1I6BA

Structure of equine apolactoferrin at 3.2 a resolution using crystals grown at 303k
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
689
structure length
689
Chain Sequence
APRKSVRWCTISPAEAAKCAKFQRNMKKVRGPSVSCIRKTSSFECIQAIAANKADAVTLDGGLVYEAGLHPYKLRPVAAEVYQTRGKPQTRYYAVAVVKKGSGFQLNQLQGVKSCHTGLGRSAGWNIPIGTLRPYLNWTGPPEPLQKAVANFFSASCVPCADGKQYPNLCRLCAGTEADKCACSSQEPYFGYSGAFKCLENGAGDVAFVKDSTVFENLPDEAERDKYELLCPDNTRKPVDAFKECHLARVPSHAVVARSVDGREDLIWKLLHRAQEEFGRNKSSAFQLFGSTPGEQDLLFKDSALGFVRIPSQIDSGLYLGANYLTATQNLRETAAEVAARRERVVWCAVGPEEERKCKQWSDVSNRKVACASASTTEECIALVLKGEADALNLDGGFIYVAGKCGLVPVLAENQKSQNSNAPDCVHRPPEGYLAVAVVRKSDADLTWNSLSGKKSCHTGVGRTAAWNIPMGLLFNQTGSCKFDKFFSQSCAPGADPQSSLCALCVGNNENENKCMPNSEERYYGYTGAFRCLAEKAGDVAFVKDVTVLQNTDGKNSEPWAKDLKQEDFELLCLDGTRKPVAEAESCHLARAPNHAVVSQSDRAQHLKKVLFLQQDQFGGNGPDCPGKFCLFKSETKNLLFNDNTECLAELQGKTTYEQYLGSEYVTSITNLRRCSSSPLLEACAFLRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LACTOTRANSFERRIN
publication title Crystal structure of equine apolactoferrin at 303 K providing further evidence of closed conformations of N and C lobes.
pubmed doi rcsb
molecule tags Metal transport
total genus 168
structure length 689
sequence length 689
ec nomenclature
pdb deposition date 2001-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00405 Transferrin Transferrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1i6bA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1i6bA04
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1i6bA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1i6bA03
4KCCA 3ILUB 3FD3A 1FTMA 3CG3A 3C32A 2PX1A 1USYH 1SW4A 2WKYA 4FEBA 5J1DA 2Q88A 4ELQA 3M3KA 4QF9A 1MXXA 1EH3A 3GXAA 5F7VA 4WEPA 3SEXA 3EPEA 4F3PA 4NEDA 2D21A 5HM4B 3TZAA 5ICTA 1NNTA 3MZ9A 2B3FA 5I57B 4PFYA 2DYXA 1XS5A 4ELOA 4RNSA 4F29A 2O7UA 3E3KA 1I69A 3T9HB 1Y3QA 4OWDA 4OETA 3KSXA 1B9JA 2Y7IA 3O29A 3OD7A 1HSLA 3JV9A 4LVQA 4I62A 4BDLA 1OQGA 2HXWA 5HBCA 4L17A 3G3GA 1N76A 5EHSA 3TMGA 3OSRA 3TELA 2OWSA 5I2NA 3C34A 4DDDA 1OLAA 4GVOA 2PYYA 1B1HA 2V93A 3JYRA 4C1UA 3SERA 1B3FA 1QW0A 4R6YA 5H8HB 4P11A 4YB7A 3PUXE 2DXYA 4G68B 1SYHA 1JQFA 1QUIA 2F34A 4I8CA 1Z7NE 4EQ9A 3ONMA 4OZ9A 4K3FA 2XHDA 3RY3A 3MP1A 1P99A 4NF6A 3PPPA 2A5SA 2HCAA 1IEJA 2M8CA 3ILTB 4XKPA 5TP9B 4DCYA 3UORA 1BP5A 4N13A 2P0SA 4OMBA 3LR1A 3G3FA 4DZ1A 2O6AA 3V8XB 3IB1A 3A3CA 4F3SA 1IXCA 4QFPA 3UIFA 4GOTA 1P1WA 1QKBA 1B1XA 1B05A 4R2BA 2RC7A 4NMYA 1ZKBA 3LBSA 2Y7RA 3U94A 5ELVA 4OFJA 3PPQA 4GXAA 4XKQA 3R7XA 4YICA 5H8FB 5I56B 3FJMA 5CMKA 3TTMA 3U72A 4LQ2A 4OEVA 2Q2CA 4LONB 3RT6B 1DPPA 4XKRA 4ZS9A 3TTLA 1N3WA 2XXQA 3HV1A 2ZYNA 3O28A 3PGFA 1LB9A 3CIJA 2ONSA 4UA8A 1VSOA 4IO4A 1BTJA 4NF8A 3G3JA 3IJXB 1NNFA 1TT1A 5I58B 3N6UA 2ONKE 4LZ8A 3OSQA 4UACA 4YU0A 3TEPA 1S7YA 2F36A 3QK6A 3OEMA 2VP1A 1B40A 3KOTA 5A5XA 3OO6A 3TQLA 3SDFA 2Y84A 1B5JA 2UVIA 2Z23A 4ISUA 4PFWA 2X7PA 3KJ7A 1D9YA 4QSEA 4YKJA 1WVJA 4F31B 1LAHE 4YB5A 5JK4A 1JEUA 3U1OA 4YZZA 2RINA 4U1ZA 5FTHA 3B6WA 3VLWA 2HZKA 3H6WA 3SESA 1MQDA 2GRVA 1UTBA 3CR9A 2I49A 3K1PA 3K02A 2RCBA 3MP8A 4PQJA 3T9UA 3FVNA 5ISUA 4LATA 3P7IA 2QL3A 5K2XA 3PV0E 2O84X 1CE2A 2ZNUA 1N3XA 2GFEA 1D9VA 4F1VA 1MS7A 3KSJA 1ZBMA 1OIBA 2A5TB 1TFDA 3MAMA 3MBPA 5ITOA 2Z8EA 2RF1A 2O69A 1MXUA 1B7UA 3G3HA 3T93B 4NF4B 2BJJX 1GVCA 1H76A 3IK6B 2QSXA 2DS9A 1US5A 1OQHA 2XXIA 1LFGA 4ZEBA 3TPAA 2H4IA 1KWHA 3VLUA 4BDQA 1YCJA 5AA2D 4HS7A 3RLFE 4POWA 3H06B 3VFJA 1R9QA 3LSXA 1Y3PA 3O6IA 1A40A 5HPQA 1MY3A 1Y3NA 1LAXA 2DP8A 3VV5A 4NF5A 1LGBC 1MXWA 3JZJA 4P0GA 1MM7A 2I0BA 4KFQA 4QFNA 2PMSA 2F78A 4RPOA 1PB8A 3Q25A 4XIGQ 1Q1KA 4PFUA 4N6PA 3LUYA 1I6BA 3H7MA 4OHNA 1NKXA 5AA4A 2P2AA 2O68A 1POY1 4TQUQ 2DWIA 3ZKKA 4Q8RA 1FQFA 1MDQA 3PPNA 2X26A 4TLLB 1JETA 1BLFA 1JW1A 1SYIA 4LUBA 2OBGA 3CFLA 1MQGA 1MRPA 2XXVA 2YLNA 4NWCA 3PU5A 2OCUA 5JEIA 5CRYA 3ZSFA 3PPOA 1LBBA 2XX9A 3K01A 4JDFA 5I59A 5AA2A 3QAXA 5JTYA 2XXXA 1VFDA 1ATGA 2ZXTA 1UQWA 1PBPA 3UGWA 4JB7A 2HAUA 2O7IA 2ZYKA 4DXUA 3FASA 4FIMA 3VVFA 4PE5B 3Q28A 1NL5A 2F7CA 1SDXA 4BDNA 4THIA 1H43A 3C36A 4XTCQ 2DE2A 2F7BA 3SKPA 1JNFA 1FTKA 2AL4A 3SEYA 1N7WA 1YTVA 4Q5TA 5CBRA 4E0XA 2ZNTA 3G7WA 3BFUA 4ND9A 3S4UA 3RN8A 3FVKA 3LSWA 1TXFA 3CSBA 4LQ5A 1AMFA 4OTEA 3PUWE 4X9TA 2F6GA 3H6TA 1GTKA 2IA4A 2DWJA 2ZYOA 1PBQA 4MF3A 4P0IA 3HCQA 1N7XA 5KCJA 2D5WA 4IO7A 4DIGA 1IITA 1YPNA 1SI1A 1IXHA 2DWAA 2ZYMA 4C1TA 4KCDA 1USYE 3VE1B 2VD3A 3SETA 1MPDA 2DE4A 2Z22A 3S2VA 3CSGA 2XXTA 3CRBA 1JW4A 4H65A 3I5OA 4R73A 1O7TA 3M3LA 3QYTA 3PUYE 1MY0A 2Y7WA 2DOJA 4RA1A 2XXYA 2PT2A 4TLMB 1RYXA 3V83A 3DP8A 5TPAA 1B3GA 4G8HA 3MW0A 3FJ7A 2I0CA 2THIA 4JBZA 4R6KA 4ONYA 3FV2A 4GLIA 1AL3A 3RTFB 5I84A 5TU0A 4H8IA 1FQBA 2F35A 4IGRA 1I6QA 4IB2A 4JSDA 2PT1A 4F19A 2VD2A 1ZLQA 3SEUA 5FHOA 3OO8A 4WKMA 3O9PA 3FXQA 4R6HA 3TKDA 5I2KB 2H98A 1QKAA 3V89B 1XHYA 5DT6A 1DOTA 4KYDA 3SEWA 2XXPA 3L6HA 3KZGA 3F11A 2CMOA 4YB6A 1SW1A 1N84A 1B7ZA 3THIA 3Q29A 5H8QB 3FXRA 3C9HA 2RCAA 3S9LC 4QRZA 4X1DA 2GH9A 5FHNA 3LSFB 3GZGA 4O3AA 3ECRA 3U93A 3FGSA 3E4RA 3UA8A 3VXBA 3KN8A 1R9LA 1US4A 4EDPA 3MC2A 2I4BA 5B70A 3KEIA 2E0SA 1MY1A 1MXYA 3RUMA 3MVXA 1FW0A 5CI5A 3O6HA 5F1QA 1EU8A 2FYIA 1A55A 2DSFA 3OELA 1ZU0A 2UYEA 3OOAA 2Q8JA 5FHMA 4XKNA 3EHUA 1LAFE 1SW5A 4NE4A 4PFTA 3CI8A 1N0TA 1Y4CA 1B4HA 4GWOA 4MH5A 4ZECA 3D4CA 1OMPA 4HCYA 1O63A 4ZEDA 3TUSA 4RXLA 5AE4A 2ANJA 3T22A 2QPQA 3VVEA 2UVJA 2AL5A 3FATA 2R6GE 4BDOA 3M8UA 2DXRA 2UVGA 3TYHA 3TTKA 2NUVA 3PMVA 3GBAA 3FIRA 3IJOB 3IO4A 3G3KA 4YAHX 2B3BA 3D4GA 1UIUA 1PB9A 4R74A 4M4GA 4FORA 1Y20A 1PB7A 5I57A 4BLAA 4ESXA 4BDMA 2OWTA 3KG2A 4KR5A 3V5AA 4MLQA 3T9VA 4GXSB 5DVJA 1GR2A 2X7QA 5H8NB 1UTHB 3KJTA 1B0LA 1LB8A 3IO6A 1DMBA 5DEXB 4U4XA 1IQ7A 4ZEIA 5DYHA 1L5TA 5KDTB 2V3TA 3N26A 2QMXA 4GL8A 3H03A 1NNPA 3FZVA 2OJTA 1LBCA 3DELB 1B2HA 3MVWA 3TDJA 2R9JA 2HZLA 1VR5A 5L9OA 1EZOA 3L6GA 3C4MA 3TODA 3KFMA 3R26A 3K4UA 4G8NA 5H8HA 4PETA 4POXA 4IY5A 4G68A 3K00A 1POTA 4RJZA 1ZJLA 1IUDA 3WAEA 4X1BA 1B5HA 3Q26A 1TFAA 3SEVA 5CMMA 4LA9A 4KYSA 5TP9A 2HFBA 3B7DA 3MWBA 4FEDA 1SQYA 3C31A 1UIVA 3DP6A 2F8DA 4AB6A 1R6ZA 3TAJA 3DLNA 4JWOA 4KYEA 4EXKA 1CB6A 3E9XA 4GF8A 2DVZA 2VOZA 1TWYA 2OK2A 5ITPA 3RT8A 1M5CA 3VXCA 4GFRA 4ZZAA 1LFIA 4F1UA 5H8FA 5I56A 2DVCA 3TCHA 4F3GA 1A8EA 4LZ5A 2V3UA 1DPEA 4WEDA 4QFOA 2GHAA 3HPIA 3QUJA 3TCGA 3QXMA 2Z8FA 1GGGA 3QSLA 5M2VA 2E1SA 1URGA 1FQDA 1SI0A 2I48A 3S9NC 3HHGA 4FECA 3T96B 4OQOA 1J1NA 2H99A 3EN3A 3MVYA 4Z7EA 5I58A 2I58A 5CMCA 2Q2AA 3O97A 2QS1A 3CVGA 3I6VA 5I2NB 1O64A 2HQ0A 5FTIA 4ELPA 5DVFA 3IAZA 4DXBA 3FV1A 4O3BA 1LLSA 4OEUA 4G2ZA 4DCXA 1M5EA 2PBWA 2OZZA 1DTZA 1MH4A 3PPRA 1XVXA 3DM0A 2OLBA 1Y4TA 4JSOA 4G68C 1MXZA 4AQ4A 2V84A 2QJEA 3PUVE 4NF6B 4ECFA 3W15C 1D4NA 2FA7A 4MFIA 3B6QA 4RY1A 4F39A 3UK4A 1QUKA 3LC8A 3MPKA 4EQ7A 3W9VA 2IEEA 1P1NA 4U22A 3U8QA 1FTLA 5DTBA 2DQVA 3H6UA 3MUQA 3OEKA 4YKIA 4KPTA 2NXOA 1MQJA 2ONRA 4MBPA 4U4SA 2H25A 2A5TA 1EZPA 1H3DA 3HO7A 4LP2B 4QSCA 4QFKA 1IXIA 1VE4A 1SD3A 1ZMGA 2REJA 4NF4A 4HTGA 1S9TA 3A09A 5L9MA 2H5YA 1OVBA 4JXIA 3BFTA 4H67A 2UXAA 4H6DA 4RPNA 3IOTA 3I3VA 1T0KA 1MM6A 5L9SA 3IORA 3KOSA 4IGTA 3H4ZA 4NF8B 1OLCA 1LAGE 3ZKLA 2Y7PA 4JWYA 4ESWA 3Q27A 3K1NA 5KZTA 4JWXA 3C35A 4I1DA 3K6VA 4U1OA 4OYVA 1B58A 1LCFA 1ELJA 4RK9A 1B51A 5A5XB 4DXCA 1MG1A 4NTLA 3PUZE 4RK2A 1M5BA 4OENA 4IY6A 2DE3A 4Z0IA 1D3KA 4F2OA 4KI0E 1A8FA 5L8DA 3B6TA 4OVJA 3UN6A 3S9EA 2Y7KA 4F18A 2V25A 4G8MA 5ICQA 4Q30B 1WDNA 3KN3A 4F3BA 1UTBB 4H8JA 5LOMA 2I3VA 1H45A 2I6EA 4QFLA 4R9GA 1NH8A 1FCKA 3IL1B 3MJNA 3FVOA 2ESNA 4FATA 3GBBA 4G77A 3K0VA 3RPWA 4ZEFA 4KHZE 4U2RA 3PMXA 4FJPA 1QJMA 3PMWA 3IB0A 2CZLA 1MY4A 4HW8A 2G29A 3K1MA 3M3FA 2O1LA 1NFTA 3PD9A 2O1MA 3TCFA 3VDFA 3EQ1A 1P1OA 2YJPA 3IOUA 4IO3A 1B32A 4OFLA 4E0WA 5DVIA 1JW5A 1RKMA 1FQCA 3ODBA 3W9WA 2QS3A 4H5GA 3BKIB 3K6XA 4IO5A 3KBRA 1IZ1A 2P1SA 4MLVA 4YMBA 2HEUA 4NF5B 1Q35A 1FTOA 1B3HA 3RGYA 2AYSA 1XVYA 5IKBA 1B3LA 2R71A 1SVXB 5EYFA 1B4ZA 5AA4B 3S9MC 3EF7A 3HN0A 3WAFA 1Y1ZA 4DLDA 4U21A 2W7YA 1QVSA 3TFLA 3G3IA 3T9XB 4PP0A 4F1YA 2VHAA 3MZBA 3USDA 1Y1MA 1QULA 4IO6A 2ZMBA 3IOVA 3H6VA 4M1VA 3PD8A 4EF1A 1GV8A 3VVDA 1WODA 2ABHA 3AXFA 3O2AA 4EUOA 3O6GA 1A54A 5BWJA 1XT8A 4KQPA 3TTNA 3MPLA 5I2KA 1YAEA 5AA2B 5I59B 1MY2A 5JTYB 3CG1A 4ZE9A 1AH5A 1NH7A 1S50A 1IXGA 1A7LA 3K2DA 1MQHA 2D3IA 5H8QA 1PEBA 2XX8A 4ZDMA 2GHBA 5AA1A 1MQIA 1B5IA 2F7AA 1AOVA 1PDAA 4R2FA 4GL0A 3CFXA 5CBSA 1FQAA 2ALUA 2F5XA 2RC9A 4GQOA 2XXRA 1MDP1 4NWDA 1IIWA 2I4CA 3MQ9A 4AB5A 4LZ7A 1F9BA 1R1NA 1DSNA 2XD2A 2RKMA 1OVTA 4OERA 4GD5A 2UYFA 1II5A 4XXUA 5H8SA 1A99A 3GLBA 1MPCA 1NMUA 1BIYA 2REGA 2Z8DA 1M5DA 3IR1A 1FQEA 4ZE8A 1QUJA 4U23A 3N94A 1Z7ME 2O51A 5KCJB 3LSLA 1VFEA 2F6PA 2RC8A 4KD5A 2B65A 3OO7A 2H9BA 1B6HA 4EXLA 2XXUA 2NVUB 3KGCA 3MP6A 4F22A 5B7DA 3H3GA 1DTGA 1XC1A 3OENA 3QUFA 1B52A 1Y9UA 1AIVA 3RNNA 3FVGA 3OO9A 4BDRA 1BKAA 4QHQA 2HAVA 2V3QA 1P1UA 4OESA 3RTWB 5TPAB 1LCTA 2G93A 1SBPA 3K6UA 2PVUA 3KN7A 2FNCA 5AA3A 4ELRA 3HSTA 3R6UA 1URDA 3TTRA 1HSEA 1EZ9A 1MH3A 1FTJA 2XX7A 4I9DA 3O66A 2DWHA 3IX1A 4YKKA 2QS2A 5CMBA 1PC3A 3A3UA 3FJGA 1B7HA 4DE8A 5BUUA 2YPNA 4F2QA 4QSDA 3U92A 3K6WA 3FXUA 2QMWA 5CM6A 1I6AA 3VLVA 3E13X 4R75A 3TQWA 4X48A 1URSA 1NNKA 3DP4A 3N6TA 4H5FA 2Q89A 5CC2A 3MZ1A 1ZTYA 4WXJA 4GIZA 4YKPA 2ZNSA 2KLFA 2Q9TA 4OXVA 2NWJA 4EQBA 5H8NA 4FE8A 3UP9A 3ZS6A 1UTHA 2F97A 4G4PA 2I3WA 5IAIA 1B0HA 4H1XA 5DEXA 4Q0CA 3RQTA 4GRKA 4ZZEA 3EHSA 4HCWA 5KDTA 1JVYA 3C33A 3QIMA 1N04A 1XOCA 4FAJA 1HSJA 1MXVA 3T66A 4IO2A 4O3CA 3OMBA 2QS4A 1ANFA 2QRYA 4ZEKA 2AIXA 4YMAA 1H44A 1SW2A 4OFOA 5K2YA 2UVHA 1LSTA 4N07A 1P1QA 3MVZA 1LFHA 2VGQA 4R72A 4H0WA 1JEVA 3EHTA 4EF2A 3CFZA 3BBRA 3N5LA 1MPBA 4RYAA 1RYOA 4TOZA 5EHMA 3OXNA 2XD3A 3HHFA 3IOWA 2NOOA 3FUZA 4C0RA 1ZIUA 1JVXA 2XXHA 1M5FA 3IB2A 4R9FA 2XXWA 1B3EA 1B46A 2LAOA
chains in the Genus database with same CATH superfamily
4KCCA 5IZ3A 3ILUB 3FD3A 4PE3A 1FTMA 3CG3A 3C32A 3RYDA 2PX1A 1USYH 1SW4A 2WKYA 4FEBA 5J1DA 2Q88A 4ELQA 3M3KA 4QF9A 1MXXA 4MNIA 1EH3A 5EQ8A 3GXAA 5F7VA 1NV0A 4WEPA 3SEXA 3EPEA 4GWXA 4F3PA 4NEDA 2D21A 5HM4B 3TZAA 5ICTA 1NNTA 3MZ9A 1BK4A 2B3FA 5I57B 4PAIA 4PFYA 2DYXA 4O8MA 1XS5A 4ELOA 4RNSA 4F29A 2O7UA 3E3KA 1I69A 1FTAA 3T9HB 1Y3QA 1NI9A 4OWDA 4OETA 1NUZA 3FXBA 3KSXA 1B9JA 2Y7IA 3O29A 4MX6A 3OD7A 1HSLA 3JV9A 4LVQA 2VT5A 4I62A 4BDLA 1OQGA 1FBCA 2HXWA 5HBCA 4L17A 3LV0A 2XWIA 3G3GA 1N76A 4HE1A 4XEQA 5EHSA 3TMGA 2V4CA 3OSRA 3TELA 2OWSA 5I2NA 3C34A 4DDDA 1FBPA 1OLAA 4GVOA 4N6DA 2PYYA 1B1HA 2V93A 3JYRA 4C1UA 3SERA 1B3FA 1QW0A 4R6YA 5H8HB 4P11A 4YB7A 3PUXE 2DXYA 4DI4B 4G68B 1SYHA 1JQFA 1QUIA 2F34A 4I8CA 1Z7NE 4EQ9A 3ONMA 4OZ9A 4K3FA 2XHDA 3RY3A 3MP1A 1P99A 4NF6A 3PPPA 2A5SA 2HCAA 1IEJA 2M8CA 3ILTB 4XKPA 5TP9B 4DCYA 3UORA 4IR8A 1BP5A 1SPIA 4N13A 2P0SA 1NV4A 4OMBA 3LR1A 3G3FA 4DZ1A 2O6AA 3V8XB 3IB1A 3A3CA 4F3SA 1IXCA 1LBXA 4QFPA 3UIFA 4GOTA 1P1WA 1QKBA 4GWYA 1B1XA 1B05A 4R2BA 2CEYA 2RC7A 2B4MA 4GWWA 4NMYA 4PTKA 1ZKBA 3LBSA 2Y7RA 3U94A 2PFZA 5ELVA 4OFJA 3PPQA 1LBYA 4GXAA 4XKQA 3R7XA 4YICA 5H8FB 5I56B 3FJMA 5CMKA 3TTMA 3U72A 4LQ2A 4OEVA 5I5PA 2Q2CA 4LONB 3RT6B 1DPPA 4XKRA 4ZS9A 3TTLA 3MSTA 1N3WA 2XXQA 3HV1A 3IFCA 2ZYNA 3O28A 3PGFA 1K9YA 1LB9A 3CIJA 2ONSA 4UA8A 1VSOA 4IO4A 1BTJA 4NF8A 3G3JA 3IJXB 3IFAA 1NNFA 1TT1A 5I58B 3N6UA 2ONKE 4LZ8A 3OSQA 4UACA 4YU0A 3TEPA 1S7YA 2F36A 3QK6A 3OEMA 4PFBA 2VP1A 1B40A 3KOTA 5A5XA 1YYZA 3OO6A 3TQLA 3SDFA 4OVPA 2Y84A 1B5JA 2ZZWA 2UVIA 2Z23A 4ISUA 4PFWA 2X7PA 3KJ7A 1D9YA 4QSEA 4YKJA 4OVTA 1WVJA 4F31B 1LAHE 4YB5A 2F3BA 5JK4A 1JEUA 5T3JA 3U1OA 1FPFA 4YZZA 2RINA 4U1ZA 5FTHA 3B6WA 3VLWA 2HZKA 3H6WA 4MEVA 3SESA 1IMAA 4O94A 1MQDA 2XWOA 2GRVA 1UTBA 3CR9A 2I49A 3K1PA 3K02A 2RCBA 3MP8A 4PQJA 3T9UA 3FVNA 5IM2A 5ISUA 4LATA 3P7IA 2QL3A 5K2XA 3PV0E 2O84X 1CE2A 2JJKA 2ZNUA 1N3XA 2GFEA 1D9VA 4F1VA 3RPLB 1MS7A 3KSJA 1ZBMA 1OIBA 1FBDA 2A5TB 1TFDA 3MAMA 3MBPA 2Z8EA 5ITOA 2RF1A 2O69A 1MXUA 1B7UA 3G3HA 3T93B 1FPJA 4NF4B 1VDWA 2BJJX 3U65A 1GVCA 1H76A 3IK6B 2QSXA 2DS9A 1KA1A 1US5A 1OQHA 2XXIA 1LFGA 4JVCA 4H46A 4KXPA 4ZEBA 3TPAA 2H4IA 1KWHA 3VLUA 4BDQA 1YCJA 5AA2D 4PAFA 1RDXA 4HS7A 3RLFE 1FPKA 4POWA 3H06B 3VFJA 1R9QA 3LSXA 1Y3PA 3O6IA 1A40A 5HPQA 1MY3A 1Y3NA 1LEVA 1LAXA 1XI6A 2DP8A 3VV5A 2KQZA 4NF5A 1LGBC 1MXWA 3JZJA 4GBVA 4P0GA 5EQ9A 1MM7A 2I0BA 4KFQA 5LDZA 4QFNA 2PMSA 2F78A 4GX4A 4RPOA 1PB8A 3Q25A 4XIGQ 1Q1KA 4PFUA 4N6PA 3LUYA 1I6BA 3H7MA 4OHNA 1NKXA 5AA4A 4NGUA 2P2AA 1FJ6A 2O68A 1POY1 4TQUQ 5ET5A 2DWIA 3ZKKA 4Q8RA 1FQFA 4I3YA 1MDQA 3PPNA 2X26A 4TLLB 2FIXA 1JETA 1BLFA 1JW1A 1SYIA 4LUBA 2OBGA 4GX6A 3CFLA 1MQGA 1MRPA 2XXVA 2YLNA 4NWCA 4AS4A 3PU5A 2OCUA 5JEIA 5CRYA 3ZSFA 3PPOA 4MMPA 1LBBA 4NX1A 2XX9A 1FPLA 3K01A 4JDFA 5I59A 5AA2A 3QAXA 4I40A 5JTYA 2XXXA 1VFDA 1ATGA 2ZXTA 1UQWA 1PBPA 3UGWA 4P1EA 4JB7A 2HAUA 2O7IA 2ZYKA 4DXUA 3FASA 4FIMA 5IGAA 3VVFA 4PE5B 1D9QA 3Q28A 1NL5A 2F7CA 1SDXA 4BDNA 4THIA 1H43A 3C36A 4XTCQ 2DE2A 2F7BA 2FBPA 3SKPA 1JNFA 1FTKA 2AL4A 3SEYA 1N7WA 1EYJA 1YTVA 4Q5TA 4QBAA 5CBRA 2GQ1A 4E0XA 3KC1A 4N91A 2ZNTA 3G7WA 4PAKA 3BFUA 4ND9A 4OVQA 3S4UA 3RN8A 3FVKA 3KBZA 3LSWA 1DBZA 4HE2A 1TXFA 3CSBA 4LQ5A 1AMFA 4OTEA 3PUWE 4X9TA 2F6GA 3H6TA 4P3LA 1GTKA 2IA4A 2DWJA 2ZYOA 1PBQA 4MF3A 4P0IA 3HCQA 1N7XA 5KCJA 2D5WA 1FPEA 4IO7A 1G0IA 4DIGA 1IITA 1SI1A 1YPNA 1IMCA 1IXHA 2DWAA 2ZYMA 4C1TA 4KCDA 1USYE 2ZZXA 3VE1B 2VD3A 3SETA 1MPDA 2DE4A 2Z22A 3S2VA 3CSGA 2XXTA 3CRBA 1JW4A 1IMFA 4H65A 3I5OA 4R73A 1O7TA 3M3LA 3QYTA 3PUYE 1JP4A 1MY0A 2Y7WA 2DOJA 4RA1A 3B8BA 4PDHA 2XXYA 2PT2A 4TLMB 1RYXA 3V83A 3DP8A 5TPAA 1B3GA 4G8HA 1RDYA 3MW0A 4JVIA 3FJ7A 2I0CA 3B50A 2THIA 4JBZA 4R6KA 4ONYA 1FPBA 3FV2A 2WBDA 1KA0A 4P1LA 4GLIA 1AL3A 3RTFB 5I84A 5TU0A 4H8IA 1FQBA 1YXIA 2F35A 4IGRA 1I6QA 4IB2A 5ESYA 4JSDA 2PT1A 4F19A 2VD2A 1ZLQA 3SEUA 5FHOA 3OO8A 4WKMA 3O9PA 3FXQA 5I7IA 2OWZA 4R6HA 4PGNA 4GX3A 3TKDA 5I2KB 2H98A 1QKAA 3V89B 1XHYA 5DT6A 1DOTA 4KYDA 3SEWA 4OANA 2XXPA 3L6HA 3KZGA 3F11A 2CMOA 4N6KA 4X04A 4FBPA 4YB6A 5J16A 1SW1A 1N84A 1B7ZA 3THIA 3Q29A 5H8QB 3FXRA 3C9HA 4PBQA 2RCAA 3S9LC 1NV3A 1INPA 1FRPA 4QRZA 4X1DA 1IMEA 2GH9A 5FHNA 3LSFB 1DK4A 2F3DA 3QMFA 1LBZA 3GZGA 4O3AA 3ECRA 3U93A 3FGSA 3E4RA 3UA8A 2XWKA 3VXBA 5ET6A 3KN8A 1R9LA 1FBHA 1US4A 4EDPA 3MC2A 2I4BA 5B70A 3KEIA 2E0SA 1MY1A 1MXYA 3RUMA 3MVXA 1FW0A 5CI5A 3O6HA 5F1QA 4UABA 1EU8A 2FYIA 1FSAA 4PBHA 1A55A 2DSFA 3OELA 1ZU0A 2UYEA 3OOAA 2Q8JA 5FHMA 3FBPA 4XKNA 3EHUA 1LAFE 1SW5A 4NE4A 4GWUA 4PFTA 3CI8A 1N0TA 4N4UA 1Y4CA 1B4HA 2Q8MA 4GWOA 4MH5A 4ZECA 3D4CA 1OMPA 4HCYA 1O63A 4ZEDA 3TUSA 4RXLA 5AE4A 2ANJA 4OVRA 3T22A 2QPQA 3VVEA 2UVJA 2AL5A 3FATA 2R6GE 4BDOA 3M8UA 2DXRA 2UVGA 1IMBA 2B4LA 3TYHA 2NUVA 3PMVA 1NUXA 3GBAA 3FIRA 3TTKA 3IJOB 3IO4A 3G3KA 4YAHX 2B3BA 3D4GA 1UIUA 1PB9A 2PCRA 2P3NA 4NQ8A 4R74A 4M4GA 4FORA 1Y20A 1PB7A 5I57A 4BLAA 4ESXA 4BDMA 2OWTA 3KG2A 4KR5A 3V5AA 4MLQA 1EYKA 2R8TA 3T9VA 4N81A 2WEFA 4GXSB 4PCDA 5DVJA 1GR2A 2X7QA 5H8NB 1UTHB 3KJTA 1B0LA 1RDZA 1LB8A 3IO6A 1DMBA 1NUWA 3E79A 4N15A 5DEXB 4PF6A 4U4XA 1KZ8A 1IQ7A 4ZEIA 5DYHA 1L5TA 5KDTB 2V3TA 3N26A 2QMXA 4GL8A 3H03A 1NNPA 3FZVA 2OJTA 1LBCA 3DELB 1B2HA 2XWVA 3MVWA 3TDJA 2R9JA 2HZLA 5F24A 1K9ZA 1VR5A 5L9OA 1EZOA 3L6GA 3C4MA 5A5LA 3TODA 2ZZVA 3KFMA 3R26A 1EYIA 3K4UA 4G8NA 5H8HA 4PETA 4POXA 4IY5A 4G68A 3K00A 1POTA 4RJZA 1ZJLA 1IUDA 3WAEA 4MJOA 4X1BA 1B5HA 3Q26A 1TFAA 3SEVA 5CMMA 4LA9A 4KYSA 5TP9A 2HFBA 3B7DA 3MWBA 4PF8A 4FEDA 1SQYA 2FHYA 3C31A 1UIVA 4PGPA 5IZ3B 3DP6A 2F8DA 4AB6A 1R6ZA 3TAJA 3DLNA 4JWOA 5IZZA 4KYEA 4EXKA 1CB6A 1FPGA 3E9XA 4GF8A 2DVZA 2VOZA 1TWYA 2OK2A 5ITPA 3RT8A 1M5CA 3VXCA 4GFRA 4ZZAA 1LFIA 4F1UA 5H8FA 5I56A 2DVCA 3TCHA 4F3GA 1A8EA 4LZ5A 2V3UA 1DPEA 4WEDA 4QFOA 2GHAA 2PFYA 3HPIA 3QUJA 4O7MA 2CEXA 3TCGA 3QXMA 2Z8FA 1GGGA 3QSLA 4GBWA 4P8BA 5M2VA 2E1SA 1URGA 1FQDA 1SI0A 2I48A 3S9NC 3HHGA 4FECA 3T96B 4OQOA 1J1NA 2H99A 3EN3A 4AS5A 3MVYA 4Z7EA 5I58A 2I58A 5CMCA 2Q2AA 2CZHA 3O97A 2QS1A 3CVGA 3I6VA 5I2NB 1O64A 2HQ0A 5FTIA 4ELPA 1NV1A 1FJ9A 5DVFA 3IAZA 3LUZA 4DXBA 3FV1A 3PTYA 1NV2A 4O3BA 1LLSA 4OEUA 4G2ZA 4DCXA 1M5EA 2PBWA 2OZZA 1DTZA 1MH4A 3PPRA 1XVXA 3DM0A 2OLBA 1Y4TA 4JSOA 4G68C 1MXZA 4AQ4A 2V84A 2QJEA 3PUVE 4NF6B 4ECFA 3W15C 1D4NA 2FA7A 4MFIA 3B6QA 4RY1A 2QVVA 4F39A 3EKIA 3UK4A 1QUKA 2XA5A 4HXVA 3LC8A 3MPKA 2WBBA 1LBVA 4EQ7A 3W9VA 3GYYA 2IEEA 1P1NA 4U22A 3U8QA 1FTLA 5DTBA 2DQVA 3H6UA 3MUQA 3OEKA 4YKIA 4KPTA 2NXOA 4OA4A 2DDKA 1MQJA 2ONRA 4MBPA 4U4SA 2H25A 3RPLA 2A5TA 1EZPA 1H3DA 3HO7A 4LP2B 4QSCA 4QFKA 1IXIA 1VE4A 1SD3A 1ZMGA 2REJA 1NV7A 4NF4A 4HTGA 1S9TA 3A09A 5L9MA 2H5YA 1OVBA 4JXIA 3BFTA 4H67A 2UXAA 2OX3A 2WX9A 1DCUA 4H6DA 4LN5A 3E78A 4RPNA 3IOTA 3I3VA 4NN3A 1MM6A 3KC0A 1T0KA 5L9SA 3IORA 3KOSA 4IGTA 3H4ZA 4NF8B 1OLCA 1LAGE 2FVZA 3ZKLA 2Y7PA 4JWYA 1YZ0A 4ESWA 3Q27A 3K1NA 5KZTA 4JWXA 3C35A 4I1DA 3K6VA 5ET7A 4U1OA 4OYVA 1B58A 1LCFA 1ELJA 4RK9A 4X8RA 1B51A 5A5XB 4DXCA 1MG1A 4NG7A 4NTLA 3PUZE 4RK2A 1M5BA 4OENA 4IY6A 2DE3A 4Z0IA 1D3KA 4F2OA 4KI0E 1A8FA 5L8DA 3B6TA 2CZKA 4OVJA 3UN6A 3S9EA 2Y7KA 2QFLA 4F18A 2V25A 4G8MA 4PC9A 5ICQA 4Q30B 1WDNA 3KN3A 4F3BA 1UTBB 4H8JA 2KR0A 5LOMA 2I3VA 1H45A 2I6EA 2HXRA 4QFLA 4R9GA 4PFIA 1NH8A 1FCKA 3IL1B 3MJNA 3FVOA 2ESNA 4FATA 2QVUA 3GBBA 3SZPA 4G77A 3K0VA 3RPWA 4KHZE 4ZEFA 4U2RA 3PMXA 5EQAA 4NHBA 3ROJA 1G0HA 4FJPA 2VPNA 1QJMA 3PMWA 3IB0A 2CZLA 1MY4A 4HW8A 2G29A 3K1MA 3M3FA 2O1LA 1NFTA 1AWBA 3PD9A 2O1MA 5ET8A 4H45A 3TCFA 3VDFA 3EQ1A 1P1OA 2YJPA 1IMDA 3IOUA 4IO3A 1B32A 1LBWA 4OFLA 4HE0A 4E0WA 3NOHA 5DVIA 4N17A 1JW5A 3MYUA 1RKMA 4QXDA 1FQCA 3ODBA 3W9WA 2QS3A 4H5GA 3BKIB 3K6XA 4IO5A 3KBRA 1IZ1A 2P1SA 4MLVA 2WYKA 4YMBA 2HEUA 4NF5B 1Q35A 1FTOA 1B3HA 4GWSA 3RGYA 1CNQA 2CZIA 4NAPA 1FBGA 1FBEA 2AYSA 2Y5KA 1XVYA 5IKBA 5EYGA 1B3LA 2R71A 1SVXB 5EYFA 1NV5A 4JVDA 1B4ZA 3T0JA 5AA4B 3S9MC 1FPIA 3EF7A 3HN0A 3WAFA 1Y1ZA 2BJIA 4DLDA 4U21A 2W7YA 4O7IA 5EYHA 1QVSA 3TFLA 3G3IA 3T9XB 4PP0A 4F1YA 2VPOA 2VHAA 3MZBA 3USDA 1Y1MA 1QULA 4IO6A 2ZMBA 3IOVA 3H6VA 4M1VA 3PD8A 4PFRA 4EF1A 1GV8A 3VVDA 1WODA 2ABHA 3AXFA 3O2AA 3A29A 4EUOA 3O6GA 1A54A 5BWJA 1XT8A 2QVRA 4KQPA 3TTNA 3MPLA 1NUYA 5I2KA 1YAEA 5AA2B 5I59B 5I3SA 1MY2A 5JTYB 3CG1A 4ZE9A 1AH5A 1NH7A 5EQ7A 1S50A 1IXGA 1A7LA 3K2DA 1MQHA 2D3IA 5H8QA 1PEBA 2XX8A 4ZDMA 2GHBA 5AA1A 1MQIA 1B5IA 2F7AA 1AOVA 1PDAA 4R2FA 4GL0A 4MAGA 4MHFA 1Q9DA 3CFXA 5CBSA 1FQAA 2ALUA 2F5XA 2RC9A 4GQOA 3BIHA 2XXRA 1MDP1 4NWDA 1IIWA 2I4CA 3MQ9A 4XF5A 4AB5A 4LZ7A 1F9BA 1R1NA 1DSNA 2XD2A 2RKMA 1OVTA 4OERA 4GD5A 2UYFA 4P56A 1II5A 4XXUA 5H8SA 1A99A 3GLBA 1MPCA 1NMUA 1BIYA 2MKZA 2REGA 2Z8DA 1M5DA 3IR1A 1FQEA 5DW8A 4ZE8A 1QUJA 4U23A 3N94A 1Z7ME 2O51A 5KCJB 4MIJA 3LSLA 1VFEA 5IZ1A 2F6PA 2RC8A 3D1RA 4KD5A 2L5VA 2B65A 3OO7A 2H9BA 1B6HA 4EXLA 2XXUA 2Q74A 2NVUB 3KGCA 3MP6A 4F22A 5B7DA 3H3GA 1DTGA 1XC1A 3OENA 3QUFA 1B52A 1Y9UA 1AIVA 3CHGA 3RNNA 3FVGA 3OO9A 4BDRA 1BKAA 4QHQA 2HAVA 2V3QA 1P1UA 4OESA 3RTWB 5TPAB 1LCTA 2G93A 1SBPA 2XXKA 3K6UA 2PVUA 3KN7A 2FNCA 5AA3A 4ELRA 3HSTA 3R6UA 1URDA 2HPGA 3T1BA 5LTCA 5FBPA 3TTRA 1HSEA 1EZ9A 1MH3A 1FTJA 2XX7A 4I9DA 4MNCA 3O66A 2DWHA 3IX1A 4P47A 4YKKA 2QS2A 2Y5LA 5CMBA 1PC3A 3A3UA 3FJGA 2FIEA 1B7HA 4XFEA 4DE8A 5BUUA 2YPNA 4F2QA 4QSDA 3U92A 3K6WA 3FXUA 2QMWA 5CM6A 4DI3D 1I6AA 3VLVA 3E13X 4R75A 3TQWA 2WYPA 4X48A 1URSA 1NNKA 3DP4A 3N6TA 4H5FA 2Q89A 5CC2A 1NV6A 1FPDA 3MZ1A 1ZTYA 4WXJA 4GIZA 4YKPA 2ZNSA 2KLFA 2Q9TA 4OXVA 2NWJA 4EQBA 5H8NA 4FE8A 4P9KA 3UP9A 3ZS6A 1UTHA 2F97A 4G4PA 4N8GA 2I3WA 5IAIA 1B0HA 4PDDA 4H1XA 3ISPA 5DEXA 4NF0A 4Q0CA 4GWZA 3RQTA 4GRKA 4ZZEA 3EHSA 4HCWA 4MNPA 5KDTA 1JVYA 3C33A 3QIMA 1N04A 1XOCA 1HSJA 4FAJA 1MXVA 3T66A 4IO2A 4O3CA 3OMBA 3HFUA 4MCOA 2QS4A 1ANFA 2QRYA 4ZEKA 2AIXA 4YMAA 1H44A 1SW2A 4OFOA 1FBFA 5K2YA 2UVHA 1LSTA 4N07A 1P1QA 3MVZA 1LFHA 2VGQA 4R72A 4H0WA 1JEVA 3EHTA 4EF2A 3CFZA 4N8YA 3BBRA 4G61A 3N5LA 1MPBA 2P3VA 4RYAA 4OVSA 1RYOA 4TOZA 5EHMA 4I3EA 3OXNA 2XD3A 3HHFA 3IOWA 2NOOA 3FUZA 4C0RA 1ZIUA 1JVXA 2XXHA 2HHMA 1M5FA 3IB2A 4R9FA 1QGXA 2XXWA 1B3EA 3BIGA 1B46A 2LAOA
chains in the Genus database with same CATH topology
4KCCA 3ILUB 3FD3A 1FTMA 3CG3A 3C32A 2PX1A 1USYH 1SW4A 2WKYA 4FEBA 5J1DA 2Q88A 4ELQA 3M3KA 4QF9A 1MXXA 1EH3A 3GXAA 5F7VA 4WEPA 3SEXA 3EPEA 4F3PA 4NEDA 2D21A 5HM4B 3TZAA 5ICTA 1NNTA 3MZ9A 2B3FA 5I57B 4PFYA 2DYXA 1XS5A 4ELOA 4RNSA 4F29A 2O7UA 3E3KA 1I69A 3T9HB 1Y3QA 4OWDA 4OETA 3KSXA 1B9JA 2Y7IA 3O29A 3OD7A 1HSLA 3JV9A 4LVQA 4I62A 4BDLA 1OQGA 2HXWA 5HBCA 4L17A 3G3GA 1N76A 5EHSA 3TMGA 3OSRA 3TELA 2OWSA 5I2NA 3C34A 4DDDA 1OLAA 4GVOA 2PYYA 1B1HA 2V93A 3JYRA 4C1UA 3SERA 1B3FA 1QW0A 4R6YA 5H8HB 4P11A 4YB7A 3PUXE 2DXYA 4G68B 1SYHA 1JQFA 1QUIA 2F34A 4I8CA 1Z7NE 4EQ9A 3ONMA 4OZ9A 4K3FA 2XHDA 3RY3A 3MP1A 1P99A 4NF6A 3PPPA 2A5SA 2HCAA 1IEJA 2M8CA 3ILTB 4XKPA 5TP9B 4DCYA 3UORA 1BP5A 4N13A 2P0SA 4OMBA 3LR1A 3G3FA 4DZ1A 2O6AA 3V8XB 3IB1A 3A3CA 4F3SA 1IXCA 4QFPA 3UIFA 4GOTA 1P1WA 1QKBA 1B1XA 1B05A 4R2BA 2RC7A 4NMYA 1ZKBA 3LBSA 2Y7RA 3U94A 5ELVA 4OFJA 3PPQA 4GXAA 4XKQA 3R7XA 4YICA 5H8FB 5I56B 3FJMA 5CMKA 3TTMA 3U72A 4LQ2A 4OEVA 2Q2CA 4LONB 3RT6B 1DPPA 4XKRA 4ZS9A 3TTLA 1N3WA 2XXQA 3HV1A 2ZYNA 3O28A 3PGFA 1LB9A 3CIJA 2ONSA 4UA8A 1VSOA 4IO4A 1BTJA 4NF8A 3G3JA 3IJXB 1NNFA 1TT1A 5I58B 3N6UA 2ONKE 4LZ8A 3OSQA 4UACA 4YU0A 3TEPA 1S7YA 2F36A 3QK6A 3OEMA 2VP1A 1B40A 3KOTA 5A5XA 3OO6A 3TQLA 3SDFA 2Y84A 1B5JA 2UVIA 2Z23A 4ISUA 4PFWA 2X7PA 3KJ7A 1D9YA 4QSEA 4YKJA 1WVJA 4F31B 1LAHE 4YB5A 5JK4A 1JEUA 3U1OA 4YZZA 2RINA 4U1ZA 5FTHA 3B6WA 3VLWA 2HZKA 3H6WA 3SESA 1MQDA 2GRVA 1UTBA 3CR9A 2I49A 3K1PA 3K02A 2RCBA 3MP8A 4PQJA 3T9UA 3FVNA 5ISUA 4LATA 3P7IA 2QL3A 5K2XA 3PV0E 2O84X 1CE2A 2ZNUA 1N3XA 2GFEA 1D9VA 4F1VA 1MS7A 3KSJA 1ZBMA 1OIBA 2A5TB 1TFDA 3MAMA 3MBPA 5ITOA 2Z8EA 2RF1A 2O69A 1MXUA 1B7UA 3G3HA 3T93B 4NF4B 2BJJX 1GVCA 1H76A 3IK6B 2QSXA 2DS9A 1US5A 1OQHA 2XXIA 1LFGA 4ZEBA 3TPAA 2H4IA 1KWHA 3VLUA 4BDQA 1YCJA 5AA2D 4HS7A 3RLFE 4POWA 3H06B 3VFJA 1R9QA 3LSXA 1Y3PA 3O6IA 1A40A 5HPQA 1MY3A 1Y3NA 1LAXA 2DP8A 3VV5A 4NF5A 1LGBC 1MXWA 3JZJA 4P0GA 1MM7A 2I0BA 4KFQA 4QFNA 2PMSA 2F78A 4RPOA 1PB8A 3Q25A 4XIGQ 1Q1KA 4PFUA 4N6PA 3LUYA 1I6BA 3H7MA 4OHNA 1NKXA 5AA4A 2P2AA 2O68A 1POY1 4TQUQ 2DWIA 3ZKKA 4Q8RA 1FQFA 1MDQA 3PPNA 2X26A 4TLLB 1JETA 1BLFA 1JW1A 1SYIA 4LUBA 2OBGA 3CFLA 1MQGA 1MRPA 2XXVA 2YLNA 4NWCA 3PU5A 2OCUA 5JEIA 5CRYA 3ZSFA 3PPOA 1LBBA 2XX9A 3K01A 4JDFA 5I59A 5AA2A 3QAXA 5JTYA 2XXXA 1VFDA 1ATGA 2ZXTA 1UQWA 1PBPA 3UGWA 4JB7A 2HAUA 2O7IA 2ZYKA 4DXUA 3FASA 4FIMA 3VVFA 4PE5B 3Q28A 1NL5A 2F7CA 1SDXA 4BDNA 4THIA 1H43A 3C36A 4XTCQ 2DE2A 2F7BA 3SKPA 1JNFA 1FTKA 2AL4A 3SEYA 1N7WA 1YTVA 4Q5TA 5CBRA 4E0XA 2ZNTA 3G7WA 3BFUA 4ND9A 3S4UA 3RN8A 3FVKA 3LSWA 1TXFA 3CSBA 4LQ5A 1AMFA 4OTEA 3PUWE 4X9TA 2F6GA 3H6TA 1GTKA 2IA4A 2DWJA 2ZYOA 1PBQA 4MF3A 4P0IA 3HCQA 1N7XA 5KCJA 2D5WA 4IO7A 4DIGA 1IITA 1YPNA 1SI1A 1IXHA 2DWAA 2ZYMA 4C1TA 4KCDA 1USYE 3VE1B 2VD3A 3SETA 1MPDA 2DE4A 2Z22A 3S2VA 3CSGA 2XXTA 3CRBA 1JW4A 4H65A 3I5OA 4R73A 1O7TA 3M3LA 3QYTA 3PUYE 1MY0A 2Y7WA 2DOJA 4RA1A 2XXYA 2PT2A 4TLMB 1RYXA 3V83A 3DP8A 5TPAA 1B3GA 4G8HA 3MW0A 3FJ7A 2I0CA 2THIA 4JBZA 4R6KA 4ONYA 3FV2A 4GLIA 1AL3A 3RTFB 5I84A 5TU0A 4H8IA 1FQBA 2F35A 4IGRA 1I6QA 4IB2A 4JSDA 2PT1A 4F19A 2VD2A 1ZLQA 3SEUA 5FHOA 3OO8A 4WKMA 3O9PA 3FXQA 4R6HA 3TKDA 5I2KB 2H98A 1QKAA 3V89B 1XHYA 5DT6A 1DOTA 4KYDA 3SEWA 2XXPA 3L6HA 3KZGA 3F11A 2CMOA 4YB6A 1SW1A 1N84A 1B7ZA 3THIA 3Q29A 5H8QB 3FXRA 3C9HA 2RCAA 3S9LC 4QRZA 4X1DA 2GH9A 5FHNA 3LSFB 3GZGA 4O3AA 3ECRA 3U93A 3FGSA 3E4RA 3UA8A 3VXBA 3KN8A 1R9LA 1US4A 4EDPA 3MC2A 2I4BA 5B70A 3KEIA 2E0SA 1MY1A 1MXYA 3RUMA 3MVXA 1FW0A 5CI5A 3O6HA 5F1QA 1EU8A 2FYIA 1A55A 2DSFA 3OELA 1ZU0A 2UYEA 3OOAA 2Q8JA 5FHMA 4XKNA 3EHUA 1LAFE 1SW5A 4NE4A 4PFTA 3CI8A 1N0TA 1Y4CA 1B4HA 4GWOA 4MH5A 4ZECA 3D4CA 1OMPA 4HCYA 1O63A 4ZEDA 3TUSA 4RXLA 5AE4A 2ANJA 3T22A 2QPQA 3VVEA 2UVJA 2AL5A 3FATA 2R6GE 4BDOA 3M8UA 2DXRA 2UVGA 3TYHA 3TTKA 2NUVA 3PMVA 3GBAA 3FIRA 3IJOB 3IO4A 3G3KA 4YAHX 2B3BA 3D4GA 1UIUA 1PB9A 4R74A 4M4GA 4FORA 1Y20A 1PB7A 5I57A 4BLAA 4ESXA 4BDMA 2OWTA 3KG2A 4KR5A 3V5AA 4MLQA 3T9VA 4GXSB 5DVJA 1GR2A 2X7QA 5H8NB 1UTHB 3KJTA 1B0LA 1LB8A 3IO6A 1DMBA 5DEXB 4U4XA 1IQ7A 4ZEIA 5DYHA 1L5TA 5KDTB 2V3TA 3N26A 2QMXA 4GL8A 3H03A 1NNPA 3FZVA 2OJTA 1LBCA 3DELB 1B2HA 3MVWA 3TDJA 2R9JA 2HZLA 1VR5A 5L9OA 1EZOA 3L6GA 3C4MA 3TODA 3KFMA 3R26A 3K4UA 4G8NA 5H8HA 4PETA 4POXA 4IY5A 4G68A 3K00A 1POTA 4RJZA 1ZJLA 1IUDA 3WAEA 4X1BA 1B5HA 3Q26A 1TFAA 3SEVA 5CMMA 4LA9A 4KYSA 5TP9A 2HFBA 3B7DA 3MWBA 4FEDA 1SQYA 3C31A 1UIVA 3DP6A 2F8DA 4AB6A 1R6ZA 3TAJA 3DLNA 4JWOA 4KYEA 4EXKA 1CB6A 3E9XA 4GF8A 2DVZA 2VOZA 1TWYA 2OK2A 5ITPA 3RT8A 1M5CA 3VXCA 4GFRA 4ZZAA 1LFIA 4F1UA 5H8FA 5I56A 2DVCA 3TCHA 4F3GA 1A8EA 4LZ5A 2V3UA 1DPEA 4WEDA 4QFOA 2GHAA 3HPIA 3QUJA 3TCGA 3QXMA 2Z8FA 1GGGA 3QSLA 5M2VA 2E1SA 1URGA 1FQDA 1SI0A 2I48A 3S9NC 3HHGA 4FECA 3T96B 4OQOA 1J1NA 2H99A 3EN3A 3MVYA 4Z7EA 5I58A 2I58A 5CMCA 2Q2AA 3O97A 2QS1A 3CVGA 3I6VA 5I2NB 1O64A 2HQ0A 5FTIA 4ELPA 5DVFA 3IAZA 4DXBA 3FV1A 4O3BA 1LLSA 4OEUA 4G2ZA 4DCXA 1M5EA 2PBWA 2OZZA 1DTZA 1MH4A 3PPRA 1XVXA 3DM0A 2OLBA 1Y4TA 4JSOA 4G68C 1MXZA 4AQ4A 2V84A 2QJEA 3PUVE 4NF6B 4ECFA 3W15C 1D4NA 2FA7A 4MFIA 3B6QA 4RY1A 4F39A 3UK4A 1QUKA 3LC8A 3MPKA 4EQ7A 3W9VA 2IEEA 1P1NA 4U22A 3U8QA 1FTLA 5DTBA 2DQVA 3H6UA 3MUQA 3OEKA 4YKIA 4KPTA 2NXOA 1MQJA 2ONRA 4MBPA 4U4SA 2H25A 2A5TA 1EZPA 1H3DA 3HO7A 4LP2B 4QSCA 4QFKA 1IXIA 1VE4A 1SD3A 1ZMGA 2REJA 4NF4A 4HTGA 1S9TA 3A09A 5L9MA 2H5YA 1OVBA 4JXIA 3BFTA 4H67A 2UXAA 4H6DA 4RPNA 3IOTA 3I3VA 1T0KA 1MM6A 5L9SA 3IORA 3KOSA 4IGTA 3H4ZA 4NF8B 1OLCA 1LAGE 3ZKLA 2Y7PA 4JWYA 4ESWA 3Q27A 3K1NA 5KZTA 4JWXA 3C35A 4I1DA 3K6VA 4U1OA 4OYVA 1B58A 1LCFA 1ELJA 4RK9A 1B51A 5A5XB 4DXCA 1MG1A 4NTLA 3PUZE 4RK2A 1M5BA 4OENA 4IY6A 2DE3A 4Z0IA 1D3KA 4F2OA 4KI0E 1A8FA 5L8DA 3B6TA 4OVJA 3UN6A 3S9EA 2Y7KA 4F18A 2V25A 4G8MA 5ICQA 4Q30B 1WDNA 3KN3A 4F3BA 1UTBB 4H8JA 5LOMA 2I3VA 1H45A 2I6EA 4QFLA 4R9GA 1NH8A 1FCKA 3IL1B 3MJNA 3FVOA 2ESNA 4FATA 3GBBA 4G77A 3K0VA 3RPWA 4ZEFA 4KHZE 4U2RA 3PMXA 4FJPA 1QJMA 3PMWA 3IB0A 2CZLA 1MY4A 4HW8A 2G29A 3K1MA 3M3FA 2O1LA 1NFTA 3PD9A 2O1MA 3TCFA 3VDFA 3EQ1A 1P1OA 2YJPA 3IOUA 4IO3A 1B32A 4OFLA 4E0WA 5DVIA 1JW5A 1RKMA 1FQCA 3ODBA 3W9WA 2QS3A 4H5GA 3BKIB 3K6XA 4IO5A 3KBRA 1IZ1A 2P1SA 4MLVA 4YMBA 2HEUA 4NF5B 1Q35A 1FTOA 1B3HA 3RGYA 2AYSA 1XVYA 5IKBA 1B3LA 2R71A 1SVXB 5EYFA 1B4ZA 5AA4B 3S9MC 3EF7A 3HN0A 3WAFA 1Y1ZA 4DLDA 4U21A 2W7YA 1QVSA 3TFLA 3G3IA 3T9XB 4PP0A 4F1YA 2VHAA 3MZBA 3USDA 1Y1MA 1QULA 4IO6A 2ZMBA 3IOVA 3H6VA 4M1VA 3PD8A 4EF1A 1GV8A 3VVDA 1WODA 2ABHA 3AXFA 3O2AA 4EUOA 3O6GA 1A54A 5BWJA 1XT8A 4KQPA 3TTNA 3MPLA 5I2KA 1YAEA 5AA2B 5I59B 1MY2A 5JTYB 3CG1A 4ZE9A 1AH5A 1NH7A 1S50A 1IXGA 1A7LA 3K2DA 1MQHA 2D3IA 5H8QA 1PEBA 2XX8A 4ZDMA 2GHBA 5AA1A 1MQIA 1B5IA 2F7AA 1AOVA 1PDAA 4R2FA 4GL0A 3CFXA 5CBSA 1FQAA 2ALUA 2F5XA 2RC9A 4GQOA 2XXRA 1MDP1 4NWDA 1IIWA 2I4CA 3MQ9A 4AB5A 4LZ7A 1F9BA 1R1NA 1DSNA 2XD2A 2RKMA 1OVTA 4OERA 4GD5A 2UYFA 1II5A 4XXUA 5H8SA 1A99A 3GLBA 1MPCA 1NMUA 1BIYA 2REGA 2Z8DA 1M5DA 3IR1A 1FQEA 4ZE8A 1QUJA 4U23A 3N94A 1Z7ME 2O51A 5KCJB 3LSLA 1VFEA 2F6PA 2RC8A 4KD5A 2B65A 3OO7A 2H9BA 1B6HA 4EXLA 2XXUA 2NVUB 3KGCA 3MP6A 4F22A 5B7DA 3H3GA 1DTGA 1XC1A 3OENA 3QUFA 1B52A 1Y9UA 1AIVA 3RNNA 3FVGA 3OO9A 4BDRA 1BKAA 4QHQA 2HAVA 2V3QA 1P1UA 4OESA 3RTWB 5TPAB 1LCTA 2G93A 1SBPA 3K6UA 2PVUA 3KN7A 2FNCA 5AA3A 4ELRA 3HSTA 3R6UA 1URDA 3TTRA 1HSEA 1EZ9A 1MH3A 1FTJA 2XX7A 4I9DA 3O66A 2DWHA 3IX1A 4YKKA 2QS2A 5CMBA 1PC3A 3A3UA 3FJGA 1B7HA 4DE8A 5BUUA 2YPNA 4F2QA 4QSDA 3U92A 3K6WA 3FXUA 2QMWA 5CM6A 1I6AA 3VLVA 3E13X 4R75A 3TQWA 4X48A 1URSA 1NNKA 3DP4A 3N6TA 4H5FA 2Q89A 5CC2A 3MZ1A 1ZTYA 4WXJA 4GIZA 4YKPA 2ZNSA 2KLFA 2Q9TA 4OXVA 2NWJA 4EQBA 5H8NA 4FE8A 3UP9A 3ZS6A 1UTHA 2F97A 4G4PA 2I3WA 5IAIA 1B0HA 4H1XA 5DEXA 4Q0CA 3RQTA 4GRKA 4ZZEA 3EHSA 4HCWA 5KDTA 1JVYA 3C33A 3QIMA 1N04A 1XOCA 4FAJA 1HSJA 1MXVA 3T66A 4IO2A 4O3CA 3OMBA 2QS4A 1ANFA 2QRYA 4ZEKA 2AIXA 4YMAA 1H44A 1SW2A 4OFOA 5K2YA 2UVHA 1LSTA 4N07A 1P1QA 3MVZA 1LFHA 2VGQA 4R72A 4H0WA 1JEVA 3EHTA 4EF2A 3CFZA 3BBRA 3N5LA 1MPBA 4RYAA 1RYOA 4TOZA 5EHMA 3OXNA 2XD3A 3HHFA 3IOWA 2NOOA 3FUZA 4C0RA 1ZIUA 1JVXA 2XXHA 1M5FA 3IB2A 4R9FA 2XXWA 1B3EA 1B46A 2LAOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KCC A;  3ILU B;  3FD3 A;  1FTM A;  3CG3 A;  3C32 A;  2PX1 A;  1USY H;  1SW4 A;  2WKY A;  4FEB A;  5J1D A;  2Q88 A;  4ELQ A;  3M3K A;  4QF9 A;  1MXX A;  1EH3 A;  3GXA A;  5F7V A;  4WEP A;  3SEX A;  3EPE A;  4F3P A;  4NED A;  2D21 A;  5HM4 B;  3TZA A;  5ICT A;  1NNT A;  3MZ9 A;  2B3F A;  5I57 B;  4PFY A;  2DYX A;  1XS5 A;  4ELO A;  4RNS A;  4F29 A;  2O7U A;  3E3K A;  1I69 A;  3T9H B;  1Y3Q A;  4OWD A;  4OET A;  3KSX A;  1B9J A;  2Y7I A;  3O29 A;  3OD7 A;  1HSL A;  3JV9 A;  4LVQ A;  4I62 A;  4BDL A;  1OQG A;  2HXW A;  5HBC A;  4L17 A;  3G3G A;  1N76 A;  5EHS A;  3TMG A;  3OSR A;  3TEL A;  2OWS A;  5I2N A;  3C34 A;  4DDD A;  1OLA A;  4GVO A;  2PYY A;  1B1H A;  2V93 A;  3JYR A;  4C1U A;  3SER A;  1B3F A;  1QW0 A;  4R6Y A;  5H8H B;  4P11 A;  4YB7 A;  3PUX E;  2DXY A;  4G68 B;  1SYH A;  1JQF A;  1QUI A;  2F34 A;  4I8C A;  1Z7N E;  4EQ9 A;  3ONM A;  4OZ9 A;  4K3F A;  2XHD A;  3RY3 A;  3MP1 A;  1P99 A;  4NF6 A;  3PPP A;  2A5S A;  2HCA A;  1IEJ A;  2M8C A;  3ILT B;  4XKP A;  5TP9 B;  4DCY A;  3UOR A;  1BP5 A;  4N13 A;  2P0S A;  4OMB A;  3LR1 A;  3G3F A;  4DZ1 A;  2O6A A;  3V8X B;  3IB1 A;  3A3C A;  4F3S A;  1IXC A;  4QFP A;  3UIF A;  4GOT A;  1P1W A;  1QKB A;  1B1X A;  1B05 A;  4R2B A;  2RC7 A;  4NMY A;  1ZKB A;  3LBS A;  2Y7R A;  3U94 A;  5ELV A;  4OFJ A;  3PPQ A;  4GXA A;  4XKQ A;  3R7X A;  4YIC A;  5H8F B;  5I56 B;  3FJM A;  5CMK A;  3TTM A;  3U72 A;  4LQ2 A;  4OEV A;  2Q2C A;  4LON B;  3RT6 B;  1DPP A;  4XKR A;  4ZS9 A;  3TTL A;  1N3W A;  2XXQ A;  3HV1 A;  2ZYN A;  3O28 A;  3PGF A;  1LB9 A;  3CIJ A;  2ONS A;  4UA8 A;  1VSO A;  4IO4 A;  1BTJ A;  4NF8 A;  3G3J A;  3IJX B;  1NNF A;  1TT1 A;  5I58 B;  3N6U A;  2ONK E;  4LZ8 A;  3OSQ A;  4UAC A;  4YU0 A;  3TEP A;  1S7Y A;  2F36 A;  3QK6 A;  3OEM A;  2VP1 A;  1B40 A;  3KOT A;  5A5X A;  3OO6 A;  3TQL A;  3SDF A;  2Y84 A;  1B5J A;  2UVI A;  2Z23 A;  4ISU A;  4PFW A;  2X7P A;  3KJ7 A;  1D9Y A;  4QSE A;  4YKJ A;  1WVJ A;  4F31 B;  1LAH E;  4YB5 A;  5JK4 A;  1JEU A;  3U1O A;  4YZZ A;  2RIN A;  4U1Z A;  5FTH A;  3B6W A;  3VLW A;  2HZK A;  3H6W A;  3SES A;  1MQD A;  2GRV A;  1UTB A;  3CR9 A;  2I49 A;  3K1P A;  3K02 A;  2RCB A;  3MP8 A;  4PQJ A;  3T9U A;  3FVN A;  5ISU A;  4LAT A;  3P7I A;  2QL3 A;  5K2X A;  3PV0 E;  2O84 X;  1CE2 A;  2ZNU A;  1N3X A;  2GFE A;  1D9V A;  4F1V A;  1MS7 A;  3KSJ A;  1ZBM A;  1OIB A;  2A5T B;  1TFD A;  3MAM A;  3MBP A;  5ITO A;  2Z8E A;  2RF1 A;  2O69 A;  1MXU A;  1B7U A;  3G3H A;  3T93 B;  4NF4 B;  2BJJ X;  1GVC A;  1H76 A;  3IK6 B;  2QSX A;  2DS9 A;  1US5 A;  1OQH A;  2XXI A;  1LFG A;  4ZEB A;  3TPA A;  2H4I A;  1KWH A;  3VLU A;  4BDQ A;  1YCJ A;  5AA2 D;  4HS7 A;  3RLF E;  4POW A;  3H06 B;  3VFJ A;  1R9Q A;  3LSX A;  1Y3P A;  3O6I A;  1A40 A;  5HPQ A;  1MY3 A;  1Y3N A;  1LAX A;  2DP8 A;  3VV5 A;  4NF5 A;  1LGB C;  1MXW A;  3JZJ A;  4P0G A;  1MM7 A;  2I0B A;  4KFQ A;  4QFN A;  2PMS A;  2F78 A;  4RPO A;  1PB8 A;  3Q25 A;  4XIG Q;  1Q1K A;  4PFU A;  4N6P A;  3LUY A;  1I6B A;  3H7M A;  4OHN A;  1NKX A;  5AA4 A;  2P2A A;  2O68 A;  1POY 1;  4TQU Q;  2DWI A;  3ZKK A;  4Q8R A;  1FQF A;  1MDQ A;  3PPN A;  2X26 A;  4TLL B;  1JET A;  1BLF A;  1JW1 A;  1SYI A;  4LUB A;  2OBG A;  3CFL A;  1MQG A;  1MRP A;  2XXV A;  2YLN A;  4NWC A;  3PU5 A;  2OCU A;  5JEI A;  5CRY A;  3ZSF A;  3PPO A;  1LBB A;  2XX9 A;  3K01 A;  4JDF A;  5I59 A;  5AA2 A;  3QAX A;  5JTY A;  2XXX A;  1VFD A;  1ATG A;  2ZXT A;  1UQW A;  1PBP A;  3UGW A;  4JB7 A;  2HAU A;  2O7I A;  2ZYK A;  4DXU A;  3FAS A;  4FIM A;  3VVF A;  4PE5 B;  3Q28 A;  1NL5 A;  2F7C A;  1SDX A;  4BDN A;  4THI A;  1H43 A;  3C36 A;  4XTC Q;  2DE2 A;  2F7B A;  3SKP A;  1JNF A;  1FTK A;  2AL4 A;  3SEY A;  1N7W A;  1YTV A;  4Q5T A;  5CBR A;  4E0X A;  2ZNT A;  3G7W A;  3BFU A;  4ND9 A;  3S4U A;  3RN8 A;  3FVK A;  3LSW A;  1TXF A;  3CSB A;  4LQ5 A;  1AMF A;  4OTE A;  3PUW E;  4X9T A;  2F6G A;  3H6T A;  1GTK A;  2IA4 A;  2DWJ A;  2ZYO A;  1PBQ A;  4MF3 A;  4P0I A;  3HCQ A;  1N7X A;  5KCJ A;  2D5W A;  4IO7 A;  4DIG A;  1IIT A;  1YPN A;  1SI1 A;  1IXH A;  2DWA A;  2ZYM A;  4C1T A;  4KCD A;  1USY E;  3VE1 B;  2VD3 A;  3SET A;  1MPD A;  2DE4 A;  2Z22 A;  3S2V A;  3CSG A;  2XXT A;  3CRB A;  1JW4 A;  4H65 A;  3I5O A;  4R73 A;  1O7T A;  3M3L A;  3QYT A;  3PUY E;  1MY0 A;  2Y7W A;  2DOJ A;  4RA1 A;  2XXY A;  2PT2 A;  4TLM B;  1RYX A;  3V83 A;  3DP8 A;  5TPA A;  1B3G A;  4G8H A;  3MW0 A;  3FJ7 A;  2I0C A;  2THI A;  4JBZ A;  4R6K A;  4ONY A;  3FV2 A;  4GLI A;  1AL3 A;  3RTF B;  5I84 A;  5TU0 A;  4H8I A;  1FQB A;  2F35 A;  4IGR A;  1I6Q A;  4IB2 A;  4JSD A;  2PT1 A;  4F19 A;  2VD2 A;  1ZLQ A;  3SEU A;  5FHO A;  3OO8 A;  4WKM A;  3O9P A;  3FXQ A;  4R6H A;  3TKD A;  5I2K B;  2H98 A;  1QKA A;  3V89 B;  1XHY A;  5DT6 A;  1DOT A;  4KYD A;  3SEW A;  2XXP A;  3L6H A;  3KZG A;  3F11 A;  2CMO A;  4YB6 A;  1SW1 A;  1N84 A;  1B7Z A;  3THI A;  3Q29 A;  5H8Q B;  3FXR A;  3C9H A;  2RCA A;  3S9L C;  4QRZ A;  4X1D A;  2GH9 A;  5FHN A;  3LSF B;  3GZG A;  4O3A A;  3ECR A;  3U93 A;  3FGS A;  3E4R A;  3UA8 A;  3VXB A;  3KN8 A;  1R9L A;  1US4 A;  4EDP A;  3MC2 A;  2I4B A;  5B70 A;  3KEI A;  2E0S A;  1MY1 A;  1MXY A;  3RUM A;  3MVX A;  1FW0 A;  5CI5 A;  3O6H A;  5F1Q A;  1EU8 A;  2FYI A;  1A55 A;  2DSF A;  3OEL A;  1ZU0 A;  2UYE A;  3OOA A;  2Q8J A;  5FHM A;  4XKN A;  3EHU A;  1LAF E;  1SW5 A;  4NE4 A;  4PFT A;  3CI8 A;  1N0T A;  1Y4C A;  1B4H A;  4GWO A;  4MH5 A;  4ZEC A;  3D4C A;  1OMP A;  4HCY A;  1O63 A;  4ZED A;  3TUS A;  4RXL A;  5AE4 A;  2ANJ A;  3T22 A;  2QPQ A;  3VVE A;  2UVJ A;  2AL5 A;  3FAT A;  2R6G E;  4BDO A;  3M8U A;  2DXR A;  2UVG A;  3TYH A;  3TTK A;  2NUV A;  3PMV A;  3GBA A;  3FIR A;  3IJO B;  3IO4 A;  3G3K A;  4YAH X;  2B3B A;  3D4G A;  1UIU A;  1PB9 A;  4R74 A;  4M4G A;  4FOR A;  1Y20 A;  1PB7 A;  5I57 A;  4BLA A;  4ESX A;  4BDM A;  2OWT A;  3KG2 A;  4KR5 A;  3V5A A;  4MLQ A;  3T9V A;  4GXS B;  5DVJ A;  1GR2 A;  2X7Q A;  5H8N B;  1UTH B;  3KJT A;  1B0L A;  1LB8 A;  3IO6 A;  1DMB A;  5DEX B;  4U4X A;  1IQ7 A;  4ZEI A;  5DYH A;  1L5T A;  5KDT B;  2V3T A;  3N26 A;  2QMX A;  4GL8 A;  3H03 A;  1NNP A;  3FZV A;  2OJT A;  1LBC A;  3DEL B;  1B2H A;  3MVW A;  3TDJ A;  2R9J A;  2HZL A;  1VR5 A;  5L9O A;  1EZO A;  3L6G A;  3C4M A;  3TOD A;  3KFM A;  3R26 A;  3K4U A;  4G8N A;  5H8H A;  4PET A;  4POX A;  4IY5 A;  4G68 A;  3K00 A;  1POT A;  4RJZ A;  1ZJL A;  1IUD A;  3WAE A;  4X1B A;  1B5H A;  3Q26 A;  1TFA A;  3SEV A;  5CMM A;  4LA9 A;  4KYS A;  5TP9 A;  2HFB A;  3B7D A;  3MWB A;  4FED A;  1SQY A;  3C31 A;  1UIV A;  3DP6 A;  2F8D A;  4AB6 A;  1R6Z A;  3TAJ A;  3DLN A;  4JWO A;  4KYE A;  4EXK A;  1CB6 A;  3E9X A;  4GF8 A;  2DVZ A;  2VOZ A;  1TWY A;  2OK2 A;  5ITP A;  3RT8 A;  1M5C A;  3VXC A;  4GFR A;  4ZZA A;  1LFI A;  4F1U A;  5H8F A;  5I56 A;  2DVC A;  3TCH A;  4F3G A;  1A8E A;  4LZ5 A;  2V3U A;  1DPE A;  4WED A;  4QFO A;  2GHA A;  3HPI A;  3QUJ A;  3TCG A;  3QXM A;  2Z8F A;  1GGG A;  3QSL A;  5M2V A;  2E1S A;  1URG A;  1FQD A;  1SI0 A;  2I48 A;  3S9N C;  3HHG A;  4FEC A;  3T96 B;  4OQO A;  1J1N A;  2H99 A;  3EN3 A;  3MVY A;  4Z7E A;  5I58 A;  2I58 A;  5CMC A;  2Q2A A;  3O97 A;  2QS1 A;  3CVG A;  3I6V A;  5I2N B;  1O64 A;  2HQ0 A;  5FTI A;  4ELP A;  5DVF A;  3IAZ A;  4DXB A;  3FV1 A;  4O3B A;  1LLS A;  4OEU A;  4G2Z A;  4DCX A;  1M5E A;  2PBW A;  2OZZ A;  1DTZ A;  1MH4 A;  3PPR A;  1XVX A;  3DM0 A;  2OLB A;  1Y4T A;  4JSO A;  4G68 C;  1MXZ A;  4AQ4 A;  2V84 A;  2QJE A;  3PUV E;  4NF6 B;  4ECF A;  3W15 C;  1D4N A;  2FA7 A;  4MFI A;  3B6Q A;  4RY1 A;  4F39 A;  3UK4 A;  1QUK A;  3LC8 A;  3MPK A;  4EQ7 A;  3W9V A;  2IEE A;  1P1N A;  4U22 A;  3U8Q A;  1FTL A;  5DTB A;  2DQV A;  3H6U A;  3MUQ A;  3OEK A;  4YKI A;  4KPT A;  2NXO A;  1MQJ A;  2ONR A;  4MBP A;  4U4S A;  2H25 A;  2A5T A;  1EZP A;  1H3D A;  3HO7 A;  4LP2 B;  4QSC A;  4QFK A;  1IXI A;  1VE4 A;  1SD3 A;  1ZMG A;  2REJ A;  4NF4 A;  4HTG A;  1S9T A;  3A09 A;  5L9M A;  2H5Y A;  1OVB A;  4JXI A;  3BFT A;  4H67 A;  2UXA A;  4H6D A;  4RPN A;  3IOT A;  3I3V A;  1T0K A;  1MM6 A;  5L9S A;  3IOR A;  3KOS A;  4IGT A;  3H4Z A;  4NF8 B;  1OLC A;  1LAG E;  3ZKL A;  2Y7P A;  4JWY A;  4ESW A;  3Q27 A;  3K1N A;  5KZT A;  4JWX A;  3C35 A;  4I1D A;  3K6V A;  4U1O A;  4OYV A;  1B58 A;  1LCF A;  1ELJ A;  4RK9 A;  1B51 A;  5A5X B;  4DXC A;  1MG1 A;  4NTL A;  3PUZ E;  4RK2 A;  1M5B A;  4OEN A;  4IY6 A;  2DE3 A;  4Z0I A;  1D3K A;  4F2O A;  4KI0 E;  1A8F A;  5L8D A;  3B6T A;  4OVJ A;  3UN6 A;  3S9E A;  2Y7K A;  4F18 A;  2V25 A;  4G8M A;  5ICQ A;  4Q30 B;  1WDN A;  3KN3 A;  4F3B A;  1UTB B;  4H8J A;  5LOM A;  2I3V A;  1H45 A;  2I6E A;  4QFL A;  4R9G A;  1NH8 A;  1FCK A;  3IL1 B;  3MJN A;  3FVO A;  2ESN A;  4FAT A;  3GBB A;  4G77 A;  3K0V A;  3RPW A;  4ZEF A;  4KHZ E;  4U2R A;  3PMX A;  4FJP A;  1QJM A;  3PMW A;  3IB0 A;  2CZL A;  1MY4 A;  4HW8 A;  2G29 A;  3K1M A;  3M3F A;  2O1L A;  1NFT A;  3PD9 A;  2O1M A;  3TCF A;  3VDF A;  3EQ1 A;  1P1O A;  2YJP A;  3IOU A;  4IO3 A;  1B32 A;  4OFL A;  4E0W A;  5DVI A;  1JW5 A;  1RKM A;  1FQC A;  3ODB A;  3W9W A;  2QS3 A;  4H5G A;  3BKI B;  3K6X A;  4IO5 A;  3KBR A;  1IZ1 A;  2P1S A;  4MLV A;  4YMB A;  2HEU A;  4NF5 B;  1Q35 A;  1FTO A;  1B3H A;  3RGY A;  2AYS A;  1XVY A;  5IKB A;  1B3L A;  2R71 A;  1SVX B;  5EYF A;  1B4Z A;  5AA4 B;  3S9M C;  3EF7 A;  3HN0 A;  3WAF A;  1Y1Z A;  4DLD A;  4U21 A;  2W7Y A;  1QVS A;  3TFL A;  3G3I A;  3T9X B;  4PP0 A;  4F1Y A;  2VHA A;  3MZB A;  3USD A;  1Y1M A;  1QUL A;  4IO6 A;  2ZMB A;  3IOV A;  3H6V A;  4M1V A;  3PD8 A;  4EF1 A;  1GV8 A;  3VVD A;  1WOD A;  2ABH A;  3AXF A;  3O2A A;  4EUO A;  3O6G A;  1A54 A;  5BWJ A;  1XT8 A;  4KQP A;  3TTN A;  3MPL A;  5I2K A;  1YAE A;  5AA2 B;  5I59 B;  1MY2 A;  5JTY B;  3CG1 A;  4ZE9 A;  1AH5 A;  1NH7 A;  1S50 A;  1IXG A;  1A7L A;  3K2D A;  1MQH A;  2D3I A;  5H8Q A;  1PEB A;  2XX8 A;  4ZDM A;  2GHB A;  5AA1 A;  1MQI A;  1B5I A;  2F7A A;  1AOV A;  1PDA A;  4R2F A;  4GL0 A;  3CFX A;  5CBS A;  1FQA A;  2ALU A;  2F5X A;  2RC9 A;  4GQO A;  2XXR A;  1MDP 1;  4NWD A;  1IIW A;  2I4C A;  3MQ9 A;  4AB5 A;  4LZ7 A;  1F9B A;  1R1N A;  1DSN A;  2XD2 A;  2RKM A;  1OVT A;  4OER A;  4GD5 A;  2UYF A;  1II5 A;  4XXU A;  5H8S A;  1A99 A;  3GLB A;  1MPC A;  1NMU A;  1BIY A;  2REG A;  2Z8D A;  1M5D A;  3IR1 A;  1FQE A;  4ZE8 A;  1QUJ A;  4U23 A;  3N94 A;  1Z7M E;  2O51 A;  5KCJ B;  3LSL A;  1VFE A;  2F6P A;  2RC8 A;  4KD5 A;  2B65 A;  3OO7 A;  2H9B A;  1B6H A;  4EXL A;  2XXU A;  2NVU B;  3KGC A;  3MP6 A;  4F22 A;  5B7D A;  3H3G A;  1DTG A;  1XC1 A;  3OEN A;  3QUF A;  1B52 A;  1Y9U A;  1AIV A;  3RNN A;  3FVG A;  3OO9 A;  4BDR A;  1BKA A;  4QHQ A;  2HAV A;  2V3Q A;  1P1U A;  4OES A;  3RTW B;  5TPA B;  1LCT A;  2G93 A;  1SBP A;  3K6U A;  2PVU A;  3KN7 A;  2FNC A;  5AA3 A;  4ELR A;  3HST A;  3R6U A;  1URD A;  3TTR A;  1HSE A;  1EZ9 A;  1MH3 A;  1FTJ A;  2XX7 A;  4I9D A;  3O66 A;  2DWH A;  3IX1 A;  4YKK A;  2QS2 A;  5CMB A;  1PC3 A;  3A3U A;  3FJG A;  1B7H A;  4DE8 A;  5BUU A;  2YPN A;  4F2Q A;  4QSD A;  3U92 A;  3K6W A;  3FXU A;  2QMW A;  5CM6 A;  1I6A A;  3VLV A;  3E13 X;  4R75 A;  3TQW A;  4X48 A;  1URS A;  1NNK A;  3DP4 A;  3N6T A;  4H5F A;  2Q89 A;  5CC2 A;  3MZ1 A;  1ZTY A;  4WXJ A;  4GIZ A;  4YKP A;  2ZNS A;  2KLF A;  2Q9T A;  4OXV A;  2NWJ A;  4EQB A;  5H8N A;  4FE8 A;  3UP9 A;  3ZS6 A;  1UTH A;  2F97 A;  4G4P A;  2I3W A;  5IAI A;  1B0H A;  4H1X A;  5DEX A;  4Q0C A;  3RQT A;  4GRK A;  4ZZE A;  3EHS A;  4HCW A;  5KDT A;  1JVY A;  3C33 A;  3QIM A;  1N04 A;  1XOC A;  4FAJ A;  1HSJ A;  1MXV A;  3T66 A;  4IO2 A;  4O3C A;  3OMB A;  2QS4 A;  1ANF A;  2QRY A;  4ZEK A;  2AIX A;  4YMA A;  1H44 A;  1SW2 A;  4OFO A;  5K2Y A;  2UVH A;  1LST A;  4N07 A;  1P1Q A;  3MVZ A;  1LFH A;  2VGQ A;  4R72 A;  4H0W A;  1JEV A;  3EHT A;  4EF2 A;  3CFZ A;  3BBR A;  3N5L A;  1MPB A;  4RYA A;  1RYO A;  4TOZ A;  5EHM A;  3OXN A;  2XD3 A;  3HHF A;  3IOW A;  2NOO A;  3FUZ A;  4C0R A;  1ZIU A;  1JVX A;  2XXH A;  1M5F A;  3IB2 A;  4R9F A;  2XXW A;  1B3E A;  1B46 A;  2LAO A; 
#chains in the Genus database with same CATH topology
 4KCC A;  5IZ3 A;  3ILU B;  3FD3 A;  4PE3 A;  1FTM A;  3CG3 A;  3C32 A;  3RYD A;  2PX1 A;  1USY H;  1SW4 A;  2WKY A;  4FEB A;  5J1D A;  2Q88 A;  4ELQ A;  3M3K A;  4QF9 A;  1MXX A;  4MNI A;  1EH3 A;  5EQ8 A;  3GXA A;  5F7V A;  1NV0 A;  4WEP A;  3SEX A;  3EPE A;  4GWX A;  4F3P A;  4NED A;  2D21 A;  5HM4 B;  3TZA A;  5ICT A;  1NNT A;  3MZ9 A;  1BK4 A;  2B3F A;  5I57 B;  4PAI A;  4PFY A;  2DYX A;  4O8M A;  1XS5 A;  4ELO A;  4RNS A;  4F29 A;  2O7U A;  3E3K A;  1I69 A;  1FTA A;  3T9H B;  1Y3Q A;  1NI9 A;  4OWD A;  4OET A;  1NUZ A;  3FXB A;  3KSX A;  1B9J A;  2Y7I A;  3O29 A;  4MX6 A;  3OD7 A;  1HSL A;  3JV9 A;  4LVQ A;  2VT5 A;  4I62 A;  4BDL A;  1OQG A;  1FBC A;  2HXW A;  5HBC A;  4L17 A;  3LV0 A;  2XWI A;  3G3G A;  1N76 A;  4HE1 A;  4XEQ A;  5EHS A;  3TMG A;  2V4C A;  3OSR A;  3TEL A;  2OWS A;  5I2N A;  3C34 A;  4DDD A;  1FBP A;  1OLA A;  4GVO A;  4N6D A;  2PYY A;  1B1H A;  2V93 A;  3JYR A;  4C1U A;  3SER A;  1B3F A;  1QW0 A;  4R6Y A;  5H8H B;  4P11 A;  4YB7 A;  3PUX E;  2DXY A;  4DI4 B;  4G68 B;  1SYH A;  1JQF A;  1QUI A;  2F34 A;  4I8C A;  1Z7N E;  4EQ9 A;  3ONM A;  4OZ9 A;  4K3F A;  2XHD A;  3RY3 A;  3MP1 A;  1P99 A;  4NF6 A;  3PPP A;  2A5S A;  2HCA A;  1IEJ A;  2M8C A;  3ILT B;  4XKP A;  5TP9 B;  4DCY A;  3UOR A;  4IR8 A;  1BP5 A;  1SPI A;  4N13 A;  2P0S A;  1NV4 A;  4OMB A;  3LR1 A;  3G3F A;  4DZ1 A;  2O6A A;  3V8X B;  3IB1 A;  3A3C A;  4F3S A;  1IXC A;  1LBX A;  4QFP A;  3UIF A;  4GOT A;  1P1W A;  1QKB A;  4GWY A;  1B1X A;  1B05 A;  4R2B A;  2CEY A;  2RC7 A;  2B4M A;  4GWW A;  4NMY A;  4PTK A;  1ZKB A;  3LBS A;  2Y7R A;  3U94 A;  2PFZ A;  5ELV A;  4OFJ A;  3PPQ A;  1LBY A;  4GXA A;  4XKQ A;  3R7X A;  4YIC A;  5H8F B;  5I56 B;  3FJM A;  5CMK A;  3TTM A;  3U72 A;  4LQ2 A;  4OEV A;  5I5P A;  2Q2C A;  4LON B;  3RT6 B;  1DPP A;  4XKR A;  4ZS9 A;  3TTL A;  3MST A;  1N3W A;  2XXQ A;  3HV1 A;  3IFC A;  2ZYN A;  3O28 A;  3PGF A;  1K9Y A;  1LB9 A;  3CIJ A;  2ONS A;  4UA8 A;  1VSO A;  4IO4 A;  1BTJ A;  4NF8 A;  3G3J A;  3IJX B;  3IFA A;  1NNF A;  1TT1 A;  5I58 B;  3N6U A;  2ONK E;  4LZ8 A;  3OSQ A;  4UAC A;  4YU0 A;  3TEP A;  1S7Y A;  2F36 A;  3QK6 A;  3OEM A;  4PFB A;  2VP1 A;  1B40 A;  3KOT A;  5A5X A;  1YYZ A;  3OO6 A;  3TQL A;  3SDF A;  4OVP A;  2Y84 A;  1B5J A;  2ZZW A;  2UVI A;  2Z23 A;  4ISU A;  4PFW A;  2X7P A;  3KJ7 A;  1D9Y A;  4QSE A;  4YKJ A;  4OVT A;  1WVJ A;  4F31 B;  1LAH E;  4YB5 A;  2F3B A;  5JK4 A;  1JEU A;  5T3J A;  3U1O A;  1FPF A;  4YZZ A;  2RIN A;  4U1Z A;  5FTH A;  3B6W A;  3VLW A;  2HZK A;  3H6W A;  4MEV A;  3SES A;  1IMA A;  4O94 A;  1MQD A;  2XWO A;  2GRV A;  1UTB A;  3CR9 A;  2I49 A;  3K1P A;  3K02 A;  2RCB A;  3MP8 A;  4PQJ A;  3T9U A;  3FVN A;  5IM2 A;  5ISU A;  4LAT A;  3P7I A;  2QL3 A;  5K2X A;  3PV0 E;  2O84 X;  1CE2 A;  2JJK A;  2ZNU A;  1N3X A;  2GFE A;  1D9V A;  4F1V A;  3RPL B;  1MS7 A;  3KSJ A;  1ZBM A;  1OIB A;  1FBD A;  2A5T B;  1TFD A;  3MAM A;  3MBP A;  2Z8E A;  5ITO A;  2RF1 A;  2O69 A;  1MXU A;  1B7U A;  3G3H A;  3T93 B;  1FPJ A;  4NF4 B;  1VDW A;  2BJJ X;  3U65 A;  1GVC A;  1H76 A;  3IK6 B;  2QSX A;  2DS9 A;  1KA1 A;  1US5 A;  1OQH A;  2XXI A;  1LFG A;  4JVC A;  4H46 A;  4KXP A;  4ZEB A;  3TPA A;  2H4I A;  1KWH A;  3VLU A;  4BDQ A;  1YCJ A;  5AA2 D;  4PAF A;  1RDX A;  4HS7 A;  3RLF E;  1FPK A;  4POW A;  3H06 B;  3VFJ A;  1R9Q A;  3LSX A;  1Y3P A;  3O6I A;  1A40 A;  5HPQ A;  1MY3 A;  1Y3N A;  1LEV A;  1LAX A;  1XI6 A;  2DP8 A;  3VV5 A;  2KQZ A;  4NF5 A;  1LGB C;  1MXW A;  3JZJ A;  4GBV A;  4P0G A;  5EQ9 A;  1MM7 A;  2I0B A;  4KFQ A;  5LDZ A;  4QFN A;  2PMS A;  2F78 A;  4GX4 A;  4RPO A;  1PB8 A;  3Q25 A;  4XIG Q;  1Q1K A;  4PFU A;  4N6P A;  3LUY A;  1I6B A;  3H7M A;  4OHN A;  1NKX A;  5AA4 A;  4NGU A;  2P2A A;  1FJ6 A;  2O68 A;  1POY 1;  4TQU Q;  5ET5 A;  2DWI A;  3ZKK A;  4Q8R A;  1FQF A;  4I3Y A;  1MDQ A;  3PPN A;  2X26 A;  4TLL B;  2FIX A;  1JET A;  1BLF A;  1JW1 A;  1SYI A;  4LUB A;  2OBG A;  4GX6 A;  3CFL A;  1MQG A;  1MRP A;  2XXV A;  2YLN A;  4NWC A;  4AS4 A;  3PU5 A;  2OCU A;  5JEI A;  5CRY A;  3ZSF A;  3PPO A;  4MMP A;  1LBB A;  4NX1 A;  2XX9 A;  1FPL A;  3K01 A;  4JDF A;  5I59 A;  5AA2 A;  3QAX A;  4I40 A;  5JTY A;  2XXX A;  1VFD A;  1ATG A;  2ZXT A;  1UQW A;  1PBP A;  3UGW A;  4P1E A;  4JB7 A;  2HAU A;  2O7I A;  2ZYK A;  4DXU A;  3FAS A;  4FIM A;  5IGA A;  3VVF A;  4PE5 B;  1D9Q A;  3Q28 A;  1NL5 A;  2F7C A;  1SDX A;  4BDN A;  4THI A;  1H43 A;  3C36 A;  4XTC Q;  2DE2 A;  2F7B A;  2FBP A;  3SKP A;  1JNF A;  1FTK A;  2AL4 A;  3SEY A;  1N7W A;  1EYJ A;  1YTV A;  4Q5T A;  4QBA A;  5CBR A;  2GQ1 A;  4E0X A;  3KC1 A;  4N91 A;  2ZNT A;  3G7W A;  4PAK A;  3BFU A;  4ND9 A;  4OVQ A;  3S4U A;  3RN8 A;  3FVK A;  3KBZ A;  3LSW A;  1DBZ A;  4HE2 A;  1TXF A;  3CSB A;  4LQ5 A;  1AMF A;  4OTE A;  3PUW E;  4X9T A;  2F6G A;  3H6T A;  4P3L A;  1GTK A;  2IA4 A;  2DWJ A;  2ZYO A;  1PBQ A;  4MF3 A;  4P0I A;  3HCQ A;  1N7X A;  5KCJ A;  2D5W A;  1FPE A;  4IO7 A;  1G0I A;  4DIG A;  1IIT A;  1SI1 A;  1YPN A;  1IMC A;  1IXH A;  2DWA A;  2ZYM A;  4C1T A;  4KCD A;  1USY E;  2ZZX A;  3VE1 B;  2VD3 A;  3SET A;  1MPD A;  2DE4 A;  2Z22 A;  3S2V A;  3CSG A;  2XXT A;  3CRB A;  1JW4 A;  1IMF A;  4H65 A;  3I5O A;  4R73 A;  1O7T A;  3M3L A;  3QYT A;  3PUY E;  1JP4 A;  1MY0 A;  2Y7W A;  2DOJ A;  4RA1 A;  3B8B A;  4PDH A;  2XXY A;  2PT2 A;  4TLM B;  1RYX A;  3V83 A;  3DP8 A;  5TPA A;  1B3G A;  4G8H A;  1RDY A;  3MW0 A;  4JVI A;  3FJ7 A;  2I0C A;  3B50 A;  2THI A;  4JBZ A;  4R6K A;  4ONY A;  1FPB A;  3FV2 A;  2WBD A;  1KA0 A;  4P1L A;  4GLI A;  1AL3 A;  3RTF B;  5I84 A;  5TU0 A;  4H8I A;  1FQB A;  1YXI A;  2F35 A;  4IGR A;  1I6Q A;  4IB2 A;  5ESY A;  4JSD A;  2PT1 A;  4F19 A;  2VD2 A;  1ZLQ A;  3SEU A;  5FHO A;  3OO8 A;  4WKM A;  3O9P A;  3FXQ A;  5I7I A;  2OWZ A;  4R6H A;  4PGN A;  4GX3 A;  3TKD A;  5I2K B;  2H98 A;  1QKA A;  3V89 B;  1XHY A;  5DT6 A;  1DOT A;  4KYD A;  3SEW A;  4OAN A;  2XXP A;  3L6H A;  3KZG A;  3F11 A;  2CMO A;  4N6K A;  4X04 A;  4FBP A;  4YB6 A;  5J16 A;  1SW1 A;  1N84 A;  1B7Z A;  3THI A;  3Q29 A;  5H8Q B;  3FXR A;  3C9H A;  4PBQ A;  2RCA A;  3S9L C;  1NV3 A;  1INP A;  1FRP A;  4QRZ A;  4X1D A;  1IME A;  2GH9 A;  5FHN A;  3LSF B;  1DK4 A;  2F3D A;  3QMF A;  1LBZ A;  3GZG A;  4O3A A;  3ECR A;  3U93 A;  3FGS A;  3E4R A;  3UA8 A;  2XWK A;  3VXB A;  5ET6 A;  3KN8 A;  1R9L A;  1FBH A;  1US4 A;  4EDP A;  3MC2 A;  2I4B A;  5B70 A;  3KEI A;  2E0S A;  1MY1 A;  1MXY A;  3RUM A;  3MVX A;  1FW0 A;  5CI5 A;  3O6H A;  5F1Q A;  4UAB A;  1EU8 A;  2FYI A;  1FSA A;  4PBH A;  1A55 A;  2DSF A;  3OEL A;  1ZU0 A;  2UYE A;  3OOA A;  2Q8J A;  5FHM A;  3FBP A;  4XKN A;  3EHU A;  1LAF E;  1SW5 A;  4NE4 A;  4GWU A;  4PFT A;  3CI8 A;  1N0T A;  4N4U A;  1Y4C A;  1B4H A;  2Q8M A;  4GWO A;  4MH5 A;  4ZEC A;  3D4C A;  1OMP A;  4HCY A;  1O63 A;  4ZED A;  3TUS A;  4RXL A;  5AE4 A;  2ANJ A;  4OVR A;  3T22 A;  2QPQ A;  3VVE A;  2UVJ A;  2AL5 A;  3FAT A;  2R6G E;  4BDO A;  3M8U A;  2DXR A;  2UVG A;  1IMB A;  2B4L A;  3TYH A;  2NUV A;  3PMV A;  1NUX A;  3GBA A;  3FIR A;  3TTK A;  3IJO B;  3IO4 A;  3G3K A;  4YAH X;  2B3B A;  3D4G A;  1UIU A;  1PB9 A;  2PCR A;  2P3N A;  4NQ8 A;  4R74 A;  4M4G A;  4FOR A;  1Y20 A;  1PB7 A;  5I57 A;  4BLA A;  4ESX A;  4BDM A;  2OWT A;  3KG2 A;  4KR5 A;  3V5A A;  4MLQ A;  1EYK A;  2R8T A;  3T9V A;  4N81 A;  2WEF A;  4GXS B;  4PCD A;  5DVJ A;  1GR2 A;  2X7Q A;  5H8N B;  1UTH B;  3KJT A;  1B0L A;  1RDZ A;  1LB8 A;  3IO6 A;  1DMB A;  1NUW A;  3E79 A;  4N15 A;  5DEX B;  4PF6 A;  4U4X A;  1KZ8 A;  1IQ7 A;  4ZEI A;  5DYH A;  1L5T A;  5KDT B;  2V3T A;  3N26 A;  2QMX A;  4GL8 A;  3H03 A;  1NNP A;  3FZV A;  2OJT A;  1LBC A;  3DEL B;  1B2H A;  2XWV A;  3MVW A;  3TDJ A;  2R9J A;  2HZL A;  5F24 A;  1K9Z A;  1VR5 A;  5L9O A;  1EZO A;  3L6G A;  3C4M A;  5A5L A;  3TOD A;  2ZZV A;  3KFM A;  3R26 A;  1EYI A;  3K4U A;  4G8N A;  5H8H A;  4PET A;  4POX A;  4IY5 A;  4G68 A;  3K00 A;  1POT A;  4RJZ A;  1ZJL A;  1IUD A;  3WAE A;  4MJO A;  4X1B A;  1B5H A;  3Q26 A;  1TFA A;  3SEV A;  5CMM A;  4LA9 A;  4KYS A;  5TP9 A;  2HFB A;  3B7D A;  3MWB A;  4PF8 A;  4FED A;  1SQY A;  2FHY A;  3C31 A;  1UIV A;  4PGP A;  5IZ3 B;  3DP6 A;  2F8D A;  4AB6 A;  1R6Z A;  3TAJ A;  3DLN A;  4JWO A;  5IZZ A;  4KYE A;  4EXK A;  1CB6 A;  1FPG A;  3E9X A;  4GF8 A;  2DVZ A;  2VOZ A;  1TWY A;  2OK2 A;  5ITP A;  3RT8 A;  1M5C A;  3VXC A;  4GFR A;  4ZZA A;  1LFI A;  4F1U A;  5H8F A;  5I56 A;  2DVC A;  3TCH A;  4F3G A;  1A8E A;  4LZ5 A;  2V3U A;  1DPE A;  4WED A;  4QFO A;  2GHA A;  2PFY A;  3HPI A;  3QUJ A;  4O7M A;  2CEX A;  3TCG A;  3QXM A;  2Z8F A;  1GGG A;  3QSL A;  4GBW A;  4P8B A;  5M2V A;  2E1S A;  1URG A;  1FQD A;  1SI0 A;  2I48 A;  3S9N C;  3HHG A;  4FEC A;  3T96 B;  4OQO A;  1J1N A;  2H99 A;  3EN3 A;  4AS5 A;  3MVY A;  4Z7E A;  5I58 A;  2I58 A;  5CMC A;  2Q2A A;  2CZH A;  3O97 A;  2QS1 A;  3CVG A;  3I6V A;  5I2N B;  1O64 A;  2HQ0 A;  5FTI A;  4ELP A;  1NV1 A;  1FJ9 A;  5DVF A;  3IAZ A;  3LUZ A;  4DXB A;  3FV1 A;  3PTY A;  1NV2 A;  4O3B A;  1LLS A;  4OEU A;  4G2Z A;  4DCX A;  1M5E A;  2PBW A;  2OZZ A;  1DTZ A;  1MH4 A;  3PPR A;  1XVX A;  3DM0 A;  2OLB A;  1Y4T A;  4JSO A;  4G68 C;  1MXZ A;  4AQ4 A;  2V84 A;  2QJE A;  3PUV E;  4NF6 B;  4ECF A;  3W15 C;  1D4N A;  2FA7 A;  4MFI A;  3B6Q A;  4RY1 A;  2QVV A;  4F39 A;  3EKI A;  3UK4 A;  1QUK A;  2XA5 A;  4HXV A;  3LC8 A;  3MPK A;  2WBB A;  1LBV A;  4EQ7 A;  3W9V A;  3GYY A;  2IEE A;  1P1N A;  4U22 A;  3U8Q A;  1FTL A;  5DTB A;  2DQV A;  3H6U A;  3MUQ A;  3OEK A;  4YKI A;  4KPT A;  2NXO A;  4OA4 A;  2DDK A;  1MQJ A;  2ONR A;  4MBP A;  4U4S A;  2H25 A;  3RPL A;  2A5T A;  1EZP A;  1H3D A;  3HO7 A;  4LP2 B;  4QSC A;  4QFK A;  1IXI A;  1VE4 A;  1SD3 A;  1ZMG A;  2REJ A;  1NV7 A;  4NF4 A;  4HTG A;  1S9T A;  3A09 A;  5L9M A;  2H5Y A;  1OVB A;  4JXI A;  3BFT A;  4H67 A;  2UXA A;  2OX3 A;  2WX9 A;  1DCU A;  4H6D A;  4LN5 A;  3E78 A;  4RPN A;  3IOT A;  3I3V A;  4NN3 A;  1MM6 A;  3KC0 A;  1T0K A;  5L9S A;  3IOR A;  3KOS A;  4IGT A;  3H4Z A;  4NF8 B;  1OLC A;  1LAG E;  2FVZ A;  3ZKL A;  2Y7P A;  4JWY A;  1YZ0 A;  4ESW A;  3Q27 A;  3K1N A;  5KZT A;  4JWX A;  3C35 A;  4I1D A;  3K6V A;  5ET7 A;  4U1O A;  4OYV A;  1B58 A;  1LCF A;  1ELJ A;  4RK9 A;  4X8R A;  1B51 A;  5A5X B;  4DXC A;  1MG1 A;  4NG7 A;  4NTL A;  3PUZ E;  4RK2 A;  1M5B A;  4OEN A;  4IY6 A;  2DE3 A;  4Z0I A;  1D3K A;  4F2O A;  4KI0 E;  1A8F A;  5L8D A;  3B6T A;  2CZK A;  4OVJ A;  3UN6 A;  3S9E A;  2Y7K A;  2QFL A;  4F18 A;  2V25 A;  4G8M A;  4PC9 A;  5ICQ A;  4Q30 B;  1WDN A;  3KN3 A;  4F3B A;  1UTB B;  4H8J A;  2KR0 A;  5LOM A;  2I3V A;  1H45 A;  2I6E A;  2HXR A;  4QFL A;  4R9G A;  4PFI A;  1NH8 A;  1FCK A;  3IL1 B;  3MJN A;  3FVO A;  2ESN A;  4FAT A;  2QVU A;  3GBB A;  3SZP A;  4G77 A;  3K0V A;  3RPW A;  4KHZ E;  4ZEF A;  4U2R A;  3PMX A;  5EQA A;  4NHB A;  3ROJ A;  1G0H A;  4FJP A;  2VPN A;  1QJM A;  3PMW A;  3IB0 A;  2CZL A;  1MY4 A;  4HW8 A;  2G29 A;  3K1M A;  3M3F A;  2O1L A;  1NFT A;  1AWB A;  3PD9 A;  2O1M A;  5ET8 A;  4H45 A;  3TCF A;  3VDF A;  3EQ1 A;  1P1O A;  2YJP A;  1IMD A;  3IOU A;  4IO3 A;  1B32 A;  1LBW A;  4OFL A;  4HE0 A;  4E0W A;  3NOH A;  5DVI A;  4N17 A;  1JW5 A;  3MYU A;  1RKM A;  4QXD A;  1FQC A;  3ODB A;  3W9W A;  2QS3 A;  4H5G A;  3BKI B;  3K6X A;  4IO5 A;  3KBR A;  1IZ1 A;  2P1S A;  4MLV A;  2WYK A;  4YMB A;  2HEU A;  4NF5 B;  1Q35 A;  1FTO A;  1B3H A;  4GWS A;  3RGY A;  1CNQ A;  2CZI A;  4NAP A;  1FBG A;  1FBE A;  2AYS A;  2Y5K A;  1XVY A;  5IKB A;  5EYG A;  1B3L A;  2R71 A;  1SVX B;  5EYF A;  1NV5 A;  4JVD A;  1B4Z A;  3T0J A;  5AA4 B;  3S9M C;  1FPI A;  3EF7 A;  3HN0 A;  3WAF A;  1Y1Z A;  2BJI A;  4DLD A;  4U21 A;  2W7Y A;  4O7I A;  5EYH A;  1QVS A;  3TFL A;  3G3I A;  3T9X B;  4PP0 A;  4F1Y A;  2VPO A;  2VHA A;  3MZB A;  3USD A;  1Y1M A;  1QUL A;  4IO6 A;  2ZMB A;  3IOV A;  3H6V A;  4M1V A;  3PD8 A;  4PFR A;  4EF1 A;  1GV8 A;  3VVD A;  1WOD A;  2ABH A;  3AXF A;  3O2A A;  3A29 A;  4EUO A;  3O6G A;  1A54 A;  5BWJ A;  1XT8 A;  2QVR A;  4KQP A;  3TTN A;  3MPL A;  1NUY A;  5I2K A;  1YAE A;  5AA2 B;  5I59 B;  5I3S A;  1MY2 A;  5JTY B;  3CG1 A;  4ZE9 A;  1AH5 A;  1NH7 A;  5EQ7 A;  1S50 A;  1IXG A;  1A7L A;  3K2D A;  1MQH A;  2D3I A;  5H8Q A;  1PEB A;  2XX8 A;  4ZDM A;  2GHB A;  5AA1 A;  1MQI A;  1B5I A;  2F7A A;  1AOV A;  1PDA A;  4R2F A;  4GL0 A;  4MAG A;  4MHF A;  1Q9D A;  3CFX A;  5CBS A;  1FQA A;  2ALU A;  2F5X A;  2RC9 A;  4GQO A;  3BIH A;  2XXR A;  1MDP 1;  4NWD A;  1IIW A;  2I4C A;  3MQ9 A;  4XF5 A;  4AB5 A;  4LZ7 A;  1F9B A;  1R1N A;  1DSN A;  2XD2 A;  2RKM A;  1OVT A;  4OER A;  4GD5 A;  2UYF A;  4P56 A;  1II5 A;  4XXU A;  5H8S A;  1A99 A;  3GLB A;  1MPC A;  1NMU A;  1BIY A;  2MKZ A;  2REG A;  2Z8D A;  1M5D A;  3IR1 A;  1FQE A;  5DW8 A;  4ZE8 A;  1QUJ A;  4U23 A;  3N94 A;  1Z7M E;  2O51 A;  5KCJ B;  4MIJ A;  3LSL A;  1VFE A;  5IZ1 A;  2F6P A;  2RC8 A;  3D1R A;  4KD5 A;  2L5V A;  2B65 A;  3OO7 A;  2H9B A;  1B6H A;  4EXL A;  2XXU A;  2Q74 A;  2NVU B;  3KGC A;  3MP6 A;  4F22 A;  5B7D A;  3H3G A;  1DTG A;  1XC1 A;  3OEN A;  3QUF A;  1B52 A;  1Y9U A;  1AIV A;  3CHG A;  3RNN A;  3FVG A;  3OO9 A;  4BDR A;  1BKA A;  4QHQ A;  2HAV A;  2V3Q A;  1P1U A;  4OES A;  3RTW B;  5TPA B;  1LCT A;  2G93 A;  1SBP A;  2XXK A;  3K6U A;  2PVU A;  3KN7 A;  2FNC A;  5AA3 A;  4ELR A;  3HST A;  3R6U A;  1URD A;  2HPG A;  3T1B A;  5LTC A;  5FBP A;  3TTR A;  1HSE A;  1EZ9 A;  1MH3 A;  1FTJ A;  2XX7 A;  4I9D A;  4MNC A;  3O66 A;  2DWH A;  3IX1 A;  4P47 A;  4YKK A;  2QS2 A;  2Y5L A;  5CMB A;  1PC3 A;  3A3U A;  3FJG A;  2FIE A;  1B7H A;  4XFE A;  4DE8 A;  5BUU A;  2YPN A;  4F2Q A;  4QSD A;  3U92 A;  3K6W A;  3FXU A;  2QMW A;  5CM6 A;  4DI3 D;  1I6A A;  3VLV A;  3E13 X;  4R75 A;  3TQW A;  2WYP A;  4X48 A;  1URS A;  1NNK A;  3DP4 A;  3N6T A;  4H5F A;  2Q89 A;  5CC2 A;  1NV6 A;  1FPD A;  3MZ1 A;  1ZTY A;  4WXJ A;  4GIZ A;  4YKP A;  2ZNS A;  2KLF A;  2Q9T A;  4OXV A;  2NWJ A;  4EQB A;  5H8N A;  4FE8 A;  4P9K A;  3UP9 A;  3ZS6 A;  1UTH A;  2F97 A;  4G4P A;  4N8G A;  2I3W A;  5IAI A;  1B0H A;  4PDD A;  4H1X A;  3ISP A;  5DEX A;  4NF0 A;  4Q0C A;  4GWZ A;  3RQT A;  4GRK A;  4ZZE A;  3EHS A;  4HCW A;  4MNP A;  5KDT A;  1JVY A;  3C33 A;  3QIM A;  1N04 A;  1XOC A;  1HSJ A;  4FAJ A;  1MXV A;  3T66 A;  4IO2 A;  4O3C A;  3OMB A;  3HFU A;  4MCO A;  2QS4 A;  1ANF A;  2QRY A;  4ZEK A;  2AIX A;  4YMA A;  1H44 A;  1SW2 A;  4OFO A;  1FBF A;  5K2Y A;  2UVH A;  1LST A;  4N07 A;  1P1Q A;  3MVZ A;  1LFH A;  2VGQ A;  4R72 A;  4H0W A;  1JEV A;  3EHT A;  4EF2 A;  3CFZ A;  4N8Y A;  3BBR A;  4G61 A;  3N5L A;  1MPB A;  2P3V A;  4RYA A;  4OVS A;  1RYO A;  4TOZ A;  5EHM A;  4I3E A;  3OXN A;  2XD3 A;  3HHF A;  3IOW A;  2NOO A;  3FUZ A;  4C0R A;  1ZIU A;  1JVX A;  2XXH A;  2HHM A;  1M5F A;  3IB2 A;  4R9F A;  1QGX A;  2XXW A;  1B3E A;  3BIG A;  1B46 A;  2LAO A; 
#chains in the Genus database with same CATH homology
 4KCC A;  3ILU B;  3FD3 A;  1FTM A;  3CG3 A;  3C32 A;  2PX1 A;  1USY H;  1SW4 A;  2WKY A;  4FEB A;  5J1D A;  2Q88 A;  4ELQ A;  3M3K A;  4QF9 A;  1MXX A;  1EH3 A;  3GXA A;  5F7V A;  4WEP A;  3SEX A;  3EPE A;  4F3P A;  4NED A;  2D21 A;  5HM4 B;  3TZA A;  5ICT A;  1NNT A;  3MZ9 A;  2B3F A;  5I57 B;  4PFY A;  2DYX A;  1XS5 A;  4ELO A;  4RNS A;  4F29 A;  2O7U A;  3E3K A;  1I69 A;  3T9H B;  1Y3Q A;  4OWD A;  4OET A;  3KSX A;  1B9J A;  2Y7I A;  3O29 A;  3OD7 A;  1HSL A;  3JV9 A;  4LVQ A;  4I62 A;  4BDL A;  1OQG A;  2HXW A;  5HBC A;  4L17 A;  3G3G A;  1N76 A;  5EHS A;  3TMG A;  3OSR A;  3TEL A;  2OWS A;  5I2N A;  3C34 A;  4DDD A;  1OLA A;  4GVO A;  2PYY A;  1B1H A;  2V93 A;  3JYR A;  4C1U A;  3SER A;  1B3F A;  1QW0 A;  4R6Y A;  5H8H B;  4P11 A;  4YB7 A;  3PUX E;  2DXY A;  4G68 B;  1SYH A;  1JQF A;  1QUI A;  2F34 A;  4I8C A;  1Z7N E;  4EQ9 A;  3ONM A;  4OZ9 A;  4K3F A;  2XHD A;  3RY3 A;  3MP1 A;  1P99 A;  4NF6 A;  3PPP A;  2A5S A;  2HCA A;  1IEJ A;  2M8C A;  3ILT B;  4XKP A;  5TP9 B;  4DCY A;  3UOR A;  1BP5 A;  4N13 A;  2P0S A;  4OMB A;  3LR1 A;  3G3F A;  4DZ1 A;  2O6A A;  3V8X B;  3IB1 A;  3A3C A;  4F3S A;  1IXC A;  4QFP A;  3UIF A;  4GOT A;  1P1W A;  1QKB A;  1B1X A;  1B05 A;  4R2B A;  2RC7 A;  4NMY A;  1ZKB A;  3LBS A;  2Y7R A;  3U94 A;  5ELV A;  4OFJ A;  3PPQ A;  4GXA A;  4XKQ A;  3R7X A;  4YIC A;  5H8F B;  5I56 B;  3FJM A;  5CMK A;  3TTM A;  3U72 A;  4LQ2 A;  4OEV A;  2Q2C A;  4LON B;  3RT6 B;  1DPP A;  4XKR A;  4ZS9 A;  3TTL A;  1N3W A;  2XXQ A;  3HV1 A;  2ZYN A;  3O28 A;  3PGF A;  1LB9 A;  3CIJ A;  2ONS A;  4UA8 A;  1VSO A;  4IO4 A;  1BTJ A;  4NF8 A;  3G3J A;  3IJX B;  1NNF A;  1TT1 A;  5I58 B;  3N6U A;  2ONK E;  4LZ8 A;  3OSQ A;  4UAC A;  4YU0 A;  3TEP A;  1S7Y A;  2F36 A;  3QK6 A;  3OEM A;  2VP1 A;  1B40 A;  3KOT A;  5A5X A;  3OO6 A;  3TQL A;  3SDF A;  2Y84 A;  1B5J A;  2UVI A;  2Z23 A;  4ISU A;  4PFW A;  2X7P A;  3KJ7 A;  1D9Y A;  4QSE A;  4YKJ A;  1WVJ A;  4F31 B;  1LAH E;  4YB5 A;  5JK4 A;  1JEU A;  3U1O A;  4YZZ A;  2RIN A;  4U1Z A;  5FTH A;  3B6W A;  3VLW A;  2HZK A;  3H6W A;  3SES A;  1MQD A;  2GRV A;  1UTB A;  3CR9 A;  2I49 A;  3K1P A;  3K02 A;  2RCB A;  3MP8 A;  4PQJ A;  3T9U A;  3FVN A;  5ISU A;  4LAT A;  3P7I A;  2QL3 A;  5K2X A;  3PV0 E;  2O84 X;  1CE2 A;  2ZNU A;  1N3X A;  2GFE A;  1D9V A;  4F1V A;  1MS7 A;  3KSJ A;  1ZBM A;  1OIB A;  2A5T B;  1TFD A;  3MAM A;  3MBP A;  5ITO A;  2Z8E A;  2RF1 A;  2O69 A;  1MXU A;  1B7U A;  3G3H A;  3T93 B;  4NF4 B;  2BJJ X;  1GVC A;  1H76 A;  3IK6 B;  2QSX A;  2DS9 A;  1US5 A;  1OQH A;  2XXI A;  1LFG A;  4ZEB A;  3TPA A;  2H4I A;  1KWH A;  3VLU A;  4BDQ A;  1YCJ A;  5AA2 D;  4HS7 A;  3RLF E;  4POW A;  3H06 B;  3VFJ A;  1R9Q A;  3LSX A;  1Y3P A;  3O6I A;  1A40 A;  5HPQ A;  1MY3 A;  1Y3N A;  1LAX A;  2DP8 A;  3VV5 A;  4NF5 A;  1LGB C;  1MXW A;  3JZJ A;  4P0G A;  1MM7 A;  2I0B A;  4KFQ A;  4QFN A;  2PMS A;  2F78 A;  4RPO A;  1PB8 A;  3Q25 A;  4XIG Q;  1Q1K A;  4PFU A;  4N6P A;  3LUY A;  1I6B A;  3H7M A;  4OHN A;  1NKX A;  5AA4 A;  2P2A A;  2O68 A;  1POY 1;  4TQU Q;  2DWI A;  3ZKK A;  4Q8R A;  1FQF A;  1MDQ A;  3PPN A;  2X26 A;  4TLL B;  1JET A;  1BLF A;  1JW1 A;  1SYI A;  4LUB A;  2OBG A;  3CFL A;  1MQG A;  1MRP A;  2XXV A;  2YLN A;  4NWC A;  3PU5 A;  2OCU A;  5JEI A;  5CRY A;  3ZSF A;  3PPO A;  1LBB A;  2XX9 A;  3K01 A;  4JDF A;  5I59 A;  5AA2 A;  3QAX A;  5JTY A;  2XXX A;  1VFD A;  1ATG A;  2ZXT A;  1UQW A;  1PBP A;  3UGW A;  4JB7 A;  2HAU A;  2O7I A;  2ZYK A;  4DXU A;  3FAS A;  4FIM A;  3VVF A;  4PE5 B;  3Q28 A;  1NL5 A;  2F7C A;  1SDX A;  4BDN A;  4THI A;  1H43 A;  3C36 A;  4XTC Q;  2DE2 A;  2F7B A;  3SKP A;  1JNF A;  1FTK A;  2AL4 A;  3SEY A;  1N7W A;  1YTV A;  4Q5T A;  5CBR A;  4E0X A;  2ZNT A;  3G7W A;  3BFU A;  4ND9 A;  3S4U A;  3RN8 A;  3FVK A;  3LSW A;  1TXF A;  3CSB A;  4LQ5 A;  1AMF A;  4OTE A;  3PUW E;  4X9T A;  2F6G A;  3H6T A;  1GTK A;  2IA4 A;  2DWJ A;  2ZYO A;  1PBQ A;  4MF3 A;  4P0I A;  3HCQ A;  1N7X A;  5KCJ A;  2D5W A;  4IO7 A;  4DIG A;  1IIT A;  1YPN A;  1SI1 A;  1IXH A;  2DWA A;  2ZYM A;  4C1T A;  4KCD A;  1USY E;  3VE1 B;  2VD3 A;  3SET A;  1MPD A;  2DE4 A;  2Z22 A;  3S2V A;  3CSG A;  2XXT A;  3CRB A;  1JW4 A;  4H65 A;  3I5O A;  4R73 A;  1O7T A;  3M3L A;  3QYT A;  3PUY E;  1MY0 A;  2Y7W A;  2DOJ A;  4RA1 A;  2XXY A;  2PT2 A;  4TLM B;  1RYX A;  3V83 A;  3DP8 A;  5TPA A;  1B3G A;  4G8H A;  3MW0 A;  3FJ7 A;  2I0C A;  2THI A;  4JBZ A;  4R6K A;  4ONY A;  3FV2 A;  4GLI A;  1AL3 A;  3RTF B;  5I84 A;  5TU0 A;  4H8I A;  1FQB A;  2F35 A;  4IGR A;  1I6Q A;  4IB2 A;  4JSD A;  2PT1 A;  4F19 A;  2VD2 A;  1ZLQ A;  3SEU A;  5FHO A;  3OO8 A;  4WKM A;  3O9P A;  3FXQ A;  4R6H A;  3TKD A;  5I2K B;  2H98 A;  1QKA A;  3V89 B;  1XHY A;  5DT6 A;  1DOT A;  4KYD A;  3SEW A;  2XXP A;  3L6H A;  3KZG A;  3F11 A;  2CMO A;  4YB6 A;  1SW1 A;  1N84 A;  1B7Z A;  3THI A;  3Q29 A;  5H8Q B;  3FXR A;  3C9H A;  2RCA A;  3S9L C;  4QRZ A;  4X1D A;  2GH9 A;  5FHN A;  3LSF B;  3GZG A;  4O3A A;  3ECR A;  3U93 A;  3FGS A;  3E4R A;  3UA8 A;  3VXB A;  3KN8 A;  1R9L A;  1US4 A;  4EDP A;  3MC2 A;  2I4B A;  5B70 A;  3KEI A;  2E0S A;  1MY1 A;  1MXY A;  3RUM A;  3MVX A;  1FW0 A;  5CI5 A;  3O6H A;  5F1Q A;  1EU8 A;  2FYI A;  1A55 A;  2DSF A;  3OEL A;  1ZU0 A;  2UYE A;  3OOA A;  2Q8J A;  5FHM A;  4XKN A;  3EHU A;  1LAF E;  1SW5 A;  4NE4 A;  4PFT A;  3CI8 A;  1N0T A;  1Y4C A;  1B4H A;  4GWO A;  4MH5 A;  4ZEC A;  3D4C A;  1OMP A;  4HCY A;  1O63 A;  4ZED A;  3TUS A;  4RXL A;  5AE4 A;  2ANJ A;  3T22 A;  2QPQ A;  3VVE A;  2UVJ A;  2AL5 A;  3FAT A;  2R6G E;  4BDO A;  3M8U A;  2DXR A;  2UVG A;  3TYH A;  3TTK A;  2NUV A;  3PMV A;  3GBA A;  3FIR A;  3IJO B;  3IO4 A;  3G3K A;  4YAH X;  2B3B A;  3D4G A;  1UIU A;  1PB9 A;  4R74 A;  4M4G A;  4FOR A;  1Y20 A;  1PB7 A;  5I57 A;  4BLA A;  4ESX A;  4BDM A;  2OWT A;  3KG2 A;  4KR5 A;  3V5A A;  4MLQ A;  3T9V A;  4GXS B;  5DVJ A;  1GR2 A;  2X7Q A;  5H8N B;  1UTH B;  3KJT A;  1B0L A;  1LB8 A;  3IO6 A;  1DMB A;  5DEX B;  4U4X A;  1IQ7 A;  4ZEI A;  5DYH A;  1L5T A;  5KDT B;  2V3T A;  3N26 A;  2QMX A;  4GL8 A;  3H03 A;  1NNP A;  3FZV A;  2OJT A;  1LBC A;  3DEL B;  1B2H A;  3MVW A;  3TDJ A;  2R9J A;  2HZL A;  1VR5 A;  5L9O A;  1EZO A;  3L6G A;  3C4M A;  3TOD A;  3KFM A;  3R26 A;  3K4U A;  4G8N A;  5H8H A;  4PET A;  4POX A;  4IY5 A;  4G68 A;  3K00 A;  1POT A;  4RJZ A;  1ZJL A;  1IUD A;  3WAE A;  4X1B A;  1B5H A;  3Q26 A;  1TFA A;  3SEV A;  5CMM A;  4LA9 A;  4KYS A;  5TP9 A;  2HFB A;  3B7D A;  3MWB A;  4FED A;  1SQY A;  3C31 A;  1UIV A;  3DP6 A;  2F8D A;  4AB6 A;  1R6Z A;  3TAJ A;  3DLN A;  4JWO A;  4KYE A;  4EXK A;  1CB6 A;  3E9X A;  4GF8 A;  2DVZ A;  2VOZ A;  1TWY A;  2OK2 A;  5ITP A;  3RT8 A;  1M5C A;  3VXC A;  4GFR A;  4ZZA A;  1LFI A;  4F1U A;  5H8F A;  5I56 A;  2DVC A;  3TCH A;  4F3G A;  1A8E A;  4LZ5 A;  2V3U A;  1DPE A;  4WED A;  4QFO A;  2GHA A;  3HPI A;  3QUJ A;  3TCG A;  3QXM A;  2Z8F A;  1GGG A;  3QSL A;  5M2V A;  2E1S A;  1URG A;  1FQD A;  1SI0 A;  2I48 A;  3S9N C;  3HHG A;  4FEC A;  3T96 B;  4OQO A;  1J1N A;  2H99 A;  3EN3 A;  3MVY A;  4Z7E A;  5I58 A;  2I58 A;  5CMC A;  2Q2A A;  3O97 A;  2QS1 A;  3CVG A;  3I6V A;  5I2N B;  1O64 A;  2HQ0 A;  5FTI A;  4ELP A;  5DVF A;  3IAZ A;  4DXB A;  3FV1 A;  4O3B A;  1LLS A;  4OEU A;  4G2Z A;  4DCX A;  1M5E A;  2PBW A;  2OZZ A;  1DTZ A;  1MH4 A;  3PPR A;  1XVX A;  3DM0 A;  2OLB A;  1Y4T A;  4JSO A;  4G68 C;  1MXZ A;  4AQ4 A;  2V84 A;  2QJE A;  3PUV E;  4NF6 B;  4ECF A;  3W15 C;  1D4N A;  2FA7 A;  4MFI A;  3B6Q A;  4RY1 A;  4F39 A;  3UK4 A;  1QUK A;  3LC8 A;  3MPK A;  4EQ7 A;  3W9V A;  2IEE A;  1P1N A;  4U22 A;  3U8Q A;  1FTL A;  5DTB A;  2DQV A;  3H6U A;  3MUQ A;  3OEK A;  4YKI A;  4KPT A;  2NXO A;  1MQJ A;  2ONR A;  4MBP A;  4U4S A;  2H25 A;  2A5T A;  1EZP A;  1H3D A;  3HO7 A;  4LP2 B;  4QSC A;  4QFK A;  1IXI A;  1VE4 A;  1SD3 A;  1ZMG A;  2REJ A;  4NF4 A;  4HTG A;  1S9T A;  3A09 A;  5L9M A;  2H5Y A;  1OVB A;  4JXI A;  3BFT A;  4H67 A;  2UXA A;  4H6D A;  4RPN A;  3IOT A;  3I3V A;  1T0K A;  1MM6 A;  5L9S A;  3IOR A;  3KOS A;  4IGT A;  3H4Z A;  4NF8 B;  1OLC A;  1LAG E;  3ZKL A;  2Y7P A;  4JWY A;  4ESW A;  3Q27 A;  3K1N A;  5KZT A;  4JWX A;  3C35 A;  4I1D A;  3K6V A;  4U1O A;  4OYV A;  1B58 A;  1LCF A;  1ELJ A;  4RK9 A;  1B51 A;  5A5X B;  4DXC A;  1MG1 A;  4NTL A;  3PUZ E;  4RK2 A;  1M5B A;  4OEN A;  4IY6 A;  2DE3 A;  4Z0I A;  1D3K A;  4F2O A;  4KI0 E;  1A8F A;  5L8D A;  3B6T A;  4OVJ A;  3UN6 A;  3S9E A;  2Y7K A;  4F18 A;  2V25 A;  4G8M A;  5ICQ A;  4Q30 B;  1WDN A;  3KN3 A;  4F3B A;  1UTB B;  4H8J A;  5LOM A;  2I3V A;  1H45 A;  2I6E A;  4QFL A;  4R9G A;  1NH8 A;  1FCK A;  3IL1 B;  3MJN A;  3FVO A;  2ESN A;  4FAT A;  3GBB A;  4G77 A;  3K0V A;  3RPW A;  4ZEF A;  4KHZ E;  4U2R A;  3PMX A;  4FJP A;  1QJM A;  3PMW A;  3IB0 A;  2CZL A;  1MY4 A;  4HW8 A;  2G29 A;  3K1M A;  3M3F A;  2O1L A;  1NFT A;  3PD9 A;  2O1M A;  3TCF A;  3VDF A;  3EQ1 A;  1P1O A;  2YJP A;  3IOU A;  4IO3 A;  1B32 A;  4OFL A;  4E0W A;  5DVI A;  1JW5 A;  1RKM A;  1FQC A;  3ODB A;  3W9W A;  2QS3 A;  4H5G A;  3BKI B;  3K6X A;  4IO5 A;  3KBR A;  1IZ1 A;  2P1S A;  4MLV A;  4YMB A;  2HEU A;  4NF5 B;  1Q35 A;  1FTO A;  1B3H A;  3RGY A;  2AYS A;  1XVY A;  5IKB A;  1B3L A;  2R71 A;  1SVX B;  5EYF A;  1B4Z A;  5AA4 B;  3S9M C;  3EF7 A;  3HN0 A;  3WAF A;  1Y1Z A;  4DLD A;  4U21 A;  2W7Y A;  1QVS A;  3TFL A;  3G3I A;  3T9X B;  4PP0 A;  4F1Y A;  2VHA A;  3MZB A;  3USD A;  1Y1M A;  1QUL A;  4IO6 A;  2ZMB A;  3IOV A;  3H6V A;  4M1V A;  3PD8 A;  4EF1 A;  1GV8 A;  3VVD A;  1WOD A;  2ABH A;  3AXF A;  3O2A A;  4EUO A;  3O6G A;  1A54 A;  5BWJ A;  1XT8 A;  4KQP A;  3TTN A;  3MPL A;  5I2K A;  1YAE A;  5AA2 B;  5I59 B;  1MY2 A;  5JTY B;  3CG1 A;  4ZE9 A;  1AH5 A;  1NH7 A;  1S50 A;  1IXG A;  1A7L A;  3K2D A;  1MQH A;  2D3I A;  5H8Q A;  1PEB A;  2XX8 A;  4ZDM A;  2GHB A;  5AA1 A;  1MQI A;  1B5I A;  2F7A A;  1AOV A;  1PDA A;  4R2F A;  4GL0 A;  3CFX A;  5CBS A;  1FQA A;  2ALU A;  2F5X A;  2RC9 A;  4GQO A;  2XXR A;  1MDP 1;  4NWD A;  1IIW A;  2I4C A;  3MQ9 A;  4AB5 A;  4LZ7 A;  1F9B A;  1R1N A;  1DSN A;  2XD2 A;  2RKM A;  1OVT A;  4OER A;  4GD5 A;  2UYF A;  1II5 A;  4XXU A;  5H8S A;  1A99 A;  3GLB A;  1MPC A;  1NMU A;  1BIY A;  2REG A;  2Z8D A;  1M5D A;  3IR1 A;  1FQE A;  4ZE8 A;  1QUJ A;  4U23 A;  3N94 A;  1Z7M E;  2O51 A;  5KCJ B;  3LSL A;  1VFE A;  2F6P A;  2RC8 A;  4KD5 A;  2B65 A;  3OO7 A;  2H9B A;  1B6H A;  4EXL A;  2XXU A;  2NVU B;  3KGC A;  3MP6 A;  4F22 A;  5B7D A;  3H3G A;  1DTG A;  1XC1 A;  3OEN A;  3QUF A;  1B52 A;  1Y9U A;  1AIV A;  3RNN A;  3FVG A;  3OO9 A;  4BDR A;  1BKA A;  4QHQ A;  2HAV A;  2V3Q A;  1P1U A;  4OES A;  3RTW B;  5TPA B;  1LCT A;  2G93 A;  1SBP A;  3K6U A;  2PVU A;  3KN7 A;  2FNC A;  5AA3 A;  4ELR A;  3HST A;  3R6U A;  1URD A;  3TTR A;  1HSE A;  1EZ9 A;  1MH3 A;  1FTJ A;  2XX7 A;  4I9D A;  3O66 A;  2DWH A;  3IX1 A;  4YKK A;  2QS2 A;  5CMB A;  1PC3 A;  3A3U A;  3FJG A;  1B7H A;  4DE8 A;  5BUU A;  2YPN A;  4F2Q A;  4QSD A;  3U92 A;  3K6W A;  3FXU A;  2QMW A;  5CM6 A;  1I6A A;  3VLV A;  3E13 X;  4R75 A;  3TQW A;  4X48 A;  1URS A;  1NNK A;  3DP4 A;  3N6T A;  4H5F A;  2Q89 A;  5CC2 A;  3MZ1 A;  1ZTY A;  4WXJ A;  4GIZ A;  4YKP A;  2ZNS A;  2KLF A;  2Q9T A;  4OXV A;  2NWJ A;  4EQB A;  5H8N A;  4FE8 A;  3UP9 A;  3ZS6 A;  1UTH A;  2F97 A;  4G4P A;  2I3W A;  5IAI A;  1B0H A;  4H1X A;  5DEX A;  4Q0C A;  3RQT A;  4GRK A;  4ZZE A;  3EHS A;  4HCW A;  5KDT A;  1JVY A;  3C33 A;  3QIM A;  1N04 A;  1XOC A;  4FAJ A;  1HSJ A;  1MXV A;  3T66 A;  4IO2 A;  4O3C A;  3OMB A;  2QS4 A;  1ANF A;  2QRY A;  4ZEK A;  2AIX A;  4YMA A;  1H44 A;  1SW2 A;  4OFO A;  5K2Y A;  2UVH A;  1LST A;  4N07 A;  1P1Q A;  3MVZ A;  1LFH A;  2VGQ A;  4R72 A;  4H0W A;  1JEV A;  3EHT A;  4EF2 A;  3CFZ A;  3BBR A;  3N5L A;  1MPB A;  4RYA A;  1RYO A;  4TOZ A;  5EHM A;  3OXN A;  2XD3 A;  3HHF A;  3IOW A;  2NOO A;  3FUZ A;  4C0R A;  1ZIU A;  1JVX A;  2XXH A;  1M5F A;  3IB2 A;  4R9F A;  2XXW A;  1B3E A;  1B46 A;  2LAO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...