2ABHA

Phosphate-binding protein (re-refined)
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
321
structure length
321
Chain Sequence
EASLTGAGATFPAPVYAKWADTYQKETGNKVNYQGIGSSGGVKQIIANTVDFGASDAPLSDEKLAQEGLFQFPTVIGGVVLAVNIPGLKSGELVLDGKTLGDIYLGKIKKWDDEAIAKLNPGLKLPSQNIAVVRRADGSGTSFVFTSYLAKVNEEWKNNVGTGSTVKWPIGLGGKGNDGIAAFVQRLPGAIGYVEYAYAKQNNLAYTKLISADGKPVSPTEENFANAAKGADWSKTFAQDLTNQKGEDAWPITSTTFILIHKDQKKPEQGTEVLKFFDWAYKTGAKQANDLDYASLPDSVVEQVRAAWKTNIKDSSGKPLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Modulation of a salt link does not affect binding of phosphate to its specific active transport receptor.
pubmed doi rcsb
molecule tags Phosphotransferase
molecule keywords PHOSPHATE-BINDING PROTEIN
total genus 112
structure length 321
sequence length 321
ec nomenclature
pdb deposition date 1995-11-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2abhA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2abhA02
4BDOA 4GD5A 3CG1A 3R26A 1QUIA 1Y1MA 4R75A 4F31B 4YZZA 3UK4A 1ZTYA 4U21A 2YLNA 4LQ5A 3FZVA 2CZLA 2UVGA 4TQUQ 3TTLA 4TLLB 3RY3A 1O63A 2H4IA 2B3FA 3IO4A 1B32A 1MQIA 5CBRA 1A55A 3CRBA 3HO7A 3O66A 4NF5B 4LVQA 1SBPA 1B0HA 3G3GA 3K2DA 2ABHA 2P0SA 3EQ1A 2I3WA 4F2OA 2Y7IA 3KJ7A 4BDRA 4FAJA 3FASA 3PUXE 1PEBA 1Q35A 4EDPA 3MVWA 5I58B 4XIGQ 1QJMA 3FD3A 3KZGA 5B7DA 4KQPA 1GGGA 5H8FA 1NH8A 2PVUA 2RC8A 3QXMA 1MY4A 3FXRA 4FJPA 5H8QB 4EF1A 3TELA 1JNFA 3PPOA 2G93A 4M4GA 3OO9A 4IO5A 1H76A 1WDNA 1USYH 2BJJX 2O1MA 1QKBA 2PX1A 2Y7KA 3O2AA 3O97A 4WXJA 1LBBA 3TZAA 5B70A 3N94A 4KCCA 2XHDA 2ONSA 2UYEA 3FJMA 4OEUA 2DE2A 3LSLA 3SETA 1Y1ZA 1FQCA 1D9YA 4OHNA 2NVUB 4I62A 5H8HA 3K1MA 4YB6A 4RK9A 1LGBC 3OO8A 3MP1A 1JVYA 2A5SA 3MZBA 2F7AA 2I58A 3TTMA 4DE8A 4F39A 5HPQA 5J1DA 2OCUA 3K6XA 2I48A 4KYSA 4G77A 1I6BA 1TXFA 3BFTA 5I2NB 1GVCA 3MVZA 2X7QA 4H65A 2YJPA 3R7XA 5JTYA 2IA4A 4ZE8A 5I2NA 3FIRA 2Z8FA 1OLAA 3DP8A 1MY2A 5I2KB 2OLBA 2H98A 1M5EA 1B4ZA 1I6AA 2F97A 2P2AA 3TYHA 3OSQA 3VVEA 2XXXA 4PETA 3IAZA 3MVXA 2DWHA 3S4UA 2OJTA 5ITPA 1FTJA 3GLBA 1MQGA 1UTHA 4JXIA 1AH5A 1Y9UA 1US4A 4U1OA 2A5TB 1R9LA 1EZ9A 3VLUA 4OENA 2DXYA 4ISUA 3ILUB 3FVKA 4OWDA 3THIA 1LFGA 4EQBA 1B58A 2A5TA 2QL3A 4PFUA 3VV5A 1DMBA 3H6UA 3W9WA 1IXCA 1MDP1 2XXUA 1B1XA 2F8DA 1IITA 2QJEA 3PV0E 5DYHA 5FHOA 4N13A 3VXBA 4ZECA 3H6WA 1N0TA 3MJNA 3RPWA 4XKPA 1XC1A 5L8DA 5TU0A 3OENA 1XOCA 2Z8DA 4YKJA 4F1UA 3I3VA 4DZ1A 1PB9A 3SDFA 1POY1 1XHYA 4RYAA 1FQDA 5ITOA 2D21A 1RYXA 3KSJA 4KI0E 4C1TA 2Q2AA 3VXCA 2O7IA 1UTBB 1JW1A 5ICTA 4ZEKA 4YAHX 2DXRA 1HSJA 1P1WA 3CI8A 2Y7WA 1Y4TA 4H6DA 1YAEA 4G68C 3CSGA 2ZMBA 3M3FA 2Y7RA 3OO7A 4H5GA 4IO4A 1R1NA 3B6TA 4Z0IA 5AA2D 1FTKA 4FEBA 4YB7A 1F9BA 1N7XA 5I57B 2XXRA 2QS3A 1QVSA 2UVHA 4R6KA 4BDNA 4YMBA 4ELPA 1A40A 1ZBMA 5AA4B 2QPQA 3LUYA 4MFIA 1O64A 4H8IA 4OFOA 3BKIB 4GVOA 3RT6B 4ZZAA 1LAGE 3KN3A 4JDFA 5L9MA 1LFHA 3C33A 3E9XA 4H67A 3CVGA 3PU5A 4MH5A 2I4BA 1OLCA 4NF8B 2Z8EA 4YKKA 2DSFA 3C31A 4GLIA 4N07A 4BDLA 3EHUA 3E13X 5A5XB 2KLFA 2UVJA 3LSFB 4NF8A 4GL0A 4HCYA 1MG1A 3UORA 3DM0A 3OXNA 5AA3A 4ZEFA 1MXZA 1B52A 5CM6A 2FA7A 2W7YA 2ONRA 4HCWA 4F1VA 4QSCA 3OO6A 4R2FA 5ICQA 3TQLA 1MPDA 1B1HA 1LCTA 4KYEA 4ESXA 4F3GA 3O6HA 2E1SA 1FQBA 2M8CA 3P7IA 4AB5A 4ECFA 5BWJA 1USYE 5DTBA 1FQFA 1JVXA 2CMOA 4FE8A 2XXQA 1A8FA 3WAFA 5AA2B 4OERA 3K00A 3KOTA 3H7MA 4GWOA 3IOVA 4GQOA 2HAVA 4KCDA 4POXA 4NF5A 4R9GA 5KZTA 3A09A 2F7BA 3ONMA 2OK2A 1XVYA 4GOTA 4R6YA 4JSOA 3T9UA 1MY0A 4ELRA 1RKMA 4TOZA 1AIVA 3C9HA 3DP6A 3W15C 1NNFA 5DVFA 3ZKLA 3MZ1A 3IO6A 4BDQA 3AXFA 3B6WA 4F3PA 3CIJA 4EXKA 2I4CA 2RKMA 4F2QA 1IZ1A 1PC3A 1B3FA 1IXIA 3PUYE 2RC9A 2ZYKA 1MXWA 1BKAA 2O7UA 4HS7A 1S50A 1B05A 3CFXA 3WAEA 2PT2A 5IKBA 1B46A 2X7PA 1VFEA 1Y3PA 1VE4A 3FV1A 3RGYA 3VLVA 2XXTA 3SEVA 5LOMA 4YKPA 4O3CA 3KJTA 1URDA 3MPKA 3PPQA 4TLMB 2YPNA 3MVYA 5ELVA 3SERA 3LC8A 2Q8JA 4PP0A 1PDAA 2FYIA 1UIUA 3M3KA 4F29A 1RYOA 4QFNA 3FVGA 4JSDA 3PUWE 4GRKA 4UA8A 2QS4A 2ESNA 3IJXB 1MPBA 3TQWA 3U1OA 3FXUA 1NKXA 4FEDA 4NF6B 2F6GA 4KYDA 4Q5TA 1OVBA 3FVNA 2PYYA 3OMBA 3GXAA 3EPEA 1EU8A 3G3FA 5CI5A 1MXVA 1B2HA 1UTHB 4F18A 4JB7A 1LAHE 4Q8RA 3K4UA 4JWXA 5TP9A 3FVOA 3RNNA 4M1VA 3SEUA 3TUSA 1T0KA 5F1QA 3PD9A 4WEDA 2UYFA 3EF7A 3DP4A 4NWDA 4EXLA 2B3BA 5EHSA 3CR9A 4G2ZA 3PGFA 5EHMA 3H6TA 2DWJA 3O28A 2QSXA 1FTMA 1ZJLA 2O6AA 3MWBA 5JEIA 1NL5A 1JW5A 2Q89A 4GIZA 3C35A 3ECRA 1FQEA 1Y20A 1FTLA 4GF8A 4LONB 4NWCA 1AL3A 3TTNA 1EZPA 4U2RA 5DVJA 3U93A 1QUKA 3N6UA 2HFBA 3USDA 1B7HA 3K1NA 2ZNSA 4O3AA 3V83A 2R71A 3FUZA 3PUVE 3SEYA 4FATA 1ZLQA 4WKMA 4FORA 4NF4A 4GXSB 3TCGA 4QFKA 3S9NC 3SEXA 4U4XA 1B40A 4PQJA 2V84A 3FGSA 2AIXA 4WEPA 2WKYA 3KN8A 4QFPA 4NMYA 4YKIA 2P1SA 1GV8A 3B7DA 4XTCQ 1I6QA 2RCAA 4DLDA 3D4CA 1BLFA 5JK4A 4YICA 1NFTA 1IUDA 1NNPA 3FATA 1M5FA 2D3IA 3C34A 3O9PA 4G8NA 4YB5A 2XX8A 3T96B 3V8XB 1MH3A 1DTZA 5KCJB 3G3JA 4FECA 1JQFA 4LZ5A 3HSTA 1DOTA 2R6GE 1H45A 1ZU0A 2QS1A 1Z7NE 2XXIA 4MLVA 1SI1A 4QFLA 5FHMA 2V3QA 3IB2A 1LLSA 3G3KA 3CG3A 5CRYA 4AQ4A 4E0WA 4ZZEA 5A5XA 3V89B 3I5OA 3K01A 1MQHA 4X1DA 4XXUA 2Y7PA 1B5IA 2I0BA 4ND9A 3PPPA 1SI0A 2HCAA 2THIA 4IGRA 4OFLA 3G3IA 4ZEBA 5AA1A 3Q28A 1XT8A 3RQTA 1LFIA 1JW4A 1SYHA 4P11A 4DXBA 1SW4A 1B5JA 1TFAA 5BUUA 2DS9A 2REJA 4NEDA 4EQ9A 5L9OA 2I3VA 5HBCA 5I58A 3PPNA 1OQHA 3T22A 4BDMA 4RK2A 4X48A 5L9SA 3IOWA 5I56A 5H8NB 1AMFA 1IEJA 3IOTA 1CB6A 3SEWA 3IOUA 3O6GA 4X9TA 5I59A 2GHBA 3RUMA 3KSXA 4JWYA 2GFEA 2QS2A 4PFWA 5H8NA 3UIFA 3K0VA 2DOJA 4GFRA 1AOVA 1GTKA 4I9DA 2OBGA 1JETA 4OFJA 3Q27A 4R72A 3ZKKA 3SKPA 2OWSA 1Y4CA 1QULA 2O51A 4O3BA 1FCKA 5DEXA 1NNKA 3G3HA 3PMXA 2XD2A 3JZJA 1B7ZA 3MZ9A 3UGWA 1QW0A 5DEXB 3O29A 4XKRA 2DE3A 2HZLA 3C4MA 1P1QA 5CMMA 4DXCA 1LSTA 3U8QA 5I84A 3K6UA 4ONYA 2E0SA 5H8HB 4F22A 3PMVA 4U23A 5H8SA 3JYRA 1HSLA 5KCJA 4U22A 1SW2A 4C0RA 3BBRA 4R2BA 1L5TA 3TKDA 2XXYA 1I69A 5K2YA 2OWTA 2PT1A 3T93B 5I59B 1SVXB 3VDFA 2F7CA 5I2KA 2HXWA 3LSXA 3K6VA 2V3TA 2B65A 3OOAA 1XS5A 3RLFE 4H1XA 2QRYA 4MLQA 2Z23A 3W9VA 1MY3A 2O1LA 2X26A 3QYTA 1O7TA 4NF6A 4LUBA 3C36A 4PFYA 3E4RA 3KBRA 4ESWA 2DWIA 4NE4A 1ZIUA 4EF2A 3MAMA 4LP2B 1LB8A 2NOOA 1HSEA 2QMXA 1B3EA 3CFLA 4G68A 5TP9B 2ZXTA 3C32A 3H4ZA 2H5YA 1WODA 2ONKE 3N26A 4IB2A 1QUJA 4GL8A 4P0IA 4HTGA 5DVIA 4RNSA 3S2VA 4ZE9A 5ISUA 1N76A 3GBAA 1B0LA 5TPAB 4IY5A 3RN8A 1YPNA 1UTBA 2RINA 1Y3NA 1GR2A 2VOZA 3OD7A 5CBSA 1H43A 1IXGA 4LZ7A 5EYFA 5TPAA 4OESA 4ELQA 3RT8A 3IJOB 5FTHA 2XX9A 2ZNUA 3HCQA 4YU0A 2QMWA 1D3KA 1DSNA 1MRPA 1NNTA 1BP5A 4OMBA 4F1YA 4E0XA 4I8CA 1M5DA 2HAUA 4KHZE 1VFDA 1POTA 2G29A 3RTFB 3L6GA 2GHAA 2PBWA 3DELB 3MP8A 1URGA 3CFZA 4OXVA 1ATGA 1MXXA 1OQGA 2PMSA 3GZGA 1J1NA 1KWHA 3IB0A 2LAOA 3PUZE 4MF3A 4QRZA 4OYVA 5AA4A 3MC2A 4DXUA 4G8MA 4Z7EA 1P1UA 2ALUA 4POWA 4QSEA 1II5A 1MM7A 3KGCA 3KOSA 2NUVA 4U1ZA 5I57A 2VHAA 3VVFA 1S7YA 4UACA 3OELA 3Q29A 3H6VA 1R9QA 4OEVA 5HM4B 3TTKA 3VFJA 2I0CA 4DCXA 3OEKA 4YMAA 3IK6B 3MP6A 1N3XA 1FW0A 3IR1A 2HQ0A 3L6HA 4KFQA 1US5A 2NXOA 5H8QA 2I6EA 1A99A 2VP1A 1N04A 4QHQA 4RPNA 4XKNA 4LZ8A 2Q9TA 5AE4A 1MDQA 4RJZA 4K3FA 1SQYA 4ZDMA 3TAJA 3LSWA 3V5AA 4ZEDA 2F5XA 1TFDA 4LA9A 1B3GA 3MBPA 4PFTA 1MY1A 1XVXA 4EUOA 2Y84A 1TWYA 1B6HA 3K6WA 1B7UA 3MW0A 2XXPA 2XXVA 2DYXA 2V3UA 5K2XA 4PE5B 5CC2A 2IEEA 4DDDA 1DPEA 1DPPA 1LB9A 1A8EA 2V25A 2ZYOA 3MUQA 4R74A 4G4PA 3N5LA 1B9JA 3FV2A 4Q30B 2F36A 4QF9A 1LAFE 5CMBA 2I49A 3IL1B 2Q2CA 1UQWA 5F7VA 2RF1A 3TODA 3K02A 3FXQA 2OZZA 1B5HA 1MQDA 1MXUA 1D9VA 4IGTA 3EHSA 5JTYB 1IQ7A 1OMPA 2VD2A 3HV1A 4ZS9A 1D4NA 2F6PA 1FQAA 3H06B 3IORA 4KD5A 4DCYA 1UIVA 4RXLA 3PMWA 3KEIA 1A7LA 2UXAA 2F35A 3E3KA 5I56B 1OVTA 3FJ7A 3QAXA 1S9TA 3TPAA 3HHGA 2DVZA 5H8FB 1BIYA 3T9VA 1EZOA 1H44A 3UA8A 1M5BA 5CMCA 1VSOA 3M8UA 3MPLA 3U94A 5KDTA 4F19A 3ODBA 1B3LA 1LAXA 3DLNA 3FJGA 1P99A 3QK6A 4H0WA 3TTRA 3TDJA 4DIGA 4H8JA 3TCFA 1PBQA 3K1PA 4ELOA 1B3HA 3PPRA 2VGQA 4HW8A 5KDTB 3T9HB 4X1BA 3HHFA 2XXHA 1MM6A 1NH7A 1TT1A 3A3CA 3ZSFA 1OIBA 2DVCA 2Q88A 2ZYNA 2DP8A 3KG2A 4IO6A 2O68A 3CSBA 3ZS6A 3JV9A 3HN0A 4N6PA 2H99A 2REGA 5M2VA 3EHTA 2ZYMA 2H9BA 1Y3QA 5AA2A 1CE2A 1SD3A 3U92A 1N3WA 4FIMA 4RPOA 2H25A 3N6TA 5FTIA 2VD3A 1Z7ME 1PB7A 1N84A 1A54A 1ZKBA 2GRVA 1EH3A 2HEUA 2V93A 3GBBA 4G8HA 5DT6A 4BLAA 1MH4A 1N7WA 1YCJA 2AL5A 4Q0CA 3IB1A 4OZ9A 5CMKA 1BTJA 1IXHA 4IY6A 3VVDA 1ELJA 2F78A 3BFUA 4G68B 3RTWB 2ANJA 2RCBA 3LR1A 3H3GA 3PD8A 3Q26A 3O6IA 4RA1A 3TCHA 2XXWA 3MQ9A 4L17A 2F34A 4F3BA 4LATA 4QFOA 4ZEIA 4KR5A 4AB6A 3I6VA 1DTGA 4IO2A 4R6HA 2O84X 2R9JA 4JBZA 4IO3A 3QUFA 2UVIA 3ILTB 1VR5A 1PBPA 2DE4A 4R73A 1Q1KA 2NWJA 1SDXA 2AL4A 4JWOA 4THIA 5FHNA 3M3LA 3R6UA 1MQJA 2DQVA 4IO7A 4OQOA 3TFLA 3S9EA 1NMUA 3HPIA 1R6ZA 3UN6A 1MPCA 4QSDA 3UP9A 1YTVA 1B51A 3T9XB 2Z22A 1LCFA 1WVJA 3D4GA 3IX1A 3QIMA 3S9MC 1FTOA 2D5WA 2HZKA 3KFMA 4OVJA 1SYIA 3H03A 1P1NA 4NF4B 4U4SA 4XKQA 1QKAA 1SW5A 1IIWA 1B4HA 3Q25A 3QSLA 4P0GA 4EQ7A 5IAIA 4LQ2A 1SW1A 4H5FA 3LBSA 1LBCA 1MS7A 4OETA 3TMGA 3B6QA 1PB8A 1JEVA 4GXAA 3SESA 3T66A 4F3SA 3EN3A 3A3UA 2XX7A 4I1DA 3VLWA 2O69A 3OEMA 1MXYA 1ZMGA 3OSRA 1H3DA 4OTEA 2RC7A 1URSA 3U72A 4KPTA 3VE1B 3TEPA 3QUJA 3F11A 4C1UA 4RY1A 2GH9A 1ANFA 3G7WA 2ZNTA 4R9FA 1P1OA 4MBPA 1JEUA 4NTLA 2XD3A 2DWAA 3KN7A 2AYSA 2FNCA 1M5CA 3S9LC
chains in the Genus database with same CATH superfamily
1QUIA 4YZZA 3BIGA 3RY3A 1FJ6A 2BJIA 3HO7A 1SBPA 3G3GA 3EQ1A 4F2OA 1Q35A 3MVWA 3KZGA 1K9YA 4KQPA 5H8FA 1NH8A 2PVUA 2RC8A 3QXMA 1MY4A 2KQZA 4M4GA 4R9GA 3OO9A 1H76A 2PX1A 4WXJA 5B70A 3N94A 2XHDA 2DE2A 3SETA 4OHNA 3OO8A 4F39A 2A5SA 2F7AA 4G77A 1TXFA 5I2NA 1OLAA 1MY2A 2OLBA 1M5EA 3IAZA 1MQGA 1UTHA 1Y9UA 1US4A 1EZ9A 4EQBA 3H6UA 3MJNA 1XC1A 4GBWA 1XOCA 2Z8DA 1POY1 1XHYA 4RYAA 2D21A 5EQAA 5ICTA 4ZEKA 2Y7WA 1R1NA 4Z0IA 5AA2D 2XXRA 1ZBMA 2QPQA 3RT6B 3KN3A 1LFHA 3C33A 4H67A 2I4BA 4NF8A 5AA3A 2ONRA 3OO6A 4ESXA 4F3GA 1FQBA 3P7IA 1YYZA 4HXVA 2XXQA 4OERA 3K00A 3IOVA 4POXA 2QFLA 4TOZA 3ZKLA 2B4LA 4EXKA 1B3FA 2ZYKA 1MXWA 2O7UA 2P3VA 2PT2A 1B46A 1VFEA 3VLVA 3E79A 5IGAA 3IFCA 2YPNA 3MVYA 1AWBA 2FYIA 1UIUA 5LDZA 3FVGA 4FEDA 4NF6B 3FVNA 5CI5A 1MXVA 1DCUA 1LAHE 3FVOA 4M1VA 1T0KA 5F1QA 4G2ZA 1EYKA 4GWSA 2QSXA 5JEIA 2Q89A 4GIZA 3TTNA 5DVJA 3N6UA 4GWXA 3V83A 2R71A 4I3EA 3SEYA 3D1RA 4NF4A 4U4XA 1B40A 4PQJA 2V84A 4QFPA 3D4CA 1IUDA 2D3IA 4YB5A 2Y5KA 2XXIA 4MLVA 4E0WA 1LLSA 5A5XA 4ZZEA 3V89B 4XXUA 2I0BA 4IGRA 4MNIA 4ZEBA 4GWWA 3Q28A 5AA1A 3RQTA 4P11A 5L9OA 2DS9A 5HBCA 3PPNA 3IFAA 4X9TA 1FPEA 5H8NA 4P1EA 1JETA 3ZKKA 1Y4CA 2O51A 3G3HA 3PMXA 3JZJA 2XA5A 1QW0A 3O29A 1P1QA 1LSTA 2E0SA 4QBAA 4F22A 3PMVA 5H8SA 4U22A 1SW2A 4C0RA 1L5TA 3TKDA 2XXYA 1I69A 3LV0A 3SZPA 5I7IA 3OOAA 2V3TA 2B65A 1XS5A 4H1XA 1MY3A 2O1LA 4ESWA 2XXKA 1NV4A 1HSEA 4G68A 2ZZVA 1QUJA 4RNSA 5ISUA 1B0LA 1YPNA 1UTBA 2VOZA 5TPAA 1IXGA 3ISPA 4I8CA 1M5DA 4KHZE 4N81A 1NV2A 3DELB 3MP8A 4MF3A 1OQGA 2PMSA 1KWHA 2LAOA 3E78A 3MC2A 4Z7EA 2ALUA 3MSTA 4POWA 1II5A 4QSEA 1FSAA 1MM7A 3KOSA 4U1ZA 1R9QA 1NV6A 3IK6B 3MP6A 3BIHA 4KFQA 4QHQA 4PFBA 2ZZWA 4K3FA 3TAJA 4LA9A 3MBPA 1MY1A 4EUOA 1B7UA 5K2XA 5CC2A 1DPEA 1LB9A 2F3DA 5ET8A 4P56A 1UQWA 3EHSA 5JTYB 4DCYA 1FQAA 3IORA 1A7LA 2UXAA 5I56B 1OVTA 3T9VA 1EZOA 3UA8A 1VSOA 3U94A 5KDTA 3ODBA 3TCFA 3K1PA 3T9HB 4X1BA 3HHFA 2XXHA 2DVCA 2ZYNA 3KG2A 4IO6A 2O68A 4OVPA 4P47A 4PDDA 2H9BA 1Y3QA 4I40A 3HFUA 1PB7A 2GRVA 1N84A 1A54A 1ZKBA 4P8BA 2FHYA 1YCJA 4Q0CA 2AL5A 2FIXA 4G68B 3RTWB 1D9QA 3LR1A 3Q26A 3TTKA 3U72A 4QFOA 3I6VA 1DTGA 1FBCA 2UVIA 1PBPA 1Q1KA 1SDXA 4THIA 4OQOA 1MQJA 3TFLA 3UN6A 3UP9A 3T9XB 1LCFA 3D4GA 4XF5A 2HZKA 4OVJA 1P1NA 4U4SA 5IAIA 4LQ2A 4H5FA 4N91A 4OETA 3TMGA 3EN3A 3A3UA 3VLWA 2O69A 4OTEA 2RC7A 1URSA 3QUJA 4RY1A 3G7WA 2DWAA 3KN7A 3TTLA 4BDOA 3CG1A 3R26A 1RDXA 4F31B 3UK4A 4U21A 2YLNA 4LQ5A 3FZVA 2CZLA 4TQUQ 2B3FA 3CRBA 3O66A 4NF5B 1LBXA 4LVQA 3A29A 2I3WA 4FAJA 3FASA 4PAKA 4XIGQ 3RYDA 1GGGA 1WDNA 2BJJX 3TZAA 1LBZA 4KCCA 2ONSA 3FJMA 4OEUA 2NVUB 1FQCA 1D9YA 2CEYA 4I62A 3K1MA 4YB6A 4RK9A 1LGBC 1JVYA 4DE8A 2CZKA 3TTMA 3K6XA 2I48A 5I2NB 3BFTA 1GVCA 3MVZA 3FIRA 3VVEA 2P2AA 2XXXA 4PETA 4XEQA 5ITPA 3GLBA 4JXIA 1AH5A 1NV5A 4OENA 2DXYA 3ILUB 3FVKA 1LFGA 2A5TA 2XWOA 1IITA 2QJEA 5DYHA 3VXBA 3H6WA 3RPWA 4XKPA 1VDWA 5L8DA 4P1LA 3OENA 4YKJA 4DZ1A 1PB9A 5ITOA 2Q2AA 3VXCA 1UTBB 1INPA 4DI3D 1HSJA 4G68C 2Y7RA 4H5GA 4GX3A 1F9BA 4BDNA 1EYIA 4H8IA 4OFOA 3BKIB 5L9MA 3E9XA 3PU5A 2Q8MA 1OLCA 4NF8B 4GLIA 4BDLA 2KLFA 3LUZA 3PTYA 4HCYA 1IMBA 1MG1A 3UORA 3DM0A 4HCWA 2W7YA 5ICQA 1B1HA 1LCTA 4KYEA 1FBGA 4GBVA 4JVCA 5DTBA 1JVXA 5AA2B 5I3SA 3KOTA 1NUZA 4GQOA 4MJOA 4HE2A 4N6KA 3A09A 2F7BA 3ONMA 2OK2A 4ELRA 3C9HA 3MZ1A 3AXFA 3B6WA 2I4CA 4F2QA 1PC3A 1NUYA 4HS7A 1BKAA 1S50A 3CFXA 5IKBA 3FV1A 1Y3PA 1VE4A 3RGYA 2XXTA 3SEVA 5LOMA 1URDA 4TLMB 2Q8JA 1NV1A 3M3KA 4NG7A 4F29A 4JSDA 3FXUA 2F6GA 4YU0A 4EF1A 3EPEA 5TP9A 3RNNA 4WEDA 2B3BA 5EHSA 2DWJA 1NL5A 1JW5A 3ECRA 1Y20A 1DBZA 2HFBA 3K1NA 3FUZA 1ZLQA 4WKMA 3S9NC 4QFKA 1IMDA 2AIXA 4DLDA 1BLFA 3FATA 2CZIA 2XX8A 1DK4A 3V8XB 1MH3A 3G3JA 1FTAA 4LZ5A 2R6GE 4QFLA 5FHMA 1Z7NE 5I5PA 3TUSA 1MQHA 1FJ9A 1B5IA 1FPLA 4OFLA 5ET6A 1SYHA 1SW4A 2REJA 5I58A 3T22A 4BDMA 4X48A 3T1BA 5H8NB 1IEJA 3IOTA 1CB6A 3IOUA 5I59A 3KSXA 1NV7A 2GFEA 2QS2A 3UIFA 3K0VA 4GFRA 4I9DA 4OFJA 1QULA 1FCKA 3UGWA 4OVQA 5I84A 2CEXA 4DXCA 3K6UA 5KCJA 2Q74A 4R2BA 5K2YA 2OWTA 4MNPA 3T93B 2WEFA 2QVUA 3VDFA 1JP4A 1G0IA 3K6VA 3RLFE 2QRYA 4MLQA 2Z23A 3W9VA 4PBHA 3QYTA 3E4RA 4NE4A 4EF2A 2NOOA 2QMXA 3C32A 2H5YA 2ONKE 4P0IA 5DVIA 5TPAB 4IY5A 3RT8A 3IJOB 3HCQA 4NAPA 2OWZA 1DSNA 1MRPA 1NNTA 1VFDA 4PF6A 3L6GA 4OXVA 1MXXA 3IB0A 4QRZA 3PUZE 4OYVA 4G8MA 1P1UA 4NF0A 2VHAA 3Q29A 4OEVA 5HM4B 3VFJA 4YMAA 1FW0A 3IR1A 1US5A 2NXOA 2I6EA 1A99A 4RPNA 4XKNA 5AE4A 1MDQA 4RJZA 3V5AA 1TFDA 4PFTA 2Y84A 3MW0A 4PE5B 2V25A 2ZYOA 1A8EA 3IL1B 2HPGA 1B5HA 5AA2A 1D9VA 2VD2A 2F6PA 1UIVA 3PMWA 3KEIA 2F35A 1S9TA 3TPAA 3HHGA 2DVZA 4AS5A 5CMCA 3MPLA 3FJGA 1NUXA 3TDJA 4ELOA 4HW8A 1TT1A 2HXRA 4PTKA 2H99A 4AS4A 3FBPA 1KA0A 1SD3A 2H25A 3N6TA 2HEUA 2WX9A 2V93A 1MH4A 2JJKA 3BFUA 3H3GA 3PD8A 3MQ9A 4L17A 4ZEIA 4AB6A 4KR5A 4N4UA 2R9JA 3U65A 4X8RA 4IO3A 2NWJA 3B50A 4X04A 2AL4A 5FHNA 3R6UA 4IO7A 2QVVA 1MPCA 1WVJA 4G61A 3KFMA 4GX4A 1QKAA 1SW5A 1B4HA 3Q25A 4P0GA 4EQ7A 1SW1A 1JEVA 3SESA 3T66A 4F3SA 4GX6A 4I1DA 3OSRA 1MXYA 1ZMGA 4PDHA 1H3DA 2WYKA 4KPTA 2ZNTA 1JEUA 2AYSA 5H8QB 4JWYA 4GD5A 2UVGA 1O63A 2H4IA 1MQIA 2DDKA 3K2DA 3KJ7A 4GWZA 1PEBA 2P3NA 5I58B 3FD3A 3PPOA 2G93A 5I59B 2Y7KA 1USYH 1QKBA 1LBBA 3LSLA 4BDQA 3MZBA 2I58A 4KYSA 1I6BA 2X7QA 4H65A 2YJPA 3R7XA 2IA4A 5J16A 3DP8A 5I2KB 4MMPA 1B4ZA 3OSQA 2DWHA 1K9ZA 2OJTA 1FBFA 1FTJA 4MX6A 2A5TB 1R9LA 4ISUA 4OWDA 3THIA 1FPGA 1B58A 3VV5A 4PFUA 3W9WA 1DMBA 4PAFA 1IXCA 1MDP1 2XXUA 2F8DA 5FHOA 4N13A 1N0TA 2HHMA 5TU0A 4F1UA 1FQDA 4KI0E 1JW1A 4YAHX 4H6DA 4BDRA 2OX3A 3M3FA 3B6TA 4FEBA 4MCOA 1N7XA 4HE0A 1QVSA 4YMBA 4UABA 1CNQA 4JVIA 3LUYA 1O64A 4ZZAA 1LAGE 4YKKA 3C31A 4N07A 5EQ9A 5A5XB 4GL0A 1KZ8A 4ZEFA 1MXZA 5CM6A 4F1VA 4QSCA 4R2FA 3TQLA 1MPDA 3O6HA 2M8CA 2Y5LA 5BWJA 1USYE 4FE8A 3WAFA 1A8FA 3H7MA 4KCDA 5IZ1A 2HAVA 4P9KA 4N6DA 4PBQA 4GOTA 4R6YA 4JSOA 3T9UA 3DP6A 1NNFA 4PC9A 3CIJA 2RKMA 4H45A 1IZ1A 4O7IA 3PUYE 2RC9A 3WAEA 2X7PA 4YKPA 3KJTA 3MPKA 1LBYA 5ELVA 1FPKA 4QFNA 3PUWE 4GRKA 1MPBA 3TQWA 1NKXA 4Q5TA 1OVBA 3OMBA 3GXAA 3G3FA 1B2HA 1UTHB 4Q8RA 1QGXA 3EF7A 4NWDA 3DP4A 3CR9A 5EHMA 4HE1A 1FTMA 1ZJLA 2O6AA 3MWBA 4NQ8A 3C35A 2PFYA 4LONB 1EZPA 4U2RA 3U93A 2L5VA 3USDA 1B7HA 1IMCA 2ZNSA 4O3AA 1FBDA 4FATA 4N17A 4FORA 4GXSB 3SEXA 1FPIA 4N15A 2WKYA 4WEPA 4NMYA 4YKIA 2P1SA 3B7DA 4XTCQ 1I6QA 2RCAA 5JK4A 4YICA 1NFTA 1M5FA 4N8GA 3T96B 1DOTA 1H45A 1ZU0A 2QS1A 3SDFA 3IB2A 5CRYA 3G3KA 4X1DA 3EKIA 2Y7PA 1NV0A 3PPPA 1SI0A 2HCAA 2THIA 3G3IA 1LFIA 1JW4A 4DXBA 5BUUA 2WYPA 4EQ9A 2I3VA 4RK2A 5I56A 1AMFA 3O6GA 2GQ1A 4PFIA 2GHBA 3RUMA 4PFWA 2OBGA 2OWSA 4O3BA 4QXDA 1B7ZA 5DEXB 4XKRA 5KCJB 2HZLA 3C4MA 3U8QA 1HSLA 3BBRA 1FBPA 4PGPA 2PT1A 5F24A 1SVXB 2F7CA 5I2KA 2HXWA 1LBVA 1BK4A 2X26A 1O7TA 5IM2A 4NF6A 4LUBA 3C36A 4PFYA 1ZIUA 5EQ7A 1LB8A 1B3EA 3CFLA 1WODA 4PE3A 4GL8A 3S2VA 4HTGA 4ZE9A 1N76A 3RN8A 2RINA 1Y3NA 3OD7A 1H43A 5EYFA 1NUWA 4OESA 5FTHA 2ZNUA 1D3KA 4F1YA 4LN5A 1POTA 3RTFB 2G29A 1YZ0A 2GHAA 2PBWA 1URGA 3CFZA 1Q9DA 1ATGA 4MHFA 5AA4A 1S7YA 2WBDA 3OELA 4DCXA 1N3XA 2HQ0A 4MEVA 2VP1A 4LZ8A 2Q9TA 4ZDMA 2F5XA 1SPIA 1XVXA 1TWYA 1B6HA 1RDYA 2DYXA 4DDDA 4R74A 1B9JA 3FV2A 2F36A 1LAFE 2Q2CA 3K02A 1G0HA 1MXUA 4IGTA 3HV1A 4ZS9A 1D4NA 3H06B 2F3BA 3E3KA 3FJ7A 3B8BA 1NI9A 1BIYA 1H44A 1M5BA 1B3LA 1LAXA 4I3YA 5LTCA 3QK6A 4H0WA 3TTRA 4DIGA 4H8JA 1B3HA 3ZSFA 1OIBA 2Q88A 2DP8A 3ZS6A 3HN0A 4N6PA 3ROJA 2REGA 5M2VA 1CE2A 3U92A 1N3WA 4RPOA 4IR8A 5FTIA 1Z7ME 3GBBA 4G8HA 4GWYA 4BLAA 1NV3A 5CMKA 2VPOA 1IXHA 3VVDA 1ELJA 2ANJA 3TCHA 4IO2A 4R6HA 2O84X 4JBZA 3QUFA 3ILTB 4JWOA 3M3LA 4MNCA 2DQVA 3S9EA 3HPIA 1R6ZA 4NX1A 1B51A 5DW8A 2QVRA 3IX1A 3GYYA 3S9MC 1SYIA 4XKQA 2XWKA 5EYHA 1IIWA 3QSLA 3LBSA 1MS7A 1PB8A 2XX7A 3KC0A 3OEMA 1FPJA 3TEPA 3CHGA 4R9FA 4MBPA 4NTLA 2XD3A 2FNCA 3S9LC 4R75A 1Y1MA 1ZTYA 4TLLB 3IO4A 1B32A 5CBRA 1A55A 1B0HA 2ABHA 2P0SA 1FPFA 2Y7IA 3PUXE 4EDPA 1QJMA 5B7DA 5JTYA 3FXRA 4FJPA 4PGNA 3TELA 1JNFA 4IO5A 3O97A 2O1MA 3O2AA 2UYEA 1Y1ZA 5H8HA 3MP1A 5HPQA 2OCUA 4ZE8A 2Z8FA 2H98A 1I6AA 2F97A 3TYHA 3MVXA 3S4UA 4H46A 4U1OA 4PF8A 3VLUA 1IMEA 4O7MA 1FBHA 2QL3A 1B1XA 3PV0E 4ZECA 3I3VA 2XWVA 1RYXA 4NHBA 3KSJA 4C1TA 2O7IA 5IZ3A 2DXRA 1P1WA 3CI8A 1Y4TA 4DI4B 1YAEA 4IO4A 3CSGA 2ZMBA 3OO7A 1FTKA 4YB7A 5I57B 2QS3A 2UVHA 4R6KA 4ELPA 1A40A 1FRPA 5AA4B 4MFIA 4GVOA 4JDFA 4MH5A 3CVGA 2Z8EA 1RDZA 2DSFA 3EHUA 3E13X 2UVJA 3LSFB 2V4CA 3OXNA 1B52A 2FA7A 2E1SA 4ECFA 4AB5A 2FVZA 1FQFA 2CMOA 3FXBA 4GWOA 1FBEA 5KZTA 4NF5A 5ET7A 1XVYA 1LBWA 1MY0A 1RKMA 3W15C 5DVFA 4OANA 3IO6A 4F3PA 1XI6A 1IXIA 1B05A 2FIEA 4GWUA 4O3CA 4PFRA 3PPQA 3SERA 2VT5A 3LC8A 4PP0A 1PDAA 3MYUA 2PCRA 1RYOA 4UA8A 2QS4A 2ESNA 3RPLA 3IJXB 3U1OA 4KYDA 2PYYA 1EU8A 4F18A 4JB7A 3K4UA 4JWXA 1KA1A 3SEUA 3PD9A 2UYFA 4EXLA 3PGFA 3H6TA 4PCDA 3O28A 1FQEA 1FTLA 4GF8A 4NWCA 1AL3A 1QUKA 4OVTA 2PFZA 5T3JA 3PUVE 3TCGA 3FGSA 1GV8A 3KN8A 1IMAA 1NNPA 3O9PA 3C34A 4G8NA 4MAGA 3NOHA 1DTZA 4FECA 1JQFA 3HSTA 5FBPA 1SI1A 4AQ4A 2V3QA 3CG3A 3I5OA 3K01A 4ND9A 1XT8A 1B5JA 1TFAA 4NEDA 3KC1A 1OQHA 5L9SA 3IOWA 3SEWA 2VPNA 2KR0A 4NN3A 2DOJA 1AOVA 1GTKA 2MKZA 4R72A 1EYJA 3Q27A 3SKPA 5ET5A 5DEXA 1NNKA 2XD2A 3MZ9A 2R8TA 1FPDA 2DE3A 5CMMA 4ONYA 5H8HB 4U23A 3JYRA 4FBPA 3T0JA 1YXIA 3LSXA 5EQ8A 3KBRA 2DWIA 5ESYA 3MAMA 4LP2B 5TP9B 2ZXTA 3H4ZA 3N26A 4IB2A 3GBAA 1GR2A 5CBSA 1FPBA 4KXPA 4LZ7A 4ELQA 2XX9A 2QMWA 4OMBA 1BP5A 4OA4A 4E0XA 2HAUA 5IZ3B 3GZGA 2CZHA 1J1NA 4DXUA 1LEVA 3KGCA 2NUVA 5I57A 3VVFA 4UACA 3H6VA 2I0CA 3OEKA 3L6HA 5A5LA 4OVRA 5H8QA 1N04A 1SQYA 4ZEDA 3LSWA 4PAIA 4N8YA 4P3LA 1B3GA 5IZZA 3K6WA 2XXPA 2XXVA 2V3UA 2IEEA 1DPPA 3MUQA 4G4PA 3N5LA 4Q30B 4QF9A 5CMBA 2I49A 5F7VA 2RF1A 3TODA 3FXQA 2OZZA 1MQDA 1AIVA 1IQ7A 1OMPA 4NGUA 4KD5A 3QMFA 4RXLA 3QAXA 5H8FB 3M8UA 5EYGA 4F19A 3DLNA 1P99A 1PBQA 4JVDA 3PPRA 2VGQA 2XWIA 5KDTB 3A3CA 1MM6A 1NH7A 2WBBA 3CSBA 3JV9A 3EHTA 2ZYMA 4O8MA 4FIMA 2VD3A 1IMFA 5J1DA 1EH3A 5DT6A 4OVSA 1N7WA 4O94A 3IB1A 4OZ9A 1BTJA 3RPLB 4IY6A 3KBZA 2F78A 2RCBA 4RA1A 4F3BA 3O6IA 2XXWA 2F34A 4LATA 2B4MA 1VR5A 2DE4A 4R73A 2ZZXA 1NMUA 4QSDA 1YTVA 2Z22A 3QIMA 1FTOA 2D5WA 3H03A 4NF4B 1LBCA 3B6QA 4GXAA 3VE1B 4XFEA 2FBPA 3F11A 4C1UA 2GH9A 1ANFA 1P1OA 4MIJA 1M5CA
chains in the Genus database with same CATH topology
4BDOA 4GD5A 3CG1A 3R26A 1QUIA 1Y1MA 4R75A 4F31B 4YZZA 3UK4A 1ZTYA 4U21A 2YLNA 4LQ5A 3FZVA 2CZLA 2UVGA 4TQUQ 3TTLA 4TLLB 3RY3A 1O63A 2H4IA 2B3FA 3IO4A 1B32A 1MQIA 5CBRA 1A55A 3CRBA 3HO7A 3O66A 4NF5B 4LVQA 1SBPA 1B0HA 3G3GA 3K2DA 2ABHA 2P0SA 3EQ1A 2I3WA 4F2OA 2Y7IA 3KJ7A 4BDRA 4FAJA 3FASA 3PUXE 1PEBA 1Q35A 4EDPA 3MVWA 5I58B 4XIGQ 1QJMA 3FD3A 3KZGA 5B7DA 4KQPA 1GGGA 5H8FA 1NH8A 2PVUA 2RC8A 3QXMA 1MY4A 3FXRA 4FJPA 5H8QB 4EF1A 3TELA 1JNFA 3PPOA 2G93A 4M4GA 3OO9A 4IO5A 1H76A 1WDNA 1USYH 2BJJX 2O1MA 1QKBA 2PX1A 2Y7KA 3O2AA 3O97A 4WXJA 1LBBA 3TZAA 5B70A 3N94A 4KCCA 2XHDA 2ONSA 2UYEA 3FJMA 4OEUA 2DE2A 3LSLA 3SETA 1Y1ZA 1FQCA 1D9YA 4OHNA 2NVUB 4I62A 5H8HA 3K1MA 4YB6A 4RK9A 1LGBC 3OO8A 3MP1A 1JVYA 2A5SA 3MZBA 2F7AA 2I58A 3TTMA 4DE8A 4F39A 5HPQA 5J1DA 2OCUA 3K6XA 2I48A 4KYSA 4G77A 1I6BA 1TXFA 3BFTA 5I2NB 1GVCA 3MVZA 2X7QA 4H65A 2YJPA 3R7XA 5JTYA 2IA4A 4ZE8A 5I2NA 3FIRA 2Z8FA 1OLAA 3DP8A 1MY2A 5I2KB 2OLBA 2H98A 1M5EA 1B4ZA 1I6AA 2F97A 2P2AA 3TYHA 3OSQA 3VVEA 2XXXA 4PETA 3IAZA 3MVXA 2DWHA 3S4UA 2OJTA 5ITPA 1FTJA 3GLBA 1MQGA 1UTHA 4JXIA 1AH5A 1Y9UA 1US4A 4U1OA 2A5TB 1R9LA 1EZ9A 3VLUA 4OENA 2DXYA 4ISUA 3ILUB 3FVKA 4OWDA 3THIA 1LFGA 4EQBA 1B58A 2A5TA 2QL3A 4PFUA 3VV5A 1DMBA 3H6UA 3W9WA 1IXCA 1MDP1 2XXUA 1B1XA 2F8DA 1IITA 2QJEA 3PV0E 5DYHA 5FHOA 4N13A 3VXBA 4ZECA 3H6WA 1N0TA 3MJNA 3RPWA 4XKPA 1XC1A 5L8DA 5TU0A 3OENA 1XOCA 2Z8DA 4YKJA 4F1UA 3I3VA 4DZ1A 1PB9A 3SDFA 1POY1 1XHYA 4RYAA 1FQDA 5ITOA 2D21A 1RYXA 3KSJA 4KI0E 4C1TA 2Q2AA 3VXCA 2O7IA 1UTBB 1JW1A 5ICTA 4ZEKA 4YAHX 2DXRA 1HSJA 1P1WA 3CI8A 2Y7WA 1Y4TA 4H6DA 1YAEA 4G68C 3CSGA 2ZMBA 3M3FA 2Y7RA 3OO7A 4H5GA 4IO4A 1R1NA 3B6TA 4Z0IA 5AA2D 1FTKA 4FEBA 4YB7A 1F9BA 1N7XA 5I57B 2XXRA 2QS3A 1QVSA 2UVHA 4R6KA 4BDNA 4YMBA 4ELPA 1A40A 1ZBMA 5AA4B 2QPQA 3LUYA 4MFIA 1O64A 4H8IA 4OFOA 3BKIB 4GVOA 3RT6B 4ZZAA 1LAGE 3KN3A 4JDFA 5L9MA 1LFHA 3C33A 3E9XA 4H67A 3CVGA 3PU5A 4MH5A 2I4BA 1OLCA 4NF8B 2Z8EA 4YKKA 2DSFA 3C31A 4GLIA 4N07A 4BDLA 3EHUA 3E13X 5A5XB 2KLFA 2UVJA 3LSFB 4NF8A 4GL0A 4HCYA 1MG1A 3UORA 3DM0A 3OXNA 5AA3A 4ZEFA 1MXZA 1B52A 5CM6A 2FA7A 2W7YA 2ONRA 4HCWA 4F1VA 4QSCA 3OO6A 4R2FA 5ICQA 3TQLA 1MPDA 1B1HA 1LCTA 4KYEA 4ESXA 4F3GA 3O6HA 2E1SA 1FQBA 2M8CA 3P7IA 4AB5A 4ECFA 5BWJA 1USYE 5DTBA 1FQFA 1JVXA 2CMOA 4FE8A 2XXQA 1A8FA 3WAFA 5AA2B 4OERA 3K00A 3KOTA 3H7MA 4GWOA 3IOVA 4GQOA 2HAVA 4KCDA 4POXA 4NF5A 4R9GA 5KZTA 3A09A 2F7BA 3ONMA 2OK2A 1XVYA 4GOTA 4R6YA 4JSOA 3T9UA 1MY0A 4ELRA 1RKMA 4TOZA 1AIVA 3C9HA 3DP6A 3W15C 1NNFA 5DVFA 3ZKLA 3MZ1A 3IO6A 4BDQA 3AXFA 3B6WA 4F3PA 3CIJA 4EXKA 2I4CA 2RKMA 4F2QA 1IZ1A 1PC3A 1B3FA 1IXIA 3PUYE 2RC9A 2ZYKA 1MXWA 1BKAA 2O7UA 4HS7A 1S50A 1B05A 3CFXA 3WAEA 2PT2A 5IKBA 1B46A 2X7PA 1VFEA 1Y3PA 1VE4A 3FV1A 3RGYA 3VLVA 2XXTA 3SEVA 5LOMA 4YKPA 4O3CA 3KJTA 1URDA 3MPKA 3PPQA 4TLMB 2YPNA 3MVYA 5ELVA 3SERA 3LC8A 2Q8JA 4PP0A 1PDAA 2FYIA 1UIUA 3M3KA 4F29A 1RYOA 4QFNA 3FVGA 4JSDA 3PUWE 4GRKA 4UA8A 2QS4A 2ESNA 3IJXB 1MPBA 3TQWA 3U1OA 3FXUA 1NKXA 4FEDA 4NF6B 2F6GA 4KYDA 4Q5TA 1OVBA 3FVNA 2PYYA 3OMBA 3GXAA 3EPEA 1EU8A 3G3FA 5CI5A 1MXVA 1B2HA 1UTHB 4F18A 4JB7A 1LAHE 4Q8RA 3K4UA 4JWXA 5TP9A 3FVOA 3RNNA 4M1VA 3SEUA 3TUSA 1T0KA 5F1QA 3PD9A 4WEDA 2UYFA 3EF7A 3DP4A 4NWDA 4EXLA 2B3BA 5EHSA 3CR9A 4G2ZA 3PGFA 5EHMA 3H6TA 2DWJA 3O28A 2QSXA 1FTMA 1ZJLA 2O6AA 3MWBA 5JEIA 1NL5A 1JW5A 2Q89A 4GIZA 3C35A 3ECRA 1FQEA 1Y20A 1FTLA 4GF8A 4LONB 4NWCA 1AL3A 3TTNA 1EZPA 4U2RA 5DVJA 3U93A 1QUKA 3N6UA 2HFBA 3USDA 1B7HA 3K1NA 2ZNSA 4O3AA 3V83A 2R71A 3FUZA 3PUVE 3SEYA 4FATA 1ZLQA 4WKMA 4FORA 4NF4A 4GXSB 3TCGA 4QFKA 3S9NC 3SEXA 4U4XA 1B40A 4PQJA 2V84A 3FGSA 2AIXA 4WEPA 2WKYA 3KN8A 4QFPA 4NMYA 4YKIA 2P1SA 1GV8A 3B7DA 4XTCQ 1I6QA 2RCAA 4DLDA 3D4CA 1BLFA 5JK4A 4YICA 1NFTA 1IUDA 1NNPA 3FATA 1M5FA 2D3IA 3C34A 3O9PA 4G8NA 4YB5A 2XX8A 3T96B 3V8XB 1MH3A 1DTZA 5KCJB 3G3JA 4FECA 1JQFA 4LZ5A 3HSTA 1DOTA 2R6GE 1H45A 1ZU0A 2QS1A 1Z7NE 2XXIA 4MLVA 1SI1A 4QFLA 5FHMA 2V3QA 3IB2A 1LLSA 3G3KA 3CG3A 5CRYA 4AQ4A 4E0WA 4ZZEA 5A5XA 3V89B 3I5OA 3K01A 1MQHA 4X1DA 4XXUA 2Y7PA 1B5IA 2I0BA 4ND9A 3PPPA 1SI0A 2HCAA 2THIA 4IGRA 4OFLA 3G3IA 4ZEBA 5AA1A 3Q28A 1XT8A 3RQTA 1LFIA 1JW4A 1SYHA 4P11A 4DXBA 1SW4A 1B5JA 1TFAA 5BUUA 2DS9A 2REJA 4NEDA 4EQ9A 5L9OA 2I3VA 5HBCA 5I58A 3PPNA 1OQHA 3T22A 4BDMA 4RK2A 4X48A 5L9SA 3IOWA 5I56A 5H8NB 1AMFA 1IEJA 3IOTA 1CB6A 3SEWA 3IOUA 3O6GA 4X9TA 5I59A 2GHBA 3RUMA 3KSXA 4JWYA 2GFEA 2QS2A 4PFWA 5H8NA 3UIFA 3K0VA 2DOJA 4GFRA 1AOVA 1GTKA 4I9DA 2OBGA 1JETA 4OFJA 3Q27A 4R72A 3ZKKA 3SKPA 2OWSA 1Y4CA 1QULA 2O51A 4O3BA 1FCKA 5DEXA 1NNKA 3G3HA 3PMXA 2XD2A 3JZJA 1B7ZA 3MZ9A 3UGWA 1QW0A 5DEXB 3O29A 4XKRA 2DE3A 2HZLA 3C4MA 1P1QA 5CMMA 4DXCA 1LSTA 3U8QA 5I84A 3K6UA 4ONYA 2E0SA 5H8HB 4F22A 3PMVA 4U23A 5H8SA 3JYRA 1HSLA 5KCJA 4U22A 1SW2A 4C0RA 3BBRA 4R2BA 1L5TA 3TKDA 2XXYA 1I69A 5K2YA 2OWTA 2PT1A 3T93B 5I59B 1SVXB 3VDFA 2F7CA 5I2KA 2HXWA 3LSXA 3K6VA 2V3TA 2B65A 3OOAA 1XS5A 3RLFE 4H1XA 2QRYA 4MLQA 2Z23A 3W9VA 1MY3A 2O1LA 2X26A 3QYTA 1O7TA 4NF6A 4LUBA 3C36A 4PFYA 3E4RA 3KBRA 4ESWA 2DWIA 4NE4A 1ZIUA 4EF2A 3MAMA 4LP2B 1LB8A 2NOOA 1HSEA 2QMXA 1B3EA 3CFLA 4G68A 5TP9B 2ZXTA 3C32A 3H4ZA 2H5YA 1WODA 2ONKE 3N26A 4IB2A 1QUJA 4GL8A 4P0IA 4HTGA 5DVIA 4RNSA 3S2VA 4ZE9A 5ISUA 1N76A 3GBAA 1B0LA 5TPAB 4IY5A 3RN8A 1YPNA 1UTBA 2RINA 1Y3NA 1GR2A 2VOZA 3OD7A 5CBSA 1H43A 1IXGA 4LZ7A 5EYFA 5TPAA 4OESA 4ELQA 3RT8A 3IJOB 5FTHA 2XX9A 2ZNUA 3HCQA 4YU0A 2QMWA 1D3KA 1DSNA 1MRPA 1NNTA 1BP5A 4OMBA 4F1YA 4E0XA 4I8CA 1M5DA 2HAUA 4KHZE 1VFDA 1POTA 2G29A 3RTFB 3L6GA 2GHAA 2PBWA 3DELB 3MP8A 1URGA 3CFZA 4OXVA 1ATGA 1MXXA 1OQGA 2PMSA 3GZGA 1J1NA 1KWHA 3IB0A 2LAOA 3PUZE 4MF3A 4QRZA 4OYVA 5AA4A 3MC2A 4DXUA 4G8MA 4Z7EA 1P1UA 2ALUA 4POWA 4QSEA 1II5A 1MM7A 3KGCA 3KOSA 2NUVA 4U1ZA 5I57A 2VHAA 3VVFA 1S7YA 4UACA 3OELA 3Q29A 3H6VA 1R9QA 4OEVA 5HM4B 3TTKA 3VFJA 2I0CA 4DCXA 3OEKA 4YMAA 3IK6B 3MP6A 1N3XA 1FW0A 3IR1A 2HQ0A 3L6HA 4KFQA 1US5A 2NXOA 5H8QA 2I6EA 1A99A 2VP1A 1N04A 4QHQA 4RPNA 4XKNA 4LZ8A 2Q9TA 5AE4A 1MDQA 4RJZA 4K3FA 1SQYA 4ZDMA 3TAJA 3LSWA 3V5AA 4ZEDA 2F5XA 1TFDA 4LA9A 1B3GA 3MBPA 4PFTA 1MY1A 1XVXA 4EUOA 2Y84A 1TWYA 1B6HA 3K6WA 1B7UA 3MW0A 2XXPA 2XXVA 2DYXA 2V3UA 5K2XA 4PE5B 5CC2A 2IEEA 4DDDA 1DPEA 1DPPA 1LB9A 1A8EA 2V25A 2ZYOA 3MUQA 4R74A 4G4PA 3N5LA 1B9JA 3FV2A 4Q30B 2F36A 4QF9A 1LAFE 5CMBA 2I49A 3IL1B 2Q2CA 1UQWA 5F7VA 2RF1A 3TODA 3K02A 3FXQA 2OZZA 1B5HA 1MQDA 1MXUA 1D9VA 4IGTA 3EHSA 5JTYB 1IQ7A 1OMPA 2VD2A 3HV1A 4ZS9A 1D4NA 2F6PA 1FQAA 3H06B 3IORA 4KD5A 4DCYA 1UIVA 4RXLA 3PMWA 3KEIA 1A7LA 2UXAA 2F35A 3E3KA 5I56B 1OVTA 3FJ7A 3QAXA 1S9TA 3TPAA 3HHGA 2DVZA 5H8FB 1BIYA 3T9VA 1EZOA 1H44A 3UA8A 1M5BA 5CMCA 1VSOA 3M8UA 3MPLA 3U94A 5KDTA 4F19A 3ODBA 1B3LA 1LAXA 3DLNA 3FJGA 1P99A 3QK6A 4H0WA 3TTRA 3TDJA 4DIGA 4H8JA 3TCFA 1PBQA 3K1PA 4ELOA 1B3HA 3PPRA 2VGQA 4HW8A 5KDTB 3T9HB 4X1BA 3HHFA 2XXHA 1MM6A 1NH7A 1TT1A 3A3CA 3ZSFA 1OIBA 2DVCA 2Q88A 2ZYNA 2DP8A 3KG2A 4IO6A 2O68A 3CSBA 3ZS6A 3JV9A 3HN0A 4N6PA 2H99A 2REGA 5M2VA 3EHTA 2ZYMA 2H9BA 1Y3QA 5AA2A 1CE2A 1SD3A 3U92A 1N3WA 4FIMA 4RPOA 2H25A 3N6TA 5FTIA 2VD3A 1Z7ME 1PB7A 1N84A 1A54A 1ZKBA 2GRVA 1EH3A 2HEUA 2V93A 3GBBA 4G8HA 5DT6A 4BLAA 1MH4A 1N7WA 1YCJA 2AL5A 4Q0CA 3IB1A 4OZ9A 5CMKA 1BTJA 1IXHA 4IY6A 3VVDA 1ELJA 2F78A 3BFUA 4G68B 3RTWB 2ANJA 2RCBA 3LR1A 3H3GA 3PD8A 3Q26A 3O6IA 4RA1A 3TCHA 2XXWA 3MQ9A 4L17A 2F34A 4F3BA 4LATA 4QFOA 4ZEIA 4KR5A 4AB6A 3I6VA 1DTGA 4IO2A 4R6HA 2O84X 2R9JA 4JBZA 4IO3A 3QUFA 2UVIA 3ILTB 1VR5A 1PBPA 2DE4A 4R73A 1Q1KA 2NWJA 1SDXA 2AL4A 4JWOA 4THIA 5FHNA 3M3LA 3R6UA 1MQJA 2DQVA 4IO7A 4OQOA 3TFLA 3S9EA 1NMUA 3HPIA 1R6ZA 3UN6A 1MPCA 4QSDA 3UP9A 1YTVA 1B51A 3T9XB 2Z22A 1LCFA 1WVJA 3D4GA 3IX1A 3QIMA 3S9MC 1FTOA 2D5WA 2HZKA 3KFMA 4OVJA 1SYIA 3H03A 1P1NA 4NF4B 4U4SA 4XKQA 1QKAA 1SW5A 1IIWA 1B4HA 3Q25A 3QSLA 4P0GA 4EQ7A 5IAIA 4LQ2A 1SW1A 4H5FA 3LBSA 1LBCA 1MS7A 4OETA 3TMGA 3B6QA 1PB8A 1JEVA 4GXAA 3SESA 3T66A 4F3SA 3EN3A 3A3UA 2XX7A 4I1DA 3VLWA 2O69A 3OEMA 1MXYA 1ZMGA 3OSRA 1H3DA 4OTEA 2RC7A 1URSA 3U72A 4KPTA 3VE1B 3TEPA 3QUJA 3F11A 4C1UA 4RY1A 2GH9A 1ANFA 3G7WA 2ZNTA 4R9FA 1P1OA 4MBPA 1JEUA 4NTLA 2XD3A 2DWAA 3KN7A 2AYSA 2FNCA 1M5CA 3S9LC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BDO A;  4GD5 A;  3CG1 A;  3R26 A;  1QUI A;  1Y1M A;  4R75 A;  4F31 B;  4YZZ A;  3UK4 A;  1ZTY A;  4U21 A;  2YLN A;  4LQ5 A;  3FZV A;  2CZL A;  2UVG A;  4TQU Q;  3TTL A;  4TLL B;  3RY3 A;  1O63 A;  2H4I A;  2B3F A;  3IO4 A;  1B32 A;  1MQI A;  5CBR A;  1A55 A;  3CRB A;  3HO7 A;  3O66 A;  4NF5 B;  4LVQ A;  1SBP A;  1B0H A;  3G3G A;  3K2D A;  2ABH A;  2P0S A;  3EQ1 A;  2I3W A;  4F2O A;  2Y7I A;  3KJ7 A;  4BDR A;  4FAJ A;  3FAS A;  3PUX E;  1PEB A;  1Q35 A;  4EDP A;  3MVW A;  5I58 B;  4XIG Q;  1QJM A;  3FD3 A;  3KZG A;  5B7D A;  4KQP A;  1GGG A;  5H8F A;  1NH8 A;  2PVU A;  2RC8 A;  3QXM A;  1MY4 A;  3FXR A;  4FJP A;  5H8Q B;  4EF1 A;  3TEL A;  1JNF A;  3PPO A;  2G93 A;  4M4G A;  3OO9 A;  4IO5 A;  1H76 A;  1WDN A;  1USY H;  2BJJ X;  2O1M A;  1QKB A;  2PX1 A;  2Y7K A;  3O2A A;  3O97 A;  4WXJ A;  1LBB A;  3TZA A;  5B70 A;  3N94 A;  4KCC A;  2XHD A;  2ONS A;  2UYE A;  3FJM A;  4OEU A;  2DE2 A;  3LSL A;  3SET A;  1Y1Z A;  1FQC A;  1D9Y A;  4OHN A;  2NVU B;  4I62 A;  5H8H A;  3K1M A;  4YB6 A;  4RK9 A;  1LGB C;  3OO8 A;  3MP1 A;  1JVY A;  2A5S A;  3MZB A;  2F7A A;  2I58 A;  3TTM A;  4DE8 A;  4F39 A;  5HPQ A;  5J1D A;  2OCU A;  3K6X A;  2I48 A;  4KYS A;  4G77 A;  1I6B A;  1TXF A;  3BFT A;  5I2N B;  1GVC A;  3MVZ A;  2X7Q A;  4H65 A;  2YJP A;  3R7X A;  5JTY A;  2IA4 A;  4ZE8 A;  5I2N A;  3FIR A;  2Z8F A;  1OLA A;  3DP8 A;  1MY2 A;  5I2K B;  2OLB A;  2H98 A;  1M5E A;  1B4Z A;  1I6A A;  2F97 A;  2P2A A;  3TYH A;  3OSQ A;  3VVE A;  2XXX A;  4PET A;  3IAZ A;  3MVX A;  2DWH A;  3S4U A;  2OJT A;  5ITP A;  1FTJ A;  3GLB A;  1MQG A;  1UTH A;  4JXI A;  1AH5 A;  1Y9U A;  1US4 A;  4U1O A;  2A5T B;  1R9L A;  1EZ9 A;  3VLU A;  4OEN A;  2DXY A;  4ISU A;  3ILU B;  3FVK A;  4OWD A;  3THI A;  1LFG A;  4EQB A;  1B58 A;  2A5T A;  2QL3 A;  4PFU A;  3VV5 A;  1DMB A;  3H6U A;  3W9W A;  1IXC A;  1MDP 1;  2XXU A;  1B1X A;  2F8D A;  1IIT A;  2QJE A;  3PV0 E;  5DYH A;  5FHO A;  4N13 A;  3VXB A;  4ZEC A;  3H6W A;  1N0T A;  3MJN A;  3RPW A;  4XKP A;  1XC1 A;  5L8D A;  5TU0 A;  3OEN A;  1XOC A;  2Z8D A;  4YKJ A;  4F1U A;  3I3V A;  4DZ1 A;  1PB9 A;  3SDF A;  1POY 1;  1XHY A;  4RYA A;  1FQD A;  5ITO A;  2D21 A;  1RYX A;  3KSJ A;  4KI0 E;  4C1T A;  2Q2A A;  3VXC A;  2O7I A;  1UTB B;  1JW1 A;  5ICT A;  4ZEK A;  4YAH X;  2DXR A;  1HSJ A;  1P1W A;  3CI8 A;  2Y7W A;  1Y4T A;  4H6D A;  1YAE A;  4G68 C;  3CSG A;  2ZMB A;  3M3F A;  2Y7R A;  3OO7 A;  4H5G A;  4IO4 A;  1R1N A;  3B6T A;  4Z0I A;  5AA2 D;  1FTK A;  4FEB A;  4YB7 A;  1F9B A;  1N7X A;  5I57 B;  2XXR A;  2QS3 A;  1QVS A;  2UVH A;  4R6K A;  4BDN A;  4YMB A;  4ELP A;  1A40 A;  1ZBM A;  5AA4 B;  2QPQ A;  3LUY A;  4MFI A;  1O64 A;  4H8I A;  4OFO A;  3BKI B;  4GVO A;  3RT6 B;  4ZZA A;  1LAG E;  3KN3 A;  4JDF A;  5L9M A;  1LFH A;  3C33 A;  3E9X A;  4H67 A;  3CVG A;  3PU5 A;  4MH5 A;  2I4B A;  1OLC A;  4NF8 B;  2Z8E A;  4YKK A;  2DSF A;  3C31 A;  4GLI A;  4N07 A;  4BDL A;  3EHU A;  3E13 X;  5A5X B;  2KLF A;  2UVJ A;  3LSF B;  4NF8 A;  4GL0 A;  4HCY A;  1MG1 A;  3UOR A;  3DM0 A;  3OXN A;  5AA3 A;  4ZEF A;  1MXZ A;  1B52 A;  5CM6 A;  2FA7 A;  2W7Y A;  2ONR A;  4HCW A;  4F1V A;  4QSC A;  3OO6 A;  4R2F A;  5ICQ A;  3TQL A;  1MPD A;  1B1H A;  1LCT A;  4KYE A;  4ESX A;  4F3G A;  3O6H A;  2E1S A;  1FQB A;  2M8C A;  3P7I A;  4AB5 A;  4ECF A;  5BWJ A;  1USY E;  5DTB A;  1FQF A;  1JVX A;  2CMO A;  4FE8 A;  2XXQ A;  1A8F A;  3WAF A;  5AA2 B;  4OER A;  3K00 A;  3KOT A;  3H7M A;  4GWO A;  3IOV A;  4GQO A;  2HAV A;  4KCD A;  4POX A;  4NF5 A;  4R9G A;  5KZT A;  3A09 A;  2F7B A;  3ONM A;  2OK2 A;  1XVY A;  4GOT A;  4R6Y A;  4JSO A;  3T9U A;  1MY0 A;  4ELR A;  1RKM A;  4TOZ A;  1AIV A;  3C9H A;  3DP6 A;  3W15 C;  1NNF A;  5DVF A;  3ZKL A;  3MZ1 A;  3IO6 A;  4BDQ A;  3AXF A;  3B6W A;  4F3P A;  3CIJ A;  4EXK A;  2I4C A;  2RKM A;  4F2Q A;  1IZ1 A;  1PC3 A;  1B3F A;  1IXI A;  3PUY E;  2RC9 A;  2ZYK A;  1MXW A;  1BKA A;  2O7U A;  4HS7 A;  1S50 A;  1B05 A;  3CFX A;  3WAE A;  2PT2 A;  5IKB A;  1B46 A;  2X7P A;  1VFE A;  1Y3P A;  1VE4 A;  3FV1 A;  3RGY A;  3VLV A;  2XXT A;  3SEV A;  5LOM A;  4YKP A;  4O3C A;  3KJT A;  1URD A;  3MPK A;  3PPQ A;  4TLM B;  2YPN A;  3MVY A;  5ELV A;  3SER A;  3LC8 A;  2Q8J A;  4PP0 A;  1PDA A;  2FYI A;  1UIU A;  3M3K A;  4F29 A;  1RYO A;  4QFN A;  3FVG A;  4JSD A;  3PUW E;  4GRK A;  4UA8 A;  2QS4 A;  2ESN A;  3IJX B;  1MPB A;  3TQW A;  3U1O A;  3FXU A;  1NKX A;  4FED A;  4NF6 B;  2F6G A;  4KYD A;  4Q5T A;  1OVB A;  3FVN A;  2PYY A;  3OMB A;  3GXA A;  3EPE A;  1EU8 A;  3G3F A;  5CI5 A;  1MXV A;  1B2H A;  1UTH B;  4F18 A;  4JB7 A;  1LAH E;  4Q8R A;  3K4U A;  4JWX A;  5TP9 A;  3FVO A;  3RNN A;  4M1V A;  3SEU A;  3TUS A;  1T0K A;  5F1Q A;  3PD9 A;  4WED A;  2UYF A;  3EF7 A;  3DP4 A;  4NWD A;  4EXL A;  2B3B A;  5EHS A;  3CR9 A;  4G2Z A;  3PGF A;  5EHM A;  3H6T A;  2DWJ A;  3O28 A;  2QSX A;  1FTM A;  1ZJL A;  2O6A A;  3MWB A;  5JEI A;  1NL5 A;  1JW5 A;  2Q89 A;  4GIZ A;  3C35 A;  3ECR A;  1FQE A;  1Y20 A;  1FTL A;  4GF8 A;  4LON B;  4NWC A;  1AL3 A;  3TTN A;  1EZP A;  4U2R A;  5DVJ A;  3U93 A;  1QUK A;  3N6U A;  2HFB A;  3USD A;  1B7H A;  3K1N A;  2ZNS A;  4O3A A;  3V83 A;  2R71 A;  3FUZ A;  3PUV E;  3SEY A;  4FAT A;  1ZLQ A;  4WKM A;  4FOR A;  4NF4 A;  4GXS B;  3TCG A;  4QFK A;  3S9N C;  3SEX A;  4U4X A;  1B40 A;  4PQJ A;  2V84 A;  3FGS A;  2AIX A;  4WEP A;  2WKY A;  3KN8 A;  4QFP A;  4NMY A;  4YKI A;  2P1S A;  1GV8 A;  3B7D A;  4XTC Q;  1I6Q A;  2RCA A;  4DLD A;  3D4C A;  1BLF A;  5JK4 A;  4YIC A;  1NFT A;  1IUD A;  1NNP A;  3FAT A;  1M5F A;  2D3I A;  3C34 A;  3O9P A;  4G8N A;  4YB5 A;  2XX8 A;  3T96 B;  3V8X B;  1MH3 A;  1DTZ A;  5KCJ B;  3G3J A;  4FEC A;  1JQF A;  4LZ5 A;  3HST A;  1DOT A;  2R6G E;  1H45 A;  1ZU0 A;  2QS1 A;  1Z7N E;  2XXI A;  4MLV A;  1SI1 A;  4QFL A;  5FHM A;  2V3Q A;  3IB2 A;  1LLS A;  3G3K A;  3CG3 A;  5CRY A;  4AQ4 A;  4E0W A;  4ZZE A;  5A5X A;  3V89 B;  3I5O A;  3K01 A;  1MQH A;  4X1D A;  4XXU A;  2Y7P A;  1B5I A;  2I0B A;  4ND9 A;  3PPP A;  1SI0 A;  2HCA A;  2THI A;  4IGR A;  4OFL A;  3G3I A;  4ZEB A;  5AA1 A;  3Q28 A;  1XT8 A;  3RQT A;  1LFI A;  1JW4 A;  1SYH A;  4P11 A;  4DXB A;  1SW4 A;  1B5J A;  1TFA A;  5BUU A;  2DS9 A;  2REJ A;  4NED A;  4EQ9 A;  5L9O A;  2I3V A;  5HBC A;  5I58 A;  3PPN A;  1OQH A;  3T22 A;  4BDM A;  4RK2 A;  4X48 A;  5L9S A;  3IOW A;  5I56 A;  5H8N B;  1AMF A;  1IEJ A;  3IOT A;  1CB6 A;  3SEW A;  3IOU A;  3O6G A;  4X9T A;  5I59 A;  2GHB A;  3RUM A;  3KSX A;  4JWY A;  2GFE A;  2QS2 A;  4PFW A;  5H8N A;  3UIF A;  3K0V A;  2DOJ A;  4GFR A;  1AOV A;  1GTK A;  4I9D A;  2OBG A;  1JET A;  4OFJ A;  3Q27 A;  4R72 A;  3ZKK A;  3SKP A;  2OWS A;  1Y4C A;  1QUL A;  2O51 A;  4O3B A;  1FCK A;  5DEX A;  1NNK A;  3G3H A;  3PMX A;  2XD2 A;  3JZJ A;  1B7Z A;  3MZ9 A;  3UGW A;  1QW0 A;  5DEX B;  3O29 A;  4XKR A;  2DE3 A;  2HZL A;  3C4M A;  1P1Q A;  5CMM A;  4DXC A;  1LST A;  3U8Q A;  5I84 A;  3K6U A;  4ONY A;  2E0S A;  5H8H B;  4F22 A;  3PMV A;  4U23 A;  5H8S A;  3JYR A;  1HSL A;  5KCJ A;  4U22 A;  1SW2 A;  4C0R A;  3BBR A;  4R2B A;  1L5T A;  3TKD A;  2XXY A;  1I69 A;  5K2Y A;  2OWT A;  2PT1 A;  3T93 B;  5I59 B;  1SVX B;  3VDF A;  2F7C A;  5I2K A;  2HXW A;  3LSX A;  3K6V A;  2V3T A;  2B65 A;  3OOA A;  1XS5 A;  3RLF E;  4H1X A;  2QRY A;  4MLQ A;  2Z23 A;  3W9V A;  1MY3 A;  2O1L A;  2X26 A;  3QYT A;  1O7T A;  4NF6 A;  4LUB A;  3C36 A;  4PFY A;  3E4R A;  3KBR A;  4ESW A;  2DWI A;  4NE4 A;  1ZIU A;  4EF2 A;  3MAM A;  4LP2 B;  1LB8 A;  2NOO A;  1HSE A;  2QMX A;  1B3E A;  3CFL A;  4G68 A;  5TP9 B;  2ZXT A;  3C32 A;  3H4Z A;  2H5Y A;  1WOD A;  2ONK E;  3N26 A;  4IB2 A;  1QUJ A;  4GL8 A;  4P0I A;  4HTG A;  5DVI A;  4RNS A;  3S2V A;  4ZE9 A;  5ISU A;  1N76 A;  3GBA A;  1B0L A;  5TPA B;  4IY5 A;  3RN8 A;  1YPN A;  1UTB A;  2RIN A;  1Y3N A;  1GR2 A;  2VOZ A;  3OD7 A;  5CBS A;  1H43 A;  1IXG A;  4LZ7 A;  5EYF A;  5TPA A;  4OES A;  4ELQ A;  3RT8 A;  3IJO B;  5FTH A;  2XX9 A;  2ZNU A;  3HCQ A;  4YU0 A;  2QMW A;  1D3K A;  1DSN A;  1MRP A;  1NNT A;  1BP5 A;  4OMB A;  4F1Y A;  4E0X A;  4I8C A;  1M5D A;  2HAU A;  4KHZ E;  1VFD A;  1POT A;  2G29 A;  3RTF B;  3L6G A;  2GHA A;  2PBW A;  3DEL B;  3MP8 A;  1URG A;  3CFZ A;  4OXV A;  1ATG A;  1MXX A;  1OQG A;  2PMS A;  3GZG A;  1J1N A;  1KWH A;  3IB0 A;  2LAO A;  3PUZ E;  4MF3 A;  4QRZ A;  4OYV A;  5AA4 A;  3MC2 A;  4DXU A;  4G8M A;  4Z7E A;  1P1U A;  2ALU A;  4POW A;  4QSE A;  1II5 A;  1MM7 A;  3KGC A;  3KOS A;  2NUV A;  4U1Z A;  5I57 A;  2VHA A;  3VVF A;  1S7Y A;  4UAC A;  3OEL A;  3Q29 A;  3H6V A;  1R9Q A;  4OEV A;  5HM4 B;  3TTK A;  3VFJ A;  2I0C A;  4DCX A;  3OEK A;  4YMA A;  3IK6 B;  3MP6 A;  1N3X A;  1FW0 A;  3IR1 A;  2HQ0 A;  3L6H A;  4KFQ A;  1US5 A;  2NXO A;  5H8Q A;  2I6E A;  1A99 A;  2VP1 A;  1N04 A;  4QHQ A;  4RPN A;  4XKN A;  4LZ8 A;  2Q9T A;  5AE4 A;  1MDQ A;  4RJZ A;  4K3F A;  1SQY A;  4ZDM A;  3TAJ A;  3LSW A;  3V5A A;  4ZED A;  2F5X A;  1TFD A;  4LA9 A;  1B3G A;  3MBP A;  4PFT A;  1MY1 A;  1XVX A;  4EUO A;  2Y84 A;  1TWY A;  1B6H A;  3K6W A;  1B7U A;  3MW0 A;  2XXP A;  2XXV A;  2DYX A;  2V3U A;  5K2X A;  4PE5 B;  5CC2 A;  2IEE A;  4DDD A;  1DPE A;  1DPP A;  1LB9 A;  1A8E A;  2V25 A;  2ZYO A;  3MUQ A;  4R74 A;  4G4P A;  3N5L A;  1B9J A;  3FV2 A;  4Q30 B;  2F36 A;  4QF9 A;  1LAF E;  5CMB A;  2I49 A;  3IL1 B;  2Q2C A;  1UQW A;  5F7V A;  2RF1 A;  3TOD A;  3K02 A;  3FXQ A;  2OZZ A;  1B5H A;  1MQD A;  1MXU A;  1D9V A;  4IGT A;  3EHS A;  5JTY B;  1IQ7 A;  1OMP A;  2VD2 A;  3HV1 A;  4ZS9 A;  1D4N A;  2F6P A;  1FQA A;  3H06 B;  3IOR A;  4KD5 A;  4DCY A;  1UIV A;  4RXL A;  3PMW A;  3KEI A;  1A7L A;  2UXA A;  2F35 A;  3E3K A;  5I56 B;  1OVT A;  3FJ7 A;  3QAX A;  1S9T A;  3TPA A;  3HHG A;  2DVZ A;  5H8F B;  1BIY A;  3T9V A;  1EZO A;  1H44 A;  3UA8 A;  1M5B A;  5CMC A;  1VSO A;  3M8U A;  3MPL A;  3U94 A;  5KDT A;  4F19 A;  3ODB A;  1B3L A;  1LAX A;  3DLN A;  3FJG A;  1P99 A;  3QK6 A;  4H0W A;  3TTR A;  3TDJ A;  4DIG A;  4H8J A;  3TCF A;  1PBQ A;  3K1P A;  4ELO A;  1B3H A;  3PPR A;  2VGQ A;  4HW8 A;  5KDT B;  3T9H B;  4X1B A;  3HHF A;  2XXH A;  1MM6 A;  1NH7 A;  1TT1 A;  3A3C A;  3ZSF A;  1OIB A;  2DVC A;  2Q88 A;  2ZYN A;  2DP8 A;  3KG2 A;  4IO6 A;  2O68 A;  3CSB A;  3ZS6 A;  3JV9 A;  3HN0 A;  4N6P A;  2H99 A;  2REG A;  5M2V A;  3EHT A;  2ZYM A;  2H9B A;  1Y3Q A;  5AA2 A;  1CE2 A;  1SD3 A;  3U92 A;  1N3W A;  4FIM A;  4RPO A;  2H25 A;  3N6T A;  5FTI A;  2VD3 A;  1Z7M E;  1PB7 A;  1N84 A;  1A54 A;  1ZKB A;  2GRV A;  1EH3 A;  2HEU A;  2V93 A;  3GBB A;  4G8H A;  5DT6 A;  4BLA A;  1MH4 A;  1N7W A;  1YCJ A;  2AL5 A;  4Q0C A;  3IB1 A;  4OZ9 A;  5CMK A;  1BTJ A;  1IXH A;  4IY6 A;  3VVD A;  1ELJ A;  2F78 A;  3BFU A;  4G68 B;  3RTW B;  2ANJ A;  2RCB A;  3LR1 A;  3H3G A;  3PD8 A;  3Q26 A;  3O6I A;  4RA1 A;  3TCH A;  2XXW A;  3MQ9 A;  4L17 A;  2F34 A;  4F3B A;  4LAT A;  4QFO A;  4ZEI A;  4KR5 A;  4AB6 A;  3I6V A;  1DTG A;  4IO2 A;  4R6H A;  2O84 X;  2R9J A;  4JBZ A;  4IO3 A;  3QUF A;  2UVI A;  3ILT B;  1VR5 A;  1PBP A;  2DE4 A;  4R73 A;  1Q1K A;  2NWJ A;  1SDX A;  2AL4 A;  4JWO A;  4THI A;  5FHN A;  3M3L A;  3R6U A;  1MQJ A;  2DQV A;  4IO7 A;  4OQO A;  3TFL A;  3S9E A;  1NMU A;  3HPI A;  1R6Z A;  3UN6 A;  1MPC A;  4QSD A;  3UP9 A;  1YTV A;  1B51 A;  3T9X B;  2Z22 A;  1LCF A;  1WVJ A;  3D4G A;  3IX1 A;  3QIM A;  3S9M C;  1FTO A;  2D5W A;  2HZK A;  3KFM A;  4OVJ A;  1SYI A;  3H03 A;  1P1N A;  4NF4 B;  4U4S A;  4XKQ A;  1QKA A;  1SW5 A;  1IIW A;  1B4H A;  3Q25 A;  3QSL A;  4P0G A;  4EQ7 A;  5IAI A;  4LQ2 A;  1SW1 A;  4H5F A;  3LBS A;  1LBC A;  1MS7 A;  4OET A;  3TMG A;  3B6Q A;  1PB8 A;  1JEV A;  4GXA A;  3SES A;  3T66 A;  4F3S A;  3EN3 A;  3A3U A;  2XX7 A;  4I1D A;  3VLW A;  2O69 A;  3OEM A;  1MXY A;  1ZMG A;  3OSR A;  1H3D A;  4OTE A;  2RC7 A;  1URS A;  3U72 A;  4KPT A;  3VE1 B;  3TEP A;  3QUJ A;  3F11 A;  4C1U A;  4RY1 A;  2GH9 A;  1ANF A;  3G7W A;  2ZNT A;  4R9F A;  1P1O A;  4MBP A;  1JEU A;  4NTL A;  2XD3 A;  2DWA A;  3KN7 A;  2AYS A;  2FNC A;  1M5C A;  3S9L C; 
#chains in the Genus database with same CATH topology
 1QUI A;  4YZZ A;  3BIG A;  3RY3 A;  1FJ6 A;  2BJI A;  3HO7 A;  1SBP A;  3G3G A;  3EQ1 A;  4F2O A;  1Q35 A;  3MVW A;  3KZG A;  1K9Y A;  4KQP A;  5H8F A;  1NH8 A;  2PVU A;  2RC8 A;  3QXM A;  1MY4 A;  2KQZ A;  4M4G A;  4R9G A;  3OO9 A;  1H76 A;  2PX1 A;  4WXJ A;  5B70 A;  3N94 A;  2XHD A;  2DE2 A;  3SET A;  4OHN A;  3OO8 A;  4F39 A;  2A5S A;  2F7A A;  4G77 A;  1TXF A;  5I2N A;  1OLA A;  1MY2 A;  2OLB A;  1M5E A;  3IAZ A;  1MQG A;  1UTH A;  1Y9U A;  1US4 A;  1EZ9 A;  4EQB A;  3H6U A;  3MJN A;  1XC1 A;  4GBW A;  1XOC A;  2Z8D A;  1POY 1;  1XHY A;  4RYA A;  2D21 A;  5EQA A;  5ICT A;  4ZEK A;  2Y7W A;  1R1N A;  4Z0I A;  5AA2 D;  2XXR A;  1ZBM A;  2QPQ A;  3RT6 B;  3KN3 A;  1LFH A;  3C33 A;  4H67 A;  2I4B A;  4NF8 A;  5AA3 A;  2ONR A;  3OO6 A;  4ESX A;  4F3G A;  1FQB A;  3P7I A;  1YYZ A;  4HXV A;  2XXQ A;  4OER A;  3K00 A;  3IOV A;  4POX A;  2QFL A;  4TOZ A;  3ZKL A;  2B4L A;  4EXK A;  1B3F A;  2ZYK A;  1MXW A;  2O7U A;  2P3V A;  2PT2 A;  1B46 A;  1VFE A;  3VLV A;  3E79 A;  5IGA A;  3IFC A;  2YPN A;  3MVY A;  1AWB A;  2FYI A;  1UIU A;  5LDZ A;  3FVG A;  4FED A;  4NF6 B;  3FVN A;  5CI5 A;  1MXV A;  1DCU A;  1LAH E;  3FVO A;  4M1V A;  1T0K A;  5F1Q A;  4G2Z A;  1EYK A;  4GWS A;  2QSX A;  5JEI A;  2Q89 A;  4GIZ A;  3TTN A;  5DVJ A;  3N6U A;  4GWX A;  3V83 A;  2R71 A;  4I3E A;  3SEY A;  3D1R A;  4NF4 A;  4U4X A;  1B40 A;  4PQJ A;  2V84 A;  4QFP A;  3D4C A;  1IUD A;  2D3I A;  4YB5 A;  2Y5K A;  2XXI A;  4MLV A;  4E0W A;  1LLS A;  5A5X A;  4ZZE A;  3V89 B;  4XXU A;  2I0B A;  4IGR A;  4MNI A;  4ZEB A;  4GWW A;  3Q28 A;  5AA1 A;  3RQT A;  4P11 A;  5L9O A;  2DS9 A;  5HBC A;  3PPN A;  3IFA A;  4X9T A;  1FPE A;  5H8N A;  4P1E A;  1JET A;  3ZKK A;  1Y4C A;  2O51 A;  3G3H A;  3PMX A;  3JZJ A;  2XA5 A;  1QW0 A;  3O29 A;  1P1Q A;  1LST A;  2E0S A;  4QBA A;  4F22 A;  3PMV A;  5H8S A;  4U22 A;  1SW2 A;  4C0R A;  1L5T A;  3TKD A;  2XXY A;  1I69 A;  3LV0 A;  3SZP A;  5I7I A;  3OOA A;  2V3T A;  2B65 A;  1XS5 A;  4H1X A;  1MY3 A;  2O1L A;  4ESW A;  2XXK A;  1NV4 A;  1HSE A;  4G68 A;  2ZZV A;  1QUJ A;  4RNS A;  5ISU A;  1B0L A;  1YPN A;  1UTB A;  2VOZ A;  5TPA A;  1IXG A;  3ISP A;  4I8C A;  1M5D A;  4KHZ E;  4N81 A;  1NV2 A;  3DEL B;  3MP8 A;  4MF3 A;  1OQG A;  2PMS A;  1KWH A;  2LAO A;  3E78 A;  3MC2 A;  4Z7E A;  2ALU A;  3MST A;  4POW A;  1II5 A;  4QSE A;  1FSA A;  1MM7 A;  3KOS A;  4U1Z A;  1R9Q A;  1NV6 A;  3IK6 B;  3MP6 A;  3BIH A;  4KFQ A;  4QHQ A;  4PFB A;  2ZZW A;  4K3F A;  3TAJ A;  4LA9 A;  3MBP A;  1MY1 A;  4EUO A;  1B7U A;  5K2X A;  5CC2 A;  1DPE A;  1LB9 A;  2F3D A;  5ET8 A;  4P56 A;  1UQW A;  3EHS A;  5JTY B;  4DCY A;  1FQA A;  3IOR A;  1A7L A;  2UXA A;  5I56 B;  1OVT A;  3T9V A;  1EZO A;  3UA8 A;  1VSO A;  3U94 A;  5KDT A;  3ODB A;  3TCF A;  3K1P A;  3T9H B;  4X1B A;  3HHF A;  2XXH A;  2DVC A;  2ZYN A;  3KG2 A;  4IO6 A;  2O68 A;  4OVP A;  4P47 A;  4PDD A;  2H9B A;  1Y3Q A;  4I40 A;  3HFU A;  1PB7 A;  2GRV A;  1N84 A;  1A54 A;  1ZKB A;  4P8B A;  2FHY A;  1YCJ A;  4Q0C A;  2AL5 A;  2FIX A;  4G68 B;  3RTW B;  1D9Q A;  3LR1 A;  3Q26 A;  3TTK A;  3U72 A;  4QFO A;  3I6V A;  1DTG A;  1FBC A;  2UVI A;  1PBP A;  1Q1K A;  1SDX A;  4THI A;  4OQO A;  1MQJ A;  3TFL A;  3UN6 A;  3UP9 A;  3T9X B;  1LCF A;  3D4G A;  4XF5 A;  2HZK A;  4OVJ A;  1P1N A;  4U4S A;  5IAI A;  4LQ2 A;  4H5F A;  4N91 A;  4OET A;  3TMG A;  3EN3 A;  3A3U A;  3VLW A;  2O69 A;  4OTE A;  2RC7 A;  1URS A;  3QUJ A;  4RY1 A;  3G7W A;  2DWA A;  3KN7 A;  3TTL A;  4BDO A;  3CG1 A;  3R26 A;  1RDX A;  4F31 B;  3UK4 A;  4U21 A;  2YLN A;  4LQ5 A;  3FZV A;  2CZL A;  4TQU Q;  2B3F A;  3CRB A;  3O66 A;  4NF5 B;  1LBX A;  4LVQ A;  3A29 A;  2I3W A;  4FAJ A;  3FAS A;  4PAK A;  4XIG Q;  3RYD A;  1GGG A;  1WDN A;  2BJJ X;  3TZA A;  1LBZ A;  4KCC A;  2ONS A;  3FJM A;  4OEU A;  2NVU B;  1FQC A;  1D9Y A;  2CEY A;  4I62 A;  3K1M A;  4YB6 A;  4RK9 A;  1LGB C;  1JVY A;  4DE8 A;  2CZK A;  3TTM A;  3K6X A;  2I48 A;  5I2N B;  3BFT A;  1GVC A;  3MVZ A;  3FIR A;  3VVE A;  2P2A A;  2XXX A;  4PET A;  4XEQ A;  5ITP A;  3GLB A;  4JXI A;  1AH5 A;  1NV5 A;  4OEN A;  2DXY A;  3ILU B;  3FVK A;  1LFG A;  2A5T A;  2XWO A;  1IIT A;  2QJE A;  5DYH A;  3VXB A;  3H6W A;  3RPW A;  4XKP A;  1VDW A;  5L8D A;  4P1L A;  3OEN A;  4YKJ A;  4DZ1 A;  1PB9 A;  5ITO A;  2Q2A A;  3VXC A;  1UTB B;  1INP A;  4DI3 D;  1HSJ A;  4G68 C;  2Y7R A;  4H5G A;  4GX3 A;  1F9B A;  4BDN A;  1EYI A;  4H8I A;  4OFO A;  3BKI B;  5L9M A;  3E9X A;  3PU5 A;  2Q8M A;  1OLC A;  4NF8 B;  4GLI A;  4BDL A;  2KLF A;  3LUZ A;  3PTY A;  4HCY A;  1IMB A;  1MG1 A;  3UOR A;  3DM0 A;  4HCW A;  2W7Y A;  5ICQ A;  1B1H A;  1LCT A;  4KYE A;  1FBG A;  4GBV A;  4JVC A;  5DTB A;  1JVX A;  5AA2 B;  5I3S A;  3KOT A;  1NUZ A;  4GQO A;  4MJO A;  4HE2 A;  4N6K A;  3A09 A;  2F7B A;  3ONM A;  2OK2 A;  4ELR A;  3C9H A;  3MZ1 A;  3AXF A;  3B6W A;  2I4C A;  4F2Q A;  1PC3 A;  1NUY A;  4HS7 A;  1BKA A;  1S50 A;  3CFX A;  5IKB A;  3FV1 A;  1Y3P A;  1VE4 A;  3RGY A;  2XXT A;  3SEV A;  5LOM A;  1URD A;  4TLM B;  2Q8J A;  1NV1 A;  3M3K A;  4NG7 A;  4F29 A;  4JSD A;  3FXU A;  2F6G A;  4YU0 A;  4EF1 A;  3EPE A;  5TP9 A;  3RNN A;  4WED A;  2B3B A;  5EHS A;  2DWJ A;  1NL5 A;  1JW5 A;  3ECR A;  1Y20 A;  1DBZ A;  2HFB A;  3K1N A;  3FUZ A;  1ZLQ A;  4WKM A;  3S9N C;  4QFK A;  1IMD A;  2AIX A;  4DLD A;  1BLF A;  3FAT A;  2CZI A;  2XX8 A;  1DK4 A;  3V8X B;  1MH3 A;  3G3J A;  1FTA A;  4LZ5 A;  2R6G E;  4QFL A;  5FHM A;  1Z7N E;  5I5P A;  3TUS A;  1MQH A;  1FJ9 A;  1B5I A;  1FPL A;  4OFL A;  5ET6 A;  1SYH A;  1SW4 A;  2REJ A;  5I58 A;  3T22 A;  4BDM A;  4X48 A;  3T1B A;  5H8N B;  1IEJ A;  3IOT A;  1CB6 A;  3IOU A;  5I59 A;  3KSX A;  1NV7 A;  2GFE A;  2QS2 A;  3UIF A;  3K0V A;  4GFR A;  4I9D A;  4OFJ A;  1QUL A;  1FCK A;  3UGW A;  4OVQ A;  5I84 A;  2CEX A;  4DXC A;  3K6U A;  5KCJ A;  2Q74 A;  4R2B A;  5K2Y A;  2OWT A;  4MNP A;  3T93 B;  2WEF A;  2QVU A;  3VDF A;  1JP4 A;  1G0I A;  3K6V A;  3RLF E;  2QRY A;  4MLQ A;  2Z23 A;  3W9V A;  4PBH A;  3QYT A;  3E4R A;  4NE4 A;  4EF2 A;  2NOO A;  2QMX A;  3C32 A;  2H5Y A;  2ONK E;  4P0I A;  5DVI A;  5TPA B;  4IY5 A;  3RT8 A;  3IJO B;  3HCQ A;  4NAP A;  2OWZ A;  1DSN A;  1MRP A;  1NNT A;  1VFD A;  4PF6 A;  3L6G A;  4OXV A;  1MXX A;  3IB0 A;  4QRZ A;  3PUZ E;  4OYV A;  4G8M A;  1P1U A;  4NF0 A;  2VHA A;  3Q29 A;  4OEV A;  5HM4 B;  3VFJ A;  4YMA A;  1FW0 A;  3IR1 A;  1US5 A;  2NXO A;  2I6E A;  1A99 A;  4RPN A;  4XKN A;  5AE4 A;  1MDQ A;  4RJZ A;  3V5A A;  1TFD A;  4PFT A;  2Y84 A;  3MW0 A;  4PE5 B;  2V25 A;  2ZYO A;  1A8E A;  3IL1 B;  2HPG A;  1B5H A;  5AA2 A;  1D9V A;  2VD2 A;  2F6P A;  1UIV A;  3PMW A;  3KEI A;  2F35 A;  1S9T A;  3TPA A;  3HHG A;  2DVZ A;  4AS5 A;  5CMC A;  3MPL A;  3FJG A;  1NUX A;  3TDJ A;  4ELO A;  4HW8 A;  1TT1 A;  2HXR A;  4PTK A;  2H99 A;  4AS4 A;  3FBP A;  1KA0 A;  1SD3 A;  2H25 A;  3N6T A;  2HEU A;  2WX9 A;  2V93 A;  1MH4 A;  2JJK A;  3BFU A;  3H3G A;  3PD8 A;  3MQ9 A;  4L17 A;  4ZEI A;  4AB6 A;  4KR5 A;  4N4U A;  2R9J A;  3U65 A;  4X8R A;  4IO3 A;  2NWJ A;  3B50 A;  4X04 A;  2AL4 A;  5FHN A;  3R6U A;  4IO7 A;  2QVV A;  1MPC A;  1WVJ A;  4G61 A;  3KFM A;  4GX4 A;  1QKA A;  1SW5 A;  1B4H A;  3Q25 A;  4P0G A;  4EQ7 A;  1SW1 A;  1JEV A;  3SES A;  3T66 A;  4F3S A;  4GX6 A;  4I1D A;  3OSR A;  1MXY A;  1ZMG A;  4PDH A;  1H3D A;  2WYK A;  4KPT A;  2ZNT A;  1JEU A;  2AYS A;  5H8Q B;  4JWY A;  4GD5 A;  2UVG A;  1O63 A;  2H4I A;  1MQI A;  2DDK A;  3K2D A;  3KJ7 A;  4GWZ A;  1PEB A;  2P3N A;  5I58 B;  3FD3 A;  3PPO A;  2G93 A;  5I59 B;  2Y7K A;  1USY H;  1QKB A;  1LBB A;  3LSL A;  4BDQ A;  3MZB A;  2I58 A;  4KYS A;  1I6B A;  2X7Q A;  4H65 A;  2YJP A;  3R7X A;  2IA4 A;  5J16 A;  3DP8 A;  5I2K B;  4MMP A;  1B4Z A;  3OSQ A;  2DWH A;  1K9Z A;  2OJT A;  1FBF A;  1FTJ A;  4MX6 A;  2A5T B;  1R9L A;  4ISU A;  4OWD A;  3THI A;  1FPG A;  1B58 A;  3VV5 A;  4PFU A;  3W9W A;  1DMB A;  4PAF A;  1IXC A;  1MDP 1;  2XXU A;  2F8D A;  5FHO A;  4N13 A;  1N0T A;  2HHM A;  5TU0 A;  4F1U A;  1FQD A;  4KI0 E;  1JW1 A;  4YAH X;  4H6D A;  4BDR A;  2OX3 A;  3M3F A;  3B6T A;  4FEB A;  4MCO A;  1N7X A;  4HE0 A;  1QVS A;  4YMB A;  4UAB A;  1CNQ A;  4JVI A;  3LUY A;  1O64 A;  4ZZA A;  1LAG E;  4YKK A;  3C31 A;  4N07 A;  5EQ9 A;  5A5X B;  4GL0 A;  1KZ8 A;  4ZEF A;  1MXZ A;  5CM6 A;  4F1V A;  4QSC A;  4R2F A;  3TQL A;  1MPD A;  3O6H A;  2M8C A;  2Y5L A;  5BWJ A;  1USY E;  4FE8 A;  3WAF A;  1A8F A;  3H7M A;  4KCD A;  5IZ1 A;  2HAV A;  4P9K A;  4N6D A;  4PBQ A;  4GOT A;  4R6Y A;  4JSO A;  3T9U A;  3DP6 A;  1NNF A;  4PC9 A;  3CIJ A;  2RKM A;  4H45 A;  1IZ1 A;  4O7I A;  3PUY E;  2RC9 A;  3WAE A;  2X7P A;  4YKP A;  3KJT A;  3MPK A;  1LBY A;  5ELV A;  1FPK A;  4QFN A;  3PUW E;  4GRK A;  1MPB A;  3TQW A;  1NKX A;  4Q5T A;  1OVB A;  3OMB A;  3GXA A;  3G3F A;  1B2H A;  1UTH B;  4Q8R A;  1QGX A;  3EF7 A;  4NWD A;  3DP4 A;  3CR9 A;  5EHM A;  4HE1 A;  1FTM A;  1ZJL A;  2O6A A;  3MWB A;  4NQ8 A;  3C35 A;  2PFY A;  4LON B;  1EZP A;  4U2R A;  3U93 A;  2L5V A;  3USD A;  1B7H A;  1IMC A;  2ZNS A;  4O3A A;  1FBD A;  4FAT A;  4N17 A;  4FOR A;  4GXS B;  3SEX A;  1FPI A;  4N15 A;  2WKY A;  4WEP A;  4NMY A;  4YKI A;  2P1S A;  3B7D A;  4XTC Q;  1I6Q A;  2RCA A;  5JK4 A;  4YIC A;  1NFT A;  1M5F A;  4N8G A;  3T96 B;  1DOT A;  1H45 A;  1ZU0 A;  2QS1 A;  3SDF A;  3IB2 A;  5CRY A;  3G3K A;  4X1D A;  3EKI A;  2Y7P A;  1NV0 A;  3PPP A;  1SI0 A;  2HCA A;  2THI A;  3G3I A;  1LFI A;  1JW4 A;  4DXB A;  5BUU A;  2WYP A;  4EQ9 A;  2I3V A;  4RK2 A;  5I56 A;  1AMF A;  3O6G A;  2GQ1 A;  4PFI A;  2GHB A;  3RUM A;  4PFW A;  2OBG A;  2OWS A;  4O3B A;  4QXD A;  1B7Z A;  5DEX B;  4XKR A;  5KCJ B;  2HZL A;  3C4M A;  3U8Q A;  1HSL A;  3BBR A;  1FBP A;  4PGP A;  2PT1 A;  5F24 A;  1SVX B;  2F7C A;  5I2K A;  2HXW A;  1LBV A;  1BK4 A;  2X26 A;  1O7T A;  5IM2 A;  4NF6 A;  4LUB A;  3C36 A;  4PFY A;  1ZIU A;  5EQ7 A;  1LB8 A;  1B3E A;  3CFL A;  1WOD A;  4PE3 A;  4GL8 A;  3S2V A;  4HTG A;  4ZE9 A;  1N76 A;  3RN8 A;  2RIN A;  1Y3N A;  3OD7 A;  1H43 A;  5EYF A;  1NUW A;  4OES A;  5FTH A;  2ZNU A;  1D3K A;  4F1Y A;  4LN5 A;  1POT A;  3RTF B;  2G29 A;  1YZ0 A;  2GHA A;  2PBW A;  1URG A;  3CFZ A;  1Q9D A;  1ATG A;  4MHF A;  5AA4 A;  1S7Y A;  2WBD A;  3OEL A;  4DCX A;  1N3X A;  2HQ0 A;  4MEV A;  2VP1 A;  4LZ8 A;  2Q9T A;  4ZDM A;  2F5X A;  1SPI A;  1XVX A;  1TWY A;  1B6H A;  1RDY A;  2DYX A;  4DDD A;  4R74 A;  1B9J A;  3FV2 A;  2F36 A;  1LAF E;  2Q2C A;  3K02 A;  1G0H A;  1MXU A;  4IGT A;  3HV1 A;  4ZS9 A;  1D4N A;  3H06 B;  2F3B A;  3E3K A;  3FJ7 A;  3B8B A;  1NI9 A;  1BIY A;  1H44 A;  1M5B A;  1B3L A;  1LAX A;  4I3Y A;  5LTC A;  3QK6 A;  4H0W A;  3TTR A;  4DIG A;  4H8J A;  1B3H A;  3ZSF A;  1OIB A;  2Q88 A;  2DP8 A;  3ZS6 A;  3HN0 A;  4N6P A;  3ROJ A;  2REG A;  5M2V A;  1CE2 A;  3U92 A;  1N3W A;  4RPO A;  4IR8 A;  5FTI A;  1Z7M E;  3GBB A;  4G8H A;  4GWY A;  4BLA A;  1NV3 A;  5CMK A;  2VPO A;  1IXH A;  3VVD A;  1ELJ A;  2ANJ A;  3TCH A;  4IO2 A;  4R6H A;  2O84 X;  4JBZ A;  3QUF A;  3ILT B;  4JWO A;  3M3L A;  4MNC A;  2DQV A;  3S9E A;  3HPI A;  1R6Z A;  4NX1 A;  1B51 A;  5DW8 A;  2QVR A;  3IX1 A;  3GYY A;  3S9M C;  1SYI A;  4XKQ A;  2XWK A;  5EYH A;  1IIW A;  3QSL A;  3LBS A;  1MS7 A;  1PB8 A;  2XX7 A;  3KC0 A;  3OEM A;  1FPJ A;  3TEP A;  3CHG A;  4R9F A;  4MBP A;  4NTL A;  2XD3 A;  2FNC A;  3S9L C;  4R75 A;  1Y1M A;  1ZTY A;  4TLL B;  3IO4 A;  1B32 A;  5CBR A;  1A55 A;  1B0H A;  2ABH A;  2P0S A;  1FPF A;  2Y7I A;  3PUX E;  4EDP A;  1QJM A;  5B7D A;  5JTY A;  3FXR A;  4FJP A;  4PGN A;  3TEL A;  1JNF A;  4IO5 A;  3O97 A;  2O1M A;  3O2A A;  2UYE A;  1Y1Z A;  5H8H A;  3MP1 A;  5HPQ A;  2OCU A;  4ZE8 A;  2Z8F A;  2H98 A;  1I6A A;  2F97 A;  3TYH A;  3MVX A;  3S4U A;  4H46 A;  4U1O A;  4PF8 A;  3VLU A;  1IME A;  4O7M A;  1FBH A;  2QL3 A;  1B1X A;  3PV0 E;  4ZEC A;  3I3V A;  2XWV A;  1RYX A;  4NHB A;  3KSJ A;  4C1T A;  2O7I A;  5IZ3 A;  2DXR A;  1P1W A;  3CI8 A;  1Y4T A;  4DI4 B;  1YAE A;  4IO4 A;  3CSG A;  2ZMB A;  3OO7 A;  1FTK A;  4YB7 A;  5I57 B;  2QS3 A;  2UVH A;  4R6K A;  4ELP A;  1A40 A;  1FRP A;  5AA4 B;  4MFI A;  4GVO A;  4JDF A;  4MH5 A;  3CVG A;  2Z8E A;  1RDZ A;  2DSF A;  3EHU A;  3E13 X;  2UVJ A;  3LSF B;  2V4C A;  3OXN A;  1B52 A;  2FA7 A;  2E1S A;  4ECF A;  4AB5 A;  2FVZ A;  1FQF A;  2CMO A;  3FXB A;  4GWO A;  1FBE A;  5KZT A;  4NF5 A;  5ET7 A;  1XVY A;  1LBW A;  1MY0 A;  1RKM A;  3W15 C;  5DVF A;  4OAN A;  3IO6 A;  4F3P A;  1XI6 A;  1IXI A;  1B05 A;  2FIE A;  4GWU A;  4O3C A;  4PFR A;  3PPQ A;  3SER A;  2VT5 A;  3LC8 A;  4PP0 A;  1PDA A;  3MYU A;  2PCR A;  1RYO A;  4UA8 A;  2QS4 A;  2ESN A;  3RPL A;  3IJX B;  3U1O A;  4KYD A;  2PYY A;  1EU8 A;  4F18 A;  4JB7 A;  3K4U A;  4JWX A;  1KA1 A;  3SEU A;  3PD9 A;  2UYF A;  4EXL A;  3PGF A;  3H6T A;  4PCD A;  3O28 A;  1FQE A;  1FTL A;  4GF8 A;  4NWC A;  1AL3 A;  1QUK A;  4OVT A;  2PFZ A;  5T3J A;  3PUV E;  3TCG A;  3FGS A;  1GV8 A;  3KN8 A;  1IMA A;  1NNP A;  3O9P A;  3C34 A;  4G8N A;  4MAG A;  3NOH A;  1DTZ A;  4FEC A;  1JQF A;  3HST A;  5FBP A;  1SI1 A;  4AQ4 A;  2V3Q A;  3CG3 A;  3I5O A;  3K01 A;  4ND9 A;  1XT8 A;  1B5J A;  1TFA A;  4NED A;  3KC1 A;  1OQH A;  5L9S A;  3IOW A;  3SEW A;  2VPN A;  2KR0 A;  4NN3 A;  2DOJ A;  1AOV A;  1GTK A;  2MKZ A;  4R72 A;  1EYJ A;  3Q27 A;  3SKP A;  5ET5 A;  5DEX A;  1NNK A;  2XD2 A;  3MZ9 A;  2R8T A;  1FPD A;  2DE3 A;  5CMM A;  4ONY A;  5H8H B;  4U23 A;  3JYR A;  4FBP A;  3T0J A;  1YXI A;  3LSX A;  5EQ8 A;  3KBR A;  2DWI A;  5ESY A;  3MAM A;  4LP2 B;  5TP9 B;  2ZXT A;  3H4Z A;  3N26 A;  4IB2 A;  3GBA A;  1GR2 A;  5CBS A;  1FPB A;  4KXP A;  4LZ7 A;  4ELQ A;  2XX9 A;  2QMW A;  4OMB A;  1BP5 A;  4OA4 A;  4E0X A;  2HAU A;  5IZ3 B;  3GZG A;  2CZH A;  1J1N A;  4DXU A;  1LEV A;  3KGC A;  2NUV A;  5I57 A;  3VVF A;  4UAC A;  3H6V A;  2I0C A;  3OEK A;  3L6H A;  5A5L A;  4OVR A;  5H8Q A;  1N04 A;  1SQY A;  4ZED A;  3LSW A;  4PAI A;  4N8Y A;  4P3L A;  1B3G A;  5IZZ A;  3K6W A;  2XXP A;  2XXV A;  2V3U A;  2IEE A;  1DPP A;  3MUQ A;  4G4P A;  3N5L A;  4Q30 B;  4QF9 A;  5CMB A;  2I49 A;  5F7V A;  2RF1 A;  3TOD A;  3FXQ A;  2OZZ A;  1MQD A;  1AIV A;  1IQ7 A;  1OMP A;  4NGU A;  4KD5 A;  3QMF A;  4RXL A;  3QAX A;  5H8F B;  3M8U A;  5EYG A;  4F19 A;  3DLN A;  1P99 A;  1PBQ A;  4JVD A;  3PPR A;  2VGQ A;  2XWI A;  5KDT B;  3A3C A;  1MM6 A;  1NH7 A;  2WBB A;  3CSB A;  3JV9 A;  3EHT A;  2ZYM A;  4O8M A;  4FIM A;  2VD3 A;  1IMF A;  5J1D A;  1EH3 A;  5DT6 A;  4OVS A;  1N7W A;  4O94 A;  3IB1 A;  4OZ9 A;  1BTJ A;  3RPL B;  4IY6 A;  3KBZ A;  2F78 A;  2RCB A;  4RA1 A;  4F3B A;  3O6I A;  2XXW A;  2F34 A;  4LAT A;  2B4M A;  1VR5 A;  2DE4 A;  4R73 A;  2ZZX A;  1NMU A;  4QSD A;  1YTV A;  2Z22 A;  3QIM A;  1FTO A;  2D5W A;  3H03 A;  4NF4 B;  1LBC A;  3B6Q A;  4GXA A;  3VE1 B;  4XFE A;  2FBP A;  3F11 A;  4C1U A;  2GH9 A;  1ANF A;  1P1O A;  4MIJ A;  1M5C A; 
#chains in the Genus database with same CATH homology
 4BDO A;  4GD5 A;  3CG1 A;  3R26 A;  1QUI A;  1Y1M A;  4R75 A;  4F31 B;  4YZZ A;  3UK4 A;  1ZTY A;  4U21 A;  2YLN A;  4LQ5 A;  3FZV A;  2CZL A;  2UVG A;  4TQU Q;  3TTL A;  4TLL B;  3RY3 A;  1O63 A;  2H4I A;  2B3F A;  3IO4 A;  1B32 A;  1MQI A;  5CBR A;  1A55 A;  3CRB A;  3HO7 A;  3O66 A;  4NF5 B;  4LVQ A;  1SBP A;  1B0H A;  3G3G A;  3K2D A;  2ABH A;  2P0S A;  3EQ1 A;  2I3W A;  4F2O A;  2Y7I A;  3KJ7 A;  4BDR A;  4FAJ A;  3FAS A;  3PUX E;  1PEB A;  1Q35 A;  4EDP A;  3MVW A;  5I58 B;  4XIG Q;  1QJM A;  3FD3 A;  3KZG A;  5B7D A;  4KQP A;  1GGG A;  5H8F A;  1NH8 A;  2PVU A;  2RC8 A;  3QXM A;  1MY4 A;  3FXR A;  4FJP A;  5H8Q B;  4EF1 A;  3TEL A;  1JNF A;  3PPO A;  2G93 A;  4M4G A;  3OO9 A;  4IO5 A;  1H76 A;  1WDN A;  1USY H;  2BJJ X;  2O1M A;  1QKB A;  2PX1 A;  2Y7K A;  3O2A A;  3O97 A;  4WXJ A;  1LBB A;  3TZA A;  5B70 A;  3N94 A;  4KCC A;  2XHD A;  2ONS A;  2UYE A;  3FJM A;  4OEU A;  2DE2 A;  3LSL A;  3SET A;  1Y1Z A;  1FQC A;  1D9Y A;  4OHN A;  2NVU B;  4I62 A;  5H8H A;  3K1M A;  4YB6 A;  4RK9 A;  1LGB C;  3OO8 A;  3MP1 A;  1JVY A;  2A5S A;  3MZB A;  2F7A A;  2I58 A;  3TTM A;  4DE8 A;  4F39 A;  5HPQ A;  5J1D A;  2OCU A;  3K6X A;  2I48 A;  4KYS A;  4G77 A;  1I6B A;  1TXF A;  3BFT A;  5I2N B;  1GVC A;  3MVZ A;  2X7Q A;  4H65 A;  2YJP A;  3R7X A;  5JTY A;  2IA4 A;  4ZE8 A;  5I2N A;  3FIR A;  2Z8F A;  1OLA A;  3DP8 A;  1MY2 A;  5I2K B;  2OLB A;  2H98 A;  1M5E A;  1B4Z A;  1I6A A;  2F97 A;  2P2A A;  3TYH A;  3OSQ A;  3VVE A;  2XXX A;  4PET A;  3IAZ A;  3MVX A;  2DWH A;  3S4U A;  2OJT A;  5ITP A;  1FTJ A;  3GLB A;  1MQG A;  1UTH A;  4JXI A;  1AH5 A;  1Y9U A;  1US4 A;  4U1O A;  2A5T B;  1R9L A;  1EZ9 A;  3VLU A;  4OEN A;  2DXY A;  4ISU A;  3ILU B;  3FVK A;  4OWD A;  3THI A;  1LFG A;  4EQB A;  1B58 A;  2A5T A;  2QL3 A;  4PFU A;  3VV5 A;  1DMB A;  3H6U A;  3W9W A;  1IXC A;  1MDP 1;  2XXU A;  1B1X A;  2F8D A;  1IIT A;  2QJE A;  3PV0 E;  5DYH A;  5FHO A;  4N13 A;  3VXB A;  4ZEC A;  3H6W A;  1N0T A;  3MJN A;  3RPW A;  4XKP A;  1XC1 A;  5L8D A;  5TU0 A;  3OEN A;  1XOC A;  2Z8D A;  4YKJ A;  4F1U A;  3I3V A;  4DZ1 A;  1PB9 A;  3SDF A;  1POY 1;  1XHY A;  4RYA A;  1FQD A;  5ITO A;  2D21 A;  1RYX A;  3KSJ A;  4KI0 E;  4C1T A;  2Q2A A;  3VXC A;  2O7I A;  1UTB B;  1JW1 A;  5ICT A;  4ZEK A;  4YAH X;  2DXR A;  1HSJ A;  1P1W A;  3CI8 A;  2Y7W A;  1Y4T A;  4H6D A;  1YAE A;  4G68 C;  3CSG A;  2ZMB A;  3M3F A;  2Y7R A;  3OO7 A;  4H5G A;  4IO4 A;  1R1N A;  3B6T A;  4Z0I A;  5AA2 D;  1FTK A;  4FEB A;  4YB7 A;  1F9B A;  1N7X A;  5I57 B;  2XXR A;  2QS3 A;  1QVS A;  2UVH A;  4R6K A;  4BDN A;  4YMB A;  4ELP A;  1A40 A;  1ZBM A;  5AA4 B;  2QPQ A;  3LUY A;  4MFI A;  1O64 A;  4H8I A;  4OFO A;  3BKI B;  4GVO A;  3RT6 B;  4ZZA A;  1LAG E;  3KN3 A;  4JDF A;  5L9M A;  1LFH A;  3C33 A;  3E9X A;  4H67 A;  3CVG A;  3PU5 A;  4MH5 A;  2I4B A;  1OLC A;  4NF8 B;  2Z8E A;  4YKK A;  2DSF A;  3C31 A;  4GLI A;  4N07 A;  4BDL A;  3EHU A;  3E13 X;  5A5X B;  2KLF A;  2UVJ A;  3LSF B;  4NF8 A;  4GL0 A;  4HCY A;  1MG1 A;  3UOR A;  3DM0 A;  3OXN A;  5AA3 A;  4ZEF A;  1MXZ A;  1B52 A;  5CM6 A;  2FA7 A;  2W7Y A;  2ONR A;  4HCW A;  4F1V A;  4QSC A;  3OO6 A;  4R2F A;  5ICQ A;  3TQL A;  1MPD A;  1B1H A;  1LCT A;  4KYE A;  4ESX A;  4F3G A;  3O6H A;  2E1S A;  1FQB A;  2M8C A;  3P7I A;  4AB5 A;  4ECF A;  5BWJ A;  1USY E;  5DTB A;  1FQF A;  1JVX A;  2CMO A;  4FE8 A;  2XXQ A;  1A8F A;  3WAF A;  5AA2 B;  4OER A;  3K00 A;  3KOT A;  3H7M A;  4GWO A;  3IOV A;  4GQO A;  2HAV A;  4KCD A;  4POX A;  4NF5 A;  4R9G A;  5KZT A;  3A09 A;  2F7B A;  3ONM A;  2OK2 A;  1XVY A;  4GOT A;  4R6Y A;  4JSO A;  3T9U A;  1MY0 A;  4ELR A;  1RKM A;  4TOZ A;  1AIV A;  3C9H A;  3DP6 A;  3W15 C;  1NNF A;  5DVF A;  3ZKL A;  3MZ1 A;  3IO6 A;  4BDQ A;  3AXF A;  3B6W A;  4F3P A;  3CIJ A;  4EXK A;  2I4C A;  2RKM A;  4F2Q A;  1IZ1 A;  1PC3 A;  1B3F A;  1IXI A;  3PUY E;  2RC9 A;  2ZYK A;  1MXW A;  1BKA A;  2O7U A;  4HS7 A;  1S50 A;  1B05 A;  3CFX A;  3WAE A;  2PT2 A;  5IKB A;  1B46 A;  2X7P A;  1VFE A;  1Y3P A;  1VE4 A;  3FV1 A;  3RGY A;  3VLV A;  2XXT A;  3SEV A;  5LOM A;  4YKP A;  4O3C A;  3KJT A;  1URD A;  3MPK A;  3PPQ A;  4TLM B;  2YPN A;  3MVY A;  5ELV A;  3SER A;  3LC8 A;  2Q8J A;  4PP0 A;  1PDA A;  2FYI A;  1UIU A;  3M3K A;  4F29 A;  1RYO A;  4QFN A;  3FVG A;  4JSD A;  3PUW E;  4GRK A;  4UA8 A;  2QS4 A;  2ESN A;  3IJX B;  1MPB A;  3TQW A;  3U1O A;  3FXU A;  1NKX A;  4FED A;  4NF6 B;  2F6G A;  4KYD A;  4Q5T A;  1OVB A;  3FVN A;  2PYY A;  3OMB A;  3GXA A;  3EPE A;  1EU8 A;  3G3F A;  5CI5 A;  1MXV A;  1B2H A;  1UTH B;  4F18 A;  4JB7 A;  1LAH E;  4Q8R A;  3K4U A;  4JWX A;  5TP9 A;  3FVO A;  3RNN A;  4M1V A;  3SEU A;  3TUS A;  1T0K A;  5F1Q A;  3PD9 A;  4WED A;  2UYF A;  3EF7 A;  3DP4 A;  4NWD A;  4EXL A;  2B3B A;  5EHS A;  3CR9 A;  4G2Z A;  3PGF A;  5EHM A;  3H6T A;  2DWJ A;  3O28 A;  2QSX A;  1FTM A;  1ZJL A;  2O6A A;  3MWB A;  5JEI A;  1NL5 A;  1JW5 A;  2Q89 A;  4GIZ A;  3C35 A;  3ECR A;  1FQE A;  1Y20 A;  1FTL A;  4GF8 A;  4LON B;  4NWC A;  1AL3 A;  3TTN A;  1EZP A;  4U2R A;  5DVJ A;  3U93 A;  1QUK A;  3N6U A;  2HFB A;  3USD A;  1B7H A;  3K1N A;  2ZNS A;  4O3A A;  3V83 A;  2R71 A;  3FUZ A;  3PUV E;  3SEY A;  4FAT A;  1ZLQ A;  4WKM A;  4FOR A;  4NF4 A;  4GXS B;  3TCG A;  4QFK A;  3S9N C;  3SEX A;  4U4X A;  1B40 A;  4PQJ A;  2V84 A;  3FGS A;  2AIX A;  4WEP A;  2WKY A;  3KN8 A;  4QFP A;  4NMY A;  4YKI A;  2P1S A;  1GV8 A;  3B7D A;  4XTC Q;  1I6Q A;  2RCA A;  4DLD A;  3D4C A;  1BLF A;  5JK4 A;  4YIC A;  1NFT A;  1IUD A;  1NNP A;  3FAT A;  1M5F A;  2D3I A;  3C34 A;  3O9P A;  4G8N A;  4YB5 A;  2XX8 A;  3T96 B;  3V8X B;  1MH3 A;  1DTZ A;  5KCJ B;  3G3J A;  4FEC A;  1JQF A;  4LZ5 A;  3HST A;  1DOT A;  2R6G E;  1H45 A;  1ZU0 A;  2QS1 A;  1Z7N E;  2XXI A;  4MLV A;  1SI1 A;  4QFL A;  5FHM A;  2V3Q A;  3IB2 A;  1LLS A;  3G3K A;  3CG3 A;  5CRY A;  4AQ4 A;  4E0W A;  4ZZE A;  5A5X A;  3V89 B;  3I5O A;  3K01 A;  1MQH A;  4X1D A;  4XXU A;  2Y7P A;  1B5I A;  2I0B A;  4ND9 A;  3PPP A;  1SI0 A;  2HCA A;  2THI A;  4IGR A;  4OFL A;  3G3I A;  4ZEB A;  5AA1 A;  3Q28 A;  1XT8 A;  3RQT A;  1LFI A;  1JW4 A;  1SYH A;  4P11 A;  4DXB A;  1SW4 A;  1B5J A;  1TFA A;  5BUU A;  2DS9 A;  2REJ A;  4NED A;  4EQ9 A;  5L9O A;  2I3V A;  5HBC A;  5I58 A;  3PPN A;  1OQH A;  3T22 A;  4BDM A;  4RK2 A;  4X48 A;  5L9S A;  3IOW A;  5I56 A;  5H8N B;  1AMF A;  1IEJ A;  3IOT A;  1CB6 A;  3SEW A;  3IOU A;  3O6G A;  4X9T A;  5I59 A;  2GHB A;  3RUM A;  3KSX A;  4JWY A;  2GFE A;  2QS2 A;  4PFW A;  5H8N A;  3UIF A;  3K0V A;  2DOJ A;  4GFR A;  1AOV A;  1GTK A;  4I9D A;  2OBG A;  1JET A;  4OFJ A;  3Q27 A;  4R72 A;  3ZKK A;  3SKP A;  2OWS A;  1Y4C A;  1QUL A;  2O51 A;  4O3B A;  1FCK A;  5DEX A;  1NNK A;  3G3H A;  3PMX A;  2XD2 A;  3JZJ A;  1B7Z A;  3MZ9 A;  3UGW A;  1QW0 A;  5DEX B;  3O29 A;  4XKR A;  2DE3 A;  2HZL A;  3C4M A;  1P1Q A;  5CMM A;  4DXC A;  1LST A;  3U8Q A;  5I84 A;  3K6U A;  4ONY A;  2E0S A;  5H8H B;  4F22 A;  3PMV A;  4U23 A;  5H8S A;  3JYR A;  1HSL A;  5KCJ A;  4U22 A;  1SW2 A;  4C0R A;  3BBR A;  4R2B A;  1L5T A;  3TKD A;  2XXY A;  1I69 A;  5K2Y A;  2OWT A;  2PT1 A;  3T93 B;  5I59 B;  1SVX B;  3VDF A;  2F7C A;  5I2K A;  2HXW A;  3LSX A;  3K6V A;  2V3T A;  2B65 A;  3OOA A;  1XS5 A;  3RLF E;  4H1X A;  2QRY A;  4MLQ A;  2Z23 A;  3W9V A;  1MY3 A;  2O1L A;  2X26 A;  3QYT A;  1O7T A;  4NF6 A;  4LUB A;  3C36 A;  4PFY A;  3E4R A;  3KBR A;  4ESW A;  2DWI A;  4NE4 A;  1ZIU A;  4EF2 A;  3MAM A;  4LP2 B;  1LB8 A;  2NOO A;  1HSE A;  2QMX A;  1B3E A;  3CFL A;  4G68 A;  5TP9 B;  2ZXT A;  3C32 A;  3H4Z A;  2H5Y A;  1WOD A;  2ONK E;  3N26 A;  4IB2 A;  1QUJ A;  4GL8 A;  4P0I A;  4HTG A;  5DVI A;  4RNS A;  3S2V A;  4ZE9 A;  5ISU A;  1N76 A;  3GBA A;  1B0L A;  5TPA B;  4IY5 A;  3RN8 A;  1YPN A;  1UTB A;  2RIN A;  1Y3N A;  1GR2 A;  2VOZ A;  3OD7 A;  5CBS A;  1H43 A;  1IXG A;  4LZ7 A;  5EYF A;  5TPA A;  4OES A;  4ELQ A;  3RT8 A;  3IJO B;  5FTH A;  2XX9 A;  2ZNU A;  3HCQ A;  4YU0 A;  2QMW A;  1D3K A;  1DSN A;  1MRP A;  1NNT A;  1BP5 A;  4OMB A;  4F1Y A;  4E0X A;  4I8C A;  1M5D A;  2HAU A;  4KHZ E;  1VFD A;  1POT A;  2G29 A;  3RTF B;  3L6G A;  2GHA A;  2PBW A;  3DEL B;  3MP8 A;  1URG A;  3CFZ A;  4OXV A;  1ATG A;  1MXX A;  1OQG A;  2PMS A;  3GZG A;  1J1N A;  1KWH A;  3IB0 A;  2LAO A;  3PUZ E;  4MF3 A;  4QRZ A;  4OYV A;  5AA4 A;  3MC2 A;  4DXU A;  4G8M A;  4Z7E A;  1P1U A;  2ALU A;  4POW A;  4QSE A;  1II5 A;  1MM7 A;  3KGC A;  3KOS A;  2NUV A;  4U1Z A;  5I57 A;  2VHA A;  3VVF A;  1S7Y A;  4UAC A;  3OEL A;  3Q29 A;  3H6V A;  1R9Q A;  4OEV A;  5HM4 B;  3TTK A;  3VFJ A;  2I0C A;  4DCX A;  3OEK A;  4YMA A;  3IK6 B;  3MP6 A;  1N3X A;  1FW0 A;  3IR1 A;  2HQ0 A;  3L6H A;  4KFQ A;  1US5 A;  2NXO A;  5H8Q A;  2I6E A;  1A99 A;  2VP1 A;  1N04 A;  4QHQ A;  4RPN A;  4XKN A;  4LZ8 A;  2Q9T A;  5AE4 A;  1MDQ A;  4RJZ A;  4K3F A;  1SQY A;  4ZDM A;  3TAJ A;  3LSW A;  3V5A A;  4ZED A;  2F5X A;  1TFD A;  4LA9 A;  1B3G A;  3MBP A;  4PFT A;  1MY1 A;  1XVX A;  4EUO A;  2Y84 A;  1TWY A;  1B6H A;  3K6W A;  1B7U A;  3MW0 A;  2XXP A;  2XXV A;  2DYX A;  2V3U A;  5K2X A;  4PE5 B;  5CC2 A;  2IEE A;  4DDD A;  1DPE A;  1DPP A;  1LB9 A;  1A8E A;  2V25 A;  2ZYO A;  3MUQ A;  4R74 A;  4G4P A;  3N5L A;  1B9J A;  3FV2 A;  4Q30 B;  2F36 A;  4QF9 A;  1LAF E;  5CMB A;  2I49 A;  3IL1 B;  2Q2C A;  1UQW A;  5F7V A;  2RF1 A;  3TOD A;  3K02 A;  3FXQ A;  2OZZ A;  1B5H A;  1MQD A;  1MXU A;  1D9V A;  4IGT A;  3EHS A;  5JTY B;  1IQ7 A;  1OMP A;  2VD2 A;  3HV1 A;  4ZS9 A;  1D4N A;  2F6P A;  1FQA A;  3H06 B;  3IOR A;  4KD5 A;  4DCY A;  1UIV A;  4RXL A;  3PMW A;  3KEI A;  1A7L A;  2UXA A;  2F35 A;  3E3K A;  5I56 B;  1OVT A;  3FJ7 A;  3QAX A;  1S9T A;  3TPA A;  3HHG A;  2DVZ A;  5H8F B;  1BIY A;  3T9V A;  1EZO A;  1H44 A;  3UA8 A;  1M5B A;  5CMC A;  1VSO A;  3M8U A;  3MPL A;  3U94 A;  5KDT A;  4F19 A;  3ODB A;  1B3L A;  1LAX A;  3DLN A;  3FJG A;  1P99 A;  3QK6 A;  4H0W A;  3TTR A;  3TDJ A;  4DIG A;  4H8J A;  3TCF A;  1PBQ A;  3K1P A;  4ELO A;  1B3H A;  3PPR A;  2VGQ A;  4HW8 A;  5KDT B;  3T9H B;  4X1B A;  3HHF A;  2XXH A;  1MM6 A;  1NH7 A;  1TT1 A;  3A3C A;  3ZSF A;  1OIB A;  2DVC A;  2Q88 A;  2ZYN A;  2DP8 A;  3KG2 A;  4IO6 A;  2O68 A;  3CSB A;  3ZS6 A;  3JV9 A;  3HN0 A;  4N6P A;  2H99 A;  2REG A;  5M2V A;  3EHT A;  2ZYM A;  2H9B A;  1Y3Q A;  5AA2 A;  1CE2 A;  1SD3 A;  3U92 A;  1N3W A;  4FIM A;  4RPO A;  2H25 A;  3N6T A;  5FTI A;  2VD3 A;  1Z7M E;  1PB7 A;  1N84 A;  1A54 A;  1ZKB A;  2GRV A;  1EH3 A;  2HEU A;  2V93 A;  3GBB A;  4G8H A;  5DT6 A;  4BLA A;  1MH4 A;  1N7W A;  1YCJ A;  2AL5 A;  4Q0C A;  3IB1 A;  4OZ9 A;  5CMK A;  1BTJ A;  1IXH A;  4IY6 A;  3VVD A;  1ELJ A;  2F78 A;  3BFU A;  4G68 B;  3RTW B;  2ANJ A;  2RCB A;  3LR1 A;  3H3G A;  3PD8 A;  3Q26 A;  3O6I A;  4RA1 A;  3TCH A;  2XXW A;  3MQ9 A;  4L17 A;  2F34 A;  4F3B A;  4LAT A;  4QFO A;  4ZEI A;  4KR5 A;  4AB6 A;  3I6V A;  1DTG A;  4IO2 A;  4R6H A;  2O84 X;  2R9J A;  4JBZ A;  4IO3 A;  3QUF A;  2UVI A;  3ILT B;  1VR5 A;  1PBP A;  2DE4 A;  4R73 A;  1Q1K A;  2NWJ A;  1SDX A;  2AL4 A;  4JWO A;  4THI A;  5FHN A;  3M3L A;  3R6U A;  1MQJ A;  2DQV A;  4IO7 A;  4OQO A;  3TFL A;  3S9E A;  1NMU A;  3HPI A;  1R6Z A;  3UN6 A;  1MPC A;  4QSD A;  3UP9 A;  1YTV A;  1B51 A;  3T9X B;  2Z22 A;  1LCF A;  1WVJ A;  3D4G A;  3IX1 A;  3QIM A;  3S9M C;  1FTO A;  2D5W A;  2HZK A;  3KFM A;  4OVJ A;  1SYI A;  3H03 A;  1P1N A;  4NF4 B;  4U4S A;  4XKQ A;  1QKA A;  1SW5 A;  1IIW A;  1B4H A;  3Q25 A;  3QSL A;  4P0G A;  4EQ7 A;  5IAI A;  4LQ2 A;  1SW1 A;  4H5F A;  3LBS A;  1LBC A;  1MS7 A;  4OET A;  3TMG A;  3B6Q A;  1PB8 A;  1JEV A;  4GXA A;  3SES A;  3T66 A;  4F3S A;  3EN3 A;  3A3U A;  2XX7 A;  4I1D A;  3VLW A;  2O69 A;  3OEM A;  1MXY A;  1ZMG A;  3OSR A;  1H3D A;  4OTE A;  2RC7 A;  1URS A;  3U72 A;  4KPT A;  3VE1 B;  3TEP A;  3QUJ A;  3F11 A;  4C1U A;  4RY1 A;  2GH9 A;  1ANF A;  3G7W A;  2ZNT A;  4R9F A;  1P1O A;  4MBP A;  1JEU A;  4NTL A;  2XD3 A;  2DWA A;  3KN7 A;  2AYS A;  2FNC A;  1M5C A;  3S9L C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...