1I6BA

Structure of equine apolactoferrin at 3.2 a resolution using crystals grown at 303k
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
689
structure length
689
Chain Sequence
APRKSVRWCTISPAEAAKCAKFQRNMKKVRGPSVSCIRKTSSFECIQAIAANKADAVTLDGGLVYEAGLHPYKLRPVAAEVYQTRGKPQTRYYAVAVVKKGSGFQLNQLQGVKSCHTGLGRSAGWNIPIGTLRPYLNWTGPPEPLQKAVANFFSASCVPCADGKQYPNLCRLCAGTEADKCACSSQEPYFGYSGAFKCLENGAGDVAFVKDSTVFENLPDEAERDKYELLCPDNTRKPVDAFKECHLARVPSHAVVARSVDGREDLIWKLLHRAQEEFGRNKSSAFQLFGSTPGEQDLLFKDSALGFVRIPSQIDSGLYLGANYLTATQNLRETAAEVAARRERVVWCAVGPEEERKCKQWSDVSNRKVACASASTTEECIALVLKGEADALNLDGGFIYVAGKCGLVPVLAENQKSQNSNAPDCVHRPPEGYLAVAVVRKSDADLTWNSLSGKKSCHTGVGRTAAWNIPMGLLFNQTGSCKFDKFFSQSCAPGADPQSSLCALCVGNNENENKCMPNSEERYYGYTGAFRCLAEKAGDVAFVKDVTVLQNTDGKNSEPWAKDLKQEDFELLCLDGTRKPVAEAESCHLARAPNHAVVSQSDRAQHLKKVLFLQQDQFGGNGPDCPGKFCLFKSETKNLLFNDNTECLAELQGKTTYEQYLGSEYVTSITNLRRCSSSPLLEACAFLRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LACTOTRANSFERRIN
publication title Crystal structure of equine apolactoferrin at 303 K providing further evidence of closed conformations of N and C lobes.
pubmed doi rcsb
molecule tags Metal transport
total genus 168
structure length 689
sequence length 689
ec nomenclature
pdb deposition date 2001-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00405 Transferrin Transferrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1i6bA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1i6bA04
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1i6bA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1i6bA03
2RKMA 4OFLA 3S9EA 1POY1 4ZECA 2QSXA 3IORA 3Q27A 4BDQA 2Y7WA 5EHMA 4Z7EA 3TCHA 1N0TA 2V3UA 1Y3NA 4U23A 1XT8A 1JW4A 2O7UA 4DE8A 3U1OA 1DSNA 1LSTA 1PB8A 1XVYA 2FYIA 2B3BA 3VLVA 3HHFA 3WAEA 1TFAA 2F78A 4DXBA 2HZLA 2RCBA 5H8SA 3H7MA 3S9NC 1CE2A 4F2QA 1OLCA 1ANFA 1EZPA 1SDXA 4ELPA 5K2YA 3R7XA 3OSQA 4AB6A 1URDA 3TTRA 3H4ZA 4H1XA 3K1NA 4RY1A 1MY2A 4BDRA 3O6GA 3C4MA 3A09A 3G7WA 1II5A 1QULA 3M8UA 5I56A 1IUDA 3A3CA 2P1SA 4KFQA 3RNNA 3G3HA 3V89B 3FIRA 3FUZA 2NOOA 1P1OA 1ZBMA 4NF8A 1UTBB 3U93A 2D5WA 4NTLA 3SDFA 1USYH 1LB9A 3O6IA 3KBRA 4RJZA 3FATA 3RLFE 4GFRA 4H8IA 3H3GA 3IOUA 4Z0IA 1P99A 1I6BA 3EQ1A 3OO6A 1SVXB 2QMWA 2UVJA 4OESA 4EF1A 3H06B 2DVCA 3PPPA 3DLNA 3R26A 2ONKE 1JVYA 3S4UA 1N7XA 2QS4A 1PBQA 1LGBC 4NEDA 4I1DA 2H99A 3RN8A 1URSA 5ELVA 5EYFA 5CM6A 1LAFE 1SW4A 4IB2A 1B32A 3EPEA 3TMGA 4RPNA 3ZKLA 2G29A 1JW1A 2B65A 3TUSA 4XKPA 1GV8A 4M1VA 1B3GA 1XHYA 4QRZA 5JK4A 4YB7A 4TOZA 3IJOB 5H8HB 3RT6B 3HO7A 2Q8JA 5F1QA 2FA7A 4EDPA 4ESWA 4BDOA 2XXWA 5JTYB 1NMUA 1VFDA 1YPNA 1LBCA 3CFLA 1US5A 2DWJA 3SETA 5HM4B 5I57B 4OZ9A 1URGA 1B5IA 4KCDA 1LFHA 2DXRA 4U1OA 2Z22A 1H76A 3MZ9A 3E13X 4BLAA 4H0WA 2XXIA 3E3KA 1FQBA 3MZ1A 2PT1A 2Y7RA 3G3KA 1ZLQA 2Z8DA 4EF2A 1JETA 5I2KA 4XIGQ 3F11A 2PVUA 4ELRA 5KZTA 3V83A 5CMBA 4N6PA 4OETA 1BLFA 4ESXA 4PFYA 3FVGA 3FVKA 3GLBA 3BFTA 3IO4A 5HBCA 1P1NA 3DM0A 2XD3A 3KN8A 1FCKA 5ICTA 5H8FB 1LAXA 4U4XA 3HPIA 3DP4A 4R6HA 2O1MA 4Q5TA 4NMYA 2XXUA 3TKDA 1WDNA 4NF6B 2NVUB 1N04A 3ILTB 5DYHA 1PB7A 3VXCA 2UXAA 3VFJA 2F8DA 3IJXB 3TCGA 1UTHA 2NWJA 1N3WA 4HCYA 3GZGA 2FNCA 1VFEA 4KR5A 1D4NA 3PGFA 3O2AA 3H6TA 3GBAA 3TTNA 4G68C 1A55A 4N07A 3IOVA 1A8FA 3VDFA 2HQ0A 2DS9A 1BTJA 3VE1B 4MFIA 2O6AA 2G93A 1QJMA 1P1UA 4ZEBA 1LCFA 3MVYA 4KPTA 4GXAA 1IQ7A 5TP9A 4R73A 1DOTA 1H3DA 4U1ZA 3Q26A 2IEEA 2ZXTA 4ONYA 1B9JA 4ZE8A 1NNPA 3I3VA 5AA4B 1PDAA 1B7ZA 3MVZA 3FXRA 3T22A 1Q1KA 5L8DA 3IX1A 3W9VA 2ZNUA 1NH8A 3VXBA 4FEDA 2VHAA 3PPOA 4R75A 2OJTA 2O84X 4EUOA 1GTKA 4POWA 4QHQA 4X48A 2QS3A 4KQPA 4OWDA 5CMKA 1M5DA 1TT1A 2PT2A 4R6YA 4YZZA 4ISUA 4G68B 1RYXA 4XKRA 4ECFA 4KYEA 1MPBA 1L5TA 3T96B 3T9UA 4YICA 3C31A 4IO3A 2OZZA 3LSWA 4GXSB 5DEXB 2WKYA 3N6UA 4WXJA 3CRBA 4OHNA 3IOWA 2YLNA 2V25A 2H98A 3H6UA 2Y84A 4F3SA 3OO8A 1D9VA 2PYYA 4IO5A 4MH5A 1RKMA 3SEXA 2DVZA 4LONB 4TLLB 3CIJA 1EU8A 2AL4A 1MXYA 4OTEA 4LZ8A 3LSFB 5AA2B 2DOJA 2O7IA 1B52A 2Z23A 2F7AA 4GIZA 3PUZE 4FE8A 3K6XA 4FAJA 3FXQA 3O97A 4P0GA 4ND9A 2XXTA 1Y1ZA 2GFEA 4O3BA 1B05A 4OENA 1YTVA 3TTMA 4UA8A 3PUVE 4DDDA 5HPQA 3VV5A 1JEVA 5TU0A 2PX1A 1B1HA 5K2XA 3C35A 4ELOA 2REJA 1QKBA 1B0LA 1LLSA 5A5XA 4G8MA 3KEIA 1AL3A 1R1NA 3UORA 4YKKA 2HZKA 3M3LA 4Q0CA 4HTGA 2QPQA 4IGTA 4F3GA 1NH7A 3CVGA 3KN3A 5AA2D 1MQJA 2I4BA 1NNFA 2ONRA 5H8NB 1FTMA 3U92A 4XKNA 1EZOA 3TQLA 2OBGA 3QYTA 2F36A 3CSGA 2M8CA 4YKIA 3TODA 1AOVA 1MPCA 5I59B 4TLMB 1MRPA 1T0KA 4OVJA 2NUVA 4F3PA 4QSEA 3PUYE 3QIMA 4AB5A 3BKIB 5I2NB 1B4ZA 1R6ZA 4ZDMA 4JXIA 1B58A 2QL3A 3CFZA 4GOTA 3I5OA 3LR1A 2AIXA 4OMBA 3B7DA 4DLDA 3MUQA 4C0RA 4JB7A 3MPLA 3MP8A 2NXOA 1ZIUA 4GL0A 3T9HB 1HSJA 2UVHA 2D21A 3CFXA 3H6WA 4F39A 2Y7KA 4X9TA 5H8QA 4IO2A 1S7YA 1DPEA 3B6TA 3ECRA 1GR2A 2ZYOA 2HAVA 4H8JA 4I62A 3O29A 2THIA 4TQUQ 1H44A 1P1QA 1ZJLA 5CRYA 1O63A 1QKAA 2ALUA 4LP2B 4RK9A 1MY3A 1TXFA 1SD3A 1OQGA 4JSOA 3VLWA 4OFJA 4GLIA 2YPNA 2REGA 2OWSA 1GVCA 3TEPA 5IKBA 2X7PA 1XOCA 1Y20A 3CI8A 2XX7A 3K6UA 5CBRA 2GH9A 4C1UA 4NE4A 1EZ9A 3K1MA 2DXYA 4IO7A 3IR1A 1Y3PA 4EQ9A 3K6WA 5CMMA 1XC1A 4F31B 3K01A 4EXLA 3PUXE 2XXYA 4AQ4A 3OXNA 4POXA 1R9LA 3ZSFA 4F1VA 2UVIA 3TAJA 5M2VA 5KCJB 3M3KA 1UTBA 4C1TA 1MG1A 4H5FA 2QMXA 1SI1A 2Y7PA 5KDTB 4F22A 3PPQA 4JSDA 2ABHA 1FTLA 3TFLA 1MDQA 3C34A 1B2HA 3HHGA 3KG2A 3ODBA 1LB8A 1ZU0A 1JEUA 4F29A 3PMWA 1B7UA 2DWHA 4ZEFA 1N84A 3MVWA 5J1DA 5CBSA 3OO9A 3TYHA 3RY3A 2PMSA 3MP6A 3OEMA 1M5BA 2Q9TA 3MAMA 1B40A 3EN3A 3DP8A 4GWOA 1OVTA 5I58B 4OYVA 3FGSA 2P0SA 3S9MC 1MQGA 4X1BA 2ZMBA 1EH3A 4MF3A 2W7YA 2HAUA 4PFTA 3SESA 2A5TB 4IY6A 4R72A 5EHSA 1B0HA 1A7LA 5H8HA 3HCQA 2GRVA 3UGWA 4QSDA 3T9XB 1IXHA 3KZGA 1ZMGA 3BFUA 5JTYA 2RF1A 3TZAA 2KLFA 3WAFA 1AIVA 2R9JA 3MWBA 1ATGA 4IO4A 4EXKA 3LSLA 3KN7A 2QS2A 3MZBA 3OOAA 3TDJA 5L9MA 1XS5A 1A8EA 4P11A 4BDMA 4GD5A 4ZZEA 4OEVA 5FTIA 4DCYA 3UK4A 3E4RA 1SI0A 3IL1B 2Q89A 4O3AA 1O64A 2GHAA 2XXQA 1N3XA 4G8HA 3IO6A 2LAOA 4FECA 3EHTA 1F9BA 2O1LA 2H4IA 3RUMA 4YKPA 2V3QA 4JBZA 2F6PA 4KD5A 3CSBA 1MPDA 1TWYA 4OFOA 3IK6B 1B46A 3LC8A 4NF4B 4ZEDA 4QSCA 4NF6A 4OXVA 4XTCQ 2I3VA 2A5SA 3OD7A 2UYFA 5L9OA 4H5GA 4JWXA 4ZZAA 3IB1A 3LSXA 1A99A 3RT8A 1MQIA 4RYAA 1FQCA 2O51A 1P1WA 1LBBA 2P2AA 4BDLA 3G3FA 1H43A 2OLBA 3V8XB 2ZNTA 4RXLA 3EHSA 3S2VA 1OLAA 2CMOA 5CC2A 4NF5B 3KFMA 5DTBA 4JDFA 2VGQA 3DELB 5TPAA 1UIUA 3KSJA 2DE2A 1XVXA 1PBPA 4QFKA 5DT6A 4QFOA 3RTWB 5AE4A 1MM6A 2DWAA 1UQWA 2V3TA 3G3IA 5L9SA 3KSXA 1MY0A 3JV9A 1QUIA 3LUYA 4KYSA 3PMXA 4THIA 4R9GA 3TTLA 2DE3A 3OELA 1MH4A 1JQFA 3Q25A 3U8QA 1B5JA 1YCJA 1Y4CA 1VR5A 1Z7ME 2ANJA 2HFBA 5LOMA 1HSEA 5AA4A 3FD3A 5FHOA 1RYOA 3U72A 2UYEA 4KI0E 1Z7NE 1FTKA 1HSLA 4PFWA 1SYIA 3FVNA 1DPPA 1MXWA 1A54A 2I49A 3E9XA 1LCTA 1QW0A 2DSFA 3D4GA 2OK2A 4OEUA 2VD2A 1POTA 4G4PA 1AMFA 3K6VA 3MJNA 1O7TA 5I84A 3OENA 3ZS6A 3V5AA 1IXCA 4LZ5A 4LQ5A 4F3BA 4L17A 4KYDA 2DQVA 2V84A 3OMBA 1IXIA 1WVJA 3FZVA 4EQ7A 1H45A 5DEXA 3SEWA 2I58A 2XXPA 4F19A 3FJGA 3PMVA 3SEYA 4DXUA 5B7DA 4MLQA 5B70A 4YB5A 2GHBA 4JWYA 3KJ7A 3UIFA 3W15C 1BIYA 4U2RA 4E0XA 5FHMA 3RTFB 3N5LA 3T93B 1IEJA 3MP1A 1OVBA 1MXZA 1IXGA 3BBRA 4WEDA 4QFLA 3PUWE 1FQAA 4NWCA 5AA2A 2H9BA 1MY4A 4QFNA 5I56B 2ZYKA 1KWHA 4YMBA 3TCFA 1FW0A 4MBPA 5FTHA 3ONMA 3T9VA 1S9TA 5CMCA 2XX8A 1Y9UA 3MC2A 3C33A 4NF8B 1PEBA 1MS7A 3MW0A 3PV0E 3C36A 1DTGA 2VOZA 2ESNA 5F7VA 5CI5A 1PC3A 2ZNSA 5ISUA 5DVJA 3KOSA 1BKAA 3H03A 1OMPA 3K02A 3FJ7A 4OQOA 1NKXA 1QUKA 5AA1A 2X26A 4YMAA 4U4SA 3H6VA 1SW2A 3MQ9A 4FIMA 1S50A 4QFPA 1N76A 1US4A 3FVOA 4PFUA 2HXWA 1GGGA 3QUFA 1SW5A 1R9QA 2BJJX 2OCUA 1MH3A 3L6HA 5H8NA 1MQHA 4RPOA 1M5FA 4K3FA 2Z8EA 3L6GA 1B3LA 4PE5B 1B3HA 2ZYMA 3R6UA 3S9LC 3LBSA 5I59A 4YAHX 3I6VA 3QK6A 1FTJA 3THIA 3K4UA 3K0VA 2QJEA 1VSOA 5I2NA 1B4HA 2I6EA 1ELJA 2O68A 4ZE9A 4R6KA 1B7HA 3KGCA 4LQ2A 2F7BA 3EHUA 2Y7IA 3USDA 4IO6A 3G3GA 3SEUA 5BWJA 4R2BA 3FASA 3IOTA 4U22A 5AA3A 4H67A 2AL5A 4DCXA 4ZEIA 3K2DA 2DYXA 5I2KB 4MLVA 4OERA 3O28A 2D3IA 1B3FA 3T66A 4H65A 1A40A 1Y1MA 1B51A 3CR9A 3OO7A 2OWTA 4UACA 2VD3A 4FORA 4F1YA 1B6HA 4DXCA 2DE4A 2QRYA 2R71A 2PBWA 1LFGA 2F7CA 2XXHA 4F2OA 2H5YA 1M5EA 4LVQA 4E0WA 4G77A 2F6GA 4KHZE 3B6WA 3RGYA 3CG1A 4RA1A 4Q30B 5FHNA 4JWOA 4F1UA 3IAZA 3N6TA 2IA4A 1WODA 1ZTYA 4ZEKA 4EQBA 4WEPA 3TQWA 3RQTA 3IB0A 4GF8A 4DZ1A 2XXXA 1SBPA 3GXAA 4FJPA 1UTHB 4YKJA 4GL8A 2I0CA 2RC9A 4M4GA 2RCAA 3UA8A 5DVFA 3VLUA 3W9WA 1IITA 2RC8A 3N26A 4LATA 1B3EA 4I9DA 2F97A 5KCJA 4F18A 3DP6A 3EF7A 2H25A 2XXVA 3OSRA 4P0IA 4BDNA 1J1NA 3O9PA 5KDTA 3A3UA 1FQEA 4GVOA 5DVIA 2CZLA 1Y3QA 2QS1A 1VE4A 1BP5A 5TP9B 4LZ7A 5I57A 4R9FA 1JNFA 4HW8A 5IAIA 3C32A 2Z8FA 3SERA 1I69A 4QF9A 3QUJA 1IIWA 4XKQA 1JVXA 1OQHA 3HV1A 3GBBA 1USYE 1TFDA 4PP0A 4RK2A 4PETA 1QVSA 2AYSA 4I8CA 3IB2A 4Q8RA 1NNKA 1PB9A 5I58A 2E1SA 3ZKKA 1B5HA 4DIGA 3Q28A 1YAEA 1CB6A 2A5TA 4R2FA 2I3WA 3TTKA 2F35A 4ZS9A 4ELQA 5TPAB 1NL5A 2E0SA 3KOTA 4HCWA 5H8FA 3PPRA 3UP9A 5ITPA 1B1XA 4HS7A 3RPWA 3K1PA 4LA9A 1SYHA 4R74A 3O6HA 3P7IA 3MPKA 1IZ1A 3UN6A 3KJTA 3AXFA 2HCAA 1DMBA 2B3FA 1AH5A 2XD2A 3VVEA 4G8NA 1FTOA 2Q88A 4PQJA 2R6GE 2I48A 1Y4TA 2YJPA 3OEKA 3D4CA 1MDP1 3MVXA 4YU0A 2Q2CA 4FATA 5ICQA 5JEIA 2Q2AA 4G2ZA 3ILUB 3JZJA 4H6DA 3QXMA 1MM7A 3FXUA 1I6AA 4IY5A 3G3JA 1D3KA 1MXXA 1MY1A 4XXUA 2I4CA 1LAGE 2UVGA 4NWDA 2ZYNA 5ITOA 2I0BA 1NFTA 1OIBA 4NF4A 1JW5A 3C9HA 1LAHE 2RINA 1UIVA 3TELA 3FJMA 3PD8A 2F5XA 5A5XB 2RC7A 1DTZA 2XXRA 1MXUA 4GRKA 4NF5A 4X1DA 1MQDA 4N13A 1SQYA 2DWIA 1LFIA 2XHDA 2X7QA 3VVFA 4U21A 3Q29A 3U94A 4O3CA 4LUBA 1I6QA 4G68A 2ONSA 2DP8A 3SKPA 3K00A 3QAXA 3FV1A 2VP1A 3QSLA 1FQDA 3N94A 1MXVA 1ZKBA 3M3FA 2O69A 3HN0A 1D9YA 2F34A 1SW1A 4GQOA 5BUUA 3MBPA 3FV2A 2V93A 3CG3A 4IGRA 3VVDA 4YB6A 1N7WA 3PU5A 2HEUA 4FEBA 3O66A 3SEVA 3TPAA 4KCCA 2XX9A 1FQFA 4WKMA 1QUJA 1NNTA 3B6QA 3PPNA 3HSTA 5H8QB 3JYRA 1M5CA 3PD9A 4RNSA 1Q35A
chains in the Genus database with same CATH superfamily
2RKMA 4OFLA 3S9EA 1POY1 4ZECA 2QSXA 3IORA 3Q27A 4PE3A 4BDQA 2F3DA 2Y7WA 5EHMA 4Z7EA 3TCHA 1N0TA 2V3UA 1Y3NA 4U23A 1XT8A 5FBPA 1JW4A 2O7UA 4DE8A 2FVZA 3U1OA 1DSNA 1LSTA 1PB8A 4NQ8A 1XVYA 2FYIA 4MMPA 2B3BA 3VLVA 3HHFA 3WAEA 4N91A 2XWKA 1TFAA 2F78A 4DXBA 2HZLA 2RCBA 5H8SA 3H7MA 3S9NC 1IMBA 1DK4A 1CE2A 4F2QA 1OLCA 1ANFA 1EZPA 5A5LA 1SDXA 4ELPA 5K2YA 4MHFA 3R7XA 3OSQA 4AB6A 1URDA 3TTRA 3H4ZA 4H1XA 3K1NA 4RY1A 1MY2A 4BDRA 2XA5A 3O6GA 2HPGA 3C4MA 3A09A 3G7WA 1II5A 1QULA 3M8UA 5I56A 1IUDA 3A3CA 2P1SA 4KFQA 3RNNA 5IZ1A 3G3HA 3V89B 3FIRA 3FUZA 2NOOA 1P1OA 1ZBMA 4NF8A 1UTBB 3U93A 4N15A 2D5WA 4NTLA 3SDFA 1USYH 1LB9A 4PF8A 3O6IA 3KBRA 4RJZA 3FATA 3RLFE 4GFRA 4H8IA 3H3GA 3IOUA 4Z0IA 1P99A 1I6BA 3B50A 3EQ1A 3OO6A 4NG7A 1SVXB 2QMWA 2UVJA 4OVPA 4OESA 4EF1A 3H06B 4OA4A 2DVCA 3PPPA 3DLNA 1FBEA 3R26A 2ONKE 4HXVA 1JVYA 3S4UA 1N7XA 2QS4A 1PBQA 2ZZXA 1LGBC 4NEDA 4I1DA 2H99A 3RN8A 4O94A 1URSA 4H46A 5ELVA 5EYFA 5CM6A 1LAFE 1SW4A 4IB2A 1B32A 3EPEA 3TMGA 4RPNA 3ZKLA 2G29A 5ET6A 1JW1A 2B65A 3TUSA 4XKPA 1GV8A 4M1VA 1B3GA 2PFZA 1XHYA 4QRZA 2GQ1A 5JK4A 4YB7A 4TOZA 3IJOB 5H8HB 3RT6B 3HO7A 4XEQA 2Q8JA 2XXKA 5F1QA 2FA7A 4EDPA 1FPEA 4ESWA 4BDOA 2XXWA 1JP4A 1KZ8A 4P8BA 5JTYB 1NMUA 1VFDA 1YPNA 1FTAA 1LBCA 3CFLA 1US5A 2DWJA 3SETA 5HM4B 5I57B 4OZ9A 1URGA 1RDZA 1B5IA 4KCDA 1LFHA 2DXRA 4U1OA 2Z22A 1H76A 3MZ9A 1KA1A 1FPKA 2P3VA 3E13X 4BLAA 4H0WA 2XXIA 3E3KA 1FQBA 3MZ1A 1FPBA 2PT1A 2Y7RA 3G3KA 1ZLQA 2Z8DA 4EF2A 1JETA 5I2KA 4XIGQ 4JVIA 3F11A 2XWOA 2PVUA 4X04A 4NX1A 4ELRA 5KZTA 3V83A 5CMBA 4N6PA 4OETA 1BLFA 2VPNA 4ESXA 4PFYA 2CEYA 3FVGA 1NUWA 3FVKA 3GLBA 3BFTA 3IO4A 5HBCA 1P1NA 3DM0A 5ESYA 2XD3A 3KN8A 1FCKA 5ICTA 4GWWA 5H8FB 1LAXA 4U4XA 3HPIA 3DP4A 4R6HA 1NV5A 2O1MA 4Q5TA 5T3JA 5EQAA 4NMYA 2XXUA 1G0HA 3TKDA 1WDNA 2B4LA 4NF6B 2NVUB 1N04A 3ILTB 5DYHA 1PB7A 3VXCA 2UXAA 3VFJA 2F8DA 3IJXB 3TCGA 1UTHA 2NWJA 1N3WA 4HCYA 3GZGA 2WBBA 2FNCA 1VFEA 4KR5A 1D4NA 3PGFA 3O2AA 3H6TA 3GBAA 3TTNA 4G68C 1A55A 4N07A 3IOVA 1A8FA 4I3EA 3VDFA 2HQ0A 2DS9A 4GWXA 1BTJA 4GX6A 3VE1B 4MFIA 2O6AA 2G93A 1QJMA 1AWBA 1P1UA 4ZEBA 1LCFA 3MVYA 4KPTA 4GXAA 4OVTA 2QVUA 1BK4A 1IQ7A 5TP9A 3RPLB 4R73A 1DOTA 1H3DA 4U1ZA 2F3BA 3Q26A 1EYIA 2Y5KA 4PBQA 2IEEA 2ZXTA 4ONYA 1B9JA 4ZE8A 1NNPA 3I3VA 5AA4B 4NN3A 1PDAA 1B7ZA 3MVZA 3FXRA 3T22A 1Q1KA 5L8DA 3IX1A 3W9VA 2ZNUA 1D9QA 1NH8A 3VXBA 4FEDA 2VHAA 3PPOA 4R75A 2OJTA 2O84X 4EUOA 1GTKA 4POWA 4QHQA 4X48A 2QS3A 4KQPA 4OWDA 5CMKA 1YYZA 1M5DA 1TT1A 2PT2A 4R6YA 4YZZA 4ISUA 1K9ZA 4G68B 1RYXA 4XKRA 1LEVA 1FBFA 4ECFA 4KYEA 5F24A 1MPBA 1L5TA 3T96B 4GWUA 3T9UA 4YICA 3C31A 2FIXA 4IO3A 2OZZA 3LSWA 4O8MA 4GXSB 5DEXB 2WKYA 3N6UA 4WXJA 3CRBA 4OHNA 3E78A 3IOWA 1FBPA 2YLNA 2V25A 2H98A 3H6UA 2Y84A 4F3SA 1FBDA 3OO8A 1D9VA 2KR0A 2PYYA 4IO5A 4MH5A 1RKMA 3SEXA 2DVZA 4LONB 4TLLB 1CNQA 3CIJA 1LBZA 2PCRA 1EU8A 2AL4A 1MXYA 4OTEA 4LZ8A 3LSFB 5AA2B 2DOJA 1IMCA 2O7IA 1B52A 2Z23A 2F7AA 4GIZA 3PUZE 4FE8A 2FIEA 3K6XA 4FAJA 3FXQA 3O97A 5I5PA 4P0GA 4ND9A 2XXTA 1Y1ZA 2GFEA 4O3BA 1B05A 4OENA 1YTVA 3TTMA 4UA8A 3PUVE 4DDDA 5HPQA 1YXIA 2WYPA 3VV5A 1JEVA 5TU0A 2Q74A 2PX1A 1B1HA 5K2XA 3C35A 4ELOA 2REJA 1QKBA 4N6KA 1B0LA 4MEVA 1LLSA 5A5XA 4G8MA 3KEIA 1AL3A 1FRPA 1R1NA 3UORA 4YKKA 2HZKA 3M3LA 4Q0CA 2ZZWA 4HTGA 2QPQA 1VDWA 4IGTA 1EYKA 4F3GA 1NH7A 2WEFA 2FBPA 3CVGA 3KN3A 5AA2D 4MJOA 1MQJA 2I4BA 1NNFA 4HE0A 1IMEA 2ONRA 5H8NB 1FTMA 3U92A 4XKNA 1EZOA 3TQLA 2OBGA 3QYTA 1IMDA 2F36A 4XFEA 3CSGA 2M8CA 1NV6A 1FPLA 4YKIA 3TODA 1AOVA 1MPCA 5I59B 4TLMB 1MRPA 1T0KA 4OVJA 2NUVA 4F3PA 4QSEA 3PUYE 3QIMA 4NAPA 4AB5A 3BKIB 1LBWA 5I2NB 4PAFA 1B4ZA 1R6ZA 4ZDMA 4JXIA 1B58A 1FJ6A 2QL3A 3CFZA 4GOTA 4AS5A 3I5OA 3LR1A 2AIXA 4OMBA 3B7DA 4N17A 4DLDA 3MUQA 4C0RA 4JB7A 3MPLA 3MP8A 3IFAA 3RYDA 2NXOA 1ZIUA 4GL0A 3T9HB 1HSJA 2UVHA 2D21A 3CFXA 3H6WA 4F39A 2Y7KA 4X9TA 5H8QA 4IO2A 1S7YA 5IZ3B 1DPEA 4N81A 3B6TA 3ECRA 1GR2A 2ZYOA 2HAVA 4H8JA 4I62A 3O29A 2THIA 4TQUQ 3EKIA 1H44A 3FBPA 1P1QA 1ZJLA 5CRYA 1O63A 1QKAA 2ALUA 4LP2B 4RK9A 1MY3A 1TXFA 1SD3A 1OQGA 4JSOA 4N4UA 1SPIA 3VLWA 4OFJA 4GLIA 2YPNA 2REGA 2OWSA 1GVCA 3TEPA 5IM2A 5IKBA 4OANA 4GWZA 2X7PA 1XOCA 1Y20A 3CI8A 2XX7A 3K6UA 5CBRA 2GH9A 4C1UA 4NE4A 1EZ9A 3K1MA 2DXYA 4IO7A 3IR1A 1Y3PA 4EQ9A 5ET8A 1FPFA 3K6WA 2JJKA 1RDYA 5CMMA 1XC1A 4G61A 4F31B 3K01A 4EXLA 3PUXE 4GX4A 2XXYA 4O7MA 4AQ4A 3OXNA 5I3SA 4POXA 1R9LA 3ZSFA 4F1VA 2UVIA 4XF5A 3TAJA 5M2VA 5KCJB 4PFBA 3M3KA 4LN5A 1UTBA 2HHMA 1MG1A 3KBZA 4C1TA 4H5FA 2QMXA 1SI1A 2Y7PA 3BIHA 5KDTB 4F22A 3PPQA 3T1BA 4JSDA 2ABHA 1FTLA 3TFLA 4OVRA 1MDQA 4QBAA 2QVRA 3C34A 4P47A 1B2HA 3HHGA 3KG2A 3ODBA 1KA0A 1LB8A 1ZU0A 1JEUA 4F29A 3PMWA 1B7UA 2DWHA 4ZEFA 1N84A 3MVWA 5J1DA 1FPDA 4GWSA 2WBDA 5CBSA 3OO9A 3TYHA 3RY3A 2PMSA 3MP6A 1FBCA 1M5BA 2Q9TA 3MAMA 3OEMA 4IR8A 1B40A 3EN3A 3DP8A 3HFUA 4GWOA 1OVTA 5I58B 4OYVA 3FGSA 2P0SA 3S9MC 4PDDA 3T0JA 1MQGA 4NGUA 2OX3A 4X1BA 2ZMBA 1EH3A 4MF3A 4PFTA 2W7YA 2HAUA 3SESA 2A5TB 4IY6A 4PGPA 4R72A 5EHSA 1B0HA 1A7LA 5H8HA 3HCQA 2GRVA 3UGWA 4QSDA 3T9XB 1IXHA 3KZGA 1ZMGA 3BFUA 5JTYA 2RF1A 5LTCA 3TZAA 2KLFA 3KC1A 3WAFA 1AIVA 2R9JA 3MWBA 1ATGA 4IO4A 4EXKA 3LSLA 4GBVA 4PFIA 3KN7A 2QS2A 3MZBA 3OOAA 3TDJA 5L9MA 3MYUA 1XS5A 1A8EA 4P11A 4BDMA 4GD5A 4ZZEA 4OEVA 5FTIA 4DCYA 3SZPA 3UK4A 3E4RA 1SI0A 3IL1B 2Q89A 4O3AA 4QXDA 1O64A 2GHAA 2XXQA 1DCUA 1N3XA 4G8HA 1FPGA 3IO6A 5ET7A 2LAOA 4FECA 4N8GA 3EHTA 1F9BA 2O1LA 2H4IA 1LBXA 3RUMA 2ZZVA 4YKPA 2DDKA 2V3QA 2HXRA 4JBZA 2F6PA 4KD5A 3CSBA 1MPDA 1TWYA 4OFOA 5ET5A 3IK6B 1B46A 3LC8A 4NF4B 4ZEDA 4QSCA 4NF6A 4OXVA 4XTCQ 2I3VA 2A5SA 3OD7A 2UYFA 3LV0A 5L9OA 4H5GA 4JWXA 4ZZAA 3IB1A 3LSXA 1A99A 3RT8A 1MQIA 2XWVA 1FQCA 2O51A 4RYAA 1P1WA 1LBBA 2P2AA 4BDLA 3G3FA 1H43A 2OLBA 3V8XB 2ZNTA 4RXLA 3EHSA 1FSAA 3S2VA 1EYJA 1OLAA 2CMOA 5CC2A 4NF5B 3KFMA 3PTYA 5DTBA 4JDFA 2VGQA 3DELB 5TPAA 1UIUA 3KSJA 2DE2A 1XVXA 1PBPA 4QFKA 5DT6A 4QFOA 3RTWB 5AE4A 3QMFA 1NV1A 1MM6A 2DWAA 1UQWA 2V3TA 3G3IA 5IZZA 5L9SA 3KSXA 1MY0A 3JV9A 1QUIA 3LUYA 4KYSA 3PMXA 4THIA 1FBGA 4R9GA 3TTLA 2DE3A 3OELA 3RPLA 2R8TA 4P3LA 1MH4A 1JQFA 3Q25A 3U8QA 1B5JA 1YCJA 1Y4CA 1VR5A 1Z7ME 2ANJA 2HFBA 1NV0A 5LOMA 1HSEA 5AA4A 3FD3A 5FHOA 1RYOA 3U72A 3BIGA 2UYEA 1NV4A 4KI0E 2MKZA 4HE2A 1Z7NE 1FTKA 1HSLA 4PFWA 1SYIA 3FVNA 4FBPA 1DPPA 1MXWA 1NI9A 1A54A 2I49A 3E9XA 1LCTA 1QW0A 2DSFA 3D4GA 2OK2A 4OEUA 2VD2A 4PF6A 1POTA 4G4PA 1AMFA 3K6VA 3MJNA 1O7TA 5I84A 3KC0A 3OENA 1YZ0A 3ZS6A 3V5AA 1IXCA 4LZ5A 4LQ5A 4F3BA 4L17A 4KYDA 2DQVA 2V84A 2L5VA 3OMBA 1IXIA 1WVJA 1K9YA 3CHGA 3FZVA 4EQ7A 1H45A 2CZIA 5DEXA 3SEWA 2I58A 5EQ8A 2XXPA 4F19A 4DI3D 3FJGA 3PMVA 3SEYA 4DXUA 5B7DA 4MLQA 5B70A 4AS4A 4YB5A 2GHBA 1LBVA 4OVSA 4GWYA 4JWYA 3KJ7A 3UIFA 3W15C 1BIYA 4U2RA 4E0XA 5FHMA 4MNPA 3RTFB 3N5LA 3T93B 2XWIA 1IEJA 3MP1A 1OVBA 1MXZA 1IXGA 3BBRA 4WEDA 4QFLA 3PUWE 5IGAA 1FQAA 4NWCA 2CEXA 5AA2A 4GX3A 2H9BA 1MY4A 4QFNA 5I56B 2ZYKA 1KWHA 4YMBA 4JVCA 3TCFA 1FW0A 4MBPA 5FTHA 3ONMA 3T9VA 1S9TA 5CMCA 2XX8A 1Y9UA 1RDXA 3MC2A 3C33A 4NF8B 1PEBA 1MS7A 3MW0A 3PV0E 3C36A 1DTGA 2VOZA 2ESNA 5F7VA 5CI5A 1PC3A 4MAGA 2ZNSA 5ISUA 4H45A 5DVJA 1DBZA 3KOSA 1BKAA 3A29A 5I7IA 2VPOA 3H03A 1OMPA 1INPA 3FXBA 3K02A 3FJ7A 4OQOA 1NKXA 1QUKA 4HE1A 5AA1A 2X26A 4YMAA 4U4SA 3H6VA 1SW2A 3MQ9A 4FIMA 1S50A 4QFPA 1N76A 1US4A 3FVOA 4PFUA 2HXWA 1GGGA 4N6DA 4P56A 1NUZA 3QUFA 1SW5A 1FPJA 1R9QA 2BJJX 2OCUA 3ISPA 1MH3A 3L6HA 5H8NA 1MQHA 4RPOA 1M5FA 3IFCA 4K3FA 2Z8EA 3L6GA 1B3LA 4JVDA 4PE5B 2PFYA 1B3HA 2ZYMA 3R6UA 3S9LC 3LBSA 4I3YA 5I59A 4YAHX 3I6VA 1IMAA 1NV7A 3QK6A 1FTJA 3THIA 3K4UA 3K0VA 2QJEA 1VSOA 5I2NA 1B4HA 3B8BA 5DW8A 2I6EA 1ELJA 2QVVA 2O68A 4ZE9A 4P1LA 4R6KA 1B7HA 3KGCA 4LQ2A 2F7BA 4P9KA 3EHUA 2Y7IA 3USDA 4IO6A 3G3GA 3SEUA 5BWJA 2QFLA 4R2BA 3FASA 4PC9A 3IOTA 4U22A 5AA3A 2FHYA 4H67A 2AL5A 4DCXA 5IZ3A 5EYHA 4ZEIA 3K2DA 2DYXA 5I2KB 4MLVA 4OERA 3O28A 2D3IA 1B3FA 3T66A 4H65A 1A40A 1Y1MA 1B51A 3CR9A 3OO7A 2OWTA 5EYGA 4UACA 2CZKA 2VD3A 3MSTA 4PDHA 4FORA 4F1YA 1B6HA 4DXCA 2DE4A 2QRYA 2R71A 2PBWA 1LFGA 2F7CA 2XXHA 4F2OA 2H5YA 1NV2A 1M5EA 4LVQA 4E0WA 4G77A 2F6GA 4KHZE 3B6WA 1IMFA 3RGYA 5LDZA 3CG1A 2B4MA 1LBYA 4RA1A 4Q30B 5FHNA 4JWOA 4F1UA 3IAZA 3N6TA 2IA4A 1WODA 1ZTYA 4ZEKA 4EQBA 4WEPA 3TQWA 3RQTA 3IB0A 4GF8A 4DZ1A 2XXXA 2CZHA 1SBPA 3GXAA 4FJPA 1UTHB 3NOHA 4YKJA 4GL8A 2I0CA 2RC9A 4M4GA 2WYKA 2RCAA 3UA8A 5DVFA 3VLUA 3W9WA 1IITA 2RC8A 3N26A 4LATA 4MNIA 4I9DA 1B3EA 2F97A 5KCJA 2VT5A 4MX6A 4F18A 3DP6A 3EF7A 2H25A 2XXVA 3OSRA 4P0IA 4BDNA 1J1NA 3O9PA 5KDTA 4I40A 2Q8MA 3A3UA 1FQEA 4GVOA 4PBHA 2CZLA 5DVIA 1Y3QA 2QS1A 1VE4A 1BP5A 5TP9B 4LZ7A 5I57A 2V4CA 4R9FA 1JNFA 4HW8A 4P1EA 5IAIA 3D1RA 3C32A 2Z8FA 3SERA 1I69A 4QF9A 4N8YA 1Q9DA 3QUJA 1IIWA 4XKQA 1JVXA 1OQHA 3HV1A 3GBBA 1USYE 1TFDA 4PP0A 4RK2A 5EQ9A 4PETA 4PAKA 1QVSA 1XI6A 2AYSA 4I8CA 3IB2A 4Q8RA 1NNKA 1PB9A 5I58A 2E1SA 3ZKKA 1NV3A 1B5HA 4DIGA 3Q28A 1YAEA 4NF0A 1CB6A 2A5TA 4DI4B 4R2FA 2I3WA 3TTKA 2F35A 4ZS9A 4ELQA 5TPAB 1NL5A 2E0SA 3KOTA 4HCWA 5H8FA 3PPRA 3UP9A 5ITPA 1B1XA 2P3NA 4HS7A 1NUXA 3RPWA 3K1PA 4LA9A 5J16A 1SYHA 4R74A 4KXPA 4PAIA 3O6HA 3GYYA 3P7IA 3MPKA 2KQZA 1IZ1A 3UN6A 3KJTA 3AXFA 4OVQA 2HCAA 3U65A 1DMBA 2B3FA 1AH5A 2XD2A 4MIJA 3VVEA 4G8NA 1FTOA 2Q88A 4PQJA 4MCOA 2R6GE 2I48A 1Y4TA 2YJPA 3OEKA 3D4CA 1MDP1 4PTKA 1QGXA 3MVXA 4NHBA 4YU0A 2Y5LA 2Q2CA 4FATA 5ICQA 5JEIA 2Q2AA 4G2ZA 3ILUB 3JZJA 4H6DA 3QXMA 1MM7A 3FXUA 1I6AA 4IY5A 3G3JA 1D3KA 4GBWA 1MXXA 1FPIA 1MY1A 4XXUA 2I4CA 1LAGE 2UVGA 4NWDA 2ZYNA 4UABA 5ITOA 2I0BA 1NFTA 1OIBA 4NF4A 1JW5A 3C9HA 1LAHE 2RINA 1UIVA 3LUZA 3TELA 3FJMA 3PD8A 4O7IA 2F5XA 2OWZA 5A5XB 3E79A 2RC7A 1DTZA 2XXRA 1MXUA 4GRKA 4PFRA 4NF5A 4X1DA 1MQDA 4N13A 1SQYA 2DWIA 1LFIA 2XHDA 2X7QA 3VVFA 4U21A 3Q29A 3U94A 4O3CA 4LUBA 1I6QA 4G68A 1FBHA 2ONSA 2DP8A 4X8RA 3SKPA 3K00A 3QAXA 3FV1A 2VP1A 3QSLA 3ROJA 4PCDA 5EQ7A 2BJIA 1FQDA 3N94A 1MXVA 1ZKBA 3M3FA 2O69A 3HN0A 1D9YA 2F34A 1SW1A 4GQOA 5BUUA 3MBPA 3FV2A 2V93A 1G0IA 3CG3A 4IGRA 2WX9A 3VVDA 4YB6A 1N7WA 3PU5A 2HEUA 4FEBA 1FJ9A 4MNCA 3O66A 3SEVA 3TPAA 4KCCA 2XX9A 1FQFA 4WKMA 1QUJA 1NNTA 3B6QA 3PPNA 3HSTA 5H8QB 3JYRA 1M5CA 1NUYA 3PD9A 4RNSA 4PGNA 1Q35A
chains in the Genus database with same CATH topology
2RKMA 4OFLA 3S9EA 1POY1 4ZECA 2QSXA 3IORA 3Q27A 4BDQA 2Y7WA 5EHMA 4Z7EA 3TCHA 1N0TA 2V3UA 1Y3NA 4U23A 1XT8A 1JW4A 2O7UA 4DE8A 3U1OA 1DSNA 1LSTA 1PB8A 1XVYA 2FYIA 2B3BA 3VLVA 3HHFA 3WAEA 1TFAA 2F78A 4DXBA 2HZLA 2RCBA 5H8SA 3H7MA 3S9NC 1CE2A 4F2QA 1OLCA 1ANFA 1EZPA 1SDXA 4ELPA 5K2YA 3R7XA 3OSQA 4AB6A 1URDA 3TTRA 3H4ZA 4H1XA 3K1NA 4RY1A 1MY2A 4BDRA 3O6GA 3C4MA 3A09A 3G7WA 1II5A 1QULA 3M8UA 5I56A 1IUDA 3A3CA 2P1SA 4KFQA 3RNNA 3G3HA 3V89B 3FIRA 3FUZA 2NOOA 1P1OA 1ZBMA 4NF8A 1UTBB 3U93A 2D5WA 4NTLA 3SDFA 1USYH 1LB9A 3O6IA 3KBRA 4RJZA 3FATA 3RLFE 4GFRA 4H8IA 3H3GA 3IOUA 4Z0IA 1P99A 1I6BA 3EQ1A 3OO6A 1SVXB 2QMWA 2UVJA 4OESA 4EF1A 3H06B 2DVCA 3PPPA 3DLNA 3R26A 2ONKE 1JVYA 3S4UA 1N7XA 2QS4A 1PBQA 1LGBC 4NEDA 4I1DA 2H99A 3RN8A 1URSA 5ELVA 5EYFA 5CM6A 1LAFE 1SW4A 4IB2A 1B32A 3EPEA 3TMGA 4RPNA 3ZKLA 2G29A 1JW1A 2B65A 3TUSA 4XKPA 1GV8A 4M1VA 1B3GA 1XHYA 4QRZA 5JK4A 4YB7A 4TOZA 3IJOB 5H8HB 3RT6B 3HO7A 2Q8JA 5F1QA 2FA7A 4EDPA 4ESWA 4BDOA 2XXWA 5JTYB 1NMUA 1VFDA 1YPNA 1LBCA 3CFLA 1US5A 2DWJA 3SETA 5HM4B 5I57B 4OZ9A 1URGA 1B5IA 4KCDA 1LFHA 2DXRA 4U1OA 2Z22A 1H76A 3MZ9A 3E13X 4BLAA 4H0WA 2XXIA 3E3KA 1FQBA 3MZ1A 2PT1A 2Y7RA 3G3KA 1ZLQA 2Z8DA 4EF2A 1JETA 5I2KA 4XIGQ 3F11A 2PVUA 4ELRA 5KZTA 3V83A 5CMBA 4N6PA 4OETA 1BLFA 4ESXA 4PFYA 3FVGA 3FVKA 3GLBA 3BFTA 3IO4A 5HBCA 1P1NA 3DM0A 2XD3A 3KN8A 1FCKA 5ICTA 5H8FB 1LAXA 4U4XA 3HPIA 3DP4A 4R6HA 2O1MA 4Q5TA 4NMYA 2XXUA 3TKDA 1WDNA 4NF6B 2NVUB 1N04A 3ILTB 5DYHA 1PB7A 3VXCA 2UXAA 3VFJA 2F8DA 3IJXB 3TCGA 1UTHA 2NWJA 1N3WA 4HCYA 3GZGA 2FNCA 1VFEA 4KR5A 1D4NA 3PGFA 3O2AA 3H6TA 3GBAA 3TTNA 4G68C 1A55A 4N07A 3IOVA 1A8FA 3VDFA 2HQ0A 2DS9A 1BTJA 3VE1B 4MFIA 2O6AA 2G93A 1QJMA 1P1UA 4ZEBA 1LCFA 3MVYA 4KPTA 4GXAA 1IQ7A 5TP9A 4R73A 1DOTA 1H3DA 4U1ZA 3Q26A 2IEEA 2ZXTA 4ONYA 1B9JA 4ZE8A 1NNPA 3I3VA 5AA4B 1PDAA 1B7ZA 3MVZA 3FXRA 3T22A 1Q1KA 5L8DA 3IX1A 3W9VA 2ZNUA 1NH8A 3VXBA 4FEDA 2VHAA 3PPOA 4R75A 2OJTA 2O84X 4EUOA 1GTKA 4POWA 4QHQA 4X48A 2QS3A 4KQPA 4OWDA 5CMKA 1M5DA 1TT1A 2PT2A 4R6YA 4YZZA 4ISUA 4G68B 1RYXA 4XKRA 4ECFA 4KYEA 1MPBA 1L5TA 3T96B 3T9UA 4YICA 3C31A 4IO3A 2OZZA 3LSWA 4GXSB 5DEXB 2WKYA 3N6UA 4WXJA 3CRBA 4OHNA 3IOWA 2YLNA 2V25A 2H98A 3H6UA 2Y84A 4F3SA 3OO8A 1D9VA 2PYYA 4IO5A 4MH5A 1RKMA 3SEXA 2DVZA 4LONB 4TLLB 3CIJA 1EU8A 2AL4A 1MXYA 4OTEA 4LZ8A 3LSFB 5AA2B 2DOJA 2O7IA 1B52A 2Z23A 2F7AA 4GIZA 3PUZE 4FE8A 3K6XA 4FAJA 3FXQA 3O97A 4P0GA 4ND9A 2XXTA 1Y1ZA 2GFEA 4O3BA 1B05A 4OENA 1YTVA 3TTMA 4UA8A 3PUVE 4DDDA 5HPQA 3VV5A 1JEVA 5TU0A 2PX1A 1B1HA 5K2XA 3C35A 4ELOA 2REJA 1QKBA 1B0LA 1LLSA 5A5XA 4G8MA 3KEIA 1AL3A 1R1NA 3UORA 4YKKA 2HZKA 3M3LA 4Q0CA 4HTGA 2QPQA 4IGTA 4F3GA 1NH7A 3CVGA 3KN3A 5AA2D 1MQJA 2I4BA 1NNFA 2ONRA 5H8NB 1FTMA 3U92A 4XKNA 1EZOA 3TQLA 2OBGA 3QYTA 2F36A 3CSGA 2M8CA 4YKIA 3TODA 1AOVA 1MPCA 5I59B 4TLMB 1MRPA 1T0KA 4OVJA 2NUVA 4F3PA 4QSEA 3PUYE 3QIMA 4AB5A 3BKIB 5I2NB 1B4ZA 1R6ZA 4ZDMA 4JXIA 1B58A 2QL3A 3CFZA 4GOTA 3I5OA 3LR1A 2AIXA 4OMBA 3B7DA 4DLDA 3MUQA 4C0RA 4JB7A 3MPLA 3MP8A 2NXOA 1ZIUA 4GL0A 3T9HB 1HSJA 2UVHA 2D21A 3CFXA 3H6WA 4F39A 2Y7KA 4X9TA 5H8QA 4IO2A 1S7YA 1DPEA 3B6TA 3ECRA 1GR2A 2ZYOA 2HAVA 4H8JA 4I62A 3O29A 2THIA 4TQUQ 1H44A 1P1QA 1ZJLA 5CRYA 1O63A 1QKAA 2ALUA 4LP2B 4RK9A 1MY3A 1TXFA 1SD3A 1OQGA 4JSOA 3VLWA 4OFJA 4GLIA 2YPNA 2REGA 2OWSA 1GVCA 3TEPA 5IKBA 2X7PA 1XOCA 1Y20A 3CI8A 2XX7A 3K6UA 5CBRA 2GH9A 4C1UA 4NE4A 1EZ9A 3K1MA 2DXYA 4IO7A 3IR1A 1Y3PA 4EQ9A 3K6WA 5CMMA 1XC1A 4F31B 3K01A 4EXLA 3PUXE 2XXYA 4AQ4A 3OXNA 4POXA 1R9LA 3ZSFA 4F1VA 2UVIA 3TAJA 5M2VA 5KCJB 3M3KA 1UTBA 4C1TA 1MG1A 4H5FA 2QMXA 1SI1A 2Y7PA 5KDTB 4F22A 3PPQA 4JSDA 2ABHA 1FTLA 3TFLA 1MDQA 3C34A 1B2HA 3HHGA 3KG2A 3ODBA 1LB8A 1ZU0A 1JEUA 4F29A 3PMWA 1B7UA 2DWHA 4ZEFA 1N84A 3MVWA 5J1DA 5CBSA 3OO9A 3TYHA 3RY3A 2PMSA 3MP6A 3OEMA 1M5BA 2Q9TA 3MAMA 1B40A 3EN3A 3DP8A 4GWOA 1OVTA 5I58B 4OYVA 3FGSA 2P0SA 3S9MC 1MQGA 4X1BA 2ZMBA 1EH3A 4MF3A 2W7YA 2HAUA 4PFTA 3SESA 2A5TB 4IY6A 4R72A 5EHSA 1B0HA 1A7LA 5H8HA 3HCQA 2GRVA 3UGWA 4QSDA 3T9XB 1IXHA 3KZGA 1ZMGA 3BFUA 5JTYA 2RF1A 3TZAA 2KLFA 3WAFA 1AIVA 2R9JA 3MWBA 1ATGA 4IO4A 4EXKA 3LSLA 3KN7A 2QS2A 3MZBA 3OOAA 3TDJA 5L9MA 1XS5A 1A8EA 4P11A 4BDMA 4GD5A 4ZZEA 4OEVA 5FTIA 4DCYA 3UK4A 3E4RA 1SI0A 3IL1B 2Q89A 4O3AA 1O64A 2GHAA 2XXQA 1N3XA 4G8HA 3IO6A 2LAOA 4FECA 3EHTA 1F9BA 2O1LA 2H4IA 3RUMA 4YKPA 2V3QA 4JBZA 2F6PA 4KD5A 3CSBA 1MPDA 1TWYA 4OFOA 3IK6B 1B46A 3LC8A 4NF4B 4ZEDA 4QSCA 4NF6A 4OXVA 4XTCQ 2I3VA 2A5SA 3OD7A 2UYFA 5L9OA 4H5GA 4JWXA 4ZZAA 3IB1A 3LSXA 1A99A 3RT8A 1MQIA 4RYAA 1FQCA 2O51A 1P1WA 1LBBA 2P2AA 4BDLA 3G3FA 1H43A 2OLBA 3V8XB 2ZNTA 4RXLA 3EHSA 3S2VA 1OLAA 2CMOA 5CC2A 4NF5B 3KFMA 5DTBA 4JDFA 2VGQA 3DELB 5TPAA 1UIUA 3KSJA 2DE2A 1XVXA 1PBPA 4QFKA 5DT6A 4QFOA 3RTWB 5AE4A 1MM6A 2DWAA 1UQWA 2V3TA 3G3IA 5L9SA 3KSXA 1MY0A 3JV9A 1QUIA 3LUYA 4KYSA 3PMXA 4THIA 4R9GA 3TTLA 2DE3A 3OELA 1MH4A 1JQFA 3Q25A 3U8QA 1B5JA 1YCJA 1Y4CA 1VR5A 1Z7ME 2ANJA 2HFBA 5LOMA 1HSEA 5AA4A 3FD3A 5FHOA 1RYOA 3U72A 2UYEA 4KI0E 1Z7NE 1FTKA 1HSLA 4PFWA 1SYIA 3FVNA 1DPPA 1MXWA 1A54A 2I49A 3E9XA 1LCTA 1QW0A 2DSFA 3D4GA 2OK2A 4OEUA 2VD2A 1POTA 4G4PA 1AMFA 3K6VA 3MJNA 1O7TA 5I84A 3OENA 3ZS6A 3V5AA 1IXCA 4LZ5A 4LQ5A 4F3BA 4L17A 4KYDA 2DQVA 2V84A 3OMBA 1IXIA 1WVJA 3FZVA 4EQ7A 1H45A 5DEXA 3SEWA 2I58A 2XXPA 4F19A 3FJGA 3PMVA 3SEYA 4DXUA 5B7DA 4MLQA 5B70A 4YB5A 2GHBA 4JWYA 3KJ7A 3UIFA 3W15C 1BIYA 4U2RA 4E0XA 5FHMA 3RTFB 3N5LA 3T93B 1IEJA 3MP1A 1OVBA 1MXZA 1IXGA 3BBRA 4WEDA 4QFLA 3PUWE 1FQAA 4NWCA 5AA2A 2H9BA 1MY4A 4QFNA 5I56B 2ZYKA 1KWHA 4YMBA 3TCFA 1FW0A 4MBPA 5FTHA 3ONMA 3T9VA 1S9TA 5CMCA 2XX8A 1Y9UA 3MC2A 3C33A 4NF8B 1PEBA 1MS7A 3MW0A 3PV0E 3C36A 1DTGA 2VOZA 2ESNA 5F7VA 5CI5A 1PC3A 2ZNSA 5ISUA 5DVJA 3KOSA 1BKAA 3H03A 1OMPA 3K02A 3FJ7A 4OQOA 1NKXA 1QUKA 5AA1A 2X26A 4YMAA 4U4SA 3H6VA 1SW2A 3MQ9A 4FIMA 1S50A 4QFPA 1N76A 1US4A 3FVOA 4PFUA 2HXWA 1GGGA 3QUFA 1SW5A 1R9QA 2BJJX 2OCUA 1MH3A 3L6HA 5H8NA 1MQHA 4RPOA 1M5FA 4K3FA 2Z8EA 3L6GA 1B3LA 4PE5B 1B3HA 2ZYMA 3R6UA 3S9LC 3LBSA 5I59A 4YAHX 3I6VA 3QK6A 1FTJA 3THIA 3K4UA 3K0VA 2QJEA 1VSOA 5I2NA 1B4HA 2I6EA 1ELJA 2O68A 4ZE9A 4R6KA 1B7HA 3KGCA 4LQ2A 2F7BA 3EHUA 2Y7IA 3USDA 4IO6A 3G3GA 3SEUA 5BWJA 4R2BA 3FASA 3IOTA 4U22A 5AA3A 4H67A 2AL5A 4DCXA 4ZEIA 3K2DA 2DYXA 5I2KB 4MLVA 4OERA 3O28A 2D3IA 1B3FA 3T66A 4H65A 1A40A 1Y1MA 1B51A 3CR9A 3OO7A 2OWTA 4UACA 2VD3A 4FORA 4F1YA 1B6HA 4DXCA 2DE4A 2QRYA 2R71A 2PBWA 1LFGA 2F7CA 2XXHA 4F2OA 2H5YA 1M5EA 4LVQA 4E0WA 4G77A 2F6GA 4KHZE 3B6WA 3RGYA 3CG1A 4RA1A 4Q30B 5FHNA 4JWOA 4F1UA 3IAZA 3N6TA 2IA4A 1WODA 1ZTYA 4ZEKA 4EQBA 4WEPA 3TQWA 3RQTA 3IB0A 4GF8A 4DZ1A 2XXXA 1SBPA 3GXAA 4FJPA 1UTHB 4YKJA 4GL8A 2I0CA 2RC9A 4M4GA 2RCAA 3UA8A 5DVFA 3VLUA 3W9WA 1IITA 2RC8A 3N26A 4LATA 1B3EA 4I9DA 2F97A 5KCJA 4F18A 3DP6A 3EF7A 2H25A 2XXVA 3OSRA 4P0IA 4BDNA 1J1NA 3O9PA 5KDTA 3A3UA 1FQEA 4GVOA 5DVIA 2CZLA 1Y3QA 2QS1A 1VE4A 1BP5A 5TP9B 4LZ7A 5I57A 4R9FA 1JNFA 4HW8A 5IAIA 3C32A 2Z8FA 3SERA 1I69A 4QF9A 3QUJA 1IIWA 4XKQA 1JVXA 1OQHA 3HV1A 3GBBA 1USYE 1TFDA 4PP0A 4RK2A 4PETA 1QVSA 2AYSA 4I8CA 3IB2A 4Q8RA 1NNKA 1PB9A 5I58A 2E1SA 3ZKKA 1B5HA 4DIGA 3Q28A 1YAEA 1CB6A 2A5TA 4R2FA 2I3WA 3TTKA 2F35A 4ZS9A 4ELQA 5TPAB 1NL5A 2E0SA 3KOTA 4HCWA 5H8FA 3PPRA 3UP9A 5ITPA 1B1XA 4HS7A 3RPWA 3K1PA 4LA9A 1SYHA 4R74A 3O6HA 3P7IA 3MPKA 1IZ1A 3UN6A 3KJTA 3AXFA 2HCAA 1DMBA 2B3FA 1AH5A 2XD2A 3VVEA 4G8NA 1FTOA 2Q88A 4PQJA 2R6GE 2I48A 1Y4TA 2YJPA 3OEKA 3D4CA 1MDP1 3MVXA 4YU0A 2Q2CA 4FATA 5ICQA 5JEIA 2Q2AA 4G2ZA 3ILUB 3JZJA 4H6DA 3QXMA 1MM7A 3FXUA 1I6AA 4IY5A 3G3JA 1D3KA 1MXXA 1MY1A 4XXUA 2I4CA 1LAGE 2UVGA 4NWDA 2ZYNA 5ITOA 2I0BA 1NFTA 1OIBA 4NF4A 1JW5A 3C9HA 1LAHE 2RINA 1UIVA 3TELA 3FJMA 3PD8A 2F5XA 5A5XB 2RC7A 1DTZA 2XXRA 1MXUA 4GRKA 4NF5A 4X1DA 1MQDA 4N13A 1SQYA 2DWIA 1LFIA 2XHDA 2X7QA 3VVFA 4U21A 3Q29A 3U94A 4O3CA 4LUBA 1I6QA 4G68A 2ONSA 2DP8A 3SKPA 3K00A 3QAXA 3FV1A 2VP1A 3QSLA 1FQDA 3N94A 1MXVA 1ZKBA 3M3FA 2O69A 3HN0A 1D9YA 2F34A 1SW1A 4GQOA 5BUUA 3MBPA 3FV2A 2V93A 3CG3A 4IGRA 3VVDA 4YB6A 1N7WA 3PU5A 2HEUA 4FEBA 3O66A 3SEVA 3TPAA 4KCCA 2XX9A 1FQFA 4WKMA 1QUJA 1NNTA 3B6QA 3PPNA 3HSTA 5H8QB 3JYRA 1M5CA 3PD9A 4RNSA 1Q35A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RKM A;  4OFL A;  3S9E A;  1POY 1;  4ZEC A;  2QSX A;  3IOR A;  3Q27 A;  4BDQ A;  2Y7W A;  5EHM A;  4Z7E A;  3TCH A;  1N0T A;  2V3U A;  1Y3N A;  4U23 A;  1XT8 A;  1JW4 A;  2O7U A;  4DE8 A;  3U1O A;  1DSN A;  1LST A;  1PB8 A;  1XVY A;  2FYI A;  2B3B A;  3VLV A;  3HHF A;  3WAE A;  1TFA A;  2F78 A;  4DXB A;  2HZL A;  2RCB A;  5H8S A;  3H7M A;  3S9N C;  1CE2 A;  4F2Q A;  1OLC A;  1ANF A;  1EZP A;  1SDX A;  4ELP A;  5K2Y A;  3R7X A;  3OSQ A;  4AB6 A;  1URD A;  3TTR A;  3H4Z A;  4H1X A;  3K1N A;  4RY1 A;  1MY2 A;  4BDR A;  3O6G A;  3C4M A;  3A09 A;  3G7W A;  1II5 A;  1QUL A;  3M8U A;  5I56 A;  1IUD A;  3A3C A;  2P1S A;  4KFQ A;  3RNN A;  3G3H A;  3V89 B;  3FIR A;  3FUZ A;  2NOO A;  1P1O A;  1ZBM A;  4NF8 A;  1UTB B;  3U93 A;  2D5W A;  4NTL A;  3SDF A;  1USY H;  1LB9 A;  3O6I A;  3KBR A;  4RJZ A;  3FAT A;  3RLF E;  4GFR A;  4H8I A;  3H3G A;  3IOU A;  4Z0I A;  1P99 A;  1I6B A;  3EQ1 A;  3OO6 A;  1SVX B;  2QMW A;  2UVJ A;  4OES A;  4EF1 A;  3H06 B;  2DVC A;  3PPP A;  3DLN A;  3R26 A;  2ONK E;  1JVY A;  3S4U A;  1N7X A;  2QS4 A;  1PBQ A;  1LGB C;  4NED A;  4I1D A;  2H99 A;  3RN8 A;  1URS A;  5ELV A;  5EYF A;  5CM6 A;  1LAF E;  1SW4 A;  4IB2 A;  1B32 A;  3EPE A;  3TMG A;  4RPN A;  3ZKL A;  2G29 A;  1JW1 A;  2B65 A;  3TUS A;  4XKP A;  1GV8 A;  4M1V A;  1B3G A;  1XHY A;  4QRZ A;  5JK4 A;  4YB7 A;  4TOZ A;  3IJO B;  5H8H B;  3RT6 B;  3HO7 A;  2Q8J A;  5F1Q A;  2FA7 A;  4EDP A;  4ESW A;  4BDO A;  2XXW A;  5JTY B;  1NMU A;  1VFD A;  1YPN A;  1LBC A;  3CFL A;  1US5 A;  2DWJ A;  3SET A;  5HM4 B;  5I57 B;  4OZ9 A;  1URG A;  1B5I A;  4KCD A;  1LFH A;  2DXR A;  4U1O A;  2Z22 A;  1H76 A;  3MZ9 A;  3E13 X;  4BLA A;  4H0W A;  2XXI A;  3E3K A;  1FQB A;  3MZ1 A;  2PT1 A;  2Y7R A;  3G3K A;  1ZLQ A;  2Z8D A;  4EF2 A;  1JET A;  5I2K A;  4XIG Q;  3F11 A;  2PVU A;  4ELR A;  5KZT A;  3V83 A;  5CMB A;  4N6P A;  4OET A;  1BLF A;  4ESX A;  4PFY A;  3FVG A;  3FVK A;  3GLB A;  3BFT A;  3IO4 A;  5HBC A;  1P1N A;  3DM0 A;  2XD3 A;  3KN8 A;  1FCK A;  5ICT A;  5H8F B;  1LAX A;  4U4X A;  3HPI A;  3DP4 A;  4R6H A;  2O1M A;  4Q5T A;  4NMY A;  2XXU A;  3TKD A;  1WDN A;  4NF6 B;  2NVU B;  1N04 A;  3ILT B;  5DYH A;  1PB7 A;  3VXC A;  2UXA A;  3VFJ A;  2F8D A;  3IJX B;  3TCG A;  1UTH A;  2NWJ A;  1N3W A;  4HCY A;  3GZG A;  2FNC A;  1VFE A;  4KR5 A;  1D4N A;  3PGF A;  3O2A A;  3H6T A;  3GBA A;  3TTN A;  4G68 C;  1A55 A;  4N07 A;  3IOV A;  1A8F A;  3VDF A;  2HQ0 A;  2DS9 A;  1BTJ A;  3VE1 B;  4MFI A;  2O6A A;  2G93 A;  1QJM A;  1P1U A;  4ZEB A;  1LCF A;  3MVY A;  4KPT A;  4GXA A;  1IQ7 A;  5TP9 A;  4R73 A;  1DOT A;  1H3D A;  4U1Z A;  3Q26 A;  2IEE A;  2ZXT A;  4ONY A;  1B9J A;  4ZE8 A;  1NNP A;  3I3V A;  5AA4 B;  1PDA A;  1B7Z A;  3MVZ A;  3FXR A;  3T22 A;  1Q1K A;  5L8D A;  3IX1 A;  3W9V A;  2ZNU A;  1NH8 A;  3VXB A;  4FED A;  2VHA A;  3PPO A;  4R75 A;  2OJT A;  2O84 X;  4EUO A;  1GTK A;  4POW A;  4QHQ A;  4X48 A;  2QS3 A;  4KQP A;  4OWD A;  5CMK A;  1M5D A;  1TT1 A;  2PT2 A;  4R6Y A;  4YZZ A;  4ISU A;  4G68 B;  1RYX A;  4XKR A;  4ECF A;  4KYE A;  1MPB A;  1L5T A;  3T96 B;  3T9U A;  4YIC A;  3C31 A;  4IO3 A;  2OZZ A;  3LSW A;  4GXS B;  5DEX B;  2WKY A;  3N6U A;  4WXJ A;  3CRB A;  4OHN A;  3IOW A;  2YLN A;  2V25 A;  2H98 A;  3H6U A;  2Y84 A;  4F3S A;  3OO8 A;  1D9V A;  2PYY A;  4IO5 A;  4MH5 A;  1RKM A;  3SEX A;  2DVZ A;  4LON B;  4TLL B;  3CIJ A;  1EU8 A;  2AL4 A;  1MXY A;  4OTE A;  4LZ8 A;  3LSF B;  5AA2 B;  2DOJ A;  2O7I A;  1B52 A;  2Z23 A;  2F7A A;  4GIZ A;  3PUZ E;  4FE8 A;  3K6X A;  4FAJ A;  3FXQ A;  3O97 A;  4P0G A;  4ND9 A;  2XXT A;  1Y1Z A;  2GFE A;  4O3B A;  1B05 A;  4OEN A;  1YTV A;  3TTM A;  4UA8 A;  3PUV E;  4DDD A;  5HPQ A;  3VV5 A;  1JEV A;  5TU0 A;  2PX1 A;  1B1H A;  5K2X A;  3C35 A;  4ELO A;  2REJ A;  1QKB A;  1B0L A;  1LLS A;  5A5X A;  4G8M A;  3KEI A;  1AL3 A;  1R1N A;  3UOR A;  4YKK A;  2HZK A;  3M3L A;  4Q0C A;  4HTG A;  2QPQ A;  4IGT A;  4F3G A;  1NH7 A;  3CVG A;  3KN3 A;  5AA2 D;  1MQJ A;  2I4B A;  1NNF A;  2ONR A;  5H8N B;  1FTM A;  3U92 A;  4XKN A;  1EZO A;  3TQL A;  2OBG A;  3QYT A;  2F36 A;  3CSG A;  2M8C A;  4YKI A;  3TOD A;  1AOV A;  1MPC A;  5I59 B;  4TLM B;  1MRP A;  1T0K A;  4OVJ A;  2NUV A;  4F3P A;  4QSE A;  3PUY E;  3QIM A;  4AB5 A;  3BKI B;  5I2N B;  1B4Z A;  1R6Z A;  4ZDM A;  4JXI A;  1B58 A;  2QL3 A;  3CFZ A;  4GOT A;  3I5O A;  3LR1 A;  2AIX A;  4OMB A;  3B7D A;  4DLD A;  3MUQ A;  4C0R A;  4JB7 A;  3MPL A;  3MP8 A;  2NXO A;  1ZIU A;  4GL0 A;  3T9H B;  1HSJ A;  2UVH A;  2D21 A;  3CFX A;  3H6W A;  4F39 A;  2Y7K A;  4X9T A;  5H8Q A;  4IO2 A;  1S7Y A;  1DPE A;  3B6T A;  3ECR A;  1GR2 A;  2ZYO A;  2HAV A;  4H8J A;  4I62 A;  3O29 A;  2THI A;  4TQU Q;  1H44 A;  1P1Q A;  1ZJL A;  5CRY A;  1O63 A;  1QKA A;  2ALU A;  4LP2 B;  4RK9 A;  1MY3 A;  1TXF A;  1SD3 A;  1OQG A;  4JSO A;  3VLW A;  4OFJ A;  4GLI A;  2YPN A;  2REG A;  2OWS A;  1GVC A;  3TEP A;  5IKB A;  2X7P A;  1XOC A;  1Y20 A;  3CI8 A;  2XX7 A;  3K6U A;  5CBR A;  2GH9 A;  4C1U A;  4NE4 A;  1EZ9 A;  3K1M A;  2DXY A;  4IO7 A;  3IR1 A;  1Y3P A;  4EQ9 A;  3K6W A;  5CMM A;  1XC1 A;  4F31 B;  3K01 A;  4EXL A;  3PUX E;  2XXY A;  4AQ4 A;  3OXN A;  4POX A;  1R9L A;  3ZSF A;  4F1V A;  2UVI A;  3TAJ A;  5M2V A;  5KCJ B;  3M3K A;  1UTB A;  4C1T A;  1MG1 A;  4H5F A;  2QMX A;  1SI1 A;  2Y7P A;  5KDT B;  4F22 A;  3PPQ A;  4JSD A;  2ABH A;  1FTL A;  3TFL A;  1MDQ A;  3C34 A;  1B2H A;  3HHG A;  3KG2 A;  3ODB A;  1LB8 A;  1ZU0 A;  1JEU A;  4F29 A;  3PMW A;  1B7U A;  2DWH A;  4ZEF A;  1N84 A;  3MVW A;  5J1D A;  5CBS A;  3OO9 A;  3TYH A;  3RY3 A;  2PMS A;  3MP6 A;  3OEM A;  1M5B A;  2Q9T A;  3MAM A;  1B40 A;  3EN3 A;  3DP8 A;  4GWO A;  1OVT A;  5I58 B;  4OYV A;  3FGS A;  2P0S A;  3S9M C;  1MQG A;  4X1B A;  2ZMB A;  1EH3 A;  4MF3 A;  2W7Y A;  2HAU A;  4PFT A;  3SES A;  2A5T B;  4IY6 A;  4R72 A;  5EHS A;  1B0H A;  1A7L A;  5H8H A;  3HCQ A;  2GRV A;  3UGW A;  4QSD A;  3T9X B;  1IXH A;  3KZG A;  1ZMG A;  3BFU A;  5JTY A;  2RF1 A;  3TZA A;  2KLF A;  3WAF A;  1AIV A;  2R9J A;  3MWB A;  1ATG A;  4IO4 A;  4EXK A;  3LSL A;  3KN7 A;  2QS2 A;  3MZB A;  3OOA A;  3TDJ A;  5L9M A;  1XS5 A;  1A8E A;  4P11 A;  4BDM A;  4GD5 A;  4ZZE A;  4OEV A;  5FTI A;  4DCY A;  3UK4 A;  3E4R A;  1SI0 A;  3IL1 B;  2Q89 A;  4O3A A;  1O64 A;  2GHA A;  2XXQ A;  1N3X A;  4G8H A;  3IO6 A;  2LAO A;  4FEC A;  3EHT A;  1F9B A;  2O1L A;  2H4I A;  3RUM A;  4YKP A;  2V3Q A;  4JBZ A;  2F6P A;  4KD5 A;  3CSB A;  1MPD A;  1TWY A;  4OFO A;  3IK6 B;  1B46 A;  3LC8 A;  4NF4 B;  4ZED A;  4QSC A;  4NF6 A;  4OXV A;  4XTC Q;  2I3V A;  2A5S A;  3OD7 A;  2UYF A;  5L9O A;  4H5G A;  4JWX A;  4ZZA A;  3IB1 A;  3LSX A;  1A99 A;  3RT8 A;  1MQI A;  4RYA A;  1FQC A;  2O51 A;  1P1W A;  1LBB A;  2P2A A;  4BDL A;  3G3F A;  1H43 A;  2OLB A;  3V8X B;  2ZNT A;  4RXL A;  3EHS A;  3S2V A;  1OLA A;  2CMO A;  5CC2 A;  4NF5 B;  3KFM A;  5DTB A;  4JDF A;  2VGQ A;  3DEL B;  5TPA A;  1UIU A;  3KSJ A;  2DE2 A;  1XVX A;  1PBP A;  4QFK A;  5DT6 A;  4QFO A;  3RTW B;  5AE4 A;  1MM6 A;  2DWA A;  1UQW A;  2V3T A;  3G3I A;  5L9S A;  3KSX A;  1MY0 A;  3JV9 A;  1QUI A;  3LUY A;  4KYS A;  3PMX A;  4THI A;  4R9G A;  3TTL A;  2DE3 A;  3OEL A;  1MH4 A;  1JQF A;  3Q25 A;  3U8Q A;  1B5J A;  1YCJ A;  1Y4C A;  1VR5 A;  1Z7M E;  2ANJ A;  2HFB A;  5LOM A;  1HSE A;  5AA4 A;  3FD3 A;  5FHO A;  1RYO A;  3U72 A;  2UYE A;  4KI0 E;  1Z7N E;  1FTK A;  1HSL A;  4PFW A;  1SYI A;  3FVN A;  1DPP A;  1MXW A;  1A54 A;  2I49 A;  3E9X A;  1LCT A;  1QW0 A;  2DSF A;  3D4G A;  2OK2 A;  4OEU A;  2VD2 A;  1POT A;  4G4P A;  1AMF A;  3K6V A;  3MJN A;  1O7T A;  5I84 A;  3OEN A;  3ZS6 A;  3V5A A;  1IXC A;  4LZ5 A;  4LQ5 A;  4F3B A;  4L17 A;  4KYD A;  2DQV A;  2V84 A;  3OMB A;  1IXI A;  1WVJ A;  3FZV A;  4EQ7 A;  1H45 A;  5DEX A;  3SEW A;  2I58 A;  2XXP A;  4F19 A;  3FJG A;  3PMV A;  3SEY A;  4DXU A;  5B7D A;  4MLQ A;  5B70 A;  4YB5 A;  2GHB A;  4JWY A;  3KJ7 A;  3UIF A;  3W15 C;  1BIY A;  4U2R A;  4E0X A;  5FHM A;  3RTF B;  3N5L A;  3T93 B;  1IEJ A;  3MP1 A;  1OVB A;  1MXZ A;  1IXG A;  3BBR A;  4WED A;  4QFL A;  3PUW E;  1FQA A;  4NWC A;  5AA2 A;  2H9B A;  1MY4 A;  4QFN A;  5I56 B;  2ZYK A;  1KWH A;  4YMB A;  3TCF A;  1FW0 A;  4MBP A;  5FTH A;  3ONM A;  3T9V A;  1S9T A;  5CMC A;  2XX8 A;  1Y9U A;  3MC2 A;  3C33 A;  4NF8 B;  1PEB A;  1MS7 A;  3MW0 A;  3PV0 E;  3C36 A;  1DTG A;  2VOZ A;  2ESN A;  5F7V A;  5CI5 A;  1PC3 A;  2ZNS A;  5ISU A;  5DVJ A;  3KOS A;  1BKA A;  3H03 A;  1OMP A;  3K02 A;  3FJ7 A;  4OQO A;  1NKX A;  1QUK A;  5AA1 A;  2X26 A;  4YMA A;  4U4S A;  3H6V A;  1SW2 A;  3MQ9 A;  4FIM A;  1S50 A;  4QFP A;  1N76 A;  1US4 A;  3FVO A;  4PFU A;  2HXW A;  1GGG A;  3QUF A;  1SW5 A;  1R9Q A;  2BJJ X;  2OCU A;  1MH3 A;  3L6H A;  5H8N A;  1MQH A;  4RPO A;  1M5F A;  4K3F A;  2Z8E A;  3L6G A;  1B3L A;  4PE5 B;  1B3H A;  2ZYM A;  3R6U A;  3S9L C;  3LBS A;  5I59 A;  4YAH X;  3I6V A;  3QK6 A;  1FTJ A;  3THI A;  3K4U A;  3K0V A;  2QJE A;  1VSO A;  5I2N A;  1B4H A;  2I6E A;  1ELJ A;  2O68 A;  4ZE9 A;  4R6K A;  1B7H A;  3KGC A;  4LQ2 A;  2F7B A;  3EHU A;  2Y7I A;  3USD A;  4IO6 A;  3G3G A;  3SEU A;  5BWJ A;  4R2B A;  3FAS A;  3IOT A;  4U22 A;  5AA3 A;  4H67 A;  2AL5 A;  4DCX A;  4ZEI A;  3K2D A;  2DYX A;  5I2K B;  4MLV A;  4OER A;  3O28 A;  2D3I A;  1B3F A;  3T66 A;  4H65 A;  1A40 A;  1Y1M A;  1B51 A;  3CR9 A;  3OO7 A;  2OWT A;  4UAC A;  2VD3 A;  4FOR A;  4F1Y A;  1B6H A;  4DXC A;  2DE4 A;  2QRY A;  2R71 A;  2PBW A;  1LFG A;  2F7C A;  2XXH A;  4F2O A;  2H5Y A;  1M5E A;  4LVQ A;  4E0W A;  4G77 A;  2F6G A;  4KHZ E;  3B6W A;  3RGY A;  3CG1 A;  4RA1 A;  4Q30 B;  5FHN A;  4JWO A;  4F1U A;  3IAZ A;  3N6T A;  2IA4 A;  1WOD A;  1ZTY A;  4ZEK A;  4EQB A;  4WEP A;  3TQW A;  3RQT A;  3IB0 A;  4GF8 A;  4DZ1 A;  2XXX A;  1SBP A;  3GXA A;  4FJP A;  1UTH B;  4YKJ A;  4GL8 A;  2I0C A;  2RC9 A;  4M4G A;  2RCA A;  3UA8 A;  5DVF A;  3VLU A;  3W9W A;  1IIT A;  2RC8 A;  3N26 A;  4LAT A;  1B3E A;  4I9D A;  2F97 A;  5KCJ A;  4F18 A;  3DP6 A;  3EF7 A;  2H25 A;  2XXV A;  3OSR A;  4P0I A;  4BDN A;  1J1N A;  3O9P A;  5KDT A;  3A3U A;  1FQE A;  4GVO A;  5DVI A;  2CZL A;  1Y3Q A;  2QS1 A;  1VE4 A;  1BP5 A;  5TP9 B;  4LZ7 A;  5I57 A;  4R9F A;  1JNF A;  4HW8 A;  5IAI A;  3C32 A;  2Z8F A;  3SER A;  1I69 A;  4QF9 A;  3QUJ A;  1IIW A;  4XKQ A;  1JVX A;  1OQH A;  3HV1 A;  3GBB A;  1USY E;  1TFD A;  4PP0 A;  4RK2 A;  4PET A;  1QVS A;  2AYS A;  4I8C A;  3IB2 A;  4Q8R A;  1NNK A;  1PB9 A;  5I58 A;  2E1S A;  3ZKK A;  1B5H A;  4DIG A;  3Q28 A;  1YAE A;  1CB6 A;  2A5T A;  4R2F A;  2I3W A;  3TTK A;  2F35 A;  4ZS9 A;  4ELQ A;  5TPA B;  1NL5 A;  2E0S A;  3KOT A;  4HCW A;  5H8F A;  3PPR A;  3UP9 A;  5ITP A;  1B1X A;  4HS7 A;  3RPW A;  3K1P A;  4LA9 A;  1SYH A;  4R74 A;  3O6H A;  3P7I A;  3MPK A;  1IZ1 A;  3UN6 A;  3KJT A;  3AXF A;  2HCA A;  1DMB A;  2B3F A;  1AH5 A;  2XD2 A;  3VVE A;  4G8N A;  1FTO A;  2Q88 A;  4PQJ A;  2R6G E;  2I48 A;  1Y4T A;  2YJP A;  3OEK A;  3D4C A;  1MDP 1;  3MVX A;  4YU0 A;  2Q2C A;  4FAT A;  5ICQ A;  5JEI A;  2Q2A A;  4G2Z A;  3ILU B;  3JZJ A;  4H6D A;  3QXM A;  1MM7 A;  3FXU A;  1I6A A;  4IY5 A;  3G3J A;  1D3K A;  1MXX A;  1MY1 A;  4XXU A;  2I4C A;  1LAG E;  2UVG A;  4NWD A;  2ZYN A;  5ITO A;  2I0B A;  1NFT A;  1OIB A;  4NF4 A;  1JW5 A;  3C9H A;  1LAH E;  2RIN A;  1UIV A;  3TEL A;  3FJM A;  3PD8 A;  2F5X A;  5A5X B;  2RC7 A;  1DTZ A;  2XXR A;  1MXU A;  4GRK A;  4NF5 A;  4X1D A;  1MQD A;  4N13 A;  1SQY A;  2DWI A;  1LFI A;  2XHD A;  2X7Q A;  3VVF A;  4U21 A;  3Q29 A;  3U94 A;  4O3C A;  4LUB A;  1I6Q A;  4G68 A;  2ONS A;  2DP8 A;  3SKP A;  3K00 A;  3QAX A;  3FV1 A;  2VP1 A;  3QSL A;  1FQD A;  3N94 A;  1MXV A;  1ZKB A;  3M3F A;  2O69 A;  3HN0 A;  1D9Y A;  2F34 A;  1SW1 A;  4GQO A;  5BUU A;  3MBP A;  3FV2 A;  2V93 A;  3CG3 A;  4IGR A;  3VVD A;  4YB6 A;  1N7W A;  3PU5 A;  2HEU A;  4FEB A;  3O66 A;  3SEV A;  3TPA A;  4KCC A;  2XX9 A;  1FQF A;  4WKM A;  1QUJ A;  1NNT A;  3B6Q A;  3PPN A;  3HST A;  5H8Q B;  3JYR A;  1M5C A;  3PD9 A;  4RNS A;  1Q35 A; 
#chains in the Genus database with same CATH topology
 2RKM A;  4OFL A;  3S9E A;  1POY 1;  4ZEC A;  2QSX A;  3IOR A;  3Q27 A;  4PE3 A;  4BDQ A;  2F3D A;  2Y7W A;  5EHM A;  4Z7E A;  3TCH A;  1N0T A;  2V3U A;  1Y3N A;  4U23 A;  1XT8 A;  5FBP A;  1JW4 A;  2O7U A;  4DE8 A;  2FVZ A;  3U1O A;  1DSN A;  1LST A;  1PB8 A;  4NQ8 A;  1XVY A;  2FYI A;  4MMP A;  2B3B A;  3VLV A;  3HHF A;  3WAE A;  4N91 A;  2XWK A;  1TFA A;  2F78 A;  4DXB A;  2HZL A;  2RCB A;  5H8S A;  3H7M A;  3S9N C;  1IMB A;  1DK4 A;  1CE2 A;  4F2Q A;  1OLC A;  1ANF A;  1EZP A;  5A5L A;  1SDX A;  4ELP A;  5K2Y A;  4MHF A;  3R7X A;  3OSQ A;  4AB6 A;  1URD A;  3TTR A;  3H4Z A;  4H1X A;  3K1N A;  4RY1 A;  1MY2 A;  4BDR A;  2XA5 A;  3O6G A;  2HPG A;  3C4M A;  3A09 A;  3G7W A;  1II5 A;  1QUL A;  3M8U A;  5I56 A;  1IUD A;  3A3C A;  2P1S A;  4KFQ A;  3RNN A;  5IZ1 A;  3G3H A;  3V89 B;  3FIR A;  3FUZ A;  2NOO A;  1P1O A;  1ZBM A;  4NF8 A;  1UTB B;  3U93 A;  4N15 A;  2D5W A;  4NTL A;  3SDF A;  1USY H;  1LB9 A;  4PF8 A;  3O6I A;  3KBR A;  4RJZ A;  3FAT A;  3RLF E;  4GFR A;  4H8I A;  3H3G A;  3IOU A;  4Z0I A;  1P99 A;  1I6B A;  3B50 A;  3EQ1 A;  3OO6 A;  4NG7 A;  1SVX B;  2QMW A;  2UVJ A;  4OVP A;  4OES A;  4EF1 A;  3H06 B;  4OA4 A;  2DVC A;  3PPP A;  3DLN A;  1FBE A;  3R26 A;  2ONK E;  4HXV A;  1JVY A;  3S4U A;  1N7X A;  2QS4 A;  1PBQ A;  2ZZX A;  1LGB C;  4NED A;  4I1D A;  2H99 A;  3RN8 A;  4O94 A;  1URS A;  4H46 A;  5ELV A;  5EYF A;  5CM6 A;  1LAF E;  1SW4 A;  4IB2 A;  1B32 A;  3EPE A;  3TMG A;  4RPN A;  3ZKL A;  2G29 A;  5ET6 A;  1JW1 A;  2B65 A;  3TUS A;  4XKP A;  1GV8 A;  4M1V A;  1B3G A;  2PFZ A;  1XHY A;  4QRZ A;  2GQ1 A;  5JK4 A;  4YB7 A;  4TOZ A;  3IJO B;  5H8H B;  3RT6 B;  3HO7 A;  4XEQ A;  2Q8J A;  2XXK A;  5F1Q A;  2FA7 A;  4EDP A;  1FPE A;  4ESW A;  4BDO A;  2XXW A;  1JP4 A;  1KZ8 A;  4P8B A;  5JTY B;  1NMU A;  1VFD A;  1YPN A;  1FTA A;  1LBC A;  3CFL A;  1US5 A;  2DWJ A;  3SET A;  5HM4 B;  5I57 B;  4OZ9 A;  1URG A;  1RDZ A;  1B5I A;  4KCD A;  1LFH A;  2DXR A;  4U1O A;  2Z22 A;  1H76 A;  3MZ9 A;  1KA1 A;  1FPK A;  2P3V A;  3E13 X;  4BLA A;  4H0W A;  2XXI A;  3E3K A;  1FQB A;  3MZ1 A;  1FPB A;  2PT1 A;  2Y7R A;  3G3K A;  1ZLQ A;  2Z8D A;  4EF2 A;  1JET A;  5I2K A;  4XIG Q;  4JVI A;  3F11 A;  2XWO A;  2PVU A;  4X04 A;  4NX1 A;  4ELR A;  5KZT A;  3V83 A;  5CMB A;  4N6P A;  4OET A;  1BLF A;  2VPN A;  4ESX A;  4PFY A;  2CEY A;  3FVG A;  1NUW A;  3FVK A;  3GLB A;  3BFT A;  3IO4 A;  5HBC A;  1P1N A;  3DM0 A;  5ESY A;  2XD3 A;  3KN8 A;  1FCK A;  5ICT A;  4GWW A;  5H8F B;  1LAX A;  4U4X A;  3HPI A;  3DP4 A;  4R6H A;  1NV5 A;  2O1M A;  4Q5T A;  5T3J A;  5EQA A;  4NMY A;  2XXU A;  1G0H A;  3TKD A;  1WDN A;  2B4L A;  4NF6 B;  2NVU B;  1N04 A;  3ILT B;  5DYH A;  1PB7 A;  3VXC A;  2UXA A;  3VFJ A;  2F8D A;  3IJX B;  3TCG A;  1UTH A;  2NWJ A;  1N3W A;  4HCY A;  3GZG A;  2WBB A;  2FNC A;  1VFE A;  4KR5 A;  1D4N A;  3PGF A;  3O2A A;  3H6T A;  3GBA A;  3TTN A;  4G68 C;  1A55 A;  4N07 A;  3IOV A;  1A8F A;  4I3E A;  3VDF A;  2HQ0 A;  2DS9 A;  4GWX A;  1BTJ A;  4GX6 A;  3VE1 B;  4MFI A;  2O6A A;  2G93 A;  1QJM A;  1AWB A;  1P1U A;  4ZEB A;  1LCF A;  3MVY A;  4KPT A;  4GXA A;  4OVT A;  2QVU A;  1BK4 A;  1IQ7 A;  5TP9 A;  3RPL B;  4R73 A;  1DOT A;  1H3D A;  4U1Z A;  2F3B A;  3Q26 A;  1EYI A;  2Y5K A;  4PBQ A;  2IEE A;  2ZXT A;  4ONY A;  1B9J A;  4ZE8 A;  1NNP A;  3I3V A;  5AA4 B;  4NN3 A;  1PDA A;  1B7Z A;  3MVZ A;  3FXR A;  3T22 A;  1Q1K A;  5L8D A;  3IX1 A;  3W9V A;  2ZNU A;  1D9Q A;  1NH8 A;  3VXB A;  4FED A;  2VHA A;  3PPO A;  4R75 A;  2OJT A;  2O84 X;  4EUO A;  1GTK A;  4POW A;  4QHQ A;  4X48 A;  2QS3 A;  4KQP A;  4OWD A;  5CMK A;  1YYZ A;  1M5D A;  1TT1 A;  2PT2 A;  4R6Y A;  4YZZ A;  4ISU A;  1K9Z A;  4G68 B;  1RYX A;  4XKR A;  1LEV A;  1FBF A;  4ECF A;  4KYE A;  5F24 A;  1MPB A;  1L5T A;  3T96 B;  4GWU A;  3T9U A;  4YIC A;  3C31 A;  2FIX A;  4IO3 A;  2OZZ A;  3LSW A;  4O8M A;  4GXS B;  5DEX B;  2WKY A;  3N6U A;  4WXJ A;  3CRB A;  4OHN A;  3E78 A;  3IOW A;  1FBP A;  2YLN A;  2V25 A;  2H98 A;  3H6U A;  2Y84 A;  4F3S A;  1FBD A;  3OO8 A;  1D9V A;  2KR0 A;  2PYY A;  4IO5 A;  4MH5 A;  1RKM A;  3SEX A;  2DVZ A;  4LON B;  4TLL B;  1CNQ A;  3CIJ A;  1LBZ A;  2PCR A;  1EU8 A;  2AL4 A;  1MXY A;  4OTE A;  4LZ8 A;  3LSF B;  5AA2 B;  2DOJ A;  1IMC A;  2O7I A;  1B52 A;  2Z23 A;  2F7A A;  4GIZ A;  3PUZ E;  4FE8 A;  2FIE A;  3K6X A;  4FAJ A;  3FXQ A;  3O97 A;  5I5P A;  4P0G A;  4ND9 A;  2XXT A;  1Y1Z A;  2GFE A;  4O3B A;  1B05 A;  4OEN A;  1YTV A;  3TTM A;  4UA8 A;  3PUV E;  4DDD A;  5HPQ A;  1YXI A;  2WYP A;  3VV5 A;  1JEV A;  5TU0 A;  2Q74 A;  2PX1 A;  1B1H A;  5K2X A;  3C35 A;  4ELO A;  2REJ A;  1QKB A;  4N6K A;  1B0L A;  4MEV A;  1LLS A;  5A5X A;  4G8M A;  3KEI A;  1AL3 A;  1FRP A;  1R1N A;  3UOR A;  4YKK A;  2HZK A;  3M3L A;  4Q0C A;  2ZZW A;  4HTG A;  2QPQ A;  1VDW A;  4IGT A;  1EYK A;  4F3G A;  1NH7 A;  2WEF A;  2FBP A;  3CVG A;  3KN3 A;  5AA2 D;  4MJO A;  1MQJ A;  2I4B A;  1NNF A;  4HE0 A;  1IME A;  2ONR A;  5H8N B;  1FTM A;  3U92 A;  4XKN A;  1EZO A;  3TQL A;  2OBG A;  3QYT A;  1IMD A;  2F36 A;  4XFE A;  3CSG A;  2M8C A;  1NV6 A;  1FPL A;  4YKI A;  3TOD A;  1AOV A;  1MPC A;  5I59 B;  4TLM B;  1MRP A;  1T0K A;  4OVJ A;  2NUV A;  4F3P A;  4QSE A;  3PUY E;  3QIM A;  4NAP A;  4AB5 A;  3BKI B;  1LBW A;  5I2N B;  4PAF A;  1B4Z A;  1R6Z A;  4ZDM A;  4JXI A;  1B58 A;  1FJ6 A;  2QL3 A;  3CFZ A;  4GOT A;  4AS5 A;  3I5O A;  3LR1 A;  2AIX A;  4OMB A;  3B7D A;  4N17 A;  4DLD A;  3MUQ A;  4C0R A;  4JB7 A;  3MPL A;  3MP8 A;  3IFA A;  3RYD A;  2NXO A;  1ZIU A;  4GL0 A;  3T9H B;  1HSJ A;  2UVH A;  2D21 A;  3CFX A;  3H6W A;  4F39 A;  2Y7K A;  4X9T A;  5H8Q A;  4IO2 A;  1S7Y A;  5IZ3 B;  1DPE A;  4N81 A;  3B6T A;  3ECR A;  1GR2 A;  2ZYO A;  2HAV A;  4H8J A;  4I62 A;  3O29 A;  2THI A;  4TQU Q;  3EKI A;  1H44 A;  3FBP A;  1P1Q A;  1ZJL A;  5CRY A;  1O63 A;  1QKA A;  2ALU A;  4LP2 B;  4RK9 A;  1MY3 A;  1TXF A;  1SD3 A;  1OQG A;  4JSO A;  4N4U A;  1SPI A;  3VLW A;  4OFJ A;  4GLI A;  2YPN A;  2REG A;  2OWS A;  1GVC A;  3TEP A;  5IM2 A;  5IKB A;  4OAN A;  4GWZ A;  2X7P A;  1XOC A;  1Y20 A;  3CI8 A;  2XX7 A;  3K6U A;  5CBR A;  2GH9 A;  4C1U A;  4NE4 A;  1EZ9 A;  3K1M A;  2DXY A;  4IO7 A;  3IR1 A;  1Y3P A;  4EQ9 A;  5ET8 A;  1FPF A;  3K6W A;  2JJK A;  1RDY A;  5CMM A;  1XC1 A;  4G61 A;  4F31 B;  3K01 A;  4EXL A;  3PUX E;  4GX4 A;  2XXY A;  4O7M A;  4AQ4 A;  3OXN A;  5I3S A;  4POX A;  1R9L A;  3ZSF A;  4F1V A;  2UVI A;  4XF5 A;  3TAJ A;  5M2V A;  5KCJ B;  4PFB A;  3M3K A;  4LN5 A;  1UTB A;  2HHM A;  1MG1 A;  3KBZ A;  4C1T A;  4H5F A;  2QMX A;  1SI1 A;  2Y7P A;  3BIH A;  5KDT B;  4F22 A;  3PPQ A;  3T1B A;  4JSD A;  2ABH A;  1FTL A;  3TFL A;  4OVR A;  1MDQ A;  4QBA A;  2QVR A;  3C34 A;  4P47 A;  1B2H A;  3HHG A;  3KG2 A;  3ODB A;  1KA0 A;  1LB8 A;  1ZU0 A;  1JEU A;  4F29 A;  3PMW A;  1B7U A;  2DWH A;  4ZEF A;  1N84 A;  3MVW A;  5J1D A;  1FPD A;  4GWS A;  2WBD A;  5CBS A;  3OO9 A;  3TYH A;  3RY3 A;  2PMS A;  3MP6 A;  1FBC A;  1M5B A;  2Q9T A;  3MAM A;  3OEM A;  4IR8 A;  1B40 A;  3EN3 A;  3DP8 A;  3HFU A;  4GWO A;  1OVT A;  5I58 B;  4OYV A;  3FGS A;  2P0S A;  3S9M C;  4PDD A;  3T0J A;  1MQG A;  4NGU A;  2OX3 A;  4X1B A;  2ZMB A;  1EH3 A;  4MF3 A;  4PFT A;  2W7Y A;  2HAU A;  3SES A;  2A5T B;  4IY6 A;  4PGP A;  4R72 A;  5EHS A;  1B0H A;  1A7L A;  5H8H A;  3HCQ A;  2GRV A;  3UGW A;  4QSD A;  3T9X B;  1IXH A;  3KZG A;  1ZMG A;  3BFU A;  5JTY A;  2RF1 A;  5LTC A;  3TZA A;  2KLF A;  3KC1 A;  3WAF A;  1AIV A;  2R9J A;  3MWB A;  1ATG A;  4IO4 A;  4EXK A;  3LSL A;  4GBV A;  4PFI A;  3KN7 A;  2QS2 A;  3MZB A;  3OOA A;  3TDJ A;  5L9M A;  3MYU A;  1XS5 A;  1A8E A;  4P11 A;  4BDM A;  4GD5 A;  4ZZE A;  4OEV A;  5FTI A;  4DCY A;  3SZP A;  3UK4 A;  3E4R A;  1SI0 A;  3IL1 B;  2Q89 A;  4O3A A;  4QXD A;  1O64 A;  2GHA A;  2XXQ A;  1DCU A;  1N3X A;  4G8H A;  1FPG A;  3IO6 A;  5ET7 A;  2LAO A;  4FEC A;  4N8G A;  3EHT A;  1F9B A;  2O1L A;  2H4I A;  1LBX A;  3RUM A;  2ZZV A;  4YKP A;  2DDK A;  2V3Q A;  2HXR A;  4JBZ A;  2F6P A;  4KD5 A;  3CSB A;  1MPD A;  1TWY A;  4OFO A;  5ET5 A;  3IK6 B;  1B46 A;  3LC8 A;  4NF4 B;  4ZED A;  4QSC A;  4NF6 A;  4OXV A;  4XTC Q;  2I3V A;  2A5S A;  3OD7 A;  2UYF A;  3LV0 A;  5L9O A;  4H5G A;  4JWX A;  4ZZA A;  3IB1 A;  3LSX A;  1A99 A;  3RT8 A;  1MQI A;  2XWV A;  1FQC A;  2O51 A;  4RYA A;  1P1W A;  1LBB A;  2P2A A;  4BDL A;  3G3F A;  1H43 A;  2OLB A;  3V8X B;  2ZNT A;  4RXL A;  3EHS A;  1FSA A;  3S2V A;  1EYJ A;  1OLA A;  2CMO A;  5CC2 A;  4NF5 B;  3KFM A;  3PTY A;  5DTB A;  4JDF A;  2VGQ A;  3DEL B;  5TPA A;  1UIU A;  3KSJ A;  2DE2 A;  1XVX A;  1PBP A;  4QFK A;  5DT6 A;  4QFO A;  3RTW B;  5AE4 A;  3QMF A;  1NV1 A;  1MM6 A;  2DWA A;  1UQW A;  2V3T A;  3G3I A;  5IZZ A;  5L9S A;  3KSX A;  1MY0 A;  3JV9 A;  1QUI A;  3LUY A;  4KYS A;  3PMX A;  4THI A;  1FBG A;  4R9G A;  3TTL A;  2DE3 A;  3OEL A;  3RPL A;  2R8T A;  4P3L A;  1MH4 A;  1JQF A;  3Q25 A;  3U8Q A;  1B5J A;  1YCJ A;  1Y4C A;  1VR5 A;  1Z7M E;  2ANJ A;  2HFB A;  1NV0 A;  5LOM A;  1HSE A;  5AA4 A;  3FD3 A;  5FHO A;  1RYO A;  3U72 A;  3BIG A;  2UYE A;  1NV4 A;  4KI0 E;  2MKZ A;  4HE2 A;  1Z7N E;  1FTK A;  1HSL A;  4PFW A;  1SYI A;  3FVN A;  4FBP A;  1DPP A;  1MXW A;  1NI9 A;  1A54 A;  2I49 A;  3E9X A;  1LCT A;  1QW0 A;  2DSF A;  3D4G A;  2OK2 A;  4OEU A;  2VD2 A;  4PF6 A;  1POT A;  4G4P A;  1AMF A;  3K6V A;  3MJN A;  1O7T A;  5I84 A;  3KC0 A;  3OEN A;  1YZ0 A;  3ZS6 A;  3V5A A;  1IXC A;  4LZ5 A;  4LQ5 A;  4F3B A;  4L17 A;  4KYD A;  2DQV A;  2V84 A;  2L5V A;  3OMB A;  1IXI A;  1WVJ A;  1K9Y A;  3CHG A;  3FZV A;  4EQ7 A;  1H45 A;  2CZI A;  5DEX A;  3SEW A;  2I58 A;  5EQ8 A;  2XXP A;  4F19 A;  4DI3 D;  3FJG A;  3PMV A;  3SEY A;  4DXU A;  5B7D A;  4MLQ A;  5B70 A;  4AS4 A;  4YB5 A;  2GHB A;  1LBV A;  4OVS A;  4GWY A;  4JWY A;  3KJ7 A;  3UIF A;  3W15 C;  1BIY A;  4U2R A;  4E0X A;  5FHM A;  4MNP A;  3RTF B;  3N5L A;  3T93 B;  2XWI A;  1IEJ A;  3MP1 A;  1OVB A;  1MXZ A;  1IXG A;  3BBR A;  4WED A;  4QFL A;  3PUW E;  5IGA A;  1FQA A;  4NWC A;  2CEX A;  5AA2 A;  4GX3 A;  2H9B A;  1MY4 A;  4QFN A;  5I56 B;  2ZYK A;  1KWH A;  4YMB A;  4JVC A;  3TCF A;  1FW0 A;  4MBP A;  5FTH A;  3ONM A;  3T9V A;  1S9T A;  5CMC A;  2XX8 A;  1Y9U A;  1RDX A;  3MC2 A;  3C33 A;  4NF8 B;  1PEB A;  1MS7 A;  3MW0 A;  3PV0 E;  3C36 A;  1DTG A;  2VOZ A;  2ESN A;  5F7V A;  5CI5 A;  1PC3 A;  4MAG A;  2ZNS A;  5ISU A;  4H45 A;  5DVJ A;  1DBZ A;  3KOS A;  1BKA A;  3A29 A;  5I7I A;  2VPO A;  3H03 A;  1OMP A;  1INP A;  3FXB A;  3K02 A;  3FJ7 A;  4OQO A;  1NKX A;  1QUK A;  4HE1 A;  5AA1 A;  2X26 A;  4YMA A;  4U4S A;  3H6V A;  1SW2 A;  3MQ9 A;  4FIM A;  1S50 A;  4QFP A;  1N76 A;  1US4 A;  3FVO A;  4PFU A;  2HXW A;  1GGG A;  4N6D A;  4P56 A;  1NUZ A;  3QUF A;  1SW5 A;  1FPJ A;  1R9Q A;  2BJJ X;  2OCU A;  3ISP A;  1MH3 A;  3L6H A;  5H8N A;  1MQH A;  4RPO A;  1M5F A;  3IFC A;  4K3F A;  2Z8E A;  3L6G A;  1B3L A;  4JVD A;  4PE5 B;  2PFY A;  1B3H A;  2ZYM A;  3R6U A;  3S9L C;  3LBS A;  4I3Y A;  5I59 A;  4YAH X;  3I6V A;  1IMA A;  1NV7 A;  3QK6 A;  1FTJ A;  3THI A;  3K4U A;  3K0V A;  2QJE A;  1VSO A;  5I2N A;  1B4H A;  3B8B A;  5DW8 A;  2I6E A;  1ELJ A;  2QVV A;  2O68 A;  4ZE9 A;  4P1L A;  4R6K A;  1B7H A;  3KGC A;  4LQ2 A;  2F7B A;  4P9K A;  3EHU A;  2Y7I A;  3USD A;  4IO6 A;  3G3G A;  3SEU A;  5BWJ A;  2QFL A;  4R2B A;  3FAS A;  4PC9 A;  3IOT A;  4U22 A;  5AA3 A;  2FHY A;  4H67 A;  2AL5 A;  4DCX A;  5IZ3 A;  5EYH A;  4ZEI A;  3K2D A;  2DYX A;  5I2K B;  4MLV A;  4OER A;  3O28 A;  2D3I A;  1B3F A;  3T66 A;  4H65 A;  1A40 A;  1Y1M A;  1B51 A;  3CR9 A;  3OO7 A;  2OWT A;  5EYG A;  4UAC A;  2CZK A;  2VD3 A;  3MST A;  4PDH A;  4FOR A;  4F1Y A;  1B6H A;  4DXC A;  2DE4 A;  2QRY A;  2R71 A;  2PBW A;  1LFG A;  2F7C A;  2XXH A;  4F2O A;  2H5Y A;  1NV2 A;  1M5E A;  4LVQ A;  4E0W A;  4G77 A;  2F6G A;  4KHZ E;  3B6W A;  1IMF A;  3RGY A;  5LDZ A;  3CG1 A;  2B4M A;  1LBY A;  4RA1 A;  4Q30 B;  5FHN A;  4JWO A;  4F1U A;  3IAZ A;  3N6T A;  2IA4 A;  1WOD A;  1ZTY A;  4ZEK A;  4EQB A;  4WEP A;  3TQW A;  3RQT A;  3IB0 A;  4GF8 A;  4DZ1 A;  2XXX A;  2CZH A;  1SBP A;  3GXA A;  4FJP A;  1UTH B;  3NOH A;  4YKJ A;  4GL8 A;  2I0C A;  2RC9 A;  4M4G A;  2WYK A;  2RCA A;  3UA8 A;  5DVF A;  3VLU A;  3W9W A;  1IIT A;  2RC8 A;  3N26 A;  4LAT A;  4MNI A;  4I9D A;  1B3E A;  2F97 A;  5KCJ A;  2VT5 A;  4MX6 A;  4F18 A;  3DP6 A;  3EF7 A;  2H25 A;  2XXV A;  3OSR A;  4P0I A;  4BDN A;  1J1N A;  3O9P A;  5KDT A;  4I40 A;  2Q8M A;  3A3U A;  1FQE A;  4GVO A;  4PBH A;  2CZL A;  5DVI A;  1Y3Q A;  2QS1 A;  1VE4 A;  1BP5 A;  5TP9 B;  4LZ7 A;  5I57 A;  2V4C A;  4R9F A;  1JNF A;  4HW8 A;  4P1E A;  5IAI A;  3D1R A;  3C32 A;  2Z8F A;  3SER A;  1I69 A;  4QF9 A;  4N8Y A;  1Q9D A;  3QUJ A;  1IIW A;  4XKQ A;  1JVX A;  1OQH A;  3HV1 A;  3GBB A;  1USY E;  1TFD A;  4PP0 A;  4RK2 A;  5EQ9 A;  4PET A;  4PAK A;  1QVS A;  1XI6 A;  2AYS A;  4I8C A;  3IB2 A;  4Q8R A;  1NNK A;  1PB9 A;  5I58 A;  2E1S A;  3ZKK A;  1NV3 A;  1B5H A;  4DIG A;  3Q28 A;  1YAE A;  4NF0 A;  1CB6 A;  2A5T A;  4DI4 B;  4R2F A;  2I3W A;  3TTK A;  2F35 A;  4ZS9 A;  4ELQ A;  5TPA B;  1NL5 A;  2E0S A;  3KOT A;  4HCW A;  5H8F A;  3PPR A;  3UP9 A;  5ITP A;  1B1X A;  2P3N A;  4HS7 A;  1NUX A;  3RPW A;  3K1P A;  4LA9 A;  5J16 A;  1SYH A;  4R74 A;  4KXP A;  4PAI A;  3O6H A;  3GYY A;  3P7I A;  3MPK A;  2KQZ A;  1IZ1 A;  3UN6 A;  3KJT A;  3AXF A;  4OVQ A;  2HCA A;  3U65 A;  1DMB A;  2B3F A;  1AH5 A;  2XD2 A;  4MIJ A;  3VVE A;  4G8N A;  1FTO A;  2Q88 A;  4PQJ A;  4MCO A;  2R6G E;  2I48 A;  1Y4T A;  2YJP A;  3OEK A;  3D4C A;  1MDP 1;  4PTK A;  1QGX A;  3MVX A;  4NHB A;  4YU0 A;  2Y5L A;  2Q2C A;  4FAT A;  5ICQ A;  5JEI A;  2Q2A A;  4G2Z A;  3ILU B;  3JZJ A;  4H6D A;  3QXM A;  1MM7 A;  3FXU A;  1I6A A;  4IY5 A;  3G3J A;  1D3K A;  4GBW A;  1MXX A;  1FPI A;  1MY1 A;  4XXU A;  2I4C A;  1LAG E;  2UVG A;  4NWD A;  2ZYN A;  4UAB A;  5ITO A;  2I0B A;  1NFT A;  1OIB A;  4NF4 A;  1JW5 A;  3C9H A;  1LAH E;  2RIN A;  1UIV A;  3LUZ A;  3TEL A;  3FJM A;  3PD8 A;  4O7I A;  2F5X A;  2OWZ A;  5A5X B;  3E79 A;  2RC7 A;  1DTZ A;  2XXR A;  1MXU A;  4GRK A;  4PFR A;  4NF5 A;  4X1D A;  1MQD A;  4N13 A;  1SQY A;  2DWI A;  1LFI A;  2XHD A;  2X7Q A;  3VVF A;  4U21 A;  3Q29 A;  3U94 A;  4O3C A;  4LUB A;  1I6Q A;  4G68 A;  1FBH A;  2ONS A;  2DP8 A;  4X8R A;  3SKP A;  3K00 A;  3QAX A;  3FV1 A;  2VP1 A;  3QSL A;  3ROJ A;  4PCD A;  5EQ7 A;  2BJI A;  1FQD A;  3N94 A;  1MXV A;  1ZKB A;  3M3F A;  2O69 A;  3HN0 A;  1D9Y A;  2F34 A;  1SW1 A;  4GQO A;  5BUU A;  3MBP A;  3FV2 A;  2V93 A;  1G0I A;  3CG3 A;  4IGR A;  2WX9 A;  3VVD A;  4YB6 A;  1N7W A;  3PU5 A;  2HEU A;  4FEB A;  1FJ9 A;  4MNC A;  3O66 A;  3SEV A;  3TPA A;  4KCC A;  2XX9 A;  1FQF A;  4WKM A;  1QUJ A;  1NNT A;  3B6Q A;  3PPN A;  3HST A;  5H8Q B;  3JYR A;  1M5C A;  1NUY A;  3PD9 A;  4RNS A;  4PGN A;  1Q35 A; 
#chains in the Genus database with same CATH homology
 2RKM A;  4OFL A;  3S9E A;  1POY 1;  4ZEC A;  2QSX A;  3IOR A;  3Q27 A;  4BDQ A;  2Y7W A;  5EHM A;  4Z7E A;  3TCH A;  1N0T A;  2V3U A;  1Y3N A;  4U23 A;  1XT8 A;  1JW4 A;  2O7U A;  4DE8 A;  3U1O A;  1DSN A;  1LST A;  1PB8 A;  1XVY A;  2FYI A;  2B3B A;  3VLV A;  3HHF A;  3WAE A;  1TFA A;  2F78 A;  4DXB A;  2HZL A;  2RCB A;  5H8S A;  3H7M A;  3S9N C;  1CE2 A;  4F2Q A;  1OLC A;  1ANF A;  1EZP A;  1SDX A;  4ELP A;  5K2Y A;  3R7X A;  3OSQ A;  4AB6 A;  1URD A;  3TTR A;  3H4Z A;  4H1X A;  3K1N A;  4RY1 A;  1MY2 A;  4BDR A;  3O6G A;  3C4M A;  3A09 A;  3G7W A;  1II5 A;  1QUL A;  3M8U A;  5I56 A;  1IUD A;  3A3C A;  2P1S A;  4KFQ A;  3RNN A;  3G3H A;  3V89 B;  3FIR A;  3FUZ A;  2NOO A;  1P1O A;  1ZBM A;  4NF8 A;  1UTB B;  3U93 A;  2D5W A;  4NTL A;  3SDF A;  1USY H;  1LB9 A;  3O6I A;  3KBR A;  4RJZ A;  3FAT A;  3RLF E;  4GFR A;  4H8I A;  3H3G A;  3IOU A;  4Z0I A;  1P99 A;  1I6B A;  3EQ1 A;  3OO6 A;  1SVX B;  2QMW A;  2UVJ A;  4OES A;  4EF1 A;  3H06 B;  2DVC A;  3PPP A;  3DLN A;  3R26 A;  2ONK E;  1JVY A;  3S4U A;  1N7X A;  2QS4 A;  1PBQ A;  1LGB C;  4NED A;  4I1D A;  2H99 A;  3RN8 A;  1URS A;  5ELV A;  5EYF A;  5CM6 A;  1LAF E;  1SW4 A;  4IB2 A;  1B32 A;  3EPE A;  3TMG A;  4RPN A;  3ZKL A;  2G29 A;  1JW1 A;  2B65 A;  3TUS A;  4XKP A;  1GV8 A;  4M1V A;  1B3G A;  1XHY A;  4QRZ A;  5JK4 A;  4YB7 A;  4TOZ A;  3IJO B;  5H8H B;  3RT6 B;  3HO7 A;  2Q8J A;  5F1Q A;  2FA7 A;  4EDP A;  4ESW A;  4BDO A;  2XXW A;  5JTY B;  1NMU A;  1VFD A;  1YPN A;  1LBC A;  3CFL A;  1US5 A;  2DWJ A;  3SET A;  5HM4 B;  5I57 B;  4OZ9 A;  1URG A;  1B5I A;  4KCD A;  1LFH A;  2DXR A;  4U1O A;  2Z22 A;  1H76 A;  3MZ9 A;  3E13 X;  4BLA A;  4H0W A;  2XXI A;  3E3K A;  1FQB A;  3MZ1 A;  2PT1 A;  2Y7R A;  3G3K A;  1ZLQ A;  2Z8D A;  4EF2 A;  1JET A;  5I2K A;  4XIG Q;  3F11 A;  2PVU A;  4ELR A;  5KZT A;  3V83 A;  5CMB A;  4N6P A;  4OET A;  1BLF A;  4ESX A;  4PFY A;  3FVG A;  3FVK A;  3GLB A;  3BFT A;  3IO4 A;  5HBC A;  1P1N A;  3DM0 A;  2XD3 A;  3KN8 A;  1FCK A;  5ICT A;  5H8F B;  1LAX A;  4U4X A;  3HPI A;  3DP4 A;  4R6H A;  2O1M A;  4Q5T A;  4NMY A;  2XXU A;  3TKD A;  1WDN A;  4NF6 B;  2NVU B;  1N04 A;  3ILT B;  5DYH A;  1PB7 A;  3VXC A;  2UXA A;  3VFJ A;  2F8D A;  3IJX B;  3TCG A;  1UTH A;  2NWJ A;  1N3W A;  4HCY A;  3GZG A;  2FNC A;  1VFE A;  4KR5 A;  1D4N A;  3PGF A;  3O2A A;  3H6T A;  3GBA A;  3TTN A;  4G68 C;  1A55 A;  4N07 A;  3IOV A;  1A8F A;  3VDF A;  2HQ0 A;  2DS9 A;  1BTJ A;  3VE1 B;  4MFI A;  2O6A A;  2G93 A;  1QJM A;  1P1U A;  4ZEB A;  1LCF A;  3MVY A;  4KPT A;  4GXA A;  1IQ7 A;  5TP9 A;  4R73 A;  1DOT A;  1H3D A;  4U1Z A;  3Q26 A;  2IEE A;  2ZXT A;  4ONY A;  1B9J A;  4ZE8 A;  1NNP A;  3I3V A;  5AA4 B;  1PDA A;  1B7Z A;  3MVZ A;  3FXR A;  3T22 A;  1Q1K A;  5L8D A;  3IX1 A;  3W9V A;  2ZNU A;  1NH8 A;  3VXB A;  4FED A;  2VHA A;  3PPO A;  4R75 A;  2OJT A;  2O84 X;  4EUO A;  1GTK A;  4POW A;  4QHQ A;  4X48 A;  2QS3 A;  4KQP A;  4OWD A;  5CMK A;  1M5D A;  1TT1 A;  2PT2 A;  4R6Y A;  4YZZ A;  4ISU A;  4G68 B;  1RYX A;  4XKR A;  4ECF A;  4KYE A;  1MPB A;  1L5T A;  3T96 B;  3T9U A;  4YIC A;  3C31 A;  4IO3 A;  2OZZ A;  3LSW A;  4GXS B;  5DEX B;  2WKY A;  3N6U A;  4WXJ A;  3CRB A;  4OHN A;  3IOW A;  2YLN A;  2V25 A;  2H98 A;  3H6U A;  2Y84 A;  4F3S A;  3OO8 A;  1D9V A;  2PYY A;  4IO5 A;  4MH5 A;  1RKM A;  3SEX A;  2DVZ A;  4LON B;  4TLL B;  3CIJ A;  1EU8 A;  2AL4 A;  1MXY A;  4OTE A;  4LZ8 A;  3LSF B;  5AA2 B;  2DOJ A;  2O7I A;  1B52 A;  2Z23 A;  2F7A A;  4GIZ A;  3PUZ E;  4FE8 A;  3K6X A;  4FAJ A;  3FXQ A;  3O97 A;  4P0G A;  4ND9 A;  2XXT A;  1Y1Z A;  2GFE A;  4O3B A;  1B05 A;  4OEN A;  1YTV A;  3TTM A;  4UA8 A;  3PUV E;  4DDD A;  5HPQ A;  3VV5 A;  1JEV A;  5TU0 A;  2PX1 A;  1B1H A;  5K2X A;  3C35 A;  4ELO A;  2REJ A;  1QKB A;  1B0L A;  1LLS A;  5A5X A;  4G8M A;  3KEI A;  1AL3 A;  1R1N A;  3UOR A;  4YKK A;  2HZK A;  3M3L A;  4Q0C A;  4HTG A;  2QPQ A;  4IGT A;  4F3G A;  1NH7 A;  3CVG A;  3KN3 A;  5AA2 D;  1MQJ A;  2I4B A;  1NNF A;  2ONR A;  5H8N B;  1FTM A;  3U92 A;  4XKN A;  1EZO A;  3TQL A;  2OBG A;  3QYT A;  2F36 A;  3CSG A;  2M8C A;  4YKI A;  3TOD A;  1AOV A;  1MPC A;  5I59 B;  4TLM B;  1MRP A;  1T0K A;  4OVJ A;  2NUV A;  4F3P A;  4QSE A;  3PUY E;  3QIM A;  4AB5 A;  3BKI B;  5I2N B;  1B4Z A;  1R6Z A;  4ZDM A;  4JXI A;  1B58 A;  2QL3 A;  3CFZ A;  4GOT A;  3I5O A;  3LR1 A;  2AIX A;  4OMB A;  3B7D A;  4DLD A;  3MUQ A;  4C0R A;  4JB7 A;  3MPL A;  3MP8 A;  2NXO A;  1ZIU A;  4GL0 A;  3T9H B;  1HSJ A;  2UVH A;  2D21 A;  3CFX A;  3H6W A;  4F39 A;  2Y7K A;  4X9T A;  5H8Q A;  4IO2 A;  1S7Y A;  1DPE A;  3B6T A;  3ECR A;  1GR2 A;  2ZYO A;  2HAV A;  4H8J A;  4I62 A;  3O29 A;  2THI A;  4TQU Q;  1H44 A;  1P1Q A;  1ZJL A;  5CRY A;  1O63 A;  1QKA A;  2ALU A;  4LP2 B;  4RK9 A;  1MY3 A;  1TXF A;  1SD3 A;  1OQG A;  4JSO A;  3VLW A;  4OFJ A;  4GLI A;  2YPN A;  2REG A;  2OWS A;  1GVC A;  3TEP A;  5IKB A;  2X7P A;  1XOC A;  1Y20 A;  3CI8 A;  2XX7 A;  3K6U A;  5CBR A;  2GH9 A;  4C1U A;  4NE4 A;  1EZ9 A;  3K1M A;  2DXY A;  4IO7 A;  3IR1 A;  1Y3P A;  4EQ9 A;  3K6W A;  5CMM A;  1XC1 A;  4F31 B;  3K01 A;  4EXL A;  3PUX E;  2XXY A;  4AQ4 A;  3OXN A;  4POX A;  1R9L A;  3ZSF A;  4F1V A;  2UVI A;  3TAJ A;  5M2V A;  5KCJ B;  3M3K A;  1UTB A;  4C1T A;  1MG1 A;  4H5F A;  2QMX A;  1SI1 A;  2Y7P A;  5KDT B;  4F22 A;  3PPQ A;  4JSD A;  2ABH A;  1FTL A;  3TFL A;  1MDQ A;  3C34 A;  1B2H A;  3HHG A;  3KG2 A;  3ODB A;  1LB8 A;  1ZU0 A;  1JEU A;  4F29 A;  3PMW A;  1B7U A;  2DWH A;  4ZEF A;  1N84 A;  3MVW A;  5J1D A;  5CBS A;  3OO9 A;  3TYH A;  3RY3 A;  2PMS A;  3MP6 A;  3OEM A;  1M5B A;  2Q9T A;  3MAM A;  1B40 A;  3EN3 A;  3DP8 A;  4GWO A;  1OVT A;  5I58 B;  4OYV A;  3FGS A;  2P0S A;  3S9M C;  1MQG A;  4X1B A;  2ZMB A;  1EH3 A;  4MF3 A;  2W7Y A;  2HAU A;  4PFT A;  3SES A;  2A5T B;  4IY6 A;  4R72 A;  5EHS A;  1B0H A;  1A7L A;  5H8H A;  3HCQ A;  2GRV A;  3UGW A;  4QSD A;  3T9X B;  1IXH A;  3KZG A;  1ZMG A;  3BFU A;  5JTY A;  2RF1 A;  3TZA A;  2KLF A;  3WAF A;  1AIV A;  2R9J A;  3MWB A;  1ATG A;  4IO4 A;  4EXK A;  3LSL A;  3KN7 A;  2QS2 A;  3MZB A;  3OOA A;  3TDJ A;  5L9M A;  1XS5 A;  1A8E A;  4P11 A;  4BDM A;  4GD5 A;  4ZZE A;  4OEV A;  5FTI A;  4DCY A;  3UK4 A;  3E4R A;  1SI0 A;  3IL1 B;  2Q89 A;  4O3A A;  1O64 A;  2GHA A;  2XXQ A;  1N3X A;  4G8H A;  3IO6 A;  2LAO A;  4FEC A;  3EHT A;  1F9B A;  2O1L A;  2H4I A;  3RUM A;  4YKP A;  2V3Q A;  4JBZ A;  2F6P A;  4KD5 A;  3CSB A;  1MPD A;  1TWY A;  4OFO A;  3IK6 B;  1B46 A;  3LC8 A;  4NF4 B;  4ZED A;  4QSC A;  4NF6 A;  4OXV A;  4XTC Q;  2I3V A;  2A5S A;  3OD7 A;  2UYF A;  5L9O A;  4H5G A;  4JWX A;  4ZZA A;  3IB1 A;  3LSX A;  1A99 A;  3RT8 A;  1MQI A;  4RYA A;  1FQC A;  2O51 A;  1P1W A;  1LBB A;  2P2A A;  4BDL A;  3G3F A;  1H43 A;  2OLB A;  3V8X B;  2ZNT A;  4RXL A;  3EHS A;  3S2V A;  1OLA A;  2CMO A;  5CC2 A;  4NF5 B;  3KFM A;  5DTB A;  4JDF A;  2VGQ A;  3DEL B;  5TPA A;  1UIU A;  3KSJ A;  2DE2 A;  1XVX A;  1PBP A;  4QFK A;  5DT6 A;  4QFO A;  3RTW B;  5AE4 A;  1MM6 A;  2DWA A;  1UQW A;  2V3T A;  3G3I A;  5L9S A;  3KSX A;  1MY0 A;  3JV9 A;  1QUI A;  3LUY A;  4KYS A;  3PMX A;  4THI A;  4R9G A;  3TTL A;  2DE3 A;  3OEL A;  1MH4 A;  1JQF A;  3Q25 A;  3U8Q A;  1B5J A;  1YCJ A;  1Y4C A;  1VR5 A;  1Z7M E;  2ANJ A;  2HFB A;  5LOM A;  1HSE A;  5AA4 A;  3FD3 A;  5FHO A;  1RYO A;  3U72 A;  2UYE A;  4KI0 E;  1Z7N E;  1FTK A;  1HSL A;  4PFW A;  1SYI A;  3FVN A;  1DPP A;  1MXW A;  1A54 A;  2I49 A;  3E9X A;  1LCT A;  1QW0 A;  2DSF A;  3D4G A;  2OK2 A;  4OEU A;  2VD2 A;  1POT A;  4G4P A;  1AMF A;  3K6V A;  3MJN A;  1O7T A;  5I84 A;  3OEN A;  3ZS6 A;  3V5A A;  1IXC A;  4LZ5 A;  4LQ5 A;  4F3B A;  4L17 A;  4KYD A;  2DQV A;  2V84 A;  3OMB A;  1IXI A;  1WVJ A;  3FZV A;  4EQ7 A;  1H45 A;  5DEX A;  3SEW A;  2I58 A;  2XXP A;  4F19 A;  3FJG A;  3PMV A;  3SEY A;  4DXU A;  5B7D A;  4MLQ A;  5B70 A;  4YB5 A;  2GHB A;  4JWY A;  3KJ7 A;  3UIF A;  3W15 C;  1BIY A;  4U2R A;  4E0X A;  5FHM A;  3RTF B;  3N5L A;  3T93 B;  1IEJ A;  3MP1 A;  1OVB A;  1MXZ A;  1IXG A;  3BBR A;  4WED A;  4QFL A;  3PUW E;  1FQA A;  4NWC A;  5AA2 A;  2H9B A;  1MY4 A;  4QFN A;  5I56 B;  2ZYK A;  1KWH A;  4YMB A;  3TCF A;  1FW0 A;  4MBP A;  5FTH A;  3ONM A;  3T9V A;  1S9T A;  5CMC A;  2XX8 A;  1Y9U A;  3MC2 A;  3C33 A;  4NF8 B;  1PEB A;  1MS7 A;  3MW0 A;  3PV0 E;  3C36 A;  1DTG A;  2VOZ A;  2ESN A;  5F7V A;  5CI5 A;  1PC3 A;  2ZNS A;  5ISU A;  5DVJ A;  3KOS A;  1BKA A;  3H03 A;  1OMP A;  3K02 A;  3FJ7 A;  4OQO A;  1NKX A;  1QUK A;  5AA1 A;  2X26 A;  4YMA A;  4U4S A;  3H6V A;  1SW2 A;  3MQ9 A;  4FIM A;  1S50 A;  4QFP A;  1N76 A;  1US4 A;  3FVO A;  4PFU A;  2HXW A;  1GGG A;  3QUF A;  1SW5 A;  1R9Q A;  2BJJ X;  2OCU A;  1MH3 A;  3L6H A;  5H8N A;  1MQH A;  4RPO A;  1M5F A;  4K3F A;  2Z8E A;  3L6G A;  1B3L A;  4PE5 B;  1B3H A;  2ZYM A;  3R6U A;  3S9L C;  3LBS A;  5I59 A;  4YAH X;  3I6V A;  3QK6 A;  1FTJ A;  3THI A;  3K4U A;  3K0V A;  2QJE A;  1VSO A;  5I2N A;  1B4H A;  2I6E A;  1ELJ A;  2O68 A;  4ZE9 A;  4R6K A;  1B7H A;  3KGC A;  4LQ2 A;  2F7B A;  3EHU A;  2Y7I A;  3USD A;  4IO6 A;  3G3G A;  3SEU A;  5BWJ A;  4R2B A;  3FAS A;  3IOT A;  4U22 A;  5AA3 A;  4H67 A;  2AL5 A;  4DCX A;  4ZEI A;  3K2D A;  2DYX A;  5I2K B;  4MLV A;  4OER A;  3O28 A;  2D3I A;  1B3F A;  3T66 A;  4H65 A;  1A40 A;  1Y1M A;  1B51 A;  3CR9 A;  3OO7 A;  2OWT A;  4UAC A;  2VD3 A;  4FOR A;  4F1Y A;  1B6H A;  4DXC A;  2DE4 A;  2QRY A;  2R71 A;  2PBW A;  1LFG A;  2F7C A;  2XXH A;  4F2O A;  2H5Y A;  1M5E A;  4LVQ A;  4E0W A;  4G77 A;  2F6G A;  4KHZ E;  3B6W A;  3RGY A;  3CG1 A;  4RA1 A;  4Q30 B;  5FHN A;  4JWO A;  4F1U A;  3IAZ A;  3N6T A;  2IA4 A;  1WOD A;  1ZTY A;  4ZEK A;  4EQB A;  4WEP A;  3TQW A;  3RQT A;  3IB0 A;  4GF8 A;  4DZ1 A;  2XXX A;  1SBP A;  3GXA A;  4FJP A;  1UTH B;  4YKJ A;  4GL8 A;  2I0C A;  2RC9 A;  4M4G A;  2RCA A;  3UA8 A;  5DVF A;  3VLU A;  3W9W A;  1IIT A;  2RC8 A;  3N26 A;  4LAT A;  1B3E A;  4I9D A;  2F97 A;  5KCJ A;  4F18 A;  3DP6 A;  3EF7 A;  2H25 A;  2XXV A;  3OSR A;  4P0I A;  4BDN A;  1J1N A;  3O9P A;  5KDT A;  3A3U A;  1FQE A;  4GVO A;  5DVI A;  2CZL A;  1Y3Q A;  2QS1 A;  1VE4 A;  1BP5 A;  5TP9 B;  4LZ7 A;  5I57 A;  4R9F A;  1JNF A;  4HW8 A;  5IAI A;  3C32 A;  2Z8F A;  3SER A;  1I69 A;  4QF9 A;  3QUJ A;  1IIW A;  4XKQ A;  1JVX A;  1OQH A;  3HV1 A;  3GBB A;  1USY E;  1TFD A;  4PP0 A;  4RK2 A;  4PET A;  1QVS A;  2AYS A;  4I8C A;  3IB2 A;  4Q8R A;  1NNK A;  1PB9 A;  5I58 A;  2E1S A;  3ZKK A;  1B5H A;  4DIG A;  3Q28 A;  1YAE A;  1CB6 A;  2A5T A;  4R2F A;  2I3W A;  3TTK A;  2F35 A;  4ZS9 A;  4ELQ A;  5TPA B;  1NL5 A;  2E0S A;  3KOT A;  4HCW A;  5H8F A;  3PPR A;  3UP9 A;  5ITP A;  1B1X A;  4HS7 A;  3RPW A;  3K1P A;  4LA9 A;  1SYH A;  4R74 A;  3O6H A;  3P7I A;  3MPK A;  1IZ1 A;  3UN6 A;  3KJT A;  3AXF A;  2HCA A;  1DMB A;  2B3F A;  1AH5 A;  2XD2 A;  3VVE A;  4G8N A;  1FTO A;  2Q88 A;  4PQJ A;  2R6G E;  2I48 A;  1Y4T A;  2YJP A;  3OEK A;  3D4C A;  1MDP 1;  3MVX A;  4YU0 A;  2Q2C A;  4FAT A;  5ICQ A;  5JEI A;  2Q2A A;  4G2Z A;  3ILU B;  3JZJ A;  4H6D A;  3QXM A;  1MM7 A;  3FXU A;  1I6A A;  4IY5 A;  3G3J A;  1D3K A;  1MXX A;  1MY1 A;  4XXU A;  2I4C A;  1LAG E;  2UVG A;  4NWD A;  2ZYN A;  5ITO A;  2I0B A;  1NFT A;  1OIB A;  4NF4 A;  1JW5 A;  3C9H A;  1LAH E;  2RIN A;  1UIV A;  3TEL A;  3FJM A;  3PD8 A;  2F5X A;  5A5X B;  2RC7 A;  1DTZ A;  2XXR A;  1MXU A;  4GRK A;  4NF5 A;  4X1D A;  1MQD A;  4N13 A;  1SQY A;  2DWI A;  1LFI A;  2XHD A;  2X7Q A;  3VVF A;  4U21 A;  3Q29 A;  3U94 A;  4O3C A;  4LUB A;  1I6Q A;  4G68 A;  2ONS A;  2DP8 A;  3SKP A;  3K00 A;  3QAX A;  3FV1 A;  2VP1 A;  3QSL A;  1FQD A;  3N94 A;  1MXV A;  1ZKB A;  3M3F A;  2O69 A;  3HN0 A;  1D9Y A;  2F34 A;  1SW1 A;  4GQO A;  5BUU A;  3MBP A;  3FV2 A;  2V93 A;  3CG3 A;  4IGR A;  3VVD A;  4YB6 A;  1N7W A;  3PU5 A;  2HEU A;  4FEB A;  3O66 A;  3SEV A;  3TPA A;  4KCC A;  2XX9 A;  1FQF A;  4WKM A;  1QUJ A;  1NNT A;  3B6Q A;  3PPN A;  3HST A;  5H8Q B;  3JYR A;  1M5C A;  3PD9 A;  4RNS A;  1Q35 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...