2YLNA

Crystal structure of the l-cystine solute receptor of neisseria gonorrhoeae in the closed conformation
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
240
structure length
240
Chain Sequence
AISGSLIERINNKGTVTVGTEGTYAPFTYHDKDGKLTGYDVEVTRAVAEKLGVKVEFKETQWDSMMAGLKAGRFDVVANQVGLTSPERQATFDKSEPYSWSGAVLVAHNDSNIKSIADIKGVKTAQSLTSNYGEKAKAAGAQLVPVDGLAQSLTLIEQKRADATLNDELAVLDYLKKNPNAGVKIVWSAPADEKVGSGLIVNKGNDEAVAKFSTAINELKADGTLKKLGEQFFGKDISVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords PUTATIVE ABC TRANSPORTER, PERIPLASMIC BINDING PROTEIN, AMINO
publication title Crystal Structures of Two Solute Receptors for L-Cystine and L-Cysteine, Respectively, of the Human Pathogen Neisseria Gonorrhoeae.
pubmed doi rcsb
source organism Neisseria gonorrhoeae
total genus 90
structure length 240
sequence length 240
ec nomenclature
pdb deposition date 2011-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2ylnA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2ylnA02
5I56A 3QIMA 4GLIA 4YICA 3E4RA 1PB8A 5ITPA 2CMOA 3T66A 4LQ5A 3EHTA 3RQTA 3VVDA 3FJMA 3MZBA 3FV1A 4KHZE 3WAFA 1A55A 3KN7A 3ZSFA 1ZKBA 2A5SA 3UN6A 4RYAA 2Q88A 2Q2AA 4MF3A 3PUXE 1UTHB 4I9DA 2VP1A 3K6UA 5IAIA 3IOTA 4ESWA 2ESNA 4OFJA 1ANFA 1QUJA 5KZTA 3O2AA 4BDQA 3FJ7A 4NF4A 5CBRA 5ICQA 3OEKA 5K2XA 1NFTA 3MBPA 1B7HA 4WXJA 2O1LA 2XXHA 3DLNA 4TLMB 1MS7A 2HCAA 2H9BA 3KOSA 3M8UA 2DWAA 3SETA 2ZYNA 1B3HA 2I0CA 1WODA 3I6VA 4G4PA 4U1OA 1SVXB 3T93B 1MXVA 4R2BA 3ZS6A 2P0SA 4POWA 1ZJLA 1Y3NA 3VLVA 5CMMA 3T9HB 4X1BA 1FQDA 5AA2B 5L9SA 3W9VA 2ALUA 1O7TA 4JDFA 3D4CA 4FATA 4OFOA 1FTKA 1SD3A 2F6GA 3SEVA 3T9UA 4OTEA 3DELB 3VXBA 3IAZA 4R6YA 3C4MA 2HAVA 3ILUB 3FUZA 2A5TB 2OLBA 3N5LA 2RKMA 4E0WA 3LUYA 4F1UA 3OMBA 4H0WA 2V93A 2OBGA 2REJA 4BDOA 2QS2A 1MDQA 1IITA 3V83A 4O3AA 3IB0A 1MH3A 2F8DA 2I49A 2Z8DA 3SERA 4LP2B 1TWYA 1JVYA 3QYTA 2Q8JA 1POTA 3TTNA 1B7ZA 1RKMA 4IGRA 1M5CA 2HQ0A 4X9TA 4QFPA 4Z0IA 4BDLA 2UYEA 1FTMA 4F2OA 4G8MA 3TFLA 3E3KA 5B7DA 3OOAA 3MC2A 1EH3A 4BDNA 2DWJA 2XHDA 4IGTA 1IEJA 3C35A 4KYEA 1URDA 4P11A 4FE8A 1B5HA 1Y1MA 4IO2A 4DXBA 3UA8A 2PT1A 4WEPA 1M5BA 1IXCA 4K3FA 2VHAA 4EUOA 1B3FA 4KR5A 1A8FA 3PV0E 2OJTA 3KJ7A 2DWHA 1S7YA 3FXUA 4GXSB 3TKDA 1QW0A 1QUKA 4ZEDA 2QMWA 4GWOA 4M1VA 1R9QA 3QSLA 2F6PA 5I58B 4ELPA 2YJPA 4NE4A 1HSJA 1XS5A 1MQJA 2DQVA 3FD3A 2F7CA 5FTHA 2F7AA 3IO6A 3RTWB 3KN8A 4OEUA 1M5DA 3I5OA 2Q9TA 1B51A 3KSXA 3C31A 4F18A 3H7MA 3O66A 2Z8FA 3EPEA 3KJTA 2HFBA 1B52A 4ZEKA 4F22A 3U1OA 4QHQA 4RPOA 4WKMA 4YKKA 4IO3A 4YKJA 3IJXB 2I6EA 5I2KA 2DE4A 4F2QA 3CIJA 1HSLA 3N26A 3S2VA 2Q2CA 2XX8A 4M4GA 4R75A 3OD7A 5K2YA 4RK2A 2XXWA 2DVCA 2DE2A 3PD8A 2QPQA 4Q30B 2XXUA 3ILTB 3CFZA 3TMGA 4NMYA 2QS4A 3VDFA 3JV9A 3LSLA 1SI0A 1A54A 2VD2A 4PFTA 1MXXA 2ZYOA 2B65A 1LAGE 3DM0A 1J1NA 3CSGA 4YKIA 3JYRA 5I56B 2BJJX 4DLDA 3C32A 4JSDA 2H5YA 1VSOA 3FXQA 1URGA 1GV8A 1VFEA 3TTRA 2F36A 2ONKE 4HTGA 1CE2A 1LCTA 2OCUA 3K02A 2FNCA 1P1OA 1Y3QA 1UTBA 4EQ7A 1N7XA 3K0VA 4Q5TA 3MWBA 3Q25A 2UVHA 1I69A 3RPWA 1GGGA 2ZNUA 1B32A 5KCJA 2I4CA 3IX1A 2UXAA 4R9GA 2R6GE 4NF4B 2UVGA 4OESA 3OENA 1OIBA 2F78A 3HSTA 1PEBA 2XD2A 4AB5A 3GBBA 1QULA 2R9JA 1US5A 1Y1ZA 1A7LA 4KPTA 2V25A 1JVXA 4U4XA 3MAMA 4XKQA 5H8QA 5I57A 3G3JA 3PUVE 2B3FA 3ECRA 3MPLA 2FYIA 2UVIA 1O63A 4DDDA 3M3FA 5KDTA 5ISUA 3KN3A 2O68A 4LZ7A 1NH7A 2QL3A 3FVGA 3H06B 4QFNA 1R6ZA 1TFAA 5ICTA 1JETA 1B0LA 5JTYB 3K6WA 3MZ1A 3VLUA 2RINA 5I84A 3RT8A 3K1PA 3C36A 3TEPA 3OELA 1ZU0A 1N0TA 2I58A 3T22A 3MP8A 1TXFA 2Z8EA 3B7DA 2RC9A 3N94A 1FQCA 3ZKLA 4U22A 4H8IA 1NNTA 3MPKA 4ONYA 4XXUA 4NEDA 2DWIA 1BKAA 3PUYE 3HN0A 3A3CA 1QKAA 2I3WA 3PU5A 2I0BA 4PFWA 4RY1A 1MXZA 2H98A 1N84A 1B2HA 1YAEA 1URSA 4PQJA 3PPPA 2GFEA 4OQOA 2Y7PA 2XXYA 1DPPA 3W15C 1B0HA 4OZ9A 3PMWA 3FVKA 1WDNA 5EYFA 2IA4A 1IZ1A 3UP9A 1F9BA 4NWDA 3IJOB 3H6TA 2AIXA 4G68C 4EQ9A 1USYH 4NF5B 4FIMA 3TCFA 3FATA 1CB6A 4QF9A 4JXIA 4IB2A 3PPOA 4I62A 4U21A 1MPCA 1P1WA 4IO6A 3U93A 2NOOA 2F97A 2H25A 3HPIA 4EQBA 1M5EA 1FTJA 1H43A 4RJZA 2ZYKA 3MJNA 3HHFA 4RPNA 5HPQA 4GL0A 4MBPA 3OO7A 2NWJA 4ESXA 2OWTA 3MVYA 4LUBA 5JEIA 4FJPA 3HV1A 5J1DA 1O64A 3TCGA 3THIA 3KFMA 3TZAA 3UORA 4QRZA 3F11A 3DP6A 1LAFE 3LR1A 3ONMA 3M3KA 3LBSA 1NNFA 3RTFB 1LBCA 2VGQA 5JTYA 4OMBA 4XKRA 4DZ1A 4DCYA 5BWJA 4ZE9A 1B3GA 5FHNA 3FV2A 5L8DA 4R9FA 3SKPA 5I2KB 1JW4A 4ZECA 4X1DA 1VE4A 1B4HA 4H5FA 4KFQA 4MH5A 1QKBA 3L6GA 4XKPA 4FEBA 4XTCQ 1MQGA 3GBAA 2OZZA 3R26A 3VV5A 4ZDMA 4E0XA 4N6PA 3N6UA 4KYDA 2NVUB 5DVJA 2P1SA 4AQ4A 3K6XA 3TODA 2THIA 1GTKA 4PFUA 3KSJA 3PPNA 5I59A 3Q26A 4AB6A 1YTVA 4ECFA 1EZPA 1ZLQA 2PYYA 3IOUA 4QFLA 3MP6A 3ZKKA 1FTOA 3B6TA 4ELRA 1MY2A 2DE3A 1MQDA 1JW5A 4MLVA 4XKNA 4OVJA 2O69A 5LOMA 3IB1A 4WEDA 4FEDA 4G68A 2Y7RA 3OSQA 3MUQA 3CG1A 3JZJA 4UACA 2YPNA 4ZZAA 4NF5A 3VLWA 3TUSA 2ZMBA 4F1YA 3FVNA 3EN3A 4KQPA 1UTBB 1UIVA 5I2NA 2QJEA 3VFJA 2O6AA 4BDRA 4THIA 3BBRA 4R2FA 3E13X 1MRPA 3IB2A 3USDA 5KCJB 3R6UA 1B40A 3G3GA 3IO4A 3HO7A 3UGWA 1MY1A 2Y7KA 1A8EA 4H5GA 1SDXA 4JWOA 4HCWA 1LB9A 4OXVA 5CMBA 1XC1A 5H8QB 4C0RA 5I57B 1NL5A 2QS3A 1PBQA 2V3QA 3K1MA 5CI5A 4JBZA 5DTBA 1OVTA 4NTLA 3QUJA 2REGA 1OQGA 2V3UA 1II5A 5KDTB 4EXKA 1I6QA 2RC8A 1S50A 3H3GA 3CFLA 4F1VA 3O29A 3T9VA 3OO9A 3ODBA 3V5AA 1TT1A 2D5WA 4EDPA 2F5XA 3LC8A 2ZXTA 2Q89A 2I3VA 3FASA 5H8NA 3MW0A 3G3FA 5FHOA 1MY0A 3A3UA 4OERA 1AH5A 2Y84A 3GXAA 4GOTA 1PB7A 4RA1A 2HAUA 1FTLA 2DOJA 3CI8A 3IL1B 2DXRA 1IXGA 3OSRA 4POXA 2YLNA 2ONRA 3TQWA 1Y9UA 1AL3A 3R7XA 3V8XB 1D3KA 1VFDA 4R74A 1FW0A 2VD3A 3PMXA 1LSTA 4Z7EA 1MXWA 4H67A 3SEWA 2I4BA 2ABHA 4EF1A 1PBPA 3EHSA 2B3BA 1SW4A 5CMKA 2RC7A 2O51A 1NNKA 4NF8B 4Q8RA 1B05A 4KD5A 4U2RA 3MVXA 1UIUA 2RCBA 3OO6A 3S9NC 5F1QA 1XT8A 2UVJA 4RXLA 1AIVA 1N3XA 1N04A 1OMPA 2O7IA 3KEIA 5ELVA 3KBRA 3O28A 1BTJA 5AA4B 4F3PA 4YB6A 5AA3A 1SQYA 2D21A 3TTKA 3U94A 1XVYA 3MVWA 4YU0A 3HHGA 3Q28A 1ZTYA 1T0KA 4TLLB 4N07A 4R6HA 4GXAA 1B7UA 2V84A 1S9TA 3B6QA 1B3EA 1B6HA 4LQ2A 1B5JA 3O6IA 5CRYA 2H4IA 2AYSA 4KYSA 1AOVA 3PUWE 4PP0A 4BLAA 4EF2A 1PB9A 2Z22A 3G7WA 1KWHA 1BP5A 5EHSA 1SW5A 3RLFE 4P0IA 1H44A 1XOCA 5A5XA 4NWCA 2GHBA 1ELJA 3TTMA 1B5IA 1NMUA 2XD3A 1DOTA 1Y4TA 5DVIA 3Q27A 1PDAA 3TDJA 4DE8A 4ISUA 1I6AA 5DEXB 1LFIA 3GZGA 1XHYA 2HZKA 3VE1B 1DTGA 5H8FA 1Y3PA 3H6WA 4IO5A 1P1QA 4GIZA 3RN8A 1YCJA 5TP9B 1ZIUA 1OLAA 3HCQA 1GVCA 1D9YA 1H45A 2PX1A 1FQFA 3LSWA 4DIGA 3TYHA 2F34A 3MZ9A 1JNFA 2D3IA 4U23A 5F7VA 3BFTA 3H03A 5I59B 4P0GA 4YMBA 4HS7A 3H4ZA 3CRBA 4LZ5A 5AE4A 4KCCA 3K2DA 5L9OA 3UK4A 3PD9A 5AA1A 1Z7ME 1FCKA 4NF8A 4G8HA 4DCXA 2ZNTA 4G68B 4IY6A 2R71A 5EHMA 2P2AA 1OLCA 3SEXA 4OETA 5DT6A 1BIYA 4O3BA 2X7QA 3L6HA 1GR2A 1YPNA 4OHNA 5CC2A 3IORA 3SESA 3CG3A 5BUUA 2O1MA 2E0SA 4L17A 3S9MC 5I2NB 2DVZA 3KGCA 1I6BA 5AA4A 1D9VA 5CMCA 2RF1A 1NNPA 4I8CA 4QSDA 3OO8A 4C1TA 1MY4A 4H6DA 4TOZA 1JQFA 4OENA 2GHAA 2PBWA 3BFUA 4R73A 3EQ1A 4F39A 3SDFA 3A09A 3FXRA 2G29A 1B1HA 4ZE8A 2HXWA 4XIGQ 4R72A 2DXYA 2GRVA 2ZYMA 4DXCA 2OWSA 3K01A 4MFIA 4Q0CA 4ZZEA 2E1SA 5DYHA 1N3WA 1QVSA 1SI1A 2QRYA 4LVQA 1PC3A 4LONB 4IY5A 3C33A 5M2VA 1R1NA 3CR9A 3CSBA 1EU8A 5TPAA 2RCAA 3FVOA 1MPDA 1SBPA 3H6VA 2XXTA 4FORA 2HZLA 2X7PA 1JEVA 1VR5A 5DEXA 1WVJA 3P7IA 5H8NB 4ZEBA 1N76A 4EXLA 5IKBA 3BKIB 1FQBA 4YMAA 5TP9A 4ELOA 4FECA 2QSXA 3IK6B 1FQAA 2XXXA 2VOZA 5HM4B 2ZNSA 2XX7A 3C9HA 4F29A 1B3LA 4G8NA 5TU0A 3E9XA 2F35A 4YZZA 3RUMA 1SW2A 2M8CA 3O6GA 4IO7A 2PT2A 1LFGA 4ZEFA 4F3SA 3IOWA 1LBBA 1LAHE 4OWDA 3V89B 2IEEA 1RYXA 4U4SA 4O3CA 3KG2A 2GH9A 1P1NA 4QFOA 4U1ZA 3TPAA 3IR1A 1JEUA 3KOTA 2Y7WA 3AXFA 2AL4A 5FHMA 2AL5A 3I3VA 1DSNA 3PPQA 3TTLA 4YKPA 5HBCA 3MQ9A 3W9WA 2F7BA 3LSFB 2XXVA 3VVFA 4NF6B 1UTHA 5H8SA 1AMFA 3GLBA 3SEUA 2HEUA 3K4UA 1MXYA 1MDP1 2DP8A 3G3IA 1LGBC 3FGSA 1ATGA 1TFDA 1OQHA 1USYE 1MM6A 1A40A 5H8HB 4KCDA 5DVFA 3TCHA 3S4UA 3CVGA 4ZS9A 1N7WA 3O6HA 1B9JA 3EHUA 1IXIA 3MP1A 2XXIA 3PMVA 4GVOA 1FQEA 2ONSA 3H6UA 5AA2D 2OK2A 4G2ZA 1RYOA 3QXMA 2PVUA 4ND9A 1Y4CA 3TQLA 1LLSA 4YB7A 5CM6A 1Z7NE 3FZVA 4JSOA 5AA2A 3D4GA 1B58A 3DP8A 5B70A 3T9XB 3QUFA 4JWXA 4YAHX 5A5XB 1MH4A 4LZ8A 2XXQA 2V3TA 3U8QA 1MY3A 5CBSA 2I48A 4PFYA 2DSFA 3MVZA 4RNSA 5FTIA 2A5TA 4GQOA 2QS1A 2LAOA 3G3KA 1ZBMA 4IO4A 3B6WA 5H8FB 4GRKA 4DXUA 4GL8A 2XXPA 2XXRA 3WAEA 1H76A 3OXNA 3FJGA 1BLFA 3SEYA 1IQ7A 3Q29A 2X26A 4N13A 4JWYA 2NXOA 3K00A 2DYXA 3G3HA 1Q35A 3PUZE 1EZOA 4GFRA 4FAJA 2W7YA 1LB8A 4MLQA 4BDMA 1QJMA 3TELA 1MXUA 4F3BA 1POY1 3QAXA 2NUVA 1B4ZA 1IXHA 2H99A 4LA9A 1A99A 1QUIA 1D4NA 3EF7A 1MPBA 3CFXA 4NF6A 1LCFA 3TAJA 1DTZA 4H65A 4OYVA 3K6VA 1M5FA 1L5TA 1XVXA 3U92A 4X48A 3UIFA 3S9LC 3T96B 4ELQA 1SYIA 4QSCA 1B1XA 5H8HA 1DPEA 4GF8A 1SW1A 1R9LA 3PPRA 2KLFA 5I58A 3PGFA 1MG1A 1IIWA 3O97A 1EZ9A 1SYHA 1Q1KA 3N6TA 4LATA 1ZMGA 4JB7A 3QK6A 3LSXA 3KZGA 2DS9A 4ZEIA 1IUDA 1MQIA 3M3LA 2WKYA 2XX9A 4TQUQ 5L9MA 4RK9A 2CZLA 4H1XA 1LAXA 2O84X 4F3GA 3S9EA 1NH8A 3RGYA 1P99A 3FIRA 4G77A 4OEVA 5TPAB 3IOVA 2Z23A 4GD5A 4QSEA 4HCYA 2UYFA 1Y20A 3U72A 4PE5B 1P1UA 3RT6B 4H8JA 3OEMA 3DP4A 1MM7A 2G93A 2Y7IA 1HSEA 4I1DA 2O7UA 4PETA 1B46A 4F31B 5JK4A 3C34A 3VVEA 1H3DA 1NKXA 4OFLA 2ANJA 1MQHA 2QMXA 1UQWA 1US4A 4R6KA 5ITOA 4C1UA 1LFHA 3VXCA 2FA7A 4HW8A 1JW1A 3RNNA 4UA8A 3O9PA 4KI0E 3K1NA 4QFKA 1DMBA 4F19A 4YB5A 2PMSA 1OVBA 3RY3A
chains in the Genus database with same CATH superfamily
5I56A 2OX3A 3QIMA 4GLIA 4YICA 3E4RA 1PB8A 5ITPA 2CMOA 3T66A 2JJKA 4LQ5A 3EHTA 3RQTA 3VVDA 3FJMA 3MZBA 3FV1A 4KHZE 5ET5A 3WAFA 1A55A 1YXIA 3KN7A 3ZSFA 1ZKBA 2A5SA 3UN6A 4RYAA 2Q88A 2Q2AA 4DI4B 4MF3A 3PUXE 1UTHB 1KA1A 4I9DA 2VP1A 1RDYA 3K6UA 5IAIA 3IOTA 4ESWA 2ESNA 4OFJA 1ANFA 1QUJA 5KZTA 3O2AA 4BDQA 3FJ7A 5ET6A 4NF4A 5CBRA 5ICQA 3OEKA 5K2XA 1NFTA 3MBPA 1B7HA 4WXJA 2O1LA 2XXHA 3DLNA 4TLMB 1MS7A 4MHFA 2HCAA 2H9BA 3KOSA 3M8UA 2DWAA 3SETA 2ZYNA 1B3HA 2I0CA 3EKIA 5ESYA 1WODA 3I6VA 4PAKA 4NQ8A 1DK4A 4G4PA 4U1OA 1SVXB 3T93B 1MXVA 4R2BA 3ZS6A 2P0SA 4POWA 1ZJLA 1Y3NA 1EYIA 3BIGA 3VLVA 5CMMA 3T9HB 4X1BA 1FQDA 5AA2B 5L9SA 3W9VA 2ALUA 4GWUA 1O7TA 4JDFA 3D4CA 4FATA 4OFOA 1FTKA 1SD3A 2F6GA 3SEVA 3T9UA 2L5VA 5ET7A 4OTEA 4PGPA 3DELB 3VXBA 3IAZA 4R6YA 4PDHA 1G0IA 3C4MA 2HAVA 3ILUB 3FUZA 2A5TB 3D1RA 2OLBA 3N5LA 2RKMA 4E0WA 3LUYA 4GWWA 4F1UA 3OMBA 4H0WA 2V93A 5EQ8A 2OBGA 1FPIA 2REJA 1INPA 5I5PA 3MYUA 4BDOA 1FPGA 2QS2A 1MDQA 1IITA 4NF0A 3V83A 4O3AA 3IB0A 5IZ1A 1MH3A 2F8DA 2I49A 2Z8DA 1K9ZA 3SERA 4LP2B 1TWYA 2Q74A 3T1BA 1JVYA 3QYTA 2Q8JA 1POTA 3TTNA 1B7ZA 1RKMA 4IGRA 1M5CA 2HQ0A 4X9TA 2PCRA 1LBXA 4QFPA 4Z0IA 4BDLA 2UYEA 1FTMA 4F2OA 4G8MA 3TFLA 3E3KA 3OOAA 5B7DA 3MC2A 1EH3A 4BDNA 2DWJA 2XHDA 4IGTA 1IEJA 3C35A 4KYEA 4P47A 1URDA 1FPKA 1FPFA 4P11A 4FE8A 1B5HA 1Y1MA 4IO2A 4DXBA 2QVUA 3UA8A 2PT1A 4WEPA 1M5BA 3IFAA 1IXCA 4K3FA 2VHAA 4EUOA 4PAIA 1B3FA 4KR5A 1A8FA 3PV0E 2OJTA 3KJ7A 2DWHA 1S7YA 3FXUA 4GXSB 3TKDA 1QW0A 2XWIA 1QUKA 1IMEA 4ZEDA 2QMWA 4GWOA 4M1VA 1R9QA 3QSLA 2F6PA 5J16A 2GQ1A 1KZ8A 5I58B 4ELPA 2YJPA 1IMAA 4NE4A 1HSJA 1XS5A 1MQJA 1FBDA 2DQVA 3FD3A 2VPNA 2F7CA 5FTHA 2F7AA 3IO6A 3RTWB 3KN8A 2HHMA 4OEUA 1M5DA 3I5OA 2Q9TA 1B51A 3KSXA 3C31A 4F18A 4DI3D 3H7MA 3O66A 2Z8FA 3EPEA 3KJTA 2HFBA 1B52A 4ZEKA 4F22A 3U1OA 4QHQA 4RPOA 4WKMA 4YKKA 2WBDA 4IO3A 4YKJA 4NHBA 3IJXB 2I6EA 5I2KA 2DE4A 4F2QA 3CIJA 1HSLA 3N26A 4N8YA 3S2VA 2Q2CA 2XX8A 2ZZVA 4M4GA 4R75A 3OD7A 1LBYA 5K2YA 1CNQA 4RK2A 1RDXA 2XXWA 2DVCA 4QBAA 2DE2A 3PD8A 2QPQA 2KR0A 4Q30B 2XXUA 4AS4A 5IZ3B 1FPJA 3ILTB 5EYGA 3CFZA 3TMGA 4NMYA 4JVDA 2QS4A 3VDFA 3JV9A 3LSLA 4PTKA 1K9YA 1SI0A 1A54A 2VD2A 3ISPA 4PFTA 2FIXA 1MXXA 2ZYOA 2B65A 1LAGE 3DM0A 1J1NA 1FTAA 3CSGA 4YKIA 3JYRA 5I56B 2BJJX 4DLDA 3C32A 4JSDA 1FPDA 2H5YA 4N81A 1VSOA 3FXQA 1URGA 1GV8A 1FSAA 1VFEA 3TTRA 2F36A 2ONKE 4HTGA 1CE2A 1LCTA 2OCUA 1YZ0A 3K02A 5DW8A 2FNCA 3B50A 1P1OA 1Y3QA 1UTBA 4EQ7A 1N7XA 3K0VA 4PFRA 4O7MA 4Q5TA 3MWBA 2WYKA 3Q25A 2UVHA 1I69A 3RPWA 1GGGA 2ZNUA 1B32A 5KCJA 2I4CA 3IX1A 2UXAA 2OWZA 4R9GA 2R6GE 4NF4B 2UVGA 4OESA 3OENA 3E79A 1OIBA 2F78A 2WEFA 3HSTA 1PEBA 2XD2A 4AB5A 3GBBA 1QULA 2R9JA 1US5A 5LDZA 1Y1ZA 1A7LA 4KPTA 2V25A 1JVXA 4U4XA 3MAMA 4XKQA 2XWVA 5H8QA 5I57A 3G3JA 3PUVE 2B3FA 2DDKA 3ECRA 3MPLA 2FYIA 2UVIA 1O63A 1YYZA 4DDDA 2XWKA 3M3FA 1NV6A 5KDTA 3PTYA 5ISUA 3KN3A 2O68A 4LZ7A 4HXVA 4XF5A 1NH7A 2QL3A 3FVGA 3H06B 4QFNA 1R6ZA 1TFAA 2F3DA 5ICTA 4XEQA 1JETA 1FPLA 1B0LA 4H46A 5JTYB 3K6WA 3MZ1A 3VLUA 5F24A 2RINA 5I84A 3RT8A 3K1PA 3C36A 3TEPA 3OELA 1ZU0A 1N0TA 2I58A 3T22A 1JP4A 3MP8A 1TXFA 2Z8EA 4PGNA 3B7DA 2RC9A 2MKZA 3N94A 1FQCA 3ZKLA 5IZ3A 4U22A 4H8IA 1NNTA 3MPKA 4ONYA 4XXUA 4NEDA 1NUXA 2DWIA 1BKAA 3PUYE 4NAPA 3HN0A 1LEVA 4MCOA 3A3CA 4MX6A 1QKAA 2I3WA 3PU5A 2I0BA 4OVTA 4RY1A 4PFWA 1MXZA 2H98A 1N84A 1B2HA 1YAEA 1URSA 4PQJA 3PPPA 3GYYA 2GFEA 4OQOA 2Y7PA 2XXYA 1DPPA 3W15C 1B0HA 4OZ9A 3PMWA 3FVKA 1WDNA 5EQ7A 1BK4A 5EYFA 2IA4A 1IZ1A 3UP9A 1F9BA 4NWDA 3IJOB 1IMBA 3H6TA 4MJOA 2AIXA 4G68C 4EQ9A 1USYH 4NF5B 4FIMA 3ROJA 1KA0A 3TCFA 3FATA 1CB6A 4QF9A 4JXIA 1G0HA 4IB2A 4FBPA 3PPOA 4I62A 4U21A 1MPCA 1P1WA 4IO6A 3U93A 2NOOA 2F97A 2H25A 3HPIA 4EQBA 3NOHA 1M5EA 4PF8A 1FTJA 1H43A 4RJZA 2ZYKA 3MJNA 3HHFA 4RPNA 5A5LA 1XI6A 5HPQA 4GL0A 4MBPA 3OO7A 2NWJA 4ESXA 1FJ6A 2OWTA 3MVYA 4LUBA 5JEIA 4FJPA 3HV1A 5T3JA 5J1DA 1O64A 3TCGA 2HPGA 4NGUA 3THIA 3KFMA 3TZAA 3UORA 4P56A 4QRZA 3F11A 4I3YA 4NX1A 1FBPA 2B4LA 1LAFE 3DP6A 3LR1A 3ONMA 4NG7A 3M3KA 3LBSA 1NNFA 3RTFB 1LBCA 2VGQA 4OVPA 5JTYA 4JVCA 4OMBA 4XKRA 4DZ1A 4DCYA 2WBBA 5BWJA 4ZE9A 1B3GA 5FHNA 3FV2A 5L8DA 4R9FA 3SKPA 5I2KB 4N6DA 1JW4A 4ZECA 4X1DA 1VE4A 1B4HA 4H5FA 4KFQA 4MH5A 4PC9A 1QKBA 3L6GA 4XKPA 1FBGA 4FEBA 4OANA 4XTCQ 1MQGA 4GX6A 3GBAA 2OZZA 3R26A 3VV5A 4ZDMA 4E0XA 4N6PA 3N6UA 4KYDA 2NVUB 4O94A 5DVJA 2P1SA 3FBPA 4AQ4A 3K6XA 4NN3A 2KQZA 3TODA 2THIA 1GTKA 4PFUA 3KC0A 3KSJA 2F3BA 3PPNA 5I59A 3Q26A 4AB6A 4O7IA 2QVVA 1YTVA 4ECFA 1EZPA 1ZLQA 2PYYA 3IOUA 5I3SA 4GWYA 4QFLA 3MP6A 1NI9A 4PCDA 3ZKKA 1FTOA 3B6TA 4ELRA 1MY2A 2DE3A 1MQDA 1JW5A 4MLVA 4XKNA 4OVJA 4LN5A 2O69A 5LOMA 3IB1A 1NV3A 4FEDA 4WEDA 4MMPA 4G68A 2Y7RA 3OSQA 3MUQA 3CG1A 3JZJA 4UACA 2YPNA 4ZZAA 4NF5A 3VLWA 1FJ9A 3TUSA 2ZMBA 4F1YA 3FVNA 3EN3A 4KQPA 1SPIA 1UTBB 1FBCA 1UIVA 5I7IA 5I2NA 2QJEA 4QXDA 3VFJA 2O6AA 4BDRA 4THIA 3BBRA 3T0JA 4R2FA 3E13X 1MRPA 3IB2A 3USDA 2FIEA 3R6UA 5KCJB 2WYPA 1B40A 3G3GA 4UABA 3IO4A 2XWOA 3HO7A 3UGWA 1MY1A 2Y7KA 1A8EA 4H5GA 1SDXA 4JWOA 4HCWA 1LB9A 4OXVA 5CMBA 3U65A 1XC1A 5H8QB 4C0RA 5I57B 1NL5A 2QS3A 4PE3A 1PBQA 2V3QA 3K1MA 5CI5A 4JBZA 5DTBA 1OVTA 4NTLA 3QUJA 2REGA 4P1LA 2Y5LA 1OQGA 2V3UA 3BIHA 1AWBA 1II5A 5KDTB 4X8RA 4EXKA 1I6QA 2RC8A 1S50A 3H3GA 3CFLA 4F1VA 3O29A 3T9VA 3OO9A 3ODBA 3V5AA 1LBWA 1TT1A 2D5WA 4EDPA 2F5XA 3LC8A 1FBEA 3LUZA 2ZXTA 2Q89A 2I3VA 3FASA 5H8NA 3MW0A 2CZKA 3G3FA 5FHOA 1MY0A 3A3UA 4PBHA 4GX3A 4OERA 1AH5A 2Y84A 4P9KA 3GXAA 4GOTA 4PF6A 1PB7A 4RA1A 2HAUA 4PDDA 3QMFA 1FTLA 2DOJA 3CI8A 3IL1B 2DXRA 1IXGA 3OSRA 4POXA 2YLNA 2ONRA 3TQWA 1Y9UA 1AL3A 3R7XA 2FBPA 3V8XB 1D3KA 1VFDA 4R74A 1FW0A 2CZHA 2VD3A 3PMXA 5ET8A 1LSTA 4Z7EA 1FBFA 4GWSA 4HE2A 1MXWA 4H67A 3SEWA 2I4BA 2ABHA 4EF1A 1PBPA 3EHSA 2B3BA 1SW4A 5CMKA 2RC7A 2O51A 1NNKA 4NF8B 4Q8RA 1B05A 4KD5A 4U2RA 3MVXA 1UIUA 2RCBA 3OO6A 3S9NC 5F1QA 1XT8A 2FVZA 2UVJA 5IZZA 4RXLA 1AIVA 1N3XA 1N04A 1OMPA 2O7IA 4MEVA 3KEIA 5ELVA 3KBRA 3O28A 3MSTA 1BTJA 5AA4B 4F3PA 4YB6A 5AA3A 2CEYA 1SQYA 2D21A 1EYKA 3KBZA 3TTKA 3U94A 1NUWA 1XVYA 3MVWA 4YU0A 3HHGA 3Q28A 2PFZA 1FPBA 1ZTYA 1T0KA 4TLLB 4N07A 4GX4A 4R6HA 4PBQA 4GXAA 1B7UA 5IM2A 2V84A 1S9TA 3B6QA 1B3EA 1B6HA 4LQ2A 3RPLA 1B5JA 3O6IA 5CRYA 2H4IA 4PFIA 2AYSA 4KYSA 1AOVA 3PUWE 4PP0A 3FXBA 4BLAA 4EF2A 1PB9A 2Z22A 3G7WA 1KWHA 1BP5A 5EHSA 1SW5A 3RLFE 4P0IA 4N8GA 1H44A 1XOCA 5A5XA 4NWCA 2GHBA 1VDWA 1ELJA 3TTMA 1B5IA 1NMUA 2XD3A 1DOTA 1Y4TA 5DVIA 3Q27A 1PDAA 3TDJA 4DE8A 4HE0A 4ISUA 1I6AA 5DEXB 5EQ9A 1LFIA 3GZGA 1XHYA 2HZKA 3VE1B 1DTGA 4H45A 5H8FA 1Y3PA 3H6WA 4IO5A 1P1QA 3A29A 4GIZA 3RN8A 1YCJA 5TP9B 1ZIUA 1OLAA 3HCQA 2XXKA 1GVCA 1D9YA 1H45A 2PX1A 1FQFA 3LSWA 4DIGA 3TYHA 2F34A 2ZZWA 4OVQA 3MZ9A 1JNFA 2D3IA 1DBZA 4U23A 2Y5KA 5F7VA 3BFTA 3H03A 5I59B 3CHGA 4P0GA 4YMBA 4HS7A 3H4ZA 3CRBA 4LZ5A 5AE4A 4KCCA 3K2DA 5L9OA 3UK4A 3PD9A 5AA1A 1Z7ME 1FCKA 4NF8A 1NUZA 4G8HA 4DCXA 2ZNTA 4G68B 4IY6A 2R71A 5EHMA 2P2AA 1OLCA 3SEXA 4OETA 5DT6A 1BIYA 4O3BA 2X7QA 4P8BA 3L6HA 4PFBA 4AS5A 1GR2A 1YPNA 3IFCA 4OHNA 5CC2A 3IORA 3SESA 3CG3A 5BUUA 2O1MA 2E0SA 4L17A 3S9MC 5I2NB 2DVZA 3KGCA 1I6BA 5AA4A 1D9VA 3LV0A 2RF1A 5CMCA 1NNPA 4I8CA 4QSDA 3OO8A 4C1TA 1MY4A 4H6DA 4TOZA 1JQFA 4OENA 2GHAA 2PBWA 3BFUA 4R73A 1IMDA 3EQ1A 3HFUA 2R8TA 4F39A 3SDFA 4N91A 3A09A 3FXRA 2G29A 1B1HA 4ZE8A 4MNPA 2HXWA 4XIGQ 4R72A 2DXYA 2GRVA 2ZYMA 4DXCA 2OWSA 3K01A 4MFIA 4Q0CA 2BJIA 4ZZEA 2E1SA 5DYHA 1N3WA 1QVSA 1SI1A 2QRYA 4LVQA 1PC3A 4LONB 4IY5A 3C33A 5M2VA 1R1NA 3CR9A 3CSBA 1EU8A 5TPAA 3KC1A 2RCAA 4OVSA 1NV7A 1EYJA 3FVOA 1MPDA 1SBPA 3H6VA 2XXTA 4FORA 2HZLA 2FHYA 2X7PA 1JEVA 1VR5A 4N6KA 5DEXA 1WVJA 3P7IA 5H8NB 4ZEBA 2XA5A 4P1EA 1N76A 4EXLA 5IKBA 3BKIB 1FQBA 4YMAA 5TP9A 4ELOA 4FECA 2QSXA 3IK6B 1FQAA 2XXXA 2VOZA 5HM4B 1IMFA 2ZNSA 2XX7A 3C9HA 2B4MA 4F29A 1B3LA 4G8NA 1QGXA 5TU0A 3E9XA 2F35A 4YZZA 3RUMA 1SW2A 2M8CA 3O6GA 4IO7A 2PT2A 1LFGA 4I3EA 4ZEFA 4F3SA 3IOWA 1LBBA 2CEXA 1FRPA 1LAHE 4OWDA 3V89B 2IEEA 1RYXA 1Q9DA 4U4SA 4O3CA 4G61A 3KG2A 2GH9A 1P1NA 4QFOA 4U1ZA 3TPAA 3IR1A 1JEUA 5IGAA 3KOTA 2Y7WA 3AXFA 2AL4A 5FHMA 2AL5A 3I3VA 1DSNA 3PPQA 3TTLA 3B8BA 4YKPA 2ZZXA 5HBCA 2QFLA 3MQ9A 3W9WA 2F7BA 3LSFB 2XXVA 3VVFA 4NF6B 1RDZA 1UTHA 5H8SA 1AMFA 3GLBA 3SEUA 2HEUA 3K4UA 1MXYA 1MDP1 2DP8A 4N17A 3G3IA 1LGBC 3FGSA 1ATGA 1TFDA 1OQHA 5FBPA 1USYE 4GBVA 1MM6A 2WX9A 5LTCA 1A40A 5H8HB 4KCDA 5DVFA 3TCHA 4I40A 2VT5A 3S4UA 3CVGA 4ZS9A 1N7WA 3O6HA 1B9JA 3EHUA 1IXIA 3MP1A 2XXIA 3PMVA 4HE1A 4GVOA 1FQEA 2ONSA 3H6UA 5AA2D 2OK2A 4G2ZA 1RYOA 3QXMA 2PVUA 4ND9A 3RPLB 1Y4CA 1FBHA 3TQLA 1LLSA 4YB7A 5CM6A 1Z7NE 3FZVA 4JSOA 5AA2A 3D4GA 1B58A 4GBWA 3DP8A 4X04A 5B70A 3T9XB 3QUFA 4JWXA 4YAHX 5A5XB 4MIJA 4P3LA 1MH4A 4LZ8A 2XXQA 2V3TA 3U8QA 1MY3A 5CBSA 2Q8MA 2I48A 4PFYA 2DSFA 3MVZA 4RNSA 5FTIA 2A5TA 3RYDA 4GQOA 2QS1A 2LAOA 3G3KA 1ZBMA 4IO4A 3B6WA 2PFYA 5H8FB 4GRKA 4N15A 4DXUA 4GL8A 2XXPA 2XXRA 3WAEA 1H76A 3OXNA 3FJGA 1BLFA 4IR8A 3SEYA 1IQ7A 3E78A 4O8MA 1FPEA 4MAGA 1NV1A 1LBZA 3Q29A 4N4UA 2X26A 4N13A 2QVRA 4JWYA 2NXOA 3K00A 2DYXA 3SZPA 4OA4A 3G3HA 1Q35A 4MNCA 3PUZE 1EZOA 4GFRA 4FAJA 2W7YA 1LB8A 4MLQA 4BDMA 1QJMA 3TELA 1MXUA 4F3BA 1POY1 3QAXA 2NUVA 1B4ZA 1IXHA 2H99A 4LA9A 1A99A 1QUIA 1D4NA 3EF7A 4KXPA 1MPBA 3CFXA 5EQAA 4GWXA 4NF6A 1LCFA 1LBVA 4XFEA 3TAJA 1DTZA 4H65A 4OYVA 1DCUA 3K6VA 1M5FA 1L5TA 1XVXA 3U92A 4X48A 3UIFA 3S9LC 3T96B 4ELQA 1SYIA 4QSCA 1B1XA 5H8HA 1DPEA 1NV0A 2V4CA 4GF8A 1SW1A 1R9LA 3PPRA 2KLFA 2P3NA 5I58A 1NV4A 3PGFA 1MG1A 1IMCA 1IIWA 3O97A 1EZ9A 1SYHA 1Q1KA 3N6TA 4LATA 1ZMGA 4JB7A 3QK6A 4OVRA 3LSXA 3KZGA 2DS9A 4ZEIA 1IUDA 1MQIA 3M3LA 2WKYA 2XX9A 4TQUQ 5EYHA 5L9MA 2CZIA 4RK9A 1NUYA 2CZLA 4H1XA 1LAXA 2O84X 4MNIA 4F3GA 1NV2A 3S9EA 1NH8A 3RGYA 1P99A 2HXRA 3FIRA 4G77A 4OEVA 5TPAB 3IOVA 2Z23A 4GD5A 4QSEA 4JVIA 4HCYA 2UYFA 1Y20A 3U72A 4PE5B 1P1UA 3RT6B 4H8JA 3OEMA 3DP4A 1MM7A 1NV5A 2G93A 2Y7IA 1HSEA 4I1DA 2O7UA 2VPOA 4PETA 1B46A 2P3VA 4PAFA 4F31B 5JK4A 3C34A 3VVEA 4GWZA 1H3DA 1NKXA 4OFLA 2ANJA 1MQHA 2QMXA 1UQWA 1US4A 4R6KA 5ITOA 4C1UA 1D9QA 1LFHA 3VXCA 2FA7A 4HW8A 1JW1A 3RNNA 4UA8A 3O9PA 4KI0E 3K1NA 4QFKA 1DMBA 4F19A 4YB5A 2PMSA 1OVBA 3RY3A
chains in the Genus database with same CATH topology
5I56A 3QIMA 4GLIA 4YICA 3E4RA 1PB8A 5ITPA 2CMOA 3T66A 4LQ5A 3EHTA 3RQTA 3VVDA 3FJMA 3MZBA 3FV1A 4KHZE 3WAFA 1A55A 3KN7A 3ZSFA 1ZKBA 2A5SA 3UN6A 4RYAA 2Q88A 2Q2AA 4MF3A 3PUXE 1UTHB 4I9DA 2VP1A 3K6UA 5IAIA 3IOTA 4ESWA 2ESNA 4OFJA 1ANFA 1QUJA 5KZTA 3O2AA 4BDQA 3FJ7A 4NF4A 5CBRA 5ICQA 3OEKA 5K2XA 1NFTA 3MBPA 1B7HA 4WXJA 2O1LA 2XXHA 3DLNA 4TLMB 1MS7A 2HCAA 2H9BA 3KOSA 3M8UA 2DWAA 3SETA 2ZYNA 1B3HA 2I0CA 1WODA 3I6VA 4G4PA 4U1OA 1SVXB 3T93B 1MXVA 4R2BA 3ZS6A 2P0SA 4POWA 1ZJLA 1Y3NA 3VLVA 5CMMA 3T9HB 4X1BA 1FQDA 5AA2B 5L9SA 3W9VA 2ALUA 1O7TA 4JDFA 3D4CA 4FATA 4OFOA 1FTKA 1SD3A 2F6GA 3SEVA 3T9UA 4OTEA 3DELB 3VXBA 3IAZA 4R6YA 3C4MA 2HAVA 3ILUB 3FUZA 2A5TB 2OLBA 3N5LA 2RKMA 4E0WA 3LUYA 4F1UA 3OMBA 4H0WA 2V93A 2OBGA 2REJA 4BDOA 2QS2A 1MDQA 1IITA 3V83A 4O3AA 3IB0A 1MH3A 2F8DA 2I49A 2Z8DA 3SERA 4LP2B 1TWYA 1JVYA 3QYTA 2Q8JA 1POTA 3TTNA 1B7ZA 1RKMA 4IGRA 1M5CA 2HQ0A 4X9TA 4QFPA 4Z0IA 4BDLA 2UYEA 1FTMA 4F2OA 4G8MA 3TFLA 3E3KA 5B7DA 3OOAA 3MC2A 1EH3A 4BDNA 2DWJA 2XHDA 4IGTA 1IEJA 3C35A 4KYEA 1URDA 4P11A 4FE8A 1B5HA 1Y1MA 4IO2A 4DXBA 3UA8A 2PT1A 4WEPA 1M5BA 1IXCA 4K3FA 2VHAA 4EUOA 1B3FA 4KR5A 1A8FA 3PV0E 2OJTA 3KJ7A 2DWHA 1S7YA 3FXUA 4GXSB 3TKDA 1QW0A 1QUKA 4ZEDA 2QMWA 4GWOA 4M1VA 1R9QA 3QSLA 2F6PA 5I58B 4ELPA 2YJPA 4NE4A 1HSJA 1XS5A 1MQJA 2DQVA 3FD3A 2F7CA 5FTHA 2F7AA 3IO6A 3RTWB 3KN8A 4OEUA 1M5DA 3I5OA 2Q9TA 1B51A 3KSXA 3C31A 4F18A 3H7MA 3O66A 2Z8FA 3EPEA 3KJTA 2HFBA 1B52A 4ZEKA 4F22A 3U1OA 4QHQA 4RPOA 4WKMA 4YKKA 4IO3A 4YKJA 3IJXB 2I6EA 5I2KA 2DE4A 4F2QA 3CIJA 1HSLA 3N26A 3S2VA 2Q2CA 2XX8A 4M4GA 4R75A 3OD7A 5K2YA 4RK2A 2XXWA 2DVCA 2DE2A 3PD8A 2QPQA 4Q30B 2XXUA 3ILTB 3CFZA 3TMGA 4NMYA 2QS4A 3VDFA 3JV9A 3LSLA 1SI0A 1A54A 2VD2A 4PFTA 1MXXA 2ZYOA 2B65A 1LAGE 3DM0A 1J1NA 3CSGA 4YKIA 3JYRA 5I56B 2BJJX 4DLDA 3C32A 4JSDA 2H5YA 1VSOA 3FXQA 1URGA 1GV8A 1VFEA 3TTRA 2F36A 2ONKE 4HTGA 1CE2A 1LCTA 2OCUA 3K02A 2FNCA 1P1OA 1Y3QA 1UTBA 4EQ7A 1N7XA 3K0VA 4Q5TA 3MWBA 3Q25A 2UVHA 1I69A 3RPWA 1GGGA 2ZNUA 1B32A 5KCJA 2I4CA 3IX1A 2UXAA 4R9GA 2R6GE 4NF4B 2UVGA 4OESA 3OENA 1OIBA 2F78A 3HSTA 1PEBA 2XD2A 4AB5A 3GBBA 1QULA 2R9JA 1US5A 1Y1ZA 1A7LA 4KPTA 2V25A 1JVXA 4U4XA 3MAMA 4XKQA 5H8QA 5I57A 3G3JA 3PUVE 2B3FA 3ECRA 3MPLA 2FYIA 2UVIA 1O63A 4DDDA 3M3FA 5KDTA 5ISUA 3KN3A 2O68A 4LZ7A 1NH7A 2QL3A 3FVGA 3H06B 4QFNA 1R6ZA 1TFAA 5ICTA 1JETA 1B0LA 5JTYB 3K6WA 3MZ1A 3VLUA 2RINA 5I84A 3RT8A 3K1PA 3C36A 3TEPA 3OELA 1ZU0A 1N0TA 2I58A 3T22A 3MP8A 1TXFA 2Z8EA 3B7DA 2RC9A 3N94A 1FQCA 3ZKLA 4U22A 4H8IA 1NNTA 3MPKA 4ONYA 4XXUA 4NEDA 2DWIA 1BKAA 3PUYE 3HN0A 3A3CA 1QKAA 2I3WA 3PU5A 2I0BA 4PFWA 4RY1A 1MXZA 2H98A 1N84A 1B2HA 1YAEA 1URSA 4PQJA 3PPPA 2GFEA 4OQOA 2Y7PA 2XXYA 1DPPA 3W15C 1B0HA 4OZ9A 3PMWA 3FVKA 1WDNA 5EYFA 2IA4A 1IZ1A 3UP9A 1F9BA 4NWDA 3IJOB 3H6TA 2AIXA 4G68C 4EQ9A 1USYH 4NF5B 4FIMA 3TCFA 3FATA 1CB6A 4QF9A 4JXIA 4IB2A 3PPOA 4I62A 4U21A 1MPCA 1P1WA 4IO6A 3U93A 2NOOA 2F97A 2H25A 3HPIA 4EQBA 1M5EA 1FTJA 1H43A 4RJZA 2ZYKA 3MJNA 3HHFA 4RPNA 5HPQA 4GL0A 4MBPA 3OO7A 2NWJA 4ESXA 2OWTA 3MVYA 4LUBA 5JEIA 4FJPA 3HV1A 5J1DA 1O64A 3TCGA 3THIA 3KFMA 3TZAA 3UORA 4QRZA 3F11A 3DP6A 1LAFE 3LR1A 3ONMA 3M3KA 3LBSA 1NNFA 3RTFB 1LBCA 2VGQA 5JTYA 4OMBA 4XKRA 4DZ1A 4DCYA 5BWJA 4ZE9A 1B3GA 5FHNA 3FV2A 5L8DA 4R9FA 3SKPA 5I2KB 1JW4A 4ZECA 4X1DA 1VE4A 1B4HA 4H5FA 4KFQA 4MH5A 1QKBA 3L6GA 4XKPA 4FEBA 4XTCQ 1MQGA 3GBAA 2OZZA 3R26A 3VV5A 4ZDMA 4E0XA 4N6PA 3N6UA 4KYDA 2NVUB 5DVJA 2P1SA 4AQ4A 3K6XA 3TODA 2THIA 1GTKA 4PFUA 3KSJA 3PPNA 5I59A 3Q26A 4AB6A 1YTVA 4ECFA 1EZPA 1ZLQA 2PYYA 3IOUA 4QFLA 3MP6A 3ZKKA 1FTOA 3B6TA 4ELRA 1MY2A 2DE3A 1MQDA 1JW5A 4MLVA 4XKNA 4OVJA 2O69A 5LOMA 3IB1A 4WEDA 4FEDA 4G68A 2Y7RA 3OSQA 3MUQA 3CG1A 3JZJA 4UACA 2YPNA 4ZZAA 4NF5A 3VLWA 3TUSA 2ZMBA 4F1YA 3FVNA 3EN3A 4KQPA 1UTBB 1UIVA 5I2NA 2QJEA 3VFJA 2O6AA 4BDRA 4THIA 3BBRA 4R2FA 3E13X 1MRPA 3IB2A 3USDA 5KCJB 3R6UA 1B40A 3G3GA 3IO4A 3HO7A 3UGWA 1MY1A 2Y7KA 1A8EA 4H5GA 1SDXA 4JWOA 4HCWA 1LB9A 4OXVA 5CMBA 1XC1A 5H8QB 4C0RA 5I57B 1NL5A 2QS3A 1PBQA 2V3QA 3K1MA 5CI5A 4JBZA 5DTBA 1OVTA 4NTLA 3QUJA 2REGA 1OQGA 2V3UA 1II5A 5KDTB 4EXKA 1I6QA 2RC8A 1S50A 3H3GA 3CFLA 4F1VA 3O29A 3T9VA 3OO9A 3ODBA 3V5AA 1TT1A 2D5WA 4EDPA 2F5XA 3LC8A 2ZXTA 2Q89A 2I3VA 3FASA 5H8NA 3MW0A 3G3FA 5FHOA 1MY0A 3A3UA 4OERA 1AH5A 2Y84A 3GXAA 4GOTA 1PB7A 4RA1A 2HAUA 1FTLA 2DOJA 3CI8A 3IL1B 2DXRA 1IXGA 3OSRA 4POXA 2YLNA 2ONRA 3TQWA 1Y9UA 1AL3A 3R7XA 3V8XB 1D3KA 1VFDA 4R74A 1FW0A 2VD3A 3PMXA 1LSTA 4Z7EA 1MXWA 4H67A 3SEWA 2I4BA 2ABHA 4EF1A 1PBPA 3EHSA 2B3BA 1SW4A 5CMKA 2RC7A 2O51A 1NNKA 4NF8B 4Q8RA 1B05A 4KD5A 4U2RA 3MVXA 1UIUA 2RCBA 3OO6A 3S9NC 5F1QA 1XT8A 2UVJA 4RXLA 1AIVA 1N3XA 1N04A 1OMPA 2O7IA 3KEIA 5ELVA 3KBRA 3O28A 1BTJA 5AA4B 4F3PA 4YB6A 5AA3A 1SQYA 2D21A 3TTKA 3U94A 1XVYA 3MVWA 4YU0A 3HHGA 3Q28A 1ZTYA 1T0KA 4TLLB 4N07A 4R6HA 4GXAA 1B7UA 2V84A 1S9TA 3B6QA 1B3EA 1B6HA 4LQ2A 1B5JA 3O6IA 5CRYA 2H4IA 2AYSA 4KYSA 1AOVA 3PUWE 4PP0A 4BLAA 4EF2A 1PB9A 2Z22A 3G7WA 1KWHA 1BP5A 5EHSA 1SW5A 3RLFE 4P0IA 1H44A 1XOCA 5A5XA 4NWCA 2GHBA 1ELJA 3TTMA 1B5IA 1NMUA 2XD3A 1DOTA 1Y4TA 5DVIA 3Q27A 1PDAA 3TDJA 4DE8A 4ISUA 1I6AA 5DEXB 1LFIA 3GZGA 1XHYA 2HZKA 3VE1B 1DTGA 5H8FA 1Y3PA 3H6WA 4IO5A 1P1QA 4GIZA 3RN8A 1YCJA 5TP9B 1ZIUA 1OLAA 3HCQA 1GVCA 1D9YA 1H45A 2PX1A 1FQFA 3LSWA 4DIGA 3TYHA 2F34A 3MZ9A 1JNFA 2D3IA 4U23A 5F7VA 3BFTA 3H03A 5I59B 4P0GA 4YMBA 4HS7A 3H4ZA 3CRBA 4LZ5A 5AE4A 4KCCA 3K2DA 5L9OA 3UK4A 3PD9A 5AA1A 1Z7ME 1FCKA 4NF8A 4G8HA 4DCXA 2ZNTA 4G68B 4IY6A 2R71A 5EHMA 2P2AA 1OLCA 3SEXA 4OETA 5DT6A 1BIYA 4O3BA 2X7QA 3L6HA 1GR2A 1YPNA 4OHNA 5CC2A 3IORA 3SESA 3CG3A 5BUUA 2O1MA 2E0SA 4L17A 3S9MC 5I2NB 2DVZA 3KGCA 1I6BA 5AA4A 1D9VA 5CMCA 2RF1A 1NNPA 4I8CA 4QSDA 3OO8A 4C1TA 1MY4A 4H6DA 4TOZA 1JQFA 4OENA 2GHAA 2PBWA 3BFUA 4R73A 3EQ1A 4F39A 3SDFA 3A09A 3FXRA 2G29A 1B1HA 4ZE8A 2HXWA 4XIGQ 4R72A 2DXYA 2GRVA 2ZYMA 4DXCA 2OWSA 3K01A 4MFIA 4Q0CA 4ZZEA 2E1SA 5DYHA 1N3WA 1QVSA 1SI1A 2QRYA 4LVQA 1PC3A 4LONB 4IY5A 3C33A 5M2VA 1R1NA 3CR9A 3CSBA 1EU8A 5TPAA 2RCAA 3FVOA 1MPDA 1SBPA 3H6VA 2XXTA 4FORA 2HZLA 2X7PA 1JEVA 1VR5A 5DEXA 1WVJA 3P7IA 5H8NB 4ZEBA 1N76A 4EXLA 5IKBA 3BKIB 1FQBA 4YMAA 5TP9A 4ELOA 4FECA 2QSXA 3IK6B 1FQAA 2XXXA 2VOZA 5HM4B 2ZNSA 2XX7A 3C9HA 4F29A 1B3LA 4G8NA 5TU0A 3E9XA 2F35A 4YZZA 3RUMA 1SW2A 2M8CA 3O6GA 4IO7A 2PT2A 1LFGA 4ZEFA 4F3SA 3IOWA 1LBBA 1LAHE 4OWDA 3V89B 2IEEA 1RYXA 4U4SA 4O3CA 3KG2A 2GH9A 1P1NA 4QFOA 4U1ZA 3TPAA 3IR1A 1JEUA 3KOTA 2Y7WA 3AXFA 2AL4A 5FHMA 2AL5A 3I3VA 1DSNA 3PPQA 3TTLA 4YKPA 5HBCA 3MQ9A 3W9WA 2F7BA 3LSFB 2XXVA 3VVFA 4NF6B 1UTHA 5H8SA 1AMFA 3GLBA 3SEUA 2HEUA 3K4UA 1MXYA 1MDP1 2DP8A 3G3IA 1LGBC 3FGSA 1ATGA 1TFDA 1OQHA 1USYE 1MM6A 1A40A 5H8HB 4KCDA 5DVFA 3TCHA 3S4UA 3CVGA 4ZS9A 1N7WA 3O6HA 1B9JA 3EHUA 1IXIA 3MP1A 2XXIA 3PMVA 4GVOA 1FQEA 2ONSA 3H6UA 5AA2D 2OK2A 4G2ZA 1RYOA 3QXMA 2PVUA 4ND9A 1Y4CA 3TQLA 1LLSA 4YB7A 5CM6A 1Z7NE 3FZVA 4JSOA 5AA2A 3D4GA 1B58A 3DP8A 5B70A 3T9XB 3QUFA 4JWXA 4YAHX 5A5XB 1MH4A 4LZ8A 2XXQA 2V3TA 3U8QA 1MY3A 5CBSA 2I48A 4PFYA 2DSFA 3MVZA 4RNSA 5FTIA 2A5TA 4GQOA 2QS1A 2LAOA 3G3KA 1ZBMA 4IO4A 3B6WA 5H8FB 4GRKA 4DXUA 4GL8A 2XXPA 2XXRA 3WAEA 1H76A 3OXNA 3FJGA 1BLFA 3SEYA 1IQ7A 3Q29A 2X26A 4N13A 4JWYA 2NXOA 3K00A 2DYXA 3G3HA 1Q35A 3PUZE 1EZOA 4GFRA 4FAJA 2W7YA 1LB8A 4MLQA 4BDMA 1QJMA 3TELA 1MXUA 4F3BA 1POY1 3QAXA 2NUVA 1B4ZA 1IXHA 2H99A 4LA9A 1A99A 1QUIA 1D4NA 3EF7A 1MPBA 3CFXA 4NF6A 1LCFA 3TAJA 1DTZA 4H65A 4OYVA 3K6VA 1M5FA 1L5TA 1XVXA 3U92A 4X48A 3UIFA 3S9LC 3T96B 4ELQA 1SYIA 4QSCA 1B1XA 5H8HA 1DPEA 4GF8A 1SW1A 1R9LA 3PPRA 2KLFA 5I58A 3PGFA 1MG1A 1IIWA 3O97A 1EZ9A 1SYHA 1Q1KA 3N6TA 4LATA 1ZMGA 4JB7A 3QK6A 3LSXA 3KZGA 2DS9A 4ZEIA 1IUDA 1MQIA 3M3LA 2WKYA 2XX9A 4TQUQ 5L9MA 4RK9A 2CZLA 4H1XA 1LAXA 2O84X 4F3GA 3S9EA 1NH8A 3RGYA 1P99A 3FIRA 4G77A 4OEVA 5TPAB 3IOVA 2Z23A 4GD5A 4QSEA 4HCYA 2UYFA 1Y20A 3U72A 4PE5B 1P1UA 3RT6B 4H8JA 3OEMA 3DP4A 1MM7A 2G93A 2Y7IA 1HSEA 4I1DA 2O7UA 4PETA 1B46A 4F31B 5JK4A 3C34A 3VVEA 1H3DA 1NKXA 4OFLA 2ANJA 1MQHA 2QMXA 1UQWA 1US4A 4R6KA 5ITOA 4C1UA 1LFHA 3VXCA 2FA7A 4HW8A 1JW1A 3RNNA 4UA8A 3O9PA 4KI0E 3K1NA 4QFKA 1DMBA 4F19A 4YB5A 2PMSA 1OVBA 3RY3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I56 A;  3QIM A;  4GLI A;  4YIC A;  3E4R A;  1PB8 A;  5ITP A;  2CMO A;  3T66 A;  4LQ5 A;  3EHT A;  3RQT A;  3VVD A;  3FJM A;  3MZB A;  3FV1 A;  4KHZ E;  3WAF A;  1A55 A;  3KN7 A;  3ZSF A;  1ZKB A;  2A5S A;  3UN6 A;  4RYA A;  2Q88 A;  2Q2A A;  4MF3 A;  3PUX E;  1UTH B;  4I9D A;  2VP1 A;  3K6U A;  5IAI A;  3IOT A;  4ESW A;  2ESN A;  4OFJ A;  1ANF A;  1QUJ A;  5KZT A;  3O2A A;  4BDQ A;  3FJ7 A;  4NF4 A;  5CBR A;  5ICQ A;  3OEK A;  5K2X A;  1NFT A;  3MBP A;  1B7H A;  4WXJ A;  2O1L A;  2XXH A;  3DLN A;  4TLM B;  1MS7 A;  2HCA A;  2H9B A;  3KOS A;  3M8U A;  2DWA A;  3SET A;  2ZYN A;  1B3H A;  2I0C A;  1WOD A;  3I6V A;  4G4P A;  4U1O A;  1SVX B;  3T93 B;  1MXV A;  4R2B A;  3ZS6 A;  2P0S A;  4POW A;  1ZJL A;  1Y3N A;  3VLV A;  5CMM A;  3T9H B;  4X1B A;  1FQD A;  5AA2 B;  5L9S A;  3W9V A;  2ALU A;  1O7T A;  4JDF A;  3D4C A;  4FAT A;  4OFO A;  1FTK A;  1SD3 A;  2F6G A;  3SEV A;  3T9U A;  4OTE A;  3DEL B;  3VXB A;  3IAZ A;  4R6Y A;  3C4M A;  2HAV A;  3ILU B;  3FUZ A;  2A5T B;  2OLB A;  3N5L A;  2RKM A;  4E0W A;  3LUY A;  4F1U A;  3OMB A;  4H0W A;  2V93 A;  2OBG A;  2REJ A;  4BDO A;  2QS2 A;  1MDQ A;  1IIT A;  3V83 A;  4O3A A;  3IB0 A;  1MH3 A;  2F8D A;  2I49 A;  2Z8D A;  3SER A;  4LP2 B;  1TWY A;  1JVY A;  3QYT A;  2Q8J A;  1POT A;  3TTN A;  1B7Z A;  1RKM A;  4IGR A;  1M5C A;  2HQ0 A;  4X9T A;  4QFP A;  4Z0I A;  4BDL A;  2UYE A;  1FTM A;  4F2O A;  4G8M A;  3TFL A;  3E3K A;  5B7D A;  3OOA A;  3MC2 A;  1EH3 A;  4BDN A;  2DWJ A;  2XHD A;  4IGT A;  1IEJ A;  3C35 A;  4KYE A;  1URD A;  4P11 A;  4FE8 A;  1B5H A;  1Y1M A;  4IO2 A;  4DXB A;  3UA8 A;  2PT1 A;  4WEP A;  1M5B A;  1IXC A;  4K3F A;  2VHA A;  4EUO A;  1B3F A;  4KR5 A;  1A8F A;  3PV0 E;  2OJT A;  3KJ7 A;  2DWH A;  1S7Y A;  3FXU A;  4GXS B;  3TKD A;  1QW0 A;  1QUK A;  4ZED A;  2QMW A;  4GWO A;  4M1V A;  1R9Q A;  3QSL A;  2F6P A;  5I58 B;  4ELP A;  2YJP A;  4NE4 A;  1HSJ A;  1XS5 A;  1MQJ A;  2DQV A;  3FD3 A;  2F7C A;  5FTH A;  2F7A A;  3IO6 A;  3RTW B;  3KN8 A;  4OEU A;  1M5D A;  3I5O A;  2Q9T A;  1B51 A;  3KSX A;  3C31 A;  4F18 A;  3H7M A;  3O66 A;  2Z8F A;  3EPE A;  3KJT A;  2HFB A;  1B52 A;  4ZEK A;  4F22 A;  3U1O A;  4QHQ A;  4RPO A;  4WKM A;  4YKK A;  4IO3 A;  4YKJ A;  3IJX B;  2I6E A;  5I2K A;  2DE4 A;  4F2Q A;  3CIJ A;  1HSL A;  3N26 A;  3S2V A;  2Q2C A;  2XX8 A;  4M4G A;  4R75 A;  3OD7 A;  5K2Y A;  4RK2 A;  2XXW A;  2DVC A;  2DE2 A;  3PD8 A;  2QPQ A;  4Q30 B;  2XXU A;  3ILT B;  3CFZ A;  3TMG A;  4NMY A;  2QS4 A;  3VDF A;  3JV9 A;  3LSL A;  1SI0 A;  1A54 A;  2VD2 A;  4PFT A;  1MXX A;  2ZYO A;  2B65 A;  1LAG E;  3DM0 A;  1J1N A;  3CSG A;  4YKI A;  3JYR A;  5I56 B;  2BJJ X;  4DLD A;  3C32 A;  4JSD A;  2H5Y A;  1VSO A;  3FXQ A;  1URG A;  1GV8 A;  1VFE A;  3TTR A;  2F36 A;  2ONK E;  4HTG A;  1CE2 A;  1LCT A;  2OCU A;  3K02 A;  2FNC A;  1P1O A;  1Y3Q A;  1UTB A;  4EQ7 A;  1N7X A;  3K0V A;  4Q5T A;  3MWB A;  3Q25 A;  2UVH A;  1I69 A;  3RPW A;  1GGG A;  2ZNU A;  1B32 A;  5KCJ A;  2I4C A;  3IX1 A;  2UXA A;  4R9G A;  2R6G E;  4NF4 B;  2UVG A;  4OES A;  3OEN A;  1OIB A;  2F78 A;  3HST A;  1PEB A;  2XD2 A;  4AB5 A;  3GBB A;  1QUL A;  2R9J A;  1US5 A;  1Y1Z A;  1A7L A;  4KPT A;  2V25 A;  1JVX A;  4U4X A;  3MAM A;  4XKQ A;  5H8Q A;  5I57 A;  3G3J A;  3PUV E;  2B3F A;  3ECR A;  3MPL A;  2FYI A;  2UVI A;  1O63 A;  4DDD A;  3M3F A;  5KDT A;  5ISU A;  3KN3 A;  2O68 A;  4LZ7 A;  1NH7 A;  2QL3 A;  3FVG A;  3H06 B;  4QFN A;  1R6Z A;  1TFA A;  5ICT A;  1JET A;  1B0L A;  5JTY B;  3K6W A;  3MZ1 A;  3VLU A;  2RIN A;  5I84 A;  3RT8 A;  3K1P A;  3C36 A;  3TEP A;  3OEL A;  1ZU0 A;  1N0T A;  2I58 A;  3T22 A;  3MP8 A;  1TXF A;  2Z8E A;  3B7D A;  2RC9 A;  3N94 A;  1FQC A;  3ZKL A;  4U22 A;  4H8I A;  1NNT A;  3MPK A;  4ONY A;  4XXU A;  4NED A;  2DWI A;  1BKA A;  3PUY E;  3HN0 A;  3A3C A;  1QKA A;  2I3W A;  3PU5 A;  2I0B A;  4PFW A;  4RY1 A;  1MXZ A;  2H98 A;  1N84 A;  1B2H A;  1YAE A;  1URS A;  4PQJ A;  3PPP A;  2GFE A;  4OQO A;  2Y7P A;  2XXY A;  1DPP A;  3W15 C;  1B0H A;  4OZ9 A;  3PMW A;  3FVK A;  1WDN A;  5EYF A;  2IA4 A;  1IZ1 A;  3UP9 A;  1F9B A;  4NWD A;  3IJO B;  3H6T A;  2AIX A;  4G68 C;  4EQ9 A;  1USY H;  4NF5 B;  4FIM A;  3TCF A;  3FAT A;  1CB6 A;  4QF9 A;  4JXI A;  4IB2 A;  3PPO A;  4I62 A;  4U21 A;  1MPC A;  1P1W A;  4IO6 A;  3U93 A;  2NOO A;  2F97 A;  2H25 A;  3HPI A;  4EQB A;  1M5E A;  1FTJ A;  1H43 A;  4RJZ A;  2ZYK A;  3MJN A;  3HHF A;  4RPN A;  5HPQ A;  4GL0 A;  4MBP A;  3OO7 A;  2NWJ A;  4ESX A;  2OWT A;  3MVY A;  4LUB A;  5JEI A;  4FJP A;  3HV1 A;  5J1D A;  1O64 A;  3TCG A;  3THI A;  3KFM A;  3TZA A;  3UOR A;  4QRZ A;  3F11 A;  3DP6 A;  1LAF E;  3LR1 A;  3ONM A;  3M3K A;  3LBS A;  1NNF A;  3RTF B;  1LBC A;  2VGQ A;  5JTY A;  4OMB A;  4XKR A;  4DZ1 A;  4DCY A;  5BWJ A;  4ZE9 A;  1B3G A;  5FHN A;  3FV2 A;  5L8D A;  4R9F A;  3SKP A;  5I2K B;  1JW4 A;  4ZEC A;  4X1D A;  1VE4 A;  1B4H A;  4H5F A;  4KFQ A;  4MH5 A;  1QKB A;  3L6G A;  4XKP A;  4FEB A;  4XTC Q;  1MQG A;  3GBA A;  2OZZ A;  3R26 A;  3VV5 A;  4ZDM A;  4E0X A;  4N6P A;  3N6U A;  4KYD A;  2NVU B;  5DVJ A;  2P1S A;  4AQ4 A;  3K6X A;  3TOD A;  2THI A;  1GTK A;  4PFU A;  3KSJ A;  3PPN A;  5I59 A;  3Q26 A;  4AB6 A;  1YTV A;  4ECF A;  1EZP A;  1ZLQ A;  2PYY A;  3IOU A;  4QFL A;  3MP6 A;  3ZKK A;  1FTO A;  3B6T A;  4ELR A;  1MY2 A;  2DE3 A;  1MQD A;  1JW5 A;  4MLV A;  4XKN A;  4OVJ A;  2O69 A;  5LOM A;  3IB1 A;  4WED A;  4FED A;  4G68 A;  2Y7R A;  3OSQ A;  3MUQ A;  3CG1 A;  3JZJ A;  4UAC A;  2YPN A;  4ZZA A;  4NF5 A;  3VLW A;  3TUS A;  2ZMB A;  4F1Y A;  3FVN A;  3EN3 A;  4KQP A;  1UTB B;  1UIV A;  5I2N A;  2QJE A;  3VFJ A;  2O6A A;  4BDR A;  4THI A;  3BBR A;  4R2F A;  3E13 X;  1MRP A;  3IB2 A;  3USD A;  5KCJ B;  3R6U A;  1B40 A;  3G3G A;  3IO4 A;  3HO7 A;  3UGW A;  1MY1 A;  2Y7K A;  1A8E A;  4H5G A;  1SDX A;  4JWO A;  4HCW A;  1LB9 A;  4OXV A;  5CMB A;  1XC1 A;  5H8Q B;  4C0R A;  5I57 B;  1NL5 A;  2QS3 A;  1PBQ A;  2V3Q A;  3K1M A;  5CI5 A;  4JBZ A;  5DTB A;  1OVT A;  4NTL A;  3QUJ A;  2REG A;  1OQG A;  2V3U A;  1II5 A;  5KDT B;  4EXK A;  1I6Q A;  2RC8 A;  1S50 A;  3H3G A;  3CFL A;  4F1V A;  3O29 A;  3T9V A;  3OO9 A;  3ODB A;  3V5A A;  1TT1 A;  2D5W A;  4EDP A;  2F5X A;  3LC8 A;  2ZXT A;  2Q89 A;  2I3V A;  3FAS A;  5H8N A;  3MW0 A;  3G3F A;  5FHO A;  1MY0 A;  3A3U A;  4OER A;  1AH5 A;  2Y84 A;  3GXA A;  4GOT A;  1PB7 A;  4RA1 A;  2HAU A;  1FTL A;  2DOJ A;  3CI8 A;  3IL1 B;  2DXR A;  1IXG A;  3OSR A;  4POX A;  2YLN A;  2ONR A;  3TQW A;  1Y9U A;  1AL3 A;  3R7X A;  3V8X B;  1D3K A;  1VFD A;  4R74 A;  1FW0 A;  2VD3 A;  3PMX A;  1LST A;  4Z7E A;  1MXW A;  4H67 A;  3SEW A;  2I4B A;  2ABH A;  4EF1 A;  1PBP A;  3EHS A;  2B3B A;  1SW4 A;  5CMK A;  2RC7 A;  2O51 A;  1NNK A;  4NF8 B;  4Q8R A;  1B05 A;  4KD5 A;  4U2R A;  3MVX A;  1UIU A;  2RCB A;  3OO6 A;  3S9N C;  5F1Q A;  1XT8 A;  2UVJ A;  4RXL A;  1AIV A;  1N3X A;  1N04 A;  1OMP A;  2O7I A;  3KEI A;  5ELV A;  3KBR A;  3O28 A;  1BTJ A;  5AA4 B;  4F3P A;  4YB6 A;  5AA3 A;  1SQY A;  2D21 A;  3TTK A;  3U94 A;  1XVY A;  3MVW A;  4YU0 A;  3HHG A;  3Q28 A;  1ZTY A;  1T0K A;  4TLL B;  4N07 A;  4R6H A;  4GXA A;  1B7U A;  2V84 A;  1S9T A;  3B6Q A;  1B3E A;  1B6H A;  4LQ2 A;  1B5J A;  3O6I A;  5CRY A;  2H4I A;  2AYS A;  4KYS A;  1AOV A;  3PUW E;  4PP0 A;  4BLA A;  4EF2 A;  1PB9 A;  2Z22 A;  3G7W A;  1KWH A;  1BP5 A;  5EHS A;  1SW5 A;  3RLF E;  4P0I A;  1H44 A;  1XOC A;  5A5X A;  4NWC A;  2GHB A;  1ELJ A;  3TTM A;  1B5I A;  1NMU A;  2XD3 A;  1DOT A;  1Y4T A;  5DVI A;  3Q27 A;  1PDA A;  3TDJ A;  4DE8 A;  4ISU A;  1I6A A;  5DEX B;  1LFI A;  3GZG A;  1XHY A;  2HZK A;  3VE1 B;  1DTG A;  5H8F A;  1Y3P A;  3H6W A;  4IO5 A;  1P1Q A;  4GIZ A;  3RN8 A;  1YCJ A;  5TP9 B;  1ZIU A;  1OLA A;  3HCQ A;  1GVC A;  1D9Y A;  1H45 A;  2PX1 A;  1FQF A;  3LSW A;  4DIG A;  3TYH A;  2F34 A;  3MZ9 A;  1JNF A;  2D3I A;  4U23 A;  5F7V A;  3BFT A;  3H03 A;  5I59 B;  4P0G A;  4YMB A;  4HS7 A;  3H4Z A;  3CRB A;  4LZ5 A;  5AE4 A;  4KCC A;  3K2D A;  5L9O A;  3UK4 A;  3PD9 A;  5AA1 A;  1Z7M E;  1FCK A;  4NF8 A;  4G8H A;  4DCX A;  2ZNT A;  4G68 B;  4IY6 A;  2R71 A;  5EHM A;  2P2A A;  1OLC A;  3SEX A;  4OET A;  5DT6 A;  1BIY A;  4O3B A;  2X7Q A;  3L6H A;  1GR2 A;  1YPN A;  4OHN A;  5CC2 A;  3IOR A;  3SES A;  3CG3 A;  5BUU A;  2O1M A;  2E0S A;  4L17 A;  3S9M C;  5I2N B;  2DVZ A;  3KGC A;  1I6B A;  5AA4 A;  1D9V A;  5CMC A;  2RF1 A;  1NNP A;  4I8C A;  4QSD A;  3OO8 A;  4C1T A;  1MY4 A;  4H6D A;  4TOZ A;  1JQF A;  4OEN A;  2GHA A;  2PBW A;  3BFU A;  4R73 A;  3EQ1 A;  4F39 A;  3SDF A;  3A09 A;  3FXR A;  2G29 A;  1B1H A;  4ZE8 A;  2HXW A;  4XIG Q;  4R72 A;  2DXY A;  2GRV A;  2ZYM A;  4DXC A;  2OWS A;  3K01 A;  4MFI A;  4Q0C A;  4ZZE A;  2E1S A;  5DYH A;  1N3W A;  1QVS A;  1SI1 A;  2QRY A;  4LVQ A;  1PC3 A;  4LON B;  4IY5 A;  3C33 A;  5M2V A;  1R1N A;  3CR9 A;  3CSB A;  1EU8 A;  5TPA A;  2RCA A;  3FVO A;  1MPD A;  1SBP A;  3H6V A;  2XXT A;  4FOR A;  2HZL A;  2X7P A;  1JEV A;  1VR5 A;  5DEX A;  1WVJ A;  3P7I A;  5H8N B;  4ZEB A;  1N76 A;  4EXL A;  5IKB A;  3BKI B;  1FQB A;  4YMA A;  5TP9 A;  4ELO A;  4FEC A;  2QSX A;  3IK6 B;  1FQA A;  2XXX A;  2VOZ A;  5HM4 B;  2ZNS A;  2XX7 A;  3C9H A;  4F29 A;  1B3L A;  4G8N A;  5TU0 A;  3E9X A;  2F35 A;  4YZZ A;  3RUM A;  1SW2 A;  2M8C A;  3O6G A;  4IO7 A;  2PT2 A;  1LFG A;  4ZEF A;  4F3S A;  3IOW A;  1LBB A;  1LAH E;  4OWD A;  3V89 B;  2IEE A;  1RYX A;  4U4S A;  4O3C A;  3KG2 A;  2GH9 A;  1P1N A;  4QFO A;  4U1Z A;  3TPA A;  3IR1 A;  1JEU A;  3KOT A;  2Y7W A;  3AXF A;  2AL4 A;  5FHM A;  2AL5 A;  3I3V A;  1DSN A;  3PPQ A;  3TTL A;  4YKP A;  5HBC A;  3MQ9 A;  3W9W A;  2F7B A;  3LSF B;  2XXV A;  3VVF A;  4NF6 B;  1UTH A;  5H8S A;  1AMF A;  3GLB A;  3SEU A;  2HEU A;  3K4U A;  1MXY A;  1MDP 1;  2DP8 A;  3G3I A;  1LGB C;  3FGS A;  1ATG A;  1TFD A;  1OQH A;  1USY E;  1MM6 A;  1A40 A;  5H8H B;  4KCD A;  5DVF A;  3TCH A;  3S4U A;  3CVG A;  4ZS9 A;  1N7W A;  3O6H A;  1B9J A;  3EHU A;  1IXI A;  3MP1 A;  2XXI A;  3PMV A;  4GVO A;  1FQE A;  2ONS A;  3H6U A;  5AA2 D;  2OK2 A;  4G2Z A;  1RYO A;  3QXM A;  2PVU A;  4ND9 A;  1Y4C A;  3TQL A;  1LLS A;  4YB7 A;  5CM6 A;  1Z7N E;  3FZV A;  4JSO A;  5AA2 A;  3D4G A;  1B58 A;  3DP8 A;  5B70 A;  3T9X B;  3QUF A;  4JWX A;  4YAH X;  5A5X B;  1MH4 A;  4LZ8 A;  2XXQ A;  2V3T A;  3U8Q A;  1MY3 A;  5CBS A;  2I48 A;  4PFY A;  2DSF A;  3MVZ A;  4RNS A;  5FTI A;  2A5T A;  4GQO A;  2QS1 A;  2LAO A;  3G3K A;  1ZBM A;  4IO4 A;  3B6W A;  5H8F B;  4GRK A;  4DXU A;  4GL8 A;  2XXP A;  2XXR A;  3WAE A;  1H76 A;  3OXN A;  3FJG A;  1BLF A;  3SEY A;  1IQ7 A;  3Q29 A;  2X26 A;  4N13 A;  4JWY A;  2NXO A;  3K00 A;  2DYX A;  3G3H A;  1Q35 A;  3PUZ E;  1EZO A;  4GFR A;  4FAJ A;  2W7Y A;  1LB8 A;  4MLQ A;  4BDM A;  1QJM A;  3TEL A;  1MXU A;  4F3B A;  1POY 1;  3QAX A;  2NUV A;  1B4Z A;  1IXH A;  2H99 A;  4LA9 A;  1A99 A;  1QUI A;  1D4N A;  3EF7 A;  1MPB A;  3CFX A;  4NF6 A;  1LCF A;  3TAJ A;  1DTZ A;  4H65 A;  4OYV A;  3K6V A;  1M5F A;  1L5T A;  1XVX A;  3U92 A;  4X48 A;  3UIF A;  3S9L C;  3T96 B;  4ELQ A;  1SYI A;  4QSC A;  1B1X A;  5H8H A;  1DPE A;  4GF8 A;  1SW1 A;  1R9L A;  3PPR A;  2KLF A;  5I58 A;  3PGF A;  1MG1 A;  1IIW A;  3O97 A;  1EZ9 A;  1SYH A;  1Q1K A;  3N6T A;  4LAT A;  1ZMG A;  4JB7 A;  3QK6 A;  3LSX A;  3KZG A;  2DS9 A;  4ZEI A;  1IUD A;  1MQI A;  3M3L A;  2WKY A;  2XX9 A;  4TQU Q;  5L9M A;  4RK9 A;  2CZL A;  4H1X A;  1LAX A;  2O84 X;  4F3G A;  3S9E A;  1NH8 A;  3RGY A;  1P99 A;  3FIR A;  4G77 A;  4OEV A;  5TPA B;  3IOV A;  2Z23 A;  4GD5 A;  4QSE A;  4HCY A;  2UYF A;  1Y20 A;  3U72 A;  4PE5 B;  1P1U A;  3RT6 B;  4H8J A;  3OEM A;  3DP4 A;  1MM7 A;  2G93 A;  2Y7I A;  1HSE A;  4I1D A;  2O7U A;  4PET A;  1B46 A;  4F31 B;  5JK4 A;  3C34 A;  3VVE A;  1H3D A;  1NKX A;  4OFL A;  2ANJ A;  1MQH A;  2QMX A;  1UQW A;  1US4 A;  4R6K A;  5ITO A;  4C1U A;  1LFH A;  3VXC A;  2FA7 A;  4HW8 A;  1JW1 A;  3RNN A;  4UA8 A;  3O9P A;  4KI0 E;  3K1N A;  4QFK A;  1DMB A;  4F19 A;  4YB5 A;  2PMS A;  1OVB A;  3RY3 A; 
#chains in the Genus database with same CATH topology
 5I56 A;  2OX3 A;  3QIM A;  4GLI A;  4YIC A;  3E4R A;  1PB8 A;  5ITP A;  2CMO A;  3T66 A;  2JJK A;  4LQ5 A;  3EHT A;  3RQT A;  3VVD A;  3FJM A;  3MZB A;  3FV1 A;  4KHZ E;  5ET5 A;  3WAF A;  1A55 A;  1YXI A;  3KN7 A;  3ZSF A;  1ZKB A;  2A5S A;  3UN6 A;  4RYA A;  2Q88 A;  2Q2A A;  4DI4 B;  4MF3 A;  3PUX E;  1UTH B;  1KA1 A;  4I9D A;  2VP1 A;  1RDY A;  3K6U A;  5IAI A;  3IOT A;  4ESW A;  2ESN A;  4OFJ A;  1ANF A;  1QUJ A;  5KZT A;  3O2A A;  4BDQ A;  3FJ7 A;  5ET6 A;  4NF4 A;  5CBR A;  5ICQ A;  3OEK A;  5K2X A;  1NFT A;  3MBP A;  1B7H A;  4WXJ A;  2O1L A;  2XXH A;  3DLN A;  4TLM B;  1MS7 A;  4MHF A;  2HCA A;  2H9B A;  3KOS A;  3M8U A;  2DWA A;  3SET A;  2ZYN A;  1B3H A;  2I0C A;  3EKI A;  5ESY A;  1WOD A;  3I6V A;  4PAK A;  4NQ8 A;  1DK4 A;  4G4P A;  4U1O A;  1SVX B;  3T93 B;  1MXV A;  4R2B A;  3ZS6 A;  2P0S A;  4POW A;  1ZJL A;  1Y3N A;  1EYI A;  3BIG A;  3VLV A;  5CMM A;  3T9H B;  4X1B A;  1FQD A;  5AA2 B;  5L9S A;  3W9V A;  2ALU A;  4GWU A;  1O7T A;  4JDF A;  3D4C A;  4FAT A;  4OFO A;  1FTK A;  1SD3 A;  2F6G A;  3SEV A;  3T9U A;  2L5V A;  5ET7 A;  4OTE A;  4PGP A;  3DEL B;  3VXB A;  3IAZ A;  4R6Y A;  4PDH A;  1G0I A;  3C4M A;  2HAV A;  3ILU B;  3FUZ A;  2A5T B;  3D1R A;  2OLB A;  3N5L A;  2RKM A;  4E0W A;  3LUY A;  4GWW A;  4F1U A;  3OMB A;  4H0W A;  2V93 A;  5EQ8 A;  2OBG A;  1FPI A;  2REJ A;  1INP A;  5I5P A;  3MYU A;  4BDO A;  1FPG A;  2QS2 A;  1MDQ A;  1IIT A;  4NF0 A;  3V83 A;  4O3A A;  3IB0 A;  5IZ1 A;  1MH3 A;  2F8D A;  2I49 A;  2Z8D A;  1K9Z A;  3SER A;  4LP2 B;  1TWY A;  2Q74 A;  3T1B A;  1JVY A;  3QYT A;  2Q8J A;  1POT A;  3TTN A;  1B7Z A;  1RKM A;  4IGR A;  1M5C A;  2HQ0 A;  4X9T A;  2PCR A;  1LBX A;  4QFP A;  4Z0I A;  4BDL A;  2UYE A;  1FTM A;  4F2O A;  4G8M A;  3TFL A;  3E3K A;  3OOA A;  5B7D A;  3MC2 A;  1EH3 A;  4BDN A;  2DWJ A;  2XHD A;  4IGT A;  1IEJ A;  3C35 A;  4KYE A;  4P47 A;  1URD A;  1FPK A;  1FPF A;  4P11 A;  4FE8 A;  1B5H A;  1Y1M A;  4IO2 A;  4DXB A;  2QVU A;  3UA8 A;  2PT1 A;  4WEP A;  1M5B A;  3IFA A;  1IXC A;  4K3F A;  2VHA A;  4EUO A;  4PAI A;  1B3F A;  4KR5 A;  1A8F A;  3PV0 E;  2OJT A;  3KJ7 A;  2DWH A;  1S7Y A;  3FXU A;  4GXS B;  3TKD A;  1QW0 A;  2XWI A;  1QUK A;  1IME A;  4ZED A;  2QMW A;  4GWO A;  4M1V A;  1R9Q A;  3QSL A;  2F6P A;  5J16 A;  2GQ1 A;  1KZ8 A;  5I58 B;  4ELP A;  2YJP A;  1IMA A;  4NE4 A;  1HSJ A;  1XS5 A;  1MQJ A;  1FBD A;  2DQV A;  3FD3 A;  2VPN A;  2F7C A;  5FTH A;  2F7A A;  3IO6 A;  3RTW B;  3KN8 A;  2HHM A;  4OEU A;  1M5D A;  3I5O A;  2Q9T A;  1B51 A;  3KSX A;  3C31 A;  4F18 A;  4DI3 D;  3H7M A;  3O66 A;  2Z8F A;  3EPE A;  3KJT A;  2HFB A;  1B52 A;  4ZEK A;  4F22 A;  3U1O A;  4QHQ A;  4RPO A;  4WKM A;  4YKK A;  2WBD A;  4IO3 A;  4YKJ A;  4NHB A;  3IJX B;  2I6E A;  5I2K A;  2DE4 A;  4F2Q A;  3CIJ A;  1HSL A;  3N26 A;  4N8Y A;  3S2V A;  2Q2C A;  2XX8 A;  2ZZV A;  4M4G A;  4R75 A;  3OD7 A;  1LBY A;  5K2Y A;  1CNQ A;  4RK2 A;  1RDX A;  2XXW A;  2DVC A;  4QBA A;  2DE2 A;  3PD8 A;  2QPQ A;  2KR0 A;  4Q30 B;  2XXU A;  4AS4 A;  5IZ3 B;  1FPJ A;  3ILT B;  5EYG A;  3CFZ A;  3TMG A;  4NMY A;  4JVD A;  2QS4 A;  3VDF A;  3JV9 A;  3LSL A;  4PTK A;  1K9Y A;  1SI0 A;  1A54 A;  2VD2 A;  3ISP A;  4PFT A;  2FIX A;  1MXX A;  2ZYO A;  2B65 A;  1LAG E;  3DM0 A;  1J1N A;  1FTA A;  3CSG A;  4YKI A;  3JYR A;  5I56 B;  2BJJ X;  4DLD A;  3C32 A;  4JSD A;  1FPD A;  2H5Y A;  4N81 A;  1VSO A;  3FXQ A;  1URG A;  1GV8 A;  1FSA A;  1VFE A;  3TTR A;  2F36 A;  2ONK E;  4HTG A;  1CE2 A;  1LCT A;  2OCU A;  1YZ0 A;  3K02 A;  5DW8 A;  2FNC A;  3B50 A;  1P1O A;  1Y3Q A;  1UTB A;  4EQ7 A;  1N7X A;  3K0V A;  4PFR A;  4O7M A;  4Q5T A;  3MWB A;  2WYK A;  3Q25 A;  2UVH A;  1I69 A;  3RPW A;  1GGG A;  2ZNU A;  1B32 A;  5KCJ A;  2I4C A;  3IX1 A;  2UXA A;  2OWZ A;  4R9G A;  2R6G E;  4NF4 B;  2UVG A;  4OES A;  3OEN A;  3E79 A;  1OIB A;  2F78 A;  2WEF A;  3HST A;  1PEB A;  2XD2 A;  4AB5 A;  3GBB A;  1QUL A;  2R9J A;  1US5 A;  5LDZ A;  1Y1Z A;  1A7L A;  4KPT A;  2V25 A;  1JVX A;  4U4X A;  3MAM A;  4XKQ A;  2XWV A;  5H8Q A;  5I57 A;  3G3J A;  3PUV E;  2B3F A;  2DDK A;  3ECR A;  3MPL A;  2FYI A;  2UVI A;  1O63 A;  1YYZ A;  4DDD A;  2XWK A;  3M3F A;  1NV6 A;  5KDT A;  3PTY A;  5ISU A;  3KN3 A;  2O68 A;  4LZ7 A;  4HXV A;  4XF5 A;  1NH7 A;  2QL3 A;  3FVG A;  3H06 B;  4QFN A;  1R6Z A;  1TFA A;  2F3D A;  5ICT A;  4XEQ A;  1JET A;  1FPL A;  1B0L A;  4H46 A;  5JTY B;  3K6W A;  3MZ1 A;  3VLU A;  5F24 A;  2RIN A;  5I84 A;  3RT8 A;  3K1P A;  3C36 A;  3TEP A;  3OEL A;  1ZU0 A;  1N0T A;  2I58 A;  3T22 A;  1JP4 A;  3MP8 A;  1TXF A;  2Z8E A;  4PGN A;  3B7D A;  2RC9 A;  2MKZ A;  3N94 A;  1FQC A;  3ZKL A;  5IZ3 A;  4U22 A;  4H8I A;  1NNT A;  3MPK A;  4ONY A;  4XXU A;  4NED A;  1NUX A;  2DWI A;  1BKA A;  3PUY E;  4NAP A;  3HN0 A;  1LEV A;  4MCO A;  3A3C A;  4MX6 A;  1QKA A;  2I3W A;  3PU5 A;  2I0B A;  4OVT A;  4RY1 A;  4PFW A;  1MXZ A;  2H98 A;  1N84 A;  1B2H A;  1YAE A;  1URS A;  4PQJ A;  3PPP A;  3GYY A;  2GFE A;  4OQO A;  2Y7P A;  2XXY A;  1DPP A;  3W15 C;  1B0H A;  4OZ9 A;  3PMW A;  3FVK A;  1WDN A;  5EQ7 A;  1BK4 A;  5EYF A;  2IA4 A;  1IZ1 A;  3UP9 A;  1F9B A;  4NWD A;  3IJO B;  1IMB A;  3H6T A;  4MJO A;  2AIX A;  4G68 C;  4EQ9 A;  1USY H;  4NF5 B;  4FIM A;  3ROJ A;  1KA0 A;  3TCF A;  3FAT A;  1CB6 A;  4QF9 A;  4JXI A;  1G0H A;  4IB2 A;  4FBP A;  3PPO A;  4I62 A;  4U21 A;  1MPC A;  1P1W A;  4IO6 A;  3U93 A;  2NOO A;  2F97 A;  2H25 A;  3HPI A;  4EQB A;  3NOH A;  1M5E A;  4PF8 A;  1FTJ A;  1H43 A;  4RJZ A;  2ZYK A;  3MJN A;  3HHF A;  4RPN A;  5A5L A;  1XI6 A;  5HPQ A;  4GL0 A;  4MBP A;  3OO7 A;  2NWJ A;  4ESX A;  1FJ6 A;  2OWT A;  3MVY A;  4LUB A;  5JEI A;  4FJP A;  3HV1 A;  5T3J A;  5J1D A;  1O64 A;  3TCG A;  2HPG A;  4NGU A;  3THI A;  3KFM A;  3TZA A;  3UOR A;  4P56 A;  4QRZ A;  3F11 A;  4I3Y A;  4NX1 A;  1FBP A;  2B4L A;  1LAF E;  3DP6 A;  3LR1 A;  3ONM A;  4NG7 A;  3M3K A;  3LBS A;  1NNF A;  3RTF B;  1LBC A;  2VGQ A;  4OVP A;  5JTY A;  4JVC A;  4OMB A;  4XKR A;  4DZ1 A;  4DCY A;  2WBB A;  5BWJ A;  4ZE9 A;  1B3G A;  5FHN A;  3FV2 A;  5L8D A;  4R9F A;  3SKP A;  5I2K B;  4N6D A;  1JW4 A;  4ZEC A;  4X1D A;  1VE4 A;  1B4H A;  4H5F A;  4KFQ A;  4MH5 A;  4PC9 A;  1QKB A;  3L6G A;  4XKP A;  1FBG A;  4FEB A;  4OAN A;  4XTC Q;  1MQG A;  4GX6 A;  3GBA A;  2OZZ A;  3R26 A;  3VV5 A;  4ZDM A;  4E0X A;  4N6P A;  3N6U A;  4KYD A;  2NVU B;  4O94 A;  5DVJ A;  2P1S A;  3FBP A;  4AQ4 A;  3K6X A;  4NN3 A;  2KQZ A;  3TOD A;  2THI A;  1GTK A;  4PFU A;  3KC0 A;  3KSJ A;  2F3B A;  3PPN A;  5I59 A;  3Q26 A;  4AB6 A;  4O7I A;  2QVV A;  1YTV A;  4ECF A;  1EZP A;  1ZLQ A;  2PYY A;  3IOU A;  5I3S A;  4GWY A;  4QFL A;  3MP6 A;  1NI9 A;  4PCD A;  3ZKK A;  1FTO A;  3B6T A;  4ELR A;  1MY2 A;  2DE3 A;  1MQD A;  1JW5 A;  4MLV A;  4XKN A;  4OVJ A;  4LN5 A;  2O69 A;  5LOM A;  3IB1 A;  1NV3 A;  4FED A;  4WED A;  4MMP A;  4G68 A;  2Y7R A;  3OSQ A;  3MUQ A;  3CG1 A;  3JZJ A;  4UAC A;  2YPN A;  4ZZA A;  4NF5 A;  3VLW A;  1FJ9 A;  3TUS A;  2ZMB A;  4F1Y A;  3FVN A;  3EN3 A;  4KQP A;  1SPI A;  1UTB B;  1FBC A;  1UIV A;  5I7I A;  5I2N A;  2QJE A;  4QXD A;  3VFJ A;  2O6A A;  4BDR A;  4THI A;  3BBR A;  3T0J A;  4R2F A;  3E13 X;  1MRP A;  3IB2 A;  3USD A;  2FIE A;  3R6U A;  5KCJ B;  2WYP A;  1B40 A;  3G3G A;  4UAB A;  3IO4 A;  2XWO A;  3HO7 A;  3UGW A;  1MY1 A;  2Y7K A;  1A8E A;  4H5G A;  1SDX A;  4JWO A;  4HCW A;  1LB9 A;  4OXV A;  5CMB A;  3U65 A;  1XC1 A;  5H8Q B;  4C0R A;  5I57 B;  1NL5 A;  2QS3 A;  4PE3 A;  1PBQ A;  2V3Q A;  3K1M A;  5CI5 A;  4JBZ A;  5DTB A;  1OVT A;  4NTL A;  3QUJ A;  2REG A;  4P1L A;  2Y5L A;  1OQG A;  2V3U A;  3BIH A;  1AWB A;  1II5 A;  5KDT B;  4X8R A;  4EXK A;  1I6Q A;  2RC8 A;  1S50 A;  3H3G A;  3CFL A;  4F1V A;  3O29 A;  3T9V A;  3OO9 A;  3ODB A;  3V5A A;  1LBW A;  1TT1 A;  2D5W A;  4EDP A;  2F5X A;  3LC8 A;  1FBE A;  3LUZ A;  2ZXT A;  2Q89 A;  2I3V A;  3FAS A;  5H8N A;  3MW0 A;  2CZK A;  3G3F A;  5FHO A;  1MY0 A;  3A3U A;  4PBH A;  4GX3 A;  4OER A;  1AH5 A;  2Y84 A;  4P9K A;  3GXA A;  4GOT A;  4PF6 A;  1PB7 A;  4RA1 A;  2HAU A;  4PDD A;  3QMF A;  1FTL A;  2DOJ A;  3CI8 A;  3IL1 B;  2DXR A;  1IXG A;  3OSR A;  4POX A;  2YLN A;  2ONR A;  3TQW A;  1Y9U A;  1AL3 A;  3R7X A;  2FBP A;  3V8X B;  1D3K A;  1VFD A;  4R74 A;  1FW0 A;  2CZH A;  2VD3 A;  3PMX A;  5ET8 A;  1LST A;  4Z7E A;  1FBF A;  4GWS A;  4HE2 A;  1MXW A;  4H67 A;  3SEW A;  2I4B A;  2ABH A;  4EF1 A;  1PBP A;  3EHS A;  2B3B A;  1SW4 A;  5CMK A;  2RC7 A;  2O51 A;  1NNK A;  4NF8 B;  4Q8R A;  1B05 A;  4KD5 A;  4U2R A;  3MVX A;  1UIU A;  2RCB A;  3OO6 A;  3S9N C;  5F1Q A;  1XT8 A;  2FVZ A;  2UVJ A;  5IZZ A;  4RXL A;  1AIV A;  1N3X A;  1N04 A;  1OMP A;  2O7I A;  4MEV A;  3KEI A;  5ELV A;  3KBR A;  3O28 A;  3MST A;  1BTJ A;  5AA4 B;  4F3P A;  4YB6 A;  5AA3 A;  2CEY A;  1SQY A;  2D21 A;  1EYK A;  3KBZ A;  3TTK A;  3U94 A;  1NUW A;  1XVY A;  3MVW A;  4YU0 A;  3HHG A;  3Q28 A;  2PFZ A;  1FPB A;  1ZTY A;  1T0K A;  4TLL B;  4N07 A;  4GX4 A;  4R6H A;  4PBQ A;  4GXA A;  1B7U A;  5IM2 A;  2V84 A;  1S9T A;  3B6Q A;  1B3E A;  1B6H A;  4LQ2 A;  3RPL A;  1B5J A;  3O6I A;  5CRY A;  2H4I A;  4PFI A;  2AYS A;  4KYS A;  1AOV A;  3PUW E;  4PP0 A;  3FXB A;  4BLA A;  4EF2 A;  1PB9 A;  2Z22 A;  3G7W A;  1KWH A;  1BP5 A;  5EHS A;  1SW5 A;  3RLF E;  4P0I A;  4N8G A;  1H44 A;  1XOC A;  5A5X A;  4NWC A;  2GHB A;  1VDW A;  1ELJ A;  3TTM A;  1B5I A;  1NMU A;  2XD3 A;  1DOT A;  1Y4T A;  5DVI A;  3Q27 A;  1PDA A;  3TDJ A;  4DE8 A;  4HE0 A;  4ISU A;  1I6A A;  5DEX B;  5EQ9 A;  1LFI A;  3GZG A;  1XHY A;  2HZK A;  3VE1 B;  1DTG A;  4H45 A;  5H8F A;  1Y3P A;  3H6W A;  4IO5 A;  1P1Q A;  3A29 A;  4GIZ A;  3RN8 A;  1YCJ A;  5TP9 B;  1ZIU A;  1OLA A;  3HCQ A;  2XXK A;  1GVC A;  1D9Y A;  1H45 A;  2PX1 A;  1FQF A;  3LSW A;  4DIG A;  3TYH A;  2F34 A;  2ZZW A;  4OVQ A;  3MZ9 A;  1JNF A;  2D3I A;  1DBZ A;  4U23 A;  2Y5K A;  5F7V A;  3BFT A;  3H03 A;  5I59 B;  3CHG A;  4P0G A;  4YMB A;  4HS7 A;  3H4Z A;  3CRB A;  4LZ5 A;  5AE4 A;  4KCC A;  3K2D A;  5L9O A;  3UK4 A;  3PD9 A;  5AA1 A;  1Z7M E;  1FCK A;  4NF8 A;  1NUZ A;  4G8H A;  4DCX A;  2ZNT A;  4G68 B;  4IY6 A;  2R71 A;  5EHM A;  2P2A A;  1OLC A;  3SEX A;  4OET A;  5DT6 A;  1BIY A;  4O3B A;  2X7Q A;  4P8B A;  3L6H A;  4PFB A;  4AS5 A;  1GR2 A;  1YPN A;  3IFC A;  4OHN A;  5CC2 A;  3IOR A;  3SES A;  3CG3 A;  5BUU A;  2O1M A;  2E0S A;  4L17 A;  3S9M C;  5I2N B;  2DVZ A;  3KGC A;  1I6B A;  5AA4 A;  1D9V A;  3LV0 A;  2RF1 A;  5CMC A;  1NNP A;  4I8C A;  4QSD A;  3OO8 A;  4C1T A;  1MY4 A;  4H6D A;  4TOZ A;  1JQF A;  4OEN A;  2GHA A;  2PBW A;  3BFU A;  4R73 A;  1IMD A;  3EQ1 A;  3HFU A;  2R8T A;  4F39 A;  3SDF A;  4N91 A;  3A09 A;  3FXR A;  2G29 A;  1B1H A;  4ZE8 A;  4MNP A;  2HXW A;  4XIG Q;  4R72 A;  2DXY A;  2GRV A;  2ZYM A;  4DXC A;  2OWS A;  3K01 A;  4MFI A;  4Q0C A;  2BJI A;  4ZZE A;  2E1S A;  5DYH A;  1N3W A;  1QVS A;  1SI1 A;  2QRY A;  4LVQ A;  1PC3 A;  4LON B;  4IY5 A;  3C33 A;  5M2V A;  1R1N A;  3CR9 A;  3CSB A;  1EU8 A;  5TPA A;  3KC1 A;  2RCA A;  4OVS A;  1NV7 A;  1EYJ A;  3FVO A;  1MPD A;  1SBP A;  3H6V A;  2XXT A;  4FOR A;  2HZL A;  2FHY A;  2X7P A;  1JEV A;  1VR5 A;  4N6K A;  5DEX A;  1WVJ A;  3P7I A;  5H8N B;  4ZEB A;  2XA5 A;  4P1E A;  1N76 A;  4EXL A;  5IKB A;  3BKI B;  1FQB A;  4YMA A;  5TP9 A;  4ELO A;  4FEC A;  2QSX A;  3IK6 B;  1FQA A;  2XXX A;  2VOZ A;  5HM4 B;  1IMF A;  2ZNS A;  2XX7 A;  3C9H A;  2B4M A;  4F29 A;  1B3L A;  4G8N A;  1QGX A;  5TU0 A;  3E9X A;  2F35 A;  4YZZ A;  3RUM A;  1SW2 A;  2M8C A;  3O6G A;  4IO7 A;  2PT2 A;  1LFG A;  4I3E A;  4ZEF A;  4F3S A;  3IOW A;  1LBB A;  2CEX A;  1FRP A;  1LAH E;  4OWD A;  3V89 B;  2IEE A;  1RYX A;  1Q9D A;  4U4S A;  4O3C A;  4G61 A;  3KG2 A;  2GH9 A;  1P1N A;  4QFO A;  4U1Z A;  3TPA A;  3IR1 A;  1JEU A;  5IGA A;  3KOT A;  2Y7W A;  3AXF A;  2AL4 A;  5FHM A;  2AL5 A;  3I3V A;  1DSN A;  3PPQ A;  3TTL A;  3B8B A;  4YKP A;  2ZZX A;  5HBC A;  2QFL A;  3MQ9 A;  3W9W A;  2F7B A;  3LSF B;  2XXV A;  3VVF A;  4NF6 B;  1RDZ A;  1UTH A;  5H8S A;  1AMF A;  3GLB A;  3SEU A;  2HEU A;  3K4U A;  1MXY A;  1MDP 1;  2DP8 A;  4N17 A;  3G3I A;  1LGB C;  3FGS A;  1ATG A;  1TFD A;  1OQH A;  5FBP A;  1USY E;  4GBV A;  1MM6 A;  2WX9 A;  5LTC A;  1A40 A;  5H8H B;  4KCD A;  5DVF A;  3TCH A;  4I40 A;  2VT5 A;  3S4U A;  3CVG A;  4ZS9 A;  1N7W A;  3O6H A;  1B9J A;  3EHU A;  1IXI A;  3MP1 A;  2XXI A;  3PMV A;  4HE1 A;  4GVO A;  1FQE A;  2ONS A;  3H6U A;  5AA2 D;  2OK2 A;  4G2Z A;  1RYO A;  3QXM A;  2PVU A;  4ND9 A;  3RPL B;  1Y4C A;  1FBH A;  3TQL A;  1LLS A;  4YB7 A;  5CM6 A;  1Z7N E;  3FZV A;  4JSO A;  5AA2 A;  3D4G A;  1B58 A;  4GBW A;  3DP8 A;  4X04 A;  5B70 A;  3T9X B;  3QUF A;  4JWX A;  4YAH X;  5A5X B;  4MIJ A;  4P3L A;  1MH4 A;  4LZ8 A;  2XXQ A;  2V3T A;  3U8Q A;  1MY3 A;  5CBS A;  2Q8M A;  2I48 A;  4PFY A;  2DSF A;  3MVZ A;  4RNS A;  5FTI A;  2A5T A;  3RYD A;  4GQO A;  2QS1 A;  2LAO A;  3G3K A;  1ZBM A;  4IO4 A;  3B6W A;  2PFY A;  5H8F B;  4GRK A;  4N15 A;  4DXU A;  4GL8 A;  2XXP A;  2XXR A;  3WAE A;  1H76 A;  3OXN A;  3FJG A;  1BLF A;  4IR8 A;  3SEY A;  1IQ7 A;  3E78 A;  4O8M A;  1FPE A;  4MAG A;  1NV1 A;  1LBZ A;  3Q29 A;  4N4U A;  2X26 A;  4N13 A;  2QVR A;  4JWY A;  2NXO A;  3K00 A;  2DYX A;  3SZP A;  4OA4 A;  3G3H A;  1Q35 A;  4MNC A;  3PUZ E;  1EZO A;  4GFR A;  4FAJ A;  2W7Y A;  1LB8 A;  4MLQ A;  4BDM A;  1QJM A;  3TEL A;  1MXU A;  4F3B A;  1POY 1;  3QAX A;  2NUV A;  1B4Z A;  1IXH A;  2H99 A;  4LA9 A;  1A99 A;  1QUI A;  1D4N A;  3EF7 A;  4KXP A;  1MPB A;  3CFX A;  5EQA A;  4GWX A;  4NF6 A;  1LCF A;  1LBV A;  4XFE A;  3TAJ A;  1DTZ A;  4H65 A;  4OYV A;  1DCU A;  3K6V A;  1M5F A;  1L5T A;  1XVX A;  3U92 A;  4X48 A;  3UIF A;  3S9L C;  3T96 B;  4ELQ A;  1SYI A;  4QSC A;  1B1X A;  5H8H A;  1DPE A;  1NV0 A;  2V4C A;  4GF8 A;  1SW1 A;  1R9L A;  3PPR A;  2KLF A;  2P3N A;  5I58 A;  1NV4 A;  3PGF A;  1MG1 A;  1IMC A;  1IIW A;  3O97 A;  1EZ9 A;  1SYH A;  1Q1K A;  3N6T A;  4LAT A;  1ZMG A;  4JB7 A;  3QK6 A;  4OVR A;  3LSX A;  3KZG A;  2DS9 A;  4ZEI A;  1IUD A;  1MQI A;  3M3L A;  2WKY A;  2XX9 A;  4TQU Q;  5EYH A;  5L9M A;  2CZI A;  4RK9 A;  1NUY A;  2CZL A;  4H1X A;  1LAX A;  2O84 X;  4MNI A;  4F3G A;  1NV2 A;  3S9E A;  1NH8 A;  3RGY A;  1P99 A;  2HXR A;  3FIR A;  4G77 A;  4OEV A;  5TPA B;  3IOV A;  2Z23 A;  4GD5 A;  4QSE A;  4JVI A;  4HCY A;  2UYF A;  1Y20 A;  3U72 A;  4PE5 B;  1P1U A;  3RT6 B;  4H8J A;  3OEM A;  3DP4 A;  1MM7 A;  1NV5 A;  2G93 A;  2Y7I A;  1HSE A;  4I1D A;  2O7U A;  2VPO A;  4PET A;  1B46 A;  2P3V A;  4PAF A;  4F31 B;  5JK4 A;  3C34 A;  3VVE A;  4GWZ A;  1H3D A;  1NKX A;  4OFL A;  2ANJ A;  1MQH A;  2QMX A;  1UQW A;  1US4 A;  4R6K A;  5ITO A;  4C1U A;  1D9Q A;  1LFH A;  3VXC A;  2FA7 A;  4HW8 A;  1JW1 A;  3RNN A;  4UA8 A;  3O9P A;  4KI0 E;  3K1N A;  4QFK A;  1DMB A;  4F19 A;  4YB5 A;  2PMS A;  1OVB A;  3RY3 A; 
#chains in the Genus database with same CATH homology
 5I56 A;  3QIM A;  4GLI A;  4YIC A;  3E4R A;  1PB8 A;  5ITP A;  2CMO A;  3T66 A;  4LQ5 A;  3EHT A;  3RQT A;  3VVD A;  3FJM A;  3MZB A;  3FV1 A;  4KHZ E;  3WAF A;  1A55 A;  3KN7 A;  3ZSF A;  1ZKB A;  2A5S A;  3UN6 A;  4RYA A;  2Q88 A;  2Q2A A;  4MF3 A;  3PUX E;  1UTH B;  4I9D A;  2VP1 A;  3K6U A;  5IAI A;  3IOT A;  4ESW A;  2ESN A;  4OFJ A;  1ANF A;  1QUJ A;  5KZT A;  3O2A A;  4BDQ A;  3FJ7 A;  4NF4 A;  5CBR A;  5ICQ A;  3OEK A;  5K2X A;  1NFT A;  3MBP A;  1B7H A;  4WXJ A;  2O1L A;  2XXH A;  3DLN A;  4TLM B;  1MS7 A;  2HCA A;  2H9B A;  3KOS A;  3M8U A;  2DWA A;  3SET A;  2ZYN A;  1B3H A;  2I0C A;  1WOD A;  3I6V A;  4G4P A;  4U1O A;  1SVX B;  3T93 B;  1MXV A;  4R2B A;  3ZS6 A;  2P0S A;  4POW A;  1ZJL A;  1Y3N A;  3VLV A;  5CMM A;  3T9H B;  4X1B A;  1FQD A;  5AA2 B;  5L9S A;  3W9V A;  2ALU A;  1O7T A;  4JDF A;  3D4C A;  4FAT A;  4OFO A;  1FTK A;  1SD3 A;  2F6G A;  3SEV A;  3T9U A;  4OTE A;  3DEL B;  3VXB A;  3IAZ A;  4R6Y A;  3C4M A;  2HAV A;  3ILU B;  3FUZ A;  2A5T B;  2OLB A;  3N5L A;  2RKM A;  4E0W A;  3LUY A;  4F1U A;  3OMB A;  4H0W A;  2V93 A;  2OBG A;  2REJ A;  4BDO A;  2QS2 A;  1MDQ A;  1IIT A;  3V83 A;  4O3A A;  3IB0 A;  1MH3 A;  2F8D A;  2I49 A;  2Z8D A;  3SER A;  4LP2 B;  1TWY A;  1JVY A;  3QYT A;  2Q8J A;  1POT A;  3TTN A;  1B7Z A;  1RKM A;  4IGR A;  1M5C A;  2HQ0 A;  4X9T A;  4QFP A;  4Z0I A;  4BDL A;  2UYE A;  1FTM A;  4F2O A;  4G8M A;  3TFL A;  3E3K A;  5B7D A;  3OOA A;  3MC2 A;  1EH3 A;  4BDN A;  2DWJ A;  2XHD A;  4IGT A;  1IEJ A;  3C35 A;  4KYE A;  1URD A;  4P11 A;  4FE8 A;  1B5H A;  1Y1M A;  4IO2 A;  4DXB A;  3UA8 A;  2PT1 A;  4WEP A;  1M5B A;  1IXC A;  4K3F A;  2VHA A;  4EUO A;  1B3F A;  4KR5 A;  1A8F A;  3PV0 E;  2OJT A;  3KJ7 A;  2DWH A;  1S7Y A;  3FXU A;  4GXS B;  3TKD A;  1QW0 A;  1QUK A;  4ZED A;  2QMW A;  4GWO A;  4M1V A;  1R9Q A;  3QSL A;  2F6P A;  5I58 B;  4ELP A;  2YJP A;  4NE4 A;  1HSJ A;  1XS5 A;  1MQJ A;  2DQV A;  3FD3 A;  2F7C A;  5FTH A;  2F7A A;  3IO6 A;  3RTW B;  3KN8 A;  4OEU A;  1M5D A;  3I5O A;  2Q9T A;  1B51 A;  3KSX A;  3C31 A;  4F18 A;  3H7M A;  3O66 A;  2Z8F A;  3EPE A;  3KJT A;  2HFB A;  1B52 A;  4ZEK A;  4F22 A;  3U1O A;  4QHQ A;  4RPO A;  4WKM A;  4YKK A;  4IO3 A;  4YKJ A;  3IJX B;  2I6E A;  5I2K A;  2DE4 A;  4F2Q A;  3CIJ A;  1HSL A;  3N26 A;  3S2V A;  2Q2C A;  2XX8 A;  4M4G A;  4R75 A;  3OD7 A;  5K2Y A;  4RK2 A;  2XXW A;  2DVC A;  2DE2 A;  3PD8 A;  2QPQ A;  4Q30 B;  2XXU A;  3ILT B;  3CFZ A;  3TMG A;  4NMY A;  2QS4 A;  3VDF A;  3JV9 A;  3LSL A;  1SI0 A;  1A54 A;  2VD2 A;  4PFT A;  1MXX A;  2ZYO A;  2B65 A;  1LAG E;  3DM0 A;  1J1N A;  3CSG A;  4YKI A;  3JYR A;  5I56 B;  2BJJ X;  4DLD A;  3C32 A;  4JSD A;  2H5Y A;  1VSO A;  3FXQ A;  1URG A;  1GV8 A;  1VFE A;  3TTR A;  2F36 A;  2ONK E;  4HTG A;  1CE2 A;  1LCT A;  2OCU A;  3K02 A;  2FNC A;  1P1O A;  1Y3Q A;  1UTB A;  4EQ7 A;  1N7X A;  3K0V A;  4Q5T A;  3MWB A;  3Q25 A;  2UVH A;  1I69 A;  3RPW A;  1GGG A;  2ZNU A;  1B32 A;  5KCJ A;  2I4C A;  3IX1 A;  2UXA A;  4R9G A;  2R6G E;  4NF4 B;  2UVG A;  4OES A;  3OEN A;  1OIB A;  2F78 A;  3HST A;  1PEB A;  2XD2 A;  4AB5 A;  3GBB A;  1QUL A;  2R9J A;  1US5 A;  1Y1Z A;  1A7L A;  4KPT A;  2V25 A;  1JVX A;  4U4X A;  3MAM A;  4XKQ A;  5H8Q A;  5I57 A;  3G3J A;  3PUV E;  2B3F A;  3ECR A;  3MPL A;  2FYI A;  2UVI A;  1O63 A;  4DDD A;  3M3F A;  5KDT A;  5ISU A;  3KN3 A;  2O68 A;  4LZ7 A;  1NH7 A;  2QL3 A;  3FVG A;  3H06 B;  4QFN A;  1R6Z A;  1TFA A;  5ICT A;  1JET A;  1B0L A;  5JTY B;  3K6W A;  3MZ1 A;  3VLU A;  2RIN A;  5I84 A;  3RT8 A;  3K1P A;  3C36 A;  3TEP A;  3OEL A;  1ZU0 A;  1N0T A;  2I58 A;  3T22 A;  3MP8 A;  1TXF A;  2Z8E A;  3B7D A;  2RC9 A;  3N94 A;  1FQC A;  3ZKL A;  4U22 A;  4H8I A;  1NNT A;  3MPK A;  4ONY A;  4XXU A;  4NED A;  2DWI A;  1BKA A;  3PUY E;  3HN0 A;  3A3C A;  1QKA A;  2I3W A;  3PU5 A;  2I0B A;  4PFW A;  4RY1 A;  1MXZ A;  2H98 A;  1N84 A;  1B2H A;  1YAE A;  1URS A;  4PQJ A;  3PPP A;  2GFE A;  4OQO A;  2Y7P A;  2XXY A;  1DPP A;  3W15 C;  1B0H A;  4OZ9 A;  3PMW A;  3FVK A;  1WDN A;  5EYF A;  2IA4 A;  1IZ1 A;  3UP9 A;  1F9B A;  4NWD A;  3IJO B;  3H6T A;  2AIX A;  4G68 C;  4EQ9 A;  1USY H;  4NF5 B;  4FIM A;  3TCF A;  3FAT A;  1CB6 A;  4QF9 A;  4JXI A;  4IB2 A;  3PPO A;  4I62 A;  4U21 A;  1MPC A;  1P1W A;  4IO6 A;  3U93 A;  2NOO A;  2F97 A;  2H25 A;  3HPI A;  4EQB A;  1M5E A;  1FTJ A;  1H43 A;  4RJZ A;  2ZYK A;  3MJN A;  3HHF A;  4RPN A;  5HPQ A;  4GL0 A;  4MBP A;  3OO7 A;  2NWJ A;  4ESX A;  2OWT A;  3MVY A;  4LUB A;  5JEI A;  4FJP A;  3HV1 A;  5J1D A;  1O64 A;  3TCG A;  3THI A;  3KFM A;  3TZA A;  3UOR A;  4QRZ A;  3F11 A;  3DP6 A;  1LAF E;  3LR1 A;  3ONM A;  3M3K A;  3LBS A;  1NNF A;  3RTF B;  1LBC A;  2VGQ A;  5JTY A;  4OMB A;  4XKR A;  4DZ1 A;  4DCY A;  5BWJ A;  4ZE9 A;  1B3G A;  5FHN A;  3FV2 A;  5L8D A;  4R9F A;  3SKP A;  5I2K B;  1JW4 A;  4ZEC A;  4X1D A;  1VE4 A;  1B4H A;  4H5F A;  4KFQ A;  4MH5 A;  1QKB A;  3L6G A;  4XKP A;  4FEB A;  4XTC Q;  1MQG A;  3GBA A;  2OZZ A;  3R26 A;  3VV5 A;  4ZDM A;  4E0X A;  4N6P A;  3N6U A;  4KYD A;  2NVU B;  5DVJ A;  2P1S A;  4AQ4 A;  3K6X A;  3TOD A;  2THI A;  1GTK A;  4PFU A;  3KSJ A;  3PPN A;  5I59 A;  3Q26 A;  4AB6 A;  1YTV A;  4ECF A;  1EZP A;  1ZLQ A;  2PYY A;  3IOU A;  4QFL A;  3MP6 A;  3ZKK A;  1FTO A;  3B6T A;  4ELR A;  1MY2 A;  2DE3 A;  1MQD A;  1JW5 A;  4MLV A;  4XKN A;  4OVJ A;  2O69 A;  5LOM A;  3IB1 A;  4WED A;  4FED A;  4G68 A;  2Y7R A;  3OSQ A;  3MUQ A;  3CG1 A;  3JZJ A;  4UAC A;  2YPN A;  4ZZA A;  4NF5 A;  3VLW A;  3TUS A;  2ZMB A;  4F1Y A;  3FVN A;  3EN3 A;  4KQP A;  1UTB B;  1UIV A;  5I2N A;  2QJE A;  3VFJ A;  2O6A A;  4BDR A;  4THI A;  3BBR A;  4R2F A;  3E13 X;  1MRP A;  3IB2 A;  3USD A;  5KCJ B;  3R6U A;  1B40 A;  3G3G A;  3IO4 A;  3HO7 A;  3UGW A;  1MY1 A;  2Y7K A;  1A8E A;  4H5G A;  1SDX A;  4JWO A;  4HCW A;  1LB9 A;  4OXV A;  5CMB A;  1XC1 A;  5H8Q B;  4C0R A;  5I57 B;  1NL5 A;  2QS3 A;  1PBQ A;  2V3Q A;  3K1M A;  5CI5 A;  4JBZ A;  5DTB A;  1OVT A;  4NTL A;  3QUJ A;  2REG A;  1OQG A;  2V3U A;  1II5 A;  5KDT B;  4EXK A;  1I6Q A;  2RC8 A;  1S50 A;  3H3G A;  3CFL A;  4F1V A;  3O29 A;  3T9V A;  3OO9 A;  3ODB A;  3V5A A;  1TT1 A;  2D5W A;  4EDP A;  2F5X A;  3LC8 A;  2ZXT A;  2Q89 A;  2I3V A;  3FAS A;  5H8N A;  3MW0 A;  3G3F A;  5FHO A;  1MY0 A;  3A3U A;  4OER A;  1AH5 A;  2Y84 A;  3GXA A;  4GOT A;  1PB7 A;  4RA1 A;  2HAU A;  1FTL A;  2DOJ A;  3CI8 A;  3IL1 B;  2DXR A;  1IXG A;  3OSR A;  4POX A;  2YLN A;  2ONR A;  3TQW A;  1Y9U A;  1AL3 A;  3R7X A;  3V8X B;  1D3K A;  1VFD A;  4R74 A;  1FW0 A;  2VD3 A;  3PMX A;  1LST A;  4Z7E A;  1MXW A;  4H67 A;  3SEW A;  2I4B A;  2ABH A;  4EF1 A;  1PBP A;  3EHS A;  2B3B A;  1SW4 A;  5CMK A;  2RC7 A;  2O51 A;  1NNK A;  4NF8 B;  4Q8R A;  1B05 A;  4KD5 A;  4U2R A;  3MVX A;  1UIU A;  2RCB A;  3OO6 A;  3S9N C;  5F1Q A;  1XT8 A;  2UVJ A;  4RXL A;  1AIV A;  1N3X A;  1N04 A;  1OMP A;  2O7I A;  3KEI A;  5ELV A;  3KBR A;  3O28 A;  1BTJ A;  5AA4 B;  4F3P A;  4YB6 A;  5AA3 A;  1SQY A;  2D21 A;  3TTK A;  3U94 A;  1XVY A;  3MVW A;  4YU0 A;  3HHG A;  3Q28 A;  1ZTY A;  1T0K A;  4TLL B;  4N07 A;  4R6H A;  4GXA A;  1B7U A;  2V84 A;  1S9T A;  3B6Q A;  1B3E A;  1B6H A;  4LQ2 A;  1B5J A;  3O6I A;  5CRY A;  2H4I A;  2AYS A;  4KYS A;  1AOV A;  3PUW E;  4PP0 A;  4BLA A;  4EF2 A;  1PB9 A;  2Z22 A;  3G7W A;  1KWH A;  1BP5 A;  5EHS A;  1SW5 A;  3RLF E;  4P0I A;  1H44 A;  1XOC A;  5A5X A;  4NWC A;  2GHB A;  1ELJ A;  3TTM A;  1B5I A;  1NMU A;  2XD3 A;  1DOT A;  1Y4T A;  5DVI A;  3Q27 A;  1PDA A;  3TDJ A;  4DE8 A;  4ISU A;  1I6A A;  5DEX B;  1LFI A;  3GZG A;  1XHY A;  2HZK A;  3VE1 B;  1DTG A;  5H8F A;  1Y3P A;  3H6W A;  4IO5 A;  1P1Q A;  4GIZ A;  3RN8 A;  1YCJ A;  5TP9 B;  1ZIU A;  1OLA A;  3HCQ A;  1GVC A;  1D9Y A;  1H45 A;  2PX1 A;  1FQF A;  3LSW A;  4DIG A;  3TYH A;  2F34 A;  3MZ9 A;  1JNF A;  2D3I A;  4U23 A;  5F7V A;  3BFT A;  3H03 A;  5I59 B;  4P0G A;  4YMB A;  4HS7 A;  3H4Z A;  3CRB A;  4LZ5 A;  5AE4 A;  4KCC A;  3K2D A;  5L9O A;  3UK4 A;  3PD9 A;  5AA1 A;  1Z7M E;  1FCK A;  4NF8 A;  4G8H A;  4DCX A;  2ZNT A;  4G68 B;  4IY6 A;  2R71 A;  5EHM A;  2P2A A;  1OLC A;  3SEX A;  4OET A;  5DT6 A;  1BIY A;  4O3B A;  2X7Q A;  3L6H A;  1GR2 A;  1YPN A;  4OHN A;  5CC2 A;  3IOR A;  3SES A;  3CG3 A;  5BUU A;  2O1M A;  2E0S A;  4L17 A;  3S9M C;  5I2N B;  2DVZ A;  3KGC A;  1I6B A;  5AA4 A;  1D9V A;  5CMC A;  2RF1 A;  1NNP A;  4I8C A;  4QSD A;  3OO8 A;  4C1T A;  1MY4 A;  4H6D A;  4TOZ A;  1JQF A;  4OEN A;  2GHA A;  2PBW A;  3BFU A;  4R73 A;  3EQ1 A;  4F39 A;  3SDF A;  3A09 A;  3FXR A;  2G29 A;  1B1H A;  4ZE8 A;  2HXW A;  4XIG Q;  4R72 A;  2DXY A;  2GRV A;  2ZYM A;  4DXC A;  2OWS A;  3K01 A;  4MFI A;  4Q0C A;  4ZZE A;  2E1S A;  5DYH A;  1N3W A;  1QVS A;  1SI1 A;  2QRY A;  4LVQ A;  1PC3 A;  4LON B;  4IY5 A;  3C33 A;  5M2V A;  1R1N A;  3CR9 A;  3CSB A;  1EU8 A;  5TPA A;  2RCA A;  3FVO A;  1MPD A;  1SBP A;  3H6V A;  2XXT A;  4FOR A;  2HZL A;  2X7P A;  1JEV A;  1VR5 A;  5DEX A;  1WVJ A;  3P7I A;  5H8N B;  4ZEB A;  1N76 A;  4EXL A;  5IKB A;  3BKI B;  1FQB A;  4YMA A;  5TP9 A;  4ELO A;  4FEC A;  2QSX A;  3IK6 B;  1FQA A;  2XXX A;  2VOZ A;  5HM4 B;  2ZNS A;  2XX7 A;  3C9H A;  4F29 A;  1B3L A;  4G8N A;  5TU0 A;  3E9X A;  2F35 A;  4YZZ A;  3RUM A;  1SW2 A;  2M8C A;  3O6G A;  4IO7 A;  2PT2 A;  1LFG A;  4ZEF A;  4F3S A;  3IOW A;  1LBB A;  1LAH E;  4OWD A;  3V89 B;  2IEE A;  1RYX A;  4U4S A;  4O3C A;  3KG2 A;  2GH9 A;  1P1N A;  4QFO A;  4U1Z A;  3TPA A;  3IR1 A;  1JEU A;  3KOT A;  2Y7W A;  3AXF A;  2AL4 A;  5FHM A;  2AL5 A;  3I3V A;  1DSN A;  3PPQ A;  3TTL A;  4YKP A;  5HBC A;  3MQ9 A;  3W9W A;  2F7B A;  3LSF B;  2XXV A;  3VVF A;  4NF6 B;  1UTH A;  5H8S A;  1AMF A;  3GLB A;  3SEU A;  2HEU A;  3K4U A;  1MXY A;  1MDP 1;  2DP8 A;  3G3I A;  1LGB C;  3FGS A;  1ATG A;  1TFD A;  1OQH A;  1USY E;  1MM6 A;  1A40 A;  5H8H B;  4KCD A;  5DVF A;  3TCH A;  3S4U A;  3CVG A;  4ZS9 A;  1N7W A;  3O6H A;  1B9J A;  3EHU A;  1IXI A;  3MP1 A;  2XXI A;  3PMV A;  4GVO A;  1FQE A;  2ONS A;  3H6U A;  5AA2 D;  2OK2 A;  4G2Z A;  1RYO A;  3QXM A;  2PVU A;  4ND9 A;  1Y4C A;  3TQL A;  1LLS A;  4YB7 A;  5CM6 A;  1Z7N E;  3FZV A;  4JSO A;  5AA2 A;  3D4G A;  1B58 A;  3DP8 A;  5B70 A;  3T9X B;  3QUF A;  4JWX A;  4YAH X;  5A5X B;  1MH4 A;  4LZ8 A;  2XXQ A;  2V3T A;  3U8Q A;  1MY3 A;  5CBS A;  2I48 A;  4PFY A;  2DSF A;  3MVZ A;  4RNS A;  5FTI A;  2A5T A;  4GQO A;  2QS1 A;  2LAO A;  3G3K A;  1ZBM A;  4IO4 A;  3B6W A;  5H8F B;  4GRK A;  4DXU A;  4GL8 A;  2XXP A;  2XXR A;  3WAE A;  1H76 A;  3OXN A;  3FJG A;  1BLF A;  3SEY A;  1IQ7 A;  3Q29 A;  2X26 A;  4N13 A;  4JWY A;  2NXO A;  3K00 A;  2DYX A;  3G3H A;  1Q35 A;  3PUZ E;  1EZO A;  4GFR A;  4FAJ A;  2W7Y A;  1LB8 A;  4MLQ A;  4BDM A;  1QJM A;  3TEL A;  1MXU A;  4F3B A;  1POY 1;  3QAX A;  2NUV A;  1B4Z A;  1IXH A;  2H99 A;  4LA9 A;  1A99 A;  1QUI A;  1D4N A;  3EF7 A;  1MPB A;  3CFX A;  4NF6 A;  1LCF A;  3TAJ A;  1DTZ A;  4H65 A;  4OYV A;  3K6V A;  1M5F A;  1L5T A;  1XVX A;  3U92 A;  4X48 A;  3UIF A;  3S9L C;  3T96 B;  4ELQ A;  1SYI A;  4QSC A;  1B1X A;  5H8H A;  1DPE A;  4GF8 A;  1SW1 A;  1R9L A;  3PPR A;  2KLF A;  5I58 A;  3PGF A;  1MG1 A;  1IIW A;  3O97 A;  1EZ9 A;  1SYH A;  1Q1K A;  3N6T A;  4LAT A;  1ZMG A;  4JB7 A;  3QK6 A;  3LSX A;  3KZG A;  2DS9 A;  4ZEI A;  1IUD A;  1MQI A;  3M3L A;  2WKY A;  2XX9 A;  4TQU Q;  5L9M A;  4RK9 A;  2CZL A;  4H1X A;  1LAX A;  2O84 X;  4F3G A;  3S9E A;  1NH8 A;  3RGY A;  1P99 A;  3FIR A;  4G77 A;  4OEV A;  5TPA B;  3IOV A;  2Z23 A;  4GD5 A;  4QSE A;  4HCY A;  2UYF A;  1Y20 A;  3U72 A;  4PE5 B;  1P1U A;  3RT6 B;  4H8J A;  3OEM A;  3DP4 A;  1MM7 A;  2G93 A;  2Y7I A;  1HSE A;  4I1D A;  2O7U A;  4PET A;  1B46 A;  4F31 B;  5JK4 A;  3C34 A;  3VVE A;  1H3D A;  1NKX A;  4OFL A;  2ANJ A;  1MQH A;  2QMX A;  1UQW A;  1US4 A;  4R6K A;  5ITO A;  4C1U A;  1LFH A;  3VXC A;  2FA7 A;  4HW8 A;  1JW1 A;  3RNN A;  4UA8 A;  3O9P A;  4KI0 E;  3K1N A;  4QFK A;  1DMB A;  4F19 A;  4YB5 A;  2PMS A;  1OVB A;  3RY3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...