1I6BA

Structure of equine apolactoferrin at 3.2 a resolution using crystals grown at 303k
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
689
structure length
689
Chain Sequence
APRKSVRWCTISPAEAAKCAKFQRNMKKVRGPSVSCIRKTSSFECIQAIAANKADAVTLDGGLVYEAGLHPYKLRPVAAEVYQTRGKPQTRYYAVAVVKKGSGFQLNQLQGVKSCHTGLGRSAGWNIPIGTLRPYLNWTGPPEPLQKAVANFFSASCVPCADGKQYPNLCRLCAGTEADKCACSSQEPYFGYSGAFKCLENGAGDVAFVKDSTVFENLPDEAERDKYELLCPDNTRKPVDAFKECHLARVPSHAVVARSVDGREDLIWKLLHRAQEEFGRNKSSAFQLFGSTPGEQDLLFKDSALGFVRIPSQIDSGLYLGANYLTATQNLRETAAEVAARRERVVWCAVGPEEERKCKQWSDVSNRKVACASASTTEECIALVLKGEADALNLDGGFIYVAGKCGLVPVLAENQKSQNSNAPDCVHRPPEGYLAVAVVRKSDADLTWNSLSGKKSCHTGVGRTAAWNIPMGLLFNQTGSCKFDKFFSQSCAPGADPQSSLCALCVGNNENENKCMPNSEERYYGYTGAFRCLAEKAGDVAFVKDVTVLQNTDGKNSEPWAKDLKQEDFELLCLDGTRKPVAEAESCHLARAPNHAVVSQSDRAQHLKKVLFLQQDQFGGNGPDCPGKFCLFKSETKNLLFNDNTECLAELQGKTTYEQYLGSEYVTSITNLRRCSSSPLLEACAFLRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Metal transport
molecule keywords LACTOTRANSFERRIN
publication title Crystal structure of equine apolactoferrin at 303 K providing further evidence of closed conformations of N and C lobes.
pubmed doi rcsb
total genus 168
structure length 689
sequence length 689
ec nomenclature
pdb deposition date 2001-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00405 Transferrin Transferrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1i6bA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1i6bA04
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1i6bA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1i6bA03
2F6GA 1NNPA 2VP1A 1Z7NE 3O9PA 3IB2A 1FQCA 4LP2B 4FAJA 2XXYA 3LBSA 3DM0A 1EZPA 4EQ9A 2DXYA 1M5EA 1B4HA 1NKXA 1DSNA 1US4A 3JZJA 3PD8A 3N26A 4GXSB 5DVJA 4LVQA 4AQ4A 1H44A 2WKYA 5H8HB 3FGSA 2QS1A 4F22A 5A5XB 4G68B 3IAZA 1A7LA 4R6HA 3T93B 3M3KA 3PUWE 4OQOA 4P11A 1DTZA 3QK6A 1P1NA 1ZLQA 3O6HA 1US5A 1VFEA 5L9MA 1LAXA 1O64A 3PUXE 5ICQA 1B6HA 4IY5A 3A3CA 3TPAA 1FTLA 4Z0IA 3K2DA 1ZBMA 4GVOA 2Z8FA 4G77A 3SDFA 1LCTA 4F3SA 1B4ZA 2OWSA 3QUJA 4LQ2A 3VXBA 2Q2AA 4LA9A 3HHFA 3CFZA 1B5JA 3CIJA 4DCXA 3KG2A 4LQ5A 5HPQA 3N6TA 4YMBA 3GXAA 3C36A 2GFEA 1MM6A 5CC2A 5CRYA 3DP6A 2QS3A 1AH5A 4MBPA 1MXXA 3SEUA 5AA2A 1USYE 3W9WA 2F34A 3Q25A 1IXIA 3MP6A 2REGA 3CI8A 4NWCA 1MXUA 4DXUA 4U21A 1B1HA 1LFGA 1II5A 3U94A 1PBPA 3G7WA 2VOZA 1IXHA 1JEUA 2V84A 1Y1MA 4I1DA 3K02A 4XKNA 2Y7RA 4KYDA 3U1OA 2R6GE 4DDDA 3BKIB 2ONKE 2E0SA 3PPRA 1N0TA 2P0SA 2PT1A 4RXLA 2DOJA 3U93A 5ITOA 4FECA 2PMSA 2Y84A 4YU0A 2I0CA 2ZMBA 1WDNA 4G8MA 3DLNA 4F3GA 2RCBA 1HSLA 3FV1A 1SYIA 1OLAA 1QKAA 1IEJA 3TYHA 5EHMA 3FXRA 1FTJA 4OESA 4NF5B 4ESXA 3FXUA 3MPLA 1XC1A 2PYYA 4R2FA 2XHDA 1XT8A 2I48A 5DYHA 5I58A 5HM4B 2HFBA 4HS7A 4ISUA 3PUYE 2QS4A 3KJ7A 1XVXA 3H06B 1NNFA 4LZ5A 5DVFA 3HCQA 4BDOA 5AA4B 2AL5A 3GBAA 1ZU0A 1H43A 1MY4A 2XXPA 2D5WA 5CMBA 4H65A 5FHOA 2XD2A 1B3FA 1B9JA 1N04A 1RKMA 1ZKBA 2PX1A 1LB9A 4Q30B 3IL1B 4R9FA 3MZ9A 3OELA 3OO9A 1B5HA 4MFIA 4IO3A 1IITA 1LLSA 4P0IA 3FUZA 5H8NB 3ZSFA 1N3XA 2H5YA 4M4GA 1B51A 1SW2A 3HSTA 1A55A 1JVYA 5JTYB 1D4NA 4GD5A 4R2BA 4RK2A 3UA8A 4IY6A 3TCFA 4ZECA 1Y4CA 4U1OA 2F7CA 2VD2A 2OK2A 3CG1A 3OEMA 3VVEA 2E1SA 3I5OA 1JW4A 1N7WA 3C4MA 1P99A 3O66A 3FJMA 3QIMA 3TTLA 4F2QA 1XOCA 3V8XB 3S9NC 4NTLA 4KI0E 1FW0A 3TKDA 4YMAA 4F31B 2FNCA 4F3PA 3T96B 3MC2A 4I8CA 1MY3A 1VR5A 4WKMA 3PMXA 2DWIA 2A5TA 4ZEIA 4TQUQ 1SDXA 2QL3A 4P0GA 4EQ7A 1QUJA 4QHQA 4JWYA 3O6IA 2P1SA 4RY1A 2GHAA 2V3UA 3IR1A 1CB6A 1P1QA 4DZ1A 3E4RA 2ALUA 5H8FB 3H6TA 3UORA 3LSXA 1P1OA 2XXWA 4RNSA 3RLFE 3GLBA 1BLFA 3TAJA 5H8QA 1DOTA 1FQDA 1B0LA 1Y3QA 3IJOB 1MH3A 1BKAA 3HPIA 5KZTA 4H1XA 3G3HA 4GFRA 3CSGA 4XKRA 1B58A 1Y4TA 3RN8A 3KEIA 1JW5A 3RT6B 3KSXA 1ZTYA 1UTBA 4L17A 5KCJB 4Q0CA 3TTKA 3FVOA 1AOVA 5TPAA 3RT8A 4RPNA 3H6UA 4RA1A 5I59B 5I84A 5I2NB 2YPNA 3T9UA 5M2VA 1UIVA 2XXHA 4ELQA 2PVUA 4OYVA 5JEIA 3RPWA 3SESA 3G3IA 1MQHA 1Y3PA 2H99A 3IX1A 3VDFA 4LZ8A 3IOVA 2PBWA 1R1NA 1YPNA 2UVGA 1LBCA 5BWJA 3I3VA 3DP4A 3P7IA 5ISUA 3L6GA 3B6TA 4X48A 3Q27A 1UQWA 1ATGA 3K6VA 1F9BA 1B7ZA 3CG3A 3SEXA 4BDNA 3SKPA 4MF3A 3O28A 4GF8A 3RNNA 2F7AA 5I57A 5F7VA 3O97A 3TCHA 3CFXA 3Q28A 2RF1A 4YKJA 4DXCA 4QFOA 4RYAA 2Z8EA 3D4GA 4ELOA 1BIYA 2OWTA 1DTGA 2O7IA 1MQJA 3MVYA 2NOOA 1LFIA 5L8DA 1JW1A 3IB1A 5ICTA 1URGA 3OXNA 3TQWA 1USYH 5I56A 5DEXB 4XKQA 2XXTA 3K6WA 2ZNUA 2Y7PA 3C33A 4IGTA 4QFLA 1JNFA 3O6GA 4G2ZA 1SQYA 2I4BA 5F1QA 4U4SA 1S50A 5FTHA 4FEDA 4TLMB 1HSEA 2DXRA 4R6KA 4NF4A 1M5DA 4GXAA 3ILUB 3S4UA 2CZLA 4X1BA 3K1MA 3E3KA 3ZS6A 1TWYA 1M5CA 3KN7A 1OMPA 3IK6B 4OFJA 4BDQA 2XXUA 4ZEBA 3R7XA 1O63A 3G3JA 2G29A 4OFOA 4I62A 2HZLA 2DVCA 2B3BA 4JSDA 4R74A 2I3VA 1PB7A 3MZ1A 1TFDA 3B6QA 5L9SA 4HCYA 3EN3A 1B5IA 3MZBA 1B3GA 3THIA 2OJTA 2FYIA 4OERA 3AXFA 4QFPA 2DE2A 3VLWA 3WAEA 4JBZA 3JV9A 1CE2A 1ZMGA 3C9HA 1IZ1A 2A5SA 4KFQA 1B05A 4NF8B 4OEUA 3PPPA 2ANJA 3U8QA 4R75A 1RYXA 4R9GA 4U22A 3FJGA 4HCWA 1TFAA 3OSRA 3H6WA 3QAXA 1A54A 3R26A 4OXVA 4JWXA 1B46A 1MY0A 3TMGA 1FQBA 2PT2A 1M5FA 3WAFA 3UK4A 3IJXB 3L6HA 4DIGA 4PFUA 2GH9A 5H8HA 5A5XA 4G68A 3H7MA 1FTOA 2REJA 2I6EA 3RUMA 3G3KA 1R6ZA 1Z7ME 1FTMA 1KWHA 1JEVA 3S9MC 2D3IA 4YKKA 1DMBA 2DS9A 4DLDA 3USDA 1SVXB 3TEPA 4U23A 1B2HA 1Q1KA 2ZXTA 3FIRA 3QSLA 3UP9A 5KDTB 3FASA 2RC9A 2I4CA 5K2YA 2XXVA 3VXCA 3UIFA 1RYOA 1OVBA 2H9BA 3G3GA 5FHNA 4N13A 4NE4A 3KJTA 1MY1A 3BFTA 4KYSA 4QSEA 1J1NA 3K0VA 4YB5A 2QJEA 2M8CA 1VSOA 2Y7WA 3FD3A 1N7XA 3N6UA 3CFLA 3GBBA 2DSFA 2X7PA 3IB0A 3U72A 3GZGA 5IKBA 3FXQA 3N5LA 4JDFA 3VLUA 2H98A 4XTCQ 4H8IA 1NH7A 2Q8JA 5IAIA 3H3GA 3OO8A 4LUBA 5HBCA 1S9TA 1B7UA 5I2KB 4C1TA 1EU8A 4NF6B 4OFLA 2UVHA 4JB7A 4QF9A 1MY2A 2DWHA 5KDTA 1MM7A 1UIUA 2X26A 4KCDA 2DE3A 2OZZA 1MG1A 4N07A 4XXUA 3QYTA 2Y7IA 5DT6A 4IO2A 4ZDMA 1LAFE 4ECFA 1PEBA 1D9YA 4NF5A 1H76A 3KGCA 3O2AA 3PPOA 4G8HA 1PDAA 3ECRA 3H4ZA 4MLQA 2KLFA 4POXA 2ABHA 1UTHB 1I69A 3JYRA 3CVGA 1IIWA 2I0BA 4JWOA 2OBGA 4YZZA 4H8JA 4M1VA 3ILTB 3MP1A 3E13X 5AA4A 5DTBA 2VGQA 1ELJA 4O3BA 2XX8A 2NWJA 4IO4A 3T9HB 4FORA 1NH8A 4EDPA 3H6VA 4OZ9A 1MDQA 5H8NA 3SERA 4UA8A 1DPEA 3EHSA 1FCKA 5JTYA 1Y1ZA 3UGWA 3OO6A 4GIZA 3TCGA 2HAUA 2F78A 5J1DA 2O69A 1VFDA 1TXFA 2VHAA 1ZJLA 1EH3A 1GGGA 3EQ1A 3OOAA 3H03A 2DE4A 4ELPA 3DELB 3EHUA 2ZNTA 3PUZE 4F1UA 2HEUA 3W15C 1NMUA 1MXVA 3PD9A 1WODA 1LB8A 1BTJA 2ZYNA 1FQEA 2F97A 1MPCA 2VD3A 1JETA 4IO6A 2QS2A 4GRKA 1MQIA 3M3FA 2THIA 2XX7A 1B1XA 1ANFA 1JVXA 1SW4A 4OMBA 1URSA 1Y3NA 4F39A 4LZ7A 2QPQA 3S2VA 4F19A 3FVKA 3T66A 5TP9B 3EHTA 5H8FA 3FV2A 3S9LC 4FEBA 1B3HA 2HCAA 2FA7A 4IGRA 4IO7A 4GOTA 1PB8A 4H5FA 3N94A 2RCAA 4R6YA 4N6PA 1A40A 1YAEA 4GLIA 2F7BA 4IB2A 4RPOA 4X1DA 3ZKKA 1R9QA 4WEDA 3V83A 4F2OA 3OEKA 4POWA 3PUVE 1MS7A 2G93A 4EXLA 4G68C 3M8UA 4PP0A 1POY1 3MVWA 4QSDA 1PC3A 1YCJA 4QFKA 4K3FA 3IO4A 2QMWA 5KCJA 1SW5A 3ZKLA 1WVJA 5EYFA 5L9OA 5I59A 3D4CA 5AA3A 5I2NA 3SEVA 1IQ7A 2BJJX 3C32A 4R72A 3I6VA 1SYHA 3KBRA 2NXOA 5B70A 2RC7A 2I3WA 3LR1A 5CBRA 5CI5A 3BFUA 4KPTA 5TU0A 2F35A 1IXCA 4PFWA 1P1UA 5LOMA 4YAHX 3Q26A 1MDP1 2P2AA 3DP8A 3LSWA 1URDA 4KYEA 4Q8RA 2DP8A 5CMMA 3T22A 4BLAA 2UXAA 4YICA 1QW0A 2H4IA 3IOUA 3A09A 1LFHA 4NEDA 4OEVA 2UVJA 3HV1A 4ND9A 2LAOA 4G8NA 4TOZA 4PQJA 3B7DA 1S7YA 2YJPA 4KR5A 2O1LA 3K1PA 1FQFA 4DE8A 4KHZE 2RC8A 4BDLA 3OSQA 4BDRA 1JQFA 5EHSA 1EZ9A 2R9JA 4Q5TA 3LSLA 2ZYKA 5AA2B 4ZEFA 2DWAA 1GV8A 5DEXA 2ONSA 3VLVA 1MPDA 4I9DA 1FQAA 1QULA 2B3FA 3VVFA 4TLLB 3FVGA 2ZNSA 1MXZA 1Y20A 3FVNA 3CSBA 1PB9A 2O84X 1ZIUA 4QFNA 3T9VA 5ITPA 3CRBA 1T0KA 1L5TA 5AE4A 1I6AA 1B32A 5H8SA 3LC8A 4NMYA 3ONMA 2R71A 4YKPA 3C34A 2B65A 4OETA 3VV5A 3PU5A 1MPBA 1QJMA 1B52A 2H25A 3PMVA 3PPQA 5DVIA 1OQHA 2RKMA 1H3DA 1VE4A 3VFJA 3HO7A 1OIBA 3K4UA 3RGYA 2XXIA 3TTNA 4XKPA 3VE1B 2UYFA 1B0HA 3QXMA 1LCFA 2DYXA 2I58A 3G3FA 3C31A 3FJ7A 2Z22A 4ZE9A 2AL4A 3TTRA 5I58B 5ELVA 3M3LA 2ESNA 3KZGA 2OLBA 4H5GA 4QSCA 1QUIA 1M5BA 4GQOA 2NVUB 3C35A 1HSJA 4RJZA 3MP8A 4OENA 4UACA 3KOSA 1SD3A 4AB5A 3LSFB 2Q88A 4NF8A 1A8FA 2Z23A 1D3KA 4OWDA 3HN0A 3SEWA 4EUOA 1H45A 2IEEA 4OHNA 2Q2CA 1N3WA 1QKBA 4ZE8A 3RQTA 2UYEA 3U92A 3IO6A 1NNKA 4HW8A 1SI1A 4Z7EA 5B7DA 2Z8DA 2HAVA 1OLCA 4KQPA 2Q9TA 1GR2A 4EXKA 2AYSA 2IA4A 1LGBC 4G4PA 1IUDA 2V93A 5CM6A 1TT1A 1POTA 1XHYA 4PFTA 2W7YA 2HZKA 3IORA 1OVTA 1AIVA 4QRZA 4BDMA 1AL3A 2DQVA 1A99A 2O51A 4DCYA 4X9TA 1FTKA 5AA1A 4U1ZA 4ESWA 4F1YA 4ELRA 1MRPA 2O7UA 4EQBA 1MXYA 3TTMA 3KN8A 1O7TA 3VVDA 2O6AA 3R6UA 3IOTA 3TUSA 1QVSA 3KOTA 5CMKA 2A5TB 2CMOA 3PV0E 5CMCA 1B3LA 4THIA 1Y9UA 4F29A 3RTFB 4WEPA 4ZZAA 1LAHE 4JXIA 4HTGA 2RINA 4YB7A 1R9LA 1PBQA 2GHBA 4OTEA 1LSTA 5H8QB 2X7QA 2F6PA 3B6WA 3KSJA 2DVZA 3TQLA 4C0RA 4PE5B 1MXWA 5I2KA 4E0XA 4YB6A 3W9VA 3E9XA 4NF6A 4KCCA 3TDJA 3OMBA 1EZOA 3V89B 4R73A 5BUUA 1IXGA 4F1VA 3OENA 2V3TA 3TFLA 4ZEKA 4EF2A 2XXRA 3A3UA 1UTBB 3RTWB 2XX9A 4U2RA 4WXJA 2YLNA 3ODBA 2XXQA 4YKIA 5TPAB 1N76A 4IO5A 3MW0A 5FHMA 1B7HA 1OQGA 1XS5A 3F11A 3Q29A 5JK4A 1NNTA 2F8DA 1GTKA 1QUKA 3KFMA 2V3QA 4U4XA 5CBSA 1NL5A 2AIXA 4GL8A 4H6DA 4PETA 1I6BA 3MAMA 3MQ9A 3K6XA 2HQ0A 4ZS9A 1LAGE 4ZZEA 1D9VA 2I49A 3OD7A 3EPEA 2NUVA 1UTHA 4KD5A 1Q35A 3SETA 1B3EA 3MBPA 1DPPA 3FATA 3LUYA 4FJPA 5I57B 4O3CA 1N84A 3MVZA 2O1MA 4MH5A 3RY3A 3MPKA 4LONB 4NWDA 1GVCA 2F5XA 4GL0A 3QUFA 3UN6A 3CR9A 4MLVA 2QSXA 5I56B 3KN3A 2GRVA 3FZVA 3TELA 3PPNA 3MWBA 2ZYOA 3S9EA 1BP5A 3V5AA 3TODA 4XIGQ 3TZAA 1AMFA 2V25A 4DXBA 1NFTA 4JSOA 2QRYA 3K01A 1MQDA 1YTVA 4NF4B 4O3AA 3IOWA 2DWJA 4ZEDA 4RK9A 3OO7A 4LATA 2Q89A 2F36A 3BBRA 4PFYA 3EF7A 1XVYA 2Y7KA 3K00A 4F18A 4FIMA 3PGFA 4FE8A 2XXXA 4EF1A 4C1UA 3PMWA 2OCUA 4OVJA 5FTIA 4E0WA 2UVIA 2D21A 1A8EA 1SW1A 1SI0A 3SEYA 1P1WA 5TP9A 3O29A 2HXWA 3K6UA 4FATA 4F3BA 1SBPA 3MVXA 3HHGA 4GWOA 5AA2D 3MJNA 1LBBA 3K1NA 4H0WA 2O68A 1MH4A 2QMXA 1B40A 2XD3A 2ZYMA 4H67A 4ONYA 1I6QA 4AB6A 1MQGA 3MUQA 5K2XA 2ONRA 3T9XB
chains in the Genus database with same CATH superfamily
1FPFA 2F6GA 1NNPA 2VP1A 1Z7NE 3O9PA 3IB2A 3E79A 1FQCA 4LP2B 4FAJA 2XXYA 3LBSA 3DM0A 1EZPA 4EQ9A 2DXYA 1M5EA 1B4HA 1NKXA 1DSNA 1US4A 3JZJA 3PD8A 3N26A 1FBEA 4GXSB 5DVJA 4LVQA 5DW8A 4GWSA 4AQ4A 1H44A 2WKYA 5H8HB 3FGSA 2QS1A 3IFAA 4F22A 5A5XB 4G68B 3IAZA 1A7LA 4R6HA 3T93B 3M3KA 1NV3A 3PUWE 4OQOA 4P11A 1DTZA 3QK6A 1P1NA 1ZLQA 3O6HA 1US5A 1VFEA 1FPJA 1LAXA 1O64A 5L9MA 3PUXE 4PAKA 5ICQA 1B6HA 4IY5A 3A3CA 3TPAA 1FTLA 4Z0IA 4HE2A 2V4CA 1LBWA 3K2DA 1ZBMA 4GVOA 2Z8FA 4G77A 4OVRA 3SDFA 1LCTA 4F3SA 1B4ZA 2OWSA 3QUJA 1NUYA 4LQ2A 3VXBA 2Q2AA 4LA9A 4MIJA 3HHFA 5ET7A 3CFZA 1B5JA 3CIJA 4DCXA 3KG2A 4LQ5A 5HPQA 3N6TA 2XWIA 4YMBA 3GXAA 3C36A 2GFEA 1MM6A 4HXVA 5CC2A 5CRYA 3DP6A 2QS3A 1AH5A 4MBPA 1K9ZA 1MXXA 3SEUA 4N6DA 5AA2A 1USYE 3W9WA 2F34A 3Q25A 1IXIA 3MP6A 4I40A 2REGA 3CI8A 4NWCA 2ZZXA 1MXUA 4DXUA 4U21A 1B1HA 1LFGA 1II5A 3U94A 1PBPA 3G7WA 2VOZA 1IXHA 1JEUA 5I7IA 2V84A 1Y1MA 4FBPA 4I1DA 3K02A 4XKNA 2Y7RA 4KYDA 4PAIA 1FPLA 3U1OA 2R6GE 4DDDA 3BKIB 2ONKE 2E0SA 3PPRA 1N0TA 2P0SA 2PT1A 4RXLA 2DOJA 3U93A 4N8YA 5ITOA 4FECA 2PMSA 2Y84A 4YU0A 2I0CA 2ZMBA 4NN3A 1WDNA 2B4MA 4G8MA 3DLNA 4F3GA 2RCBA 1HSLA 3FV1A 1SYIA 1OLAA 1QKAA 1IEJA 5LDZA 3TYHA 5EHMA 3FXRA 1FTJA 4OESA 4NF5B 4ESXA 3FXUA 5ET6A 3MPLA 1XC1A 2PYYA 4R2FA 2XHDA 1XT8A 2I48A 5DYHA 5I58A 2HXRA 5HM4B 2HFBA 4HS7A 4ISUA 3PUYE 2QS4A 3KJ7A 1XVXA 3H06B 1NNFA 4LZ5A 5DVFA 3HCQA 4BDOA 5AA4B 2AL5A 3GBAA 1ZU0A 1H43A 2VPNA 1MY4A 2XXPA 2D5WA 5CMBA 4H65A 1INPA 5FHOA 2XD2A 1B3FA 1B9JA 1N04A 1RKMA 1ZKBA 2PX1A 1LB9A 4Q30B 4GX6A 3IL1B 4R9FA 3MZ9A 3OELA 3OO9A 1B5HA 4MFIA 4IO3A 1FPGA 1IITA 1LLSA 4P0IA 3FUZA 5H8NB 3ZSFA 4PFIA 1NI9A 1N3XA 2H5YA 3FXBA 4M4GA 1B51A 1SW2A 3HSTA 1A55A 1JVYA 5JTYB 1D4NA 4GD5A 4R2BA 2QVUA 4RK2A 3UA8A 4IY6A 4OA4A 3TCFA 4ZECA 4GBWA 1Y4CA 4XEQA 5ESYA 4U1OA 2F7CA 1FPKA 2VD2A 2OK2A 3CG1A 3OEMA 3VVEA 1EYIA 4MAGA 2E1SA 3I5OA 3ISPA 2WX9A 1JW4A 1N7WA 4XF5A 3C4MA 1P99A 3O66A 1FJ9A 3CHGA 3FJMA 3QIMA 3TTLA 4F2QA 1XOCA 3V8XB 3SZPA 3S9NC 4PBHA 4NTLA 4KI0E 1FW0A 3TKDA 4YMAA 5LTCA 2DDKA 2PFYA 4F31B 2FNCA 2R8TA 4F3PA 3T96B 3MC2A 4I8CA 1MY3A 1VR5A 4G61A 4WKMA 5EYGA 2CZKA 5F24A 1G0IA 5EQAA 3PMXA 2DWIA 2A5TA 4PF8A 4ZEIA 4TQUQ 1SDXA 2QL3A 4P0GA 4EQ7A 1QUJA 4QHQA 4JWYA 1G0HA 3O6IA 2P1SA 4RY1A 2GHAA 2V3UA 2F3BA 3IR1A 1CB6A 1P1QA 3E4RA 2ALUA 5H8FB 4DZ1A 3H6TA 3UORA 3LSXA 1P1OA 2PCRA 2XXWA 4RNSA 4JVCA 2XXKA 3RLFE 3GLBA 1BLFA 3TAJA 4QBAA 1IMCA 5H8QA 1DOTA 1FQDA 1B0LA 1Y3QA 4H46A 3IJOB 1MH3A 4N81A 1BKAA 3HPIA 2Q8MA 5KZTA 4H1XA 3G3HA 4GFRA 3A29A 3CSGA 4XKRA 1B58A 1Y4TA 3RN8A 3KEIA 1JW5A 3RT6B 3KSXA 1ZTYA 4NAPA 1UTBA 4L17A 1K9YA 5KCJB 4PE3A 4Q0CA 3TTKA 3FVOA 1AOVA 5TPAA 3RT8A 4RPNA 3H6UA 4RA1A 5I59B 4MNIA 5I84A 2JJKA 5I2NB 2YPNA 3T9UA 4MHFA 3BIGA 5M2VA 1UIVA 2XXHA 4ELQA 3LV0A 2PVUA 4OYVA 5JEIA 1Q9DA 3RPWA 3SESA 3G3IA 1MQHA 2FIXA 1Y3PA 1KA0A 2H99A 3IX1A 3VDFA 4LZ8A 1LBYA 3IOVA 2PBWA 1R1NA 1NUWA 1YPNA 2UVGA 1LBCA 5BWJA 4GWZA 3I3VA 3DP4A 3E78A 3P7IA 5ISUA 3L6GA 4QXDA 3B6TA 4X48A 3Q27A 4HE1A 1UQWA 1ATGA 4GWWA 3K6VA 1F9BA 1B7ZA 3CG3A 1RDXA 4N17A 3SEXA 2WEFA 4BDNA 3SKPA 1IMEA 4MF3A 3O28A 4GF8A 3RNNA 2F7AA 5I57A 5F7VA 3O97A 3TCHA 3CFXA 3QMFA 2KR0A 3Q28A 2RF1A 4YKJA 4DXCA 4QFOA 4RYAA 2Z8EA 3D4GA 4ELOA 1BIYA 2OWTA 1DTGA 2O7IA 1MQJA 3MVYA 2NOOA 1LFIA 5L8DA 1JW1A 3IB1A 5ICTA 1URGA 4OVPA 3OXNA 3TQWA 1USYH 5I56A 4N15A 5DEXB 4XKQA 2XXTA 3K6WA 2ZNUA 4GWUA 2Y7PA 3C33A 4IGTA 4QFLA 1JNFA 1FTAA 3LUZA 1FSAA 3O6GA 4G2ZA 1SQYA 2I4BA 5F1QA 4U4SA 1S50A 5FTHA 4FEDA 2KQZA 4TLMB 1HSEA 4O7IA 5IM2A 2DXRA 5IZZA 2QFLA 3KC0A 4R6KA 4N8GA 4NF4A 1M5DA 4GXAA 3ILUB 3S4UA 2CZLA 4X1BA 3K1MA 3E3KA 3ZS6A 1TWYA 1M5CA 3KN7A 1OMPA 3IK6B 4JVDA 4OFJA 4MX6A 4BDQA 4KXPA 1SPIA 1NV5A 2XXUA 4ZEBA 3R7XA 1O63A 3G3JA 2G29A 4OFOA 4I62A 2HZLA 2DVCA 2B3BA 4JSDA 4R74A 2I3VA 1PB7A 3MZ1A 3BIHA 2PFZA 1TFDA 3B6QA 5L9SA 4HCYA 3EN3A 1B5IA 3MZBA 1B3GA 3THIA 2OJTA 2FYIA 4OERA 3AXFA 4GWYA 4LN5A 4QFPA 2DE2A 3VLWA 3WAEA 4JBZA 3JV9A 1CE2A 1ZMGA 4MNPA 4AS4A 3C9HA 1IZ1A 2A5SA 4KFQA 5I5PA 1B05A 4MNCA 4NF8B 4OEUA 3PPPA 2ANJA 3U8QA 4R75A 1RYXA 2QVRA 4R9GA 1IMBA 4U22A 3FJGA 4HCWA 1TFAA 3OSRA 3H6WA 1FBDA 3QAXA 1A54A 3R26A 4OXVA 5FBPA 4JWXA 1B46A 1MY0A 3TMGA 1FQBA 2PT2A 1M5FA 3WAFA 3UK4A 3IJXB 3L6HA 4DIGA 4PFUA 2GH9A 5IZ3B 3KC1A 4N4UA 4PAFA 5H8HA 5A5XA 4G68A 3H7MA 1FTOA 2REJA 1VDWA 2I6EA 3RUMA 3G3KA 1R6ZA 1Z7ME 1FTMA 1KWHA 1JEVA 3S9MC 2D3IA 4YKKA 1DMBA 1KA1A 2DS9A 4DLDA 3USDA 1SVXB 3TEPA 2XA5A 5EQ8A 4U23A 1B2HA 3IFCA 4OANA 1Q1KA 2ZXTA 3FIRA 3QSLA 3UP9A 5KDTB 3FASA 2RC9A 3PTYA 2I4CA 5K2YA 2XXVA 3VXCA 3UIFA 1RYOA 1OVBA 1NUZA 2H9BA 3G3GA 5FHNA 4N13A 4NE4A 3KJTA 1MY1A 3BFTA 4KYSA 4QSEA 1J1NA 3K0VA 2QJEA 2M8CA 2Y7WA 1VSOA 3FD3A 4YB5A 1N7XA 3N6UA 2P3VA 3CFLA 3GBBA 2XWKA 2DSFA 2X7PA 3IB0A 3U72A 3B50A 3GZGA 5IKBA 3FXQA 3N5LA 4JDFA 4O8MA 3VLUA 2Y5KA 2H98A 4XTCQ 4H8IA 1NH7A 2Q8JA 5IAIA 2OWZA 3H3GA 2WBBA 3OO8A 4LUBA 2P3NA 4MJOA 5HBCA 1S9TA 4PDDA 3MYUA 1B7UA 5I2KB 4UABA 4C1TA 1EU8A 1DBZA 4NF6B 4OVSA 4OFLA 2FIEA 2UVHA 4JB7A 4PFBA 4QF9A 1MY2A 2DWHA 5KDTA 1MM7A 1UIUA 2X26A 4KCDA 2DE3A 2OZZA 1MG1A 4N07A 4XXUA 1CNQA 2OX3A 3QYTA 2Y7IA 5DT6A 4IO2A 3ROJA 4ZDMA 1LAFE 4ECFA 5A5LA 5ET5A 1PEBA 1D9YA 4NF5A 1H76A 3KGCA 3O2AA 3PPOA 4G8HA 1FPIA 1PDAA 3ECRA 3H4ZA 4MLQA 2KLFA 4POXA 2ABHA 1UTHB 1I69A 3FBPA 3JYRA 3CVGA 1IIWA 2I0BA 4JWOA 2OBGA 4YZZA 1EYKA 4H8JA 4M1VA 3ILTB 3MP1A 3E13X 4PGNA 5AA4A 5DTBA 2VGQA 1ELJA 4O3BA 2XX8A 2NWJA 4IO4A 3T9HB 1NV6A 3RPLB 4FORA 1NH8A 2CZHA 4EDPA 3H6VA 4OZ9A 1MDQA 4PF6A 5H8NA 3B8BA 3SERA 4UA8A 1DPEA 3EHSA 1FCKA 5JTYA 1Y1ZA 3U65A 3UGWA 3OO6A 4GIZA 3TCGA 2HAUA 1LBZA 2WYPA 2VT5A 2F78A 5J1DA 2O69A 4HE0A 1VFDA 2Q74A 1TXFA 4X04A 1LBVA 2VHAA 1ZJLA 1EH3A 1GGGA 2Y5LA 3EQ1A 3OOAA 3H03A 2DE4A 4ELPA 3D1RA 3DELB 4NHBA 3EHUA 2ZNTA 3PUZE 4F1UA 2HEUA 3W15C 1NMUA 1MXVA 3PD9A 1NV7A 1WODA 1LB8A 1BTJA 2ZYNA 1FQEA 2F97A 1MPCA 2VD3A 1JETA 4IO6A 2QS2A 4GRKA 1MQIA 3M3FA 2THIA 2XX7A 1B1XA 1ANFA 1JVXA 2CZIA 2FHYA 1SW4A 4OMBA 1URSA 1Y3NA 4F39A 4LZ7A 2QPQA 3S2VA 4F19A 3FVKA 3T66A 5TP9B 3EHTA 5H8FA 3FV2A 3S9LC 4FEBA 1B3HA 1AWBA 2HCAA 2FA7A 4IGRA 4IO7A 3T0JA 5IGAA 4GX3A 4GOTA 1PB8A 4H5FA 3N94A 2RCAA 4R6YA 4N6PA 1A40A 1YAEA 4GLIA 2QVVA 2F7BA 4IB2A 4RPOA 4X1DA 4MEVA 3ZKKA 2BJIA 1R9QA 4PFRA 4WEDA 3V83A 4F2OA 4O7MA 3OEKA 4O94A 4POWA 5I3SA 3PUVE 1MS7A 2G93A 4EXLA 4G68C 3M8UA 4PP0A 1POY1 3MVWA 4QSDA 1PC3A 1YCJA 4QFKA 4PCDA 4K3FA 3IO4A 5IZ1A 2QMWA 5KCJA 4P1EA 1SW5A 1KZ8A 3ZKLA 1WVJA 5EYFA 5L9OA 5I59A 3D4CA 5AA3A 5I2NA 3SEVA 1IQ7A 2BJJX 3C32A 4R72A 3I6VA 1SYHA 3KBRA 2NXOA 5B70A 2RC7A 2I3WA 3LR1A 5CBRA 5CI5A 3BFUA 4KPTA 5TU0A 2F35A 1IXCA 4PFWA 1P1UA 5LOMA 2FBPA 4YAHX 3Q26A 1MDP1 2P2AA 3DP8A 3LSWA 1URDA 3MSTA 4KYEA 4Q8RA 2DP8A 1FBFA 5CMMA 3T22A 4BLAA 2UXAA 4YICA 1QW0A 2H4IA 3IOUA 4MMPA 3A09A 4PTKA 1LFHA 4NEDA 4OEVA 2UVJA 3HV1A 4ND9A 2LAOA 4G8NA 4TOZA 4PQJA 3B7DA 1S7YA 2YJPA 4KR5A 2O1LA 3K1PA 1FQFA 4DE8A 4KHZE 2RC8A 1NV1A 4BDLA 2HHMA 3OSQA 4BDRA 4AS5A 1JQFA 5EHSA 1EZ9A 2R9JA 4Q5TA 3LSLA 2ZYKA 5AA2B 3NOHA 4ZEFA 2DWAA 1GV8A 5DEXA 2ONSA 3VLVA 5T3JA 1MPDA 4I9DA 2HPGA 1FQAA 1QULA 2B3FA 3VVFA 1XI6A 4TLLB 3FVGA 2ZNSA 1MXZA 1Y20A 4P1LA 3FVNA 5EQ7A 2MKZA 4I3YA 3CSBA 1PB9A 1EYJA 4PGPA 2O84X 1ZIUA 1RDZA 4QFNA 3T9VA 5ITPA 3RYDA 3CRBA 1T0KA 1L5TA 4NG7A 5AE4A 1I6AA 1B32A 5H8SA 3LC8A 4NMYA 3ONMA 2R71A 4YKPA 3C34A 2B65A 4OETA 3VV5A 3T1BA 3PU5A 1MPBA 1QJMA 2ZZVA 1B52A 2H25A 3PMVA 3PPQA 5DVIA 1LEVA 1OQHA 4PDHA 2RKMA 1H3DA 1VE4A 4H45A 3VFJA 3HO7A 1OIBA 3K4UA 3RGYA 2XXIA 3TTNA 1LBXA 4XKPA 3VE1B 2UYFA 1IMFA 1B0HA 3QXMA 1LCFA 2DYXA 2I58A 3G3FA 3C31A 3FJ7A 2Z22A 4ZE9A 2AL4A 3TTRA 4NF0A 2GQ1A 5I58B 5ELVA 3M3LA 1FBPA 2ESNA 3EKIA 2OLBA 3KZGA 4H5GA 2WBDA 4QSCA 1QUIA 1M5BA 1YYZA 4GQOA 2NVUB 3C35A 1HSJA 4RJZA 1JP4A 3MP8A 4OENA 4PBQA 4UACA 3KOSA 1SD3A 4AB5A 3LSFB 2Q88A 4GWXA 2CEXA 4NF8A 1A8FA 2Z23A 1D3KA 4OWDA 3HN0A 3SEWA 1IMAA 4EUOA 1H45A 2IEEA 2ZZWA 4OHNA 2Q2CA 1N3WA 1NUXA 1QKBA 1RDYA 4PC9A 4ZE8A 3RQTA 5J16A 2UYEA 5IZ3A 3U92A 3IO6A 4NGUA 1NNKA 4HW8A 1SI1A 4Z7EA 5B7DA 4OVQA 2Z8DA 2HAVA 1OLCA 4KQPA 1YXIA 2Q9TA 1GR2A 4EXKA 2AYSA 2IA4A 1LGBC 4G4PA 1IUDA 2V93A 5CM6A 1TT1A 1POTA 1XHYA 4PFTA 2W7YA 2HZKA 3IORA 1OVTA 4P8BA 1AIVA 4QRZA 4BDMA 1AL3A 2DQVA 1YZ0A 1A99A 2O51A 4DCYA 4X9TA 1FTKA 5AA1A 4U1ZA 4ESWA 4F1YA 4ELRA 1MRPA 2O7UA 2L5VA 5EYHA 4EQBA 1MXYA 3TTMA 3KN8A 1O7TA 3VVDA 2O6AA 1BK4A 3R6UA 3IOTA 3TUSA 1QVSA 3KOTA 5CMKA 2A5TB 2CMOA 3PV0E 5CMCA 1IMDA 1B3LA 4THIA 1Y9UA 4F29A 3RTFB 4I3EA 4WEPA 4DI3D 4ZZAA 1LAHE 4JXIA 5EQ9A 4N91A 4HTGA 2RINA 4YB7A 1R9LA 1PBQA 2GHBA 4OTEA 1LSTA 5H8QB 2X7QA 2F6PA 3B6WA 3KSJA 2DVZA 3GYYA 3TQLA 4C0RA 4PE5B 1MXWA 5I2KA 4E0XA 4YB6A 3W9VA 2F3DA 3E9XA 4NF6A 4KCCA 3TDJA 3OMBA 1EZOA 3V89B 4R73A 5BUUA 1IXGA 4F1VA 3OENA 2V3TA 3TFLA 4ZEKA 1FRPA 4EF2A 2XXRA 3A3UA 1UTBB 3RTWB 2XX9A 4U2RA 4WXJA 2YLNA 3ODBA 4NQ8A 2XXQA 4YKIA 5TPAB 1N76A 4IO5A 2XWOA 4DI4B 3MW0A 4N6KA 5FHMA 1B7HA 1OQGA 1XS5A 3F11A 3Q29A 5JK4A 1NNTA 2F8DA 1GTKA 1FBCA 1QUKA 3KFMA 2V3QA 4U4XA 4P56A 5CBSA 1FPDA 1NL5A 2AIXA 4GL8A 1FPBA 4H6DA 4PETA 4P3LA 1I6BA 1NV2A 3MAMA 3MQ9A 3K6XA 2HQ0A 4ZS9A 1LAGE 4ZZEA 1D9VA 2I49A 3OD7A 3EPEA 2WYKA 2NUVA 4X8RA 1UTHA 4KD5A 1Q35A 3SETA 2FVZA 1B3EA 3MBPA 1FJ6A 1DK4A 4IR8A 1DPPA 3FATA 3LUYA 1FBGA 1DCUA 4FJPA 5I57B 4O3CA 1N84A 3MVZA 2O1MA 4MH5A 1FPEA 5ET8A 3RY3A 3MPKA 1QGXA 4LONB 4NWDA 3RPLA 1GVCA 2F5XA 4GL0A 4P9KA 3QUFA 1NV0A 3UN6A 3CR9A 4MLVA 2QSXA 5I56B 3KN3A 2GRVA 3FZVA 1NV4A 3TELA 3PPNA 3MWBA 4JVIA 2ZYOA 3S9EA 1BP5A 2B4LA 3V5AA 3TODA 4XIGQ 3TZAA 1AMFA 2V25A 4DXBA 3KBZA 1NFTA 2VPOA 4JSOA 2QRYA 3K01A 1D9QA 1MQDA 1YTVA 4NF4B 4O3AA 3IOWA 2DWJA 4ZEDA 4RK9A 3OO7A 4LATA 2Q89A 2F36A 3BBRA 4PFYA 3EF7A 1XVYA 2Y7KA 4MCOA 4XFEA 3K00A 4F18A 4FIMA 4GX4A 3PGFA 4FE8A 2XXXA 4EF1A 4C1UA 1FBHA 3HFUA 3PMWA 2OCUA 4OVJA 5FTIA 4E0WA 2UVIA 2D21A 1A8EA 1SW1A 2CEYA 1SI0A 3SEYA 4P47A 1P1WA 5TP9A 3O29A 2HXWA 3K6UA 4FATA 4GBVA 4F3BA 1SBPA 3MVXA 3HHGA 4GWOA 5AA2D 2XWVA 3MJNA 1LBBA 4OVTA 3K1NA 4H0WA 2O68A 4NX1A 1MH4A 2QMXA 1B40A 2XD3A 2ZYMA 4H67A 4ONYA 1I6QA 4AB6A 1MQGA 3MUQA 5K2XA 2ONRA 3T9XB
chains in the Genus database with same CATH topology
2F6GA 1NNPA 2VP1A 1Z7NE 3O9PA 3IB2A 1FQCA 4LP2B 4FAJA 2XXYA 3LBSA 3DM0A 1EZPA 4EQ9A 2DXYA 1M5EA 1B4HA 1NKXA 1DSNA 1US4A 3JZJA 3PD8A 3N26A 4GXSB 5DVJA 4LVQA 4AQ4A 1H44A 2WKYA 5H8HB 3FGSA 2QS1A 4F22A 5A5XB 4G68B 3IAZA 1A7LA 4R6HA 3T93B 3M3KA 3PUWE 4OQOA 4P11A 1DTZA 3QK6A 1P1NA 1ZLQA 3O6HA 1US5A 1VFEA 5L9MA 1LAXA 1O64A 3PUXE 5ICQA 1B6HA 4IY5A 3A3CA 3TPAA 1FTLA 4Z0IA 3K2DA 1ZBMA 4GVOA 2Z8FA 4G77A 3SDFA 1LCTA 4F3SA 1B4ZA 2OWSA 3QUJA 4LQ2A 3VXBA 2Q2AA 4LA9A 3HHFA 3CFZA 1B5JA 3CIJA 4DCXA 3KG2A 4LQ5A 5HPQA 3N6TA 4YMBA 3GXAA 3C36A 2GFEA 1MM6A 5CC2A 5CRYA 3DP6A 2QS3A 1AH5A 4MBPA 1MXXA 3SEUA 5AA2A 1USYE 3W9WA 2F34A 3Q25A 1IXIA 3MP6A 2REGA 3CI8A 4NWCA 1MXUA 4DXUA 4U21A 1B1HA 1LFGA 1II5A 3U94A 1PBPA 3G7WA 2VOZA 1IXHA 1JEUA 2V84A 1Y1MA 4I1DA 3K02A 4XKNA 2Y7RA 4KYDA 3U1OA 2R6GE 4DDDA 3BKIB 2ONKE 2E0SA 3PPRA 1N0TA 2P0SA 2PT1A 4RXLA 2DOJA 3U93A 5ITOA 4FECA 2PMSA 2Y84A 4YU0A 2I0CA 2ZMBA 1WDNA 4G8MA 3DLNA 4F3GA 2RCBA 1HSLA 3FV1A 1SYIA 1OLAA 1QKAA 1IEJA 3TYHA 5EHMA 3FXRA 1FTJA 4OESA 4NF5B 4ESXA 3FXUA 3MPLA 1XC1A 2PYYA 4R2FA 2XHDA 1XT8A 2I48A 5DYHA 5I58A 5HM4B 2HFBA 4HS7A 4ISUA 3PUYE 2QS4A 3KJ7A 1XVXA 3H06B 1NNFA 4LZ5A 5DVFA 3HCQA 4BDOA 5AA4B 2AL5A 3GBAA 1ZU0A 1H43A 1MY4A 2XXPA 2D5WA 5CMBA 4H65A 5FHOA 2XD2A 1B3FA 1B9JA 1N04A 1RKMA 1ZKBA 2PX1A 1LB9A 4Q30B 3IL1B 4R9FA 3MZ9A 3OELA 3OO9A 1B5HA 4MFIA 4IO3A 1IITA 1LLSA 4P0IA 3FUZA 5H8NB 3ZSFA 1N3XA 2H5YA 4M4GA 1B51A 1SW2A 3HSTA 1A55A 1JVYA 5JTYB 1D4NA 4GD5A 4R2BA 4RK2A 3UA8A 4IY6A 3TCFA 4ZECA 1Y4CA 4U1OA 2F7CA 2VD2A 2OK2A 3CG1A 3OEMA 3VVEA 2E1SA 3I5OA 1JW4A 1N7WA 3C4MA 1P99A 3O66A 3FJMA 3QIMA 3TTLA 4F2QA 1XOCA 3V8XB 3S9NC 4NTLA 4KI0E 1FW0A 3TKDA 4YMAA 4F31B 2FNCA 4F3PA 3T96B 3MC2A 4I8CA 1MY3A 1VR5A 4WKMA 3PMXA 2DWIA 2A5TA 4ZEIA 4TQUQ 1SDXA 2QL3A 4P0GA 4EQ7A 1QUJA 4QHQA 4JWYA 3O6IA 2P1SA 4RY1A 2GHAA 2V3UA 3IR1A 1CB6A 1P1QA 4DZ1A 3E4RA 2ALUA 5H8FB 3H6TA 3UORA 3LSXA 1P1OA 2XXWA 4RNSA 3RLFE 3GLBA 1BLFA 3TAJA 5H8QA 1DOTA 1FQDA 1B0LA 1Y3QA 3IJOB 1MH3A 1BKAA 3HPIA 5KZTA 4H1XA 3G3HA 4GFRA 3CSGA 4XKRA 1B58A 1Y4TA 3RN8A 3KEIA 1JW5A 3RT6B 3KSXA 1ZTYA 1UTBA 4L17A 5KCJB 4Q0CA 3TTKA 3FVOA 1AOVA 5TPAA 3RT8A 4RPNA 3H6UA 4RA1A 5I59B 5I84A 5I2NB 2YPNA 3T9UA 5M2VA 1UIVA 2XXHA 4ELQA 2PVUA 4OYVA 5JEIA 3RPWA 3SESA 3G3IA 1MQHA 1Y3PA 2H99A 3IX1A 3VDFA 4LZ8A 3IOVA 2PBWA 1R1NA 1YPNA 2UVGA 1LBCA 5BWJA 3I3VA 3DP4A 3P7IA 5ISUA 3L6GA 3B6TA 4X48A 3Q27A 1UQWA 1ATGA 3K6VA 1F9BA 1B7ZA 3CG3A 3SEXA 4BDNA 3SKPA 4MF3A 3O28A 4GF8A 3RNNA 2F7AA 5I57A 5F7VA 3O97A 3TCHA 3CFXA 3Q28A 2RF1A 4YKJA 4DXCA 4QFOA 4RYAA 2Z8EA 3D4GA 4ELOA 1BIYA 2OWTA 1DTGA 2O7IA 1MQJA 3MVYA 2NOOA 1LFIA 5L8DA 1JW1A 3IB1A 5ICTA 1URGA 3OXNA 3TQWA 1USYH 5I56A 5DEXB 4XKQA 2XXTA 3K6WA 2ZNUA 2Y7PA 3C33A 4IGTA 4QFLA 1JNFA 3O6GA 4G2ZA 1SQYA 2I4BA 5F1QA 4U4SA 1S50A 5FTHA 4FEDA 4TLMB 1HSEA 2DXRA 4R6KA 4NF4A 1M5DA 4GXAA 3ILUB 3S4UA 2CZLA 4X1BA 3K1MA 3E3KA 3ZS6A 1TWYA 1M5CA 3KN7A 1OMPA 3IK6B 4OFJA 4BDQA 2XXUA 4ZEBA 3R7XA 1O63A 3G3JA 2G29A 4OFOA 4I62A 2HZLA 2DVCA 2B3BA 4JSDA 4R74A 2I3VA 1PB7A 3MZ1A 1TFDA 3B6QA 5L9SA 4HCYA 3EN3A 1B5IA 3MZBA 1B3GA 3THIA 2OJTA 2FYIA 4OERA 3AXFA 4QFPA 2DE2A 3VLWA 3WAEA 4JBZA 3JV9A 1CE2A 1ZMGA 3C9HA 1IZ1A 2A5SA 4KFQA 1B05A 4NF8B 4OEUA 3PPPA 2ANJA 3U8QA 4R75A 1RYXA 4R9GA 4U22A 3FJGA 4HCWA 1TFAA 3OSRA 3H6WA 3QAXA 1A54A 3R26A 4OXVA 4JWXA 1B46A 1MY0A 3TMGA 1FQBA 2PT2A 1M5FA 3WAFA 3UK4A 3IJXB 3L6HA 4DIGA 4PFUA 2GH9A 5H8HA 5A5XA 4G68A 3H7MA 1FTOA 2REJA 2I6EA 3RUMA 3G3KA 1R6ZA 1Z7ME 1FTMA 1KWHA 1JEVA 3S9MC 2D3IA 4YKKA 1DMBA 2DS9A 4DLDA 3USDA 1SVXB 3TEPA 4U23A 1B2HA 1Q1KA 2ZXTA 3FIRA 3QSLA 3UP9A 5KDTB 3FASA 2RC9A 2I4CA 5K2YA 2XXVA 3VXCA 3UIFA 1RYOA 1OVBA 2H9BA 3G3GA 5FHNA 4N13A 4NE4A 3KJTA 1MY1A 3BFTA 4KYSA 4QSEA 1J1NA 3K0VA 4YB5A 2QJEA 2M8CA 1VSOA 2Y7WA 3FD3A 1N7XA 3N6UA 3CFLA 3GBBA 2DSFA 2X7PA 3IB0A 3U72A 3GZGA 5IKBA 3FXQA 3N5LA 4JDFA 3VLUA 2H98A 4XTCQ 4H8IA 1NH7A 2Q8JA 5IAIA 3H3GA 3OO8A 4LUBA 5HBCA 1S9TA 1B7UA 5I2KB 4C1TA 1EU8A 4NF6B 4OFLA 2UVHA 4JB7A 4QF9A 1MY2A 2DWHA 5KDTA 1MM7A 1UIUA 2X26A 4KCDA 2DE3A 2OZZA 1MG1A 4N07A 4XXUA 3QYTA 2Y7IA 5DT6A 4IO2A 4ZDMA 1LAFE 4ECFA 1PEBA 1D9YA 4NF5A 1H76A 3KGCA 3O2AA 3PPOA 4G8HA 1PDAA 3ECRA 3H4ZA 4MLQA 2KLFA 4POXA 2ABHA 1UTHB 1I69A 3JYRA 3CVGA 1IIWA 2I0BA 4JWOA 2OBGA 4YZZA 4H8JA 4M1VA 3ILTB 3MP1A 3E13X 5AA4A 5DTBA 2VGQA 1ELJA 4O3BA 2XX8A 2NWJA 4IO4A 3T9HB 4FORA 1NH8A 4EDPA 3H6VA 4OZ9A 1MDQA 5H8NA 3SERA 4UA8A 1DPEA 3EHSA 1FCKA 5JTYA 1Y1ZA 3UGWA 3OO6A 4GIZA 3TCGA 2HAUA 2F78A 5J1DA 2O69A 1VFDA 1TXFA 2VHAA 1ZJLA 1EH3A 1GGGA 3EQ1A 3OOAA 3H03A 2DE4A 4ELPA 3DELB 3EHUA 2ZNTA 3PUZE 4F1UA 2HEUA 3W15C 1NMUA 1MXVA 3PD9A 1WODA 1LB8A 1BTJA 2ZYNA 1FQEA 2F97A 1MPCA 2VD3A 1JETA 4IO6A 2QS2A 4GRKA 1MQIA 3M3FA 2THIA 2XX7A 1B1XA 1ANFA 1JVXA 1SW4A 4OMBA 1URSA 1Y3NA 4F39A 4LZ7A 2QPQA 3S2VA 4F19A 3FVKA 3T66A 5TP9B 3EHTA 5H8FA 3FV2A 3S9LC 4FEBA 1B3HA 2HCAA 2FA7A 4IGRA 4IO7A 4GOTA 1PB8A 4H5FA 3N94A 2RCAA 4R6YA 4N6PA 1A40A 1YAEA 4GLIA 2F7BA 4IB2A 4RPOA 4X1DA 3ZKKA 1R9QA 4WEDA 3V83A 4F2OA 3OEKA 4POWA 3PUVE 1MS7A 2G93A 4EXLA 4G68C 3M8UA 4PP0A 1POY1 3MVWA 4QSDA 1PC3A 1YCJA 4QFKA 4K3FA 3IO4A 2QMWA 5KCJA 1SW5A 3ZKLA 1WVJA 5EYFA 5L9OA 5I59A 3D4CA 5AA3A 5I2NA 3SEVA 1IQ7A 2BJJX 3C32A 4R72A 3I6VA 1SYHA 3KBRA 2NXOA 5B70A 2RC7A 2I3WA 3LR1A 5CBRA 5CI5A 3BFUA 4KPTA 5TU0A 2F35A 1IXCA 4PFWA 1P1UA 5LOMA 4YAHX 3Q26A 1MDP1 2P2AA 3DP8A 3LSWA 1URDA 4KYEA 4Q8RA 2DP8A 5CMMA 3T22A 4BLAA 2UXAA 4YICA 1QW0A 2H4IA 3IOUA 3A09A 1LFHA 4NEDA 4OEVA 2UVJA 3HV1A 4ND9A 2LAOA 4G8NA 4TOZA 4PQJA 3B7DA 1S7YA 2YJPA 4KR5A 2O1LA 3K1PA 1FQFA 4DE8A 4KHZE 2RC8A 4BDLA 3OSQA 4BDRA 1JQFA 5EHSA 1EZ9A 2R9JA 4Q5TA 3LSLA 2ZYKA 5AA2B 4ZEFA 2DWAA 1GV8A 5DEXA 2ONSA 3VLVA 1MPDA 4I9DA 1FQAA 1QULA 2B3FA 3VVFA 4TLLB 3FVGA 2ZNSA 1MXZA 1Y20A 3FVNA 3CSBA 1PB9A 2O84X 1ZIUA 4QFNA 3T9VA 5ITPA 3CRBA 1T0KA 1L5TA 5AE4A 1I6AA 1B32A 5H8SA 3LC8A 4NMYA 3ONMA 2R71A 4YKPA 3C34A 2B65A 4OETA 3VV5A 3PU5A 1MPBA 1QJMA 1B52A 2H25A 3PMVA 3PPQA 5DVIA 1OQHA 2RKMA 1H3DA 1VE4A 3VFJA 3HO7A 1OIBA 3K4UA 3RGYA 2XXIA 3TTNA 4XKPA 3VE1B 2UYFA 1B0HA 3QXMA 1LCFA 2DYXA 2I58A 3G3FA 3C31A 3FJ7A 2Z22A 4ZE9A 2AL4A 3TTRA 5I58B 5ELVA 3M3LA 2ESNA 3KZGA 2OLBA 4H5GA 4QSCA 1QUIA 1M5BA 4GQOA 2NVUB 3C35A 1HSJA 4RJZA 3MP8A 4OENA 4UACA 3KOSA 1SD3A 4AB5A 3LSFB 2Q88A 4NF8A 1A8FA 2Z23A 1D3KA 4OWDA 3HN0A 3SEWA 4EUOA 1H45A 2IEEA 4OHNA 2Q2CA 1N3WA 1QKBA 4ZE8A 3RQTA 2UYEA 3U92A 3IO6A 1NNKA 4HW8A 1SI1A 4Z7EA 5B7DA 2Z8DA 2HAVA 1OLCA 4KQPA 2Q9TA 1GR2A 4EXKA 2AYSA 2IA4A 1LGBC 4G4PA 1IUDA 2V93A 5CM6A 1TT1A 1POTA 1XHYA 4PFTA 2W7YA 2HZKA 3IORA 1OVTA 1AIVA 4QRZA 4BDMA 1AL3A 2DQVA 1A99A 2O51A 4DCYA 4X9TA 1FTKA 5AA1A 4U1ZA 4ESWA 4F1YA 4ELRA 1MRPA 2O7UA 4EQBA 1MXYA 3TTMA 3KN8A 1O7TA 3VVDA 2O6AA 3R6UA 3IOTA 3TUSA 1QVSA 3KOTA 5CMKA 2A5TB 2CMOA 3PV0E 5CMCA 1B3LA 4THIA 1Y9UA 4F29A 3RTFB 4WEPA 4ZZAA 1LAHE 4JXIA 4HTGA 2RINA 4YB7A 1R9LA 1PBQA 2GHBA 4OTEA 1LSTA 5H8QB 2X7QA 2F6PA 3B6WA 3KSJA 2DVZA 3TQLA 4C0RA 4PE5B 1MXWA 5I2KA 4E0XA 4YB6A 3W9VA 3E9XA 4NF6A 4KCCA 3TDJA 3OMBA 1EZOA 3V89B 4R73A 5BUUA 1IXGA 4F1VA 3OENA 2V3TA 3TFLA 4ZEKA 4EF2A 2XXRA 3A3UA 1UTBB 3RTWB 2XX9A 4U2RA 4WXJA 2YLNA 3ODBA 2XXQA 4YKIA 5TPAB 1N76A 4IO5A 3MW0A 5FHMA 1B7HA 1OQGA 1XS5A 3F11A 3Q29A 5JK4A 1NNTA 2F8DA 1GTKA 1QUKA 3KFMA 2V3QA 4U4XA 5CBSA 1NL5A 2AIXA 4GL8A 4H6DA 4PETA 1I6BA 3MAMA 3MQ9A 3K6XA 2HQ0A 4ZS9A 1LAGE 4ZZEA 1D9VA 2I49A 3OD7A 3EPEA 2NUVA 1UTHA 4KD5A 1Q35A 3SETA 1B3EA 3MBPA 1DPPA 3FATA 3LUYA 4FJPA 5I57B 4O3CA 1N84A 3MVZA 2O1MA 4MH5A 3RY3A 3MPKA 4LONB 4NWDA 1GVCA 2F5XA 4GL0A 3QUFA 3UN6A 3CR9A 4MLVA 2QSXA 5I56B 3KN3A 2GRVA 3FZVA 3TELA 3PPNA 3MWBA 2ZYOA 3S9EA 1BP5A 3V5AA 3TODA 4XIGQ 3TZAA 1AMFA 2V25A 4DXBA 1NFTA 4JSOA 2QRYA 3K01A 1MQDA 1YTVA 4NF4B 4O3AA 3IOWA 2DWJA 4ZEDA 4RK9A 3OO7A 4LATA 2Q89A 2F36A 3BBRA 4PFYA 3EF7A 1XVYA 2Y7KA 3K00A 4F18A 4FIMA 3PGFA 4FE8A 2XXXA 4EF1A 4C1UA 3PMWA 2OCUA 4OVJA 5FTIA 4E0WA 2UVIA 2D21A 1A8EA 1SW1A 1SI0A 3SEYA 1P1WA 5TP9A 3O29A 2HXWA 3K6UA 4FATA 4F3BA 1SBPA 3MVXA 3HHGA 4GWOA 5AA2D 3MJNA 1LBBA 3K1NA 4H0WA 2O68A 1MH4A 2QMXA 1B40A 2XD3A 2ZYMA 4H67A 4ONYA 1I6QA 4AB6A 1MQGA 3MUQA 5K2XA 2ONRA 3T9XB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F6G A;  1NNP A;  2VP1 A;  1Z7N E;  3O9P A;  3IB2 A;  1FQC A;  4LP2 B;  4FAJ A;  2XXY A;  3LBS A;  3DM0 A;  1EZP A;  4EQ9 A;  2DXY A;  1M5E A;  1B4H A;  1NKX A;  1DSN A;  1US4 A;  3JZJ A;  3PD8 A;  3N26 A;  4GXS B;  5DVJ A;  4LVQ A;  4AQ4 A;  1H44 A;  2WKY A;  5H8H B;  3FGS A;  2QS1 A;  4F22 A;  5A5X B;  4G68 B;  3IAZ A;  1A7L A;  4R6H A;  3T93 B;  3M3K A;  3PUW E;  4OQO A;  4P11 A;  1DTZ A;  3QK6 A;  1P1N A;  1ZLQ A;  3O6H A;  1US5 A;  1VFE A;  5L9M A;  1LAX A;  1O64 A;  3PUX E;  5ICQ A;  1B6H A;  4IY5 A;  3A3C A;  3TPA A;  1FTL A;  4Z0I A;  3K2D A;  1ZBM A;  4GVO A;  2Z8F A;  4G77 A;  3SDF A;  1LCT A;  4F3S A;  1B4Z A;  2OWS A;  3QUJ A;  4LQ2 A;  3VXB A;  2Q2A A;  4LA9 A;  3HHF A;  3CFZ A;  1B5J A;  3CIJ A;  4DCX A;  3KG2 A;  4LQ5 A;  5HPQ A;  3N6T A;  4YMB A;  3GXA A;  3C36 A;  2GFE A;  1MM6 A;  5CC2 A;  5CRY A;  3DP6 A;  2QS3 A;  1AH5 A;  4MBP A;  1MXX A;  3SEU A;  5AA2 A;  1USY E;  3W9W A;  2F34 A;  3Q25 A;  1IXI A;  3MP6 A;  2REG A;  3CI8 A;  4NWC A;  1MXU A;  4DXU A;  4U21 A;  1B1H A;  1LFG A;  1II5 A;  3U94 A;  1PBP A;  3G7W A;  2VOZ A;  1IXH A;  1JEU A;  2V84 A;  1Y1M A;  4I1D A;  3K02 A;  4XKN A;  2Y7R A;  4KYD A;  3U1O A;  2R6G E;  4DDD A;  3BKI B;  2ONK E;  2E0S A;  3PPR A;  1N0T A;  2P0S A;  2PT1 A;  4RXL A;  2DOJ A;  3U93 A;  5ITO A;  4FEC A;  2PMS A;  2Y84 A;  4YU0 A;  2I0C A;  2ZMB A;  1WDN A;  4G8M A;  3DLN A;  4F3G A;  2RCB A;  1HSL A;  3FV1 A;  1SYI A;  1OLA A;  1QKA A;  1IEJ A;  3TYH A;  5EHM A;  3FXR A;  1FTJ A;  4OES A;  4NF5 B;  4ESX A;  3FXU A;  3MPL A;  1XC1 A;  2PYY A;  4R2F A;  2XHD A;  1XT8 A;  2I48 A;  5DYH A;  5I58 A;  5HM4 B;  2HFB A;  4HS7 A;  4ISU A;  3PUY E;  2QS4 A;  3KJ7 A;  1XVX A;  3H06 B;  1NNF A;  4LZ5 A;  5DVF A;  3HCQ A;  4BDO A;  5AA4 B;  2AL5 A;  3GBA A;  1ZU0 A;  1H43 A;  1MY4 A;  2XXP A;  2D5W A;  5CMB A;  4H65 A;  5FHO A;  2XD2 A;  1B3F A;  1B9J A;  1N04 A;  1RKM A;  1ZKB A;  2PX1 A;  1LB9 A;  4Q30 B;  3IL1 B;  4R9F A;  3MZ9 A;  3OEL A;  3OO9 A;  1B5H A;  4MFI A;  4IO3 A;  1IIT A;  1LLS A;  4P0I A;  3FUZ A;  5H8N B;  3ZSF A;  1N3X A;  2H5Y A;  4M4G A;  1B51 A;  1SW2 A;  3HST A;  1A55 A;  1JVY A;  5JTY B;  1D4N A;  4GD5 A;  4R2B A;  4RK2 A;  3UA8 A;  4IY6 A;  3TCF A;  4ZEC A;  1Y4C A;  4U1O A;  2F7C A;  2VD2 A;  2OK2 A;  3CG1 A;  3OEM A;  3VVE A;  2E1S A;  3I5O A;  1JW4 A;  1N7W A;  3C4M A;  1P99 A;  3O66 A;  3FJM A;  3QIM A;  3TTL A;  4F2Q A;  1XOC A;  3V8X B;  3S9N C;  4NTL A;  4KI0 E;  1FW0 A;  3TKD A;  4YMA A;  4F31 B;  2FNC A;  4F3P A;  3T96 B;  3MC2 A;  4I8C A;  1MY3 A;  1VR5 A;  4WKM A;  3PMX A;  2DWI A;  2A5T A;  4ZEI A;  4TQU Q;  1SDX A;  2QL3 A;  4P0G A;  4EQ7 A;  1QUJ A;  4QHQ A;  4JWY A;  3O6I A;  2P1S A;  4RY1 A;  2GHA A;  2V3U A;  3IR1 A;  1CB6 A;  1P1Q A;  4DZ1 A;  3E4R A;  2ALU A;  5H8F B;  3H6T A;  3UOR A;  3LSX A;  1P1O A;  2XXW A;  4RNS A;  3RLF E;  3GLB A;  1BLF A;  3TAJ A;  5H8Q A;  1DOT A;  1FQD A;  1B0L A;  1Y3Q A;  3IJO B;  1MH3 A;  1BKA A;  3HPI A;  5KZT A;  4H1X A;  3G3H A;  4GFR A;  3CSG A;  4XKR A;  1B58 A;  1Y4T A;  3RN8 A;  3KEI A;  1JW5 A;  3RT6 B;  3KSX A;  1ZTY A;  1UTB A;  4L17 A;  5KCJ B;  4Q0C A;  3TTK A;  3FVO A;  1AOV A;  5TPA A;  3RT8 A;  4RPN A;  3H6U A;  4RA1 A;  5I59 B;  5I84 A;  5I2N B;  2YPN A;  3T9U A;  5M2V A;  1UIV A;  2XXH A;  4ELQ A;  2PVU A;  4OYV A;  5JEI A;  3RPW A;  3SES A;  3G3I A;  1MQH A;  1Y3P A;  2H99 A;  3IX1 A;  3VDF A;  4LZ8 A;  3IOV A;  2PBW A;  1R1N A;  1YPN A;  2UVG A;  1LBC A;  5BWJ A;  3I3V A;  3DP4 A;  3P7I A;  5ISU A;  3L6G A;  3B6T A;  4X48 A;  3Q27 A;  1UQW A;  1ATG A;  3K6V A;  1F9B A;  1B7Z A;  3CG3 A;  3SEX A;  4BDN A;  3SKP A;  4MF3 A;  3O28 A;  4GF8 A;  3RNN A;  2F7A A;  5I57 A;  5F7V A;  3O97 A;  3TCH A;  3CFX A;  3Q28 A;  2RF1 A;  4YKJ A;  4DXC A;  4QFO A;  4RYA A;  2Z8E A;  3D4G A;  4ELO A;  1BIY A;  2OWT A;  1DTG A;  2O7I A;  1MQJ A;  3MVY A;  2NOO A;  1LFI A;  5L8D A;  1JW1 A;  3IB1 A;  5ICT A;  1URG A;  3OXN A;  3TQW A;  1USY H;  5I56 A;  5DEX B;  4XKQ A;  2XXT A;  3K6W A;  2ZNU A;  2Y7P A;  3C33 A;  4IGT A;  4QFL A;  1JNF A;  3O6G A;  4G2Z A;  1SQY A;  2I4B A;  5F1Q A;  4U4S A;  1S50 A;  5FTH A;  4FED A;  4TLM B;  1HSE A;  2DXR A;  4R6K A;  4NF4 A;  1M5D A;  4GXA A;  3ILU B;  3S4U A;  2CZL A;  4X1B A;  3K1M A;  3E3K A;  3ZS6 A;  1TWY A;  1M5C A;  3KN7 A;  1OMP A;  3IK6 B;  4OFJ A;  4BDQ A;  2XXU A;  4ZEB A;  3R7X A;  1O63 A;  3G3J A;  2G29 A;  4OFO A;  4I62 A;  2HZL A;  2DVC A;  2B3B A;  4JSD A;  4R74 A;  2I3V A;  1PB7 A;  3MZ1 A;  1TFD A;  3B6Q A;  5L9S A;  4HCY A;  3EN3 A;  1B5I A;  3MZB A;  1B3G A;  3THI A;  2OJT A;  2FYI A;  4OER A;  3AXF A;  4QFP A;  2DE2 A;  3VLW A;  3WAE A;  4JBZ A;  3JV9 A;  1CE2 A;  1ZMG A;  3C9H A;  1IZ1 A;  2A5S A;  4KFQ A;  1B05 A;  4NF8 B;  4OEU A;  3PPP A;  2ANJ A;  3U8Q A;  4R75 A;  1RYX A;  4R9G A;  4U22 A;  3FJG A;  4HCW A;  1TFA A;  3OSR A;  3H6W A;  3QAX A;  1A54 A;  3R26 A;  4OXV A;  4JWX A;  1B46 A;  1MY0 A;  3TMG A;  1FQB A;  2PT2 A;  1M5F A;  3WAF A;  3UK4 A;  3IJX B;  3L6H A;  4DIG A;  4PFU A;  2GH9 A;  5H8H A;  5A5X A;  4G68 A;  3H7M A;  1FTO A;  2REJ A;  2I6E A;  3RUM A;  3G3K A;  1R6Z A;  1Z7M E;  1FTM A;  1KWH A;  1JEV A;  3S9M C;  2D3I A;  4YKK A;  1DMB A;  2DS9 A;  4DLD A;  3USD A;  1SVX B;  3TEP A;  4U23 A;  1B2H A;  1Q1K A;  2ZXT A;  3FIR A;  3QSL A;  3UP9 A;  5KDT B;  3FAS A;  2RC9 A;  2I4C A;  5K2Y A;  2XXV A;  3VXC A;  3UIF A;  1RYO A;  1OVB A;  2H9B A;  3G3G A;  5FHN A;  4N13 A;  4NE4 A;  3KJT A;  1MY1 A;  3BFT A;  4KYS A;  4QSE A;  1J1N A;  3K0V A;  4YB5 A;  2QJE A;  2M8C A;  1VSO A;  2Y7W A;  3FD3 A;  1N7X A;  3N6U A;  3CFL A;  3GBB A;  2DSF A;  2X7P A;  3IB0 A;  3U72 A;  3GZG A;  5IKB A;  3FXQ A;  3N5L A;  4JDF A;  3VLU A;  2H98 A;  4XTC Q;  4H8I A;  1NH7 A;  2Q8J A;  5IAI A;  3H3G A;  3OO8 A;  4LUB A;  5HBC A;  1S9T A;  1B7U A;  5I2K B;  4C1T A;  1EU8 A;  4NF6 B;  4OFL A;  2UVH A;  4JB7 A;  4QF9 A;  1MY2 A;  2DWH A;  5KDT A;  1MM7 A;  1UIU A;  2X26 A;  4KCD A;  2DE3 A;  2OZZ A;  1MG1 A;  4N07 A;  4XXU A;  3QYT A;  2Y7I A;  5DT6 A;  4IO2 A;  4ZDM A;  1LAF E;  4ECF A;  1PEB A;  1D9Y A;  4NF5 A;  1H76 A;  3KGC A;  3O2A A;  3PPO A;  4G8H A;  1PDA A;  3ECR A;  3H4Z A;  4MLQ A;  2KLF A;  4POX A;  2ABH A;  1UTH B;  1I69 A;  3JYR A;  3CVG A;  1IIW A;  2I0B A;  4JWO A;  2OBG A;  4YZZ A;  4H8J A;  4M1V A;  3ILT B;  3MP1 A;  3E13 X;  5AA4 A;  5DTB A;  2VGQ A;  1ELJ A;  4O3B A;  2XX8 A;  2NWJ A;  4IO4 A;  3T9H B;  4FOR A;  1NH8 A;  4EDP A;  3H6V A;  4OZ9 A;  1MDQ A;  5H8N A;  3SER A;  4UA8 A;  1DPE A;  3EHS A;  1FCK A;  5JTY A;  1Y1Z A;  3UGW A;  3OO6 A;  4GIZ A;  3TCG A;  2HAU A;  2F78 A;  5J1D A;  2O69 A;  1VFD A;  1TXF A;  2VHA A;  1ZJL A;  1EH3 A;  1GGG A;  3EQ1 A;  3OOA A;  3H03 A;  2DE4 A;  4ELP A;  3DEL B;  3EHU A;  2ZNT A;  3PUZ E;  4F1U A;  2HEU A;  3W15 C;  1NMU A;  1MXV A;  3PD9 A;  1WOD A;  1LB8 A;  1BTJ A;  2ZYN A;  1FQE A;  2F97 A;  1MPC A;  2VD3 A;  1JET A;  4IO6 A;  2QS2 A;  4GRK A;  1MQI A;  3M3F A;  2THI A;  2XX7 A;  1B1X A;  1ANF A;  1JVX A;  1SW4 A;  4OMB A;  1URS A;  1Y3N A;  4F39 A;  4LZ7 A;  2QPQ A;  3S2V A;  4F19 A;  3FVK A;  3T66 A;  5TP9 B;  3EHT A;  5H8F A;  3FV2 A;  3S9L C;  4FEB A;  1B3H A;  2HCA A;  2FA7 A;  4IGR A;  4IO7 A;  4GOT A;  1PB8 A;  4H5F A;  3N94 A;  2RCA A;  4R6Y A;  4N6P A;  1A40 A;  1YAE A;  4GLI A;  2F7B A;  4IB2 A;  4RPO A;  4X1D A;  3ZKK A;  1R9Q A;  4WED A;  3V83 A;  4F2O A;  3OEK A;  4POW A;  3PUV E;  1MS7 A;  2G93 A;  4EXL A;  4G68 C;  3M8U A;  4PP0 A;  1POY 1;  3MVW A;  4QSD A;  1PC3 A;  1YCJ A;  4QFK A;  4K3F A;  3IO4 A;  2QMW A;  5KCJ A;  1SW5 A;  3ZKL A;  1WVJ A;  5EYF A;  5L9O A;  5I59 A;  3D4C A;  5AA3 A;  5I2N A;  3SEV A;  1IQ7 A;  2BJJ X;  3C32 A;  4R72 A;  3I6V A;  1SYH A;  3KBR A;  2NXO A;  5B70 A;  2RC7 A;  2I3W A;  3LR1 A;  5CBR A;  5CI5 A;  3BFU A;  4KPT A;  5TU0 A;  2F35 A;  1IXC A;  4PFW A;  1P1U A;  5LOM A;  4YAH X;  3Q26 A;  1MDP 1;  2P2A A;  3DP8 A;  3LSW A;  1URD A;  4KYE A;  4Q8R A;  2DP8 A;  5CMM A;  3T22 A;  4BLA A;  2UXA A;  4YIC A;  1QW0 A;  2H4I A;  3IOU A;  3A09 A;  1LFH A;  4NED A;  4OEV A;  2UVJ A;  3HV1 A;  4ND9 A;  2LAO A;  4G8N A;  4TOZ A;  4PQJ A;  3B7D A;  1S7Y A;  2YJP A;  4KR5 A;  2O1L A;  3K1P A;  1FQF A;  4DE8 A;  4KHZ E;  2RC8 A;  4BDL A;  3OSQ A;  4BDR A;  1JQF A;  5EHS A;  1EZ9 A;  2R9J A;  4Q5T A;  3LSL A;  2ZYK A;  5AA2 B;  4ZEF A;  2DWA A;  1GV8 A;  5DEX A;  2ONS A;  3VLV A;  1MPD A;  4I9D A;  1FQA A;  1QUL A;  2B3F A;  3VVF A;  4TLL B;  3FVG A;  2ZNS A;  1MXZ A;  1Y20 A;  3FVN A;  3CSB A;  1PB9 A;  2O84 X;  1ZIU A;  4QFN A;  3T9V A;  5ITP A;  3CRB A;  1T0K A;  1L5T A;  5AE4 A;  1I6A A;  1B32 A;  5H8S A;  3LC8 A;  4NMY A;  3ONM A;  2R71 A;  4YKP A;  3C34 A;  2B65 A;  4OET A;  3VV5 A;  3PU5 A;  1MPB A;  1QJM A;  1B52 A;  2H25 A;  3PMV A;  3PPQ A;  5DVI A;  1OQH A;  2RKM A;  1H3D A;  1VE4 A;  3VFJ A;  3HO7 A;  1OIB A;  3K4U A;  3RGY A;  2XXI A;  3TTN A;  4XKP A;  3VE1 B;  2UYF A;  1B0H A;  3QXM A;  1LCF A;  2DYX A;  2I58 A;  3G3F A;  3C31 A;  3FJ7 A;  2Z22 A;  4ZE9 A;  2AL4 A;  3TTR A;  5I58 B;  5ELV A;  3M3L A;  2ESN A;  3KZG A;  2OLB A;  4H5G A;  4QSC A;  1QUI A;  1M5B A;  4GQO A;  2NVU B;  3C35 A;  1HSJ A;  4RJZ A;  3MP8 A;  4OEN A;  4UAC A;  3KOS A;  1SD3 A;  4AB5 A;  3LSF B;  2Q88 A;  4NF8 A;  1A8F A;  2Z23 A;  1D3K A;  4OWD A;  3HN0 A;  3SEW A;  4EUO A;  1H45 A;  2IEE A;  4OHN A;  2Q2C A;  1N3W A;  1QKB A;  4ZE8 A;  3RQT A;  2UYE A;  3U92 A;  3IO6 A;  1NNK A;  4HW8 A;  1SI1 A;  4Z7E A;  5B7D A;  2Z8D A;  2HAV A;  1OLC A;  4KQP A;  2Q9T A;  1GR2 A;  4EXK A;  2AYS A;  2IA4 A;  1LGB C;  4G4P A;  1IUD A;  2V93 A;  5CM6 A;  1TT1 A;  1POT A;  1XHY A;  4PFT A;  2W7Y A;  2HZK A;  3IOR A;  1OVT A;  1AIV A;  4QRZ A;  4BDM A;  1AL3 A;  2DQV A;  1A99 A;  2O51 A;  4DCY A;  4X9T A;  1FTK A;  5AA1 A;  4U1Z A;  4ESW A;  4F1Y A;  4ELR A;  1MRP A;  2O7U A;  4EQB A;  1MXY A;  3TTM A;  3KN8 A;  1O7T A;  3VVD A;  2O6A A;  3R6U A;  3IOT A;  3TUS A;  1QVS A;  3KOT A;  5CMK A;  2A5T B;  2CMO A;  3PV0 E;  5CMC A;  1B3L A;  4THI A;  1Y9U A;  4F29 A;  3RTF B;  4WEP A;  4ZZA A;  1LAH E;  4JXI A;  4HTG A;  2RIN A;  4YB7 A;  1R9L A;  1PBQ A;  2GHB A;  4OTE A;  1LST A;  5H8Q B;  2X7Q A;  2F6P A;  3B6W A;  3KSJ A;  2DVZ A;  3TQL A;  4C0R A;  4PE5 B;  1MXW A;  5I2K A;  4E0X A;  4YB6 A;  3W9V A;  3E9X A;  4NF6 A;  4KCC A;  3TDJ A;  3OMB A;  1EZO A;  3V89 B;  4R73 A;  5BUU A;  1IXG A;  4F1V A;  3OEN A;  2V3T A;  3TFL A;  4ZEK A;  4EF2 A;  2XXR A;  3A3U A;  1UTB B;  3RTW B;  2XX9 A;  4U2R A;  4WXJ A;  2YLN A;  3ODB A;  2XXQ A;  4YKI A;  5TPA B;  1N76 A;  4IO5 A;  3MW0 A;  5FHM A;  1B7H A;  1OQG A;  1XS5 A;  3F11 A;  3Q29 A;  5JK4 A;  1NNT A;  2F8D A;  1GTK A;  1QUK A;  3KFM A;  2V3Q A;  4U4X A;  5CBS A;  1NL5 A;  2AIX A;  4GL8 A;  4H6D A;  4PET A;  1I6B A;  3MAM A;  3MQ9 A;  3K6X A;  2HQ0 A;  4ZS9 A;  1LAG E;  4ZZE A;  1D9V A;  2I49 A;  3OD7 A;  3EPE A;  2NUV A;  1UTH A;  4KD5 A;  1Q35 A;  3SET A;  1B3E A;  3MBP A;  1DPP A;  3FAT A;  3LUY A;  4FJP A;  5I57 B;  4O3C A;  1N84 A;  3MVZ A;  2O1M A;  4MH5 A;  3RY3 A;  3MPK A;  4LON B;  4NWD A;  1GVC A;  2F5X A;  4GL0 A;  3QUF A;  3UN6 A;  3CR9 A;  4MLV A;  2QSX A;  5I56 B;  3KN3 A;  2GRV A;  3FZV A;  3TEL A;  3PPN A;  3MWB A;  2ZYO A;  3S9E A;  1BP5 A;  3V5A A;  3TOD A;  4XIG Q;  3TZA A;  1AMF A;  2V25 A;  4DXB A;  1NFT A;  4JSO A;  2QRY A;  3K01 A;  1MQD A;  1YTV A;  4NF4 B;  4O3A A;  3IOW A;  2DWJ A;  4ZED A;  4RK9 A;  3OO7 A;  4LAT A;  2Q89 A;  2F36 A;  3BBR A;  4PFY A;  3EF7 A;  1XVY A;  2Y7K A;  3K00 A;  4F18 A;  4FIM A;  3PGF A;  4FE8 A;  2XXX A;  4EF1 A;  4C1U A;  3PMW A;  2OCU A;  4OVJ A;  5FTI A;  4E0W A;  2UVI A;  2D21 A;  1A8E A;  1SW1 A;  1SI0 A;  3SEY A;  1P1W A;  5TP9 A;  3O29 A;  2HXW A;  3K6U A;  4FAT A;  4F3B A;  1SBP A;  3MVX A;  3HHG A;  4GWO A;  5AA2 D;  3MJN A;  1LBB A;  3K1N A;  4H0W A;  2O68 A;  1MH4 A;  2QMX A;  1B40 A;  2XD3 A;  2ZYM A;  4H67 A;  4ONY A;  1I6Q A;  4AB6 A;  1MQG A;  3MUQ A;  5K2X A;  2ONR A;  3T9X B; 
#chains in the Genus database with same CATH topology
 1FPF A;  2F6G A;  1NNP A;  2VP1 A;  1Z7N E;  3O9P A;  3IB2 A;  3E79 A;  1FQC A;  4LP2 B;  4FAJ A;  2XXY A;  3LBS A;  3DM0 A;  1EZP A;  4EQ9 A;  2DXY A;  1M5E A;  1B4H A;  1NKX A;  1DSN A;  1US4 A;  3JZJ A;  3PD8 A;  3N26 A;  1FBE A;  4GXS B;  5DVJ A;  4LVQ A;  5DW8 A;  4GWS A;  4AQ4 A;  1H44 A;  2WKY A;  5H8H B;  3FGS A;  2QS1 A;  3IFA A;  4F22 A;  5A5X B;  4G68 B;  3IAZ A;  1A7L A;  4R6H A;  3T93 B;  3M3K A;  1NV3 A;  3PUW E;  4OQO A;  4P11 A;  1DTZ A;  3QK6 A;  1P1N A;  1ZLQ A;  3O6H A;  1US5 A;  1VFE A;  1FPJ A;  1LAX A;  1O64 A;  5L9M A;  3PUX E;  4PAK A;  5ICQ A;  1B6H A;  4IY5 A;  3A3C A;  3TPA A;  1FTL A;  4Z0I A;  4HE2 A;  2V4C A;  1LBW A;  3K2D A;  1ZBM A;  4GVO A;  2Z8F A;  4G77 A;  4OVR A;  3SDF A;  1LCT A;  4F3S A;  1B4Z A;  2OWS A;  3QUJ A;  1NUY A;  4LQ2 A;  3VXB A;  2Q2A A;  4LA9 A;  4MIJ A;  3HHF A;  5ET7 A;  3CFZ A;  1B5J A;  3CIJ A;  4DCX A;  3KG2 A;  4LQ5 A;  5HPQ A;  3N6T A;  2XWI A;  4YMB A;  3GXA A;  3C36 A;  2GFE A;  1MM6 A;  4HXV A;  5CC2 A;  5CRY A;  3DP6 A;  2QS3 A;  1AH5 A;  4MBP A;  1K9Z A;  1MXX A;  3SEU A;  4N6D A;  5AA2 A;  1USY E;  3W9W A;  2F34 A;  3Q25 A;  1IXI A;  3MP6 A;  4I40 A;  2REG A;  3CI8 A;  4NWC A;  2ZZX A;  1MXU A;  4DXU A;  4U21 A;  1B1H A;  1LFG A;  1II5 A;  3U94 A;  1PBP A;  3G7W A;  2VOZ A;  1IXH A;  1JEU A;  5I7I A;  2V84 A;  1Y1M A;  4FBP A;  4I1D A;  3K02 A;  4XKN A;  2Y7R A;  4KYD A;  4PAI A;  1FPL A;  3U1O A;  2R6G E;  4DDD A;  3BKI B;  2ONK E;  2E0S A;  3PPR A;  1N0T A;  2P0S A;  2PT1 A;  4RXL A;  2DOJ A;  3U93 A;  4N8Y A;  5ITO A;  4FEC A;  2PMS A;  2Y84 A;  4YU0 A;  2I0C A;  2ZMB A;  4NN3 A;  1WDN A;  2B4M A;  4G8M A;  3DLN A;  4F3G A;  2RCB A;  1HSL A;  3FV1 A;  1SYI A;  1OLA A;  1QKA A;  1IEJ A;  5LDZ A;  3TYH A;  5EHM A;  3FXR A;  1FTJ A;  4OES A;  4NF5 B;  4ESX A;  3FXU A;  5ET6 A;  3MPL A;  1XC1 A;  2PYY A;  4R2F A;  2XHD A;  1XT8 A;  2I48 A;  5DYH A;  5I58 A;  2HXR A;  5HM4 B;  2HFB A;  4HS7 A;  4ISU A;  3PUY E;  2QS4 A;  3KJ7 A;  1XVX A;  3H06 B;  1NNF A;  4LZ5 A;  5DVF A;  3HCQ A;  4BDO A;  5AA4 B;  2AL5 A;  3GBA A;  1ZU0 A;  1H43 A;  2VPN A;  1MY4 A;  2XXP A;  2D5W A;  5CMB A;  4H65 A;  1INP A;  5FHO A;  2XD2 A;  1B3F A;  1B9J A;  1N04 A;  1RKM A;  1ZKB A;  2PX1 A;  1LB9 A;  4Q30 B;  4GX6 A;  3IL1 B;  4R9F A;  3MZ9 A;  3OEL A;  3OO9 A;  1B5H A;  4MFI A;  4IO3 A;  1FPG A;  1IIT A;  1LLS A;  4P0I A;  3FUZ A;  5H8N B;  3ZSF A;  4PFI A;  1NI9 A;  1N3X A;  2H5Y A;  3FXB A;  4M4G A;  1B51 A;  1SW2 A;  3HST A;  1A55 A;  1JVY A;  5JTY B;  1D4N A;  4GD5 A;  4R2B A;  2QVU A;  4RK2 A;  3UA8 A;  4IY6 A;  4OA4 A;  3TCF A;  4ZEC A;  4GBW A;  1Y4C A;  4XEQ A;  5ESY A;  4U1O A;  2F7C A;  1FPK A;  2VD2 A;  2OK2 A;  3CG1 A;  3OEM A;  3VVE A;  1EYI A;  4MAG A;  2E1S A;  3I5O A;  3ISP A;  2WX9 A;  1JW4 A;  1N7W A;  4XF5 A;  3C4M A;  1P99 A;  3O66 A;  1FJ9 A;  3CHG A;  3FJM A;  3QIM A;  3TTL A;  4F2Q A;  1XOC A;  3V8X B;  3SZP A;  3S9N C;  4PBH A;  4NTL A;  4KI0 E;  1FW0 A;  3TKD A;  4YMA A;  5LTC A;  2DDK A;  2PFY A;  4F31 B;  2FNC A;  2R8T A;  4F3P A;  3T96 B;  3MC2 A;  4I8C A;  1MY3 A;  1VR5 A;  4G61 A;  4WKM A;  5EYG A;  2CZK A;  5F24 A;  1G0I A;  5EQA A;  3PMX A;  2DWI A;  2A5T A;  4PF8 A;  4ZEI A;  4TQU Q;  1SDX A;  2QL3 A;  4P0G A;  4EQ7 A;  1QUJ A;  4QHQ A;  4JWY A;  1G0H A;  3O6I A;  2P1S A;  4RY1 A;  2GHA A;  2V3U A;  2F3B A;  3IR1 A;  1CB6 A;  1P1Q A;  3E4R A;  2ALU A;  5H8F B;  4DZ1 A;  3H6T A;  3UOR A;  3LSX A;  1P1O A;  2PCR A;  2XXW A;  4RNS A;  4JVC A;  2XXK A;  3RLF E;  3GLB A;  1BLF A;  3TAJ A;  4QBA A;  1IMC A;  5H8Q A;  1DOT A;  1FQD A;  1B0L A;  1Y3Q A;  4H46 A;  3IJO B;  1MH3 A;  4N81 A;  1BKA A;  3HPI A;  2Q8M A;  5KZT A;  4H1X A;  3G3H A;  4GFR A;  3A29 A;  3CSG A;  4XKR A;  1B58 A;  1Y4T A;  3RN8 A;  3KEI A;  1JW5 A;  3RT6 B;  3KSX A;  1ZTY A;  4NAP A;  1UTB A;  4L17 A;  1K9Y A;  5KCJ B;  4PE3 A;  4Q0C A;  3TTK A;  3FVO A;  1AOV A;  5TPA A;  3RT8 A;  4RPN A;  3H6U A;  4RA1 A;  5I59 B;  4MNI A;  5I84 A;  2JJK A;  5I2N B;  2YPN A;  3T9U A;  4MHF A;  3BIG A;  5M2V A;  1UIV A;  2XXH A;  4ELQ A;  3LV0 A;  2PVU A;  4OYV A;  5JEI A;  1Q9D A;  3RPW A;  3SES A;  3G3I A;  1MQH A;  2FIX A;  1Y3P A;  1KA0 A;  2H99 A;  3IX1 A;  3VDF A;  4LZ8 A;  1LBY A;  3IOV A;  2PBW A;  1R1N A;  1NUW A;  1YPN A;  2UVG A;  1LBC A;  5BWJ A;  4GWZ A;  3I3V A;  3DP4 A;  3E78 A;  3P7I A;  5ISU A;  3L6G A;  4QXD A;  3B6T A;  4X48 A;  3Q27 A;  4HE1 A;  1UQW A;  1ATG A;  4GWW A;  3K6V A;  1F9B A;  1B7Z A;  3CG3 A;  1RDX A;  4N17 A;  3SEX A;  2WEF A;  4BDN A;  3SKP A;  1IME A;  4MF3 A;  3O28 A;  4GF8 A;  3RNN A;  2F7A A;  5I57 A;  5F7V A;  3O97 A;  3TCH A;  3CFX A;  3QMF A;  2KR0 A;  3Q28 A;  2RF1 A;  4YKJ A;  4DXC A;  4QFO A;  4RYA A;  2Z8E A;  3D4G A;  4ELO A;  1BIY A;  2OWT A;  1DTG A;  2O7I A;  1MQJ A;  3MVY A;  2NOO A;  1LFI A;  5L8D A;  1JW1 A;  3IB1 A;  5ICT A;  1URG A;  4OVP A;  3OXN A;  3TQW A;  1USY H;  5I56 A;  4N15 A;  5DEX B;  4XKQ A;  2XXT A;  3K6W A;  2ZNU A;  4GWU A;  2Y7P A;  3C33 A;  4IGT A;  4QFL A;  1JNF A;  1FTA A;  3LUZ A;  1FSA A;  3O6G A;  4G2Z A;  1SQY A;  2I4B A;  5F1Q A;  4U4S A;  1S50 A;  5FTH A;  4FED A;  2KQZ A;  4TLM B;  1HSE A;  4O7I A;  5IM2 A;  2DXR A;  5IZZ A;  2QFL A;  3KC0 A;  4R6K A;  4N8G A;  4NF4 A;  1M5D A;  4GXA A;  3ILU B;  3S4U A;  2CZL A;  4X1B A;  3K1M A;  3E3K A;  3ZS6 A;  1TWY A;  1M5C A;  3KN7 A;  1OMP A;  3IK6 B;  4JVD A;  4OFJ A;  4MX6 A;  4BDQ A;  4KXP A;  1SPI A;  1NV5 A;  2XXU A;  4ZEB A;  3R7X A;  1O63 A;  3G3J A;  2G29 A;  4OFO A;  4I62 A;  2HZL A;  2DVC A;  2B3B A;  4JSD A;  4R74 A;  2I3V A;  1PB7 A;  3MZ1 A;  3BIH A;  2PFZ A;  1TFD A;  3B6Q A;  5L9S A;  4HCY A;  3EN3 A;  1B5I A;  3MZB A;  1B3G A;  3THI A;  2OJT A;  2FYI A;  4OER A;  3AXF A;  4GWY A;  4LN5 A;  4QFP A;  2DE2 A;  3VLW A;  3WAE A;  4JBZ A;  3JV9 A;  1CE2 A;  1ZMG A;  4MNP A;  4AS4 A;  3C9H A;  1IZ1 A;  2A5S A;  4KFQ A;  5I5P A;  1B05 A;  4MNC A;  4NF8 B;  4OEU A;  3PPP A;  2ANJ A;  3U8Q A;  4R75 A;  1RYX A;  2QVR A;  4R9G A;  1IMB A;  4U22 A;  3FJG A;  4HCW A;  1TFA A;  3OSR A;  3H6W A;  1FBD A;  3QAX A;  1A54 A;  3R26 A;  4OXV A;  5FBP A;  4JWX A;  1B46 A;  1MY0 A;  3TMG A;  1FQB A;  2PT2 A;  1M5F A;  3WAF A;  3UK4 A;  3IJX B;  3L6H A;  4DIG A;  4PFU A;  2GH9 A;  5IZ3 B;  3KC1 A;  4N4U A;  4PAF A;  5H8H A;  5A5X A;  4G68 A;  3H7M A;  1FTO A;  2REJ A;  1VDW A;  2I6E A;  3RUM A;  3G3K A;  1R6Z A;  1Z7M E;  1FTM A;  1KWH A;  1JEV A;  3S9M C;  2D3I A;  4YKK A;  1DMB A;  1KA1 A;  2DS9 A;  4DLD A;  3USD A;  1SVX B;  3TEP A;  2XA5 A;  5EQ8 A;  4U23 A;  1B2H A;  3IFC A;  4OAN A;  1Q1K A;  2ZXT A;  3FIR A;  3QSL A;  3UP9 A;  5KDT B;  3FAS A;  2RC9 A;  3PTY A;  2I4C A;  5K2Y A;  2XXV A;  3VXC A;  3UIF A;  1RYO A;  1OVB A;  1NUZ A;  2H9B A;  3G3G A;  5FHN A;  4N13 A;  4NE4 A;  3KJT A;  1MY1 A;  3BFT A;  4KYS A;  4QSE A;  1J1N A;  3K0V A;  2QJE A;  2M8C A;  2Y7W A;  1VSO A;  3FD3 A;  4YB5 A;  1N7X A;  3N6U A;  2P3V A;  3CFL A;  3GBB A;  2XWK A;  2DSF A;  2X7P A;  3IB0 A;  3U72 A;  3B50 A;  3GZG A;  5IKB A;  3FXQ A;  3N5L A;  4JDF A;  4O8M A;  3VLU A;  2Y5K A;  2H98 A;  4XTC Q;  4H8I A;  1NH7 A;  2Q8J A;  5IAI A;  2OWZ A;  3H3G A;  2WBB A;  3OO8 A;  4LUB A;  2P3N A;  4MJO A;  5HBC A;  1S9T A;  4PDD A;  3MYU A;  1B7U A;  5I2K B;  4UAB A;  4C1T A;  1EU8 A;  1DBZ A;  4NF6 B;  4OVS A;  4OFL A;  2FIE A;  2UVH A;  4JB7 A;  4PFB A;  4QF9 A;  1MY2 A;  2DWH A;  5KDT A;  1MM7 A;  1UIU A;  2X26 A;  4KCD A;  2DE3 A;  2OZZ A;  1MG1 A;  4N07 A;  4XXU A;  1CNQ A;  2OX3 A;  3QYT A;  2Y7I A;  5DT6 A;  4IO2 A;  3ROJ A;  4ZDM A;  1LAF E;  4ECF A;  5A5L A;  5ET5 A;  1PEB A;  1D9Y A;  4NF5 A;  1H76 A;  3KGC A;  3O2A A;  3PPO A;  4G8H A;  1FPI A;  1PDA A;  3ECR A;  3H4Z A;  4MLQ A;  2KLF A;  4POX A;  2ABH A;  1UTH B;  1I69 A;  3FBP A;  3JYR A;  3CVG A;  1IIW A;  2I0B A;  4JWO A;  2OBG A;  4YZZ A;  1EYK A;  4H8J A;  4M1V A;  3ILT B;  3MP1 A;  3E13 X;  4PGN A;  5AA4 A;  5DTB A;  2VGQ A;  1ELJ A;  4O3B A;  2XX8 A;  2NWJ A;  4IO4 A;  3T9H B;  1NV6 A;  3RPL B;  4FOR A;  1NH8 A;  2CZH A;  4EDP A;  3H6V A;  4OZ9 A;  1MDQ A;  4PF6 A;  5H8N A;  3B8B A;  3SER A;  4UA8 A;  1DPE A;  3EHS A;  1FCK A;  5JTY A;  1Y1Z A;  3U65 A;  3UGW A;  3OO6 A;  4GIZ A;  3TCG A;  2HAU A;  1LBZ A;  2WYP A;  2VT5 A;  2F78 A;  5J1D A;  2O69 A;  4HE0 A;  1VFD A;  2Q74 A;  1TXF A;  4X04 A;  1LBV A;  2VHA A;  1ZJL A;  1EH3 A;  1GGG A;  2Y5L A;  3EQ1 A;  3OOA A;  3H03 A;  2DE4 A;  4ELP A;  3D1R A;  3DEL B;  4NHB A;  3EHU A;  2ZNT A;  3PUZ E;  4F1U A;  2HEU A;  3W15 C;  1NMU A;  1MXV A;  3PD9 A;  1NV7 A;  1WOD A;  1LB8 A;  1BTJ A;  2ZYN A;  1FQE A;  2F97 A;  1MPC A;  2VD3 A;  1JET A;  4IO6 A;  2QS2 A;  4GRK A;  1MQI A;  3M3F A;  2THI A;  2XX7 A;  1B1X A;  1ANF A;  1JVX A;  2CZI A;  2FHY A;  1SW4 A;  4OMB A;  1URS A;  1Y3N A;  4F39 A;  4LZ7 A;  2QPQ A;  3S2V A;  4F19 A;  3FVK A;  3T66 A;  5TP9 B;  3EHT A;  5H8F A;  3FV2 A;  3S9L C;  4FEB A;  1B3H A;  1AWB A;  2HCA A;  2FA7 A;  4IGR A;  4IO7 A;  3T0J A;  5IGA A;  4GX3 A;  4GOT A;  1PB8 A;  4H5F A;  3N94 A;  2RCA A;  4R6Y A;  4N6P A;  1A40 A;  1YAE A;  4GLI A;  2QVV A;  2F7B A;  4IB2 A;  4RPO A;  4X1D A;  4MEV A;  3ZKK A;  2BJI A;  1R9Q A;  4PFR A;  4WED A;  3V83 A;  4F2O A;  4O7M A;  3OEK A;  4O94 A;  4POW A;  5I3S A;  3PUV E;  1MS7 A;  2G93 A;  4EXL A;  4G68 C;  3M8U A;  4PP0 A;  1POY 1;  3MVW A;  4QSD A;  1PC3 A;  1YCJ A;  4QFK A;  4PCD A;  4K3F A;  3IO4 A;  5IZ1 A;  2QMW A;  5KCJ A;  4P1E A;  1SW5 A;  1KZ8 A;  3ZKL A;  1WVJ A;  5EYF A;  5L9O A;  5I59 A;  3D4C A;  5AA3 A;  5I2N A;  3SEV A;  1IQ7 A;  2BJJ X;  3C32 A;  4R72 A;  3I6V A;  1SYH A;  3KBR A;  2NXO A;  5B70 A;  2RC7 A;  2I3W A;  3LR1 A;  5CBR A;  5CI5 A;  3BFU A;  4KPT A;  5TU0 A;  2F35 A;  1IXC A;  4PFW A;  1P1U A;  5LOM A;  2FBP A;  4YAH X;  3Q26 A;  1MDP 1;  2P2A A;  3DP8 A;  3LSW A;  1URD A;  3MST A;  4KYE A;  4Q8R A;  2DP8 A;  1FBF A;  5CMM A;  3T22 A;  4BLA A;  2UXA A;  4YIC A;  1QW0 A;  2H4I A;  3IOU A;  4MMP A;  3A09 A;  4PTK A;  1LFH A;  4NED A;  4OEV A;  2UVJ A;  3HV1 A;  4ND9 A;  2LAO A;  4G8N A;  4TOZ A;  4PQJ A;  3B7D A;  1S7Y A;  2YJP A;  4KR5 A;  2O1L A;  3K1P A;  1FQF A;  4DE8 A;  4KHZ E;  2RC8 A;  1NV1 A;  4BDL A;  2HHM A;  3OSQ A;  4BDR A;  4AS5 A;  1JQF A;  5EHS A;  1EZ9 A;  2R9J A;  4Q5T A;  3LSL A;  2ZYK A;  5AA2 B;  3NOH A;  4ZEF A;  2DWA A;  1GV8 A;  5DEX A;  2ONS A;  3VLV A;  5T3J A;  1MPD A;  4I9D A;  2HPG A;  1FQA A;  1QUL A;  2B3F A;  3VVF A;  1XI6 A;  4TLL B;  3FVG A;  2ZNS A;  1MXZ A;  1Y20 A;  4P1L A;  3FVN A;  5EQ7 A;  2MKZ A;  4I3Y A;  3CSB A;  1PB9 A;  1EYJ A;  4PGP A;  2O84 X;  1ZIU A;  1RDZ A;  4QFN A;  3T9V A;  5ITP A;  3RYD A;  3CRB A;  1T0K A;  1L5T A;  4NG7 A;  5AE4 A;  1I6A A;  1B32 A;  5H8S A;  3LC8 A;  4NMY A;  3ONM A;  2R71 A;  4YKP A;  3C34 A;  2B65 A;  4OET A;  3VV5 A;  3T1B A;  3PU5 A;  1MPB A;  1QJM A;  2ZZV A;  1B52 A;  2H25 A;  3PMV A;  3PPQ A;  5DVI A;  1LEV A;  1OQH A;  4PDH A;  2RKM A;  1H3D A;  1VE4 A;  4H45 A;  3VFJ A;  3HO7 A;  1OIB A;  3K4U A;  3RGY A;  2XXI A;  3TTN A;  1LBX A;  4XKP A;  3VE1 B;  2UYF A;  1IMF A;  1B0H A;  3QXM A;  1LCF A;  2DYX A;  2I58 A;  3G3F A;  3C31 A;  3FJ7 A;  2Z22 A;  4ZE9 A;  2AL4 A;  3TTR A;  4NF0 A;  2GQ1 A;  5I58 B;  5ELV A;  3M3L A;  1FBP A;  2ESN A;  3EKI A;  2OLB A;  3KZG A;  4H5G A;  2WBD A;  4QSC A;  1QUI A;  1M5B A;  1YYZ A;  4GQO A;  2NVU B;  3C35 A;  1HSJ A;  4RJZ A;  1JP4 A;  3MP8 A;  4OEN A;  4PBQ A;  4UAC A;  3KOS A;  1SD3 A;  4AB5 A;  3LSF B;  2Q88 A;  4GWX A;  2CEX A;  4NF8 A;  1A8F A;  2Z23 A;  1D3K A;  4OWD A;  3HN0 A;  3SEW A;  1IMA A;  4EUO A;  1H45 A;  2IEE A;  2ZZW A;  4OHN A;  2Q2C A;  1N3W A;  1NUX A;  1QKB A;  1RDY A;  4PC9 A;  4ZE8 A;  3RQT A;  5J16 A;  2UYE A;  5IZ3 A;  3U92 A;  3IO6 A;  4NGU A;  1NNK A;  4HW8 A;  1SI1 A;  4Z7E A;  5B7D A;  4OVQ A;  2Z8D A;  2HAV A;  1OLC A;  4KQP A;  1YXI A;  2Q9T A;  1GR2 A;  4EXK A;  2AYS A;  2IA4 A;  1LGB C;  4G4P A;  1IUD A;  2V93 A;  5CM6 A;  1TT1 A;  1POT A;  1XHY A;  4PFT A;  2W7Y A;  2HZK A;  3IOR A;  1OVT A;  4P8B A;  1AIV A;  4QRZ A;  4BDM A;  1AL3 A;  2DQV A;  1YZ0 A;  1A99 A;  2O51 A;  4DCY A;  4X9T A;  1FTK A;  5AA1 A;  4U1Z A;  4ESW A;  4F1Y A;  4ELR A;  1MRP A;  2O7U A;  2L5V A;  5EYH A;  4EQB A;  1MXY A;  3TTM A;  3KN8 A;  1O7T A;  3VVD A;  2O6A A;  1BK4 A;  3R6U A;  3IOT A;  3TUS A;  1QVS A;  3KOT A;  5CMK A;  2A5T B;  2CMO A;  3PV0 E;  5CMC A;  1IMD A;  1B3L A;  4THI A;  1Y9U A;  4F29 A;  3RTF B;  4I3E A;  4WEP A;  4DI3 D;  4ZZA A;  1LAH E;  4JXI A;  5EQ9 A;  4N91 A;  4HTG A;  2RIN A;  4YB7 A;  1R9L A;  1PBQ A;  2GHB A;  4OTE A;  1LST A;  5H8Q B;  2X7Q A;  2F6P A;  3B6W A;  3KSJ A;  2DVZ A;  3GYY A;  3TQL A;  4C0R A;  4PE5 B;  1MXW A;  5I2K A;  4E0X A;  4YB6 A;  3W9V A;  2F3D A;  3E9X A;  4NF6 A;  4KCC A;  3TDJ A;  3OMB A;  1EZO A;  3V89 B;  4R73 A;  5BUU A;  1IXG A;  4F1V A;  3OEN A;  2V3T A;  3TFL A;  4ZEK A;  1FRP A;  4EF2 A;  2XXR A;  3A3U A;  1UTB B;  3RTW B;  2XX9 A;  4U2R A;  4WXJ A;  2YLN A;  3ODB A;  4NQ8 A;  2XXQ A;  4YKI A;  5TPA B;  1N76 A;  4IO5 A;  2XWO A;  4DI4 B;  3MW0 A;  4N6K A;  5FHM A;  1B7H A;  1OQG A;  1XS5 A;  3F11 A;  3Q29 A;  5JK4 A;  1NNT A;  2F8D A;  1GTK A;  1FBC A;  1QUK A;  3KFM A;  2V3Q A;  4U4X A;  4P56 A;  5CBS A;  1FPD A;  1NL5 A;  2AIX A;  4GL8 A;  1FPB A;  4H6D A;  4PET A;  4P3L A;  1I6B A;  1NV2 A;  3MAM A;  3MQ9 A;  3K6X A;  2HQ0 A;  4ZS9 A;  1LAG E;  4ZZE A;  1D9V A;  2I49 A;  3OD7 A;  3EPE A;  2WYK A;  2NUV A;  4X8R A;  1UTH A;  4KD5 A;  1Q35 A;  3SET A;  2FVZ A;  1B3E A;  3MBP A;  1FJ6 A;  1DK4 A;  4IR8 A;  1DPP A;  3FAT A;  3LUY A;  1FBG A;  1DCU A;  4FJP A;  5I57 B;  4O3C A;  1N84 A;  3MVZ A;  2O1M A;  4MH5 A;  1FPE A;  5ET8 A;  3RY3 A;  3MPK A;  1QGX A;  4LON B;  4NWD A;  3RPL A;  1GVC A;  2F5X A;  4GL0 A;  4P9K A;  3QUF A;  1NV0 A;  3UN6 A;  3CR9 A;  4MLV A;  2QSX A;  5I56 B;  3KN3 A;  2GRV A;  3FZV A;  1NV4 A;  3TEL A;  3PPN A;  3MWB A;  4JVI A;  2ZYO A;  3S9E A;  1BP5 A;  2B4L A;  3V5A A;  3TOD A;  4XIG Q;  3TZA A;  1AMF A;  2V25 A;  4DXB A;  3KBZ A;  1NFT A;  2VPO A;  4JSO A;  2QRY A;  3K01 A;  1D9Q A;  1MQD A;  1YTV A;  4NF4 B;  4O3A A;  3IOW A;  2DWJ A;  4ZED A;  4RK9 A;  3OO7 A;  4LAT A;  2Q89 A;  2F36 A;  3BBR A;  4PFY A;  3EF7 A;  1XVY A;  2Y7K A;  4MCO A;  4XFE A;  3K00 A;  4F18 A;  4FIM A;  4GX4 A;  3PGF A;  4FE8 A;  2XXX A;  4EF1 A;  4C1U A;  1FBH A;  3HFU A;  3PMW A;  2OCU A;  4OVJ A;  5FTI A;  4E0W A;  2UVI A;  2D21 A;  1A8E A;  1SW1 A;  2CEY A;  1SI0 A;  3SEY A;  4P47 A;  1P1W A;  5TP9 A;  3O29 A;  2HXW A;  3K6U A;  4FAT A;  4GBV A;  4F3B A;  1SBP A;  3MVX A;  3HHG A;  4GWO A;  5AA2 D;  2XWV A;  3MJN A;  1LBB A;  4OVT A;  3K1N A;  4H0W A;  2O68 A;  4NX1 A;  1MH4 A;  2QMX A;  1B40 A;  2XD3 A;  2ZYM A;  4H67 A;  4ONY A;  1I6Q A;  4AB6 A;  1MQG A;  3MUQ A;  5K2X A;  2ONR A;  3T9X B; 
#chains in the Genus database with same CATH homology
 2F6G A;  1NNP A;  2VP1 A;  1Z7N E;  3O9P A;  3IB2 A;  1FQC A;  4LP2 B;  4FAJ A;  2XXY A;  3LBS A;  3DM0 A;  1EZP A;  4EQ9 A;  2DXY A;  1M5E A;  1B4H A;  1NKX A;  1DSN A;  1US4 A;  3JZJ A;  3PD8 A;  3N26 A;  4GXS B;  5DVJ A;  4LVQ A;  4AQ4 A;  1H44 A;  2WKY A;  5H8H B;  3FGS A;  2QS1 A;  4F22 A;  5A5X B;  4G68 B;  3IAZ A;  1A7L A;  4R6H A;  3T93 B;  3M3K A;  3PUW E;  4OQO A;  4P11 A;  1DTZ A;  3QK6 A;  1P1N A;  1ZLQ A;  3O6H A;  1US5 A;  1VFE A;  5L9M A;  1LAX A;  1O64 A;  3PUX E;  5ICQ A;  1B6H A;  4IY5 A;  3A3C A;  3TPA A;  1FTL A;  4Z0I A;  3K2D A;  1ZBM A;  4GVO A;  2Z8F A;  4G77 A;  3SDF A;  1LCT A;  4F3S A;  1B4Z A;  2OWS A;  3QUJ A;  4LQ2 A;  3VXB A;  2Q2A A;  4LA9 A;  3HHF A;  3CFZ A;  1B5J A;  3CIJ A;  4DCX A;  3KG2 A;  4LQ5 A;  5HPQ A;  3N6T A;  4YMB A;  3GXA A;  3C36 A;  2GFE A;  1MM6 A;  5CC2 A;  5CRY A;  3DP6 A;  2QS3 A;  1AH5 A;  4MBP A;  1MXX A;  3SEU A;  5AA2 A;  1USY E;  3W9W A;  2F34 A;  3Q25 A;  1IXI A;  3MP6 A;  2REG A;  3CI8 A;  4NWC A;  1MXU A;  4DXU A;  4U21 A;  1B1H A;  1LFG A;  1II5 A;  3U94 A;  1PBP A;  3G7W A;  2VOZ A;  1IXH A;  1JEU A;  2V84 A;  1Y1M A;  4I1D A;  3K02 A;  4XKN A;  2Y7R A;  4KYD A;  3U1O A;  2R6G E;  4DDD A;  3BKI B;  2ONK E;  2E0S A;  3PPR A;  1N0T A;  2P0S A;  2PT1 A;  4RXL A;  2DOJ A;  3U93 A;  5ITO A;  4FEC A;  2PMS A;  2Y84 A;  4YU0 A;  2I0C A;  2ZMB A;  1WDN A;  4G8M A;  3DLN A;  4F3G A;  2RCB A;  1HSL A;  3FV1 A;  1SYI A;  1OLA A;  1QKA A;  1IEJ A;  3TYH A;  5EHM A;  3FXR A;  1FTJ A;  4OES A;  4NF5 B;  4ESX A;  3FXU A;  3MPL A;  1XC1 A;  2PYY A;  4R2F A;  2XHD A;  1XT8 A;  2I48 A;  5DYH A;  5I58 A;  5HM4 B;  2HFB A;  4HS7 A;  4ISU A;  3PUY E;  2QS4 A;  3KJ7 A;  1XVX A;  3H06 B;  1NNF A;  4LZ5 A;  5DVF A;  3HCQ A;  4BDO A;  5AA4 B;  2AL5 A;  3GBA A;  1ZU0 A;  1H43 A;  1MY4 A;  2XXP A;  2D5W A;  5CMB A;  4H65 A;  5FHO A;  2XD2 A;  1B3F A;  1B9J A;  1N04 A;  1RKM A;  1ZKB A;  2PX1 A;  1LB9 A;  4Q30 B;  3IL1 B;  4R9F A;  3MZ9 A;  3OEL A;  3OO9 A;  1B5H A;  4MFI A;  4IO3 A;  1IIT A;  1LLS A;  4P0I A;  3FUZ A;  5H8N B;  3ZSF A;  1N3X A;  2H5Y A;  4M4G A;  1B51 A;  1SW2 A;  3HST A;  1A55 A;  1JVY A;  5JTY B;  1D4N A;  4GD5 A;  4R2B A;  4RK2 A;  3UA8 A;  4IY6 A;  3TCF A;  4ZEC A;  1Y4C A;  4U1O A;  2F7C A;  2VD2 A;  2OK2 A;  3CG1 A;  3OEM A;  3VVE A;  2E1S A;  3I5O A;  1JW4 A;  1N7W A;  3C4M A;  1P99 A;  3O66 A;  3FJM A;  3QIM A;  3TTL A;  4F2Q A;  1XOC A;  3V8X B;  3S9N C;  4NTL A;  4KI0 E;  1FW0 A;  3TKD A;  4YMA A;  4F31 B;  2FNC A;  4F3P A;  3T96 B;  3MC2 A;  4I8C A;  1MY3 A;  1VR5 A;  4WKM A;  3PMX A;  2DWI A;  2A5T A;  4ZEI A;  4TQU Q;  1SDX A;  2QL3 A;  4P0G A;  4EQ7 A;  1QUJ A;  4QHQ A;  4JWY A;  3O6I A;  2P1S A;  4RY1 A;  2GHA A;  2V3U A;  3IR1 A;  1CB6 A;  1P1Q A;  4DZ1 A;  3E4R A;  2ALU A;  5H8F B;  3H6T A;  3UOR A;  3LSX A;  1P1O A;  2XXW A;  4RNS A;  3RLF E;  3GLB A;  1BLF A;  3TAJ A;  5H8Q A;  1DOT A;  1FQD A;  1B0L A;  1Y3Q A;  3IJO B;  1MH3 A;  1BKA A;  3HPI A;  5KZT A;  4H1X A;  3G3H A;  4GFR A;  3CSG A;  4XKR A;  1B58 A;  1Y4T A;  3RN8 A;  3KEI A;  1JW5 A;  3RT6 B;  3KSX A;  1ZTY A;  1UTB A;  4L17 A;  5KCJ B;  4Q0C A;  3TTK A;  3FVO A;  1AOV A;  5TPA A;  3RT8 A;  4RPN A;  3H6U A;  4RA1 A;  5I59 B;  5I84 A;  5I2N B;  2YPN A;  3T9U A;  5M2V A;  1UIV A;  2XXH A;  4ELQ A;  2PVU A;  4OYV A;  5JEI A;  3RPW A;  3SES A;  3G3I A;  1MQH A;  1Y3P A;  2H99 A;  3IX1 A;  3VDF A;  4LZ8 A;  3IOV A;  2PBW A;  1R1N A;  1YPN A;  2UVG A;  1LBC A;  5BWJ A;  3I3V A;  3DP4 A;  3P7I A;  5ISU A;  3L6G A;  3B6T A;  4X48 A;  3Q27 A;  1UQW A;  1ATG A;  3K6V A;  1F9B A;  1B7Z A;  3CG3 A;  3SEX A;  4BDN A;  3SKP A;  4MF3 A;  3O28 A;  4GF8 A;  3RNN A;  2F7A A;  5I57 A;  5F7V A;  3O97 A;  3TCH A;  3CFX A;  3Q28 A;  2RF1 A;  4YKJ A;  4DXC A;  4QFO A;  4RYA A;  2Z8E A;  3D4G A;  4ELO A;  1BIY A;  2OWT A;  1DTG A;  2O7I A;  1MQJ A;  3MVY A;  2NOO A;  1LFI A;  5L8D A;  1JW1 A;  3IB1 A;  5ICT A;  1URG A;  3OXN A;  3TQW A;  1USY H;  5I56 A;  5DEX B;  4XKQ A;  2XXT A;  3K6W A;  2ZNU A;  2Y7P A;  3C33 A;  4IGT A;  4QFL A;  1JNF A;  3O6G A;  4G2Z A;  1SQY A;  2I4B A;  5F1Q A;  4U4S A;  1S50 A;  5FTH A;  4FED A;  4TLM B;  1HSE A;  2DXR A;  4R6K A;  4NF4 A;  1M5D A;  4GXA A;  3ILU B;  3S4U A;  2CZL A;  4X1B A;  3K1M A;  3E3K A;  3ZS6 A;  1TWY A;  1M5C A;  3KN7 A;  1OMP A;  3IK6 B;  4OFJ A;  4BDQ A;  2XXU A;  4ZEB A;  3R7X A;  1O63 A;  3G3J A;  2G29 A;  4OFO A;  4I62 A;  2HZL A;  2DVC A;  2B3B A;  4JSD A;  4R74 A;  2I3V A;  1PB7 A;  3MZ1 A;  1TFD A;  3B6Q A;  5L9S A;  4HCY A;  3EN3 A;  1B5I A;  3MZB A;  1B3G A;  3THI A;  2OJT A;  2FYI A;  4OER A;  3AXF A;  4QFP A;  2DE2 A;  3VLW A;  3WAE A;  4JBZ A;  3JV9 A;  1CE2 A;  1ZMG A;  3C9H A;  1IZ1 A;  2A5S A;  4KFQ A;  1B05 A;  4NF8 B;  4OEU A;  3PPP A;  2ANJ A;  3U8Q A;  4R75 A;  1RYX A;  4R9G A;  4U22 A;  3FJG A;  4HCW A;  1TFA A;  3OSR A;  3H6W A;  3QAX A;  1A54 A;  3R26 A;  4OXV A;  4JWX A;  1B46 A;  1MY0 A;  3TMG A;  1FQB A;  2PT2 A;  1M5F A;  3WAF A;  3UK4 A;  3IJX B;  3L6H A;  4DIG A;  4PFU A;  2GH9 A;  5H8H A;  5A5X A;  4G68 A;  3H7M A;  1FTO A;  2REJ A;  2I6E A;  3RUM A;  3G3K A;  1R6Z A;  1Z7M E;  1FTM A;  1KWH A;  1JEV A;  3S9M C;  2D3I A;  4YKK A;  1DMB A;  2DS9 A;  4DLD A;  3USD A;  1SVX B;  3TEP A;  4U23 A;  1B2H A;  1Q1K A;  2ZXT A;  3FIR A;  3QSL A;  3UP9 A;  5KDT B;  3FAS A;  2RC9 A;  2I4C A;  5K2Y A;  2XXV A;  3VXC A;  3UIF A;  1RYO A;  1OVB A;  2H9B A;  3G3G A;  5FHN A;  4N13 A;  4NE4 A;  3KJT A;  1MY1 A;  3BFT A;  4KYS A;  4QSE A;  1J1N A;  3K0V A;  4YB5 A;  2QJE A;  2M8C A;  1VSO A;  2Y7W A;  3FD3 A;  1N7X A;  3N6U A;  3CFL A;  3GBB A;  2DSF A;  2X7P A;  3IB0 A;  3U72 A;  3GZG A;  5IKB A;  3FXQ A;  3N5L A;  4JDF A;  3VLU A;  2H98 A;  4XTC Q;  4H8I A;  1NH7 A;  2Q8J A;  5IAI A;  3H3G A;  3OO8 A;  4LUB A;  5HBC A;  1S9T A;  1B7U A;  5I2K B;  4C1T A;  1EU8 A;  4NF6 B;  4OFL A;  2UVH A;  4JB7 A;  4QF9 A;  1MY2 A;  2DWH A;  5KDT A;  1MM7 A;  1UIU A;  2X26 A;  4KCD A;  2DE3 A;  2OZZ A;  1MG1 A;  4N07 A;  4XXU A;  3QYT A;  2Y7I A;  5DT6 A;  4IO2 A;  4ZDM A;  1LAF E;  4ECF A;  1PEB A;  1D9Y A;  4NF5 A;  1H76 A;  3KGC A;  3O2A A;  3PPO A;  4G8H A;  1PDA A;  3ECR A;  3H4Z A;  4MLQ A;  2KLF A;  4POX A;  2ABH A;  1UTH B;  1I69 A;  3JYR A;  3CVG A;  1IIW A;  2I0B A;  4JWO A;  2OBG A;  4YZZ A;  4H8J A;  4M1V A;  3ILT B;  3MP1 A;  3E13 X;  5AA4 A;  5DTB A;  2VGQ A;  1ELJ A;  4O3B A;  2XX8 A;  2NWJ A;  4IO4 A;  3T9H B;  4FOR A;  1NH8 A;  4EDP A;  3H6V A;  4OZ9 A;  1MDQ A;  5H8N A;  3SER A;  4UA8 A;  1DPE A;  3EHS A;  1FCK A;  5JTY A;  1Y1Z A;  3UGW A;  3OO6 A;  4GIZ A;  3TCG A;  2HAU A;  2F78 A;  5J1D A;  2O69 A;  1VFD A;  1TXF A;  2VHA A;  1ZJL A;  1EH3 A;  1GGG A;  3EQ1 A;  3OOA A;  3H03 A;  2DE4 A;  4ELP A;  3DEL B;  3EHU A;  2ZNT A;  3PUZ E;  4F1U A;  2HEU A;  3W15 C;  1NMU A;  1MXV A;  3PD9 A;  1WOD A;  1LB8 A;  1BTJ A;  2ZYN A;  1FQE A;  2F97 A;  1MPC A;  2VD3 A;  1JET A;  4IO6 A;  2QS2 A;  4GRK A;  1MQI A;  3M3F A;  2THI A;  2XX7 A;  1B1X A;  1ANF A;  1JVX A;  1SW4 A;  4OMB A;  1URS A;  1Y3N A;  4F39 A;  4LZ7 A;  2QPQ A;  3S2V A;  4F19 A;  3FVK A;  3T66 A;  5TP9 B;  3EHT A;  5H8F A;  3FV2 A;  3S9L C;  4FEB A;  1B3H A;  2HCA A;  2FA7 A;  4IGR A;  4IO7 A;  4GOT A;  1PB8 A;  4H5F A;  3N94 A;  2RCA A;  4R6Y A;  4N6P A;  1A40 A;  1YAE A;  4GLI A;  2F7B A;  4IB2 A;  4RPO A;  4X1D A;  3ZKK A;  1R9Q A;  4WED A;  3V83 A;  4F2O A;  3OEK A;  4POW A;  3PUV E;  1MS7 A;  2G93 A;  4EXL A;  4G68 C;  3M8U A;  4PP0 A;  1POY 1;  3MVW A;  4QSD A;  1PC3 A;  1YCJ A;  4QFK A;  4K3F A;  3IO4 A;  2QMW A;  5KCJ A;  1SW5 A;  3ZKL A;  1WVJ A;  5EYF A;  5L9O A;  5I59 A;  3D4C A;  5AA3 A;  5I2N A;  3SEV A;  1IQ7 A;  2BJJ X;  3C32 A;  4R72 A;  3I6V A;  1SYH A;  3KBR A;  2NXO A;  5B70 A;  2RC7 A;  2I3W A;  3LR1 A;  5CBR A;  5CI5 A;  3BFU A;  4KPT A;  5TU0 A;  2F35 A;  1IXC A;  4PFW A;  1P1U A;  5LOM A;  4YAH X;  3Q26 A;  1MDP 1;  2P2A A;  3DP8 A;  3LSW A;  1URD A;  4KYE A;  4Q8R A;  2DP8 A;  5CMM A;  3T22 A;  4BLA A;  2UXA A;  4YIC A;  1QW0 A;  2H4I A;  3IOU A;  3A09 A;  1LFH A;  4NED A;  4OEV A;  2UVJ A;  3HV1 A;  4ND9 A;  2LAO A;  4G8N A;  4TOZ A;  4PQJ A;  3B7D A;  1S7Y A;  2YJP A;  4KR5 A;  2O1L A;  3K1P A;  1FQF A;  4DE8 A;  4KHZ E;  2RC8 A;  4BDL A;  3OSQ A;  4BDR A;  1JQF A;  5EHS A;  1EZ9 A;  2R9J A;  4Q5T A;  3LSL A;  2ZYK A;  5AA2 B;  4ZEF A;  2DWA A;  1GV8 A;  5DEX A;  2ONS A;  3VLV A;  1MPD A;  4I9D A;  1FQA A;  1QUL A;  2B3F A;  3VVF A;  4TLL B;  3FVG A;  2ZNS A;  1MXZ A;  1Y20 A;  3FVN A;  3CSB A;  1PB9 A;  2O84 X;  1ZIU A;  4QFN A;  3T9V A;  5ITP A;  3CRB A;  1T0K A;  1L5T A;  5AE4 A;  1I6A A;  1B32 A;  5H8S A;  3LC8 A;  4NMY A;  3ONM A;  2R71 A;  4YKP A;  3C34 A;  2B65 A;  4OET A;  3VV5 A;  3PU5 A;  1MPB A;  1QJM A;  1B52 A;  2H25 A;  3PMV A;  3PPQ A;  5DVI A;  1OQH A;  2RKM A;  1H3D A;  1VE4 A;  3VFJ A;  3HO7 A;  1OIB A;  3K4U A;  3RGY A;  2XXI A;  3TTN A;  4XKP A;  3VE1 B;  2UYF A;  1B0H A;  3QXM A;  1LCF A;  2DYX A;  2I58 A;  3G3F A;  3C31 A;  3FJ7 A;  2Z22 A;  4ZE9 A;  2AL4 A;  3TTR A;  5I58 B;  5ELV A;  3M3L A;  2ESN A;  3KZG A;  2OLB A;  4H5G A;  4QSC A;  1QUI A;  1M5B A;  4GQO A;  2NVU B;  3C35 A;  1HSJ A;  4RJZ A;  3MP8 A;  4OEN A;  4UAC A;  3KOS A;  1SD3 A;  4AB5 A;  3LSF B;  2Q88 A;  4NF8 A;  1A8F A;  2Z23 A;  1D3K A;  4OWD A;  3HN0 A;  3SEW A;  4EUO A;  1H45 A;  2IEE A;  4OHN A;  2Q2C A;  1N3W A;  1QKB A;  4ZE8 A;  3RQT A;  2UYE A;  3U92 A;  3IO6 A;  1NNK A;  4HW8 A;  1SI1 A;  4Z7E A;  5B7D A;  2Z8D A;  2HAV A;  1OLC A;  4KQP A;  2Q9T A;  1GR2 A;  4EXK A;  2AYS A;  2IA4 A;  1LGB C;  4G4P A;  1IUD A;  2V93 A;  5CM6 A;  1TT1 A;  1POT A;  1XHY A;  4PFT A;  2W7Y A;  2HZK A;  3IOR A;  1OVT A;  1AIV A;  4QRZ A;  4BDM A;  1AL3 A;  2DQV A;  1A99 A;  2O51 A;  4DCY A;  4X9T A;  1FTK A;  5AA1 A;  4U1Z A;  4ESW A;  4F1Y A;  4ELR A;  1MRP A;  2O7U A;  4EQB A;  1MXY A;  3TTM A;  3KN8 A;  1O7T A;  3VVD A;  2O6A A;  3R6U A;  3IOT A;  3TUS A;  1QVS A;  3KOT A;  5CMK A;  2A5T B;  2CMO A;  3PV0 E;  5CMC A;  1B3L A;  4THI A;  1Y9U A;  4F29 A;  3RTF B;  4WEP A;  4ZZA A;  1LAH E;  4JXI A;  4HTG A;  2RIN A;  4YB7 A;  1R9L A;  1PBQ A;  2GHB A;  4OTE A;  1LST A;  5H8Q B;  2X7Q A;  2F6P A;  3B6W A;  3KSJ A;  2DVZ A;  3TQL A;  4C0R A;  4PE5 B;  1MXW A;  5I2K A;  4E0X A;  4YB6 A;  3W9V A;  3E9X A;  4NF6 A;  4KCC A;  3TDJ A;  3OMB A;  1EZO A;  3V89 B;  4R73 A;  5BUU A;  1IXG A;  4F1V A;  3OEN A;  2V3T A;  3TFL A;  4ZEK A;  4EF2 A;  2XXR A;  3A3U A;  1UTB B;  3RTW B;  2XX9 A;  4U2R A;  4WXJ A;  2YLN A;  3ODB A;  2XXQ A;  4YKI A;  5TPA B;  1N76 A;  4IO5 A;  3MW0 A;  5FHM A;  1B7H A;  1OQG A;  1XS5 A;  3F11 A;  3Q29 A;  5JK4 A;  1NNT A;  2F8D A;  1GTK A;  1QUK A;  3KFM A;  2V3Q A;  4U4X A;  5CBS A;  1NL5 A;  2AIX A;  4GL8 A;  4H6D A;  4PET A;  1I6B A;  3MAM A;  3MQ9 A;  3K6X A;  2HQ0 A;  4ZS9 A;  1LAG E;  4ZZE A;  1D9V A;  2I49 A;  3OD7 A;  3EPE A;  2NUV A;  1UTH A;  4KD5 A;  1Q35 A;  3SET A;  1B3E A;  3MBP A;  1DPP A;  3FAT A;  3LUY A;  4FJP A;  5I57 B;  4O3C A;  1N84 A;  3MVZ A;  2O1M A;  4MH5 A;  3RY3 A;  3MPK A;  4LON B;  4NWD A;  1GVC A;  2F5X A;  4GL0 A;  3QUF A;  3UN6 A;  3CR9 A;  4MLV A;  2QSX A;  5I56 B;  3KN3 A;  2GRV A;  3FZV A;  3TEL A;  3PPN A;  3MWB A;  2ZYO A;  3S9E A;  1BP5 A;  3V5A A;  3TOD A;  4XIG Q;  3TZA A;  1AMF A;  2V25 A;  4DXB A;  1NFT A;  4JSO A;  2QRY A;  3K01 A;  1MQD A;  1YTV A;  4NF4 B;  4O3A A;  3IOW A;  2DWJ A;  4ZED A;  4RK9 A;  3OO7 A;  4LAT A;  2Q89 A;  2F36 A;  3BBR A;  4PFY A;  3EF7 A;  1XVY A;  2Y7K A;  3K00 A;  4F18 A;  4FIM A;  3PGF A;  4FE8 A;  2XXX A;  4EF1 A;  4C1U A;  3PMW A;  2OCU A;  4OVJ A;  5FTI A;  4E0W A;  2UVI A;  2D21 A;  1A8E A;  1SW1 A;  1SI0 A;  3SEY A;  1P1W A;  5TP9 A;  3O29 A;  2HXW A;  3K6U A;  4FAT A;  4F3B A;  1SBP A;  3MVX A;  3HHG A;  4GWO A;  5AA2 D;  3MJN A;  1LBB A;  3K1N A;  4H0W A;  2O68 A;  1MH4 A;  2QMX A;  1B40 A;  2XD3 A;  2ZYM A;  4H67 A;  4ONY A;  1I6Q A;  4AB6 A;  1MQG A;  3MUQ A;  5K2X A;  2ONR A;  3T9X B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...