB 2VGQA 1JQFA 1LBVA 1RDZA 5K2XA 3OMBA 1PB9A 3V5AA 3CI8A 3TMGA 3IJXB 4KD5A 4ZECA 4THIA 3FXBA 4X1DA 4HCWA 4ESXA 1RYXA 1SW5A 1UTHA 2XXKA 3B8BA 4EF2A 5I57B 4N91A 1PBQA 5H8FA 1USYH 3KJTA 3SEVA 1A40A 4LQ2A 1NMUA 4GRKA 2OZZA 3U92A 1EU8A 5FBPA 2I49A 5T3JA 1LLSA 1FPDA 2F6GA 3I3VA 1IXHA 4TLMB 4XKRA 2XWKA 3C31A 3IOUA 2I4BA 4KPTA 2XX9A 4MF3A 2HEUA 4H65A 4PDHA 1I6QA 1BP5A 4YKJA 5ICTA 1MXYA 1MXUA 1ZBMA 2O1LA 3EHSA 3Q29A 3MWBA 2WKYA 4H1XA 4TLLB 2F8DA 3C34A 1LEVA 3C33A 4R2BA 5AA4B 3QYTA 1NKXA 2CZHA 5IKBA 3MZ9A 3PPNA 1QW0A 3E9XA 2ONKE 3S2VA 1URDA 2F5XA 4GBVA 2UXAA 3R7XA 4FE8A 2KLFA 2ANJA 1NNFA 1JEVA 3PMXA 1US4A 3A3CA 3TTMA 4ELQA 1QUKA 2WBBA 3LUYA 1LB9A 3KG2A 4POXA 1YYZA 2F7AA 5ET5A 5ICQA 3E78A 3FZVA 5FHOA 4DCYA 4WEDA 4R6YA 3SKPA 2Q88A 4DCXA 1P1QA 1LBYA 5IAIA 4PFTA 4NG7A 1UTBA 2XXQA 1KA0A 5FHNA 4MMPA 1DMBA 4HCYA 4C1UA 3FATA 1LAHE 2OWTA 4IR8A 1A8EA 2AL5A 1RYOA 4QFLA 1FQBA 1P1OA 1USYE 2F3BA 4R73A 3FIRA 2HAVA 4DI4B 3D4GA 3OELA 4QXDA 3OO8A 3OEKA 4PDDA 4BDLA 1LSTA 2O69A 2F6PA 3CG3A 3T9UA 2Q2AA 1P1NA 4IO5A 2I58A 4F2OA 3ZSFA 3G3IA 1NNKA 1MXXA 2UVHA 5L9MA 4HE2A 2XXTA 2Q8MA 1MY3A 4ZS9A 3H06B 1WDNA 1JW5A 5IZ3B 3D1RA 4MNIA 2GFEA 4RNSA 4R75A 4EQ9A 3PTYA 3RTWB 3K1NA 1B3HA 1RDXA 3K6WA 4FJPA 4LZ5A 2VOZA 4FEBA 1GGGA 3M3LA 2LAOA 4OVTA 3RLFE 1IMCA 1B3GA 3U65A 2XXWA 3LSLA 3KN3A 3N26A 1ZJLA 3ODBA 4DI3D 2XWOA 1NV6A 3G3FA 4GWXA 2V25A 2WYKA 4OYVA 5H8NA 3VFJA 1AIVA 2HFBA 2RF1A 4ELOA 3UGWA 1KA1A 3O2AA 1FQCA 2XHDA 3MYUA 4GWSA 4YU0A 5F7VA 4NAPA 1FBPA 1FTOA 1LB8A 2VD3A 4ECFA 3QIMA 1IXGA 3ZS6A 5ET7A 5I2NB 2XXPA 4I3YA 4QFKA 1LAGE 3TKDA 1BTJA 4N8YA 4PC9A 4ZEKA 2PX1A 3K00A 2XA5A 1D9YA 4I1DA 2Y84A 5DVIA 2D3IA 3O9PA 4O94A 2F78A 4G68B 4RK9A 1K9ZA 2VPNA 3IJOB 5DEXB 4OVQA 4EDPA 2ZNUA 4DDDA 1FTJA 3ROJA 1IXIA 1ZTYA 3D4CA 2Q9TA 2X7QA 5H8NB 2I48A 1FW0A 3DP8A 1D3KA 4PCDA 5BWJA 3VXCA 2H9BA 4U1OA 1N76A 4KYDA 4ZEFA 2Q2CA 3TZAA 2QS3A 2DS9A 1PEBA 3IOTA 5L9SA 3CHGA 4IY5A 4K3FA 2I3VA 5HM4B 2XXRA 4X48A 5I3SA 2DP8A 5J16A 5M2VA 4X8RA 2H98A 1PC3A 4MX6A 3VVEA 4ZEBA 1XOCA 1YZ0A 2P2AA 1OVBA 1URGA 1MY0A 1DTZA 1N3XA 1OLCA 4MIJA 3Q27A 3PD9A 3N6UA 4F3GA 4LATA 4F1VA 3VVFA 2V3UA 1SQYA 3K6UA 2F36A 4GOTA 2ALUA 3I5OA 4NWCA 4OTEA 4G2ZA 4I9DA 2BJIA 2DVZA 3SEYA 2HCAA 4KI0E 4JSDA 4GQOA 3C4MA 1AWBA 3KEIA 1MPCA 1VE4A 1NV0A 4TOZA 2G93A 4PE3A 5CMMA 5JEIA 4I40A 1XT8A 1ELJA 1MQHA 3R26A 1NV3A 1SW1A 3P7IA 4FIMA 4H8JA 2ZZVA 3KOTA 3K6XA 4NMYA 5I2KB 1FQFA 3IO6A 3W9VA 1PB8A 4XKPA 4G8HA 3MBPA 1KZ8A 1D9QA 1DK4A 2XXXA 3H4ZA 4JSOA 4PTKA 1NUWA 5L8DA 4MBPA 1B9JA 3EHTA 3MPKA 3F11A 3SESA 2QFLA 1FBEA 4Q0CA 1MXWA 1ATGA 3SZPA 1FBHA 3MW0A 2DSFA 3RN8A 2RCBA 5CMBA 1DOTA 1MM6A 3K01A 3TCGA 2V93A 4N07A 1XHYA 5DYHA 2NWJA 4P56A 4PFBA 4NF5B 2O7IA 4O8MA 4G77A 5TPAB 4XFEA 2ZYOA 4GWUA 4GWYA 5IZZA 4QBAA 3PMWA 3C32A 1FTMA 4DZ1A 3CFXA 3R6UA 2ZNTA 3U94A 4C0RA 1EYJA 4JDFA 2V3QA 4P47A 1DPEA 3T22A 5ITOA 2ONRA 2MKZA 1IUDA 2XD3A 4GWOA 1I6AA 3EKIA 2A5TB 4DXBA 4YZZA 2R8TA 4NF8B 1EH3A 2O51A 4OENA 5IZ3A 2OBGA 1ZU0A 1O63A 2HZLA 2ESNA 4GL0A 4H45A 1GVCA 4HTGA 1FBCA 4I3EA 3FXRA 4R6KA 2I0CA 1H43A 4M4GA 4Z7EA 1DTGA 2I0BA 4KXPA 3U1OA 2F34A 1I69A 3M3FA 3LUZA 3FVNA 4OWDA 2PT2A 1P1UA 1LBBA 1Y9UA 4DE8A 4GIZA 1JVXA 3KBRA 2HQ0A 1B1XA 3QXMA 1Y4TA 1SW2A 3RNNA 4P0GA 3PV0E 4ZZEA 2Q89A 3RT6B 4F3SA 3KC0A 2R6GE 1Q35A 4ZDMA 3RUMA 1M5BA 2RKMA 2O7UA 3UIFA 3KGCA 1FPKA 4G61A 3PPRA 4G8NA 2HXRA 3K1MA 1FBFA 2OK2A 4U4SA 4E0WA 5KZTA 3UP9A 5FTHA 3KFMA 3H6VA 4OERA 3Q28A 3GZGA 2Z8EA 3T1BA 2BJJX 3A09A 2ZZXA 1B58A 4ZE8A 4N6KA 2GHAA 3S9EA 4XKNA 4ELRA 1ZKBA 4YMAA 4NX1A 2REGA 5JTYB 2Z8FA 4RK2A 1LBZA 1IMBA 4F1YA 3IB1A 3L6GA 4UACA 3A29A 3PUWE 4PETA 3GLBA 2F7CA 5CBSA 1OLAA 5A5XB 4EF1A 2PFZA 1K9YA 2R9JA 3K1PA 1MS7A 1VR5A 3LSXA 4KR5A 5DW8A 1MY1A 4AB6A 4PFYA 1MH3A 3Q26A 2GRVA 2WBDA 5DTBA 4ZZAA 4NN3A 3O97A 1CE2A 2QS2A 3T9XB 4F3PA 4XIGQ 2KR0A 1B7HA 4EXKA 4RPOA 3T9HB 2P3VA 5DVJA 4KHZE 4IO7A 4JVDA 1XVXA 1FJ6A 4OETA 1Y1MA 2P1SA 3IOVA 3RQTA 1R6ZA 4MNPA 1LFIA 4L17A 3SEUA 3IOWA 1URSA 4IGTA 4PFWA 1KWHA 1N3WA 3TAJA 3OO9A 5AA2A 5I57A 3K0VA 1JNFA 5I58A 2E0SA 3S9NC 1B2HA 1NUXA 3HN0A 1SVXB 1LAXA 4IY6A 2CMOA 1TWYA 1NH8A 3T9VA 1NFTA 4U21A 4ZEDA 4IB2A 4FAJA 5I59B 1NNPA 1QVSA 3MC2A 1MQDA 5I7IA 1QUIA 3PUZE 3RTFB 2DE4A 4X9TA 1ZMGA 1B7ZA 4N4UA 1R9QA 3MSTA 4NF6A 1AOVA 1BK4A 4RYAA 2PCRA 3ONMA 2RC7A 3ILTB 1B40A 2DWJA 1TFDA 3CR9A 4HE0A 3VXBA 4H5GA 2RC8A 1NI9A 2HAUA 3V8XB 3KOSA 1H44A 2F3DA 4MAGA 3OSRA 3MZBA 1BKAA 4MFIA 4P8BA 4PFIA 4DIGA 2F97A 3KBZA 1VFDA 3PU5A 1IMFA 2IA4A 1YAEA 4P11A 2A5SA 4PGNA 1MPDA 1VFEA 3B50A 4AB5A 3FD3A 4KYEA 4O3BA 4O3AA 1FJ9A 3H03A 4HXVA 3MVXA 1B32A 3IO4A 1Y3QA 1QULA 4IO3A 3CFLA 3TDJA 4KCDA 4JB7A 4YB7A 3OOAA 1SYHA 2DXYA 3RPLB 2WYPA 1SD3A 3SEWA 1VDWA 3IB0A 4FECA 2VHAA 5EQ9A 1Y20A 1B0HA 1ZLQA 1N0TA 2DQVA 1WODA 2RC9A 4O3CA 4YKKA 4NQ8A 2UVGA 2DWAA 3H6TA 4U23A 5ISUA 2XXHA 3KJ7A 3DP6A 1B05A 5EQ8A 2W7YA 1P99A 3W9WA 1SBPA 3E4RA 2AL4A 4M1VA 2QS4A 2XX8A 4GBWA 4GF8A 4KCCA 3IB2A 2UYFA 3G3GA 4ONYA 4ELPA 3EPEA 3TCFA 3MP8A 4RXLA 5AA4A 4JWYA 1PDAA 1EZ9A 1QKBA 5B7DA 3FUZA 2ZXTA 4OESA 4GFRA 2QVVA 1ZIUA 4RY1A 2Y5LA 2PBWA 3VLVA 3LC8A 1DBZA 2H99A 1H45A 1G0IA 4PF6A 1WVJA 4H5FA 4U22A 4NE4A 3UN6A 4G68C 4U2RA 3WAFA 1LGBC 2VT5A 4XTCQ 3TTNA 3G3HA 2Y7WA 3IORA 2FBPA 4ESWA 1LCFA 3ZKLA 1MPBA 3EN3A 4FEDA 4ZEIA 4ND9A 3TODA 3BFUA 3FXQA 3TCHA 1UIVA 4F19A 4MJOA 5B70A 1AH5A 2FA7A 4RJZA 4PBQA 3IFAA 4P1EA 2GH9A 4X04A 1MQGA 4I62A 4LQ5A 4NF4B 1UTHB 3H7MA 5CBRA 1NV5A 5EHSA 1H3DA 4WEPA 2QSXA 1LFGA 1SDXA 2YJPA 2FIXA 5I84A 1XC1A 1IMEA 2HHMA 3USDA 3TEPA 5DT6A 2DYXA 4PAIA 3E3KA 4FATA 5FTIA 5LDZA 2OJTA 4F18A 4QSCA 1CNQA 1JW1A 3IL1B 4JXIA 2H5YA 1S7YA 3O6HA 3T66A 2CZIA 4F31B 1LBXA 4QFOA 1GV8A 3V89B 3PPOA 3VLWA 3PUXE 3EHUA 4KFQA 1B4ZA 4DLDA 4JVCA 1FTLA 3B6QA 3KN8A 2P3NA 1B52A 4H46A 1T0KA 1A99A 5TP9B 4YKIA 1FRPA 5EYHA 2Y7PA 4UA8A 2XWVA 1B51A 4QFNA 4AS5A 1FPFA 3QK6A 4Z0IA 3Q25A 2VP1A 3NOHA 2YLNA 3B7DA 4P0IA 2V3TA 1M5CA 2QS1A 3RPWA 3I6VA 4YB5A 1SPIA 3TPAA 1B5HA 5KDTB 1ANFA 2UYEA 4G8MA 1LAFE 5IZ1A 1Y3NA 3G3KA 3N6TA 1D4NA 2B4LA 2FIEA 3HSTA 4YB6A 5BUUA 3V83A 2AIXA 3G3JA 1QGXA 2WEFA 2Y7IA 4JBZA 5ESYA 1R1NA 1J1NA 1HSEA 4N17A 5JTYA 5DVFA 5EQ7A 3HHGA 1FQEA 4Q30B 4TQUQ 1IXCA 2XWIA 2ZYKA 3KSXA 3FXUA 4PFRA 1MY2A 1JVYA 1F9BA 1FQAA 1G0HA 3PPPA 1OIBA 2B3FA 1MDP1 1POY1 1QKAA 3QSLA 1FPGA 2NXOA 1MQIA 4IO4A 1IEJA 1RDYA 3MVYA 3S9MC 2DOJA 2I3WA 1SW4A 3U8QA 3UORA 2O68A 2L5VA 4H0WA 1FPBA 3HHFA 1S9TA 3RYDA 4F1UA 1QUJA 2F7BA 1NV7A 4N81A 3SETA 1MG1A 4POWA 4NEDA 3GXAA 1SI1A 4QFPA 2Y7RA 3MJNA 1D9VA 2QVUA 1BIYA 3JZJA 1NNTA 1YCJA 3TTRA 4P3LA
chains in the Genus database with same CATH topology
3RQTA 2PT1A 3OEMA 3RLFE 3THIA 1R6ZA 1B3GA 1UQWA 4EQ9A 3MUQA 2XXWA 1US5A 3IR1A 3CFZA 1LFIA 3LSLA 1HSLA 3FVGA 3KN3A 3N26A 1ZJLA 4L17A 5EHMA 3ODBA 5TPAA 4YKPA 3SEUA 5HPQA 4LUBA 1EZOA 3IOWA 3OO7A 1URSA 4IGTA 3T9HB 4PFWA 1DSNA 1KWHA 1N3WA 3M3KA 4R74A 3G3FA 3TAJA 3IAZA 2V25A 2I6EA 4GLIA 2A5TA 3OO9A 5AA2A 5I57A 3K0VA 2O1MA 4OYVA 5H8NA 3VFJA 1AIVA 1JNFA 1DPPA 2HFBA 1MRPA 2RF1A 1B3EA 3E13X 3ECRA 5CMKA 1Z7ME 4ELOA 4RY1A 2E0SA 2H25A 3UGWA 1B2HA 3S9NC 1MXZA 3HN0A 5J1DA 2DVCA 3O2AA 1SVXB 1FQCA 2XHDA 1LAXA 4IY6A 1B3LA 2CMOA 2F35A 3H6WA 5KDTA 4YU0A 1TWYA 5F7VA 5H8HB 3U92A 1NH8A 2QPQA 3H6UA 1XVYA 1NFTA 4OXVA 4U21A 1FTOA 1LB8A 2VD3A 3MP6A 4LVQA 2ZYMA 4IB2A 3QIMA 3TTKA 1IXGA 3GBAA 3ZS6A 4PE5B 4FAJA 5I59B 1NNPA 1QVSA 3MC2A 1MQDA 4NTLA 4JWOA 5I2NB 1QUIA 3C35A 3PUZE 2XXPA 5I58A 3RTFB 4NF6B 4QFKA 4OVJA 3MQ9A 1LAGE 2DE4A 4X9TA 3UA8A 1ZMGA 1B7ZA 3TKDA 1BTJA 4H6DA 4C1TA 1R9QA 1OQHA 3OENA 4NF6A 1AOVA 5CMCA 4RYAA 1P1WA 4DZ1A 5H8HA 4ZEKA 1TFAA 2PX1A 3PGFA 3K00A 2ZYNA 3WAEA 2Z23A 1D9YA 4I1DA 2Y84A 3ONMA 2RC7A 1PBPA 1B40A 2D3IA 2DWJA 3ILTB 3O9PA 5DEXA 5DVIA 2F78A 3TCGA 3FJMA 1TFDA 4AQ4A 5I2KA 3CR9A 3DP4A 4G68B 3T9VA 5A5XA 1N04A 4RK9A 1B5JA 3IJOB 2RC8A 4H5GA 4NF4A 5DEXB 2HAUA 3VXBA 4EDPA 3V8XB 4F39A 2ZNUA 3KOSA 3BBRA 1FTJA 1H44A 3U93A 1IXIA 4DDDA 2FNCA 3VE1B 5TU0A 4BDMA 1ZTYA 3JV9A 4RA1A 4DXUA 3D4CA 3OSRA 3M8UA 2Q9TA 2X7QA 1HSJA 3MZBA 1POTA 5I58B 1BKAA 5H8NB 1B0LA 4MFIA 2I48A 5AE4A 3PUYE 4PFUA 1FW0A 1OQGA 1D3KA 2NUVA 2B65A 3DP8A 4R6HA 1II5A 2DXRA 2H9BA 3K4UA 3VXCA 3SEXA 5BWJA 1OMPA 4U1OA 5CRYA 1N76A 3QUFA 3TTLA 4DIGA 2F97A 1JW4A 4KYDA 1SYIA 3O29A 1XS5A 5LOMA 3CIJA 1O7TA 1VFDA 3EF7A 3PU5A 2IA4A 2NVUB 1YAEA 4P11A 2A5SA 3TTMA 4BDRA 2UVIA 4ZEFA 4HW8A 1MPDA 1Y1ZA 4H67A 1VFEA 4F3BA 2Q2CA 3TZAA 2QS3A 1LCTA 2DS9A 3OD7A 1L5TA 4AB5A 1PEBA 3FD3A 3IOTA 2Z22A 3FJ7A 4IO6A 4KYEA 4O3AA 4O3BA 5L9SA 3H03A 4X1BA 2OCUA 4IY5A 3TTRA 3T93B 3MVXA 3VV5A 1B32A 4K3FA 4GVOA 3IO4A 1Y3QA 2I3VA 4XKQA 1QULA 5HM4B 4IO3A 3FASA 3CFLA 1I6BA 3TDJA 2XXRA 4KCDA 4JB7A 4R9FA 4YB7A 5ITPA 3OOAA 4X48A 1B46A 2DP8A 1NH7A 3O6IA 5M2VA 3O28A 5K2YA 3UK4A 2QL3A 2H98A 1PC3A 1SYHA 2DXYA 2I4CA 2ONSA 4JWXA 2REJA 3VVEA 1SD3A 3EQ1A 3SEWA 4Z7EA 4ZEBA 1XOCA 3IB0A 4OFOA 4Q5TA 4QSDA 5I56A 4FECA 2P2AA 2VHAA 1Y20A 1OVBA 1URGA 4QRZA 3W15C 1B0HA 3K02A 1A54A 1ZLQA 1MY0A 1SI0A 2PVUA 1DTZA 4BDNA 1B4HA 1N0TA 4LZ8A 5FHMA 2DQVA 3LSWA 3MZ1A 1WODA 1N3XA 1NL5A 2RC9A 3C36A 4NWDA 4O3CA 4YKKA 4EQ7A 2UVGA 2DWAA 1OLCA 4OHNA 4PP0A 3H6TA 1RKMA 4U23A 3BFTA 1TXFA 3Q27A 5H8QB 5ISUA 3TQWA 2XXHA 3KJ7A 3DP6A 3PD9A 3N6UA 5F1QA 4LATA 4F3GA 1B05A 4F1VA 3LBSA 3VVFA 2V3UA 2W7YA 1SQYA 2ZNSA 2VD2A 4F22A 2DE2A 3K6UA 1P99A 2F36A 3W9WA 1M5DA 3KSJA 5H8SA 3SERA 4GOTA 2ALUA 3H3GA 3I5OA 1PB7A 1SBPA 4GL8A 4NWCA 1FQDA 4OTEA 4G2ZA 4R72A 3L6HA 4F2QA 4I9DA 3E4RA 4YMBA 2DVZA 2AL4A 2M8CA 3B6WA 4M1VA 3SEYA 2HCAA 2QS4A 4KI0E 4JSDA 1MH4A 2XX8A 1B1HA 2X7PA 4GQOA 2Z8DA 3C4MA 3O66A 5KCJA 3KEIA 1MPCA 3HV1A 4GF8A 4KCCA 3ZKKA 3MVWA 3IB2A 1VE4A 1M5EA 2UYFA 2V84A 3OSQA 1A8FA 2DWIA 3G3GA 4ONYA 3PPQA 4XXUA 2ABHA 4ELPA 2QMWA 2XXUA 3FJGA 1S50A 4TOZA 3EPEA 4WXJA 2G93A 1QJMA 1MM7A 3TCFA 3S9LC 3MP1A 1Q1KA 3FVKA 5CMMA 3QAXA 3MP8A 1CB6A 4RXLA 4NF5A 5TP9A 1IITA 4ECFA 1MY4A 2XXIA 4JWYA 1BLFA 5CI5A 4I8CA 5AA4A 1XT8A 3KN7A 1PDAA 1ELJA 2YPNA 5JEIA 2D21A 4OQOA 1MQHA 1EZ9A 3R26A 4LONB 1A7LA 2FYIA 5H8QA 4NF8A 1QKBA 5B7DA 1GTKA 1UIUA 3FUZA 3DM0A 3VLUA 2ZXTA 1SW1A 4OESA 3P7IA 4GFRA 1B6HA 3PUVE 1MQJA 2XX7A 3DELB 3C9HA 4FIMA 4H8JA 3KOTA 4G68A 1FTKA 1ZIUA 3K6XA 4NMYA 4OZ9A 2P0SA 1N7WA 1FQFA 3IO6A 4MLVA 1PB8A 2PBWA 5ELVA 5I2KB 5AA1A 3VLVA 3W9VA 1TT1A 4XKPA 4MH5A 4G8HA 2NOOA 4Q8RA 3LC8A 3MBPA 2XXXA 1AL3A 2H99A 2D5WA 3BKIB 3H4ZA 5I56B 1H45A 3A3UA 5JK4A 3T96B 2OWSA 4H8IA 1UTBB 4RPNA 4GD5A 4JSOA 1WVJA 4H5FA 5AA3A 3IX1A 5L8DA 2H4IA 4MBPA 4KQPA 4NE4A 4U22A 3UN6A 2O6AA 1B9JA 2X26A 4EXLA 3EHTA 3LSFB 4G68C 3CSGA 4QHQA 4U2RA 1IQ7A 2PYYA 3WAFA 5H8FB 3MPKA 2VGQA 3F11A 1JQFA 1LGBC 5CM6A 4YICA 1IIWA 2RINA 3SESA 4XTCQ 2Y7KA 3TTNA 3G3HA 4ESXA 5K2XA 1O64A 2Y7WA 2DWHA 3IORA 3OMBA 1PB9A 4Q0CA 1MXWA 1ATGA 3V5AA 3FVOA 4ESWA 1LCFA 3MW0A 3ZKLA 2DSFA 1MPBA 3QUJA 3CI8A 3EN3A 2RCBA 3RN8A 3TMGA 4FEDA 3IJXB 4KD5A 4ZEIA 4ZECA 5CMBA 4ND9A 3TODA 1DOTA 4THIA 3SDFA 1B3FA 4X1DA 3BFUA 4OFJA 3FXQA 3TCHA 4HCWA 3S4UA 1RYXA 1MM6A 1SW5A 1UIVA 2V93A 1UTHA 2XXVA 3K01A 1YTVA 3N94A 4N07A 4F19A 1XHYA 5DYHA 5B70A 2NWJA 1AH5A 2FA7A 3VDFA 4NF5B 4EF2A 4IGRA 4RJZA 5I57B 1B7UA 4LP2B 1PBQA 2O7IA 2PMSA 3HCQA 3LR1A 4G77A 5H8FA 5TPAB 1USYH 2ZYOA 3FGSA 4GXAA 3KJTA 2GH9A 4U1ZA 1A40A 4LQ2A 1MQGA 2RCAA 3SEVA 1NMUA 3PMWA 4GRKA 4I62A 2OZZA 3C32A 1EU8A 1FTMA 1MXVA 2I49A 3MAMA 3CFXA 1LLSA 4LQ5A 4N6PA 1UTHB 1YPNA 3R6UA 4NF4B 3H7MA 2ZNTA 3U94A 4C0RA 5CBRA 2F6GA 4JDFA 2V3QA 3I3VA 5EHSA 2QMXA 1IXHA 1H3DA 3PMVA 4TLMB 1DPEA 4XKRA 3T22A 3TQLA 3C31A 4WEPA 5ITOA 2ONRA 2QSXA 1LFGA 1IUDA 1SDXA 2YJPA 2XD3A 3K6VA 1I6AA 3IOUA 4GWOA 3KZGA 4QSEA 1LFHA 2A5TB 2I4BA 4DXBA 4R2FA 5I84A 4KPTA 1XC1A 1FCKA 2XX9A 1OVTA 4MF3A 3TELA 2HEUA 5HBCA 4YZZA 2Q8JA 3USDA 1GR2A 3TEPA 4H65A 5DT6A 2CZLA 4NF8B 2DYXA 1MDQA 3E3KA 4FATA 5FTIA 2OJTA 4F18A 4QSCA 1I6QA 1JW1A 1BP5A 1EH3A 2O51A 3IL1B 4OENA 4YKJA 4BLAA 4JXIA 1EZPA 5ICTA 2H5YA 2DE3A 1LBCA 1MXYA 1MXUA 1ZBMA 1S7YA 2OBGA 3JYRA 3O6HA 1ZU0A 2O1LA 1O63A 3T66A 2HZLA 2ESNA 2UVJA 3DLNA 4GL0A 4F31B 1GVCA 4HTGA 3CVGA 3EHSA 4QFOA 3TFLA 1GV8A 3FXRA 3V89B 3Q29A 2I0CA 3PPOA 1H43A 3MWBA 3OXNA 4OFLA 3PUXE 3EHUA 4M4GA 4R6KA 3VLWA 3VVDA 2WKYA 4KFQA 1DTGA 4H1XA 1B4ZA 2I0BA 4DLDA 4TLLB 2F8DA 3U1OA 2O84X 2F34A 3C34A 4E0XA 1FTLA 1I69A 3B6QA 3C33A 3HPIA 3KN8A 4KYSA 4R2BA 4EXKA 1B52A 5AA4B 1T0KA 3M3FA 1A99A 5TP9B 4YKIA 3QYTA 1NKXA 3FVNA 4OWDA 2Y7PA 5IKBA 3CG1A 3FV2A 4UA8A 3MZ9A 2IEEA 3PPNA 1QW0A 4MLQA 1B51A 3CRBA 2PT2A 3E9XA 1P1UA 2ONKE 2HXWA 4QFNA 3S2VA 1URDA 2QJEA 1LBBA 2F5XA 2THIA 3QK6A 4N13A 1Y9UA 4Z0IA 2UXAA 4EUOA 3Q25A 2VP1A 1Y4CA 3R7XA 4DE8A 2YLNA 5L9OA 2B3BA 3B7DA 4FE8A 2KLFA 1JVXA 4GIZA 4P0IA 2V3TA 5I59A 3KBRA 4EQBA 1M5CA 2QS1A 2HQ0A 3RPWA 1B1XA 3QXMA 5KCJB 2ANJA 1Y4TA 2ZMBA 1NNFA 1JEVA 3IK6B 1SW2A 3I6VA 3PMXA 4YB5A 1US4A 3RNNA 4P0GA 3TPAA 1B5HA 3A3CA 1ANFA 2UYEA 3PV0E 4G8MA 2Q89A 1LAFE 4OEUA 4OEVA 1QUKA 4ZZEA 3RT6B 4ELQA 4F3SA 2R6GE 1Q35A 1Y3NA 4ZDMA 3LUYA 1LB9A 3KG2A 4POXA 1M5BA 2RKMA 2XD2A 3G3KA 3RUMA 4ZEDA 2O7UA 3UIFA 3KGCA 3PPRA 2F7AA 4G8NA 5ICQA 3N6TA 1D4NA 3HSTA 4YB6A 5BUUA 3V83A 2AIXA 5AA2B 3K1MA 2OK2A 3FZVA 4U4SA 5FHOA 4LZ7A 3G3JA 4DCYA 4E0WA 4DXCA 5KZTA 4WEDA 3UP9A 4R6YA 5FTHA 3AXFA 2Y7IA 4JBZA 1R1NA 1J1NA 1HSEA 2Q88A 3GBBA 3KFMA 3SKPA 4DCXA 1P1QA 5JTYA 1B5IA 5DVFA 5IAIA 3H6VA 4PFTA 1M5FA 1VSOA 4OERA 3HHGA 1FQEA 4Q30B 4TQUQ 4ISUA 4YAHX 3RT8A 5AA2D 1UTBA 3Q28A 3GZGA 1IXCA 2XXQA 2ZYKA 3KSXA 3N5LA 5FHNA 2Z8EA 3FXUA 1DMBA 1MY2A 1R9LA 4HCYA 4C1UA 3FATA 1JVYA 1LAHE 1Y3PA 2OWTA 2BJJX 3A09A 1F9BA 1B58A 1A8EA 1FQAA 3ILUB 3PPPA 2AL5A 1OIBA 4ZE8A 2B3FA 1IZ1A 1RYOA 2GHAA 4QFLA 1FQBA 3G7WA 3S9EA 4XKNA 3MPLA 2QRYA 1P1OA 1USYE 1MDP1 1POY1 1QKAA 3QSLA 3K2DA 1ZKBA 4ELRA 4R73A 3MVZA 4YMAA 1N7XA 3FIRA 3OO6A 2NXOA 1MQIA 2REGA 2HAVA 5JTYB 3D4GA 2Z8FA 3OELA 4RK2A 4IO4A 1IEJA 3HO7A 3TYHA 4F1YA 3IB1A 3L6GA 3OO8A 1A55A 4UACA 3OEKA 3PUWE 3MVYA 2OLBA 4BDLA 1N84A 4PETA 1LSTA 2O69A 3GLBA 3RY3A 2R71A 3S9MC 2F7CA 2F6PA 2XXYA 4HS7A 2DOJA 2I3WA 3CG3A 3O6GA 5CBSA 1OLAA 5A5XB 3B6TA 1SW4A 2GHBA 3T9UA 2Q2AA 3U8QA 4EF1A 1P1NA 4IO5A 3UORA 2I58A 3TUSA 4BDOA 3ZSFA 2O68A 2R9JA 1NNKA 1MXXA 3G3IA 1MS7A 3K1PA 4F2OA 1VR5A 2UVHA 4LA9A 3LSXA 4H0WA 4KR5A 4WKMA 1MY1A 5L9MA 4PFYA 3U72A 2G29A 1MH3A 3HHFA 4AB6A 2XXTA 4F29A 3Q26A 1MY3A 2GRVA 3CSBA 1Z7NE 1S9TA 4ZS9A 4F1UA 1JETA 3H06B 5KDTB 4PQJA 1QUJA 1WDNA 5DTBA 4ZZAA 1JW5A 4QF9A 2F7BA 1CE2A 2QS2A 3O97A 3T9XB 1H76A 1MG1A 3FV1A 3SETA 4GXSB 4F3PA 5I2NA 4OMBA 4XIGQ 4G4PA 4BDQA 1JEUA 2GFEA 1B7HA 2HZKA 4NEDA 4POWA 4R75A 4RNSA 4RPOA 5DVJA 3GXAA 2E1SA 4R9GA 3RGYA 5EYFA 3PD8A 1SI1A 4KHZE 4FORA 4QFPA 3RTWB 3K1NA 4IO7A 1B3HA 2Y7RA 3MJNA 1D9VA 1XVXA 4OETA 3K6WA 4FJPA 1BIYA 4IO2A 4LZ5A 5CC2A 3JZJA 1AMFA 1Y1MA 2VOZA 2AYSA 1NNTA 2P1SA 4FEBA 1GGGA 1YCJA 2LAOA 3M3LA 4ZE9A 3IOVA 4U4XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RQT A;  2PT1 A;  3OEM A;  3RLF E;  3THI A;  1R6Z A;  1B3G A;  1UQW A;  4EQ9 A;  3MUQ A;  2XXW A;  1US5 A;  3IR1 A;  3CFZ A;  1LFI A;  3LSL A;  1HSL A;  3FVG A;  3KN3 A;  3N26 A;  1ZJL A;  4L17 A;  5EHM A;  3ODB A;  5TPA A;  4YKP A;  3SEU A;  5HPQ A;  4LUB A;  1EZO A;  3IOW A;  3OO7 A;  1URS A;  4IGT A;  3T9H B;  4PFW A;  1DSN A;  1KWH A;  1N3W A;  3M3K A;  4R74 A;  3G3F A;  3TAJ A;  3IAZ A;  2V25 A;  2I6E A;  4GLI A;  2A5T A;  3OO9 A;  5AA2 A;  5I57 A;  3K0V A;  2O1M A;  4OYV A;  5H8N A;  3VFJ A;  1AIV A;  1JNF A;  1DPP A;  2HFB A;  1MRP A;  2RF1 A;  1B3E A;  3E13 X;  3ECR A;  5CMK A;  1Z7M E;  4ELO A;  4RY1 A;  2E0S A;  2H25 A;  3UGW A;  1B2H A;  3S9N C;  1MXZ A;  3HN0 A;  5J1D A;  2DVC A;  3O2A A;  1SVX B;  1FQC A;  2XHD A;  1LAX A;  4IY6 A;  1B3L A;  2CMO A;  2F35 A;  3H6W A;  5KDT A;  4YU0 A;  1TWY A;  5F7V A;  5H8H B;  3U92 A;  1NH8 A;  2QPQ A;  3H6U A;  1XVY A;  1NFT A;  4OXV A;  4U21 A;  1FTO A;  1LB8 A;  2VD3 A;  3MP6 A;  4LVQ A;  2ZYM A;  4IB2 A;  3QIM A;  3TTK A;  1IXG A;  3GBA A;  3ZS6 A;  4PE5 B;  4FAJ A;  5I59 B;  1NNP A;  1QVS A;  3MC2 A;  1MQD A;  4NTL A;  4JWO A;  5I2N B;  1QUI A;  3C35 A;  3PUZ E;  2XXP A;  5I58 A;  3RTF B;  4NF6 B;  4QFK A;  4OVJ A;  3MQ9 A;  1LAG E;  2DE4 A;  4X9T A;  3UA8 A;  1ZMG A;  1B7Z A;  3TKD A;  1BTJ A;  4H6D A;  4C1T A;  1R9Q A;  1OQH A;  3OEN A;  4NF6 A;  1AOV A;  5CMC A;  4RYA A;  1P1W A;  4DZ1 A;  5H8H A;  4ZEK A;  1TFA A;  2PX1 A;  3PGF A;  3K00 A;  2ZYN A;  3WAE A;  2Z23 A;  1D9Y A;  4I1D A;  2Y84 A;  3ONM A;  2RC7 A;  1PBP A;  1B40 A;  2D3I A;  2DWJ A;  3ILT B;  3O9P A;  5DEX A;  5DVI A;  2F78 A;  3TCG A;  3FJM A;  1TFD A;  4AQ4 A;  5I2K A;  3CR9 A;  3DP4 A;  4G68 B;  3T9V A;  5A5X A;  1N04 A;  4RK9 A;  1B5J A;  3IJO B;  2RC8 A;  4H5G A;  4NF4 A;  5DEX B;  2HAU A;  3VXB A;  4EDP A;  3V8X B;  4F39 A;  2ZNU A;  3KOS A;  3BBR A;  1FTJ A;  1H44 A;  3U93 A;  1IXI A;  4DDD A;  2FNC A;  3VE1 B;  5TU0 A;  4BDM A;  1ZTY A;  3JV9 A;  4RA1 A;  4DXU A;  3D4C A;  3OSR A;  3M8U A;  2Q9T A;  2X7Q A;  1HSJ A;  3MZB A;  1POT A;  5I58 B;  1BKA A;  5H8N B;  1B0L A;  4MFI A;  2I48 A;  5AE4 A;  3PUY E;  4PFU A;  1FW0 A;  1OQG A;  1D3K A;  2NUV A;  2B65 A;  3DP8 A;  4R6H A;  1II5 A;  2DXR A;  2H9B A;  3K4U A;  3VXC A;  3SEX A;  5BWJ A;  1OMP A;  4U1O A;  5CRY A;  1N76 A;  3QUF A;  3TTL A;  4DIG A;  2F97 A;  1JW4 A;  4KYD A;  1SYI A;  3O29 A;  1XS5 A;  5LOM A;  3CIJ A;  1O7T A;  1VFD A;  3EF7 A;  3PU5 A;  2IA4 A;  2NVU B;  1YAE A;  4P11 A;  2A5S A;  3TTM A;  4BDR A;  2UVI A;  4ZEF A;  4HW8 A;  1MPD A;  1Y1Z A;  4H67 A;  1VFE A;  4F3B A;  2Q2C A;  3TZA A;  2QS3 A;  1LCT A;  2DS9 A;  3OD7 A;  1L5T A;  4AB5 A;  1PEB A;  3FD3 A;  3IOT A;  2Z22 A;  3FJ7 A;  4IO6 A;  4KYE A;  4O3A A;  4O3B A;  5L9S A;  3H03 A;  4X1B A;  2OCU A;  4IY5 A;  3TTR A;  3T93 B;  3MVX A;  3VV5 A;  1B32 A;  4K3F A;  4GVO A;  3IO4 A;  1Y3Q A;  2I3V A;  4XKQ A;  1QUL A;  5HM4 B;  4IO3 A;  3FAS A;  3CFL A;  1I6B A;  3TDJ A;  2XXR A;  4KCD A;  4JB7 A;  4R9F A;  4YB7 A;  5ITP A;  3OOA A;  4X48 A;  1B46 A;  2DP8 A;  1NH7 A;  3O6I A;  5M2V A;  3O28 A;  5K2Y A;  3UK4 A;  2QL3 A;  2H98 A;  1PC3 A;  1SYH A;  2DXY A;  2I4C A;  2ONS A;  4JWX A;  2REJ A;  3VVE A;  1SD3 A;  3EQ1 A;  3SEW A;  4Z7E A;  4ZEB A;  1XOC A;  3IB0 A;  4OFO A;  4Q5T A;  4QSD A;  5I56 A;  4FEC A;  2P2A A;  2VHA A;  1Y20 A;  1OVB A;  1URG A;  4QRZ A;  3W15 C;  1B0H A;  3K02 A;  1A54 A;  1ZLQ A;  1MY0 A;  1SI0 A;  2PVU A;  1DTZ A;  4BDN A;  1B4H A;  1N0T A;  4LZ8 A;  5FHM A;  2DQV A;  3LSW A;  3MZ1 A;  1WOD A;  1N3X A;  1NL5 A;  2RC9 A;  3C36 A;  4NWD A;  4O3C A;  4YKK A;  4EQ7 A;  2UVG A;  2DWA A;  1OLC A;  4OHN A;  4PP0 A;  3H6T A;  1RKM A;  4U23 A;  3BFT A;  1TXF A;  3Q27 A;  5H8Q B;  5ISU A;  3TQW A;  2XXH A;  3KJ7 A;  3DP6 A;  3PD9 A;  3N6U A;  5F1Q A;  4LAT A;  4F3G A;  1B05 A;  4F1V A;  3LBS A;  3VVF A;  2V3U A;  2W7Y A;  1SQY A;  2ZNS A;  2VD2 A;  4F22 A;  2DE2 A;  3K6U A;  1P99 A;  2F36 A;  3W9W A;  1M5D A;  3KSJ A;  5H8S A;  3SER A;  4GOT A;  2ALU A;  3H3G A;  3I5O A;  1PB7 A;  1SBP A;  4GL8 A;  4NWC A;  1FQD A;  4OTE A;  4G2Z A;  4R72 A;  3L6H A;  4F2Q A;  4I9D A;  3E4R A;  4YMB A;  2DVZ A;  2AL4 A;  2M8C A;  3B6W A;  4M1V A;  3SEY A;  2HCA A;  2QS4 A;  4KI0 E;  4JSD A;  1MH4 A;  2XX8 A;  1B1H A;  2X7P A;  4GQO A;  2Z8D A;  3C4M A;  3O66 A;  5KCJ A;  3KEI A;  1MPC A;  3HV1 A;  4GF8 A;  4KCC A;  3ZKK A;  3MVW A;  3IB2 A;  1VE4 A;  1M5E A;  2UYF A;  2V84 A;  3OSQ A;  1A8F A;  2DWI A;  3G3G A;  4ONY A;  3PPQ A;  4XXU A;  2ABH A;  4ELP A;  2QMW A;  2XXU A;  3FJG A;  1S50 A;  4TOZ A;  3EPE A;  4WXJ A;  2G93 A;  1QJM A;  1MM7 A;  3TCF A;  3S9L C;  3MP1 A;  1Q1K A;  3FVK A;  5CMM A;  3QAX A;  3MP8 A;  1CB6 A;  4RXL A;  4NF5 A;  5TP9 A;  1IIT A;  4ECF A;  1MY4 A;  2XXI A;  4JWY A;  1BLF A;  5CI5 A;  4I8C A;  5AA4 A;  1XT8 A;  3KN7 A;  1PDA A;  1ELJ A;  2YPN A;  5JEI A;  2D21 A;  4OQO A;  1MQH A;  1EZ9 A;  3R26 A;  4LON B;  1A7L A;  2FYI A;  5H8Q A;  4NF8 A;  1QKB A;  5B7D A;  1GTK A;  1UIU A;  3FUZ A;  3DM0 A;  3VLU A;  2ZXT A;  1SW1 A;  4OES A;  3P7I A;  4GFR A;  1B6H A;  3PUV E;  1MQJ A;  2XX7 A;  3DEL B;  3C9H A;  4FIM A;  4H8J A;  3KOT A;  4G68 A;  1FTK A;  1ZIU A;  3K6X A;  4NMY A;  4OZ9 A;  2P0S A;  1N7W A;  1FQF A;  3IO6 A;  4MLV A;  1PB8 A;  2PBW A;  5ELV A;  5I2K B;  5AA1 A;  3VLV A;  3W9V A;  1TT1 A;  4XKP A;  4MH5 A;  4G8H A;  2NOO A;  4Q8R A;  3LC8 A;  3MBP A;  2XXX A;  1AL3 A;  2H99 A;  2D5W A;  3BKI B;  3H4Z A;  5I56 B;  1H45 A;  3A3U A;  5JK4 A;  3T96 B;  2OWS A;  4H8I A;  1UTB B;  4RPN A;  4GD5 A;  4JSO A;  1WVJ A;  4H5F A;  5AA3 A;  3IX1 A;  5L8D A;  2H4I A;  4MBP A;  4KQP A;  4NE4 A;  4U22 A;  3UN6 A;  2O6A A;  1B9J A;  2X26 A;  4EXL A;  3EHT A;  3LSF B;  4G68 C;  3CSG A;  4QHQ A;  4U2R A;  1IQ7 A;  2PYY A;  3WAF A;  5H8F B;  3MPK A;  2VGQ A;  3F11 A;  1JQF A;  1LGB C;  5CM6 A;  4YIC A;  1IIW A;  2RIN A;  3SES A;  4XTC Q;  2Y7K A;  3TTN A;  3G3H A;  4ESX A;  5K2X A;  1O64 A;  2Y7W A;  2DWH A;  3IOR A;  3OMB A;  1PB9 A;  4Q0C A;  1MXW A;  1ATG A;  3V5A A;  3FVO A;  4ESW A;  1LCF A;  3MW0 A;  3ZKL A;  2DSF A;  1MPB A;  3QUJ A;  3CI8 A;  3EN3 A;  2RCB A;  3RN8 A;  3TMG A;  4FED A;  3IJX B;  4KD5 A;  4ZEI A;  4ZEC A;  5CMB A;  4ND9 A;  3TOD A;  1DOT A;  4THI A;  3SDF A;  1B3F A;  4X1D A;  3BFU A;  4OFJ A;  3FXQ A;  3TCH A;  4HCW A;  3S4U A;  1RYX A;  1MM6 A;  1SW5 A;  1UIV A;  2V93 A;  1UTH A;  2XXV A;  3K01 A;  1YTV A;  3N94 A;  4N07 A;  4F19 A;  1XHY A;  5DYH A;  5B70 A;  2NWJ A;  1AH5 A;  2FA7 A;  3VDF A;  4NF5 B;  4EF2 A;  4IGR A;  4RJZ A;  5I57 B;  1B7U A;  4LP2 B;  1PBQ A;  2O7I A;  2PMS A;  3HCQ A;  3LR1 A;  4G77 A;  5H8F A;  5TPA B;  1USY H;  2ZYO A;  3FGS A;  4GXA A;  3KJT A;  2GH9 A;  4U1Z A;  1A40 A;  4LQ2 A;  1MQG A;  2RCA A;  3SEV A;  1NMU A;  3PMW A;  4GRK A;  4I62 A;  2OZZ A;  3C32 A;  1EU8 A;  1FTM A;  1MXV A;  2I49 A;  3MAM A;  3CFX A;  1LLS A;  4LQ5 A;  4N6P A;  1UTH B;  1YPN A;  3R6U A;  4NF4 B;  3H7M A;  2ZNT A;  3U94 A;  4C0R A;  5CBR A;  2F6G A;  4JDF A;  2V3Q A;  3I3V A;  5EHS A;  2QMX A;  1IXH A;  1H3D A;  3PMV A;  4TLM B;  1DPE A;  4XKR A;  3T22 A;  3TQL A;  3C31 A;  4WEP A;  5ITO A;  2ONR A;  2QSX A;  1LFG A;  1IUD A;  1SDX A;  2YJP A;  2XD3 A;  3K6V A;  1I6A A;  3IOU A;  4GWO A;  3KZG A;  4QSE A;  1LFH A;  2A5T B;  2I4B A;  4DXB A;  4R2F A;  5I84 A;  4KPT A;  1XC1 A;  1FCK A;  2XX9 A;  1OVT A;  4MF3 A;  3TEL A;  2HEU A;  5HBC A;  4YZZ A;  2Q8J A;  3USD A;  1GR2 A;  3TEP A;  4H65 A;  5DT6 A;  2CZL A;  4NF8 B;  2DYX A;  1MDQ A;  3E3K A;  4FAT A;  5FTI A;  2OJT A;  4F18 A;  4QSC A;  1I6Q A;  1JW1 A;  1BP5 A;  1EH3 A;  2O51 A;  3IL1 B;  4OEN A;  4YKJ A;  4BLA A;  4JXI A;  1EZP A;  5ICT A;  2H5Y A;  2DE3 A;  1LBC A;  1MXY A;  1MXU A;  1ZBM A;  1S7Y A;  2OBG A;  3JYR A;  3O6H A;  1ZU0 A;  2O1L A;  1O63 A;  3T66 A;  2HZL A;  2ESN A;  2UVJ A;  3DLN A;  4GL0 A;  4F31 B;  1GVC A;  4HTG A;  3CVG A;  3EHS A;  4QFO A;  3TFL A;  1GV8 A;  3FXR A;  3V89 B;  3Q29 A;  2I0C A;  3PPO A;  1H43 A;  3MWB A;  3OXN A;  4OFL A;  3PUX E;  3EHU A;  4M4G A;  4R6K A;  3VLW A;  3VVD A;  2WKY A;  4KFQ A;  1DTG A;  4H1X A;  1B4Z A;  2I0B A;  4DLD A;  4TLL B;  2F8D A;  3U1O A;  2O84 X;  2F34 A;  3C34 A;  4E0X A;  1FTL A;  1I69 A;  3B6Q A;  3C33 A;  3HPI A;  3KN8 A;  4KYS A;  4R2B A;  4EXK A;  1B52 A;  5AA4 B;  1T0K A;  3M3F A;  1A99 A;  5TP9 B;  4YKI A;  3QYT A;  1NKX A;  3FVN A;  4OWD A;  2Y7P A;  5IKB A;  3CG1 A;  3FV2 A;  4UA8 A;  3MZ9 A;  2IEE A;  3PPN A;  1QW0 A;  4MLQ A;  1B51 A;  3CRB A;  2PT2 A;  3E9X A;  1P1U A;  2ONK E;  2HXW A;  4QFN A;  3S2V A;  1URD A;  2QJE A;  1LBB A;  2F5X A;  2THI A;  3QK6 A;  4N13 A;  1Y9U A;  4Z0I A;  2UXA A;  4EUO A;  3Q25 A;  2VP1 A;  1Y4C A;  3R7X A;  4DE8 A;  2YLN A;  5L9O A;  2B3B A;  3B7D A;  4FE8 A;  2KLF A;  1JVX A;  4GIZ A;  4P0I A;  2V3T A;  5I59 A;  3KBR A;  4EQB A;  1M5C A;  2QS1 A;  2HQ0 A;  3RPW A;  1B1X A;  3QXM A;  5KCJ B;  2ANJ A;  1Y4T A;  2ZMB A;  1NNF A;  1JEV A;  3IK6 B;  1SW2 A;  3I6V A;  3PMX A;  4YB5 A;  1US4 A;  3RNN A;  4P0G A;  3TPA A;  1B5H A;  3A3C A;  1ANF A;  2UYE A;  3PV0 E;  4G8M A;  2Q89 A;  1LAF E;  4OEU A;  4OEV A;  1QUK A;  4ZZE A;  3RT6 B;  4ELQ A;  4F3S A;  2R6G E;  1Q35 A;  1Y3N A;  4ZDM A;  3LUY A;  1LB9 A;  3KG2 A;  4POX A;  1M5B A;  2RKM A;  2XD2 A;  3G3K A;  3RUM A;  4ZED A;  2O7U A;  3UIF A;  3KGC A;  3PPR A;  2F7A A;  4G8N A;  5ICQ A;  3N6T A;  1D4N A;  3HST A;  4YB6 A;  5BUU A;  3V83 A;  2AIX A;  5AA2 B;  3K1M A;  2OK2 A;  3FZV A;  4U4S A;  5FHO A;  4LZ7 A;  3G3J A;  4DCY A;  4E0W A;  4DXC A;  5KZT A;  4WED A;  3UP9 A;  4R6Y A;  5FTH A;  3AXF A;  2Y7I A;  4JBZ A;  1R1N A;  1J1N A;  1HSE A;  2Q88 A;  3GBB A;  3KFM A;  3SKP A;  4DCX A;  1P1Q A;  5JTY A;  1B5I A;  5DVF A;  5IAI A;  3H6V A;  4PFT A;  1M5F A;  1VSO A;  4OER A;  3HHG A;  1FQE A;  4Q30 B;  4TQU Q;  4ISU A;  4YAH X;  3RT8 A;  5AA2 D;  1UTB A;  3Q28 A;  3GZG A;  1IXC A;  2XXQ A;  2ZYK A;  3KSX A;  3N5L A;  5FHN A;  2Z8E A;  3FXU A;  1DMB A;  1MY2 A;  1R9L A;  4HCY A;  4C1U A;  3FAT A;  1JVY A;  1LAH E;  1Y3P A;  2OWT A;  2BJJ X;  3A09 A;  1F9B A;  1B58 A;  1A8E A;  1FQA A;  3ILU B;  3PPP A;  2AL5 A;  1OIB A;  4ZE8 A;  2B3F A;  1IZ1 A;  1RYO A;  2GHA A;  4QFL A;  1FQB A;  3G7W A;  3S9E A;  4XKN A;  3MPL A;  2QRY A;  1P1O A;  1USY E;  1MDP 1;  1POY 1;  1QKA A;  3QSL A;  3K2D A;  1ZKB A;  4ELR A;  4R73 A;  3MVZ A;  4YMA A;  1N7X A;  3FIR A;  3OO6 A;  2NXO A;  1MQI A;  2REG A;  2HAV A;  5JTY B;  3D4G A;  2Z8F A;  3OEL A;  4RK2 A;  4IO4 A;  1IEJ A;  3HO7 A;  3TYH A;  4F1Y A;  3IB1 A;  3L6G A;  3OO8 A;  1A55 A;  4UAC A;  3OEK A;  3PUW E;  3MVY A;  2OLB A;  4BDL A;  1N84 A;  4PET A;  1LST A;  2O69 A;  3GLB A;  3RY3 A;  2R71 A;  3S9M C;  2F7C A;  2F6P A;  2XXY A;  4HS7 A;  2DOJ A;  2I3W A;  3CG3 A;  3O6G A;  5CBS A;  1OLA A;  5A5X B;  3B6T A;  1SW4 A;  2GHB A;  3T9U A;  2Q2A A;  3U8Q A;  4EF1 A;  1P1N A;  4IO5 A;  3UOR A;  2I58 A;  3TUS A;  4BDO A;  3ZSF A;  2O68 A;  2R9J A;  1NNK A;  1MXX A;  3G3I A;  1MS7 A;  3K1P A;  4F2O A;  1VR5 A;  2UVH A;  4LA9 A;  3LSX A;  4H0W A;  4KR5 A;  4WKM A;  1MY1 A;  5L9M A;  4PFY A;  3U72 A;  2G29 A;  1MH3 A;  3HHF A;  4AB6 A;  2XXT A;  4F29 A;  3Q26 A;  1MY3 A;  2GRV A;  3CSB A;  1Z7N E;  1S9T A;  4ZS9 A;  4F1U A;  1JET A;  3H06 B;  5KDT B;  4PQJ A;  1QUJ A;  1WDN A;  5DTB A;  4ZZA A;  1JW5 A;  4QF9 A;  2F7B A;  1CE2 A;  2QS2 A;  3O97 A;  3T9X B;  1H76 A;  1MG1 A;  3FV1 A;  3SET A;  4GXS B;  4F3P A;  5I2N A;  4OMB A;  4XIG Q;  4G4P A;  4BDQ A;  1JEU A;  2GFE A;  1B7H A;  2HZK A;  4NED A;  4POW A;  4R75 A;  4RNS A;  4RPO A;  5DVJ A;  3GXA A;  2E1S A;  4R9G A;  3RGY A;  5EYF A;  3PD8 A;  1SI1 A;  4KHZ E;  4FOR A;  4QFP A;  3RTW B;  3K1N A;  4IO7 A;  1B3H A;  2Y7R A;  3MJN A;  1D9V A;  1XVX A;  4OET A;  3K6W A;  4FJP A;  1BIY A;  4IO2 A;  4LZ5 A;  5CC2 A;  3JZJ A;  1AMF A;  1Y1M A;  2VOZ A;  2AYS A;  1NNT A;  2P1S A;  4FEB A;  1GGG A;  1YCJ A;  2LAO A;  3M3L A;  4ZE9 A;  3IOV A;  4U4X A; 
#chains in the Genus database with same CATH topology
 3OEM A;  3THI A;  1UQW A;  3MUQ A;  2KQZ A;  1US5 A;  3IR1 A;  5HPQ A;  1EZO A;  2OWZ A;  4PF8 A;  2A5T A;  3T0J A;  2O1M A;  1NV4 A;  3ECR A;  1DPP A;  1MXZ A;  2DVC A;  3H6W A;  5KDT A;  1INP A;  5H8H B;  2QPQ A;  4OXV A;  3H6U A;  4LVQ A;  3TTK A;  3MP6 A;  2ZYM A;  4NTL A;  4JWO A;  3UA8 A;  4GX3 A;  4H6D A;  4C1T A;  1OQH A;  3OEN A;  1P1W A;  5H8H A;  3ISP A;  1TFA A;  2ZYN A;  5DEX A;  4AQ4 A;  5A5X A;  1N04 A;  1FPI A;  1B5J A;  4F39 A;  2CZK A;  3BBR A;  3GYY A;  3VE1 B;  4BDM A;  4RA1 A;  4GWZ A;  3M8U A;  1POT A;  5AE4 A;  4PFU A;  1OQG A;  2B65 A;  2DXR A;  4FBP A;  1OMP A;  5CRY A;  3QUF A;  3TTL A;  1JW4 A;  1O7T A;  1FBG A;  4BDR A;  1Y1Z A;  4F3B A;  1L5T A;  2Z22 A;  4IO6 A;  4X1B A;  4XKQ A;  3FAS A;  1I6B A;  5ITP A;  4NF0 A;  3O28 A;  2QL3 A;  4PAF A;  2I4C A;  4JWX A;  5ET8 A;  5I56 A;  3BIH A;  4QRZ A;  1DCU A;  3W15 C;  1SI0 A;  2PVU A;  4BDN A;  1B4H A;  4LZ8 A;  3MZ1 A;  1NL5 A;  4NWD A;  4OHN A;  4PP0 A;  3BFT A;  1TXF A;  5H8Q B;  5F1Q A;  2ZNS A;  2VD2 A;  5H8S A;  1EYI A;  4GL8 A;  4F2Q A;  3QMF A;  2M8C A;  3B6W A;  1MH4 A;  3BIG A;  2Z8D A;  3O66 A;  5KCJ A;  3HV1 A;  3ZKK A;  4OVS A;  1M5E A;  3OSQ A;  1A8F A;  2DWI A;  1FPE A;  2V4C A;  2ABH A;  4PGP A;  4XXU A;  1LBW A;  3FJG A;  5IGA A;  1QJM A;  3S9L C;  1Q1K A;  2ZZW A;  2B4M A;  1MY4 A;  2D21 A;  4OQO A;  2FYI A;  5H8Q A;  4NF8 A;  1GTK A;  1UIU A;  3VLU A;  3DM0 A;  1FTA A;  1B6H A;  1MQJ A;  3DEL B;  3C9H A;  1FTK A;  4OZ9 A;  1N7W A;  4MLV A;  1TT1 A;  2NOO A;  3FBP A;  1AL3 A;  2D5W A;  3BKI B;  5I56 B;  4H8I A;  1UTB B;  4GD5 A;  5F24 A;  5AA3 A;  3HFU A;  2O6A A;  4EXL A;  4QHQ A;  2PYY A;  1IMD A;  5CM6 A;  4YIC A;  2CEX A;  1IIW A;  1JP4 A;  2RIN A;  2Y7K A;  1O64 A;  2DWH A;  3FVO A;  3QUJ A;  3SDF A;  1B3F A;  5A5L A;  1FPL A;  4OFJ A;  3S4U A;  3N94 A;  1YXI A;  2XXV A;  1YTV A;  3VDF A;  4IGR A;  1B7U A;  4LP2 B;  3HCQ A;  2PMS A;  3LR1 A;  3FGS A;  4GXA A;  2CEY A;  4U1Z A;  2RCA A;  3MAM A;  1MXV A;  4N6P A;  5J1D A;  1YPN A;  2QMX A;  3PMV A;  3TQL A;  4AS4 A;  3K6V A;  3KZG A;  4QSE A;  1LFH A;  4R2F A;  1FCK A;  1OVT A;  3TEL A;  5HBC A;  2Q8J A;  1GR2 A;  2CZL A;  1XI6 A;  1MDQ A;  2Y5K A;  1EZP A;  2DE3 A;  1LBC A;  1NUY A;  3JYR A;  2UVJ A;  3DLN A;  4XEQ A;  1FBD A;  2GQ1 A;  3CVG A;  3TFL A;  1NV1 A;  4OFL A;  3OXN A;  3VVD A;  2O84 X;  4E0X A;  3RPL A;  3HPI A;  4KYS A;  3CG1 A;  3FV2 A;  2IEE A;  4MLQ A;  3CRB A;  5EYG A;  2HXW A;  2VPO A;  2QJE A;  4BLA A;  4EUO A;  2THI A;  4N13 A;  1Y4C A;  5L9O A;  2B3B A;  5I59 A;  4EQB A;  5KCJ B;  2ZMB A;  3IK6 B;  4OEV A;  4OEU A;  3LV0 A;  2DDK A;  5LTC A;  4LN5 A;  2XD2 A;  5AA2 B;  4GX4 A;  4DXC A;  4LZ7 A;  3AXF A;  3GBB A;  1B5I A;  1M5F A;  1VSO A;  4MCO A;  3RT8 A;  4YAH X;  4ISU A;  5AA2 D;  3N5L A;  1R9L A;  1Y3P A;  4N6D A;  3ILU B;  4UAB A;  1IZ1 A;  3G7W A;  3MPL A;  2QRY A;  3K2D A;  3MVZ A;  1N7X A;  3OO6 A;  4GX6 A;  3HO7 A;  4XF5 A;  3TYH A;  5ET6 A;  1A55 A;  2OLB A;  1N84 A;  3RY3 A;  2R71 A;  2XXY A;  4HS7 A;  3O6G A;  3B6T A;  2GHB A;  4MEV A;  3TUS A;  4BDO A;  2JJK A;  4LA9 A;  4WKM A;  3U72 A;  2G29 A;  4F29 A;  3CSB A;  1Z7N E;  1JET A;  4PQJ A;  4QF9 A;  1H76 A;  3FV1 A;  4GXS B;  5I2N A;  4OMB A;  4G4P A;  4BDQ A;  1JEU A;  2HZK A;  3RGY A;  2E1S A;  4R9G A;  5EYF A;  3PD8 A;  4FOR A;  4IO2 A;  1AMF A;  2AYS A;  4ZE9 A;  4U4X A;  2PT1 A;  5IM2 A;  3CFZ A;  1HSL A;  3FVG A;  5EHM A;  2PFY A;  5TPA A;  4YKP A;  4LUB A;  3OO7 A;  4P1L A;  1DSN A;  3M3K A;  4R74 A;  3IFC A;  3IAZ A;  4GLI A;  2I6E A;  1MRP A;  3E13 X;  1B3E A;  5CMK A;  1Z7M E;  2H25 A;  4PAK A;  4P9K A;  1B3L A;  2F35 A;  5I5P A;  1XVY A;  3GBA A;  4PE5 B;  1IMA A;  3C35 A;  5EQA A;  4NF6 B;  4OVJ A;  3MQ9 A;  2FHY A;  4MHF A;  4MNC A;  5CMC A;  4O7I A;  3PGF A;  3WAE A;  2Z23 A;  4OVP A;  1PBP A;  3FJM A;  5I2K A;  3DP4 A;  2FVZ A;  4NF4 A;  3U93 A;  2Q74 A;  2FNC A;  4NHB A;  5TU0 A;  3JV9 A;  4DXU A;  1HSJ A;  5I58 B;  4N8G A;  1B0L A;  3PUY E;  2NUV A;  4R6H A;  1II5 A;  3K4U A;  3SEX A;  1SYI A;  3O29 A;  1XS5 A;  5LOM A;  3CIJ A;  3EF7 A;  2NVU B;  2UVI A;  4HW8 A;  4OA4 A;  4H67 A;  1LCT A;  3OD7 A;  3FJ7 A;  2OCU A;  1FPJ A;  3T93 B;  3VV5 A;  1NUZ A;  1Q9D A;  4GVO A;  3KC1 A;  4PBH A;  4R9F A;  1B46 A;  1NH7 A;  3O6I A;  4O7M A;  5K2Y A;  3UK4 A;  2ONS A;  2REJ A;  3EQ1 A;  4OFO A;  4Q5T A;  4QSD A;  3K02 A;  1A54 A;  4OAN A;  4JVI A;  3E79 A;  5FHM A;  3LSW A;  2HPG A;  3C36 A;  1EYK A;  4EQ7 A;  1RKM A;  3TQW A;  3LBS A;  4F22 A;  2DE2 A;  4N15 A;  1M5D A;  3KSJ A;  3SER A;  4GWW A;  3H3G A;  1PB7 A;  4R72 A;  1FQD A;  3L6H A;  4YMB A;  4HE1 A;  1B1H A;  2X7P A;  3MVW A;  2V84 A;  3PPQ A;  1NV2 A;  2QMW A;  2XXU A;  1S50 A;  4WXJ A;  1MM7 A;  3MP1 A;  3FVK A;  3QAX A;  2WX9 A;  1CB6 A;  4NF5 A;  5TP9 A;  1IIT A;  2XXI A;  5CI5 A;  1BLF A;  4I8C A;  3KN7 A;  2YPN A;  4LON B;  1A7L A;  3PUV E;  2XX7 A;  4G68 A;  5CC2 A;  2P0S A;  5AA1 A;  5ELV A;  4MH5 A;  4Q8R A;  2QVR A;  3A3U A;  5JK4 A;  3T96 B;  2OWS A;  4NGU A;  4RPN A;  3IX1 A;  2H4I A;  2OX3 A;  4KQP A;  1FSA A;  2X26 A;  3LSF B;  4OVR A;  3CSG A;  1IQ7 A;  5H8F B;  2VGQ A;  1JQF A;  1LBV A;  1RDZ A;  5K2X A;  3OMB A;  1PB9 A;  3V5A A;  3CI8 A;  3TMG A;  3IJX B;  4KD5 A;  4ZEC A;  4THI A;  3FXB A;  4X1D A;  4HCW A;  4ESX A;  1RYX A;  1SW5 A;  1UTH A;  2XXK A;  3B8B A;  4EF2 A;  5I57 B;  4N91 A;  1PBQ A;  5H8F A;  1USY H;  3KJT A;  3SEV A;  1A40 A;  4LQ2 A;  1NMU A;  4GRK A;  2OZZ A;  3U92 A;  1EU8 A;  5FBP A;  2I49 A;  5T3J A;  1LLS A;  1FPD A;  2F6G A;  3I3V A;  1IXH A;  4TLM B;  4XKR A;  2XWK A;  3C31 A;  3IOU A;  2I4B A;  4KPT A;  2XX9 A;  4MF3 A;  2HEU A;  4H65 A;  4PDH A;  1I6Q A;  1BP5 A;  4YKJ A;  5ICT A;  1MXY A;  1MXU A;  1ZBM A;  2O1L A;  3EHS A;  3Q29 A;  3MWB A;  2WKY A;  4H1X A;  4TLL B;  2F8D A;  3C34 A;  1LEV A;  3C33 A;  4R2B A;  5AA4 B;  3QYT A;  1NKX A;  2CZH A;  5IKB A;  3MZ9 A;  3PPN A;  1QW0 A;  3E9X A;  2ONK E;  3S2V A;  1URD A;  2F5X A;  4GBV A;  2UXA A;  3R7X A;  4FE8 A;  2KLF A;  2ANJ A;  1NNF A;  1JEV A;  3PMX A;  1US4 A;  3A3C A;  3TTM A;  4ELQ A;  1QUK A;  2WBB A;  3LUY A;  1LB9 A;  3KG2 A;  4POX A;  1YYZ A;  2F7A A;  5ET5 A;  5ICQ A;  3E78 A;  3FZV A;  5FHO A;  4DCY A;  4WED A;  4R6Y A;  3SKP A;  2Q88 A;  4DCX A;  1P1Q A;  1LBY A;  5IAI A;  4PFT A;  4NG7 A;  1UTB A;  2XXQ A;  1KA0 A;  5FHN A;  4MMP A;  1DMB A;  4HCY A;  4C1U A;  3FAT A;  1LAH E;  2OWT A;  4IR8 A;  1A8E A;  2AL5 A;  1RYO A;  4QFL A;  1FQB A;  1P1O A;  1USY E;  2F3B A;  4R73 A;  3FIR A;  2HAV A;  4DI4 B;  3D4G A;  3OEL A;  4QXD A;  3OO8 A;  3OEK A;  4PDD A;  4BDL A;  1LST A;  2O69 A;  2F6P A;  3CG3 A;  3T9U A;  2Q2A A;  1P1N A;  4IO5 A;  2I58 A;  4F2O A;  3ZSF A;  3G3I A;  1NNK A;  1MXX A;  2UVH A;  5L9M A;  4HE2 A;  2XXT A;  2Q8M A;  1MY3 A;  4ZS9 A;  3H06 B;  1WDN A;  1JW5 A;  5IZ3 B;  3D1R A;  4MNI A;  2GFE A;  4RNS A;  4R75 A;  4EQ9 A;  3PTY A;  3RTW B;  3K1N A;  1B3H A;  1RDX A;  3K6W A;  4FJP A;  4LZ5 A;  2VOZ A;  4FEB A;  1GGG A;  3M3L A;  2LAO A;  4OVT A;  3RLF E;  1IMC A;  1B3G A;  3U65 A;  2XXW A;  3LSL A;  3KN3 A;  3N26 A;  1ZJL A;  3ODB A;  4DI3 D;  2XWO A;  1NV6 A;  3G3F A;  4GWX A;  2V25 A;  2WYK A;  4OYV A;  5H8N A;  3VFJ A;  1AIV A;  2HFB A;  2RF1 A;  4ELO A;  3UGW A;  1KA1 A;  3O2A A;  1FQC A;  2XHD A;  3MYU A;  4GWS A;  4YU0 A;  5F7V A;  4NAP A;  1FBP A;  1FTO A;  1LB8 A;  2VD3 A;  4ECF A;  3QIM A;  1IXG A;  3ZS6 A;  5ET7 A;  5I2N B;  2XXP A;  4I3Y A;  4QFK A;  1LAG E;  3TKD A;  1BTJ A;  4N8Y A;  4PC9 A;  4ZEK A;  2PX1 A;  3K00 A;  2XA5 A;  1D9Y A;  4I1D A;  2Y84 A;  5DVI A;  2D3I A;  3O9P A;  4O94 A;  2F78 A;  4G68 B;  4RK9 A;  1K9Z A;  2VPN A;  3IJO B;  5DEX B;  4OVQ A;  4EDP A;  2ZNU A;  4DDD A;  1FTJ A;  3ROJ A;  1IXI A;  1ZTY A;  3D4C A;  2Q9T A;  2X7Q A;  5H8N B;  2I48 A;  1FW0 A;  3DP8 A;  1D3K A;  4PCD A;  5BWJ A;  3VXC A;  2H9B A;  4U1O A;  1N76 A;  4KYD A;  4ZEF A;  2Q2C A;  3TZA A;  2QS3 A;  2DS9 A;  1PEB A;  3IOT A;  5L9S A;  3CHG A;  4IY5 A;  4K3F A;  2I3V A;  5HM4 B;  2XXR A;  4X48 A;  5I3S A;  2DP8 A;  5J16 A;  5M2V A;  4X8R A;  2H98 A;  1PC3 A;  4MX6 A;  3VVE A;  4ZEB A;  1XOC A;  1YZ0 A;  2P2A A;  1OVB A;  1URG A;  1MY0 A;  1DTZ A;  1N3X A;  1OLC A;  4MIJ A;  3Q27 A;  3PD9 A;  3N6U A;  4F3G A;  4LAT A;  4F1V A;  3VVF A;  2V3U A;  1SQY A;  3K6U A;  2F36 A;  4GOT A;  2ALU A;  3I5O A;  4NWC A;  4OTE A;  4G2Z A;  4I9D A;  2BJI A;  2DVZ A;  3SEY A;  2HCA A;  4KI0 E;  4JSD A;  4GQO A;  3C4M A;  1AWB A;  3KEI A;  1MPC A;  1VE4 A;  1NV0 A;  4TOZ A;  2G93 A;  4PE3 A;  5CMM A;  5JEI A;  4I40 A;  1XT8 A;  1ELJ A;  1MQH A;  3R26 A;  1NV3 A;  1SW1 A;  3P7I A;  4FIM A;  4H8J A;  2ZZV A;  3KOT A;  3K6X A;  4NMY A;  5I2K B;  1FQF A;  3IO6 A;  3W9V A;  1PB8 A;  4XKP A;  4G8H A;  3MBP A;  1KZ8 A;  1D9Q A;  1DK4 A;  2XXX A;  3H4Z A;  4JSO A;  4PTK A;  1NUW A;  5L8D A;  4MBP A;  1B9J A;  3EHT A;  3MPK A;  3F11 A;  3SES A;  2QFL A;  1FBE A;  4Q0C A;  1MXW A;  1ATG A;  3SZP A;  1FBH A;  3MW0 A;  2DSF A;  3RN8 A;  2RCB A;  5CMB A;  1DOT A;  1MM6 A;  3K01 A;  3TCG A;  2V93 A;  4N07 A;  1XHY A;  5DYH A;  2NWJ A;  4P56 A;  4PFB A;  4NF5 B;  2O7I A;  4O8M A;  4G77 A;  5TPA B;  4XFE A;  2ZYO A;  4GWU A;  4GWY A;  5IZZ A;  4QBA A;  3PMW A;  3C32 A;  1FTM A;  4DZ1 A;  3CFX A;  3R6U A;  2ZNT A;  3U94 A;  4C0R A;  1EYJ A;  4JDF A;  2V3Q A;  4P47 A;  1DPE A;  3T22 A;  5ITO A;  2ONR A;  2MKZ A;  1IUD A;  2XD3 A;  4GWO A;  1I6A A;  3EKI A;  2A5T B;  4DXB A;  4YZZ A;  2R8T A;  4NF8 B;  1EH3 A;  2O51 A;  4OEN A;  5IZ3 A;  2OBG A;  1ZU0 A;  1O63 A;  2HZL A;  2ESN A;  4GL0 A;  4H45 A;  1GVC A;  4HTG A;  1FBC A;  4I3E A;  3FXR A;  4R6K A;  2I0C A;  1H43 A;  4M4G A;  4Z7E A;  1DTG A;  2I0B A;  4KXP A;  3U1O A;  2F34 A;  1I69 A;  3M3F A;  3LUZ A;  3FVN A;  4OWD A;  2PT2 A;  1P1U A;  1LBB A;  1Y9U A;  4DE8 A;  4GIZ A;  1JVX A;  3KBR A;  2HQ0 A;  1B1X A;  3QXM A;  1Y4T A;  1SW2 A;  3RNN A;  4P0G A;  3PV0 E;  4ZZE A;  2Q89 A;  3RT6 B;  4F3S A;  3KC0 A;  2R6G E;  1Q35 A;  4ZDM A;  3RUM A;  1M5B A;  2RKM A;  2O7U A;  3UIF A;  3KGC A;  1FPK A;  4G61 A;  3PPR A;  4G8N A;  2HXR A;  3K1M A;  1FBF A;  2OK2 A;  4U4S A;  4E0W A;  5KZT A;  3UP9 A;  5FTH A;  3KFM A;  3H6V A;  4OER A;  3Q28 A;  3GZG A;  2Z8E A;  3T1B A;  2BJJ X;  3A09 A;  2ZZX A;  1B58 A;  4ZE8 A;  4N6K A;  2GHA A;  3S9E A;  4XKN A;  4ELR A;  1ZKB A;  4YMA A;  4NX1 A;  2REG A;  5JTY B;  2Z8F A;  4RK2 A;  1LBZ A;  1IMB A;  4F1Y A;  3IB1 A;  3L6G A;  4UAC A;  3A29 A;  3PUW E;  4PET A;  3GLB A;  2F7C A;  5CBS A;  1OLA A;  5A5X B;  4EF1 A;  2PFZ A;  1K9Y A;  2R9J A;  3K1P A;  1MS7 A;  1VR5 A;  3LSX A;  4KR5 A;  5DW8 A;  1MY1 A;  4AB6 A;  4PFY A;  1MH3 A;  3Q26 A;  2GRV A;  2WBD A;  5DTB A;  4ZZA A;  4NN3 A;  3O97 A;  1CE2 A;  2QS2 A;  3T9X B;  4F3P A;  4XIG Q;  2KR0 A;  1B7H A;  4EXK A;  4RPO A;  3T9H B;  2P3V A;  5DVJ A;  4KHZ E;  4IO7 A;  4JVD A;  1XVX A;  1FJ6 A;  4OET A;  1Y1M A;  2P1S A;  3IOV A;  3RQT A;  1R6Z A;  4MNP A;  1LFI A;  4L17 A;  3SEU A;  3IOW A;  1URS A;  4IGT A;  4PFW A;  1KWH A;  1N3W A;  3TAJ A;  3OO9 A;  5AA2 A;  5I57 A;  3K0V A;  1JNF A;  5I58 A;  2E0S A;  3S9N C;  1B2H A;  1NUX A;  3HN0 A;  1SVX B;  1LAX A;  4IY6 A;  2CMO A;  1TWY A;  1NH8 A;  3T9V A;  1NFT A;  4U21 A;  4ZED A;  4IB2 A;  4FAJ A;  5I59 B;  1NNP A;  1QVS A;  3MC2 A;  1MQD A;  5I7I A;  1QUI A;  3PUZ E;  3RTF B;  2DE4 A;  4X9T A;  1ZMG A;  1B7Z A;  4N4U A;  1R9Q A;  3MST A;  4NF6 A;  1AOV A;  1BK4 A;  4RYA A;  2PCR A;  3ONM A;  2RC7 A;  3ILT B;  1B40 A;  2DWJ A;  1TFD A;  3CR9 A;  4HE0 A;  3VXB A;  4H5G A;  2RC8 A;  1NI9 A;  2HAU A;  3V8X B;  3KOS A;  1H44 A;  2F3D A;  4MAG A;  3OSR A;  3MZB A;  1BKA A;  4MFI A;  4P8B A;  4PFI A;  4DIG A;  2F97 A;  3KBZ A;  1VFD A;  3PU5 A;  1IMF A;  2IA4 A;  1YAE A;  4P11 A;  2A5S A;  4PGN A;  1MPD A;  1VFE A;  3B50 A;  4AB5 A;  3FD3 A;  4KYE A;  4O3B A;  4O3A A;  1FJ9 A;  3H03 A;  4HXV A;  3MVX A;  1B32 A;  3IO4 A;  1Y3Q A;  1QUL A;  4IO3 A;  3CFL A;  3TDJ A;  4KCD A;  4JB7 A;  4YB7 A;  3OOA A;  1SYH A;  2DXY A;  3RPL B;  2WYP A;  1SD3 A;  3SEW A;  1VDW A;  3IB0 A;  4FEC A;  2VHA A;  5EQ9 A;  1Y20 A;  1B0H A;  1ZLQ A;  1N0T A;  2DQV A;  1WOD A;  2RC9 A;  4O3C A;  4YKK A;  4NQ8 A;  2UVG A;  2DWA A;  3H6T A;  4U23 A;  5ISU A;  2XXH A;  3KJ7 A;  3DP6 A;  1B05 A;  5EQ8 A;  2W7Y A;  1P99 A;  3W9W A;  1SBP A;  3E4R A;  2AL4 A;  4M1V A;  2QS4 A;  2XX8 A;  4GBW A;  4GF8 A;  4KCC A;  3IB2 A;  2UYF A;  3G3G A;  4ONY A;  4ELP A;  3EPE A;  3TCF A;  3MP8 A;  4RXL A;  5AA4 A;  4JWY A;  1PDA A;  1EZ9 A;  1QKB A;  5B7D A;  3FUZ A;  2ZXT A;  4OES A;  4GFR A;  2QVV A;  1ZIU A;  4RY1 A;  2Y5L A;  2PBW A;  3VLV A;  3LC8 A;  1DBZ A;  2H99 A;  1H45 A;  1G0I A;  4PF6 A;  1WVJ A;  4H5F A;  4U22 A;  4NE4 A;  3UN6 A;  4G68 C;  4U2R A;  3WAF A;  1LGB C;  2VT5 A;  4XTC Q;  3TTN A;  3G3H A;  2Y7W A;  3IOR A;  2FBP A;  4ESW A;  1LCF A;  3ZKL A;  1MPB A;  3EN3 A;  4FED A;  4ZEI A;  4ND9 A;  3TOD A;  3BFU A;  3FXQ A;  3TCH A;  1UIV A;  4F19 A;  4MJO A;  5B70 A;  1AH5 A;  2FA7 A;  4RJZ A;  4PBQ A;  3IFA A;  4P1E A;  2GH9 A;  4X04 A;  1MQG A;  4I62 A;  4LQ5 A;  4NF4 B;  1UTH B;  3H7M A;  5CBR A;  1NV5 A;  5EHS A;  1H3D A;  4WEP A;  2QSX A;  1LFG A;  1SDX A;  2YJP A;  2FIX A;  5I84 A;  1XC1 A;  1IME A;  2HHM A;  3USD A;  3TEP A;  5DT6 A;  2DYX A;  4PAI A;  3E3K A;  4FAT A;  5FTI A;  5LDZ A;  2OJT A;  4F18 A;  4QSC A;  1CNQ A;  1JW1 A;  3IL1 B;  4JXI A;  2H5Y A;  1S7Y A;  3O6H A;  3T66 A;  2CZI A;  4F31 B;  1LBX A;  4QFO A;  1GV8 A;  3V89 B;  3PPO A;  3VLW A;  3PUX E;  3EHU A;  4KFQ A;  1B4Z A;  4DLD A;  4JVC A;  1FTL A;  3B6Q A;  3KN8 A;  2P3N A;  1B52 A;  4H46 A;  1T0K A;  1A99 A;  5TP9 B;  4YKI A;  1FRP A;  5EYH A;  2Y7P A;  4UA8 A;  2XWV A;  1B51 A;  4QFN A;  4AS5 A;  1FPF A;  3QK6 A;  4Z0I A;  3Q25 A;  2VP1 A;  3NOH A;  2YLN A;  3B7D A;  4P0I A;  2V3T A;  1M5C A;  2QS1 A;  3RPW A;  3I6V A;  4YB5 A;  1SPI A;  3TPA A;  1B5H A;  5KDT B;  1ANF A;  2UYE A;  4G8M A;  1LAF E;  5IZ1 A;  1Y3N A;  3G3K A;  3N6T A;  1D4N A;  2B4L A;  2FIE A;  3HST A;  4YB6 A;  5BUU A;  3V83 A;  2AIX A;  3G3J A;  1QGX A;  2WEF A;  2Y7I A;  4JBZ A;  5ESY A;  1R1N A;  1J1N A;  1HSE A;  4N17 A;  5JTY A;  5DVF A;  5EQ7 A;  3HHG A;  1FQE A;  4Q30 B;  4TQU Q;  1IXC A;  2XWI A;  2ZYK A;  3KSX A;  3FXU A;  4PFR A;  1MY2 A;  1JVY A;  1F9B A;  1FQA A;  1G0H A;  3PPP A;  1OIB A;  2B3F A;  1MDP 1;  1POY 1;  1QKA A;  3QSL A;  1FPG A;  2NXO A;  1MQI A;  4IO4 A;  1IEJ A;  1RDY A;  3MVY A;  3S9M C;  2DOJ A;  2I3W A;  1SW4 A;  3U8Q A;  3UOR A;  2O68 A;  2L5V A;  4H0W A;  1FPB A;  3HHF A;  1S9T A;  3RYD A;  4F1U A;  1QUJ A;  2F7B A;  1NV7 A;  4N81 A;  3SET A;  1MG1 A;  4POW A;  4NED A;  3GXA A;  1SI1 A;  4QFP A;  2Y7R A;  3MJN A;  1D9V A;  2QVU A;  1BIY A;  3JZJ A;  1NNT A;  1YCJ A;  3TTR A;  4P3L A; 
#chains in the Genus database with same CATH homology
 3RQT A;  2PT1 A;  3OEM A;  3RLF E;  3THI A;  1R6Z A;  1B3G A;  1UQW A;  4EQ9 A;  3MUQ A;  2XXW A;  1US5 A;  3IR1 A;  3CFZ A;  1LFI A;  3LSL A;  1HSL A;  3FVG A;  3KN3 A;  3N26 A;  1ZJL A;  4L17 A;  5EHM A;  3ODB A;  5TPA A;  4YKP A;  3SEU A;  5HPQ A;  4LUB A;  1EZO A;  3IOW A;  3OO7 A;  1URS A;  4IGT A;  3T9H B;  4PFW A;  1DSN A;  1KWH A;  1N3W A;  3M3K A;  4R74 A;  3G3F A;  3TAJ A;  3IAZ A;  2V25 A;  2I6E A;  4GLI A;  2A5T A;  3OO9 A;  5AA2 A;  5I57 A;  3K0V A;  2O1M A;  4OYV A;  5H8N A;  3VFJ A;  1AIV A;  1JNF A;  1DPP A;  2HFB A;  1MRP A;  2RF1 A;  1B3E A;  3E13 X;  3ECR A;  5CMK A;  1Z7M E;  4ELO A;  4RY1 A;  2E0S A;  2H25 A;  3UGW A;  1B2H A;  3S9N C;  1MXZ A;  3HN0 A;  5J1D A;  2DVC A;  3O2A A;  1SVX B;  1FQC A;  2XHD A;  1LAX A;  4IY6 A;  1B3L A;  2CMO A;  2F35 A;  3H6W A;  5KDT A;  4YU0 A;  1TWY A;  5F7V A;  5H8H B;  3U92 A;  1NH8 A;  2QPQ A;  3H6U A;  1XVY A;  1NFT A;  4OXV A;  4U21 A;  1FTO A;  1LB8 A;  2VD3 A;  3MP6 A;  4LVQ A;  2ZYM A;  4IB2 A;  3QIM A;  3TTK A;  1IXG A;  3GBA A;  3ZS6 A;  4PE5 B;  4FAJ A;  5I59 B;  1NNP A;  1QVS A;  3MC2 A;  1MQD A;  4NTL A;  4JWO A;  5I2N B;  1QUI A;  3C35 A;  3PUZ E;  2XXP A;  5I58 A;  3RTF B;  4NF6 B;  4QFK A;  4OVJ A;  3MQ9 A;  1LAG E;  2DE4 A;  4X9T A;  3UA8 A;  1ZMG A;  1B7Z A;  3TKD A;  1BTJ A;  4H6D A;  4C1T A;  1R9Q A;  1OQH A;  3OEN A;  4NF6 A;  1AOV A;  5CMC A;  4RYA A;  1P1W A;  4DZ1 A;  5H8H A;  4ZEK A;  1TFA A;  2PX1 A;  3PGF A;  3K00 A;  2ZYN A;  3WAE A;  2Z23 A;  1D9Y A;  4I1D A;  2Y84 A;  3ONM A;  2RC7 A;  1PBP A;  1B40 A;  2D3I A;  2DWJ A;  3ILT B;  3O9P A;  5DEX A;  5DVI A;  2F78 A;  3TCG A;  3FJM A;  1TFD A;  4AQ4 A;  5I2K A;  3CR9 A;  3DP4 A;  4G68 B;  3T9V A;  5A5X A;  1N04 A;  4RK9 A;  1B5J A;  3IJO B;  2RC8 A;  4H5G A;  4NF4 A;  5DEX B;  2HAU A;  3VXB A;  4EDP A;  3V8X B;  4F39 A;  2ZNU A;  3KOS A;  3BBR A;  1FTJ A;  1H44 A;  3U93 A;  1IXI A;  4DDD A;  2FNC A;  3VE1 B;  5TU0 A;  4BDM A;  1ZTY A;  3JV9 A;  4RA1 A;  4DXU A;  3D4C A;  3OSR A;  3M8U A;  2Q9T A;  2X7Q A;  1HSJ A;  3MZB A;  1POT A;  5I58 B;  1BKA A;  5H8N B;  1B0L A;  4MFI A;  2I48 A;  5AE4 A;  3PUY E;  4PFU A;  1FW0 A;  1OQG A;  1D3K A;  2NUV A;  2B65 A;  3DP8 A;  4R6H A;  1II5 A;  2DXR A;  2H9B A;  3K4U A;  3VXC A;  3SEX A;  5BWJ A;  1OMP A;  4U1O A;  5CRY A;  1N76 A;  3QUF A;  3TTL A;  4DIG A;  2F97 A;  1JW4 A;  4KYD A;  1SYI A;  3O29 A;  1XS5 A;  5LOM A;  3CIJ A;  1O7T A;  1VFD A;  3EF7 A;  3PU5 A;  2IA4 A;  2NVU B;  1YAE A;  4P11 A;  2A5S A;  3TTM A;  4BDR A;  2UVI A;  4ZEF A;  4HW8 A;  1MPD A;  1Y1Z A;  4H67 A;  1VFE A;  4F3B A;  2Q2C A;  3TZA A;  2QS3 A;  1LCT A;  2DS9 A;  3OD7 A;  1L5T A;  4AB5 A;  1PEB A;  3FD3 A;  3IOT A;  2Z22 A;  3FJ7 A;  4IO6 A;  4KYE A;  4O3A A;  4O3B A;  5L9S A;  3H03 A;  4X1B A;  2OCU A;  4IY5 A;  3TTR A;  3T93 B;  3MVX A;  3VV5 A;  1B32 A;  4K3F A;  4GVO A;  3IO4 A;  1Y3Q A;  2I3V A;  4XKQ A;  1QUL A;  5HM4 B;  4IO3 A;  3FAS A;  3CFL A;  1I6B A;  3TDJ A;  2XXR A;  4KCD A;  4JB7 A;  4R9F A;  4YB7 A;  5ITP A;  3OOA A;  4X48 A;  1B46 A;  2DP8 A;  1NH7 A;  3O6I A;  5M2V A;  3O28 A;  5K2Y A;  3UK4 A;  2QL3 A;  2H98 A;  1PC3 A;  1SYH A;  2DXY A;  2I4C A;  2ONS A;  4JWX A;  2REJ A;  3VVE A;  1SD3 A;  3EQ1 A;  3SEW A;  4Z7E A;  4ZEB A;  1XOC A;  3IB0 A;  4OFO A;  4Q5T A;  4QSD A;  5I56 A;  4FEC A;  2P2A A;  2VHA A;  1Y20 A;  1OVB A;  1URG A;  4QRZ A;  3W15 C;  1B0H A;  3K02 A;  1A54 A;  1ZLQ A;  1MY0 A;  1SI0 A;  2PVU A;  1DTZ A;  4BDN A;  1B4H A;  1N0T A;  4LZ8 A;  5FHM A;  2DQV A;  3LSW A;  3MZ1 A;  1WOD A;  1N3X A;  1NL5 A;  2RC9 A;  3C36 A;  4NWD A;  4O3C A;  4YKK A;  4EQ7 A;  2UVG A;  2DWA A;  1OLC A;  4OHN A;  4PP0 A;  3H6T A;  1RKM A;  4U23 A;  3BFT A;  1TXF A;  3Q27 A;  5H8Q B;  5ISU A;  3TQW A;  2XXH A;  3KJ7 A;  3DP6 A;  3PD9 A;  3N6U A;  5F1Q A;  4LAT A;  4F3G A;  1B05 A;  4F1V A;  3LBS A;  3VVF A;  2V3U A;  2W7Y A;  1SQY A;  2ZNS A;  2VD2 A;  4F22 A;  2DE2 A;  3K6U A;  1P99 A;  2F36 A;  3W9W A;  1M5D A;  3KSJ A;  5H8S A;  3SER A;  4GOT A;  2ALU A;  3H3G A;  3I5O A;  1PB7 A;  1SBP A;  4GL8 A;  4NWC A;  1FQD A;  4OTE A;  4G2Z A;  4R72 A;  3L6H A;  4F2Q A;  4I9D A;  3E4R A;  4YMB A;  2DVZ A;  2AL4 A;  2M8C A;  3B6W A;  4M1V A;  3SEY A;  2HCA A;  2QS4 A;  4KI0 E;  4JSD A;  1MH4 A;  2XX8 A;  1B1H A;  2X7P A;  4GQO A;  2Z8D A;  3C4M A;  3O66 A;  5KCJ A;  3KEI A;  1MPC A;  3HV1 A;  4GF8 A;  4KCC A;  3ZKK A;  3MVW A;  3IB2 A;  1VE4 A;  1M5E A;  2UYF A;  2V84 A;  3OSQ A;  1A8F A;  2DWI A;  3G3G A;  4ONY A;  3PPQ A;  4XXU A;  2ABH A;  4ELP A;  2QMW A;  2XXU A;  3FJG A;  1S50 A;  4TOZ A;  3EPE A;  4WXJ A;  2G93 A;  1QJM A;  1MM7 A;  3TCF A;  3S9L C;  3MP1 A;  1Q1K A;  3FVK A;  5CMM A;  3QAX A;  3MP8 A;  1CB6 A;  4RXL A;  4NF5 A;  5TP9 A;  1IIT A;  4ECF A;  1MY4 A;  2XXI A;  4JWY A;  1BLF A;  5CI5 A;  4I8C A;  5AA4 A;  1XT8 A;  3KN7 A;  1PDA A;  1ELJ A;  2YPN A;  5JEI A;  2D21 A;  4OQO A;  1MQH A;  1EZ9 A;  3R26 A;  4LON B;  1A7L A;  2FYI A;  5H8Q A;  4NF8 A;  1QKB A;  5B7D A;  1GTK A;  1UIU A;  3FUZ A;  3DM0 A;  3VLU A;  2ZXT A;  1SW1 A;  4OES A;  3P7I A;  4GFR A;  1B6H A;  3PUV E;  1MQJ A;  2XX7 A;  3DEL B;  3C9H A;  4FIM A;  4H8J A;  3KOT A;  4G68 A;  1FTK A;  1ZIU A;  3K6X A;  4NMY A;  4OZ9 A;  2P0S A;  1N7W A;  1FQF A;  3IO6 A;  4MLV A;  1PB8 A;  2PBW A;  5ELV A;  5I2K B;  5AA1 A;  3VLV A;  3W9V A;  1TT1 A;  4XKP A;  4MH5 A;  4G8H A;  2NOO A;  4Q8R A;  3LC8 A;  3MBP A;  2XXX A;  1AL3 A;  2H99 A;  2D5W A;  3BKI B;  3H4Z A;  5I56 B;  1H45 A;  3A3U A;  5JK4 A;  3T96 B;  2OWS A;  4H8I A;  1UTB B;  4RPN A;  4GD5 A;  4JSO A;  1WVJ A;  4H5F A;  5AA3 A;  3IX1 A;  5L8D A;  2H4I A;  4MBP A;  4KQP A;  4NE4 A;  4U22 A;  3UN6 A;  2O6A A;  1B9J A;  2X26 A;  4EXL A;  3EHT A;  3LSF B;  4G68 C;  3CSG A;  4QHQ A;  4U2R A;  1IQ7 A;  2PYY A;  3WAF A;  5H8F B;  3MPK A;  2VGQ A;  3F11 A;  1JQF A;  1LGB C;  5CM6 A;  4YIC A;  1IIW A;  2RIN A;  3SES A;  4XTC Q;  2Y7K A;  3TTN A;  3G3H A;  4ESX A;  5K2X A;  1O64 A;  2Y7W A;  2DWH A;  3IOR A;  3OMB A;  1PB9 A;  4Q0C A;  1MXW A;  1ATG A;  3V5A A;  3FVO A;  4ESW A;  1LCF A;  3MW0 A;  3ZKL A;  2DSF A;  1MPB A;  3QUJ A;  3CI8 A;  3EN3 A;  2RCB A;  3RN8 A;  3TMG A;  4FED A;  3IJX B;  4KD5 A;  4ZEI A;  4ZEC A;  5CMB A;  4ND9 A;  3TOD A;  1DOT A;  4THI A;  3SDF A;  1B3F A;  4X1D A;  3BFU A;  4OFJ A;  3FXQ A;  3TCH A;  4HCW A;  3S4U A;  1RYX A;  1MM6 A;  1SW5 A;  1UIV A;  2V93 A;  1UTH A;  2XXV A;  3K01 A;  1YTV A;  3N94 A;  4N07 A;  4F19 A;  1XHY A;  5DYH A;  5B70 A;  2NWJ A;  1AH5 A;  2FA7 A;  3VDF A;  4NF5 B;  4EF2 A;  4IGR A;  4RJZ A;  5I57 B;  1B7U A;  4LP2 B;  1PBQ A;  2O7I A;  2PMS A;  3HCQ A;  3LR1 A;  4G77 A;  5H8F A;  5TPA B;  1USY H;  2ZYO A;  3FGS A;  4GXA A;  3KJT A;  2GH9 A;  4U1Z A;  1A40 A;  4LQ2 A;  1MQG A;  2RCA A;  3SEV A;  1NMU A;  3PMW A;  4GRK A;  4I62 A;  2OZZ A;  3C32 A;  1EU8 A;  1FTM A;  1MXV A;  2I49 A;  3MAM A;  3CFX A;  1LLS A;  4LQ5 A;  4N6P A;  1UTH B;  1YPN A;  3R6U A;  4NF4 B;  3H7M A;  2ZNT A;  3U94 A;  4C0R A;  5CBR A;  2F6G A;  4JDF A;  2V3Q A;  3I3V A;  5EHS A;  2QMX A;  1IXH A;  1H3D A;  3PMV A;  4TLM B;  1DPE A;  4XKR A;  3T22 A;  3TQL A;  3C31 A;  4WEP A;  5ITO A;  2ONR A;  2QSX A;  1LFG A;  1IUD A;  1SDX A;  2YJP A;  2XD3 A;  3K6V A;  1I6A A;  3IOU A;  4GWO A;  3KZG A;  4QSE A;  1LFH A;  2A5T B;  2I4B A;  4DXB A;  4R2F A;  5I84 A;  4KPT A;  1XC1 A;  1FCK A;  2XX9 A;  1OVT A;  4MF3 A;  3TEL A;  2HEU A;  5HBC A;  4YZZ A;  2Q8J A;  3USD A;  1GR2 A;  3TEP A;  4H65 A;  5DT6 A;  2CZL A;  4NF8 B;  2DYX A;  1MDQ A;  3E3K A;  4FAT A;  5FTI A;  2OJT A;  4F18 A;  4QSC A;  1I6Q A;  1JW1 A;  1BP5 A;  1EH3 A;  2O51 A;  3IL1 B;  4OEN A;  4YKJ A;  4BLA A;  4JXI A;  1EZP A;  5ICT A;  2H5Y A;  2DE3 A;  1LBC A;  1MXY A;  1MXU A;  1ZBM A;  1S7Y A;  2OBG A;  3JYR A;  3O6H A;  1ZU0 A;  2O1L A;  1O63 A;  3T66 A;  2HZL A;  2ESN A;  2UVJ A;  3DLN A;  4GL0 A;  4F31 B;  1GVC A;  4HTG A;  3CVG A;  3EHS A;  4QFO A;  3TFL A;  1GV8 A;  3FXR A;  3V89 B;  3Q29 A;  2I0C A;  3PPO A;  1H43 A;  3MWB A;  3OXN A;  4OFL A;  3PUX E;  3EHU A;  4M4G A;  4R6K A;  3VLW A;  3VVD A;  2WKY A;  4KFQ A;  1DTG A;  4H1X A;  1B4Z A;  2I0B A;  4DLD A;  4TLL B;  2F8D A;  3U1O A;  2O84 X;  2F34 A;  3C34 A;  4E0X A;  1FTL A;  1I69 A;  3B6Q A;  3C33 A;  3HPI A;  3KN8 A;  4KYS A;  4R2B A;  4EXK A;  1B52 A;  5AA4 B;  1T0K A;  3M3F A;  1A99 A;  5TP9 B;  4YKI A;  3QYT A;  1NKX A;  3FVN A;  4OWD A;  2Y7P A;  5IKB A;  3CG1 A;  3FV2 A;  4UA8 A;  3MZ9 A;  2IEE A;  3PPN A;  1QW0 A;  4MLQ A;  1B51 A;  3CRB A;  2PT2 A;  3E9X A;  1P1U A;  2ONK E;  2HXW A;  4QFN A;  3S2V A;  1URD A;  2QJE A;  1LBB A;  2F5X A;  2THI A;  3QK6 A;  4N13 A;  1Y9U A;  4Z0I A;  2UXA A;  4EUO A;  3Q25 A;  2VP1 A;  1Y4C A;  3R7X A;  4DE8 A;  2YLN A;  5L9O A;  2B3B A;  3B7D A;  4FE8 A;  2KLF A;  1JVX A;  4GIZ A;  4P0I A;  2V3T A;  5I59 A;  3KBR A;  4EQB A;  1M5C A;  2QS1 A;  2HQ0 A;  3RPW A;  1B1X A;  3QXM A;  5KCJ B;  2ANJ A;  1Y4T A;  2ZMB A;  1NNF A;  1JEV A;  3IK6 B;  1SW2 A;  3I6V A;  3PMX A;  4YB5 A;  1US4 A;  3RNN A;  4P0G A;  3TPA A;  1B5H A;  3A3C A;  1ANF A;  2UYE A;  3PV0 E;  4G8M A;  2Q89 A;  1LAF E;  4OEU A;  4OEV A;  1QUK A;  4ZZE A;  3RT6 B;  4ELQ A;  4F3S A;  2R6G E;  1Q35 A;  1Y3N A;  4ZDM A;  3LUY A;  1LB9 A;  3KG2 A;  4POX A;  1M5B A;  2RKM A;  2XD2 A;  3G3K A;  3RUM A;  4ZED A;  2O7U A;  3UIF A;  3KGC A;  3PPR A;  2F7A A;  4G8N A;  5ICQ A;  3N6T A;  1D4N A;  3HST A;  4YB6 A;  5BUU A;  3V83 A;  2AIX A;  5AA2 B;  3K1M A;  2OK2 A;  3FZV A;  4U4S A;  5FHO A;  4LZ7 A;  3G3J A;  4DCY A;  4E0W A;  4DXC A;  5KZT A;  4WED A;  3UP9 A;  4R6Y A;  5FTH A;  3AXF A;  2Y7I A;  4JBZ A;  1R1N A;  1J1N A;  1HSE A;  2Q88 A;  3GBB A;  3KFM A;  3SKP A;  4DCX A;  1P1Q A;  5JTY A;  1B5I A;  5DVF A;  5IAI A;  3H6V A;  4PFT A;  1M5F A;  1VSO A;  4OER A;  3HHG A;  1FQE A;  4Q30 B;  4TQU Q;  4ISU A;  4YAH X;  3RT8 A;  5AA2 D;  1UTB A;  3Q28 A;  3GZG A;  1IXC A;  2XXQ A;  2ZYK A;  3KSX A;  3N5L A;  5FHN A;  2Z8E A;  3FXU A;  1DMB A;  1MY2 A;  1R9L A;  4HCY A;  4C1U A;  3FAT A;  1JVY A;  1LAH E;  1Y3P A;  2OWT A;  2BJJ X;  3A09 A;  1F9B A;  1B58 A;  1A8E A;  1FQA A;  3ILU B;  3PPP A;  2AL5 A;  1OIB A;  4ZE8 A;  2B3F A;  1IZ1 A;  1RYO A;  2GHA A;  4QFL A;  1FQB A;  3G7W A;  3S9E A;  4XKN A;  3MPL A;  2QRY A;  1P1O A;  1USY E;  1MDP 1;  1POY 1;  1QKA A;  3QSL A;  3K2D A;  1ZKB A;  4ELR A;  4R73 A;  3MVZ A;  4YMA A;  1N7X A;  3FIR A;  3OO6 A;  2NXO A;  1MQI A;  2REG A;  2HAV A;  5JTY B;  3D4G A;  2Z8F A;  3OEL A;  4RK2 A;  4IO4 A;  1IEJ A;  3HO7 A;  3TYH A;  4F1Y A;  3IB1 A;  3L6G A;  3OO8 A;  1A55 A;  4UAC A;  3OEK A;  3PUW E;  3MVY A;  2OLB A;  4BDL A;  1N84 A;  4PET A;  1LST A;  2O69 A;  3GLB A;  3RY3 A;  2R71 A;  3S9M C;  2F7C A;  2F6P A;  2XXY A;  4HS7 A;  2DOJ A;  2I3W A;  3CG3 A;  3O6G A;  5CBS A;  1OLA A;  5A5X B;  3B6T A;  1SW4 A;  2GHB A;  3T9U A;  2Q2A A;  3U8Q A;  4EF1 A;  1P1N A;  4IO5 A;  3UOR A;  2I58 A;  3TUS A;  4BDO A;  3ZSF A;  2O68 A;  2R9J A;  1NNK A;  1MXX A;  3G3I A;  1MS7 A;  3K1P A;  4F2O A;  1VR5 A;  2UVH A;  4LA9 A;  3LSX A;  4H0W A;  4KR5 A;  4WKM A;  1MY1 A;  5L9M A;  4PFY A;  3U72 A;  2G29 A;  1MH3 A;  3HHF A;  4AB6 A;  2XXT A;  4F29 A;  3Q26 A;  1MY3 A;  2GRV A;  3CSB A;  1Z7N E;  1S9T A;  4ZS9 A;  4F1U A;  1JET A;  3H06 B;  5KDT B;  4PQJ A;  1QUJ A;  1WDN A;  5DTB A;  4ZZA A;  1JW5 A;  4QF9 A;  2F7B A;  1CE2 A;  2QS2 A;  3O97 A;  3T9X B;  1H76 A;  1MG1 A;  3FV1 A;  3SET A;  4GXS B;  4F3P A;  5I2N A;  4OMB A;  4XIG Q;  4G4P A;  4BDQ A;  1JEU A;  2GFE A;  1B7H A;  2HZK A;  4NED A;  4POW A;  4R75 A;  4RNS A;  4RPO A;  5DVJ A;  3GXA A;  2E1S A;  4R9G A;  3RGY A;  5EYF A;  3PD8 A;  1SI1 A;  4KHZ E;  4FOR A;  4QFP A;  3RTW B;  3K1N A;  4IO7 A;  1B3H A;  2Y7R A;  3MJN A;  1D9V A;  1XVX A;  4OET A;  3K6W A;  4FJP A;  1BIY A;  4IO2 A;  4LZ5 A;  5CC2 A;  3JZJ A;  1AMF A;  1Y1M A;  2VOZ A;  2AYS A;  1NNT A;  2P1S A;  4FEB A;  1GGG A;  1YCJ A;  2LAO A;  3M3L A;  4ZE9 A;  3IOV A;  4U4X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...