2ABHA

Phosphate-binding protein (re-refined)
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
321
structure length
321
Chain Sequence
EASLTGAGATFPAPVYAKWADTYQKETGNKVNYQGIGSSGGVKQIIANTVDFGASDAPLSDEKLAQEGLFQFPTVIGGVVLAVNIPGLKSGELVLDGKTLGDIYLGKIKKWDDEAIAKLNPGLKLPSQNIAVVRRADGSGTSFVFTSYLAKVNEEWKNNVGTGSTVKWPIGLGGKGNDGIAAFVQRLPGAIGYVEYAYAKQNNLAYTKLISADGKPVSPTEENFANAAKGADWSKTFAQDLTNQKGEDAWPITSTTFILIHKDQKKPEQGTEVLKFFDWAYKTGAKQANDLDYASLPDSVVEQVRAAWKTNIKDSSGKPLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Phosphotransferase
molecule keywords PHOSPHATE-BINDING PROTEIN
publication title Modulation of a salt link does not affect binding of phosphate to its specific active transport receptor.
pubmed doi rcsb
total genus 112
structure length 321
sequence length 321
ec nomenclature
pdb deposition date 1995-11-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2abhA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2abhA02
2XXTA 3CFXA 2I3WA 3O29A 3S9MC 1JVYA 4F3BA 4UACA 3S9LC 1UTHB 4OERA 4YKPA 2ZMBA 1JVXA 3FV2A 4R2BA 4KFQA 2QPQA 4G8MA 4F39A 4G68B 2PVUA 3PPQA 5K2XA 4Z7EA 3H7MA 4DDDA 4R6YA 2O51A 2I6EA 3C4MA 1MPCA 2OCUA 3T9VA 1QKBA 3OSRA 3K0VA 3QIMA 1MDQA 2GH9A 4ZEFA 4PFTA 4EXLA 4O3AA 3PPOA 1YTVA 1WVJA 5ITOA 3K6WA 4R6KA 3IOVA 4OZ9A 3RLFE 2ZXTA 2RF1A 2I3VA 4MF3A 3OELA 4DXUA 5B70A 3KEIA 4R74A 1TT1A 3O6HA 2O1MA 1SYIA 3TTLA 5CBSA 3Q29A 1UIUA 3A3UA 1AOVA 3C34A 3B6QA 3RPWA 4R9GA 2Q89A 3OD7A 1PBQA 1JETA 3C9HA 1B3GA 3SDFA 2V25A 4C1TA 1B0HA 3TTNA 4MH5A 1MH4A 2M8CA 1TXFA 1II5A 2YPNA 3RY3A 4F1UA 3RUMA 1B9JA 1LB9A 4DCYA 1B4ZA 3FVOA 5CM6A 1ZJLA 4PE5B 5B7DA 3DELB 3G3HA 3O97A 4FEDA 1Y20A 2GHAA 4LQ2A 4OVJA 3IX1A 1FTMA 1URSA 4QFKA 3LR1A 1LFHA 1ZMGA 3CR9A 4OWDA 4BDNA 3C31A 4GD5A 4PFYA 2THIA 1ELJA 4F18A 3P7IA 3VVDA 3Q28A 2VOZA 3OO7A 3RTWB 1HSJA 4ZZEA 4H67A 5TP9B 4OFOA 2P0SA 2XX9A 1ZBMA 4ELQA 4KD5A 2H25A 3VLVA 3RNNA 3HHGA 1O63A 3MJNA 1B3EA 1SW5A 4QSDA 4FJPA 4ZZAA 3H3GA 3K01A 1QULA 3QAXA 2O7IA 3UN6A 4OHNA 2RKMA 1M5CA 1AL3A 4EXKA 2XXVA 1XC1A 3G3KA 2H4IA 2V93A 4PP0A 1Y1ZA 4R72A 2OK2A 3ZS6A 1IXHA 3DP6A 4H5GA 3VFJA 4L17A 4Q8RA 1NNFA 4GIZA 3DP4A 3Q27A 4AQ4A 1S50A 3KSXA 2Z8DA 3SERA 3S2VA 3PUXE 3C32A 4U1OA 2F35A 5KDTA 3K00A 3UP9A 5H8NA 4XIGQ 3UA8A 2QS3A 4JWXA 4NWDA 2FYIA 3VXBA 2QMWA 5ICQA 4QFLA 4F3GA 2F36A 5JEIA 2F7CA 1H45A 3DM0A 1IXCA 2ALUA 3IR1A 5FTIA 3TCFA 1EU8A 5I57B 3GZGA 2F5XA 1B1HA 3A09A 3MZBA 3QSLA 4XKNA 1Z7ME 2CZLA 1ATGA 1MXWA 1N76A 4DXCA 1RYXA 1MY3A 3TFLA 4GLIA 1XT8A 4FIMA 3TCHA 5I56B 2PT2A 4NF8A 3CSBA 1YAEA 3C33A 2RINA 3IOTA 1N3XA 1FQDA 4JWYA 4LQ5A 2HAVA 4DXBA 1NNTA 2O84X 2I0CA 1A8FA 2DYXA 3OO8A 1QW0A 3KJ7A 3IB2A 4X1BA 1SYHA 3D4GA 3K1PA 1LAFE 1O64A 2O69A 2VD3A 5I2KB 3KOTA 1H3DA 5A5XA 4KYEA 4Z0IA 1CE2A 3FUZA 1LSTA 4QRZA 1XVXA 4YKKA 2DP8A 3TODA 1A7LA 3PGFA 5ICTA 4RA1A 4TLLB 5CI5A 2QS2A 3ZKKA 3I3VA 2B65A 4HW8A 2AL5A 2HZLA 4G8NA 3A3CA 3K1MA 1FCKA 4FE8A 3VDFA 2AYSA 2O6AA 2DXYA 4GF8A 2V84A 4PFWA 4P0IA 1FQEA 3T22A 1LCTA 5AA4A 3MVYA 3RGYA 4KPTA 4LZ5A 4OESA 3TELA 3GBAA 1MRPA 3TQWA 3ODBA 3W9VA 2O7UA 1UTBB 2X7PA 3HV1A 2HFBA 5AA2A 1M5DA 3CFLA 2F34A 3GBBA 1MM6A 1GGGA 3H4ZA 2OBGA 3L6GA 5FHNA 4RPOA 4BLAA 4OEUA 4RPNA 3K6VA 4MLVA 4KQPA 4F19A 2XX8A 1LB8A 4GL8A 4FAJA 4RYAA 1M5EA 2V3QA 4F2OA 2ZNSA 4MBPA 3M3KA 3V8XB 1JNFA 1MY4A 1A40A 4Q30B 2G93A 4NF5A 4LVQA 2E0SA 3E4RA 4OXVA 5F1QA 1IIWA 4QFNA 4WEDA 1SDXA 4F3PA 2OWTA 4IO5A 3CSGA 3E13X 4RK2A 3FXRA 2R9JA 3JYRA 4M1VA 2F6PA 2HAUA 2DE2A 3QK6A 5L8DA 3VLUA 3CFZA 4PFUA 4AB5A 4U23A 1Y9UA 3IJXB 4IO3A 3OEMA 1BP5A 3PD9A 4G4PA 4H0WA 3FVGA 2DWIA 2VD2A 3I5OA 3TZAA 1S9TA 3THIA 4KR5A 5DEXA 1N7XA 3FZVA 1P1NA 4POWA 2P2AA 1OIBA 2UYFA 5H8QA 1XS5A 3T93B 1A8EA 3CVGA 1B52A 3K02A 4POXA 1OLCA 5ITPA 4IB2A 4RNSA 4ELRA 4NF6A 3ILUB 2QJEA 2AL4A 1US5A 1Q35A 4N13A 3LSFB 2UVIA 4BDLA 4XTCQ 4ZE8A 1MQHA 3WAFA 1USYH 4YKIA 3U93A 2Q88A 3W9WA 2YLNA 5L9OA 3I6VA 3KGCA 4GL0A 4QFOA 1B5IA 1MY1A 3FATA 1AMFA 2XD2A 4ZDMA 5CBRA 4PQJA 1OMPA 2W7YA 4ZS9A 3U8QA 3RTFB 5H8FA 3KN3A 4E0WA 4IY6A 2Z8FA 2NXOA 1MXUA 2X7QA 4KCDA 3PMWA 3G3GA 1B1XA 3N94A 1H43A 1LFGA 1Y3QA 1S7YA 3VLWA 4QSEA 1B7ZA 3N6TA 1GVCA 4X9TA 5JK4A 1AH5A 2OLBA 5FHOA 2PBWA 3PU5A 1OVBA 1AIVA 3WAEA 4E0XA 4JBZA 2F7AA 4ZEBA 1A99A 5H8HA 2I4CA 4AB6A 1IQ7A 3S4UA 4DLDA 2B3FA 1QKAA 4GWOA 4GFRA 3MUQA 1MQIA 1P1OA 2QS4A 2LAOA 2KLFA 3BFUA 3FJGA 3FV1A 4JWOA 3UORA 2E1SA 4ONYA 4I62A 2BJJX 2OZZA 4JSOA 4RY1A 3OOAA 1ZIUA 4ESXA 4WKMA 3T9HB 4O3BA 3OXNA 3KFMA 2UVJA 3S9NC 3ZKLA 4THIA 1P99A 3HSTA 4UA8A 2HXWA 4G2ZA 2IEEA 3UK4A 4ISUA 5L9MA 3G3FA 3KBRA 3EHSA 4GRKA 3RN8A 2B3BA 3OSQA 3PPPA 4DIGA 1LAXA 4LP2B 1MM7A 2FNCA 3T9UA 1SW1A 4F29A 2ONSA 3GLBA 4U2RA 5KDTB 5KZTA 3MWBA 1POY1 3D4CA 5H8NB 2RCBA 3MVXA 4XKRA 1MQGA 4YAHX 2RC9A 4ELOA 2ZYKA 3G3IA 1JQFA 4IO6A 4PETA 3IL1B 4EDPA 4I8CA 3Q26A 1SI0A 1B5HA 1N3WA 3PMXA 3EF7A 1MXVA 4FECA 4I9DA 4F22A 3PD8A 4N6PA 1PBPA 3U1OA 2RCAA 1B51A 4BDRA 3Q25A 2Y7IA 2H9BA 2GHBA 3KN7A 3T96B 4QFPA 1Y1MA 3MW0A 2Y7KA 4KCCA 3IO4A 4NF8B 1I69A 5DT6A 1FW0A 1GTKA 1Z7NE 3KN8A 1DTGA 2ESNA 3IB0A 2ZNUA 2P1SA 4M4GA 3GXAA 1B2HA 1PEBA 4OMBA 1IITA 4NF4A 2XXRA 3BBRA 4EQ7A 3CI8A 1QVSA 3MPLA 1MPDA 1LBBA 4LA9A 1MY0A 5A5XB 3QYTA 1F9BA 4OEVA 2XXPA 5DVJA 2ANJA 1YPNA 1VE4A 4LONB 4DE8A 4C1UA 5JTYA 4GQOA 3C36A 2XXYA 5TU0A 5KCJA 2QSXA 3FD3A 1UIVA 4H65A 3MP6A 3MAMA 5DVIA 5AE4A 2CMOA 2DWHA 2O1LA 5AA2D 4QF9A 1QUKA 4MFIA 3FJMA 5M2VA 1MDP1 4LUBA 3EPEA 1RYOA 2D21A 1J1NA 3CG3A 4H5FA 5AA4B 1URDA 1I6AA 4NWCA 5IAIA 1JEVA 2F6GA 3CIJA 3SEWA 2NOOA 1A55A 3LC8A 3MBPA 1SQYA 5AA2B 1P1QA 2XX7A 1LBCA 3B6TA 5K2YA 1SBPA 4ZEKA 2REGA 1L5TA 4ZE9A 4XKPA 3VVEA 2QL3A 4BDOA 4JB7A 4H8JA 4MLQA 3TTRA 3ZSFA 2RC8A 4EQ9A 1H44A 3VV5A 4OTEA 2XD3A 4BDQA 3PMVA 4HCWA 5TPAA 2I49A 4F31B 3LUYA 3PPNA 5EHMA 1FTKA 2A5TA 3K6XA 2H5YA 1P1WA 2UVGA 4IO7A 3CRBA 4NF5B 1OLAA 3O9PA 3JV9A 4OETA 5H8SA 1LLSA 1TFAA 1D4NA 3O28A 4NE4A 3U94A 1BTJA 3FVKA 2DXRA 1N0TA 2HQ0A 4LZ7A 1VFDA 3T9XB 4GOTA 3PUZE 5HBCA 2PT1A 4OYVA 4NMYA 3C35A 3IOUA 3M3LA 3U92A 3SEVA 1TWYA 4FORA 2DVCA 2UYEA 1US4A 4GXSB 3R6UA 5HPQA 2I58A 1GR2A 2PMSA 2YJPA 1Y3PA 3M3FA 3USDA 5DEXB 1OQHA 4U1ZA 1SD3A 1WODA 2H99A 4H8IA 4TQUQ 5ISUA 3HPIA 5H8QB 3RQTA 2ZYMA 3TTKA 1N7WA 4H1XA 3SESA 1JW5A 3LSLA 1EZPA 2Y84A 3IJOB 3TMGA 3V5AA 3PUVE 3IORA 3MP1A 3R26A 3ECRA 4R73A 2PYYA 4WXJA 1NH7A 3CG1A 2XXHA 3OENA 4IO2A 4NF6B 1MY2A 3OO9A 3FGSA 1QUJA 1TFDA 4XKQA 2FA7A 4F2QA 4LZ8A 3FIRA 1B58A 1EH3A 3SEYA 5FHMA 2NWJA 3R7XA 3B7DA 1B05A 5I58A 3IK6B 5HM4B 1B5JA 2VHAA 1D9YA 5BUUA 2Q2CA 1M5FA 1NNKA 1Y4CA 4IGRA 3MVWA 5I2NA 5AA3A 4XXUA 2AIXA 5DTBA 1M5BA 5H8FB 5I59A 5EHSA 1GV8A 2QMXA 2F8DA 2REJA 3LBSA 1H76A 1LFIA 1MXZA 1EZOA 1PB9A 1DPEA 1IUDA 2H98A 3MPKA 1HSEA 1DTZA 1WDNA 1NL5A 2ONKE 1UTHA 4F3SA 4DZ1A 4U4SA 3K1NA 4BDMA 4P0GA 4G68A 4K3FA 5H8HB 3B6WA 1LCFA 2I0BA 2ZYOA 3IB1A 1RKMA 1SW2A 4GVOA 4DCXA 2V3UA 3ONMA 3UGWA 4H6DA 2IA4A 1PDAA 1R9QA 2DQVA 4G68C 4ND9A 1B4HA 5F7VA 5J1DA 3HHFA 4YMAA 3M8UA 3MQ9A 4TLMB 3L6HA 4YU0A 3V89B 4HCYA 3H6VA 1CB6A 1B7UA 3SKPA 2GFEA 4R6HA 4QHQA 1R6ZA 3O6GA 1B40A 5EYFA 1Y3NA 1SW4A 4OQOA 5CRYA 4GXAA 4X1DA 1POTA 2DSFA 3TQLA 3H6UA 3PV0E 1R1NA 3VE1B 3F11A 2VP1A 2DVZA 3W15C 1NKXA 5CC2A 4OENA 2GRVA 3DP8A 3U72A 4KI0E 2I4BA 1SVXB 1NFTA 2F97A 2HEUA 5AA1A 1URGA 3MZ1A 5ELVA 4C0RA 1LAHE 3VXCA 4Q0CA 1DOTA 1ZTYA 2HZKA 3EHUA 4WEPA 5CMCA 3UIFA 1MQDA 4HTGA 1NMUA 1LGBC 4F1YA 3TEPA 1QUIA 4I1DA 2XXWA 4EF1A 2RC7A 1FTOA 2Q9TA 1Y4TA 3IOWA 4O3CA 5IKBA 1XHYA 1ZKBA 3EQ1A 1N04A 1IZ1A 4IY5A 2Q8JA 3K6UA 2ONRA 1DMBA 2OWSA 5TP9A 2R71A 5CMMA 1MPBA 2ABHA 1OVTA 3IO6A 4R75A 3BKIB 2I48A 3O6IA 1P1UA 1A54A 2ZNTA 3K2DA 1B7HA 3TUSA 2UXAA 2F7BA 4KHZE 3BFTA 4EF2A 2Y7PA 4NF4B 1VSOA 1Q1KA 4ECFA 2XXXA 1IXIA 3QUFA 3G7WA 4F1VA 3N26A 3O66A 1D3KA 1B46A 2WKYA 3SEXA 1PB8A 3TYHA 4OFJA 4Q5TA 2R6GE 3PUYE 5JTYB 1B3HA 4OFLA 5KCJB 3TDJA 1B3LA 1FTLA 3KJTA 4U22A 3EN3A 2G29A 2XXQA 1FQCA 2DE4A 3HN0A 4TOZA 1USYE 4NTLA 5CMBA 4U21A 4YB5A 4ZEDA 4YB7A 4IO4A 3DLNA 4R9FA 4ZECA 1YCJA 1R9LA 4KYSA 4KYDA 3FVNA 1XVYA 1PB7A 3RT8A 1JW1A 4RJZA 3LSWA 1HSLA 1MH3A 3HO7A 4X48A 1JEUA 3TAJA 2NUVA 1BLFA 3SEUA 5I57A 1KWHA 1ANFA 3H06B 2ZYNA 3FXQA 2XXIA 5LOMA 1IXGA 3RT6B 3PUWE 5I84A 3S9EA 1FQBA 4RXLA 3LSXA 1FQFA 2DWJA 2HCAA 4QSCA 4YMBA 5DVFA 3KZGA 4N07A 3OEKA 4YKJA 3FASA 5I56A 5TPAB 3E9XA 4JSDA 1NNPA 3TTMA 3SETA 2D3IA 2OJTA 2Y7RA 2F78A 2DWAA 3EHTA 3V83A 1BIYA 2A5TB 3H6TA 5BWJA 4EUOA 3N6UA 4FATA 1ZLQA 1NH8A 3MP8A 1MXYA 3HCQA 5I2KA 2DE3A 4P11A 3TKDA 3IAZA 3AXFA 4LATA 2O68A 1MG1A 4HS7A 4EQBA 3N5LA 1B6HA 2Z8EA 3ILTB 1SI1A 3MVZA 4G8HA 3TPAA 2XHDA 1XOCA 2Q2AA 2PX1A 3KG2A 3FXUA 2Z22A 1OQGA 3E3KA 1VFEA 2UVHA 1I6QA 2QRYA 1T0KA 3TCGA 5L9SA 2X26A 4IGTA 3KOSA 3OMBA 3VVFA 2DOJA 4RK9A 1D9VA 1MXXA 1UTBA 2XXUA 4FEBA 3H03A 1UQWA 3QXMA 1O7TA 3O2AA 2Y7WA 4U4XA 1DSNA 2Z23A 4JXIA 1MS7A 1I6BA 3KSJA 3MZ9A 4YICA 1LAGE 5FTHA 1B32A 1PC3A 3H6WA 1JW4A 1FTJA 2QS1A 1FQAA 4YB6A 1B3FA 5I58B 3JZJA 3K4UA 5DYHA 4ZEIA 1DPPA 1ZU0A 1IEJA 1QJMA 1EZ9A 3OO6A 2A5SA 3G3JA 2DS9A 4ESWA 2VGQA 5I2NB 4NEDA 4YZZA 4R2FA 1BKAA 2D5WA 3FJ7A 1MQJA 5I59B 3PPRA 3MC2A 2V3TA 1N84A 4JDFA 4G77A 5CMKA 1VR5A 2NVUB 3T66A 4ELPA 3QUJA 1B0LA
chains in the Genus database with same CATH superfamily
2XXTA 3CFXA 2I3WA 5IZ3A 3O29A 2HHMA 3S9MC 2Y5LA 5ET6A 1JVYA 4F3BA 4UACA 3S9LC 1UTHB 4OERA 4YKPA 2ZMBA 1JVXA 3FV2A 2FHYA 4R2BA 4KFQA 2QPQA 4G8MA 4F39A 4G68B 2PVUA 1RDXA 2Q74A 3PPQA 5K2XA 1FBCA 4OVPA 4Z7EA 3H7MA 4MHFA 3D1RA 4DDDA 1LBWA 4R6YA 2O51A 2I6EA 3C4MA 1MPCA 2OCUA 3T9VA 1QKBA 3OSRA 3K0VA 2DDKA 3QIMA 4N4UA 1MDQA 2GH9A 4P1LA 4ZEFA 4PFTA 4EXLA 4O3AA 3PPOA 1YTVA 1K9YA 1FPIA 1WVJA 5ITOA 3K6WA 4R6KA 3IOVA 4OZ9A 5EYHA 3RLFE 2ZXTA 2RF1A 2I3VA 4MF3A 3OELA 4DXUA 5B70A 3KEIA 4R74A 1TT1A 3O6HA 2O1MA 1SYIA 3TTLA 5EQ8A 5CBSA 2JJKA 3Q29A 3E79A 1UIUA 3A3UA 1AOVA 2ZZXA 3C34A 1FJ6A 3B6QA 3RPWA 4R9GA 2Q89A 3OD7A 1PBQA 1JETA 3C9HA 1B3GA 3SDFA 2V25A 3E78A 4C1TA 2B4LA 1B0HA 3TTNA 4MH5A 1MH4A 2M8CA 1TXFA 1II5A 2YPNA 3RY3A 4F1UA 3RUMA 3BIGA 1B9JA 1LB9A 4DCYA 1B4ZA 3FVOA 5CM6A 1ZJLA 4PE5B 5B7DA 1INPA 3DELB 3G3HA 3O97A 4FEDA 1Y20A 2GHAA 4LQ2A 4PTKA 4OVJA 3IX1A 1FTMA 1URSA 4QFKA 3LR1A 1LFHA 1ZMGA 3CR9A 2KQZA 4OVRA 4OWDA 4BDNA 3C31A 4GD5A 4PFYA 2THIA 1ELJA 4F18A 3P7IA 3VVDA 3Q28A 2F3BA 1VDWA 2VOZA 1NI9A 3OO7A 3RTWB 1HSJA 4ZZEA 4H67A 5TP9B 4OFOA 5EYGA 2P0SA 2XX9A 1ZBMA 4ELQA 4KD5A 2H25A 3VLVA 3RNNA 5FBPA 3HHGA 1O63A 3MJNA 4DI3D 2CEYA 1B3EA 1SW5A 4QSDA 4FJPA 4ZZAA 4PFIA 3H3GA 3K01A 1QULA 3QAXA 2O7IA 3UN6A 4OHNA 1NV0A 2RKMA 1M5CA 1AL3A 5EQ7A 4EXKA 2XXVA 1XC1A 3G3KA 2H4IA 2V93A 4PP0A 1Y1ZA 4R72A 2OK2A 4GBWA 3ZS6A 1IXHA 1KA1A 3DP6A 4H5GA 3VFJA 4L17A 1FBGA 4Q8RA 1NNFA 4GIZA 3DP4A 3Q27A 4AQ4A 1S50A 3KSXA 2Z8DA 3SERA 3S2VA 3PUXE 3C32A 4U1OA 2F35A 5LTCA 5KDTA 3K00A 3UP9A 5H8NA 4XIGQ 3UA8A 2QS3A 4JWXA 4NWDA 2FYIA 3VXBA 1IMEA 2QMWA 5ICQA 4QFLA 4F3GA 2F36A 5JEIA 2F7CA 1H45A 3DM0A 1IXCA 2ALUA 3IR1A 5FTIA 3TCFA 1EU8A 5I57B 3GZGA 2F5XA 1B1HA 4H46A 3QMFA 3A09A 3MZBA 3QSLA 4XKNA 1Z7ME 2CZLA 1ATGA 1MXWA 1N76A 4DXCA 1RYXA 1MY3A 1YZ0A 4GBVA 3TFLA 4GLIA 4PFRA 1XT8A 2OX3A 4FIMA 3TCHA 5I56B 2PT2A 4NF8A 1RDYA 3CSBA 3B8BA 1YAEA 3C33A 2RINA 3IOTA 1N3XA 1FQDA 4JWYA 4LQ5A 1NV6A 2HAVA 4DXBA 1NNTA 2O84X 2I0CA 1A8FA 2DYXA 5J16A 3OO8A 1QW0A 3KJ7A 2VPOA 3IB2A 4X1BA 1SYHA 3D4GA 4PAIA 1FBDA 3K1PA 1LAFE 1O64A 2O69A 2VD3A 5I2KB 2Y5KA 3KOTA 4OVQA 1H3DA 5A5XA 4KYEA 4Z0IA 1CE2A 3FUZA 1LSTA 2BJIA 4QRZA 1XVXA 4YKKA 2DP8A 3TODA 4PGNA 1A7LA 3PGFA 5ICTA 4RA1A 4TLLB 4N8GA 5CI5A 2QS2A 3ZKKA 3I3VA 2B65A 4HW8A 4MAGA 2AL5A 2HZLA 3SZPA 4G8NA 3A3CA 3K1MA 1FCKA 1EYKA 4FE8A 3VDFA 3IFCA 4O8MA 2AYSA 2O6AA 2DXYA 4GF8A 2CEXA 4GWSA 2V84A 4PFWA 4P0IA 1FQEA 3T22A 1LCTA 5AA4A 3MVYA 3RGYA 4KPTA 4LZ5A 4OESA 3TELA 3GBAA 1MRPA 3TQWA 3ODBA 3W9VA 2O7UA 4HXVA 1UTBB 2X7PA 3HV1A 2HFBA 4PCDA 5AA2A 1M5DA 3CFLA 2F34A 3GBBA 3RYDA 1MM6A 1GGGA 1SPIA 3H4ZA 2OBGA 3L6GA 5FHNA 4PAFA 3MSTA 4RPOA 4BLAA 4OEUA 4MMPA 4RPNA 3K6VA 4MLVA 2FBPA 4KQPA 4F19A 2XX8A 1LB8A 4GL8A 5EQAA 4FAJA 4RYAA 1M5EA 2V3QA 1FPJA 4F2OA 2ZNSA 4MBPA 3M3KA 2F3DA 4MNPA 4MCOA 3V8XB 1JNFA 4JVDA 4PDHA 1MY4A 1A40A 2ZZWA 4Q30B 4N81A 2G93A 4NF5A 4LVQA 2E0SA 3E4RA 4OXVA 5F1QA 1IIWA 4QFNA 1NV3A 4WEDA 1SDXA 4F3PA 2OWTA 4IO5A 2MKZA 5I5PA 5IZ3B 3CSGA 3E13X 4RK2A 1JP4A 1FPDA 3FXRA 2R9JA 3JYRA 5F24A 4M1VA 2F6PA 3RPLA 2HAUA 1IMBA 2DE2A 3QK6A 5L8DA 3VLUA 3CFZA 4PFUA 4AB5A 4U23A 1Y9UA 4O94A 3IJXB 4IO3A 3OEMA 1NUXA 1BP5A 3PD9A 4G4PA 4H0WA 3FVGA 2DWIA 2VD2A 3I5OA 3TZAA 1S9TA 4GX6A 3THIA 4KR5A 1XI6A 5DEXA 1N7XA 3FZVA 1P1NA 4POWA 2P2AA 1OIBA 2UYFA 5H8QA 1NUYA 1NV5A 1XS5A 4PC9A 2CZIA 3T93B 1A8EA 3CVGA 1B52A 3K02A 1FPBA 4PAKA 4POXA 1OLCA 5ITPA 4IB2A 4RNSA 3LV0A 4ELRA 4NF6A 3ILUB 2QJEA 2AL4A 4NGUA 1US5A 1Q35A 4N13A 1CNQA 3LSFB 2UVIA 4GWYA 4BDLA 4XTCQ 4ZE8A 1MQHA 3T1BA 4HE0A 3WAFA 1USYH 4YKIA 3U93A 2Q88A 3W9WA 2YLNA 5L9OA 3I6VA 4AS4A 3KGCA 4GL0A 4QFOA 1B5IA 2XWIA 1MY1A 3FATA 1AMFA 2XD2A 4ZDMA 5CBRA 3KC0A 2WBBA 4PQJA 1OMPA 2W7YA 4ZS9A 1EYJA 3U8QA 3RTFB 1IMAA 5H8FA 3KN3A 4E0WA 4IY6A 2Z8FA 2NXOA 1MXUA 2X7QA 4KCDA 3PMWA 3G3GA 5ET7A 1B1XA 3N94A 1H43A 1LFGA 1Y3QA 1S7YA 4P9KA 5ET5A 3VLWA 4QSEA 1B7ZA 1NV4A 3N6TA 1GVCA 4X9TA 5JK4A 1AH5A 2OLBA 5FHOA 2PBWA 3PU5A 1OVBA 1AIVA 3WAEA 4E0XA 4JBZA 2F7AA 4ZEBA 1A99A 5H8HA 2I4CA 4AB6A 2HXRA 1IQ7A 2VT5A 3S4UA 4N6DA 1LEVA 4DLDA 2B3FA 1QKAA 4GWOA 1IMFA 4GFRA 1QGXA 3MUQA 1MQIA 4PDDA 1P1OA 2QS4A 2LAOA 2KLFA 3BFUA 3FJGA 3FV1A 4GX4A 4JWOA 3UORA 2E1SA 3MYUA 3KBZA 2B4MA 4ONYA 4I62A 2BJJX 2OZZA 4JSOA 4RY1A 3OOAA 1ZIUA 4ESXA 4WKMA 4MIJA 3T9HB 4O3BA 3OXNA 3KFMA 2UVJA 3S9NC 4DI4B 3ZKLA 4THIA 1P99A 3HSTA 4X04A 4UA8A 2XWKA 2HXWA 2VPNA 4G2ZA 4XF5A 2IEEA 3UK4A 2QVRA 4ISUA 5L9MA 3G3FA 3KBRA 3EHSA 4GRKA 3RN8A 2B3BA 1FBPA 3OSQA 3PPPA 4DIGA 1LAXA 4LP2B 1MM7A 2FNCA 3T9UA 1LBYA 1SW1A 4I40A 4F29A 2ONSA 1IMCA 1K9ZA 3GLBA 4U2RA 5KDTB 5KZTA 3MWBA 1POY1 3D4CA 1IMDA 5H8NB 3B50A 2QFLA 2RCBA 4XFEA 3MVXA 4XKRA 1MQGA 4YAHX 2RC9A 4ELOA 2ZYKA 3G3IA 5IZZA 1JQFA 4JVCA 1FSAA 5EQ9A 3U65A 4IO6A 4PETA 3IL1B 4EDPA 4I8CA 3Q26A 4QXDA 4OVSA 1SI0A 1B5HA 1N3WA 3PMXA 3EF7A 1MXVA 4FECA 4I9DA 4NHBA 4F22A 3PD8A 4N6PA 1PBPA 2WBDA 3U1OA 1NUZA 2RCAA 1B51A 4BDRA 3ROJA 3Q25A 2Y7IA 1FJ9A 2H9BA 2GHBA 3KN7A 3T96B 4O7MA 4QFPA 1Y1MA 3MW0A 2Y7KA 4KCCA 3IO4A 4NF8B 1I69A 5DT6A 1FW0A 1GTKA 1Z7NE 3KN8A 1DTGA 2ESNA 3IB0A 2ZNUA 4NAPA 2P1SA 4M4GA 4NF0A 3GXAA 1B2HA 1PEBA 4OMBA 1IITA 4NF4A 2XXRA 3BBRA 1LBZA 2FIEA 4EQ7A 3CI8A 2V4CA 1QVSA 3MPLA 1MPDA 1LBBA 4LA9A 1MY0A 5A5XB 3QYTA 1F9BA 4NQ8A 4OEVA 2XXPA 5DVJA 2ANJA 1YPNA 1VE4A 4LONB 4DE8A 2PFYA 4C1UA 5JTYA 4GQOA 3C36A 2XXYA 5TU0A 5KCJA 2QSXA 3FD3A 3LUZA 1UIVA 4H65A 3MP6A 1BK4A 3MAMA 5DVIA 5AE4A 2CMOA 2DWHA 2O1LA 1G0HA 5AA2D 4QF9A 1FTAA 2XA5A 1QUKA 4MFIA 3FJMA 4GWXA 5M2VA 1MDP1 4LUBA 3EPEA 2ZZVA 4JVIA 1RYOA 2D21A 1J1NA 3CG3A 4H5FA 5AA4B 1URDA 4H45A 5IGAA 1I6AA 4NWCA 5IAIA 1JEVA 2F6GA 3CIJA 3SEWA 2NOOA 1A55A 3LC8A 3MBPA 1SQYA 4N6KA 5AA2B 1P1QA 2XX7A 4MNIA 1LBCA 3B6TA 5K2YA 1SBPA 5DW8A 4ZEKA 2REGA 1L5TA 4ZE9A 4XKPA 3VVEA 5I3SA 2QL3A 4BDOA 3FBPA 1KA0A 4JB7A 4H8JA 4MLQA 3TTRA 3ZSFA 2RC8A 4EQ9A 1H44A 3VV5A 4OTEA 2XD3A 4BDQA 1NV7A 3FXBA 3PMVA 4HCWA 5TPAA 2I49A 4F31B 4NN3A 3LUYA 4GWWA 3PPNA 4NG7A 5EHMA 1FTKA 2A5TA 3K6XA 4P56A 4I3EA 2H5YA 1P1WA 2UVGA 4IO7A 3CRBA 3ISPA 2FVZA 4NF5B 1OLAA 3O9PA 3JV9A 4OETA 5H8SA 1LLSA 1TFAA 1D4NA 4NE4A 3O28A 3U94A 4N17A 4X8RA 2CZHA 1BTJA 3FVKA 2DXRA 1N0TA 2HQ0A 4LZ7A 1VFDA 3T9XB 4GOTA 3PUZE 5HBCA 2PT1A 4OYVA 1LBVA 3RPLB 4NMYA 3C35A 3IOUA 2P3NA 3M3LA 3U92A 2Q8MA 3SEVA 1TWYA 4FORA 2DVCA 2UYEA 1US4A 4GXSB 3R6UA 1FPKA 4I3YA 5HPQA 2I58A 4OA4A 1GR2A 2PMSA 2YJPA 4P3LA 1Y3PA 3M3FA 5IZ1A 3USDA 5DEXB 1OQHA 4U1ZA 1SD3A 1WODA 4G61A 2H99A 4H8IA 4TQUQ 5ISUA 3HPIA 5H8QB 3RQTA 2ZYMA 3TTKA 1N7WA 4H1XA 3SESA 1JW5A 3LSLA 3KC1A 1EZPA 2Y84A 1NV2A 3IJOB 3TMGA 3V5AA 3PUVE 3IORA 3MP1A 3R26A 3ECRA 4R73A 2PYYA 4WXJA 1NH7A 4P47A 3CG1A 2XXHA 3OENA 4IO2A 4NF6B 1MY2A 3OO9A 3FGSA 4MEVA 1QUJA 1TFDA 4XKQA 2FA7A 4F2QA 4LZ8A 1FPEA 4MNCA 3FIRA 1B58A 1EH3A 3SEYA 5FHMA 2NWJA 3R7XA 3B7DA 4FBPA 1B05A 2FIXA 5I58A 2QVUA 3IK6B 5HM4B 1B5JA 2VHAA 1D9YA 5BUUA 2Q2CA 1M5FA 1FBFA 1NNKA 1FBEA 1Y4CA 4IGRA 3MVWA 5I2NA 5AA3A 4XXUA 2AIXA 5DTBA 1M5BA 5H8FB 5I59A 5EHSA 1YYZA 1GV8A 2QMXA 2F8DA 2REJA 3LBSA 1H76A 1LFIA 1MXZA 1EZOA 1G0IA 1PB9A 1DPEA 1IUDA 2H98A 3MPKA 4P1EA 4GX3A 1HSEA 1DTZA 1WDNA 1NL5A 2ONKE 1UTHA 2WX9A 4F3SA 4DZ1A 4U4SA 3K1NA 4BDMA 4P0GA 4P8BA 4G68A 4K3FA 5H8HB 3B6WA 1LCFA 2I0BA 2ZYOA 3IB1A 1RKMA 1SW2A 4GVOA 4HE1A 4DCXA 2V3UA 3ONMA 3UGWA 4H6DA 2IA4A 1PDAA 1R9QA 2DQVA 4G68C 4ND9A 1B4HA 3IFAA 5F7VA 5J1DA 3HHFA 4YMAA 3M8UA 4XEQA 3MQ9A 4TLMB 4PBQA 3L6HA 3NOHA 4YU0A 3V89B 2WYPA 4HCYA 3H6VA 1CB6A 1B7UA 3SKPA 2GFEA 4R6HA 4QHQA 1R6ZA 3O6GA 1B40A 5EYFA 1Y3NA 1SW4A 4OQOA 5CRYA 4GXAA 4X1DA 1POTA 2DSFA 3TQLA 3H6UA 3PV0E 3EKIA 1R1NA 3VE1B 1D9QA 3F11A 2VP1A 2DVZA 3W15C 1NKXA 5CC2A 4OENA 2GRVA 3DP8A 3U72A 4KI0E 2I4BA 1SVXB 1AWBA 1NFTA 2F97A 2HEUA 5AA1A 1URGA 3MZ1A 5ELVA 4C0RA 1LAHE 3VXCA 4Q0CA 1DOTA 1ZTYA 2HZKA 3EHUA 4WEPA 5CMCA 3UIFA 3BIHA 1MQDA 4HTGA 1NMUA 1LGBC 4F1YA 3TEPA 1QUIA 4I1DA 2XXWA 4EF1A 2RC7A 4GWUA 1FTOA 2Q9TA 1Y4TA 3IOWA 4O3CA 5IKBA 1XHYA 1ZKBA 3EQ1A 1N04A 1IZ1A 4IY5A 2Q8JA 3K6UA 2ONRA 4PGPA 1DMBA 1FPLA 2OWSA 5TP9A 2PCRA 2R71A 1RDZA 4OVTA 5CMMA 4MJOA 1MPBA 2ABHA 1OVTA 3IO6A 4R75A 4OANA 3BKIB 2I48A 4QBAA 3O6IA 1P1UA 1A54A 2ZNTA 3K2DA 1DK4A 2R8TA 1B7HA 3TUSA 1FPGA 2UXAA 2F7BA 4KHZE 2WEFA 3BFTA 4EF2A 2Y7PA 4MX6A 4NF4B 1VSOA 1Q1KA 4ECFA 2XXXA 1IXIA 3QUFA 3G7WA 4F1VA 3N26A 3O66A 1D3KA 1B46A 2WKYA 3SEXA 4NX1A 1PB8A 3TYHA 4OFJA 4Q5TA 2R6GE 3PUYE 5JTYB 1B3HA 4PF8A 4OFLA 5KCJB 3TDJA 1B3LA 1FTLA 3KJTA 4U22A 3EN3A 2G29A 2XXQA 1FQCA 2DE4A 3HN0A 4TOZA 2XXKA 1USYE 3PTYA 4NTLA 5CMBA 4U21A 4YB5A 4ZEDA 4YB7A 4IO4A 3DLNA 4R9FA 4ZECA 1YCJA 1R9LA 4KYSA 4IR8A 4KYDA 3FVNA 5A5LA 1KZ8A 5ESYA 1XVYA 1PB7A 3RT8A 1JW1A 4RJZA 3LSWA 1HSLA 1MH3A 3HO7A 4N15A 4X48A 1JEUA 3TAJA 2NUVA 1BLFA 4GWZA 4LN5A 2HPGA 3SEUA 5I57A 1KWHA 1ANFA 3H06B 2ZYNA 4AS5A 3FXQA 2XXIA 5LOMA 1IXGA 3RT6B 3PUWE 5I84A 3S9EA 1FQBA 4RXLA 1EYIA 3CHGA 3LSXA 1FQFA 2DWJA 2HCAA 4QSCA 5IM2A 4O7IA 4YMBA 5DVFA 3KZGA 1NUWA 4N07A 5I7IA 3T0JA 3OEKA 4YKJA 3FASA 5I56A 5TPAB 3E9XA 4JSDA 1NNPA 2P3VA 5T3JA 3TTMA 3SETA 2D3IA 2OJTA 2Y7RA 2F78A 1FPFA 2DWAA 3EHTA 3V83A 1FBHA 1BIYA 2A5TB 4HE2A 3H6TA 5BWJA 4EUOA 3N6UA 4FATA 2WYKA 1ZLQA 1NH8A 3MP8A 1MXYA 1DBZA 3HCQA 5I2KA 2DE3A 4PF6A 5LDZA 4P11A 3TKDA 4PBHA 3IAZA 4PE3A 4N91A 3AXFA 4LATA 1FRPA 2O68A 1MG1A 4HS7A 4EQBA 3N5LA 1B6HA 2Z8EA 3ILTB 1SI1A 3MVZA 4G8HA 3TPAA 2XHDA 1XOCA 2Q2AA 2PX1A 3KG2A 3FXUA 2Z22A 1OQGA 2QVVA 3E3KA 5ET8A 1VFEA 2UVHA 2KR0A 1NV1A 1I6QA 2QRYA 1T0KA 3TCGA 2XWOA 2PFZA 5L9SA 2X26A 4IGTA 3KOSA 3OMBA 3VVFA 2DOJA 4RK9A 1D9VA 1MXXA 1UTBA 2L5VA 2XXUA 4PFBA 2OWZA 4N8YA 4FEBA 3H03A 1UQWA 3QXMA 1LBXA 2GQ1A 1O7TA 3O2AA 2Y7WA 4U4XA 1DSNA 2Z23A 4JXIA 1MS7A 1I6BA 3KSJA 3MZ9A 4YICA 1LAGE 5FTHA 1B32A 1PC3A 3H6WA 1JW4A 1FTJA 2QS1A 1FQAA 4YB6A 1B3FA 5I58B 3JZJA 3K4UA 5DYHA 4ZEIA 1DPPA 4KXPA 1ZU0A 1IEJA 1QJMA 1EZ9A 3OO6A 1Q9DA 2A5SA 1DCUA 3G3JA 2DS9A 4ESWA 2VGQA 5I2NB 4NEDA 4YZZA 4R2FA 1BKAA 3A29A 2D5WA 3FJ7A 4UABA 1MQJA 5I59B 3PPRA 1YXIA 3MC2A 2V3TA 1N84A 4JDFA 4G77A 2CZKA 2XWVA 5CMKA 3GYYA 1VR5A 2NVUB 3T66A 4ELPA 3QUJA 1B0LA 3HFUA
chains in the Genus database with same CATH topology
2XXTA 3CFXA 2I3WA 3O29A 3S9MC 1JVYA 4F3BA 4UACA 3S9LC 1UTHB 4OERA 4YKPA 2ZMBA 1JVXA 3FV2A 4R2BA 4KFQA 2QPQA 4G8MA 4F39A 4G68B 2PVUA 3PPQA 5K2XA 4Z7EA 3H7MA 4DDDA 4R6YA 2O51A 2I6EA 3C4MA 1MPCA 2OCUA 3T9VA 1QKBA 3OSRA 3K0VA 3QIMA 1MDQA 2GH9A 4ZEFA 4PFTA 4EXLA 4O3AA 3PPOA 1YTVA 1WVJA 5ITOA 3K6WA 4R6KA 3IOVA 4OZ9A 3RLFE 2ZXTA 2RF1A 2I3VA 4MF3A 3OELA 4DXUA 5B70A 3KEIA 4R74A 1TT1A 3O6HA 2O1MA 1SYIA 3TTLA 5CBSA 3Q29A 1UIUA 3A3UA 1AOVA 3C34A 3B6QA 3RPWA 4R9GA 2Q89A 3OD7A 1PBQA 1JETA 3C9HA 1B3GA 3SDFA 2V25A 4C1TA 1B0HA 3TTNA 4MH5A 1MH4A 2M8CA 1TXFA 1II5A 2YPNA 3RY3A 4F1UA 3RUMA 1B9JA 1LB9A 4DCYA 1B4ZA 3FVOA 5CM6A 1ZJLA 4PE5B 5B7DA 3DELB 3G3HA 3O97A 4FEDA 1Y20A 2GHAA 4LQ2A 4OVJA 3IX1A 1FTMA 1URSA 4QFKA 3LR1A 1LFHA 1ZMGA 3CR9A 4OWDA 4BDNA 3C31A 4GD5A 4PFYA 2THIA 1ELJA 4F18A 3P7IA 3VVDA 3Q28A 2VOZA 3OO7A 3RTWB 1HSJA 4ZZEA 4H67A 5TP9B 4OFOA 2P0SA 2XX9A 1ZBMA 4ELQA 4KD5A 2H25A 3VLVA 3RNNA 3HHGA 1O63A 3MJNA 1B3EA 1SW5A 4QSDA 4FJPA 4ZZAA 3H3GA 3K01A 1QULA 3QAXA 2O7IA 3UN6A 4OHNA 2RKMA 1M5CA 1AL3A 4EXKA 2XXVA 1XC1A 3G3KA 2H4IA 2V93A 4PP0A 1Y1ZA 4R72A 2OK2A 3ZS6A 1IXHA 3DP6A 4H5GA 3VFJA 4L17A 4Q8RA 1NNFA 4GIZA 3DP4A 3Q27A 4AQ4A 1S50A 3KSXA 2Z8DA 3SERA 3S2VA 3PUXE 3C32A 4U1OA 2F35A 5KDTA 3K00A 3UP9A 5H8NA 4XIGQ 3UA8A 2QS3A 4JWXA 4NWDA 2FYIA 3VXBA 2QMWA 5ICQA 4QFLA 4F3GA 2F36A 5JEIA 2F7CA 1H45A 3DM0A 1IXCA 2ALUA 3IR1A 5FTIA 3TCFA 1EU8A 5I57B 3GZGA 2F5XA 1B1HA 3A09A 3MZBA 3QSLA 4XKNA 1Z7ME 2CZLA 1ATGA 1MXWA 1N76A 4DXCA 1RYXA 1MY3A 3TFLA 4GLIA 1XT8A 4FIMA 3TCHA 5I56B 2PT2A 4NF8A 3CSBA 1YAEA 3C33A 2RINA 3IOTA 1N3XA 1FQDA 4JWYA 4LQ5A 2HAVA 4DXBA 1NNTA 2O84X 2I0CA 1A8FA 2DYXA 3OO8A 1QW0A 3KJ7A 3IB2A 4X1BA 1SYHA 3D4GA 3K1PA 1LAFE 1O64A 2O69A 2VD3A 5I2KB 3KOTA 1H3DA 5A5XA 4KYEA 4Z0IA 1CE2A 3FUZA 1LSTA 4QRZA 1XVXA 4YKKA 2DP8A 3TODA 1A7LA 3PGFA 5ICTA 4RA1A 4TLLB 5CI5A 2QS2A 3ZKKA 3I3VA 2B65A 4HW8A 2AL5A 2HZLA 4G8NA 3A3CA 3K1MA 1FCKA 4FE8A 3VDFA 2AYSA 2O6AA 2DXYA 4GF8A 2V84A 4PFWA 4P0IA 1FQEA 3T22A 1LCTA 5AA4A 3MVYA 3RGYA 4KPTA 4LZ5A 4OESA 3TELA 3GBAA 1MRPA 3TQWA 3ODBA 3W9VA 2O7UA 1UTBB 2X7PA 3HV1A 2HFBA 5AA2A 1M5DA 3CFLA 2F34A 3GBBA 1MM6A 1GGGA 3H4ZA 2OBGA 3L6GA 5FHNA 4RPOA 4BLAA 4OEUA 4RPNA 3K6VA 4MLVA 4KQPA 4F19A 2XX8A 1LB8A 4GL8A 4FAJA 4RYAA 1M5EA 2V3QA 4F2OA 2ZNSA 4MBPA 3M3KA 3V8XB 1JNFA 1MY4A 1A40A 4Q30B 2G93A 4NF5A 4LVQA 2E0SA 3E4RA 4OXVA 5F1QA 1IIWA 4QFNA 4WEDA 1SDXA 4F3PA 2OWTA 4IO5A 3CSGA 3E13X 4RK2A 3FXRA 2R9JA 3JYRA 4M1VA 2F6PA 2HAUA 2DE2A 3QK6A 5L8DA 3VLUA 3CFZA 4PFUA 4AB5A 4U23A 1Y9UA 3IJXB 4IO3A 3OEMA 1BP5A 3PD9A 4G4PA 4H0WA 3FVGA 2DWIA 2VD2A 3I5OA 3TZAA 1S9TA 3THIA 4KR5A 5DEXA 1N7XA 3FZVA 1P1NA 4POWA 2P2AA 1OIBA 2UYFA 5H8QA 1XS5A 3T93B 1A8EA 3CVGA 1B52A 3K02A 4POXA 1OLCA 5ITPA 4IB2A 4RNSA 4ELRA 4NF6A 3ILUB 2QJEA 2AL4A 1US5A 1Q35A 4N13A 3LSFB 2UVIA 4BDLA 4XTCQ 4ZE8A 1MQHA 3WAFA 1USYH 4YKIA 3U93A 2Q88A 3W9WA 2YLNA 5L9OA 3I6VA 3KGCA 4GL0A 4QFOA 1B5IA 1MY1A 3FATA 1AMFA 2XD2A 4ZDMA 5CBRA 4PQJA 1OMPA 2W7YA 4ZS9A 3U8QA 3RTFB 5H8FA 3KN3A 4E0WA 4IY6A 2Z8FA 2NXOA 1MXUA 2X7QA 4KCDA 3PMWA 3G3GA 1B1XA 3N94A 1H43A 1LFGA 1Y3QA 1S7YA 3VLWA 4QSEA 1B7ZA 3N6TA 1GVCA 4X9TA 5JK4A 1AH5A 2OLBA 5FHOA 2PBWA 3PU5A 1OVBA 1AIVA 3WAEA 4E0XA 4JBZA 2F7AA 4ZEBA 1A99A 5H8HA 2I4CA 4AB6A 1IQ7A 3S4UA 4DLDA 2B3FA 1QKAA 4GWOA 4GFRA 3MUQA 1MQIA 1P1OA 2QS4A 2LAOA 2KLFA 3BFUA 3FJGA 3FV1A 4JWOA 3UORA 2E1SA 4ONYA 4I62A 2BJJX 2OZZA 4JSOA 4RY1A 3OOAA 1ZIUA 4ESXA 4WKMA 3T9HB 4O3BA 3OXNA 3KFMA 2UVJA 3S9NC 3ZKLA 4THIA 1P99A 3HSTA 4UA8A 2HXWA 4G2ZA 2IEEA 3UK4A 4ISUA 5L9MA 3G3FA 3KBRA 3EHSA 4GRKA 3RN8A 2B3BA 3OSQA 3PPPA 4DIGA 1LAXA 4LP2B 1MM7A 2FNCA 3T9UA 1SW1A 4F29A 2ONSA 3GLBA 4U2RA 5KDTB 5KZTA 3MWBA 1POY1 3D4CA 5H8NB 2RCBA 3MVXA 4XKRA 1MQGA 4YAHX 2RC9A 4ELOA 2ZYKA 3G3IA 1JQFA 4IO6A 4PETA 3IL1B 4EDPA 4I8CA 3Q26A 1SI0A 1B5HA 1N3WA 3PMXA 3EF7A 1MXVA 4FECA 4I9DA 4F22A 3PD8A 4N6PA 1PBPA 3U1OA 2RCAA 1B51A 4BDRA 3Q25A 2Y7IA 2H9BA 2GHBA 3KN7A 3T96B 4QFPA 1Y1MA 3MW0A 2Y7KA 4KCCA 3IO4A 4NF8B 1I69A 5DT6A 1FW0A 1GTKA 1Z7NE 3KN8A 1DTGA 2ESNA 3IB0A 2ZNUA 2P1SA 4M4GA 3GXAA 1B2HA 1PEBA 4OMBA 1IITA 4NF4A 2XXRA 3BBRA 4EQ7A 3CI8A 1QVSA 3MPLA 1MPDA 1LBBA 4LA9A 1MY0A 5A5XB 3QYTA 1F9BA 4OEVA 2XXPA 5DVJA 2ANJA 1YPNA 1VE4A 4LONB 4DE8A 4C1UA 5JTYA 4GQOA 3C36A 2XXYA 5TU0A 5KCJA 2QSXA 3FD3A 1UIVA 4H65A 3MP6A 3MAMA 5DVIA 5AE4A 2CMOA 2DWHA 2O1LA 5AA2D 4QF9A 1QUKA 4MFIA 3FJMA 5M2VA 1MDP1 4LUBA 3EPEA 1RYOA 2D21A 1J1NA 3CG3A 4H5FA 5AA4B 1URDA 1I6AA 4NWCA 5IAIA 1JEVA 2F6GA 3CIJA 3SEWA 2NOOA 1A55A 3LC8A 3MBPA 1SQYA 5AA2B 1P1QA 2XX7A 1LBCA 3B6TA 5K2YA 1SBPA 4ZEKA 2REGA 1L5TA 4ZE9A 4XKPA 3VVEA 2QL3A 4BDOA 4JB7A 4H8JA 4MLQA 3TTRA 3ZSFA 2RC8A 4EQ9A 1H44A 3VV5A 4OTEA 2XD3A 4BDQA 3PMVA 4HCWA 5TPAA 2I49A 4F31B 3LUYA 3PPNA 5EHMA 1FTKA 2A5TA 3K6XA 2H5YA 1P1WA 2UVGA 4IO7A 3CRBA 4NF5B 1OLAA 3O9PA 3JV9A 4OETA 5H8SA 1LLSA 1TFAA 1D4NA 3O28A 4NE4A 3U94A 1BTJA 3FVKA 2DXRA 1N0TA 2HQ0A 4LZ7A 1VFDA 3T9XB 4GOTA 3PUZE 5HBCA 2PT1A 4OYVA 4NMYA 3C35A 3IOUA 3M3LA 3U92A 3SEVA 1TWYA 4FORA 2DVCA 2UYEA 1US4A 4GXSB 3R6UA 5HPQA 2I58A 1GR2A 2PMSA 2YJPA 1Y3PA 3M3FA 3USDA 5DEXB 1OQHA 4U1ZA 1SD3A 1WODA 2H99A 4H8IA 4TQUQ 5ISUA 3HPIA 5H8QB 3RQTA 2ZYMA 3TTKA 1N7WA 4H1XA 3SESA 1JW5A 3LSLA 1EZPA 2Y84A 3IJOB 3TMGA 3V5AA 3PUVE 3IORA 3MP1A 3R26A 3ECRA 4R73A 2PYYA 4WXJA 1NH7A 3CG1A 2XXHA 3OENA 4IO2A 4NF6B 1MY2A 3OO9A 3FGSA 1QUJA 1TFDA 4XKQA 2FA7A 4F2QA 4LZ8A 3FIRA 1B58A 1EH3A 3SEYA 5FHMA 2NWJA 3R7XA 3B7DA 1B05A 5I58A 3IK6B 5HM4B 1B5JA 2VHAA 1D9YA 5BUUA 2Q2CA 1M5FA 1NNKA 1Y4CA 4IGRA 3MVWA 5I2NA 5AA3A 4XXUA 2AIXA 5DTBA 1M5BA 5H8FB 5I59A 5EHSA 1GV8A 2QMXA 2F8DA 2REJA 3LBSA 1H76A 1LFIA 1MXZA 1EZOA 1PB9A 1DPEA 1IUDA 2H98A 3MPKA 1HSEA 1DTZA 1WDNA 1NL5A 2ONKE 1UTHA 4F3SA 4DZ1A 4U4SA 3K1NA 4BDMA 4P0GA 4G68A 4K3FA 5H8HB 3B6WA 1LCFA 2I0BA 2ZYOA 3IB1A 1RKMA 1SW2A 4GVOA 4DCXA 2V3UA 3ONMA 3UGWA 4H6DA 2IA4A 1PDAA 1R9QA 2DQVA 4G68C 4ND9A 1B4HA 5F7VA 5J1DA 3HHFA 4YMAA 3M8UA 3MQ9A 4TLMB 3L6HA 4YU0A 3V89B 4HCYA 3H6VA 1CB6A 1B7UA 3SKPA 2GFEA 4R6HA 4QHQA 1R6ZA 3O6GA 1B40A 5EYFA 1Y3NA 1SW4A 4OQOA 5CRYA 4GXAA 4X1DA 1POTA 2DSFA 3TQLA 3H6UA 3PV0E 1R1NA 3VE1B 3F11A 2VP1A 2DVZA 3W15C 1NKXA 5CC2A 4OENA 2GRVA 3DP8A 3U72A 4KI0E 2I4BA 1SVXB 1NFTA 2F97A 2HEUA 5AA1A 1URGA 3MZ1A 5ELVA 4C0RA 1LAHE 3VXCA 4Q0CA 1DOTA 1ZTYA 2HZKA 3EHUA 4WEPA 5CMCA 3UIFA 1MQDA 4HTGA 1NMUA 1LGBC 4F1YA 3TEPA 1QUIA 4I1DA 2XXWA 4EF1A 2RC7A 1FTOA 2Q9TA 1Y4TA 3IOWA 4O3CA 5IKBA 1XHYA 1ZKBA 3EQ1A 1N04A 1IZ1A 4IY5A 2Q8JA 3K6UA 2ONRA 1DMBA 2OWSA 5TP9A 2R71A 5CMMA 1MPBA 2ABHA 1OVTA 3IO6A 4R75A 3BKIB 2I48A 3O6IA 1P1UA 1A54A 2ZNTA 3K2DA 1B7HA 3TUSA 2UXAA 2F7BA 4KHZE 3BFTA 4EF2A 2Y7PA 4NF4B 1VSOA 1Q1KA 4ECFA 2XXXA 1IXIA 3QUFA 3G7WA 4F1VA 3N26A 3O66A 1D3KA 1B46A 2WKYA 3SEXA 1PB8A 3TYHA 4OFJA 4Q5TA 2R6GE 3PUYE 5JTYB 1B3HA 4OFLA 5KCJB 3TDJA 1B3LA 1FTLA 3KJTA 4U22A 3EN3A 2G29A 2XXQA 1FQCA 2DE4A 3HN0A 4TOZA 1USYE 4NTLA 5CMBA 4U21A 4YB5A 4ZEDA 4YB7A 4IO4A 3DLNA 4R9FA 4ZECA 1YCJA 1R9LA 4KYSA 4KYDA 3FVNA 1XVYA 1PB7A 3RT8A 1JW1A 4RJZA 3LSWA 1HSLA 1MH3A 3HO7A 4X48A 1JEUA 3TAJA 2NUVA 1BLFA 3SEUA 5I57A 1KWHA 1ANFA 3H06B 2ZYNA 3FXQA 2XXIA 5LOMA 1IXGA 3RT6B 3PUWE 5I84A 3S9EA 1FQBA 4RXLA 3LSXA 1FQFA 2DWJA 2HCAA 4QSCA 4YMBA 5DVFA 3KZGA 4N07A 3OEKA 4YKJA 3FASA 5I56A 5TPAB 3E9XA 4JSDA 1NNPA 3TTMA 3SETA 2D3IA 2OJTA 2Y7RA 2F78A 2DWAA 3EHTA 3V83A 1BIYA 2A5TB 3H6TA 5BWJA 4EUOA 3N6UA 4FATA 1ZLQA 1NH8A 3MP8A 1MXYA 3HCQA 5I2KA 2DE3A 4P11A 3TKDA 3IAZA 3AXFA 4LATA 2O68A 1MG1A 4HS7A 4EQBA 3N5LA 1B6HA 2Z8EA 3ILTB 1SI1A 3MVZA 4G8HA 3TPAA 2XHDA 1XOCA 2Q2AA 2PX1A 3KG2A 3FXUA 2Z22A 1OQGA 3E3KA 1VFEA 2UVHA 1I6QA 2QRYA 1T0KA 3TCGA 5L9SA 2X26A 4IGTA 3KOSA 3OMBA 3VVFA 2DOJA 4RK9A 1D9VA 1MXXA 1UTBA 2XXUA 4FEBA 3H03A 1UQWA 3QXMA 1O7TA 3O2AA 2Y7WA 4U4XA 1DSNA 2Z23A 4JXIA 1MS7A 1I6BA 3KSJA 3MZ9A 4YICA 1LAGE 5FTHA 1B32A 1PC3A 3H6WA 1JW4A 1FTJA 2QS1A 1FQAA 4YB6A 1B3FA 5I58B 3JZJA 3K4UA 5DYHA 4ZEIA 1DPPA 1ZU0A 1IEJA 1QJMA 1EZ9A 3OO6A 2A5SA 3G3JA 2DS9A 4ESWA 2VGQA 5I2NB 4NEDA 4YZZA 4R2FA 1BKAA 2D5WA 3FJ7A 1MQJA 5I59B 3PPRA 3MC2A 2V3TA 1N84A 4JDFA 4G77A 5CMKA 1VR5A 2NVUB 3T66A 4ELPA 3QUJA 1B0LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XXT A;  3CFX A;  2I3W A;  3O29 A;  3S9M C;  1JVY A;  4F3B A;  4UAC A;  3S9L C;  1UTH B;  4OER A;  4YKP A;  2ZMB A;  1JVX A;  3FV2 A;  4R2B A;  4KFQ A;  2QPQ A;  4G8M A;  4F39 A;  4G68 B;  2PVU A;  3PPQ A;  5K2X A;  4Z7E A;  3H7M A;  4DDD A;  4R6Y A;  2O51 A;  2I6E A;  3C4M A;  1MPC A;  2OCU A;  3T9V A;  1QKB A;  3OSR A;  3K0V A;  3QIM A;  1MDQ A;  2GH9 A;  4ZEF A;  4PFT A;  4EXL A;  4O3A A;  3PPO A;  1YTV A;  1WVJ A;  5ITO A;  3K6W A;  4R6K A;  3IOV A;  4OZ9 A;  3RLF E;  2ZXT A;  2RF1 A;  2I3V A;  4MF3 A;  3OEL A;  4DXU A;  5B70 A;  3KEI A;  4R74 A;  1TT1 A;  3O6H A;  2O1M A;  1SYI A;  3TTL A;  5CBS A;  3Q29 A;  1UIU A;  3A3U A;  1AOV A;  3C34 A;  3B6Q A;  3RPW A;  4R9G A;  2Q89 A;  3OD7 A;  1PBQ A;  1JET A;  3C9H A;  1B3G A;  3SDF A;  2V25 A;  4C1T A;  1B0H A;  3TTN A;  4MH5 A;  1MH4 A;  2M8C A;  1TXF A;  1II5 A;  2YPN A;  3RY3 A;  4F1U A;  3RUM A;  1B9J A;  1LB9 A;  4DCY A;  1B4Z A;  3FVO A;  5CM6 A;  1ZJL A;  4PE5 B;  5B7D A;  3DEL B;  3G3H A;  3O97 A;  4FED A;  1Y20 A;  2GHA A;  4LQ2 A;  4OVJ A;  3IX1 A;  1FTM A;  1URS A;  4QFK A;  3LR1 A;  1LFH A;  1ZMG A;  3CR9 A;  4OWD A;  4BDN A;  3C31 A;  4GD5 A;  4PFY A;  2THI A;  1ELJ A;  4F18 A;  3P7I A;  3VVD A;  3Q28 A;  2VOZ A;  3OO7 A;  3RTW B;  1HSJ A;  4ZZE A;  4H67 A;  5TP9 B;  4OFO A;  2P0S A;  2XX9 A;  1ZBM A;  4ELQ A;  4KD5 A;  2H25 A;  3VLV A;  3RNN A;  3HHG A;  1O63 A;  3MJN A;  1B3E A;  1SW5 A;  4QSD A;  4FJP A;  4ZZA A;  3H3G A;  3K01 A;  1QUL A;  3QAX A;  2O7I A;  3UN6 A;  4OHN A;  2RKM A;  1M5C A;  1AL3 A;  4EXK A;  2XXV A;  1XC1 A;  3G3K A;  2H4I A;  2V93 A;  4PP0 A;  1Y1Z A;  4R72 A;  2OK2 A;  3ZS6 A;  1IXH A;  3DP6 A;  4H5G A;  3VFJ A;  4L17 A;  4Q8R A;  1NNF A;  4GIZ A;  3DP4 A;  3Q27 A;  4AQ4 A;  1S50 A;  3KSX A;  2Z8D A;  3SER A;  3S2V A;  3PUX E;  3C32 A;  4U1O A;  2F35 A;  5KDT A;  3K00 A;  3UP9 A;  5H8N A;  4XIG Q;  3UA8 A;  2QS3 A;  4JWX A;  4NWD A;  2FYI A;  3VXB A;  2QMW A;  5ICQ A;  4QFL A;  4F3G A;  2F36 A;  5JEI A;  2F7C A;  1H45 A;  3DM0 A;  1IXC A;  2ALU A;  3IR1 A;  5FTI A;  3TCF A;  1EU8 A;  5I57 B;  3GZG A;  2F5X A;  1B1H A;  3A09 A;  3MZB A;  3QSL A;  4XKN A;  1Z7M E;  2CZL A;  1ATG A;  1MXW A;  1N76 A;  4DXC A;  1RYX A;  1MY3 A;  3TFL A;  4GLI A;  1XT8 A;  4FIM A;  3TCH A;  5I56 B;  2PT2 A;  4NF8 A;  3CSB A;  1YAE A;  3C33 A;  2RIN A;  3IOT A;  1N3X A;  1FQD A;  4JWY A;  4LQ5 A;  2HAV A;  4DXB A;  1NNT A;  2O84 X;  2I0C A;  1A8F A;  2DYX A;  3OO8 A;  1QW0 A;  3KJ7 A;  3IB2 A;  4X1B A;  1SYH A;  3D4G A;  3K1P A;  1LAF E;  1O64 A;  2O69 A;  2VD3 A;  5I2K B;  3KOT A;  1H3D A;  5A5X A;  4KYE A;  4Z0I A;  1CE2 A;  3FUZ A;  1LST A;  4QRZ A;  1XVX A;  4YKK A;  2DP8 A;  3TOD A;  1A7L A;  3PGF A;  5ICT A;  4RA1 A;  4TLL B;  5CI5 A;  2QS2 A;  3ZKK A;  3I3V A;  2B65 A;  4HW8 A;  2AL5 A;  2HZL A;  4G8N A;  3A3C A;  3K1M A;  1FCK A;  4FE8 A;  3VDF A;  2AYS A;  2O6A A;  2DXY A;  4GF8 A;  2V84 A;  4PFW A;  4P0I A;  1FQE A;  3T22 A;  1LCT A;  5AA4 A;  3MVY A;  3RGY A;  4KPT A;  4LZ5 A;  4OES A;  3TEL A;  3GBA A;  1MRP A;  3TQW A;  3ODB A;  3W9V A;  2O7U A;  1UTB B;  2X7P A;  3HV1 A;  2HFB A;  5AA2 A;  1M5D A;  3CFL A;  2F34 A;  3GBB A;  1MM6 A;  1GGG A;  3H4Z A;  2OBG A;  3L6G A;  5FHN A;  4RPO A;  4BLA A;  4OEU A;  4RPN A;  3K6V A;  4MLV A;  4KQP A;  4F19 A;  2XX8 A;  1LB8 A;  4GL8 A;  4FAJ A;  4RYA A;  1M5E A;  2V3Q A;  4F2O A;  2ZNS A;  4MBP A;  3M3K A;  3V8X B;  1JNF A;  1MY4 A;  1A40 A;  4Q30 B;  2G93 A;  4NF5 A;  4LVQ A;  2E0S A;  3E4R A;  4OXV A;  5F1Q A;  1IIW A;  4QFN A;  4WED A;  1SDX A;  4F3P A;  2OWT A;  4IO5 A;  3CSG A;  3E13 X;  4RK2 A;  3FXR A;  2R9J A;  3JYR A;  4M1V A;  2F6P A;  2HAU A;  2DE2 A;  3QK6 A;  5L8D A;  3VLU A;  3CFZ A;  4PFU A;  4AB5 A;  4U23 A;  1Y9U A;  3IJX B;  4IO3 A;  3OEM A;  1BP5 A;  3PD9 A;  4G4P A;  4H0W A;  3FVG A;  2DWI A;  2VD2 A;  3I5O A;  3TZA A;  1S9T A;  3THI A;  4KR5 A;  5DEX A;  1N7X A;  3FZV A;  1P1N A;  4POW A;  2P2A A;  1OIB A;  2UYF A;  5H8Q A;  1XS5 A;  3T93 B;  1A8E A;  3CVG A;  1B52 A;  3K02 A;  4POX A;  1OLC A;  5ITP A;  4IB2 A;  4RNS A;  4ELR A;  4NF6 A;  3ILU B;  2QJE A;  2AL4 A;  1US5 A;  1Q35 A;  4N13 A;  3LSF B;  2UVI A;  4BDL A;  4XTC Q;  4ZE8 A;  1MQH A;  3WAF A;  1USY H;  4YKI A;  3U93 A;  2Q88 A;  3W9W A;  2YLN A;  5L9O A;  3I6V A;  3KGC A;  4GL0 A;  4QFO A;  1B5I A;  1MY1 A;  3FAT A;  1AMF A;  2XD2 A;  4ZDM A;  5CBR A;  4PQJ A;  1OMP A;  2W7Y A;  4ZS9 A;  3U8Q A;  3RTF B;  5H8F A;  3KN3 A;  4E0W A;  4IY6 A;  2Z8F A;  2NXO A;  1MXU A;  2X7Q A;  4KCD A;  3PMW A;  3G3G A;  1B1X A;  3N94 A;  1H43 A;  1LFG A;  1Y3Q A;  1S7Y A;  3VLW A;  4QSE A;  1B7Z A;  3N6T A;  1GVC A;  4X9T A;  5JK4 A;  1AH5 A;  2OLB A;  5FHO A;  2PBW A;  3PU5 A;  1OVB A;  1AIV A;  3WAE A;  4E0X A;  4JBZ A;  2F7A A;  4ZEB A;  1A99 A;  5H8H A;  2I4C A;  4AB6 A;  1IQ7 A;  3S4U A;  4DLD A;  2B3F A;  1QKA A;  4GWO A;  4GFR A;  3MUQ A;  1MQI A;  1P1O A;  2QS4 A;  2LAO A;  2KLF A;  3BFU A;  3FJG A;  3FV1 A;  4JWO A;  3UOR A;  2E1S A;  4ONY A;  4I62 A;  2BJJ X;  2OZZ A;  4JSO A;  4RY1 A;  3OOA A;  1ZIU A;  4ESX A;  4WKM A;  3T9H B;  4O3B A;  3OXN A;  3KFM A;  2UVJ A;  3S9N C;  3ZKL A;  4THI A;  1P99 A;  3HST A;  4UA8 A;  2HXW A;  4G2Z A;  2IEE A;  3UK4 A;  4ISU A;  5L9M A;  3G3F A;  3KBR A;  3EHS A;  4GRK A;  3RN8 A;  2B3B A;  3OSQ A;  3PPP A;  4DIG A;  1LAX A;  4LP2 B;  1MM7 A;  2FNC A;  3T9U A;  1SW1 A;  4F29 A;  2ONS A;  3GLB A;  4U2R A;  5KDT B;  5KZT A;  3MWB A;  1POY 1;  3D4C A;  5H8N B;  2RCB A;  3MVX A;  4XKR A;  1MQG A;  4YAH X;  2RC9 A;  4ELO A;  2ZYK A;  3G3I A;  1JQF A;  4IO6 A;  4PET A;  3IL1 B;  4EDP A;  4I8C A;  3Q26 A;  1SI0 A;  1B5H A;  1N3W A;  3PMX A;  3EF7 A;  1MXV A;  4FEC A;  4I9D A;  4F22 A;  3PD8 A;  4N6P A;  1PBP A;  3U1O A;  2RCA A;  1B51 A;  4BDR A;  3Q25 A;  2Y7I A;  2H9B A;  2GHB A;  3KN7 A;  3T96 B;  4QFP A;  1Y1M A;  3MW0 A;  2Y7K A;  4KCC A;  3IO4 A;  4NF8 B;  1I69 A;  5DT6 A;  1FW0 A;  1GTK A;  1Z7N E;  3KN8 A;  1DTG A;  2ESN A;  3IB0 A;  2ZNU A;  2P1S A;  4M4G A;  3GXA A;  1B2H A;  1PEB A;  4OMB A;  1IIT A;  4NF4 A;  2XXR A;  3BBR A;  4EQ7 A;  3CI8 A;  1QVS A;  3MPL A;  1MPD A;  1LBB A;  4LA9 A;  1MY0 A;  5A5X B;  3QYT A;  1F9B A;  4OEV A;  2XXP A;  5DVJ A;  2ANJ A;  1YPN A;  1VE4 A;  4LON B;  4DE8 A;  4C1U A;  5JTY A;  4GQO A;  3C36 A;  2XXY A;  5TU0 A;  5KCJ A;  2QSX A;  3FD3 A;  1UIV A;  4H65 A;  3MP6 A;  3MAM A;  5DVI A;  5AE4 A;  2CMO A;  2DWH A;  2O1L A;  5AA2 D;  4QF9 A;  1QUK A;  4MFI A;  3FJM A;  5M2V A;  1MDP 1;  4LUB A;  3EPE A;  1RYO A;  2D21 A;  1J1N A;  3CG3 A;  4H5F A;  5AA4 B;  1URD A;  1I6A A;  4NWC A;  5IAI A;  1JEV A;  2F6G A;  3CIJ A;  3SEW A;  2NOO A;  1A55 A;  3LC8 A;  3MBP A;  1SQY A;  5AA2 B;  1P1Q A;  2XX7 A;  1LBC A;  3B6T A;  5K2Y A;  1SBP A;  4ZEK A;  2REG A;  1L5T A;  4ZE9 A;  4XKP A;  3VVE A;  2QL3 A;  4BDO A;  4JB7 A;  4H8J A;  4MLQ A;  3TTR A;  3ZSF A;  2RC8 A;  4EQ9 A;  1H44 A;  3VV5 A;  4OTE A;  2XD3 A;  4BDQ A;  3PMV A;  4HCW A;  5TPA A;  2I49 A;  4F31 B;  3LUY A;  3PPN A;  5EHM A;  1FTK A;  2A5T A;  3K6X A;  2H5Y A;  1P1W A;  2UVG A;  4IO7 A;  3CRB A;  4NF5 B;  1OLA A;  3O9P A;  3JV9 A;  4OET A;  5H8S A;  1LLS A;  1TFA A;  1D4N A;  3O28 A;  4NE4 A;  3U94 A;  1BTJ A;  3FVK A;  2DXR A;  1N0T A;  2HQ0 A;  4LZ7 A;  1VFD A;  3T9X B;  4GOT A;  3PUZ E;  5HBC A;  2PT1 A;  4OYV A;  4NMY A;  3C35 A;  3IOU A;  3M3L A;  3U92 A;  3SEV A;  1TWY A;  4FOR A;  2DVC A;  2UYE A;  1US4 A;  4GXS B;  3R6U A;  5HPQ A;  2I58 A;  1GR2 A;  2PMS A;  2YJP A;  1Y3P A;  3M3F A;  3USD A;  5DEX B;  1OQH A;  4U1Z A;  1SD3 A;  1WOD A;  2H99 A;  4H8I A;  4TQU Q;  5ISU A;  3HPI A;  5H8Q B;  3RQT A;  2ZYM A;  3TTK A;  1N7W A;  4H1X A;  3SES A;  1JW5 A;  3LSL A;  1EZP A;  2Y84 A;  3IJO B;  3TMG A;  3V5A A;  3PUV E;  3IOR A;  3MP1 A;  3R26 A;  3ECR A;  4R73 A;  2PYY A;  4WXJ A;  1NH7 A;  3CG1 A;  2XXH A;  3OEN A;  4IO2 A;  4NF6 B;  1MY2 A;  3OO9 A;  3FGS A;  1QUJ A;  1TFD A;  4XKQ A;  2FA7 A;  4F2Q A;  4LZ8 A;  3FIR A;  1B58 A;  1EH3 A;  3SEY A;  5FHM A;  2NWJ A;  3R7X A;  3B7D A;  1B05 A;  5I58 A;  3IK6 B;  5HM4 B;  1B5J A;  2VHA A;  1D9Y A;  5BUU A;  2Q2C A;  1M5F A;  1NNK A;  1Y4C A;  4IGR A;  3MVW A;  5I2N A;  5AA3 A;  4XXU A;  2AIX A;  5DTB A;  1M5B A;  5H8F B;  5I59 A;  5EHS A;  1GV8 A;  2QMX A;  2F8D A;  2REJ A;  3LBS A;  1H76 A;  1LFI A;  1MXZ A;  1EZO A;  1PB9 A;  1DPE A;  1IUD A;  2H98 A;  3MPK A;  1HSE A;  1DTZ A;  1WDN A;  1NL5 A;  2ONK E;  1UTH A;  4F3S A;  4DZ1 A;  4U4S A;  3K1N A;  4BDM A;  4P0G A;  4G68 A;  4K3F A;  5H8H B;  3B6W A;  1LCF A;  2I0B A;  2ZYO A;  3IB1 A;  1RKM A;  1SW2 A;  4GVO A;  4DCX A;  2V3U A;  3ONM A;  3UGW A;  4H6D A;  2IA4 A;  1PDA A;  1R9Q A;  2DQV A;  4G68 C;  4ND9 A;  1B4H A;  5F7V A;  5J1D A;  3HHF A;  4YMA A;  3M8U A;  3MQ9 A;  4TLM B;  3L6H A;  4YU0 A;  3V89 B;  4HCY A;  3H6V A;  1CB6 A;  1B7U A;  3SKP A;  2GFE A;  4R6H A;  4QHQ A;  1R6Z A;  3O6G A;  1B40 A;  5EYF A;  1Y3N A;  1SW4 A;  4OQO A;  5CRY A;  4GXA A;  4X1D A;  1POT A;  2DSF A;  3TQL A;  3H6U A;  3PV0 E;  1R1N A;  3VE1 B;  3F11 A;  2VP1 A;  2DVZ A;  3W15 C;  1NKX A;  5CC2 A;  4OEN A;  2GRV A;  3DP8 A;  3U72 A;  4KI0 E;  2I4B A;  1SVX B;  1NFT A;  2F97 A;  2HEU A;  5AA1 A;  1URG A;  3MZ1 A;  5ELV A;  4C0R A;  1LAH E;  3VXC A;  4Q0C A;  1DOT A;  1ZTY A;  2HZK A;  3EHU A;  4WEP A;  5CMC A;  3UIF A;  1MQD A;  4HTG A;  1NMU A;  1LGB C;  4F1Y A;  3TEP A;  1QUI A;  4I1D A;  2XXW A;  4EF1 A;  2RC7 A;  1FTO A;  2Q9T A;  1Y4T A;  3IOW A;  4O3C A;  5IKB A;  1XHY A;  1ZKB A;  3EQ1 A;  1N04 A;  1IZ1 A;  4IY5 A;  2Q8J A;  3K6U A;  2ONR A;  1DMB A;  2OWS A;  5TP9 A;  2R71 A;  5CMM A;  1MPB A;  2ABH A;  1OVT A;  3IO6 A;  4R75 A;  3BKI B;  2I48 A;  3O6I A;  1P1U A;  1A54 A;  2ZNT A;  3K2D A;  1B7H A;  3TUS A;  2UXA A;  2F7B A;  4KHZ E;  3BFT A;  4EF2 A;  2Y7P A;  4NF4 B;  1VSO A;  1Q1K A;  4ECF A;  2XXX A;  1IXI A;  3QUF A;  3G7W A;  4F1V A;  3N26 A;  3O66 A;  1D3K A;  1B46 A;  2WKY A;  3SEX A;  1PB8 A;  3TYH A;  4OFJ A;  4Q5T A;  2R6G E;  3PUY E;  5JTY B;  1B3H A;  4OFL A;  5KCJ B;  3TDJ A;  1B3L A;  1FTL A;  3KJT A;  4U22 A;  3EN3 A;  2G29 A;  2XXQ A;  1FQC A;  2DE4 A;  3HN0 A;  4TOZ A;  1USY E;  4NTL A;  5CMB A;  4U21 A;  4YB5 A;  4ZED A;  4YB7 A;  4IO4 A;  3DLN A;  4R9F A;  4ZEC A;  1YCJ A;  1R9L A;  4KYS A;  4KYD A;  3FVN A;  1XVY A;  1PB7 A;  3RT8 A;  1JW1 A;  4RJZ A;  3LSW A;  1HSL A;  1MH3 A;  3HO7 A;  4X48 A;  1JEU A;  3TAJ A;  2NUV A;  1BLF A;  3SEU A;  5I57 A;  1KWH A;  1ANF A;  3H06 B;  2ZYN A;  3FXQ A;  2XXI A;  5LOM A;  1IXG A;  3RT6 B;  3PUW E;  5I84 A;  3S9E A;  1FQB A;  4RXL A;  3LSX A;  1FQF A;  2DWJ A;  2HCA A;  4QSC A;  4YMB A;  5DVF A;  3KZG A;  4N07 A;  3OEK A;  4YKJ A;  3FAS A;  5I56 A;  5TPA B;  3E9X A;  4JSD A;  1NNP A;  3TTM A;  3SET A;  2D3I A;  2OJT A;  2Y7R A;  2F78 A;  2DWA A;  3EHT A;  3V83 A;  1BIY A;  2A5T B;  3H6T A;  5BWJ A;  4EUO A;  3N6U A;  4FAT A;  1ZLQ A;  1NH8 A;  3MP8 A;  1MXY A;  3HCQ A;  5I2K A;  2DE3 A;  4P11 A;  3TKD A;  3IAZ A;  3AXF A;  4LAT A;  2O68 A;  1MG1 A;  4HS7 A;  4EQB A;  3N5L A;  1B6H A;  2Z8E A;  3ILT B;  1SI1 A;  3MVZ A;  4G8H A;  3TPA A;  2XHD A;  1XOC A;  2Q2A A;  2PX1 A;  3KG2 A;  3FXU A;  2Z22 A;  1OQG A;  3E3K A;  1VFE A;  2UVH A;  1I6Q A;  2QRY A;  1T0K A;  3TCG A;  5L9S A;  2X26 A;  4IGT A;  3KOS A;  3OMB A;  3VVF A;  2DOJ A;  4RK9 A;  1D9V A;  1MXX A;  1UTB A;  2XXU A;  4FEB A;  3H03 A;  1UQW A;  3QXM A;  1O7T A;  3O2A A;  2Y7W A;  4U4X A;  1DSN A;  2Z23 A;  4JXI A;  1MS7 A;  1I6B A;  3KSJ A;  3MZ9 A;  4YIC A;  1LAG E;  5FTH A;  1B32 A;  1PC3 A;  3H6W A;  1JW4 A;  1FTJ A;  2QS1 A;  1FQA A;  4YB6 A;  1B3F A;  5I58 B;  3JZJ A;  3K4U A;  5DYH A;  4ZEI A;  1DPP A;  1ZU0 A;  1IEJ A;  1QJM A;  1EZ9 A;  3OO6 A;  2A5S A;  3G3J A;  2DS9 A;  4ESW A;  2VGQ A;  5I2N B;  4NED A;  4YZZ A;  4R2F A;  1BKA A;  2D5W A;  3FJ7 A;  1MQJ A;  5I59 B;  3PPR A;  3MC2 A;  2V3T A;  1N84 A;  4JDF A;  4G77 A;  5CMK A;  1VR5 A;  2NVU B;  3T66 A;  4ELP A;  3QUJ A;  1B0L A; 
#chains in the Genus database with same CATH topology
 2XXT A;  3CFX A;  2I3W A;  5IZ3 A;  3O29 A;  2HHM A;  3S9M C;  2Y5L A;  5ET6 A;  1JVY A;  4F3B A;  4UAC A;  3S9L C;  1UTH B;  4OER A;  4YKP A;  2ZMB A;  1JVX A;  3FV2 A;  2FHY A;  4R2B A;  4KFQ A;  2QPQ A;  4G8M A;  4F39 A;  4G68 B;  2PVU A;  1RDX A;  2Q74 A;  3PPQ A;  5K2X A;  1FBC A;  4OVP A;  4Z7E A;  3H7M A;  4MHF A;  3D1R A;  4DDD A;  1LBW A;  4R6Y A;  2O51 A;  2I6E A;  3C4M A;  1MPC A;  2OCU A;  3T9V A;  1QKB A;  3OSR A;  3K0V A;  2DDK A;  3QIM A;  4N4U A;  1MDQ A;  2GH9 A;  4P1L A;  4ZEF A;  4PFT A;  4EXL A;  4O3A A;  3PPO A;  1YTV A;  1K9Y A;  1FPI A;  1WVJ A;  5ITO A;  3K6W A;  4R6K A;  3IOV A;  4OZ9 A;  5EYH A;  3RLF E;  2ZXT A;  2RF1 A;  2I3V A;  4MF3 A;  3OEL A;  4DXU A;  5B70 A;  3KEI A;  4R74 A;  1TT1 A;  3O6H A;  2O1M A;  1SYI A;  3TTL A;  5EQ8 A;  5CBS A;  2JJK A;  3Q29 A;  3E79 A;  1UIU A;  3A3U A;  1AOV A;  2ZZX A;  3C34 A;  1FJ6 A;  3B6Q A;  3RPW A;  4R9G A;  2Q89 A;  3OD7 A;  1PBQ A;  1JET A;  3C9H A;  1B3G A;  3SDF A;  2V25 A;  3E78 A;  4C1T A;  2B4L A;  1B0H A;  3TTN A;  4MH5 A;  1MH4 A;  2M8C A;  1TXF A;  1II5 A;  2YPN A;  3RY3 A;  4F1U A;  3RUM A;  3BIG A;  1B9J A;  1LB9 A;  4DCY A;  1B4Z A;  3FVO A;  5CM6 A;  1ZJL A;  4PE5 B;  5B7D A;  1INP A;  3DEL B;  3G3H A;  3O97 A;  4FED A;  1Y20 A;  2GHA A;  4LQ2 A;  4PTK A;  4OVJ A;  3IX1 A;  1FTM A;  1URS A;  4QFK A;  3LR1 A;  1LFH A;  1ZMG A;  3CR9 A;  2KQZ A;  4OVR A;  4OWD A;  4BDN A;  3C31 A;  4GD5 A;  4PFY A;  2THI A;  1ELJ A;  4F18 A;  3P7I A;  3VVD A;  3Q28 A;  2F3B A;  1VDW A;  2VOZ A;  1NI9 A;  3OO7 A;  3RTW B;  1HSJ A;  4ZZE A;  4H67 A;  5TP9 B;  4OFO A;  5EYG A;  2P0S A;  2XX9 A;  1ZBM A;  4ELQ A;  4KD5 A;  2H25 A;  3VLV A;  3RNN A;  5FBP A;  3HHG A;  1O63 A;  3MJN A;  4DI3 D;  2CEY A;  1B3E A;  1SW5 A;  4QSD A;  4FJP A;  4ZZA A;  4PFI A;  3H3G A;  3K01 A;  1QUL A;  3QAX A;  2O7I A;  3UN6 A;  4OHN A;  1NV0 A;  2RKM A;  1M5C A;  1AL3 A;  5EQ7 A;  4EXK A;  2XXV A;  1XC1 A;  3G3K A;  2H4I A;  2V93 A;  4PP0 A;  1Y1Z A;  4R72 A;  2OK2 A;  4GBW A;  3ZS6 A;  1IXH A;  1KA1 A;  3DP6 A;  4H5G A;  3VFJ A;  4L17 A;  1FBG A;  4Q8R A;  1NNF A;  4GIZ A;  3DP4 A;  3Q27 A;  4AQ4 A;  1S50 A;  3KSX A;  2Z8D A;  3SER A;  3S2V A;  3PUX E;  3C32 A;  4U1O A;  2F35 A;  5LTC A;  5KDT A;  3K00 A;  3UP9 A;  5H8N A;  4XIG Q;  3UA8 A;  2QS3 A;  4JWX A;  4NWD A;  2FYI A;  3VXB A;  1IME A;  2QMW A;  5ICQ A;  4QFL A;  4F3G A;  2F36 A;  5JEI A;  2F7C A;  1H45 A;  3DM0 A;  1IXC A;  2ALU A;  3IR1 A;  5FTI A;  3TCF A;  1EU8 A;  5I57 B;  3GZG A;  2F5X A;  1B1H A;  4H46 A;  3QMF A;  3A09 A;  3MZB A;  3QSL A;  4XKN A;  1Z7M E;  2CZL A;  1ATG A;  1MXW A;  1N76 A;  4DXC A;  1RYX A;  1MY3 A;  1YZ0 A;  4GBV A;  3TFL A;  4GLI A;  4PFR A;  1XT8 A;  2OX3 A;  4FIM A;  3TCH A;  5I56 B;  2PT2 A;  4NF8 A;  1RDY A;  3CSB A;  3B8B A;  1YAE A;  3C33 A;  2RIN A;  3IOT A;  1N3X A;  1FQD A;  4JWY A;  4LQ5 A;  1NV6 A;  2HAV A;  4DXB A;  1NNT A;  2O84 X;  2I0C A;  1A8F A;  2DYX A;  5J16 A;  3OO8 A;  1QW0 A;  3KJ7 A;  2VPO A;  3IB2 A;  4X1B A;  1SYH A;  3D4G A;  4PAI A;  1FBD A;  3K1P A;  1LAF E;  1O64 A;  2O69 A;  2VD3 A;  5I2K B;  2Y5K A;  3KOT A;  4OVQ A;  1H3D A;  5A5X A;  4KYE A;  4Z0I A;  1CE2 A;  3FUZ A;  1LST A;  2BJI A;  4QRZ A;  1XVX A;  4YKK A;  2DP8 A;  3TOD A;  4PGN A;  1A7L A;  3PGF A;  5ICT A;  4RA1 A;  4TLL B;  4N8G A;  5CI5 A;  2QS2 A;  3ZKK A;  3I3V A;  2B65 A;  4HW8 A;  4MAG A;  2AL5 A;  2HZL A;  3SZP A;  4G8N A;  3A3C A;  3K1M A;  1FCK A;  1EYK A;  4FE8 A;  3VDF A;  3IFC A;  4O8M A;  2AYS A;  2O6A A;  2DXY A;  4GF8 A;  2CEX A;  4GWS A;  2V84 A;  4PFW A;  4P0I A;  1FQE A;  3T22 A;  1LCT A;  5AA4 A;  3MVY A;  3RGY A;  4KPT A;  4LZ5 A;  4OES A;  3TEL A;  3GBA A;  1MRP A;  3TQW A;  3ODB A;  3W9V A;  2O7U A;  4HXV A;  1UTB B;  2X7P A;  3HV1 A;  2HFB A;  4PCD A;  5AA2 A;  1M5D A;  3CFL A;  2F34 A;  3GBB A;  3RYD A;  1MM6 A;  1GGG A;  1SPI A;  3H4Z A;  2OBG A;  3L6G A;  5FHN A;  4PAF A;  3MST A;  4RPO A;  4BLA A;  4OEU A;  4MMP A;  4RPN A;  3K6V A;  4MLV A;  2FBP A;  4KQP A;  4F19 A;  2XX8 A;  1LB8 A;  4GL8 A;  5EQA A;  4FAJ A;  4RYA A;  1M5E A;  2V3Q A;  1FPJ A;  4F2O A;  2ZNS A;  4MBP A;  3M3K A;  2F3D A;  4MNP A;  4MCO A;  3V8X B;  1JNF A;  4JVD A;  4PDH A;  1MY4 A;  1A40 A;  2ZZW A;  4Q30 B;  4N81 A;  2G93 A;  4NF5 A;  4LVQ A;  2E0S A;  3E4R A;  4OXV A;  5F1Q A;  1IIW A;  4QFN A;  1NV3 A;  4WED A;  1SDX A;  4F3P A;  2OWT A;  4IO5 A;  2MKZ A;  5I5P A;  5IZ3 B;  3CSG A;  3E13 X;  4RK2 A;  1JP4 A;  1FPD A;  3FXR A;  2R9J A;  3JYR A;  5F24 A;  4M1V A;  2F6P A;  3RPL A;  2HAU A;  1IMB A;  2DE2 A;  3QK6 A;  5L8D A;  3VLU A;  3CFZ A;  4PFU A;  4AB5 A;  4U23 A;  1Y9U A;  4O94 A;  3IJX B;  4IO3 A;  3OEM A;  1NUX A;  1BP5 A;  3PD9 A;  4G4P A;  4H0W A;  3FVG A;  2DWI A;  2VD2 A;  3I5O A;  3TZA A;  1S9T A;  4GX6 A;  3THI A;  4KR5 A;  1XI6 A;  5DEX A;  1N7X A;  3FZV A;  1P1N A;  4POW A;  2P2A A;  1OIB A;  2UYF A;  5H8Q A;  1NUY A;  1NV5 A;  1XS5 A;  4PC9 A;  2CZI A;  3T93 B;  1A8E A;  3CVG A;  1B52 A;  3K02 A;  1FPB A;  4PAK A;  4POX A;  1OLC A;  5ITP A;  4IB2 A;  4RNS A;  3LV0 A;  4ELR A;  4NF6 A;  3ILU B;  2QJE A;  2AL4 A;  4NGU A;  1US5 A;  1Q35 A;  4N13 A;  1CNQ A;  3LSF B;  2UVI A;  4GWY A;  4BDL A;  4XTC Q;  4ZE8 A;  1MQH A;  3T1B A;  4HE0 A;  3WAF A;  1USY H;  4YKI A;  3U93 A;  2Q88 A;  3W9W A;  2YLN A;  5L9O A;  3I6V A;  4AS4 A;  3KGC A;  4GL0 A;  4QFO A;  1B5I A;  2XWI A;  1MY1 A;  3FAT A;  1AMF A;  2XD2 A;  4ZDM A;  5CBR A;  3KC0 A;  2WBB A;  4PQJ A;  1OMP A;  2W7Y A;  4ZS9 A;  1EYJ A;  3U8Q A;  3RTF B;  1IMA A;  5H8F A;  3KN3 A;  4E0W A;  4IY6 A;  2Z8F A;  2NXO A;  1MXU A;  2X7Q A;  4KCD A;  3PMW A;  3G3G A;  5ET7 A;  1B1X A;  3N94 A;  1H43 A;  1LFG A;  1Y3Q A;  1S7Y A;  4P9K A;  5ET5 A;  3VLW A;  4QSE A;  1B7Z A;  1NV4 A;  3N6T A;  1GVC A;  4X9T A;  5JK4 A;  1AH5 A;  2OLB A;  5FHO A;  2PBW A;  3PU5 A;  1OVB A;  1AIV A;  3WAE A;  4E0X A;  4JBZ A;  2F7A A;  4ZEB A;  1A99 A;  5H8H A;  2I4C A;  4AB6 A;  2HXR A;  1IQ7 A;  2VT5 A;  3S4U A;  4N6D A;  1LEV A;  4DLD A;  2B3F A;  1QKA A;  4GWO A;  1IMF A;  4GFR A;  1QGX A;  3MUQ A;  1MQI A;  4PDD A;  1P1O A;  2QS4 A;  2LAO A;  2KLF A;  3BFU A;  3FJG A;  3FV1 A;  4GX4 A;  4JWO A;  3UOR A;  2E1S A;  3MYU A;  3KBZ A;  2B4M A;  4ONY A;  4I62 A;  2BJJ X;  2OZZ A;  4JSO A;  4RY1 A;  3OOA A;  1ZIU A;  4ESX A;  4WKM A;  4MIJ A;  3T9H B;  4O3B A;  3OXN A;  3KFM A;  2UVJ A;  3S9N C;  4DI4 B;  3ZKL A;  4THI A;  1P99 A;  3HST A;  4X04 A;  4UA8 A;  2XWK A;  2HXW A;  2VPN A;  4G2Z A;  4XF5 A;  2IEE A;  3UK4 A;  2QVR A;  4ISU A;  5L9M A;  3G3F A;  3KBR A;  3EHS A;  4GRK A;  3RN8 A;  2B3B A;  1FBP A;  3OSQ A;  3PPP A;  4DIG A;  1LAX A;  4LP2 B;  1MM7 A;  2FNC A;  3T9U A;  1LBY A;  1SW1 A;  4I40 A;  4F29 A;  2ONS A;  1IMC A;  1K9Z A;  3GLB A;  4U2R A;  5KDT B;  5KZT A;  3MWB A;  1POY 1;  3D4C A;  1IMD A;  5H8N B;  3B50 A;  2QFL A;  2RCB A;  4XFE A;  3MVX A;  4XKR A;  1MQG A;  4YAH X;  2RC9 A;  4ELO A;  2ZYK A;  3G3I A;  5IZZ A;  1JQF A;  4JVC A;  1FSA A;  5EQ9 A;  3U65 A;  4IO6 A;  4PET A;  3IL1 B;  4EDP A;  4I8C A;  3Q26 A;  4QXD A;  4OVS A;  1SI0 A;  1B5H A;  1N3W A;  3PMX A;  3EF7 A;  1MXV A;  4FEC A;  4I9D A;  4NHB A;  4F22 A;  3PD8 A;  4N6P A;  1PBP A;  2WBD A;  3U1O A;  1NUZ A;  2RCA A;  1B51 A;  4BDR A;  3ROJ A;  3Q25 A;  2Y7I A;  1FJ9 A;  2H9B A;  2GHB A;  3KN7 A;  3T96 B;  4O7M A;  4QFP A;  1Y1M A;  3MW0 A;  2Y7K A;  4KCC A;  3IO4 A;  4NF8 B;  1I69 A;  5DT6 A;  1FW0 A;  1GTK A;  1Z7N E;  3KN8 A;  1DTG A;  2ESN A;  3IB0 A;  2ZNU A;  4NAP A;  2P1S A;  4M4G A;  4NF0 A;  3GXA A;  1B2H A;  1PEB A;  4OMB A;  1IIT A;  4NF4 A;  2XXR A;  3BBR A;  1LBZ A;  2FIE A;  4EQ7 A;  3CI8 A;  2V4C A;  1QVS A;  3MPL A;  1MPD A;  1LBB A;  4LA9 A;  1MY0 A;  5A5X B;  3QYT A;  1F9B A;  4NQ8 A;  4OEV A;  2XXP A;  5DVJ A;  2ANJ A;  1YPN A;  1VE4 A;  4LON B;  4DE8 A;  2PFY A;  4C1U A;  5JTY A;  4GQO A;  3C36 A;  2XXY A;  5TU0 A;  5KCJ A;  2QSX A;  3FD3 A;  3LUZ A;  1UIV A;  4H65 A;  3MP6 A;  1BK4 A;  3MAM A;  5DVI A;  5AE4 A;  2CMO A;  2DWH A;  2O1L A;  1G0H A;  5AA2 D;  4QF9 A;  1FTA A;  2XA5 A;  1QUK A;  4MFI A;  3FJM A;  4GWX A;  5M2V A;  1MDP 1;  4LUB A;  3EPE A;  2ZZV A;  4JVI A;  1RYO A;  2D21 A;  1J1N A;  3CG3 A;  4H5F A;  5AA4 B;  1URD A;  4H45 A;  5IGA A;  1I6A A;  4NWC A;  5IAI A;  1JEV A;  2F6G A;  3CIJ A;  3SEW A;  2NOO A;  1A55 A;  3LC8 A;  3MBP A;  1SQY A;  4N6K A;  5AA2 B;  1P1Q A;  2XX7 A;  4MNI A;  1LBC A;  3B6T A;  5K2Y A;  1SBP A;  5DW8 A;  4ZEK A;  2REG A;  1L5T A;  4ZE9 A;  4XKP A;  3VVE A;  5I3S A;  2QL3 A;  4BDO A;  3FBP A;  1KA0 A;  4JB7 A;  4H8J A;  4MLQ A;  3TTR A;  3ZSF A;  2RC8 A;  4EQ9 A;  1H44 A;  3VV5 A;  4OTE A;  2XD3 A;  4BDQ A;  1NV7 A;  3FXB A;  3PMV A;  4HCW A;  5TPA A;  2I49 A;  4F31 B;  4NN3 A;  3LUY A;  4GWW A;  3PPN A;  4NG7 A;  5EHM A;  1FTK A;  2A5T A;  3K6X A;  4P56 A;  4I3E A;  2H5Y A;  1P1W A;  2UVG A;  4IO7 A;  3CRB A;  3ISP A;  2FVZ A;  4NF5 B;  1OLA A;  3O9P A;  3JV9 A;  4OET A;  5H8S A;  1LLS A;  1TFA A;  1D4N A;  4NE4 A;  3O28 A;  3U94 A;  4N17 A;  4X8R A;  2CZH A;  1BTJ A;  3FVK A;  2DXR A;  1N0T A;  2HQ0 A;  4LZ7 A;  1VFD A;  3T9X B;  4GOT A;  3PUZ E;  5HBC A;  2PT1 A;  4OYV A;  1LBV A;  3RPL B;  4NMY A;  3C35 A;  3IOU A;  2P3N A;  3M3L A;  3U92 A;  2Q8M A;  3SEV A;  1TWY A;  4FOR A;  2DVC A;  2UYE A;  1US4 A;  4GXS B;  3R6U A;  1FPK A;  4I3Y A;  5HPQ A;  2I58 A;  4OA4 A;  1GR2 A;  2PMS A;  2YJP A;  4P3L A;  1Y3P A;  3M3F A;  5IZ1 A;  3USD A;  5DEX B;  1OQH A;  4U1Z A;  1SD3 A;  1WOD A;  4G61 A;  2H99 A;  4H8I A;  4TQU Q;  5ISU A;  3HPI A;  5H8Q B;  3RQT A;  2ZYM A;  3TTK A;  1N7W A;  4H1X A;  3SES A;  1JW5 A;  3LSL A;  3KC1 A;  1EZP A;  2Y84 A;  1NV2 A;  3IJO B;  3TMG A;  3V5A A;  3PUV E;  3IOR A;  3MP1 A;  3R26 A;  3ECR A;  4R73 A;  2PYY A;  4WXJ A;  1NH7 A;  4P47 A;  3CG1 A;  2XXH A;  3OEN A;  4IO2 A;  4NF6 B;  1MY2 A;  3OO9 A;  3FGS A;  4MEV A;  1QUJ A;  1TFD A;  4XKQ A;  2FA7 A;  4F2Q A;  4LZ8 A;  1FPE A;  4MNC A;  3FIR A;  1B58 A;  1EH3 A;  3SEY A;  5FHM A;  2NWJ A;  3R7X A;  3B7D A;  4FBP A;  1B05 A;  2FIX A;  5I58 A;  2QVU A;  3IK6 B;  5HM4 B;  1B5J A;  2VHA A;  1D9Y A;  5BUU A;  2Q2C A;  1M5F A;  1FBF A;  1NNK A;  1FBE A;  1Y4C A;  4IGR A;  3MVW A;  5I2N A;  5AA3 A;  4XXU A;  2AIX A;  5DTB A;  1M5B A;  5H8F B;  5I59 A;  5EHS A;  1YYZ A;  1GV8 A;  2QMX A;  2F8D A;  2REJ A;  3LBS A;  1H76 A;  1LFI A;  1MXZ A;  1EZO A;  1G0I A;  1PB9 A;  1DPE A;  1IUD A;  2H98 A;  3MPK A;  4P1E A;  4GX3 A;  1HSE A;  1DTZ A;  1WDN A;  1NL5 A;  2ONK E;  1UTH A;  2WX9 A;  4F3S A;  4DZ1 A;  4U4S A;  3K1N A;  4BDM A;  4P0G A;  4P8B A;  4G68 A;  4K3F A;  5H8H B;  3B6W A;  1LCF A;  2I0B A;  2ZYO A;  3IB1 A;  1RKM A;  1SW2 A;  4GVO A;  4HE1 A;  4DCX A;  2V3U A;  3ONM A;  3UGW A;  4H6D A;  2IA4 A;  1PDA A;  1R9Q A;  2DQV A;  4G68 C;  4ND9 A;  1B4H A;  3IFA A;  5F7V A;  5J1D A;  3HHF A;  4YMA A;  3M8U A;  4XEQ A;  3MQ9 A;  4TLM B;  4PBQ A;  3L6H A;  3NOH A;  4YU0 A;  3V89 B;  2WYP A;  4HCY A;  3H6V A;  1CB6 A;  1B7U A;  3SKP A;  2GFE A;  4R6H A;  4QHQ A;  1R6Z A;  3O6G A;  1B40 A;  5EYF A;  1Y3N A;  1SW4 A;  4OQO A;  5CRY A;  4GXA A;  4X1D A;  1POT A;  2DSF A;  3TQL A;  3H6U A;  3PV0 E;  3EKI A;  1R1N A;  3VE1 B;  1D9Q A;  3F11 A;  2VP1 A;  2DVZ A;  3W15 C;  1NKX A;  5CC2 A;  4OEN A;  2GRV A;  3DP8 A;  3U72 A;  4KI0 E;  2I4B A;  1SVX B;  1AWB A;  1NFT A;  2F97 A;  2HEU A;  5AA1 A;  1URG A;  3MZ1 A;  5ELV A;  4C0R A;  1LAH E;  3VXC A;  4Q0C A;  1DOT A;  1ZTY A;  2HZK A;  3EHU A;  4WEP A;  5CMC A;  3UIF A;  3BIH A;  1MQD A;  4HTG A;  1NMU A;  1LGB C;  4F1Y A;  3TEP A;  1QUI A;  4I1D A;  2XXW A;  4EF1 A;  2RC7 A;  4GWU A;  1FTO A;  2Q9T A;  1Y4T A;  3IOW A;  4O3C A;  5IKB A;  1XHY A;  1ZKB A;  3EQ1 A;  1N04 A;  1IZ1 A;  4IY5 A;  2Q8J A;  3K6U A;  2ONR A;  4PGP A;  1DMB A;  1FPL A;  2OWS A;  5TP9 A;  2PCR A;  2R71 A;  1RDZ A;  4OVT A;  5CMM A;  4MJO A;  1MPB A;  2ABH A;  1OVT A;  3IO6 A;  4R75 A;  4OAN A;  3BKI B;  2I48 A;  4QBA A;  3O6I A;  1P1U A;  1A54 A;  2ZNT A;  3K2D A;  1DK4 A;  2R8T A;  1B7H A;  3TUS A;  1FPG A;  2UXA A;  2F7B A;  4KHZ E;  2WEF A;  3BFT A;  4EF2 A;  2Y7P A;  4MX6 A;  4NF4 B;  1VSO A;  1Q1K A;  4ECF A;  2XXX A;  1IXI A;  3QUF A;  3G7W A;  4F1V A;  3N26 A;  3O66 A;  1D3K A;  1B46 A;  2WKY A;  3SEX A;  4NX1 A;  1PB8 A;  3TYH A;  4OFJ A;  4Q5T A;  2R6G E;  3PUY E;  5JTY B;  1B3H A;  4PF8 A;  4OFL A;  5KCJ B;  3TDJ A;  1B3L A;  1FTL A;  3KJT A;  4U22 A;  3EN3 A;  2G29 A;  2XXQ A;  1FQC A;  2DE4 A;  3HN0 A;  4TOZ A;  2XXK A;  1USY E;  3PTY A;  4NTL A;  5CMB A;  4U21 A;  4YB5 A;  4ZED A;  4YB7 A;  4IO4 A;  3DLN A;  4R9F A;  4ZEC A;  1YCJ A;  1R9L A;  4KYS A;  4IR8 A;  4KYD A;  3FVN A;  5A5L A;  1KZ8 A;  5ESY A;  1XVY A;  1PB7 A;  3RT8 A;  1JW1 A;  4RJZ A;  3LSW A;  1HSL A;  1MH3 A;  3HO7 A;  4N15 A;  4X48 A;  1JEU A;  3TAJ A;  2NUV A;  1BLF A;  4GWZ A;  4LN5 A;  2HPG A;  3SEU A;  5I57 A;  1KWH A;  1ANF A;  3H06 B;  2ZYN A;  4AS5 A;  3FXQ A;  2XXI A;  5LOM A;  1IXG A;  3RT6 B;  3PUW E;  5I84 A;  3S9E A;  1FQB A;  4RXL A;  1EYI A;  3CHG A;  3LSX A;  1FQF A;  2DWJ A;  2HCA A;  4QSC A;  5IM2 A;  4O7I A;  4YMB A;  5DVF A;  3KZG A;  1NUW A;  4N07 A;  5I7I A;  3T0J A;  3OEK A;  4YKJ A;  3FAS A;  5I56 A;  5TPA B;  3E9X A;  4JSD A;  1NNP A;  2P3V A;  5T3J A;  3TTM A;  3SET A;  2D3I A;  2OJT A;  2Y7R A;  2F78 A;  1FPF A;  2DWA A;  3EHT A;  3V83 A;  1FBH A;  1BIY A;  2A5T B;  4HE2 A;  3H6T A;  5BWJ A;  4EUO A;  3N6U A;  4FAT A;  2WYK A;  1ZLQ A;  1NH8 A;  3MP8 A;  1MXY A;  1DBZ A;  3HCQ A;  5I2K A;  2DE3 A;  4PF6 A;  5LDZ A;  4P11 A;  3TKD A;  4PBH A;  3IAZ A;  4PE3 A;  4N91 A;  3AXF A;  4LAT A;  1FRP A;  2O68 A;  1MG1 A;  4HS7 A;  4EQB A;  3N5L A;  1B6H A;  2Z8E A;  3ILT B;  1SI1 A;  3MVZ A;  4G8H A;  3TPA A;  2XHD A;  1XOC A;  2Q2A A;  2PX1 A;  3KG2 A;  3FXU A;  2Z22 A;  1OQG A;  2QVV A;  3E3K A;  5ET8 A;  1VFE A;  2UVH A;  2KR0 A;  1NV1 A;  1I6Q A;  2QRY A;  1T0K A;  3TCG A;  2XWO A;  2PFZ A;  5L9S A;  2X26 A;  4IGT A;  3KOS A;  3OMB A;  3VVF A;  2DOJ A;  4RK9 A;  1D9V A;  1MXX A;  1UTB A;  2L5V A;  2XXU A;  4PFB A;  2OWZ A;  4N8Y A;  4FEB A;  3H03 A;  1UQW A;  3QXM A;  1LBX A;  2GQ1 A;  1O7T A;  3O2A A;  2Y7W A;  4U4X A;  1DSN A;  2Z23 A;  4JXI A;  1MS7 A;  1I6B A;  3KSJ A;  3MZ9 A;  4YIC A;  1LAG E;  5FTH A;  1B32 A;  1PC3 A;  3H6W A;  1JW4 A;  1FTJ A;  2QS1 A;  1FQA A;  4YB6 A;  1B3F A;  5I58 B;  3JZJ A;  3K4U A;  5DYH A;  4ZEI A;  1DPP A;  4KXP A;  1ZU0 A;  1IEJ A;  1QJM A;  1EZ9 A;  3OO6 A;  1Q9D A;  2A5S A;  1DCU A;  3G3J A;  2DS9 A;  4ESW A;  2VGQ A;  5I2N B;  4NED A;  4YZZ A;  4R2F A;  1BKA A;  3A29 A;  2D5W A;  3FJ7 A;  4UAB A;  1MQJ A;  5I59 B;  3PPR A;  1YXI A;  3MC2 A;  2V3T A;  1N84 A;  4JDF A;  4G77 A;  2CZK A;  2XWV A;  5CMK A;  3GYY A;  1VR5 A;  2NVU B;  3T66 A;  4ELP A;  3QUJ A;  1B0L A;  3HFU A; 
#chains in the Genus database with same CATH homology
 2XXT A;  3CFX A;  2I3W A;  3O29 A;  3S9M C;  1JVY A;  4F3B A;  4UAC A;  3S9L C;  1UTH B;  4OER A;  4YKP A;  2ZMB A;  1JVX A;  3FV2 A;  4R2B A;  4KFQ A;  2QPQ A;  4G8M A;  4F39 A;  4G68 B;  2PVU A;  3PPQ A;  5K2X A;  4Z7E A;  3H7M A;  4DDD A;  4R6Y A;  2O51 A;  2I6E A;  3C4M A;  1MPC A;  2OCU A;  3T9V A;  1QKB A;  3OSR A;  3K0V A;  3QIM A;  1MDQ A;  2GH9 A;  4ZEF A;  4PFT A;  4EXL A;  4O3A A;  3PPO A;  1YTV A;  1WVJ A;  5ITO A;  3K6W A;  4R6K A;  3IOV A;  4OZ9 A;  3RLF E;  2ZXT A;  2RF1 A;  2I3V A;  4MF3 A;  3OEL A;  4DXU A;  5B70 A;  3KEI A;  4R74 A;  1TT1 A;  3O6H A;  2O1M A;  1SYI A;  3TTL A;  5CBS A;  3Q29 A;  1UIU A;  3A3U A;  1AOV A;  3C34 A;  3B6Q A;  3RPW A;  4R9G A;  2Q89 A;  3OD7 A;  1PBQ A;  1JET A;  3C9H A;  1B3G A;  3SDF A;  2V25 A;  4C1T A;  1B0H A;  3TTN A;  4MH5 A;  1MH4 A;  2M8C A;  1TXF A;  1II5 A;  2YPN A;  3RY3 A;  4F1U A;  3RUM A;  1B9J A;  1LB9 A;  4DCY A;  1B4Z A;  3FVO A;  5CM6 A;  1ZJL A;  4PE5 B;  5B7D A;  3DEL B;  3G3H A;  3O97 A;  4FED A;  1Y20 A;  2GHA A;  4LQ2 A;  4OVJ A;  3IX1 A;  1FTM A;  1URS A;  4QFK A;  3LR1 A;  1LFH A;  1ZMG A;  3CR9 A;  4OWD A;  4BDN A;  3C31 A;  4GD5 A;  4PFY A;  2THI A;  1ELJ A;  4F18 A;  3P7I A;  3VVD A;  3Q28 A;  2VOZ A;  3OO7 A;  3RTW B;  1HSJ A;  4ZZE A;  4H67 A;  5TP9 B;  4OFO A;  2P0S A;  2XX9 A;  1ZBM A;  4ELQ A;  4KD5 A;  2H25 A;  3VLV A;  3RNN A;  3HHG A;  1O63 A;  3MJN A;  1B3E A;  1SW5 A;  4QSD A;  4FJP A;  4ZZA A;  3H3G A;  3K01 A;  1QUL A;  3QAX A;  2O7I A;  3UN6 A;  4OHN A;  2RKM A;  1M5C A;  1AL3 A;  4EXK A;  2XXV A;  1XC1 A;  3G3K A;  2H4I A;  2V93 A;  4PP0 A;  1Y1Z A;  4R72 A;  2OK2 A;  3ZS6 A;  1IXH A;  3DP6 A;  4H5G A;  3VFJ A;  4L17 A;  4Q8R A;  1NNF A;  4GIZ A;  3DP4 A;  3Q27 A;  4AQ4 A;  1S50 A;  3KSX A;  2Z8D A;  3SER A;  3S2V A;  3PUX E;  3C32 A;  4U1O A;  2F35 A;  5KDT A;  3K00 A;  3UP9 A;  5H8N A;  4XIG Q;  3UA8 A;  2QS3 A;  4JWX A;  4NWD A;  2FYI A;  3VXB A;  2QMW A;  5ICQ A;  4QFL A;  4F3G A;  2F36 A;  5JEI A;  2F7C A;  1H45 A;  3DM0 A;  1IXC A;  2ALU A;  3IR1 A;  5FTI A;  3TCF A;  1EU8 A;  5I57 B;  3GZG A;  2F5X A;  1B1H A;  3A09 A;  3MZB A;  3QSL A;  4XKN A;  1Z7M E;  2CZL A;  1ATG A;  1MXW A;  1N76 A;  4DXC A;  1RYX A;  1MY3 A;  3TFL A;  4GLI A;  1XT8 A;  4FIM A;  3TCH A;  5I56 B;  2PT2 A;  4NF8 A;  3CSB A;  1YAE A;  3C33 A;  2RIN A;  3IOT A;  1N3X A;  1FQD A;  4JWY A;  4LQ5 A;  2HAV A;  4DXB A;  1NNT A;  2O84 X;  2I0C A;  1A8F A;  2DYX A;  3OO8 A;  1QW0 A;  3KJ7 A;  3IB2 A;  4X1B A;  1SYH A;  3D4G A;  3K1P A;  1LAF E;  1O64 A;  2O69 A;  2VD3 A;  5I2K B;  3KOT A;  1H3D A;  5A5X A;  4KYE A;  4Z0I A;  1CE2 A;  3FUZ A;  1LST A;  4QRZ A;  1XVX A;  4YKK A;  2DP8 A;  3TOD A;  1A7L A;  3PGF A;  5ICT A;  4RA1 A;  4TLL B;  5CI5 A;  2QS2 A;  3ZKK A;  3I3V A;  2B65 A;  4HW8 A;  2AL5 A;  2HZL A;  4G8N A;  3A3C A;  3K1M A;  1FCK A;  4FE8 A;  3VDF A;  2AYS A;  2O6A A;  2DXY A;  4GF8 A;  2V84 A;  4PFW A;  4P0I A;  1FQE A;  3T22 A;  1LCT A;  5AA4 A;  3MVY A;  3RGY A;  4KPT A;  4LZ5 A;  4OES A;  3TEL A;  3GBA A;  1MRP A;  3TQW A;  3ODB A;  3W9V A;  2O7U A;  1UTB B;  2X7P A;  3HV1 A;  2HFB A;  5AA2 A;  1M5D A;  3CFL A;  2F34 A;  3GBB A;  1MM6 A;  1GGG A;  3H4Z A;  2OBG A;  3L6G A;  5FHN A;  4RPO A;  4BLA A;  4OEU A;  4RPN A;  3K6V A;  4MLV A;  4KQP A;  4F19 A;  2XX8 A;  1LB8 A;  4GL8 A;  4FAJ A;  4RYA A;  1M5E A;  2V3Q A;  4F2O A;  2ZNS A;  4MBP A;  3M3K A;  3V8X B;  1JNF A;  1MY4 A;  1A40 A;  4Q30 B;  2G93 A;  4NF5 A;  4LVQ A;  2E0S A;  3E4R A;  4OXV A;  5F1Q A;  1IIW A;  4QFN A;  4WED A;  1SDX A;  4F3P A;  2OWT A;  4IO5 A;  3CSG A;  3E13 X;  4RK2 A;  3FXR A;  2R9J A;  3JYR A;  4M1V A;  2F6P A;  2HAU A;  2DE2 A;  3QK6 A;  5L8D A;  3VLU A;  3CFZ A;  4PFU A;  4AB5 A;  4U23 A;  1Y9U A;  3IJX B;  4IO3 A;  3OEM A;  1BP5 A;  3PD9 A;  4G4P A;  4H0W A;  3FVG A;  2DWI A;  2VD2 A;  3I5O A;  3TZA A;  1S9T A;  3THI A;  4KR5 A;  5DEX A;  1N7X A;  3FZV A;  1P1N A;  4POW A;  2P2A A;  1OIB A;  2UYF A;  5H8Q A;  1XS5 A;  3T93 B;  1A8E A;  3CVG A;  1B52 A;  3K02 A;  4POX A;  1OLC A;  5ITP A;  4IB2 A;  4RNS A;  4ELR A;  4NF6 A;  3ILU B;  2QJE A;  2AL4 A;  1US5 A;  1Q35 A;  4N13 A;  3LSF B;  2UVI A;  4BDL A;  4XTC Q;  4ZE8 A;  1MQH A;  3WAF A;  1USY H;  4YKI A;  3U93 A;  2Q88 A;  3W9W A;  2YLN A;  5L9O A;  3I6V A;  3KGC A;  4GL0 A;  4QFO A;  1B5I A;  1MY1 A;  3FAT A;  1AMF A;  2XD2 A;  4ZDM A;  5CBR A;  4PQJ A;  1OMP A;  2W7Y A;  4ZS9 A;  3U8Q A;  3RTF B;  5H8F A;  3KN3 A;  4E0W A;  4IY6 A;  2Z8F A;  2NXO A;  1MXU A;  2X7Q A;  4KCD A;  3PMW A;  3G3G A;  1B1X A;  3N94 A;  1H43 A;  1LFG A;  1Y3Q A;  1S7Y A;  3VLW A;  4QSE A;  1B7Z A;  3N6T A;  1GVC A;  4X9T A;  5JK4 A;  1AH5 A;  2OLB A;  5FHO A;  2PBW A;  3PU5 A;  1OVB A;  1AIV A;  3WAE A;  4E0X A;  4JBZ A;  2F7A A;  4ZEB A;  1A99 A;  5H8H A;  2I4C A;  4AB6 A;  1IQ7 A;  3S4U A;  4DLD A;  2B3F A;  1QKA A;  4GWO A;  4GFR A;  3MUQ A;  1MQI A;  1P1O A;  2QS4 A;  2LAO A;  2KLF A;  3BFU A;  3FJG A;  3FV1 A;  4JWO A;  3UOR A;  2E1S A;  4ONY A;  4I62 A;  2BJJ X;  2OZZ A;  4JSO A;  4RY1 A;  3OOA A;  1ZIU A;  4ESX A;  4WKM A;  3T9H B;  4O3B A;  3OXN A;  3KFM A;  2UVJ A;  3S9N C;  3ZKL A;  4THI A;  1P99 A;  3HST A;  4UA8 A;  2HXW A;  4G2Z A;  2IEE A;  3UK4 A;  4ISU A;  5L9M A;  3G3F A;  3KBR A;  3EHS A;  4GRK A;  3RN8 A;  2B3B A;  3OSQ A;  3PPP A;  4DIG A;  1LAX A;  4LP2 B;  1MM7 A;  2FNC A;  3T9U A;  1SW1 A;  4F29 A;  2ONS A;  3GLB A;  4U2R A;  5KDT B;  5KZT A;  3MWB A;  1POY 1;  3D4C A;  5H8N B;  2RCB A;  3MVX A;  4XKR A;  1MQG A;  4YAH X;  2RC9 A;  4ELO A;  2ZYK A;  3G3I A;  1JQF A;  4IO6 A;  4PET A;  3IL1 B;  4EDP A;  4I8C A;  3Q26 A;  1SI0 A;  1B5H A;  1N3W A;  3PMX A;  3EF7 A;  1MXV A;  4FEC A;  4I9D A;  4F22 A;  3PD8 A;  4N6P A;  1PBP A;  3U1O A;  2RCA A;  1B51 A;  4BDR A;  3Q25 A;  2Y7I A;  2H9B A;  2GHB A;  3KN7 A;  3T96 B;  4QFP A;  1Y1M A;  3MW0 A;  2Y7K A;  4KCC A;  3IO4 A;  4NF8 B;  1I69 A;  5DT6 A;  1FW0 A;  1GTK A;  1Z7N E;  3KN8 A;  1DTG A;  2ESN A;  3IB0 A;  2ZNU A;  2P1S A;  4M4G A;  3GXA A;  1B2H A;  1PEB A;  4OMB A;  1IIT A;  4NF4 A;  2XXR A;  3BBR A;  4EQ7 A;  3CI8 A;  1QVS A;  3MPL A;  1MPD A;  1LBB A;  4LA9 A;  1MY0 A;  5A5X B;  3QYT A;  1F9B A;  4OEV A;  2XXP A;  5DVJ A;  2ANJ A;  1YPN A;  1VE4 A;  4LON B;  4DE8 A;  4C1U A;  5JTY A;  4GQO A;  3C36 A;  2XXY A;  5TU0 A;  5KCJ A;  2QSX A;  3FD3 A;  1UIV A;  4H65 A;  3MP6 A;  3MAM A;  5DVI A;  5AE4 A;  2CMO A;  2DWH A;  2O1L A;  5AA2 D;  4QF9 A;  1QUK A;  4MFI A;  3FJM A;  5M2V A;  1MDP 1;  4LUB A;  3EPE A;  1RYO A;  2D21 A;  1J1N A;  3CG3 A;  4H5F A;  5AA4 B;  1URD A;  1I6A A;  4NWC A;  5IAI A;  1JEV A;  2F6G A;  3CIJ A;  3SEW A;  2NOO A;  1A55 A;  3LC8 A;  3MBP A;  1SQY A;  5AA2 B;  1P1Q A;  2XX7 A;  1LBC A;  3B6T A;  5K2Y A;  1SBP A;  4ZEK A;  2REG A;  1L5T A;  4ZE9 A;  4XKP A;  3VVE A;  2QL3 A;  4BDO A;  4JB7 A;  4H8J A;  4MLQ A;  3TTR A;  3ZSF A;  2RC8 A;  4EQ9 A;  1H44 A;  3VV5 A;  4OTE A;  2XD3 A;  4BDQ A;  3PMV A;  4HCW A;  5TPA A;  2I49 A;  4F31 B;  3LUY A;  3PPN A;  5EHM A;  1FTK A;  2A5T A;  3K6X A;  2H5Y A;  1P1W A;  2UVG A;  4IO7 A;  3CRB A;  4NF5 B;  1OLA A;  3O9P A;  3JV9 A;  4OET A;  5H8S A;  1LLS A;  1TFA A;  1D4N A;  3O28 A;  4NE4 A;  3U94 A;  1BTJ A;  3FVK A;  2DXR A;  1N0T A;  2HQ0 A;  4LZ7 A;  1VFD A;  3T9X B;  4GOT A;  3PUZ E;  5HBC A;  2PT1 A;  4OYV A;  4NMY A;  3C35 A;  3IOU A;  3M3L A;  3U92 A;  3SEV A;  1TWY A;  4FOR A;  2DVC A;  2UYE A;  1US4 A;  4GXS B;  3R6U A;  5HPQ A;  2I58 A;  1GR2 A;  2PMS A;  2YJP A;  1Y3P A;  3M3F A;  3USD A;  5DEX B;  1OQH A;  4U1Z A;  1SD3 A;  1WOD A;  2H99 A;  4H8I A;  4TQU Q;  5ISU A;  3HPI A;  5H8Q B;  3RQT A;  2ZYM A;  3TTK A;  1N7W A;  4H1X A;  3SES A;  1JW5 A;  3LSL A;  1EZP A;  2Y84 A;  3IJO B;  3TMG A;  3V5A A;  3PUV E;  3IOR A;  3MP1 A;  3R26 A;  3ECR A;  4R73 A;  2PYY A;  4WXJ A;  1NH7 A;  3CG1 A;  2XXH A;  3OEN A;  4IO2 A;  4NF6 B;  1MY2 A;  3OO9 A;  3FGS A;  1QUJ A;  1TFD A;  4XKQ A;  2FA7 A;  4F2Q A;  4LZ8 A;  3FIR A;  1B58 A;  1EH3 A;  3SEY A;  5FHM A;  2NWJ A;  3R7X A;  3B7D A;  1B05 A;  5I58 A;  3IK6 B;  5HM4 B;  1B5J A;  2VHA A;  1D9Y A;  5BUU A;  2Q2C A;  1M5F A;  1NNK A;  1Y4C A;  4IGR A;  3MVW A;  5I2N A;  5AA3 A;  4XXU A;  2AIX A;  5DTB A;  1M5B A;  5H8F B;  5I59 A;  5EHS A;  1GV8 A;  2QMX A;  2F8D A;  2REJ A;  3LBS A;  1H76 A;  1LFI A;  1MXZ A;  1EZO A;  1PB9 A;  1DPE A;  1IUD A;  2H98 A;  3MPK A;  1HSE A;  1DTZ A;  1WDN A;  1NL5 A;  2ONK E;  1UTH A;  4F3S A;  4DZ1 A;  4U4S A;  3K1N A;  4BDM A;  4P0G A;  4G68 A;  4K3F A;  5H8H B;  3B6W A;  1LCF A;  2I0B A;  2ZYO A;  3IB1 A;  1RKM A;  1SW2 A;  4GVO A;  4DCX A;  2V3U A;  3ONM A;  3UGW A;  4H6D A;  2IA4 A;  1PDA A;  1R9Q A;  2DQV A;  4G68 C;  4ND9 A;  1B4H A;  5F7V A;  5J1D A;  3HHF A;  4YMA A;  3M8U A;  3MQ9 A;  4TLM B;  3L6H A;  4YU0 A;  3V89 B;  4HCY A;  3H6V A;  1CB6 A;  1B7U A;  3SKP A;  2GFE A;  4R6H A;  4QHQ A;  1R6Z A;  3O6G A;  1B40 A;  5EYF A;  1Y3N A;  1SW4 A;  4OQO A;  5CRY A;  4GXA A;  4X1D A;  1POT A;  2DSF A;  3TQL A;  3H6U A;  3PV0 E;  1R1N A;  3VE1 B;  3F11 A;  2VP1 A;  2DVZ A;  3W15 C;  1NKX A;  5CC2 A;  4OEN A;  2GRV A;  3DP8 A;  3U72 A;  4KI0 E;  2I4B A;  1SVX B;  1NFT A;  2F97 A;  2HEU A;  5AA1 A;  1URG A;  3MZ1 A;  5ELV A;  4C0R A;  1LAH E;  3VXC A;  4Q0C A;  1DOT A;  1ZTY A;  2HZK A;  3EHU A;  4WEP A;  5CMC A;  3UIF A;  1MQD A;  4HTG A;  1NMU A;  1LGB C;  4F1Y A;  3TEP A;  1QUI A;  4I1D A;  2XXW A;  4EF1 A;  2RC7 A;  1FTO A;  2Q9T A;  1Y4T A;  3IOW A;  4O3C A;  5IKB A;  1XHY A;  1ZKB A;  3EQ1 A;  1N04 A;  1IZ1 A;  4IY5 A;  2Q8J A;  3K6U A;  2ONR A;  1DMB A;  2OWS A;  5TP9 A;  2R71 A;  5CMM A;  1MPB A;  2ABH A;  1OVT A;  3IO6 A;  4R75 A;  3BKI B;  2I48 A;  3O6I A;  1P1U A;  1A54 A;  2ZNT A;  3K2D A;  1B7H A;  3TUS A;  2UXA A;  2F7B A;  4KHZ E;  3BFT A;  4EF2 A;  2Y7P A;  4NF4 B;  1VSO A;  1Q1K A;  4ECF A;  2XXX A;  1IXI A;  3QUF A;  3G7W A;  4F1V A;  3N26 A;  3O66 A;  1D3K A;  1B46 A;  2WKY A;  3SEX A;  1PB8 A;  3TYH A;  4OFJ A;  4Q5T A;  2R6G E;  3PUY E;  5JTY B;  1B3H A;  4OFL A;  5KCJ B;  3TDJ A;  1B3L A;  1FTL A;  3KJT A;  4U22 A;  3EN3 A;  2G29 A;  2XXQ A;  1FQC A;  2DE4 A;  3HN0 A;  4TOZ A;  1USY E;  4NTL A;  5CMB A;  4U21 A;  4YB5 A;  4ZED A;  4YB7 A;  4IO4 A;  3DLN A;  4R9F A;  4ZEC A;  1YCJ A;  1R9L A;  4KYS A;  4KYD A;  3FVN A;  1XVY A;  1PB7 A;  3RT8 A;  1JW1 A;  4RJZ A;  3LSW A;  1HSL A;  1MH3 A;  3HO7 A;  4X48 A;  1JEU A;  3TAJ A;  2NUV A;  1BLF A;  3SEU A;  5I57 A;  1KWH A;  1ANF A;  3H06 B;  2ZYN A;  3FXQ A;  2XXI A;  5LOM A;  1IXG A;  3RT6 B;  3PUW E;  5I84 A;  3S9E A;  1FQB A;  4RXL A;  3LSX A;  1FQF A;  2DWJ A;  2HCA A;  4QSC A;  4YMB A;  5DVF A;  3KZG A;  4N07 A;  3OEK A;  4YKJ A;  3FAS A;  5I56 A;  5TPA B;  3E9X A;  4JSD A;  1NNP A;  3TTM A;  3SET A;  2D3I A;  2OJT A;  2Y7R A;  2F78 A;  2DWA A;  3EHT A;  3V83 A;  1BIY A;  2A5T B;  3H6T A;  5BWJ A;  4EUO A;  3N6U A;  4FAT A;  1ZLQ A;  1NH8 A;  3MP8 A;  1MXY A;  3HCQ A;  5I2K A;  2DE3 A;  4P11 A;  3TKD A;  3IAZ A;  3AXF A;  4LAT A;  2O68 A;  1MG1 A;  4HS7 A;  4EQB A;  3N5L A;  1B6H A;  2Z8E A;  3ILT B;  1SI1 A;  3MVZ A;  4G8H A;  3TPA A;  2XHD A;  1XOC A;  2Q2A A;  2PX1 A;  3KG2 A;  3FXU A;  2Z22 A;  1OQG A;  3E3K A;  1VFE A;  2UVH A;  1I6Q A;  2QRY A;  1T0K A;  3TCG A;  5L9S A;  2X26 A;  4IGT A;  3KOS A;  3OMB A;  3VVF A;  2DOJ A;  4RK9 A;  1D9V A;  1MXX A;  1UTB A;  2XXU A;  4FEB A;  3H03 A;  1UQW A;  3QXM A;  1O7T A;  3O2A A;  2Y7W A;  4U4X A;  1DSN A;  2Z23 A;  4JXI A;  1MS7 A;  1I6B A;  3KSJ A;  3MZ9 A;  4YIC A;  1LAG E;  5FTH A;  1B32 A;  1PC3 A;  3H6W A;  1JW4 A;  1FTJ A;  2QS1 A;  1FQA A;  4YB6 A;  1B3F A;  5I58 B;  3JZJ A;  3K4U A;  5DYH A;  4ZEI A;  1DPP A;  1ZU0 A;  1IEJ A;  1QJM A;  1EZ9 A;  3OO6 A;  2A5S A;  3G3J A;  2DS9 A;  4ESW A;  2VGQ A;  5I2N B;  4NED A;  4YZZ A;  4R2F A;  1BKA A;  2D5W A;  3FJ7 A;  1MQJ A;  5I59 B;  3PPR A;  3MC2 A;  2V3T A;  1N84 A;  4JDF A;  4G77 A;  5CMK A;  1VR5 A;  2NVU B;  3T66 A;  4ELP A;  3QUJ A;  1B0L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...