2ABHA

Phosphate-binding protein (re-refined)
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
321
structure length
321
Chain Sequence
EASLTGAGATFPAPVYAKWADTYQKETGNKVNYQGIGSSGGVKQIIANTVDFGASDAPLSDEKLAQEGLFQFPTVIGGVVLAVNIPGLKSGELVLDGKTLGDIYLGKIKKWDDEAIAKLNPGLKLPSQNIAVVRRADGSGTSFVFTSYLAKVNEEWKNNVGTGSTVKWPIGLGGKGNDGIAAFVQRLPGAIGYVEYAYAKQNNLAYTKLISADGKPVSPTEENFANAAKGADWSKTFAQDLTNQKGEDAWPITSTTFILIHKDQKKPEQGTEVLKFFDWAYKTGAKQANDLDYASLPDSVVEQVRAAWKTNIKDSSGKPLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Modulation of a salt link does not affect binding of phosphate to its specific active transport receptor.
pubmed doi rcsb
molecule tags Phosphotransferase
molecule keywords PHOSPHATE-BINDING PROTEIN
total genus 112
structure length 321
sequence length 321
ec nomenclature
pdb deposition date 1995-11-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2abhA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2abhA02
1PB7A 1GR2A 4ELRA 4FATA 4PFYA 1OQGA 5EHMA 3O6HA 3TCHA 2AIXA 3KJTA 1B3LA 4OZ9A 3TUSA 3CRBA 3CVGA 5CMMA 3VVDA 4R73A 4FIMA 2F6GA 3TODA 3MPLA 1IXCA 1MM7A 1FCKA 2OLBA 1UIUA 1QJMA 3H6TA 3PUZE 1JETA 3V89B 3VVFA 2Z23A 3IL1B 4DDDA 5KZTA 2QSXA 3TPAA 3IOVA 1WVJA 3H4ZA 3PUWE 3HV1A 3VLVA 4E0WA 1IUDA 3A3UA 1MXWA 2OK2A 2RCAA 2NUVA 4IGRA 3K6WA 4O3AA 4R72A 1LB9A 2Y7IA 2Z8EA 2QS3A 2G29A 3K1MA 4Q0CA 3C9HA 3KSXA 4DE8A 3TFLA 3U93A 3RNNA 3S9LC 3TEPA 4AB5A 2HFBA 2Y7WA 1MH3A 1ZJLA 3QUFA 1PBQA 3FXQA 3G7WA 1H3DA 1DOTA 4JWOA 1ZTYA 1NH7A 4QSDA 4Q5TA 4OETA 1IEJA 3GXAA 5I2KA 4RK9A 4WKMA 1SI1A 2XXHA 3VLUA 4FE8A 2I48A 1B52A 1A8EA 4IO4A 3C31A 1AMFA 1Y1MA 5A5XB 4F29A 4MBPA 4R9FA 1XHYA 1FQFA 4NF8B 3IOWA 3TTKA 1A55A 1US5A 2QJEA 3IORA 4IY5A 4ZZEA 3RY3A 3TCGA 1R9LA 4JSDA 4F19A 3C32A 2V3QA 1P1QA 1MY1A 4F1YA 1P1OA 2HZKA 3OO7A 5DTBA 1AL3A 3TELA 1BP5A 2OWTA 3FATA 1SYIA 4ELQA 5KDTA 2OCUA 1YAEA 3O9PA 4GLIA 1ZMGA 4KPTA 3FXUA 4LQ5A 1OQHA 2I58A 4KYSA 2V3TA 1H44A 3KEIA 3KG2A 2M8CA 5H8SA 5H8QB 2UVJA 4ND9A 4C0RA 3CFZA 3DP6A 3PUVE 4PFUA 2Q9TA 4KHZE 2H99A 3RPWA 4LZ7A 1DTZA 3T22A 4MF3A 1UQWA 2GRVA 3PMXA 3KZGA 3S2VA 5K2YA 1I6BA 2HAVA 5CMKA 3N6TA 1DMBA 1LFIA 1VFDA 4RPNA 4R75A 4YKJA 1ELJA 3SETA 3U72A 3ZSFA 5HM4B 4ZE8A 5JK4A 4KFQA 3T9UA 1TT1A 4YB6A 5JTYA 2F78A 4XKNA 3TKDA 3SEVA 1S50A 4BDMA 1MXUA 2O7UA 1URDA 5AA2B 4MLQA 1FTJA 1PBPA 3AXFA 1B32A 1IXGA 3D4CA 3IJXB 5I2NB 1LFHA 3LBSA 2DWIA 1PB8A 3FASA 5CC2A 5EHSA 2X7PA 4OEUA 2RKMA 1WODA 1J1NA 4KQPA 4FAJA 3TQLA 2F7AA 3PU5A 4X1BA 2UYEA 1JW1A 4XXUA 5TPAA 4M4GA 4F2QA 5KCJB 1YPNA 2QMXA 4EF1A 2OBGA 1S7YA 4WEDA 4ZE9A 3FIRA 2R6GE 2XXVA 4U21A 1OVBA 3E13X 2XX9A 3EPEA 3VFJA 1L5TA 2ZYKA 1IQ7A 2F35A 3JV9A 5TP9B 1A54A 1D3KA 3A3CA 3BFUA 3C33A 2XX7A 1B7UA 3H7MA 1XVXA 3OENA 2FNCA 4H1XA 1GTKA 1OVTA 2FYIA 3I5OA 4DCXA 5ISUA 4K3FA 2I3VA 3O2AA 4NF6A 4OFOA 2F97A 4Z0IA 1OLAA 1XVYA 5IAIA 1Y3PA 1B0LA 3DP4A 2PT1A 3KGCA 3OO8A 3GBAA 2D21A 5DVIA 3H6WA 4YZZA 3SESA 5I56A 4U4XA 1TFAA 1M5EA 4U2RA 1LSTA 1Y4CA 3OELA 1GVCA 3S9EA 1FTOA 1NNPA 1VE4A 4EQ7A 3K6UA 2XXYA 1P99A 3O97A 4DLDA 3DP8A 4U1ZA 4UA8A 2HAUA 1LBBA 3K00A 5CRYA 3V5AA 2XD3A 5I59B 5H8HA 4HW8A 3U1OA 2DE4A 4NWCA 3LC8A 4XTCQ 4ZEFA 3CR9A 3PMWA 4R6YA 3T93B 1XC1A 2XXTA 3ZS6A 5JTYB 4QSCA 2DVZA 1LAXA 4YAHX 1SW2A 4ESWA 1B1XA 4OERA 4NF5B 3PMVA 2QS4A 1OLCA 5I59A 4G8MA 1FQBA 1I6QA 2VGQA 1N84A 3KOSA 3MPKA 4IO7A 3C35A 1RYOA 3CSGA 4IO2A 2B65A 2F7CA 3ILUB 5DVFA 1MY3A 1QVSA 3G3HA 3PPPA 5FHOA 3CSBA 1VSOA 3G3JA 4OFLA 5CM6A 2O51A 3CIJA 3ONMA 3KJ7A 3K4UA 3P7IA 2CMOA 5DVJA 3F11A 4GL8A 4LUBA 1P1NA 4ECFA 4BLAA 1EZPA 4H8JA 4DXUA 3K01A 4QF9A 3BKIB 3H3GA 3PD9A 5TPAB 3UA8A 3H06B 3JYRA 4QSEA 4PQJA 2O6AA 1MQDA 5FTHA 3SEYA 3MP8A 1N0TA 1N3XA 2W7YA 4KYEA 3TTLA 1FQCA 2HZLA 2RC7A 3KN3A 3FVOA 4ESXA 3HCQA 1GGGA 3ECRA 4LZ5A 1B9JA 4LVQA 4NF4B 3SERA 2H5YA 2ONRA 5L9SA 1B4ZA 2DOJA 4GRKA 1SQYA 4RK2A 2IEEA 1A40A 1FTLA 3TAJA 5CBSA 5I2NA 1ZLQA 1JW5A 2Q89A 4H5FA 2QS2A 4R6HA 1LBCA 2PT2A 1HSJA 2F5XA 3CFXA 2Y7RA 1B5HA 2RC8A 1A7LA 3QIMA 2UYFA 1ATGA 2VD3A 2A5SA 3MQ9A 2DSFA 2QPQA 5TU0A 3SEXA 3B6QA 1DPEA 2F34A 4C1UA 3RGYA 5KCJA 4NMYA 3FVGA 2THIA 2XXQA 3VXCA 2QL3A 1R6ZA 1D9VA 1FTKA 4LA9A 3QYTA 1JEVA 1FW0A 1MQJA 1VFEA 2DQVA 2REGA 1MY0A 3FXRA 3ODBA 5AA2D 2O1MA 3OO6A 1MQHA 3IO4A 2YJPA 4IO3A 4R2BA 3S4UA 3I6VA 1FQDA 3BFTA 3RLFE 3Q29A 3MBPA 2O69A 3HHGA 1Y1ZA 1B5JA 4GVOA 1MDP1 1QW0A 4U22A 3UK4A 1F9BA 5AE4A 1MXZA 3OMBA 4YMAA 3QSLA 2NOOA 2CZLA 3WAFA 1XOCA 1Y9UA 3JZJA 1D4NA 2VHAA 2WKYA 3U8QA 5AA4A 1US4A 3N94A 4FECA 3T96B 3VV5A 5I84A 4ZDMA 4F39A 3MWBA 3PD8A 4RA1A 1USYE 2IA4A 3LSWA 1EH3A 1UTBB 4X1DA 1MXVA 4KCDA 2OZZA 2DXRA 2GHBA 1Y3QA 4G2ZA 3TTNA 3S9MC 1YCJA 2H9BA 2YLNA 3RTFB 1NNKA 1OMPA 3K02A 3L6HA 3FV2A 4N07A 1FTMA 3ILTB 4GQOA 1SVXB 3OSRA 4U23A 2DE3A 3Q25A 3OEMA 3K6XA 4H0WA 4TLMB 5FTIA 4U4SA 3KFMA 5FHMA 5H8QA 5JEIA 2HEUA 2XXXA 3KSJA 2QRYA 3MZ1A 3PUYE 3ZKLA 4FJPA 4LZ8A 4HS7A 1M5FA 4RJZA 3G3IA 1VR5A 3SEUA 4C1TA 1H43A 3H6VA 5AA1A 1POTA 4XKRA 1A99A 2XXRA 1QUJA 3BBRA 2GHAA 1ZIUA 3UN6A 1SI0A 3TMGA 3PUXE 1URGA 1AH5A 3FZVA 3V83A 3MUQA 1DPPA 1LB8A 3H03A 4E0XA 4U1OA 3WAEA 1LLSA 4G8NA 1ZU0A 1S9TA 4G68A 4QFPA 1USYH 3W15C 2PX1A 1A8FA 2NVUB 1B3FA 4ZEDA 5I57B 1QULA 1O64A 3E9XA 3MVWA 2ABHA 4F31B 4NWDA 2I4CA 1Z7ME 2PVUA 3OEKA 3PGFA 4GWOA 5ITPA 1LCFA 2Y7PA 5H8FB 4ZEKA 3RN8A 1B3GA 1MS7A 1MH4A 2XXWA 4G68B 1P1WA 4YB7A 4O3CA 5HBCA 4EXKA 5KDTB 5F7VA 1ZBMA 3O28A 2Z8FA 4OTEA 3KOTA 4X9TA 2Z8DA 4HTGA 1BKAA 1MM6A 3PPOA 4N13A 4KYDA 3MP6A 1B4HA 1IXHA 2DYXA 5L8DA 4OVJA 3RUMA 2AL4A 3K1PA 1N04A 4XKQA 3O6GA 2YPNA 3HN0A 3W9WA 1B3HA 3VE1B 1JVYA 4ONYA 4TOZA 1I69A 4FEDA 1B7ZA 4LONB 4BDNA 4YMBA 3Q28A 2DWHA 2ZNUA 3FUZA 1B6HA 2GFEA 4P0GA 5ICQA 1Q1KA 3R6UA 1SW4A 1NNFA 1RYXA 3LSXA 1QUKA 2DVCA 2PMSA 3O66A 1EZ9A 1MRPA 4JSOA 1EZOA 2ONSA 3T9XB 5DYHA 3B7DA 2ZYOA 1MQIA 2A5TA 2D3IA 3D4GA 4YKKA 5L9MA 3B6WA 1XS5A 3QXMA 4BDOA 1T0KA 4MLVA 2DWJA 3VDFA 1B1HA 1CE2A 2Q8JA 3CG1A 5L9OA 1OIBA 3TTMA 2G93A 2XXIA 1MDQA 3LR1A 3HO7A 3IB0A 3TYHA 4F22A 3MVXA 5M2VA 4F18A 5LOMA 4GFRA 4POXA 3FJ7A 2ZYMA 2Y84A 1SDXA 3OXNA 4G77A 4JWYA 2O68A 4IO6A 1LAFE 1JVXA 5TP9A 5CMBA 5I57A 2B3FA 1PDAA 4GL0A 1LGBC 3IB1A 4OHNA 4WEPA 4XIGQ 4JWXA 4PFWA 4Q30B 3LUYA 3TZAA 1D9YA 4MH5A 1NKXA 2PYYA 4G68C 4OESA 1MG1A 3V8XB 3VVEA 4OEVA 4YKPA 2XD2A 2HCAA 5H8FA 4PFTA 5A5XA 1JW4A 1MPCA 4HCYA 3U92A 3M3FA 3THIA 2UVHA 3UP9A 4YKIA 4AB6A 1HSEA 1M5DA 1N7WA 4NF8A 2GH9A 3IX1A 4IO5A 4O3BA 1DTGA 1N3WA 3PPRA 3FJMA 4H65A 4ZEBA 4EQ9A 1B3EA 1B5IA 4NE4A 1IITA 2D5WA 3CFLA 5F1QA 4L17A 2I0BA 3GZGA 1JNFA 1B46A 2DXYA 4F3PA 4QFKA 1NFTA 1JEUA 1O63A 2F7BA 2V3UA 3A09A 4BDLA 4AQ4A 3PV0E 3Q26A 1PEBA 4POWA 2FA7A 3TCFA 4G4PA 2KLFA 3UIFA 4I1DA 4IGTA 4XKPA 4BDQA 3IK6B 5H8NB 1IIWA 4ELPA 4M1VA 4DZ1A 1QUIA 5DEXA 4ZECA 3MW0A 1KWHA 1B05A 1BTJA 1LAHE 2H4IA 1QKBA 2A5TB 3K2DA 1CB6A 3DLNA 4FEBA 4ELOA 5H8NA 4ZS9A 5EYFA 3TQWA 3MC2A 1B58A 3B6TA 1NMUA 2E0SA 5DEXB 2DWAA 2V25A 2ESNA 4P11A 4DXCA 4JDFA 5I56B 5I2KB 2BJJX 4R74A 2E1SA 3MZ9A 1IXIA 4NF6B 4F1UA 4PETA 4QHQA 4KR5A 2OJTA 4GF8A 1PC3A 3FVNA 4RY1A 4DXBA 5BUUA 2AYSA 1Y3NA 1SD3A 2AL5A 1LCTA 1LFGA 4OXVA 1B7HA 2QMWA 2V84A 4OENA 3T9HB 3UORA 4GIZA 4H5GA 1IZ1A 1RKMA 3EHSA 3RQTA 2RF1A 1TWYA 2HQ0A 2R9JA 3FGSA 3MZBA 3FJGA 3QAXA 4GD5A 3VXBA 2Q88A 2R71A 1QKAA 3N6UA 4NF5A 3O29A 2ZYNA 3EN3A 2ALUA 5ELVA 5HPQA 2I6EA 2B3BA 5B7DA 4IY6A 1N76A 4LQ2A 1N7XA 2ZXTA 4X48A 3L6GA 4TLLB 2H25A 4I9DA 5CMCA 4EUOA 4GXSB 4HCWA 2X7QA 3GBBA 3KBRA 1II5A 1MQGA 2XXPA 2ANJA 2ZNTA 5IKBA 2NWJA 4LP2B 2ONKE 2F8DA 1MXXA 2V93A 4IB2A 4PE5B 4N6PA 2O7IA 2P1SA 1XT8A 1Y20A 4THIA 3TDJA 1MPBA 1SW5A 4KI0E 5BWJA 4H67A 4OYVA 1WDNA 4PP0A 3DM0A 1PB9A 1TFDA 3FD3A 1M5BA 3LSLA 1TXFA 1ZKBA 3FVKA 4KD5A 4MFIA 4F2OA 3VLWA 1MY2A 2UVIA 2XX8A 3SDFA 2REJA 1UIVA 2DS9A 1ANFA 2O84X 3EQ1A 4F3BA 3EHTA 2VP1A 1BIYA 3C36A 4DCYA 4YB5A 3T9VA 2VOZA 1O7TA 3G3FA 4I8CA 2VD2A 3IB2A 4EDPA 4OQOA 3CI8A 5H8HB 2I3WA 3IO6A 5I58A 4UACA 2OWSA 3U94A 1EU8A 3W9VA 3R7XA 4ZZAA 3S9NC 3IR1A 5CI5A 3IOUA 4H8IA 2F6PA 2DP8A 3G3KA 3MVYA 3Q27A 1H45A 2RCBA 4GOTA 1SYHA 1Z7NE 2P2AA 2XHDA 3FV1A 3MAMA 1FQEA 3PPNA 1UTBA 4G8HA 3RT8A 4BDRA 1POY1 3K6VA 4OFJA 4EXLA 1H76A 2Q2AA 5K2XA 5I58B 1LAGE 4NTLA 2ZMBA 4R2FA 4ZEIA 4NEDA 3LSFB 5J1DA 4GXAA 2X26A 4R6KA 1B51A 1MPDA 4QFOA 5AA3A 3ZKKA 5CBRA 4RXLA 3TTRA 3IAZA 3N5LA 3OO9A 1AIVA 4DIGA 1NH8A 1NNTA 1Q35A 2PBWA 3I3VA 3KN7A 1UTHA 2F36A 2RC9A 4QFLA 1YTVA 3RTWB 4EF2A 1JQFA 1SBPA 3G3GA 3PPQA 1NL5A 5FHNA 3T66A 3E3KA 1M5CA 2DE2A 4Q8RA 2Y7KA 1MY4A 3C4MA 1FQAA 2I0CA 3KN8A 3K0VA 4RPOA 2QS1A 3MJNA 3EF7A 4JXIA 1DSNA 3MVZA 4YICA 4RNSA 3RT6B 3SKPA 5B70A 3N26A 3IOTA 4NF4A 4OWDA 2Z22A 4F3SA 4F3GA 3C34A 1UTHB 3HHFA 5AA4B 3M3LA 3E4RA 2O1LA 4TQUQ 5DT6A 4OMBA 2ZNSA 1MXYA 3DELB 3EHUA 3M3KA 3QK6A 4I62A 1B40A 4JB7A 3H6UA 4QRZA 3HPIA 3OD7A 4P0IA 5ICTA 2HXWA 4EQBA 2I49A 3SEWA 2LAOA 2NXOA 3OOAA 1R9QA 1Y4TA 3MP1A 3M8UA 1HSLA 4F1VA 2RINA 3K1NA 3QUJA 1B2HA 3R26A 1I6AA 4QFNA 1P1UA 4LATA 1B0HA 4R9GA 2Q2CA 4WXJA 3USDA 4RYAA 1URSA 3IJOB 2I4BA 2XXUA 4H6DA 1R1NA 5AA2A 3O6IA 1AOVA 4Z7EA 2UVGA 2H98A 2UXAA 5ITOA 1SW1A 4JBZA 4KCCA 3CG3A 3HSTA 4ISUA 4FORA 3OSQA 1BLFA 4YU0A 1GV8A 3UGWA 2P0SA 3GLBA
chains in the Genus database with same CATH superfamily
1OQGA 3TCHA 2AIXA 5EQ7A 3CVGA 5CMMA 4FIMA 2OLBA 1DBZA 1QJMA 3IL1B 2QSXA 3IOVA 3HV1A 4PAFA 1MXWA 2OK2A 4O3AA 2Q8MA 1FPFA 2Z8EA 4DE8A 3K1MA 4Q0CA 3EKIA 3RNNA 4JWOA 4OETA 1IEJA 1A8EA 4F29A 4R9FA 1XHYA 1FQFA 5EQ8A 1A55A 4IY5A 4ZZEA 4F19A 1R9LA 4GWZA 2V3QA 4F1YA 1P1OA 1AL3A 3FATA 2OCUA 1ZMGA 1OQHA 4KYSA 5H8SA 5H8QB 4GX6A 2MKZA 3CFZA 4PFUA 2H99A 4LZ7A 1FSAA 2GRVA 3PMXA 3S2VA 5K2YA 5CMKA 1LFIA 4P47A 4ZE8A 5JK4A 4KFQA 5JTYA 3SEVA 1MXUA 3AXFA 5I2NB 1PB8A 2X7PA 1XI6A 2VPNA 1WODA 4FAJA 2FHYA 2B4MA 1IMAA 5TPAA 1YPNA 1S7YA 2XXVA 1LBXA 3E13X 1IQ7A 3C33A 3BFUA 3H7MA 5IAIA 3SZPA 1XVXA 3ROJA 1OVTA 3QMFA 1BLFA 4OFOA 1OLAA 4XF5A 1IMEA 3DP4A 2PT1A 3KGCA 5DVIA 3H6WA 4U4XA 1M5EA 1Y4CA 4EQ7A 5H8HA 4HW8A 4ZEFA 3PMWA 3ZS6A 1LAXA 4YAHX 4ESWA 1OLCA 5I59A 4G8MA 4EDPA 1RYOA 3PPPA 2O51A 2WBBA 5DVJA 4N81A 4ECFA 4H8JA 4DXUA 3H3GA 3RPLB 4I3EA 3JYRA 4QSEA 3MP8A 1N0TA 3KN3A 3ECRA 4LZ5A 4NF4B 3SERA 4RK2A 1FTLA 3FXBA 1FPEA 2FBPA 1NV0A 2PT2A 2F5XA 1B5HA 1A7LA 2A5SA 2QPQA 1FPKA 1DPEA 4C1UA 4NMYA 2XXQA 3QYTA 1MQJA 3ODBA 4XEQA 2O1MA 5ESYA 3IO4A 1Y1ZA 1B5JA 1MXZA 3NOHA 2NOOA 4MX6A 5AA4A 2WKYA 2VHAA 1US4A 2V4CA 5IZ3A 2IA4A 1UTBB 4X1DA 1MXVA 1Y3QA 2H9BA 5I5PA 3L6HA 5F7VA 1FTMA 4F3GA 3OSRA 2DE3A 3Q25A 4TLMB 5FHMA 3KSJA 1BK4A 2KQZA 3LUZA 4MMPA 4HS7A 1M5FA 4RJZA 3G3IA 1VR5A 4C1TA 1POTA 4XKRA 1A99A 3FZVA 1LB8A 3H03A 1LLSA 2CZHA 1S9TA 4G68A 2NVUB 1B3FA 2WX9A 1QULA 1FPBA 2ABHA 1Z7ME 5ITPA 4IR8A 4G68B 3LV0A 4O3CA 4EXKA 4X9TA 4HTGA 1BKAA 4KYDA 5B70A 5L8DA 3RUMA 2AL4A 5EYHA 3O6GA 3CHGA 4TOZA 4FEDA 3IFCA 5IZ1A 1QUKA 2DVCA 4JSOA 3B7DA 1MQIA 2A5TA 3QXMA 1T0KA 1B1HA 5I3SA 4G61A 1CE2A 2Q8JA 1OIBA 2G93A 3LR1A 1QGXA 5M2VA 2WEFA 1LAFE 5TP9A 3FBPA 3IB1A 4WEPA 4Q30B 4MH5A 3V8XB 4MCOA 4OESA 3VVEA 2UVHA 3UP9A 4AB6A 1HSEA 4NF8A 3IX1A 4IO5A 3PPRA 4EQ9A 4GBVA 1IITA 3CFLA 3GZGA 1JNFA 1B46A 2DXYA 4QFKA 1NFTA 1LBWA 1JEUA 3A09A 4O8MA 4G4PA 3UIFA 4XKPA 4BDQA 3IK6B 3B50A 5DEXA 4PDDA 3K2DA 3HFUA 3BIGA 3MC2A 2V25A 3MZ9A 3PTYA 4KR5A 1NI9A 4GF8A 2VT5A 2ZZXA 3FVNA 5BUUA 4P8BA 1B7HA 4GIZA 1TWYA 3MZBA 2R9JA 2Q88A 4NF5A 3O29A 2ZYNA 1N76A 3L6GA 4GXSB 3GBBA 2XXPA 5IKBA 2NWJA 4TLLB 1NUZA 4PF6A 1WDNA 1M5BA 1TXFA 2UVIA 1ANFA 2VP1A 1BIYA 3C36A 2VOZA 3G3FA 2VD2A 3IO6A 5I58A 2QVVA 1EU8A 3R7XA 4ZZAA 2DP8A 1H45A 3PPNA 4N17A 1POY1 4OFJA 4EXLA 4P1LA 1NV6A 4MHFA 1D9QA 5I58B 1MPDA 5AA3A 3OO9A 5B7DA 1NNTA 3RTWB 1UTHA 1SBPA 4P1EA 3T66A 2DE2A 4Q8RA 1FQAA 2QS1A 4F3SA 2Z22A 3C34A 1UTHB 5AA4B 3E4RA 2O1LA 4TQUQ 5DT6A 4JB7A 3DELB 4I62A 3H6UA 2HXWA 2LAOA 2NXOA 3OOAA 1R9QA 4F1VA 3K1NA 3QUJA 4N91A 1I6AA 1P1UA 4LATA 2Q2CA 3IJOB 4O7MA 2UVGA 2H98A 2UXAA 5ITOA 1SW1A 3HSTA 3FVGA 1PB7A 1GR2A 4PFYA 3KJTA 1K9YA 1B3LA 3CRBA 3VVDA 2F3DA 1IXCA 1MM7A 4DDDA 1NUWA 2GQ1A 4E0WA 4N4UA 4PF8A 2Q74A 2RCAA 4R72A 1LB9A 3KSXA 3TFLA 3QUFA 2Y7WA 1MH3A 1VDWA 1ZJLA 1ZTYA 1NH7A 4MJOA 1SI1A 2XXHA 2QFLA 4FE8A 2I48A 5A5XB 3IOWA 3TCGA 3RY3A 1P1QA 5DTBA 1EYKA 1BP5A 2OWTA 5KDTA 1SYIA 3O9PA 4KPTA 4LQ5A 2I58A 2M8CA 5FBPA 4C0RA 1G0HA 1FPGA 4MF3A 3KZGA 2HAVA 1FBCA 1DMBA 3SETA 1VFDA 4RPNA 4XKNA 2O7UA 1FTJA 3IJXB 1B32A 1IXGA 2DWIA 4OEUA 2RKMA 3GYYA 1J1NA 3PU5A 4PE3A 4F2QA 2QMXA 4EF1A 4WEDA 4ZE9A 2R6GE 1OVBA 2XWKA 3EPEA 5ET7A 2ZYKA 5TP9B 1D3KA 3A3CA 3OENA 5ET5A 2I3VA 3O2AA 4NF6A 1B0LA 5I56A 2D21A 1GVCA 3S9EA 3K6UA 3V5AA 2XD3A 3LC8A 4XTCQ 1XC1A 4GBWA 4NF5B 1LBVA 2QS4A 1FBEA 3PMVA 4IO7A 1FTAA 4IO2A 4JVDA 3C35A 5DVFA 2B65A 1MY3A 1QVSA 3CSBA 1VSOA 3ONMA 3A29A 3F11A 4LUBA 1P1NA 1FBDA 1KA1A 1EZPA 5TPAB 4PQJA 3SEYA 1N3XA 4KYEA 3TTLA 2RC7A 1GGGA 1B9JA 2ONRA 2DOJA 5I2NA 4H5FA 1LBCA 1HSJA 3QIMA 2VD3A 2P3VA 5TU0A 4AS5A 2F34A 3RYDA 3VXCA 2QL3A 1R6ZA 1D9VA 1FTKA 4O94A 1JEVA 2REGA 5A5LA 3FXRA 2JJKA 2XWIA 2QVUA 3BFTA 3RLFE 3MBPA 3HHGA 3UK4A 1F9BA 1FRPA 1XOCA 1D4NA 3U8QA 1FPIA 4GWUA 4ZDMA 3MWBA 1USYE 3LSWA 1EH3A 1YXIA 4LN5A 3RTFB 1OMPA 4U23A 3ILTB 5FTIA 1DK4A 3OEMA 1IMBA 3KFMA 3PUYE 5IM2A 1NUYA 2CEXA 1H43A 5AA1A 2GHAA 3UN6A 1JP4A 3PUXE 1URGA 3V83A 3MUQA 4U1OA 4NF0A 1USYH 4NWDA 2I4CA 2PVUA 3E78A 5H8FB 4ZEKA 2XXWA 1MH4A 1P1WA 3O28A 2Z8FA 3KOTA 2Z8DA 1MM6A 1G0IA 2DYXA 3K1PA 3VE1B 4ONYA 4BDNA 1I69A 4YMBA 2DWHA 3FUZA 1B6HA 4P0GA 4PFBA 1SW4A 1NNFA 1RYXA 1MRPA 2ONSA 3T9XB 5L9MA 3VDFA 4HE2A 1IMFA 3HO7A 4JVCA 3TYHA 5LOMA 4GFRA 4POXA 3FJ7A 1SDXA 4IO6A 2B3FA 4XIGQ 1LGBC 4OHNA 3MYUA 4JWXA 3TZAA 1NKXA 2PYYA 3U92A 4YKIA 1M5DA 2GH9A 4O3BA 1N3WA 4GWYA 4NE4A 2D5WA 2I0BA 4F3PA 2F7BA 2KLFA 1IIWA 4ELPA 4M1VA 4DZ1A 4ZECA 1B05A 1LAHE 2A5TB 2ZZVA 5EYFA 3B6TA 1NMUA 5I2KB 4PBQA 3RPLA 1IXIA 4F1UA 4PETA 2OJTA 2AYSA 1Y3NA 2AL5A 1LCTA 4OENA 3T9HB 3UORA 3QAXA 4GD5A 1QKAA 3EN3A 2ALUA 4IY6A 4X48A 1N7XA 4NX1A 4I9DA 4EUOA 4HCWA 2X7QA 1II5A 4X8RA 4LP2B 2ONKE 2F8DA 2V93A 4IB2A 3UA8A 5ICQA 3TDJA 1MPBA 1SW5A 2CEYA 4OYVA 3VLWA 2XX8A 3T9VA 1O7TA 2I3WA 3U94A 3W9VA 3S9NC 3IR1A 2XWVA 3IOUA 5CI5A 4MNIA 3FV1A 1UTBA 3K6VA 5J1DA 4R2FA 4PFRA 4NEDA 1B51A 3ZKKA 3IAZA 1NH8A 2PBWA 2F36A 2RC9A 3G3GA 5FHNA 1MY4A 3C4MA 2I0CA 1FBFA 4OWDA 3HHFA 1MXYA 3EHUA 3QK6A 3HPIA 4P0IA 5ICTA 4EQBA 3SEWA 3MP1A 1HSLA 4GX3A 2RINA 1B2HA 1B0HA 5EYGA 4H6DA 1FPDA 5AA2A 1LBYA 4ISUA 4FORA 2P0SA 4NAPA 5EHMA 3TUSA 4R73A 2F6GA 3TODA 3MPLA 1FCKA 1UIUA 3H6TA 1JETA 3VVFA 5KZTA 2Z23A 1WVJA 3A3UA 4N6KA 2Y7IA 3C9HA 3U93A 3S9LC 3TEPA 4AB5A 2HFBA 1PBQA 3FXQA 1H3DA 1DOTA 2DDKA 2FIXA 4Q5TA 5I2KA 4RK9A 4WKMA 4PDHA 3VLUA 1B52A 1Y1MA 4MBPA 4NF8B 1US5A 2QJEA 3IORA 3C32A 1YYZA 2HZKA 3T0JA 3TELA 4ELQA 1RDXA 4GLIA 3FXUA 2V3TA 1H44A 4ND9A 3DP6A 3PUVE 2Q9TA 4KHZE 5LDZA 3RPWA 3ZSFA 5HM4B 5EQAA 2XXKA 4YB6A 2F78A 3TKDA 4BDMA 4MLQA 1FBHA 3FASA 5EHSA 2HHMA 4KQPA 3TQLA 2F7AA 4X1BA 1JW1A 4XXUA 4M4GA 5KCJB 4OVPA 3VFJA 2XX9A 1NV4A 1B7UA 2XX7A 2FNCA 4K3FA 2WYKA 4HE1A 4Z0IA 2F97A 1XVYA 3OO8A 3GBAA 1LSTA 1LBZA 1VE4A 2XXYA 1P99A 4DLDA 4UA8A 3K00A 5I59B 2HPGA 2DE4A 4NWCA 3CR9A 3T93B 1YZ0A 3BIHA 4MIJA 1I6QA 1N84A 3KOSA 3ILUB 4GX4A 4MNPA 1AWBA 3G3JA 4OFLA 3P7IA 3KJ7A 3K4UA 4NHBA 4GL8A 3BKIB 3H06B 2W7YA 1FQCA 2HZLA 4ESXA 2H5YA 1IMDA 4PFIA 2IEEA 1A40A 3TAJA 5CBSA 1ZLQA 1JW5A 2Q89A 4R6HA 4QBAA 2Y7RA 2RC8A 2UYFA 3MQ9A 3B6QA 3KC0A 3RGYA 2THIA 1NV1A 1VFEA 1MY0A 3OO6A 4IO3A 2YJPA 3S4UA 3I6VA 1FQDA 4I40A 3Q29A 2O69A 4U22A 3OMBA 2CZLA 3VV5A 4DI4B 4F39A 3PD8A 4RA1A 4PCDA 4KCDA 2OZZA 2GHBA 3S9MC 1NNKA 3MSTA 4N07A 3FV2A 4OA4A 2FIEA 4GQOA 5H8QA 3K6XA 2HEUA 2XXXA 2QRYA 3ZKLA 4FJPA 5LTCA 1NV3A 1ZIUA 1SI0A 3KBZA 1AH5A 4E0XA 4QFPA 4HE0A 1A8FA 5I57B 2L5VA 3E9XA 4F31B 3OEKA 4GWOA 1LCFA 4NN3A 1MS7A 5HBCA 5KDTB 1INPA 1FBPA 4N13A 1B4HA 1IXHA 2PFYA 4OVJA 1N04A 4I3YA 4XKQA 2YPNA 3W9WA 1NUXA 1B3HA 4PAIA 1LEVA 4LONB 1B7ZA 3Q28A 2ZNUA 1FJ6A 3LSXA 2PMSA 3O66A 2R8TA 5DYHA 2ZYOA 4YKKA 3B6WA 1XS5A 4BDOA 2DWJA 3ISPA 1NV2A 5L9OA 3IB0A 4F22A 3MVXA 4F18A 3OXNA 4JWYA 1PDAA 4GL0A 4PFWA 3LUYA 4G68C 1MG1A 4YKPA 2XD2A 2HCAA 1JW4A 1MPCA 4PBHA 3THIA 1N7WA 1SPIA 4ZEBA 1B3EA 1B5IA 4L17A 2VPOA 1O63A 4BDLA 3Q26A 4POWA 5H8NB 4IGTA 1QUIA 1BTJA 2H4IA 4H45A 1DCUA 1CB6A 3DLNA 4FEBA 4ELOA 5H8NA 3TQWA 1B58A 5I56B 2E0SA 5DEXB 2ESNA 4DXCA 4JDFA 2BJJX 4R74A 4N8YA 4QXDA 1LFGA 2QMWA 4H5GA 1IZ1A 3B8BA 3RQTA 4N15A 3FGSA 2R71A 2I6EA 2B3BA 4LQ2A 2ZXTA 3KBRA 5ET6A 2ANJA 2ZNTA 1MXXA 3TTMA 4N6PA 1Y20A 5BWJA 5DW8A 4H67A 4PP0A 3DM0A 1PB9A 4KD5A 3FVKA 4MFIA 1MY2A 2Y5KA 2REJA 1UIVA 2XWOA 2DS9A 3EQ1A 3EHTA 4DCYA 4I8CA 3IB2A 4OQOA 3CI8A 5H8HB 4OVQA 1FPLA 4OANA 4H8IA 3G3KA 4MEVA 2P2AA 2XHDA 4BDRA 4P3LA 4O7IA 1LAGE 4NG7A 4NTLA 4GXAA 2X26A 2BJIA 4R6KA 4QFOA 5CBRA 4P9KA 3TTRA 1AIVA 4DIGA 1Q35A 3I3VA 1YTVA 4EF2A 3PPQA 2Y7KA 3KN8A 3K0VA 4YICA 3MJNA 3EF7A 3MVZA 3IOTA 4NF4A 4QRZA 1B40A 2I49A 4HXVA 1Y4TA 2HXRA 3USDA 1URSA 2PCRA 2I4BA 2XXUA 3O6IA 2XA5A 4JBZA 1GV8A 3UGWA 4GWWA 4H46A 4ELRA 4FATA 3O6HA 4OZ9A 1EYJA 3PUZE 3V89B 2OWZA 3TPAA 3H4ZA 3PUWE 3VLVA 3IFAA 1IUDA 4NGUA 2NUVA 4IGRA 3K6WA 2QS3A 4DI3D 2G29A 3G7WA 4QSDA 3GXAA 4IO4A 3C31A 1AMFA 3TTKA 4JSDA 1MY1A 3OO7A 1NV7A 4OVTA 4NQ8A 1YAEA 3KEIA 3KG2A 2UVJA 4GWSA 1DTZA 4GWXA 3T22A 1UQWA 1I6BA 3N6TA 3U72A 4R75A 4YKJA 1ELJA 2P3NA 3T9UA 1TT1A 3KC1A 1S50A 1URDA 5AA2B 1PBPA 1LFHA 3D4CA 3LBSA 5CC2A 5ET8A 2UYEA 2OBGA 3FIRA 4U21A 1L5TA 3JV9A 2F35A 1A54A 4H1XA 4DCXA 5ISUA 1GTKA 2FYIA 3I5OA 1Y3PA 4YZZA 3SESA 1TFAA 4U2RA 3OELA 2CZIA 1FTOA 1NNPA 1CNQA 2PFZA 3O97A 3DP8A 4U1ZA 2HAUA 1LBBA 5CRYA 3U1OA 4R6YA 2XXTA 5JTYB 4QSCA 2DVZA 1SW2A 1B1XA 4OERA 4PTKA 1FQBA 2VGQA 3MPKA 3CSGA 2F7CA 3G3HA 5FHOA 2KR0A 5CM6A 3CIJA 2CMOA 4BLAA 3K01A 4QF9A 3PD9A 5FTHA 2O6AA 1MQDA 2WYPA 3FVOA 3HCQA 4LVQA 1B4ZA 4GRKA 1SQYA 2QS2A 3CFXA 1ATGA 2DSFA 3SEXA 5KCJA 4OVSA 4LA9A 1FW0A 2DQVA 5AA2D 1MQHA 4R2BA 5F24A 4PGPA 4GVOA 1MDP1 1QW0A 5AE4A 4YMAA 3QSLA 5T3JA 3WAFA 1Y9UA 3JZJA 3N94A 4FECA 3T96B 5I84A 5J16A 2DXRA 3TTNA 4G2ZA 1YCJA 2YLNA 3K02A 1SVXB 1RDYA 4H0WA 4U4SA 5EQ9A 5JEIA 3MZ1A 2F3BA 4LZ8A 3SEUA 3H6VA 2WBDA 2XXRA 1QUJA 1KZ8A 3BBRA 3TMGA 1NV5A 1DPPA 3WAEA 4G8NA 3W15C 1ZU0A 2PX1A 4ZEDA 1O64A 3MVWA 3PGFA 2Y7PA 4OVRA 3RN8A 1B3GA 4YB7A 1FPJA 1ZBMA 4OTEA 3PPOA 3MP6A 5H8FA 3T1BA 3HN0A 1JVYA 2GFEA 4PGNA 1Q1KA 3R6UA 1EZ9A 2D3IA 3D4GA 1IMCA 4MLVA 3CG1A 2XXIA 1MDQA 3D1RA 1Q9DA 4N6DA 2ZYMA 2Y84A 4G77A 2O68A 2B4LA 1JVXA 5CMBA 5I57A 4PAKA 1D9YA 4OEVA 4PFTA 5A5XA 4HCYA 3M3FA 1DTGA 3FJMA 4H65A 5F1QA 3E79A 1FBGA 4XFEA 2V3UA 1RDZA 4AQ4A 3PV0E 1PEBA 2FA7A 3TCFA 4I1DA 3MW0A 1KWHA 2ZZWA 1QKBA 4ZS9A 2DWAA 4P11A 2E1SA 4NF6B 4QHQA 1PC3A 4N8GA 4RY1A 4DXBA 1SD3A 4OXVA 2V84A 1RKMA 3EHSA 2RF1A 2HQ0A 3FJGA 3VXBA 3N6UA 4FBPA 5ELVA 5HPQA 3U65A 2H25A 4X04A 5CMCA 1MQGA 4PE5B 4THIA 2O7IA 2P1SA 1XT8A 2Y5LA 4KI0E 2FVZA 3FD3A 1TFDA 3LSLA 1K9ZA 1ZKBA 4F2OA 3SDFA 2CZKA 5IZZA 2O84X 4F3BA 4PC9A 5I7IA 4YB5A 2OWSA 2F6PA 5IZ3B 3MVYA 3Q27A 4GOTA 2RCBA 1SYHA 1Z7NE 3MAMA 1FQEA 3RT8A 4G8HA 1H76A 5K2XA 2Q2AA 2ZMBA 4ZEIA 3LSFB 4RXLA 4KXPA 3N5LA 5IGAA 3KN7A 4P56A 2QVRA 4QFLA 1JQFA 1FJ9A 1NL5A 3E3KA 1M5CA 5L9SA 4UACA 4RPOA 3SKPA 4JXIA 1DSNA 3RT6B 4RNSA 3N26A 3M3LA 4OMBA 2ZNSA 1EZOA 3M3KA 1EYIA 3OD7A 3M8UA 4MAGA 3R26A 2OX3A 4QFNA 4R9GA 4WXJA 4AS4A 4RYAA 4MNCA 1R1NA 4JVIA 1AOVA 4Z7EA 1KA0A 4KCCA 3CG3A 3OSQA 4UABA 4YU0A 3GLBA
chains in the Genus database with same CATH topology
1PB7A 1GR2A 4ELRA 4FATA 4PFYA 1OQGA 5EHMA 3O6HA 3TCHA 2AIXA 3KJTA 1B3LA 4OZ9A 3TUSA 3CRBA 3CVGA 5CMMA 3VVDA 4R73A 4FIMA 2F6GA 3TODA 3MPLA 1IXCA 1MM7A 1FCKA 2OLBA 1UIUA 1QJMA 3H6TA 3PUZE 1JETA 3V89B 3VVFA 2Z23A 3IL1B 4DDDA 5KZTA 2QSXA 3TPAA 3IOVA 1WVJA 3H4ZA 3PUWE 3HV1A 3VLVA 4E0WA 1IUDA 3A3UA 1MXWA 2OK2A 2RCAA 2NUVA 4IGRA 3K6WA 4O3AA 4R72A 1LB9A 2Y7IA 2Z8EA 2QS3A 2G29A 3K1MA 4Q0CA 3C9HA 3KSXA 4DE8A 3TFLA 3U93A 3RNNA 3S9LC 3TEPA 4AB5A 2HFBA 2Y7WA 1MH3A 1ZJLA 3QUFA 1PBQA 3FXQA 3G7WA 1H3DA 1DOTA 4JWOA 1ZTYA 1NH7A 4QSDA 4Q5TA 4OETA 1IEJA 3GXAA 5I2KA 4RK9A 4WKMA 1SI1A 2XXHA 3VLUA 4FE8A 2I48A 1B52A 1A8EA 4IO4A 3C31A 1AMFA 1Y1MA 5A5XB 4F29A 4MBPA 4R9FA 1XHYA 1FQFA 4NF8B 3IOWA 3TTKA 1A55A 1US5A 2QJEA 3IORA 4IY5A 4ZZEA 3RY3A 3TCGA 1R9LA 4JSDA 4F19A 3C32A 2V3QA 1P1QA 1MY1A 4F1YA 1P1OA 2HZKA 3OO7A 5DTBA 1AL3A 3TELA 1BP5A 2OWTA 3FATA 1SYIA 4ELQA 5KDTA 2OCUA 1YAEA 3O9PA 4GLIA 1ZMGA 4KPTA 3FXUA 4LQ5A 1OQHA 2I58A 4KYSA 2V3TA 1H44A 3KEIA 3KG2A 2M8CA 5H8SA 5H8QB 2UVJA 4ND9A 4C0RA 3CFZA 3DP6A 3PUVE 4PFUA 2Q9TA 4KHZE 2H99A 3RPWA 4LZ7A 1DTZA 3T22A 4MF3A 1UQWA 2GRVA 3PMXA 3KZGA 3S2VA 5K2YA 1I6BA 2HAVA 5CMKA 3N6TA 1DMBA 1LFIA 1VFDA 4RPNA 4R75A 4YKJA 1ELJA 3SETA 3U72A 3ZSFA 5HM4B 4ZE8A 5JK4A 4KFQA 3T9UA 1TT1A 4YB6A 5JTYA 2F78A 4XKNA 3TKDA 3SEVA 1S50A 4BDMA 1MXUA 2O7UA 1URDA 5AA2B 4MLQA 1FTJA 1PBPA 3AXFA 1B32A 1IXGA 3D4CA 3IJXB 5I2NB 1LFHA 3LBSA 2DWIA 1PB8A 3FASA 5CC2A 5EHSA 2X7PA 4OEUA 2RKMA 1WODA 1J1NA 4KQPA 4FAJA 3TQLA 2F7AA 3PU5A 4X1BA 2UYEA 1JW1A 4XXUA 5TPAA 4M4GA 4F2QA 5KCJB 1YPNA 2QMXA 4EF1A 2OBGA 1S7YA 4WEDA 4ZE9A 3FIRA 2R6GE 2XXVA 4U21A 1OVBA 3E13X 2XX9A 3EPEA 3VFJA 1L5TA 2ZYKA 1IQ7A 2F35A 3JV9A 5TP9B 1A54A 1D3KA 3A3CA 3BFUA 3C33A 2XX7A 1B7UA 3H7MA 1XVXA 3OENA 2FNCA 4H1XA 1GTKA 1OVTA 2FYIA 3I5OA 4DCXA 5ISUA 4K3FA 2I3VA 3O2AA 4NF6A 4OFOA 2F97A 4Z0IA 1OLAA 1XVYA 5IAIA 1Y3PA 1B0LA 3DP4A 2PT1A 3KGCA 3OO8A 3GBAA 2D21A 5DVIA 3H6WA 4YZZA 3SESA 5I56A 4U4XA 1TFAA 1M5EA 4U2RA 1LSTA 1Y4CA 3OELA 1GVCA 3S9EA 1FTOA 1NNPA 1VE4A 4EQ7A 3K6UA 2XXYA 1P99A 3O97A 4DLDA 3DP8A 4U1ZA 4UA8A 2HAUA 1LBBA 3K00A 5CRYA 3V5AA 2XD3A 5I59B 5H8HA 4HW8A 3U1OA 2DE4A 4NWCA 3LC8A 4XTCQ 4ZEFA 3CR9A 3PMWA 4R6YA 3T93B 1XC1A 2XXTA 3ZS6A 5JTYB 4QSCA 2DVZA 1LAXA 4YAHX 1SW2A 4ESWA 1B1XA 4OERA 4NF5B 3PMVA 2QS4A 1OLCA 5I59A 4G8MA 1FQBA 1I6QA 2VGQA 1N84A 3KOSA 3MPKA 4IO7A 3C35A 1RYOA 3CSGA 4IO2A 2B65A 2F7CA 3ILUB 5DVFA 1MY3A 1QVSA 3G3HA 3PPPA 5FHOA 3CSBA 1VSOA 3G3JA 4OFLA 5CM6A 2O51A 3CIJA 3ONMA 3KJ7A 3K4UA 3P7IA 2CMOA 5DVJA 3F11A 4GL8A 4LUBA 1P1NA 4ECFA 4BLAA 1EZPA 4H8JA 4DXUA 3K01A 4QF9A 3BKIB 3H3GA 3PD9A 5TPAB 3UA8A 3H06B 3JYRA 4QSEA 4PQJA 2O6AA 1MQDA 5FTHA 3SEYA 3MP8A 1N0TA 1N3XA 2W7YA 4KYEA 3TTLA 1FQCA 2HZLA 2RC7A 3KN3A 3FVOA 4ESXA 3HCQA 1GGGA 3ECRA 4LZ5A 1B9JA 4LVQA 4NF4B 3SERA 2H5YA 2ONRA 5L9SA 1B4ZA 2DOJA 4GRKA 1SQYA 4RK2A 2IEEA 1A40A 1FTLA 3TAJA 5CBSA 5I2NA 1ZLQA 1JW5A 2Q89A 4H5FA 2QS2A 4R6HA 1LBCA 2PT2A 1HSJA 2F5XA 3CFXA 2Y7RA 1B5HA 2RC8A 1A7LA 3QIMA 2UYFA 1ATGA 2VD3A 2A5SA 3MQ9A 2DSFA 2QPQA 5TU0A 3SEXA 3B6QA 1DPEA 2F34A 4C1UA 3RGYA 5KCJA 4NMYA 3FVGA 2THIA 2XXQA 3VXCA 2QL3A 1R6ZA 1D9VA 1FTKA 4LA9A 3QYTA 1JEVA 1FW0A 1MQJA 1VFEA 2DQVA 2REGA 1MY0A 3FXRA 3ODBA 5AA2D 2O1MA 3OO6A 1MQHA 3IO4A 2YJPA 4IO3A 4R2BA 3S4UA 3I6VA 1FQDA 3BFTA 3RLFE 3Q29A 3MBPA 2O69A 3HHGA 1Y1ZA 1B5JA 4GVOA 1MDP1 1QW0A 4U22A 3UK4A 1F9BA 5AE4A 1MXZA 3OMBA 4YMAA 3QSLA 2NOOA 2CZLA 3WAFA 1XOCA 1Y9UA 3JZJA 1D4NA 2VHAA 2WKYA 3U8QA 5AA4A 1US4A 3N94A 4FECA 3T96B 3VV5A 5I84A 4ZDMA 4F39A 3MWBA 3PD8A 4RA1A 1USYE 2IA4A 3LSWA 1EH3A 1UTBB 4X1DA 1MXVA 4KCDA 2OZZA 2DXRA 2GHBA 1Y3QA 4G2ZA 3TTNA 3S9MC 1YCJA 2H9BA 2YLNA 3RTFB 1NNKA 1OMPA 3K02A 3L6HA 3FV2A 4N07A 1FTMA 3ILTB 4GQOA 1SVXB 3OSRA 4U23A 2DE3A 3Q25A 3OEMA 3K6XA 4H0WA 4TLMB 5FTIA 4U4SA 3KFMA 5FHMA 5H8QA 5JEIA 2HEUA 2XXXA 3KSJA 2QRYA 3MZ1A 3PUYE 3ZKLA 4FJPA 4LZ8A 4HS7A 1M5FA 4RJZA 3G3IA 1VR5A 3SEUA 4C1TA 1H43A 3H6VA 5AA1A 1POTA 4XKRA 1A99A 2XXRA 1QUJA 3BBRA 2GHAA 1ZIUA 3UN6A 1SI0A 3TMGA 3PUXE 1URGA 1AH5A 3FZVA 3V83A 3MUQA 1DPPA 1LB8A 3H03A 4E0XA 4U1OA 3WAEA 1LLSA 4G8NA 1ZU0A 1S9TA 4G68A 4QFPA 1USYH 3W15C 2PX1A 1A8FA 2NVUB 1B3FA 4ZEDA 5I57B 1QULA 1O64A 3E9XA 3MVWA 2ABHA 4F31B 4NWDA 2I4CA 1Z7ME 2PVUA 3OEKA 3PGFA 4GWOA 5ITPA 1LCFA 2Y7PA 5H8FB 4ZEKA 3RN8A 1B3GA 1MS7A 1MH4A 2XXWA 4G68B 1P1WA 4YB7A 4O3CA 5HBCA 4EXKA 5KDTB 5F7VA 1ZBMA 3O28A 2Z8FA 4OTEA 3KOTA 4X9TA 2Z8DA 4HTGA 1BKAA 1MM6A 3PPOA 4N13A 4KYDA 3MP6A 1B4HA 1IXHA 2DYXA 5L8DA 4OVJA 3RUMA 2AL4A 3K1PA 1N04A 4XKQA 3O6GA 2YPNA 3HN0A 3W9WA 1B3HA 3VE1B 1JVYA 4ONYA 4TOZA 1I69A 4FEDA 1B7ZA 4LONB 4BDNA 4YMBA 3Q28A 2DWHA 2ZNUA 3FUZA 1B6HA 2GFEA 4P0GA 5ICQA 1Q1KA 3R6UA 1SW4A 1NNFA 1RYXA 3LSXA 1QUKA 2DVCA 2PMSA 3O66A 1EZ9A 1MRPA 4JSOA 1EZOA 2ONSA 3T9XB 5DYHA 3B7DA 2ZYOA 1MQIA 2A5TA 2D3IA 3D4GA 4YKKA 5L9MA 3B6WA 1XS5A 3QXMA 4BDOA 1T0KA 4MLVA 2DWJA 3VDFA 1B1HA 1CE2A 2Q8JA 3CG1A 5L9OA 1OIBA 3TTMA 2G93A 2XXIA 1MDQA 3LR1A 3HO7A 3IB0A 3TYHA 4F22A 3MVXA 5M2VA 4F18A 5LOMA 4GFRA 4POXA 3FJ7A 2ZYMA 2Y84A 1SDXA 3OXNA 4G77A 4JWYA 2O68A 4IO6A 1LAFE 1JVXA 5TP9A 5CMBA 5I57A 2B3FA 1PDAA 4GL0A 1LGBC 3IB1A 4OHNA 4WEPA 4XIGQ 4JWXA 4PFWA 4Q30B 3LUYA 3TZAA 1D9YA 4MH5A 1NKXA 2PYYA 4G68C 4OESA 1MG1A 3V8XB 3VVEA 4OEVA 4YKPA 2XD2A 2HCAA 5H8FA 4PFTA 5A5XA 1JW4A 1MPCA 4HCYA 3U92A 3M3FA 3THIA 2UVHA 3UP9A 4YKIA 4AB6A 1HSEA 1M5DA 1N7WA 4NF8A 2GH9A 3IX1A 4IO5A 4O3BA 1DTGA 1N3WA 3PPRA 3FJMA 4H65A 4ZEBA 4EQ9A 1B3EA 1B5IA 4NE4A 1IITA 2D5WA 3CFLA 5F1QA 4L17A 2I0BA 3GZGA 1JNFA 1B46A 2DXYA 4F3PA 4QFKA 1NFTA 1JEUA 1O63A 2F7BA 2V3UA 3A09A 4BDLA 4AQ4A 3PV0E 3Q26A 1PEBA 4POWA 2FA7A 3TCFA 4G4PA 2KLFA 3UIFA 4I1DA 4IGTA 4XKPA 4BDQA 3IK6B 5H8NB 1IIWA 4ELPA 4M1VA 4DZ1A 1QUIA 5DEXA 4ZECA 3MW0A 1KWHA 1B05A 1BTJA 1LAHE 2H4IA 1QKBA 2A5TB 3K2DA 1CB6A 3DLNA 4FEBA 4ELOA 5H8NA 4ZS9A 5EYFA 3TQWA 3MC2A 1B58A 3B6TA 1NMUA 2E0SA 5DEXB 2DWAA 2V25A 2ESNA 4P11A 4DXCA 4JDFA 5I56B 5I2KB 2BJJX 4R74A 2E1SA 3MZ9A 1IXIA 4NF6B 4F1UA 4PETA 4QHQA 4KR5A 2OJTA 4GF8A 1PC3A 3FVNA 4RY1A 4DXBA 5BUUA 2AYSA 1Y3NA 1SD3A 2AL5A 1LCTA 1LFGA 4OXVA 1B7HA 2QMWA 2V84A 4OENA 3T9HB 3UORA 4GIZA 4H5GA 1IZ1A 1RKMA 3EHSA 3RQTA 2RF1A 1TWYA 2HQ0A 2R9JA 3FGSA 3MZBA 3FJGA 3QAXA 4GD5A 3VXBA 2Q88A 2R71A 1QKAA 3N6UA 4NF5A 3O29A 2ZYNA 3EN3A 2ALUA 5ELVA 5HPQA 2I6EA 2B3BA 5B7DA 4IY6A 1N76A 4LQ2A 1N7XA 2ZXTA 4X48A 3L6GA 4TLLB 2H25A 4I9DA 5CMCA 4EUOA 4GXSB 4HCWA 2X7QA 3GBBA 3KBRA 1II5A 1MQGA 2XXPA 2ANJA 2ZNTA 5IKBA 2NWJA 4LP2B 2ONKE 2F8DA 1MXXA 2V93A 4IB2A 4PE5B 4N6PA 2O7IA 2P1SA 1XT8A 1Y20A 4THIA 3TDJA 1MPBA 1SW5A 4KI0E 5BWJA 4H67A 4OYVA 1WDNA 4PP0A 3DM0A 1PB9A 1TFDA 3FD3A 1M5BA 3LSLA 1TXFA 1ZKBA 3FVKA 4KD5A 4MFIA 4F2OA 3VLWA 1MY2A 2UVIA 2XX8A 3SDFA 2REJA 1UIVA 2DS9A 1ANFA 2O84X 3EQ1A 4F3BA 3EHTA 2VP1A 1BIYA 3C36A 4DCYA 4YB5A 3T9VA 2VOZA 1O7TA 3G3FA 4I8CA 2VD2A 3IB2A 4EDPA 4OQOA 3CI8A 5H8HB 2I3WA 3IO6A 5I58A 4UACA 2OWSA 3U94A 1EU8A 3W9VA 3R7XA 4ZZAA 3S9NC 3IR1A 5CI5A 3IOUA 4H8IA 2F6PA 2DP8A 3G3KA 3MVYA 3Q27A 1H45A 2RCBA 4GOTA 1SYHA 1Z7NE 2P2AA 2XHDA 3FV1A 3MAMA 1FQEA 3PPNA 1UTBA 4G8HA 3RT8A 4BDRA 1POY1 3K6VA 4OFJA 4EXLA 1H76A 2Q2AA 5K2XA 5I58B 1LAGE 4NTLA 2ZMBA 4R2FA 4ZEIA 4NEDA 3LSFB 5J1DA 4GXAA 2X26A 4R6KA 1B51A 1MPDA 4QFOA 5AA3A 3ZKKA 5CBRA 4RXLA 3TTRA 3IAZA 3N5LA 3OO9A 1AIVA 4DIGA 1NH8A 1NNTA 1Q35A 2PBWA 3I3VA 3KN7A 1UTHA 2F36A 2RC9A 4QFLA 1YTVA 3RTWB 4EF2A 1JQFA 1SBPA 3G3GA 3PPQA 1NL5A 5FHNA 3T66A 3E3KA 1M5CA 2DE2A 4Q8RA 2Y7KA 1MY4A 3C4MA 1FQAA 2I0CA 3KN8A 3K0VA 4RPOA 2QS1A 3MJNA 3EF7A 4JXIA 1DSNA 3MVZA 4YICA 4RNSA 3RT6B 3SKPA 5B70A 3N26A 3IOTA 4NF4A 4OWDA 2Z22A 4F3SA 4F3GA 3C34A 1UTHB 3HHFA 5AA4B 3M3LA 3E4RA 2O1LA 4TQUQ 5DT6A 4OMBA 2ZNSA 1MXYA 3DELB 3EHUA 3M3KA 3QK6A 4I62A 1B40A 4JB7A 3H6UA 4QRZA 3HPIA 3OD7A 4P0IA 5ICTA 2HXWA 4EQBA 2I49A 3SEWA 2LAOA 2NXOA 3OOAA 1R9QA 1Y4TA 3MP1A 3M8UA 1HSLA 4F1VA 2RINA 3K1NA 3QUJA 1B2HA 3R26A 1I6AA 4QFNA 1P1UA 4LATA 1B0HA 4R9GA 2Q2CA 4WXJA 3USDA 4RYAA 1URSA 3IJOB 2I4BA 2XXUA 4H6DA 1R1NA 5AA2A 3O6IA 1AOVA 4Z7EA 2UVGA 2H98A 2UXAA 5ITOA 1SW1A 4JBZA 4KCCA 3CG3A 3HSTA 4ISUA 4FORA 3OSQA 1BLFA 4YU0A 1GV8A 3UGWA 2P0SA 3GLBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PB7 A;  1GR2 A;  4ELR A;  4FAT A;  4PFY A;  1OQG A;  5EHM A;  3O6H A;  3TCH A;  2AIX A;  3KJT A;  1B3L A;  4OZ9 A;  3TUS A;  3CRB A;  3CVG A;  5CMM A;  3VVD A;  4R73 A;  4FIM A;  2F6G A;  3TOD A;  3MPL A;  1IXC A;  1MM7 A;  1FCK A;  2OLB A;  1UIU A;  1QJM A;  3H6T A;  3PUZ E;  1JET A;  3V89 B;  3VVF A;  2Z23 A;  3IL1 B;  4DDD A;  5KZT A;  2QSX A;  3TPA A;  3IOV A;  1WVJ A;  3H4Z A;  3PUW E;  3HV1 A;  3VLV A;  4E0W A;  1IUD A;  3A3U A;  1MXW A;  2OK2 A;  2RCA A;  2NUV A;  4IGR A;  3K6W A;  4O3A A;  4R72 A;  1LB9 A;  2Y7I A;  2Z8E A;  2QS3 A;  2G29 A;  3K1M A;  4Q0C A;  3C9H A;  3KSX A;  4DE8 A;  3TFL A;  3U93 A;  3RNN A;  3S9L C;  3TEP A;  4AB5 A;  2HFB A;  2Y7W A;  1MH3 A;  1ZJL A;  3QUF A;  1PBQ A;  3FXQ A;  3G7W A;  1H3D A;  1DOT A;  4JWO A;  1ZTY A;  1NH7 A;  4QSD A;  4Q5T A;  4OET A;  1IEJ A;  3GXA A;  5I2K A;  4RK9 A;  4WKM A;  1SI1 A;  2XXH A;  3VLU A;  4FE8 A;  2I48 A;  1B52 A;  1A8E A;  4IO4 A;  3C31 A;  1AMF A;  1Y1M A;  5A5X B;  4F29 A;  4MBP A;  4R9F A;  1XHY A;  1FQF A;  4NF8 B;  3IOW A;  3TTK A;  1A55 A;  1US5 A;  2QJE A;  3IOR A;  4IY5 A;  4ZZE A;  3RY3 A;  3TCG A;  1R9L A;  4JSD A;  4F19 A;  3C32 A;  2V3Q A;  1P1Q A;  1MY1 A;  4F1Y A;  1P1O A;  2HZK A;  3OO7 A;  5DTB A;  1AL3 A;  3TEL A;  1BP5 A;  2OWT A;  3FAT A;  1SYI A;  4ELQ A;  5KDT A;  2OCU A;  1YAE A;  3O9P A;  4GLI A;  1ZMG A;  4KPT A;  3FXU A;  4LQ5 A;  1OQH A;  2I58 A;  4KYS A;  2V3T A;  1H44 A;  3KEI A;  3KG2 A;  2M8C A;  5H8S A;  5H8Q B;  2UVJ A;  4ND9 A;  4C0R A;  3CFZ A;  3DP6 A;  3PUV E;  4PFU A;  2Q9T A;  4KHZ E;  2H99 A;  3RPW A;  4LZ7 A;  1DTZ A;  3T22 A;  4MF3 A;  1UQW A;  2GRV A;  3PMX A;  3KZG A;  3S2V A;  5K2Y A;  1I6B A;  2HAV A;  5CMK A;  3N6T A;  1DMB A;  1LFI A;  1VFD A;  4RPN A;  4R75 A;  4YKJ A;  1ELJ A;  3SET A;  3U72 A;  3ZSF A;  5HM4 B;  4ZE8 A;  5JK4 A;  4KFQ A;  3T9U A;  1TT1 A;  4YB6 A;  5JTY A;  2F78 A;  4XKN A;  3TKD A;  3SEV A;  1S50 A;  4BDM A;  1MXU A;  2O7U A;  1URD A;  5AA2 B;  4MLQ A;  1FTJ A;  1PBP A;  3AXF A;  1B32 A;  1IXG A;  3D4C A;  3IJX B;  5I2N B;  1LFH A;  3LBS A;  2DWI A;  1PB8 A;  3FAS A;  5CC2 A;  5EHS A;  2X7P A;  4OEU A;  2RKM A;  1WOD A;  1J1N A;  4KQP A;  4FAJ A;  3TQL A;  2F7A A;  3PU5 A;  4X1B A;  2UYE A;  1JW1 A;  4XXU A;  5TPA A;  4M4G A;  4F2Q A;  5KCJ B;  1YPN A;  2QMX A;  4EF1 A;  2OBG A;  1S7Y A;  4WED A;  4ZE9 A;  3FIR A;  2R6G E;  2XXV A;  4U21 A;  1OVB A;  3E13 X;  2XX9 A;  3EPE A;  3VFJ A;  1L5T A;  2ZYK A;  1IQ7 A;  2F35 A;  3JV9 A;  5TP9 B;  1A54 A;  1D3K A;  3A3C A;  3BFU A;  3C33 A;  2XX7 A;  1B7U A;  3H7M A;  1XVX A;  3OEN A;  2FNC A;  4H1X A;  1GTK A;  1OVT A;  2FYI A;  3I5O A;  4DCX A;  5ISU A;  4K3F A;  2I3V A;  3O2A A;  4NF6 A;  4OFO A;  2F97 A;  4Z0I A;  1OLA A;  1XVY A;  5IAI A;  1Y3P A;  1B0L A;  3DP4 A;  2PT1 A;  3KGC A;  3OO8 A;  3GBA A;  2D21 A;  5DVI A;  3H6W A;  4YZZ A;  3SES A;  5I56 A;  4U4X A;  1TFA A;  1M5E A;  4U2R A;  1LST A;  1Y4C A;  3OEL A;  1GVC A;  3S9E A;  1FTO A;  1NNP A;  1VE4 A;  4EQ7 A;  3K6U A;  2XXY A;  1P99 A;  3O97 A;  4DLD A;  3DP8 A;  4U1Z A;  4UA8 A;  2HAU A;  1LBB A;  3K00 A;  5CRY A;  3V5A A;  2XD3 A;  5I59 B;  5H8H A;  4HW8 A;  3U1O A;  2DE4 A;  4NWC A;  3LC8 A;  4XTC Q;  4ZEF A;  3CR9 A;  3PMW A;  4R6Y A;  3T93 B;  1XC1 A;  2XXT A;  3ZS6 A;  5JTY B;  4QSC A;  2DVZ A;  1LAX A;  4YAH X;  1SW2 A;  4ESW A;  1B1X A;  4OER A;  4NF5 B;  3PMV A;  2QS4 A;  1OLC A;  5I59 A;  4G8M A;  1FQB A;  1I6Q A;  2VGQ A;  1N84 A;  3KOS A;  3MPK A;  4IO7 A;  3C35 A;  1RYO A;  3CSG A;  4IO2 A;  2B65 A;  2F7C A;  3ILU B;  5DVF A;  1MY3 A;  1QVS A;  3G3H A;  3PPP A;  5FHO A;  3CSB A;  1VSO A;  3G3J A;  4OFL A;  5CM6 A;  2O51 A;  3CIJ A;  3ONM A;  3KJ7 A;  3K4U A;  3P7I A;  2CMO A;  5DVJ A;  3F11 A;  4GL8 A;  4LUB A;  1P1N A;  4ECF A;  4BLA A;  1EZP A;  4H8J A;  4DXU A;  3K01 A;  4QF9 A;  3BKI B;  3H3G A;  3PD9 A;  5TPA B;  3UA8 A;  3H06 B;  3JYR A;  4QSE A;  4PQJ A;  2O6A A;  1MQD A;  5FTH A;  3SEY A;  3MP8 A;  1N0T A;  1N3X A;  2W7Y A;  4KYE A;  3TTL A;  1FQC A;  2HZL A;  2RC7 A;  3KN3 A;  3FVO A;  4ESX A;  3HCQ A;  1GGG A;  3ECR A;  4LZ5 A;  1B9J A;  4LVQ A;  4NF4 B;  3SER A;  2H5Y A;  2ONR A;  5L9S A;  1B4Z A;  2DOJ A;  4GRK A;  1SQY A;  4RK2 A;  2IEE A;  1A40 A;  1FTL A;  3TAJ A;  5CBS A;  5I2N A;  1ZLQ A;  1JW5 A;  2Q89 A;  4H5F A;  2QS2 A;  4R6H A;  1LBC A;  2PT2 A;  1HSJ A;  2F5X A;  3CFX A;  2Y7R A;  1B5H A;  2RC8 A;  1A7L A;  3QIM A;  2UYF A;  1ATG A;  2VD3 A;  2A5S A;  3MQ9 A;  2DSF A;  2QPQ A;  5TU0 A;  3SEX A;  3B6Q A;  1DPE A;  2F34 A;  4C1U A;  3RGY A;  5KCJ A;  4NMY A;  3FVG A;  2THI A;  2XXQ A;  3VXC A;  2QL3 A;  1R6Z A;  1D9V A;  1FTK A;  4LA9 A;  3QYT A;  1JEV A;  1FW0 A;  1MQJ A;  1VFE A;  2DQV A;  2REG A;  1MY0 A;  3FXR A;  3ODB A;  5AA2 D;  2O1M A;  3OO6 A;  1MQH A;  3IO4 A;  2YJP A;  4IO3 A;  4R2B A;  3S4U A;  3I6V A;  1FQD A;  3BFT A;  3RLF E;  3Q29 A;  3MBP A;  2O69 A;  3HHG A;  1Y1Z A;  1B5J A;  4GVO A;  1MDP 1;  1QW0 A;  4U22 A;  3UK4 A;  1F9B A;  5AE4 A;  1MXZ A;  3OMB A;  4YMA A;  3QSL A;  2NOO A;  2CZL A;  3WAF A;  1XOC A;  1Y9U A;  3JZJ A;  1D4N A;  2VHA A;  2WKY A;  3U8Q A;  5AA4 A;  1US4 A;  3N94 A;  4FEC A;  3T96 B;  3VV5 A;  5I84 A;  4ZDM A;  4F39 A;  3MWB A;  3PD8 A;  4RA1 A;  1USY E;  2IA4 A;  3LSW A;  1EH3 A;  1UTB B;  4X1D A;  1MXV A;  4KCD A;  2OZZ A;  2DXR A;  2GHB A;  1Y3Q A;  4G2Z A;  3TTN A;  3S9M C;  1YCJ A;  2H9B A;  2YLN A;  3RTF B;  1NNK A;  1OMP A;  3K02 A;  3L6H A;  3FV2 A;  4N07 A;  1FTM A;  3ILT B;  4GQO A;  1SVX B;  3OSR A;  4U23 A;  2DE3 A;  3Q25 A;  3OEM A;  3K6X A;  4H0W A;  4TLM B;  5FTI A;  4U4S A;  3KFM A;  5FHM A;  5H8Q A;  5JEI A;  2HEU A;  2XXX A;  3KSJ A;  2QRY A;  3MZ1 A;  3PUY E;  3ZKL A;  4FJP A;  4LZ8 A;  4HS7 A;  1M5F A;  4RJZ A;  3G3I A;  1VR5 A;  3SEU A;  4C1T A;  1H43 A;  3H6V A;  5AA1 A;  1POT A;  4XKR A;  1A99 A;  2XXR A;  1QUJ A;  3BBR A;  2GHA A;  1ZIU A;  3UN6 A;  1SI0 A;  3TMG A;  3PUX E;  1URG A;  1AH5 A;  3FZV A;  3V83 A;  3MUQ A;  1DPP A;  1LB8 A;  3H03 A;  4E0X A;  4U1O A;  3WAE A;  1LLS A;  4G8N A;  1ZU0 A;  1S9T A;  4G68 A;  4QFP A;  1USY H;  3W15 C;  2PX1 A;  1A8F A;  2NVU B;  1B3F A;  4ZED A;  5I57 B;  1QUL A;  1O64 A;  3E9X A;  3MVW A;  2ABH A;  4F31 B;  4NWD A;  2I4C A;  1Z7M E;  2PVU A;  3OEK A;  3PGF A;  4GWO A;  5ITP A;  1LCF A;  2Y7P A;  5H8F B;  4ZEK A;  3RN8 A;  1B3G A;  1MS7 A;  1MH4 A;  2XXW A;  4G68 B;  1P1W A;  4YB7 A;  4O3C A;  5HBC A;  4EXK A;  5KDT B;  5F7V A;  1ZBM A;  3O28 A;  2Z8F A;  4OTE A;  3KOT A;  4X9T A;  2Z8D A;  4HTG A;  1BKA A;  1MM6 A;  3PPO A;  4N13 A;  4KYD A;  3MP6 A;  1B4H A;  1IXH A;  2DYX A;  5L8D A;  4OVJ A;  3RUM A;  2AL4 A;  3K1P A;  1N04 A;  4XKQ A;  3O6G A;  2YPN A;  3HN0 A;  3W9W A;  1B3H A;  3VE1 B;  1JVY A;  4ONY A;  4TOZ A;  1I69 A;  4FED A;  1B7Z A;  4LON B;  4BDN A;  4YMB A;  3Q28 A;  2DWH A;  2ZNU A;  3FUZ A;  1B6H A;  2GFE A;  4P0G A;  5ICQ A;  1Q1K A;  3R6U A;  1SW4 A;  1NNF A;  1RYX A;  3LSX A;  1QUK A;  2DVC A;  2PMS A;  3O66 A;  1EZ9 A;  1MRP A;  4JSO A;  1EZO A;  2ONS A;  3T9X B;  5DYH A;  3B7D A;  2ZYO A;  1MQI A;  2A5T A;  2D3I A;  3D4G A;  4YKK A;  5L9M A;  3B6W A;  1XS5 A;  3QXM A;  4BDO A;  1T0K A;  4MLV A;  2DWJ A;  3VDF A;  1B1H A;  1CE2 A;  2Q8J A;  3CG1 A;  5L9O A;  1OIB A;  3TTM A;  2G93 A;  2XXI A;  1MDQ A;  3LR1 A;  3HO7 A;  3IB0 A;  3TYH A;  4F22 A;  3MVX A;  5M2V A;  4F18 A;  5LOM A;  4GFR A;  4POX A;  3FJ7 A;  2ZYM A;  2Y84 A;  1SDX A;  3OXN A;  4G77 A;  4JWY A;  2O68 A;  4IO6 A;  1LAF E;  1JVX A;  5TP9 A;  5CMB A;  5I57 A;  2B3F A;  1PDA A;  4GL0 A;  1LGB C;  3IB1 A;  4OHN A;  4WEP A;  4XIG Q;  4JWX A;  4PFW A;  4Q30 B;  3LUY A;  3TZA A;  1D9Y A;  4MH5 A;  1NKX A;  2PYY A;  4G68 C;  4OES A;  1MG1 A;  3V8X B;  3VVE A;  4OEV A;  4YKP A;  2XD2 A;  2HCA A;  5H8F A;  4PFT A;  5A5X A;  1JW4 A;  1MPC A;  4HCY A;  3U92 A;  3M3F A;  3THI A;  2UVH A;  3UP9 A;  4YKI A;  4AB6 A;  1HSE A;  1M5D A;  1N7W A;  4NF8 A;  2GH9 A;  3IX1 A;  4IO5 A;  4O3B A;  1DTG A;  1N3W A;  3PPR A;  3FJM A;  4H65 A;  4ZEB A;  4EQ9 A;  1B3E A;  1B5I A;  4NE4 A;  1IIT A;  2D5W A;  3CFL A;  5F1Q A;  4L17 A;  2I0B A;  3GZG A;  1JNF A;  1B46 A;  2DXY A;  4F3P A;  4QFK A;  1NFT A;  1JEU A;  1O63 A;  2F7B A;  2V3U A;  3A09 A;  4BDL A;  4AQ4 A;  3PV0 E;  3Q26 A;  1PEB A;  4POW A;  2FA7 A;  3TCF A;  4G4P A;  2KLF A;  3UIF A;  4I1D A;  4IGT A;  4XKP A;  4BDQ A;  3IK6 B;  5H8N B;  1IIW A;  4ELP A;  4M1V A;  4DZ1 A;  1QUI A;  5DEX A;  4ZEC A;  3MW0 A;  1KWH A;  1B05 A;  1BTJ A;  1LAH E;  2H4I A;  1QKB A;  2A5T B;  3K2D A;  1CB6 A;  3DLN A;  4FEB A;  4ELO A;  5H8N A;  4ZS9 A;  5EYF A;  3TQW A;  3MC2 A;  1B58 A;  3B6T A;  1NMU A;  2E0S A;  5DEX B;  2DWA A;  2V25 A;  2ESN A;  4P11 A;  4DXC A;  4JDF A;  5I56 B;  5I2K B;  2BJJ X;  4R74 A;  2E1S A;  3MZ9 A;  1IXI A;  4NF6 B;  4F1U A;  4PET A;  4QHQ A;  4KR5 A;  2OJT A;  4GF8 A;  1PC3 A;  3FVN A;  4RY1 A;  4DXB A;  5BUU A;  2AYS A;  1Y3N A;  1SD3 A;  2AL5 A;  1LCT A;  1LFG A;  4OXV A;  1B7H A;  2QMW A;  2V84 A;  4OEN A;  3T9H B;  3UOR A;  4GIZ A;  4H5G A;  1IZ1 A;  1RKM A;  3EHS A;  3RQT A;  2RF1 A;  1TWY A;  2HQ0 A;  2R9J A;  3FGS A;  3MZB A;  3FJG A;  3QAX A;  4GD5 A;  3VXB A;  2Q88 A;  2R71 A;  1QKA A;  3N6U A;  4NF5 A;  3O29 A;  2ZYN A;  3EN3 A;  2ALU A;  5ELV A;  5HPQ A;  2I6E A;  2B3B A;  5B7D A;  4IY6 A;  1N76 A;  4LQ2 A;  1N7X A;  2ZXT A;  4X48 A;  3L6G A;  4TLL B;  2H25 A;  4I9D A;  5CMC A;  4EUO A;  4GXS B;  4HCW A;  2X7Q A;  3GBB A;  3KBR A;  1II5 A;  1MQG A;  2XXP A;  2ANJ A;  2ZNT A;  5IKB A;  2NWJ A;  4LP2 B;  2ONK E;  2F8D A;  1MXX A;  2V93 A;  4IB2 A;  4PE5 B;  4N6P A;  2O7I A;  2P1S A;  1XT8 A;  1Y20 A;  4THI A;  3TDJ A;  1MPB A;  1SW5 A;  4KI0 E;  5BWJ A;  4H67 A;  4OYV A;  1WDN A;  4PP0 A;  3DM0 A;  1PB9 A;  1TFD A;  3FD3 A;  1M5B A;  3LSL A;  1TXF A;  1ZKB A;  3FVK A;  4KD5 A;  4MFI A;  4F2O A;  3VLW A;  1MY2 A;  2UVI A;  2XX8 A;  3SDF A;  2REJ A;  1UIV A;  2DS9 A;  1ANF A;  2O84 X;  3EQ1 A;  4F3B A;  3EHT A;  2VP1 A;  1BIY A;  3C36 A;  4DCY A;  4YB5 A;  3T9V A;  2VOZ A;  1O7T A;  3G3F A;  4I8C A;  2VD2 A;  3IB2 A;  4EDP A;  4OQO A;  3CI8 A;  5H8H B;  2I3W A;  3IO6 A;  5I58 A;  4UAC A;  2OWS A;  3U94 A;  1EU8 A;  3W9V A;  3R7X A;  4ZZA A;  3S9N C;  3IR1 A;  5CI5 A;  3IOU A;  4H8I A;  2F6P A;  2DP8 A;  3G3K A;  3MVY A;  3Q27 A;  1H45 A;  2RCB A;  4GOT A;  1SYH A;  1Z7N E;  2P2A A;  2XHD A;  3FV1 A;  3MAM A;  1FQE A;  3PPN A;  1UTB A;  4G8H A;  3RT8 A;  4BDR A;  1POY 1;  3K6V A;  4OFJ A;  4EXL A;  1H76 A;  2Q2A A;  5K2X A;  5I58 B;  1LAG E;  4NTL A;  2ZMB A;  4R2F A;  4ZEI A;  4NED A;  3LSF B;  5J1D A;  4GXA A;  2X26 A;  4R6K A;  1B51 A;  1MPD A;  4QFO A;  5AA3 A;  3ZKK A;  5CBR A;  4RXL A;  3TTR A;  3IAZ A;  3N5L A;  3OO9 A;  1AIV A;  4DIG A;  1NH8 A;  1NNT A;  1Q35 A;  2PBW A;  3I3V A;  3KN7 A;  1UTH A;  2F36 A;  2RC9 A;  4QFL A;  1YTV A;  3RTW B;  4EF2 A;  1JQF A;  1SBP A;  3G3G A;  3PPQ A;  1NL5 A;  5FHN A;  3T66 A;  3E3K A;  1M5C A;  2DE2 A;  4Q8R A;  2Y7K A;  1MY4 A;  3C4M A;  1FQA A;  2I0C A;  3KN8 A;  3K0V A;  4RPO A;  2QS1 A;  3MJN A;  3EF7 A;  4JXI A;  1DSN A;  3MVZ A;  4YIC A;  4RNS A;  3RT6 B;  3SKP A;  5B70 A;  3N26 A;  3IOT A;  4NF4 A;  4OWD A;  2Z22 A;  4F3S A;  4F3G A;  3C34 A;  1UTH B;  3HHF A;  5AA4 B;  3M3L A;  3E4R A;  2O1L A;  4TQU Q;  5DT6 A;  4OMB A;  2ZNS A;  1MXY A;  3DEL B;  3EHU A;  3M3K A;  3QK6 A;  4I62 A;  1B40 A;  4JB7 A;  3H6U A;  4QRZ A;  3HPI A;  3OD7 A;  4P0I A;  5ICT A;  2HXW A;  4EQB A;  2I49 A;  3SEW A;  2LAO A;  2NXO A;  3OOA A;  1R9Q A;  1Y4T A;  3MP1 A;  3M8U A;  1HSL A;  4F1V A;  2RIN A;  3K1N A;  3QUJ A;  1B2H A;  3R26 A;  1I6A A;  4QFN A;  1P1U A;  4LAT A;  1B0H A;  4R9G A;  2Q2C A;  4WXJ A;  3USD A;  4RYA A;  1URS A;  3IJO B;  2I4B A;  2XXU A;  4H6D A;  1R1N A;  5AA2 A;  3O6I A;  1AOV A;  4Z7E A;  2UVG A;  2H98 A;  2UXA A;  5ITO A;  1SW1 A;  4JBZ A;  4KCC A;  3CG3 A;  3HST A;  4ISU A;  4FOR A;  3OSQ A;  1BLF A;  4YU0 A;  1GV8 A;  3UGW A;  2P0S A;  3GLB A; 
#chains in the Genus database with same CATH topology
 1OQG A;  3TCH A;  2AIX A;  5EQ7 A;  3CVG A;  5CMM A;  4FIM A;  2OLB A;  1DBZ A;  1QJM A;  3IL1 B;  2QSX A;  3IOV A;  3HV1 A;  4PAF A;  1MXW A;  2OK2 A;  4O3A A;  2Q8M A;  1FPF A;  2Z8E A;  4DE8 A;  3K1M A;  4Q0C A;  3EKI A;  3RNN A;  4JWO A;  4OET A;  1IEJ A;  1A8E A;  4F29 A;  4R9F A;  1XHY A;  1FQF A;  5EQ8 A;  1A55 A;  4IY5 A;  4ZZE A;  4F19 A;  1R9L A;  4GWZ A;  2V3Q A;  4F1Y A;  1P1O A;  1AL3 A;  3FAT A;  2OCU A;  1ZMG A;  1OQH A;  4KYS A;  5H8S A;  5H8Q B;  4GX6 A;  2MKZ A;  3CFZ A;  4PFU A;  2H99 A;  4LZ7 A;  1FSA A;  2GRV A;  3PMX A;  3S2V A;  5K2Y A;  5CMK A;  1LFI A;  4P47 A;  4ZE8 A;  5JK4 A;  4KFQ A;  5JTY A;  3SEV A;  1MXU A;  3AXF A;  5I2N B;  1PB8 A;  2X7P A;  1XI6 A;  2VPN A;  1WOD A;  4FAJ A;  2FHY A;  2B4M A;  1IMA A;  5TPA A;  1YPN A;  1S7Y A;  2XXV A;  1LBX A;  3E13 X;  1IQ7 A;  3C33 A;  3BFU A;  3H7M A;  5IAI A;  3SZP A;  1XVX A;  3ROJ A;  1OVT A;  3QMF A;  1BLF A;  4OFO A;  1OLA A;  4XF5 A;  1IME A;  3DP4 A;  2PT1 A;  3KGC A;  5DVI A;  3H6W A;  4U4X A;  1M5E A;  1Y4C A;  4EQ7 A;  5H8H A;  4HW8 A;  4ZEF A;  3PMW A;  3ZS6 A;  1LAX A;  4YAH X;  4ESW A;  1OLC A;  5I59 A;  4G8M A;  4EDP A;  1RYO A;  3PPP A;  2O51 A;  2WBB A;  5DVJ A;  4N81 A;  4ECF A;  4H8J A;  4DXU A;  3H3G A;  3RPL B;  4I3E A;  3JYR A;  4QSE A;  3MP8 A;  1N0T A;  3KN3 A;  3ECR A;  4LZ5 A;  4NF4 B;  3SER A;  4RK2 A;  1FTL A;  3FXB A;  1FPE A;  2FBP A;  1NV0 A;  2PT2 A;  2F5X A;  1B5H A;  1A7L A;  2A5S A;  2QPQ A;  1FPK A;  1DPE A;  4C1U A;  4NMY A;  2XXQ A;  3QYT A;  1MQJ A;  3ODB A;  4XEQ A;  2O1M A;  5ESY A;  3IO4 A;  1Y1Z A;  1B5J A;  1MXZ A;  3NOH A;  2NOO A;  4MX6 A;  5AA4 A;  2WKY A;  2VHA A;  1US4 A;  2V4C A;  5IZ3 A;  2IA4 A;  1UTB B;  4X1D A;  1MXV A;  1Y3Q A;  2H9B A;  5I5P A;  3L6H A;  5F7V A;  1FTM A;  4F3G A;  3OSR A;  2DE3 A;  3Q25 A;  4TLM B;  5FHM A;  3KSJ A;  1BK4 A;  2KQZ A;  3LUZ A;  4MMP A;  4HS7 A;  1M5F A;  4RJZ A;  3G3I A;  1VR5 A;  4C1T A;  1POT A;  4XKR A;  1A99 A;  3FZV A;  1LB8 A;  3H03 A;  1LLS A;  2CZH A;  1S9T A;  4G68 A;  2NVU B;  1B3F A;  2WX9 A;  1QUL A;  1FPB A;  2ABH A;  1Z7M E;  5ITP A;  4IR8 A;  4G68 B;  3LV0 A;  4O3C A;  4EXK A;  4X9T A;  4HTG A;  1BKA A;  4KYD A;  5B70 A;  5L8D A;  3RUM A;  2AL4 A;  5EYH A;  3O6G A;  3CHG A;  4TOZ A;  4FED A;  3IFC A;  5IZ1 A;  1QUK A;  2DVC A;  4JSO A;  3B7D A;  1MQI A;  2A5T A;  3QXM A;  1T0K A;  1B1H A;  5I3S A;  4G61 A;  1CE2 A;  2Q8J A;  1OIB A;  2G93 A;  3LR1 A;  1QGX A;  5M2V A;  2WEF A;  1LAF E;  5TP9 A;  3FBP A;  3IB1 A;  4WEP A;  4Q30 B;  4MH5 A;  3V8X B;  4MCO A;  4OES A;  3VVE A;  2UVH A;  3UP9 A;  4AB6 A;  1HSE A;  4NF8 A;  3IX1 A;  4IO5 A;  3PPR A;  4EQ9 A;  4GBV A;  1IIT A;  3CFL A;  3GZG A;  1JNF A;  1B46 A;  2DXY A;  4QFK A;  1NFT A;  1LBW A;  1JEU A;  3A09 A;  4O8M A;  4G4P A;  3UIF A;  4XKP A;  4BDQ A;  3IK6 B;  3B50 A;  5DEX A;  4PDD A;  3K2D A;  3HFU A;  3BIG A;  3MC2 A;  2V25 A;  3MZ9 A;  3PTY A;  4KR5 A;  1NI9 A;  4GF8 A;  2VT5 A;  2ZZX A;  3FVN A;  5BUU A;  4P8B A;  1B7H A;  4GIZ A;  1TWY A;  3MZB A;  2R9J A;  2Q88 A;  4NF5 A;  3O29 A;  2ZYN A;  1N76 A;  3L6G A;  4GXS B;  3GBB A;  2XXP A;  5IKB A;  2NWJ A;  4TLL B;  1NUZ A;  4PF6 A;  1WDN A;  1M5B A;  1TXF A;  2UVI A;  1ANF A;  2VP1 A;  1BIY A;  3C36 A;  2VOZ A;  3G3F A;  2VD2 A;  3IO6 A;  5I58 A;  2QVV A;  1EU8 A;  3R7X A;  4ZZA A;  2DP8 A;  1H45 A;  3PPN A;  4N17 A;  1POY 1;  4OFJ A;  4EXL A;  4P1L A;  1NV6 A;  4MHF A;  1D9Q A;  5I58 B;  1MPD A;  5AA3 A;  3OO9 A;  5B7D A;  1NNT A;  3RTW B;  1UTH A;  1SBP A;  4P1E A;  3T66 A;  2DE2 A;  4Q8R A;  1FQA A;  2QS1 A;  4F3S A;  2Z22 A;  3C34 A;  1UTH B;  5AA4 B;  3E4R A;  2O1L A;  4TQU Q;  5DT6 A;  4JB7 A;  3DEL B;  4I62 A;  3H6U A;  2HXW A;  2LAO A;  2NXO A;  3OOA A;  1R9Q A;  4F1V A;  3K1N A;  3QUJ A;  4N91 A;  1I6A A;  1P1U A;  4LAT A;  2Q2C A;  3IJO B;  4O7M A;  2UVG A;  2H98 A;  2UXA A;  5ITO A;  1SW1 A;  3HST A;  3FVG A;  1PB7 A;  1GR2 A;  4PFY A;  3KJT A;  1K9Y A;  1B3L A;  3CRB A;  3VVD A;  2F3D A;  1IXC A;  1MM7 A;  4DDD A;  1NUW A;  2GQ1 A;  4E0W A;  4N4U A;  4PF8 A;  2Q74 A;  2RCA A;  4R72 A;  1LB9 A;  3KSX A;  3TFL A;  3QUF A;  2Y7W A;  1MH3 A;  1VDW A;  1ZJL A;  1ZTY A;  1NH7 A;  4MJO A;  1SI1 A;  2XXH A;  2QFL A;  4FE8 A;  2I48 A;  5A5X B;  3IOW A;  3TCG A;  3RY3 A;  1P1Q A;  5DTB A;  1EYK A;  1BP5 A;  2OWT A;  5KDT A;  1SYI A;  3O9P A;  4KPT A;  4LQ5 A;  2I58 A;  2M8C A;  5FBP A;  4C0R A;  1G0H A;  1FPG A;  4MF3 A;  3KZG A;  2HAV A;  1FBC A;  1DMB A;  3SET A;  1VFD A;  4RPN A;  4XKN A;  2O7U A;  1FTJ A;  3IJX B;  1B32 A;  1IXG A;  2DWI A;  4OEU A;  2RKM A;  3GYY A;  1J1N A;  3PU5 A;  4PE3 A;  4F2Q A;  2QMX A;  4EF1 A;  4WED A;  4ZE9 A;  2R6G E;  1OVB A;  2XWK A;  3EPE A;  5ET7 A;  2ZYK A;  5TP9 B;  1D3K A;  3A3C A;  3OEN A;  5ET5 A;  2I3V A;  3O2A A;  4NF6 A;  1B0L A;  5I56 A;  2D21 A;  1GVC A;  3S9E A;  3K6U A;  3V5A A;  2XD3 A;  3LC8 A;  4XTC Q;  1XC1 A;  4GBW A;  4NF5 B;  1LBV A;  2QS4 A;  1FBE A;  3PMV A;  4IO7 A;  1FTA A;  4IO2 A;  4JVD A;  3C35 A;  5DVF A;  2B65 A;  1MY3 A;  1QVS A;  3CSB A;  1VSO A;  3ONM A;  3A29 A;  3F11 A;  4LUB A;  1P1N A;  1FBD A;  1KA1 A;  1EZP A;  5TPA B;  4PQJ A;  3SEY A;  1N3X A;  4KYE A;  3TTL A;  2RC7 A;  1GGG A;  1B9J A;  2ONR A;  2DOJ A;  5I2N A;  4H5F A;  1LBC A;  1HSJ A;  3QIM A;  2VD3 A;  2P3V A;  5TU0 A;  4AS5 A;  2F34 A;  3RYD A;  3VXC A;  2QL3 A;  1R6Z A;  1D9V A;  1FTK A;  4O94 A;  1JEV A;  2REG A;  5A5L A;  3FXR A;  2JJK A;  2XWI A;  2QVU A;  3BFT A;  3RLF E;  3MBP A;  3HHG A;  3UK4 A;  1F9B A;  1FRP A;  1XOC A;  1D4N A;  3U8Q A;  1FPI A;  4GWU A;  4ZDM A;  3MWB A;  1USY E;  3LSW A;  1EH3 A;  1YXI A;  4LN5 A;  3RTF B;  1OMP A;  4U23 A;  3ILT B;  5FTI A;  1DK4 A;  3OEM A;  1IMB A;  3KFM A;  3PUY E;  5IM2 A;  1NUY A;  2CEX A;  1H43 A;  5AA1 A;  2GHA A;  3UN6 A;  1JP4 A;  3PUX E;  1URG A;  3V83 A;  3MUQ A;  4U1O A;  4NF0 A;  1USY H;  4NWD A;  2I4C A;  2PVU A;  3E78 A;  5H8F B;  4ZEK A;  2XXW A;  1MH4 A;  1P1W A;  3O28 A;  2Z8F A;  3KOT A;  2Z8D A;  1MM6 A;  1G0I A;  2DYX A;  3K1P A;  3VE1 B;  4ONY A;  4BDN A;  1I69 A;  4YMB A;  2DWH A;  3FUZ A;  1B6H A;  4P0G A;  4PFB A;  1SW4 A;  1NNF A;  1RYX A;  1MRP A;  2ONS A;  3T9X B;  5L9M A;  3VDF A;  4HE2 A;  1IMF A;  3HO7 A;  4JVC A;  3TYH A;  5LOM A;  4GFR A;  4POX A;  3FJ7 A;  1SDX A;  4IO6 A;  2B3F A;  4XIG Q;  1LGB C;  4OHN A;  3MYU A;  4JWX A;  3TZA A;  1NKX A;  2PYY A;  3U92 A;  4YKI A;  1M5D A;  2GH9 A;  4O3B A;  1N3W A;  4GWY A;  4NE4 A;  2D5W A;  2I0B A;  4F3P A;  2F7B A;  2KLF A;  1IIW A;  4ELP A;  4M1V A;  4DZ1 A;  4ZEC A;  1B05 A;  1LAH E;  2A5T B;  2ZZV A;  5EYF A;  3B6T A;  1NMU A;  5I2K B;  4PBQ A;  3RPL A;  1IXI A;  4F1U A;  4PET A;  2OJT A;  2AYS A;  1Y3N A;  2AL5 A;  1LCT A;  4OEN A;  3T9H B;  3UOR A;  3QAX A;  4GD5 A;  1QKA A;  3EN3 A;  2ALU A;  4IY6 A;  4X48 A;  1N7X A;  4NX1 A;  4I9D A;  4EUO A;  4HCW A;  2X7Q A;  1II5 A;  4X8R A;  4LP2 B;  2ONK E;  2F8D A;  2V93 A;  4IB2 A;  3UA8 A;  5ICQ A;  3TDJ A;  1MPB A;  1SW5 A;  2CEY A;  4OYV A;  3VLW A;  2XX8 A;  3T9V A;  1O7T A;  2I3W A;  3U94 A;  3W9V A;  3S9N C;  3IR1 A;  2XWV A;  3IOU A;  5CI5 A;  4MNI A;  3FV1 A;  1UTB A;  3K6V A;  5J1D A;  4R2F A;  4PFR A;  4NED A;  1B51 A;  3ZKK A;  3IAZ A;  1NH8 A;  2PBW A;  2F36 A;  2RC9 A;  3G3G A;  5FHN A;  1MY4 A;  3C4M A;  2I0C A;  1FBF A;  4OWD A;  3HHF A;  1MXY A;  3EHU A;  3QK6 A;  3HPI A;  4P0I A;  5ICT A;  4EQB A;  3SEW A;  3MP1 A;  1HSL A;  4GX3 A;  2RIN A;  1B2H A;  1B0H A;  5EYG A;  4H6D A;  1FPD A;  5AA2 A;  1LBY A;  4ISU A;  4FOR A;  2P0S A;  4NAP A;  5EHM A;  3TUS A;  4R73 A;  2F6G A;  3TOD A;  3MPL A;  1FCK A;  1UIU A;  3H6T A;  1JET A;  3VVF A;  5KZT A;  2Z23 A;  1WVJ A;  3A3U A;  4N6K A;  2Y7I A;  3C9H A;  3U93 A;  3S9L C;  3TEP A;  4AB5 A;  2HFB A;  1PBQ A;  3FXQ A;  1H3D A;  1DOT A;  2DDK A;  2FIX A;  4Q5T A;  5I2K A;  4RK9 A;  4WKM A;  4PDH A;  3VLU A;  1B52 A;  1Y1M A;  4MBP A;  4NF8 B;  1US5 A;  2QJE A;  3IOR A;  3C32 A;  1YYZ A;  2HZK A;  3T0J A;  3TEL A;  4ELQ A;  1RDX A;  4GLI A;  3FXU A;  2V3T A;  1H44 A;  4ND9 A;  3DP6 A;  3PUV E;  2Q9T A;  4KHZ E;  5LDZ A;  3RPW A;  3ZSF A;  5HM4 B;  5EQA A;  2XXK A;  4YB6 A;  2F78 A;  3TKD A;  4BDM A;  4MLQ A;  1FBH A;  3FAS A;  5EHS A;  2HHM A;  4KQP A;  3TQL A;  2F7A A;  4X1B A;  1JW1 A;  4XXU A;  4M4G A;  5KCJ B;  4OVP A;  3VFJ A;  2XX9 A;  1NV4 A;  1B7U A;  2XX7 A;  2FNC A;  4K3F A;  2WYK A;  4HE1 A;  4Z0I A;  2F97 A;  1XVY A;  3OO8 A;  3GBA A;  1LST A;  1LBZ A;  1VE4 A;  2XXY A;  1P99 A;  4DLD A;  4UA8 A;  3K00 A;  5I59 B;  2HPG A;  2DE4 A;  4NWC A;  3CR9 A;  3T93 B;  1YZ0 A;  3BIH A;  4MIJ A;  1I6Q A;  1N84 A;  3KOS A;  3ILU B;  4GX4 A;  4MNP A;  1AWB A;  3G3J A;  4OFL A;  3P7I A;  3KJ7 A;  3K4U A;  4NHB A;  4GL8 A;  3BKI B;  3H06 B;  2W7Y A;  1FQC A;  2HZL A;  4ESX A;  2H5Y A;  1IMD A;  4PFI A;  2IEE A;  1A40 A;  3TAJ A;  5CBS A;  1ZLQ A;  1JW5 A;  2Q89 A;  4R6H A;  4QBA A;  2Y7R A;  2RC8 A;  2UYF A;  3MQ9 A;  3B6Q A;  3KC0 A;  3RGY A;  2THI A;  1NV1 A;  1VFE A;  1MY0 A;  3OO6 A;  4IO3 A;  2YJP A;  3S4U A;  3I6V A;  1FQD A;  4I40 A;  3Q29 A;  2O69 A;  4U22 A;  3OMB A;  2CZL A;  3VV5 A;  4DI4 B;  4F39 A;  3PD8 A;  4RA1 A;  4PCD A;  4KCD A;  2OZZ A;  2GHB A;  3S9M C;  1NNK A;  3MST A;  4N07 A;  3FV2 A;  4OA4 A;  2FIE A;  4GQO A;  5H8Q A;  3K6X A;  2HEU A;  2XXX A;  2QRY A;  3ZKL A;  4FJP A;  5LTC A;  1NV3 A;  1ZIU A;  1SI0 A;  3KBZ A;  1AH5 A;  4E0X A;  4QFP A;  4HE0 A;  1A8F A;  5I57 B;  2L5V A;  3E9X A;  4F31 B;  3OEK A;  4GWO A;  1LCF A;  4NN3 A;  1MS7 A;  5HBC A;  5KDT B;  1INP A;  1FBP A;  4N13 A;  1B4H A;  1IXH A;  2PFY A;  4OVJ A;  1N04 A;  4I3Y A;  4XKQ A;  2YPN A;  3W9W A;  1NUX A;  1B3H A;  4PAI A;  1LEV A;  4LON B;  1B7Z A;  3Q28 A;  2ZNU A;  1FJ6 A;  3LSX A;  2PMS A;  3O66 A;  2R8T A;  5DYH A;  2ZYO A;  4YKK A;  3B6W A;  1XS5 A;  4BDO A;  2DWJ A;  3ISP A;  1NV2 A;  5L9O A;  3IB0 A;  4F22 A;  3MVX A;  4F18 A;  3OXN A;  4JWY A;  1PDA A;  4GL0 A;  4PFW A;  3LUY A;  4G68 C;  1MG1 A;  4YKP A;  2XD2 A;  2HCA A;  1JW4 A;  1MPC A;  4PBH A;  3THI A;  1N7W A;  1SPI A;  4ZEB A;  1B3E A;  1B5I A;  4L17 A;  2VPO A;  1O63 A;  4BDL A;  3Q26 A;  4POW A;  5H8N B;  4IGT A;  1QUI A;  1BTJ A;  2H4I A;  4H45 A;  1DCU A;  1CB6 A;  3DLN A;  4FEB A;  4ELO A;  5H8N A;  3TQW A;  1B58 A;  5I56 B;  2E0S A;  5DEX B;  2ESN A;  4DXC A;  4JDF A;  2BJJ X;  4R74 A;  4N8Y A;  4QXD A;  1LFG A;  2QMW A;  4H5G A;  1IZ1 A;  3B8B A;  3RQT A;  4N15 A;  3FGS A;  2R71 A;  2I6E A;  2B3B A;  4LQ2 A;  2ZXT A;  3KBR A;  5ET6 A;  2ANJ A;  2ZNT A;  1MXX A;  3TTM A;  4N6P A;  1Y20 A;  5BWJ A;  5DW8 A;  4H67 A;  4PP0 A;  3DM0 A;  1PB9 A;  4KD5 A;  3FVK A;  4MFI A;  1MY2 A;  2Y5K A;  2REJ A;  1UIV A;  2XWO A;  2DS9 A;  3EQ1 A;  3EHT A;  4DCY A;  4I8C A;  3IB2 A;  4OQO A;  3CI8 A;  5H8H B;  4OVQ A;  1FPL A;  4OAN A;  4H8I A;  3G3K A;  4MEV A;  2P2A A;  2XHD A;  4BDR A;  4P3L A;  4O7I A;  1LAG E;  4NG7 A;  4NTL A;  4GXA A;  2X26 A;  2BJI A;  4R6K A;  4QFO A;  5CBR A;  4P9K A;  3TTR A;  1AIV A;  4DIG A;  1Q35 A;  3I3V A;  1YTV A;  4EF2 A;  3PPQ A;  2Y7K A;  3KN8 A;  3K0V A;  4YIC A;  3MJN A;  3EF7 A;  3MVZ A;  3IOT A;  4NF4 A;  4QRZ A;  1B40 A;  2I49 A;  4HXV A;  1Y4T A;  2HXR A;  3USD A;  1URS A;  2PCR A;  2I4B A;  2XXU A;  3O6I A;  2XA5 A;  4JBZ A;  1GV8 A;  3UGW A;  4GWW A;  4H46 A;  4ELR A;  4FAT A;  3O6H A;  4OZ9 A;  1EYJ A;  3PUZ E;  3V89 B;  2OWZ A;  3TPA A;  3H4Z A;  3PUW E;  3VLV A;  3IFA A;  1IUD A;  4NGU A;  2NUV A;  4IGR A;  3K6W A;  2QS3 A;  4DI3 D;  2G29 A;  3G7W A;  4QSD A;  3GXA A;  4IO4 A;  3C31 A;  1AMF A;  3TTK A;  4JSD A;  1MY1 A;  3OO7 A;  1NV7 A;  4OVT A;  4NQ8 A;  1YAE A;  3KEI A;  3KG2 A;  2UVJ A;  4GWS A;  1DTZ A;  4GWX A;  3T22 A;  1UQW A;  1I6B A;  3N6T A;  3U72 A;  4R75 A;  4YKJ A;  1ELJ A;  2P3N A;  3T9U A;  1TT1 A;  3KC1 A;  1S50 A;  1URD A;  5AA2 B;  1PBP A;  1LFH A;  3D4C A;  3LBS A;  5CC2 A;  5ET8 A;  2UYE A;  2OBG A;  3FIR A;  4U21 A;  1L5T A;  3JV9 A;  2F35 A;  1A54 A;  4H1X A;  4DCX A;  5ISU A;  1GTK A;  2FYI A;  3I5O A;  1Y3P A;  4YZZ A;  3SES A;  1TFA A;  4U2R A;  3OEL A;  2CZI A;  1FTO A;  1NNP A;  1CNQ A;  2PFZ A;  3O97 A;  3DP8 A;  4U1Z A;  2HAU A;  1LBB A;  5CRY A;  3U1O A;  4R6Y A;  2XXT A;  5JTY B;  4QSC A;  2DVZ A;  1SW2 A;  1B1X A;  4OER A;  4PTK A;  1FQB A;  2VGQ A;  3MPK A;  3CSG A;  2F7C A;  3G3H A;  5FHO A;  2KR0 A;  5CM6 A;  3CIJ A;  2CMO A;  4BLA A;  3K01 A;  4QF9 A;  3PD9 A;  5FTH A;  2O6A A;  1MQD A;  2WYP A;  3FVO A;  3HCQ A;  4LVQ A;  1B4Z A;  4GRK A;  1SQY A;  2QS2 A;  3CFX A;  1ATG A;  2DSF A;  3SEX A;  5KCJ A;  4OVS A;  4LA9 A;  1FW0 A;  2DQV A;  5AA2 D;  1MQH A;  4R2B A;  5F24 A;  4PGP A;  4GVO A;  1MDP 1;  1QW0 A;  5AE4 A;  4YMA A;  3QSL A;  5T3J A;  3WAF A;  1Y9U A;  3JZJ A;  3N94 A;  4FEC A;  3T96 B;  5I84 A;  5J16 A;  2DXR A;  3TTN A;  4G2Z A;  1YCJ A;  2YLN A;  3K02 A;  1SVX B;  1RDY A;  4H0W A;  4U4S A;  5EQ9 A;  5JEI A;  3MZ1 A;  2F3B A;  4LZ8 A;  3SEU A;  3H6V A;  2WBD A;  2XXR A;  1QUJ A;  1KZ8 A;  3BBR A;  3TMG A;  1NV5 A;  1DPP A;  3WAE A;  4G8N A;  3W15 C;  1ZU0 A;  2PX1 A;  4ZED A;  1O64 A;  3MVW A;  3PGF A;  2Y7P A;  4OVR A;  3RN8 A;  1B3G A;  4YB7 A;  1FPJ A;  1ZBM A;  4OTE A;  3PPO A;  3MP6 A;  5H8F A;  3T1B A;  3HN0 A;  1JVY A;  2GFE A;  4PGN A;  1Q1K A;  3R6U A;  1EZ9 A;  2D3I A;  3D4G A;  1IMC A;  4MLV A;  3CG1 A;  2XXI A;  1MDQ A;  3D1R A;  1Q9D A;  4N6D A;  2ZYM A;  2Y84 A;  4G77 A;  2O68 A;  2B4L A;  1JVX A;  5CMB A;  5I57 A;  4PAK A;  1D9Y A;  4OEV A;  4PFT A;  5A5X A;  4HCY A;  3M3F A;  1DTG A;  3FJM A;  4H65 A;  5F1Q A;  3E79 A;  1FBG A;  4XFE A;  2V3U A;  1RDZ A;  4AQ4 A;  3PV0 E;  1PEB A;  2FA7 A;  3TCF A;  4I1D A;  3MW0 A;  1KWH A;  2ZZW A;  1QKB A;  4ZS9 A;  2DWA A;  4P11 A;  2E1S A;  4NF6 B;  4QHQ A;  1PC3 A;  4N8G A;  4RY1 A;  4DXB A;  1SD3 A;  4OXV A;  2V84 A;  1RKM A;  3EHS A;  2RF1 A;  2HQ0 A;  3FJG A;  3VXB A;  3N6U A;  4FBP A;  5ELV A;  5HPQ A;  3U65 A;  2H25 A;  4X04 A;  5CMC A;  1MQG A;  4PE5 B;  4THI A;  2O7I A;  2P1S A;  1XT8 A;  2Y5L A;  4KI0 E;  2FVZ A;  3FD3 A;  1TFD A;  3LSL A;  1K9Z A;  1ZKB A;  4F2O A;  3SDF A;  2CZK A;  5IZZ A;  2O84 X;  4F3B A;  4PC9 A;  5I7I A;  4YB5 A;  2OWS A;  2F6P A;  5IZ3 B;  3MVY A;  3Q27 A;  4GOT A;  2RCB A;  1SYH A;  1Z7N E;  3MAM A;  1FQE A;  3RT8 A;  4G8H A;  1H76 A;  5K2X A;  2Q2A A;  2ZMB A;  4ZEI A;  3LSF B;  4RXL A;  4KXP A;  3N5L A;  5IGA A;  3KN7 A;  4P56 A;  2QVR A;  4QFL A;  1JQF A;  1FJ9 A;  1NL5 A;  3E3K A;  1M5C A;  5L9S A;  4UAC A;  4RPO A;  3SKP A;  4JXI A;  1DSN A;  3RT6 B;  4RNS A;  3N26 A;  3M3L A;  4OMB A;  2ZNS A;  1EZO A;  3M3K A;  1EYI A;  3OD7 A;  3M8U A;  4MAG A;  3R26 A;  2OX3 A;  4QFN A;  4R9G A;  4WXJ A;  4AS4 A;  4RYA A;  4MNC A;  1R1N A;  4JVI A;  1AOV A;  4Z7E A;  1KA0 A;  4KCC A;  3CG3 A;  3OSQ A;  4UAB A;  4YU0 A;  3GLB A; 
#chains in the Genus database with same CATH homology
 1PB7 A;  1GR2 A;  4ELR A;  4FAT A;  4PFY A;  1OQG A;  5EHM A;  3O6H A;  3TCH A;  2AIX A;  3KJT A;  1B3L A;  4OZ9 A;  3TUS A;  3CRB A;  3CVG A;  5CMM A;  3VVD A;  4R73 A;  4FIM A;  2F6G A;  3TOD A;  3MPL A;  1IXC A;  1MM7 A;  1FCK A;  2OLB A;  1UIU A;  1QJM A;  3H6T A;  3PUZ E;  1JET A;  3V89 B;  3VVF A;  2Z23 A;  3IL1 B;  4DDD A;  5KZT A;  2QSX A;  3TPA A;  3IOV A;  1WVJ A;  3H4Z A;  3PUW E;  3HV1 A;  3VLV A;  4E0W A;  1IUD A;  3A3U A;  1MXW A;  2OK2 A;  2RCA A;  2NUV A;  4IGR A;  3K6W A;  4O3A A;  4R72 A;  1LB9 A;  2Y7I A;  2Z8E A;  2QS3 A;  2G29 A;  3K1M A;  4Q0C A;  3C9H A;  3KSX A;  4DE8 A;  3TFL A;  3U93 A;  3RNN A;  3S9L C;  3TEP A;  4AB5 A;  2HFB A;  2Y7W A;  1MH3 A;  1ZJL A;  3QUF A;  1PBQ A;  3FXQ A;  3G7W A;  1H3D A;  1DOT A;  4JWO A;  1ZTY A;  1NH7 A;  4QSD A;  4Q5T A;  4OET A;  1IEJ A;  3GXA A;  5I2K A;  4RK9 A;  4WKM A;  1SI1 A;  2XXH A;  3VLU A;  4FE8 A;  2I48 A;  1B52 A;  1A8E A;  4IO4 A;  3C31 A;  1AMF A;  1Y1M A;  5A5X B;  4F29 A;  4MBP A;  4R9F A;  1XHY A;  1FQF A;  4NF8 B;  3IOW A;  3TTK A;  1A55 A;  1US5 A;  2QJE A;  3IOR A;  4IY5 A;  4ZZE A;  3RY3 A;  3TCG A;  1R9L A;  4JSD A;  4F19 A;  3C32 A;  2V3Q A;  1P1Q A;  1MY1 A;  4F1Y A;  1P1O A;  2HZK A;  3OO7 A;  5DTB A;  1AL3 A;  3TEL A;  1BP5 A;  2OWT A;  3FAT A;  1SYI A;  4ELQ A;  5KDT A;  2OCU A;  1YAE A;  3O9P A;  4GLI A;  1ZMG A;  4KPT A;  3FXU A;  4LQ5 A;  1OQH A;  2I58 A;  4KYS A;  2V3T A;  1H44 A;  3KEI A;  3KG2 A;  2M8C A;  5H8S A;  5H8Q B;  2UVJ A;  4ND9 A;  4C0R A;  3CFZ A;  3DP6 A;  3PUV E;  4PFU A;  2Q9T A;  4KHZ E;  2H99 A;  3RPW A;  4LZ7 A;  1DTZ A;  3T22 A;  4MF3 A;  1UQW A;  2GRV A;  3PMX A;  3KZG A;  3S2V A;  5K2Y A;  1I6B A;  2HAV A;  5CMK A;  3N6T A;  1DMB A;  1LFI A;  1VFD A;  4RPN A;  4R75 A;  4YKJ A;  1ELJ A;  3SET A;  3U72 A;  3ZSF A;  5HM4 B;  4ZE8 A;  5JK4 A;  4KFQ A;  3T9U A;  1TT1 A;  4YB6 A;  5JTY A;  2F78 A;  4XKN A;  3TKD A;  3SEV A;  1S50 A;  4BDM A;  1MXU A;  2O7U A;  1URD A;  5AA2 B;  4MLQ A;  1FTJ A;  1PBP A;  3AXF A;  1B32 A;  1IXG A;  3D4C A;  3IJX B;  5I2N B;  1LFH A;  3LBS A;  2DWI A;  1PB8 A;  3FAS A;  5CC2 A;  5EHS A;  2X7P A;  4OEU A;  2RKM A;  1WOD A;  1J1N A;  4KQP A;  4FAJ A;  3TQL A;  2F7A A;  3PU5 A;  4X1B A;  2UYE A;  1JW1 A;  4XXU A;  5TPA A;  4M4G A;  4F2Q A;  5KCJ B;  1YPN A;  2QMX A;  4EF1 A;  2OBG A;  1S7Y A;  4WED A;  4ZE9 A;  3FIR A;  2R6G E;  2XXV A;  4U21 A;  1OVB A;  3E13 X;  2XX9 A;  3EPE A;  3VFJ A;  1L5T A;  2ZYK A;  1IQ7 A;  2F35 A;  3JV9 A;  5TP9 B;  1A54 A;  1D3K A;  3A3C A;  3BFU A;  3C33 A;  2XX7 A;  1B7U A;  3H7M A;  1XVX A;  3OEN A;  2FNC A;  4H1X A;  1GTK A;  1OVT A;  2FYI A;  3I5O A;  4DCX A;  5ISU A;  4K3F A;  2I3V A;  3O2A A;  4NF6 A;  4OFO A;  2F97 A;  4Z0I A;  1OLA A;  1XVY A;  5IAI A;  1Y3P A;  1B0L A;  3DP4 A;  2PT1 A;  3KGC A;  3OO8 A;  3GBA A;  2D21 A;  5DVI A;  3H6W A;  4YZZ A;  3SES A;  5I56 A;  4U4X A;  1TFA A;  1M5E A;  4U2R A;  1LST A;  1Y4C A;  3OEL A;  1GVC A;  3S9E A;  1FTO A;  1NNP A;  1VE4 A;  4EQ7 A;  3K6U A;  2XXY A;  1P99 A;  3O97 A;  4DLD A;  3DP8 A;  4U1Z A;  4UA8 A;  2HAU A;  1LBB A;  3K00 A;  5CRY A;  3V5A A;  2XD3 A;  5I59 B;  5H8H A;  4HW8 A;  3U1O A;  2DE4 A;  4NWC A;  3LC8 A;  4XTC Q;  4ZEF A;  3CR9 A;  3PMW A;  4R6Y A;  3T93 B;  1XC1 A;  2XXT A;  3ZS6 A;  5JTY B;  4QSC A;  2DVZ A;  1LAX A;  4YAH X;  1SW2 A;  4ESW A;  1B1X A;  4OER A;  4NF5 B;  3PMV A;  2QS4 A;  1OLC A;  5I59 A;  4G8M A;  1FQB A;  1I6Q A;  2VGQ A;  1N84 A;  3KOS A;  3MPK A;  4IO7 A;  3C35 A;  1RYO A;  3CSG A;  4IO2 A;  2B65 A;  2F7C A;  3ILU B;  5DVF A;  1MY3 A;  1QVS A;  3G3H A;  3PPP A;  5FHO A;  3CSB A;  1VSO A;  3G3J A;  4OFL A;  5CM6 A;  2O51 A;  3CIJ A;  3ONM A;  3KJ7 A;  3K4U A;  3P7I A;  2CMO A;  5DVJ A;  3F11 A;  4GL8 A;  4LUB A;  1P1N A;  4ECF A;  4BLA A;  1EZP A;  4H8J A;  4DXU A;  3K01 A;  4QF9 A;  3BKI B;  3H3G A;  3PD9 A;  5TPA B;  3UA8 A;  3H06 B;  3JYR A;  4QSE A;  4PQJ A;  2O6A A;  1MQD A;  5FTH A;  3SEY A;  3MP8 A;  1N0T A;  1N3X A;  2W7Y A;  4KYE A;  3TTL A;  1FQC A;  2HZL A;  2RC7 A;  3KN3 A;  3FVO A;  4ESX A;  3HCQ A;  1GGG A;  3ECR A;  4LZ5 A;  1B9J A;  4LVQ A;  4NF4 B;  3SER A;  2H5Y A;  2ONR A;  5L9S A;  1B4Z A;  2DOJ A;  4GRK A;  1SQY A;  4RK2 A;  2IEE A;  1A40 A;  1FTL A;  3TAJ A;  5CBS A;  5I2N A;  1ZLQ A;  1JW5 A;  2Q89 A;  4H5F A;  2QS2 A;  4R6H A;  1LBC A;  2PT2 A;  1HSJ A;  2F5X A;  3CFX A;  2Y7R A;  1B5H A;  2RC8 A;  1A7L A;  3QIM A;  2UYF A;  1ATG A;  2VD3 A;  2A5S A;  3MQ9 A;  2DSF A;  2QPQ A;  5TU0 A;  3SEX A;  3B6Q A;  1DPE A;  2F34 A;  4C1U A;  3RGY A;  5KCJ A;  4NMY A;  3FVG A;  2THI A;  2XXQ A;  3VXC A;  2QL3 A;  1R6Z A;  1D9V A;  1FTK A;  4LA9 A;  3QYT A;  1JEV A;  1FW0 A;  1MQJ A;  1VFE A;  2DQV A;  2REG A;  1MY0 A;  3FXR A;  3ODB A;  5AA2 D;  2O1M A;  3OO6 A;  1MQH A;  3IO4 A;  2YJP A;  4IO3 A;  4R2B A;  3S4U A;  3I6V A;  1FQD A;  3BFT A;  3RLF E;  3Q29 A;  3MBP A;  2O69 A;  3HHG A;  1Y1Z A;  1B5J A;  4GVO A;  1MDP 1;  1QW0 A;  4U22 A;  3UK4 A;  1F9B A;  5AE4 A;  1MXZ A;  3OMB A;  4YMA A;  3QSL A;  2NOO A;  2CZL A;  3WAF A;  1XOC A;  1Y9U A;  3JZJ A;  1D4N A;  2VHA A;  2WKY A;  3U8Q A;  5AA4 A;  1US4 A;  3N94 A;  4FEC A;  3T96 B;  3VV5 A;  5I84 A;  4ZDM A;  4F39 A;  3MWB A;  3PD8 A;  4RA1 A;  1USY E;  2IA4 A;  3LSW A;  1EH3 A;  1UTB B;  4X1D A;  1MXV A;  4KCD A;  2OZZ A;  2DXR A;  2GHB A;  1Y3Q A;  4G2Z A;  3TTN A;  3S9M C;  1YCJ A;  2H9B A;  2YLN A;  3RTF B;  1NNK A;  1OMP A;  3K02 A;  3L6H A;  3FV2 A;  4N07 A;  1FTM A;  3ILT B;  4GQO A;  1SVX B;  3OSR A;  4U23 A;  2DE3 A;  3Q25 A;  3OEM A;  3K6X A;  4H0W A;  4TLM B;  5FTI A;  4U4S A;  3KFM A;  5FHM A;  5H8Q A;  5JEI A;  2HEU A;  2XXX A;  3KSJ A;  2QRY A;  3MZ1 A;  3PUY E;  3ZKL A;  4FJP A;  4LZ8 A;  4HS7 A;  1M5F A;  4RJZ A;  3G3I A;  1VR5 A;  3SEU A;  4C1T A;  1H43 A;  3H6V A;  5AA1 A;  1POT A;  4XKR A;  1A99 A;  2XXR A;  1QUJ A;  3BBR A;  2GHA A;  1ZIU A;  3UN6 A;  1SI0 A;  3TMG A;  3PUX E;  1URG A;  1AH5 A;  3FZV A;  3V83 A;  3MUQ A;  1DPP A;  1LB8 A;  3H03 A;  4E0X A;  4U1O A;  3WAE A;  1LLS A;  4G8N A;  1ZU0 A;  1S9T A;  4G68 A;  4QFP A;  1USY H;  3W15 C;  2PX1 A;  1A8F A;  2NVU B;  1B3F A;  4ZED A;  5I57 B;  1QUL A;  1O64 A;  3E9X A;  3MVW A;  2ABH A;  4F31 B;  4NWD A;  2I4C A;  1Z7M E;  2PVU A;  3OEK A;  3PGF A;  4GWO A;  5ITP A;  1LCF A;  2Y7P A;  5H8F B;  4ZEK A;  3RN8 A;  1B3G A;  1MS7 A;  1MH4 A;  2XXW A;  4G68 B;  1P1W A;  4YB7 A;  4O3C A;  5HBC A;  4EXK A;  5KDT B;  5F7V A;  1ZBM A;  3O28 A;  2Z8F A;  4OTE A;  3KOT A;  4X9T A;  2Z8D A;  4HTG A;  1BKA A;  1MM6 A;  3PPO A;  4N13 A;  4KYD A;  3MP6 A;  1B4H A;  1IXH A;  2DYX A;  5L8D A;  4OVJ A;  3RUM A;  2AL4 A;  3K1P A;  1N04 A;  4XKQ A;  3O6G A;  2YPN A;  3HN0 A;  3W9W A;  1B3H A;  3VE1 B;  1JVY A;  4ONY A;  4TOZ A;  1I69 A;  4FED A;  1B7Z A;  4LON B;  4BDN A;  4YMB A;  3Q28 A;  2DWH A;  2ZNU A;  3FUZ A;  1B6H A;  2GFE A;  4P0G A;  5ICQ A;  1Q1K A;  3R6U A;  1SW4 A;  1NNF A;  1RYX A;  3LSX A;  1QUK A;  2DVC A;  2PMS A;  3O66 A;  1EZ9 A;  1MRP A;  4JSO A;  1EZO A;  2ONS A;  3T9X B;  5DYH A;  3B7D A;  2ZYO A;  1MQI A;  2A5T A;  2D3I A;  3D4G A;  4YKK A;  5L9M A;  3B6W A;  1XS5 A;  3QXM A;  4BDO A;  1T0K A;  4MLV A;  2DWJ A;  3VDF A;  1B1H A;  1CE2 A;  2Q8J A;  3CG1 A;  5L9O A;  1OIB A;  3TTM A;  2G93 A;  2XXI A;  1MDQ A;  3LR1 A;  3HO7 A;  3IB0 A;  3TYH A;  4F22 A;  3MVX A;  5M2V A;  4F18 A;  5LOM A;  4GFR A;  4POX A;  3FJ7 A;  2ZYM A;  2Y84 A;  1SDX A;  3OXN A;  4G77 A;  4JWY A;  2O68 A;  4IO6 A;  1LAF E;  1JVX A;  5TP9 A;  5CMB A;  5I57 A;  2B3F A;  1PDA A;  4GL0 A;  1LGB C;  3IB1 A;  4OHN A;  4WEP A;  4XIG Q;  4JWX A;  4PFW A;  4Q30 B;  3LUY A;  3TZA A;  1D9Y A;  4MH5 A;  1NKX A;  2PYY A;  4G68 C;  4OES A;  1MG1 A;  3V8X B;  3VVE A;  4OEV A;  4YKP A;  2XD2 A;  2HCA A;  5H8F A;  4PFT A;  5A5X A;  1JW4 A;  1MPC A;  4HCY A;  3U92 A;  3M3F A;  3THI A;  2UVH A;  3UP9 A;  4YKI A;  4AB6 A;  1HSE A;  1M5D A;  1N7W A;  4NF8 A;  2GH9 A;  3IX1 A;  4IO5 A;  4O3B A;  1DTG A;  1N3W A;  3PPR A;  3FJM A;  4H65 A;  4ZEB A;  4EQ9 A;  1B3E A;  1B5I A;  4NE4 A;  1IIT A;  2D5W A;  3CFL A;  5F1Q A;  4L17 A;  2I0B A;  3GZG A;  1JNF A;  1B46 A;  2DXY A;  4F3P A;  4QFK A;  1NFT A;  1JEU A;  1O63 A;  2F7B A;  2V3U A;  3A09 A;  4BDL A;  4AQ4 A;  3PV0 E;  3Q26 A;  1PEB A;  4POW A;  2FA7 A;  3TCF A;  4G4P A;  2KLF A;  3UIF A;  4I1D A;  4IGT A;  4XKP A;  4BDQ A;  3IK6 B;  5H8N B;  1IIW A;  4ELP A;  4M1V A;  4DZ1 A;  1QUI A;  5DEX A;  4ZEC A;  3MW0 A;  1KWH A;  1B05 A;  1BTJ A;  1LAH E;  2H4I A;  1QKB A;  2A5T B;  3K2D A;  1CB6 A;  3DLN A;  4FEB A;  4ELO A;  5H8N A;  4ZS9 A;  5EYF A;  3TQW A;  3MC2 A;  1B58 A;  3B6T A;  1NMU A;  2E0S A;  5DEX B;  2DWA A;  2V25 A;  2ESN A;  4P11 A;  4DXC A;  4JDF A;  5I56 B;  5I2K B;  2BJJ X;  4R74 A;  2E1S A;  3MZ9 A;  1IXI A;  4NF6 B;  4F1U A;  4PET A;  4QHQ A;  4KR5 A;  2OJT A;  4GF8 A;  1PC3 A;  3FVN A;  4RY1 A;  4DXB A;  5BUU A;  2AYS A;  1Y3N A;  1SD3 A;  2AL5 A;  1LCT A;  1LFG A;  4OXV A;  1B7H A;  2QMW A;  2V84 A;  4OEN A;  3T9H B;  3UOR A;  4GIZ A;  4H5G A;  1IZ1 A;  1RKM A;  3EHS A;  3RQT A;  2RF1 A;  1TWY A;  2HQ0 A;  2R9J A;  3FGS A;  3MZB A;  3FJG A;  3QAX A;  4GD5 A;  3VXB A;  2Q88 A;  2R71 A;  1QKA A;  3N6U A;  4NF5 A;  3O29 A;  2ZYN A;  3EN3 A;  2ALU A;  5ELV A;  5HPQ A;  2I6E A;  2B3B A;  5B7D A;  4IY6 A;  1N76 A;  4LQ2 A;  1N7X A;  2ZXT A;  4X48 A;  3L6G A;  4TLL B;  2H25 A;  4I9D A;  5CMC A;  4EUO A;  4GXS B;  4HCW A;  2X7Q A;  3GBB A;  3KBR A;  1II5 A;  1MQG A;  2XXP A;  2ANJ A;  2ZNT A;  5IKB A;  2NWJ A;  4LP2 B;  2ONK E;  2F8D A;  1MXX A;  2V93 A;  4IB2 A;  4PE5 B;  4N6P A;  2O7I A;  2P1S A;  1XT8 A;  1Y20 A;  4THI A;  3TDJ A;  1MPB A;  1SW5 A;  4KI0 E;  5BWJ A;  4H67 A;  4OYV A;  1WDN A;  4PP0 A;  3DM0 A;  1PB9 A;  1TFD A;  3FD3 A;  1M5B A;  3LSL A;  1TXF A;  1ZKB A;  3FVK A;  4KD5 A;  4MFI A;  4F2O A;  3VLW A;  1MY2 A;  2UVI A;  2XX8 A;  3SDF A;  2REJ A;  1UIV A;  2DS9 A;  1ANF A;  2O84 X;  3EQ1 A;  4F3B A;  3EHT A;  2VP1 A;  1BIY A;  3C36 A;  4DCY A;  4YB5 A;  3T9V A;  2VOZ A;  1O7T A;  3G3F A;  4I8C A;  2VD2 A;  3IB2 A;  4EDP A;  4OQO A;  3CI8 A;  5H8H B;  2I3W A;  3IO6 A;  5I58 A;  4UAC A;  2OWS A;  3U94 A;  1EU8 A;  3W9V A;  3R7X A;  4ZZA A;  3S9N C;  3IR1 A;  5CI5 A;  3IOU A;  4H8I A;  2F6P A;  2DP8 A;  3G3K A;  3MVY A;  3Q27 A;  1H45 A;  2RCB A;  4GOT A;  1SYH A;  1Z7N E;  2P2A A;  2XHD A;  3FV1 A;  3MAM A;  1FQE A;  3PPN A;  1UTB A;  4G8H A;  3RT8 A;  4BDR A;  1POY 1;  3K6V A;  4OFJ A;  4EXL A;  1H76 A;  2Q2A A;  5K2X A;  5I58 B;  1LAG E;  4NTL A;  2ZMB A;  4R2F A;  4ZEI A;  4NED A;  3LSF B;  5J1D A;  4GXA A;  2X26 A;  4R6K A;  1B51 A;  1MPD A;  4QFO A;  5AA3 A;  3ZKK A;  5CBR A;  4RXL A;  3TTR A;  3IAZ A;  3N5L A;  3OO9 A;  1AIV A;  4DIG A;  1NH8 A;  1NNT A;  1Q35 A;  2PBW A;  3I3V A;  3KN7 A;  1UTH A;  2F36 A;  2RC9 A;  4QFL A;  1YTV A;  3RTW B;  4EF2 A;  1JQF A;  1SBP A;  3G3G A;  3PPQ A;  1NL5 A;  5FHN A;  3T66 A;  3E3K A;  1M5C A;  2DE2 A;  4Q8R A;  2Y7K A;  1MY4 A;  3C4M A;  1FQA A;  2I0C A;  3KN8 A;  3K0V A;  4RPO A;  2QS1 A;  3MJN A;  3EF7 A;  4JXI A;  1DSN A;  3MVZ A;  4YIC A;  4RNS A;  3RT6 B;  3SKP A;  5B70 A;  3N26 A;  3IOT A;  4NF4 A;  4OWD A;  2Z22 A;  4F3S A;  4F3G A;  3C34 A;  1UTH B;  3HHF A;  5AA4 B;  3M3L A;  3E4R A;  2O1L A;  4TQU Q;  5DT6 A;  4OMB A;  2ZNS A;  1MXY A;  3DEL B;  3EHU A;  3M3K A;  3QK6 A;  4I62 A;  1B40 A;  4JB7 A;  3H6U A;  4QRZ A;  3HPI A;  3OD7 A;  4P0I A;  5ICT A;  2HXW A;  4EQB A;  2I49 A;  3SEW A;  2LAO A;  2NXO A;  3OOA A;  1R9Q A;  1Y4T A;  3MP1 A;  3M8U A;  1HSL A;  4F1V A;  2RIN A;  3K1N A;  3QUJ A;  1B2H A;  3R26 A;  1I6A A;  4QFN A;  1P1U A;  4LAT A;  1B0H A;  4R9G A;  2Q2C A;  4WXJ A;  3USD A;  4RYA A;  1URS A;  3IJO B;  2I4B A;  2XXU A;  4H6D A;  1R1N A;  5AA2 A;  3O6I A;  1AOV A;  4Z7E A;  2UVG A;  2H98 A;  2UXA A;  5ITO A;  1SW1 A;  4JBZ A;  4KCC A;  3CG3 A;  3HST A;  4ISU A;  4FOR A;  3OSQ A;  1BLF A;  4YU0 A;  1GV8 A;  3UGW A;  2P0S A;  3GLB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...