4OVRA

Crystal structure of a trap periplasmic solute binding protein from xanthobacter autotrophicus py2, target efi-510329, with bound beta-d-galacturonate
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
298
structure length
298
Chain Sequence
RQYRSADVQPADYPTVKAVQSMSDELNKETNGKISIKVFPNSQLGSEKDTIEQVKLGALDFIRINSGTLNTVCPAMTVPVLPFLFRDKAHMRAVLDGPIGDEILADCASHGLVGLAFYDSGARSFYATTPIRKLEDLKGKKIRVQQSDIWVSMMKLLGANATPMPAGEVFTGLKSGLIDGAENNWPSYDNFHHYEAAKNYSLSEHSMAPEVLLISKRVFDSFTPEEQVQVRKAAKNSVGYMRQLWDAMEISSREKVEKAGVEVITIDKAPFQAAVQPLYDQFVTDPKLKDMITRIKAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Solute-binding protein
molecule keywords TRAP dicarboxylate transporter, DctP subunit
publication title Experimental strategies for functional annotation and metabolism discovery: targeted screening of solute binding proteins and unbiased panning of metabolomes.
pubmed doi rcsb
source organism Xanthobacter autotrophicus
total genus 97
structure length 298
sequence length 298
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4ovrA00
4PE3A 4NX1A 2XWKA 4UABA 4P8BA 2XWOA 4OVTA 2WYKA 4NHBA 4NQ8A 2WYPA 4P56A 4PFIA 4P1EA 4PAIA 4NG7A 4MNIA 5IGAA 2PFZA 4PBQA 4O7MA 2XWVA 4OVRA 2VPOA 5IM2A 4PDHA 4PBHA 4MNPA 4MEVA 4PDDA 3U65A 4XEQA 4N17A 4PF6A 4PGPA 5LTCA 2ZZXA 4NF0A 4PC9A 2PFYA 4N15A 4XFEA 4YZZA 5I7IA 4O94A 5CM6A 2ZZVA 4N4UA 5IZZA 4MAGA 4NN3A 2XXKA 4YICA 2HZLA 4MMPA 4OVSA 4PETA 4X04A 4PFBA 2HPGA 3FXBA 4DI4B 4PGNA 4PCDA 4OANA 4N91A 3B50A 2CEYA 2ZZWA 2XWIA 2XA5A 4N6DA 4MCOA 4LN5A 3GYYA 4MIJA 4MNCA 4PF8A 4NGUA 4P9KA 4DI3D 4MX6A 4OVQA 2CEXA 4MHFA 4P3LA 4N8GA 5I5PA 2HZKA 4P47A 4XF5A 4OVPA 4PFRA 2VPNA 4NAPA 4OA4A 4P1LA 2WX9A 4O8MA 4PAKA 2V4CA 4X8RA 4N8YA 4PAFA 4N6KA
chains in the Genus database with same CATH superfamily
2XXRA 1IXHA 2H25A 1N3XA 3HFUA 3KBZA 4UABA 5J1DA 1R6ZA 4F22A 4PFYA 5IZ3A 4PP0A 1WVJA 3PV0E 1AIVA 1OMPA 1RYXA 3CFZA 2YLNA 2ZYNA 2XXVA 1DTGA 1RYOA 5FHNA 3UP9A 1GGGA 2QS1A 3FUZA 1SW1A 3MVZA 5HBCA 1IMFA 5H8SA 1G0IA 2E0SA 3O97A 3PUWE 1URGA 1FQCA 2DWIA 4FJPA 1JEUA 2XXTA 2DOJA 2WEFA 1B0LA 2PCRA 2PX1A 1A55A 4QFOA 2FYIA 1POTA 3RNNA 1FTJA 3LSXA 4ZZAA 1OQGA 2WKYA 5JK4A 2NUVA 4OANA 1INPA 2Y5LA 1P1QA 4KD5A 3IFAA 1SPIA 2I3WA 4HTGA 1QJMA 4DCXA 1K9ZA 3FVGA 1UQWA 3C9HA 1VR5A 2XXUA 4GQOA 1Y3QA 1ZLQA 1IMDA 2QS3A 2PT2A 3RPWA 4RA1A 1P1NA 1RKMA 1QUIA 4PAKA 4X8RA 2RKMA 2R71A 4LQ5A 4LVQA 3H6TA 2QFLA 4X1DA 5FTHA 4JWXA 4TLMB 3RT6B 1D4NA 5DT6A 3FASA 5ET7A 3UN6A 2UVIA 3W9WA 4WXJA 1US4A 3BFTA 2QS2A 2I58A 1H43A 2B4LA 3B6TA 4EQ9A 1IMBA 3D1RA 3PU5A 4OTEA 3CHGA 1B5HA 4PBHA 2FNCA 4AS4A 4I9DA 5IKBA 1B4HA 1S7YA 1MXYA 4JSDA 1JEVA 2FIXA 3OO6A 3TCFA 4YZZA 1ELJA 4UA8A 3OD7A 1S50A 3K01A 3WAFA 1UIVA 2H9BA 4NN3A 2YJPA 5CMBA 4JDFA 3C31A 1B1HA 5EQ7A 5AA4B 4H67A 1A99A 1I6AA 4G8MA 1N04A 3VE1B 1DPEA 3OO8A 1JVXA 1ZBMA 4IR8A 3LUYA 3VVEA 4P0IA 1IMAA 1O7TA 2O6AA 1OQHA 4F19A 4ESXA 4IGRA 1NH8A 4JWOA 3EQ1A 1BKAA 1D3KA 2HZKA 4ELPA 3R7XA 1B32A 3BIGA 3LR1A 3OELA 3IO4A 1FTKA 4LZ8A 2VT5A 2Z8FA 1TXFA 2HAUA 1FQEA 3P7IA 2QVVA 4ND9A 1RDZA 2Z23A 3VVFA 2CMOA 2WYKA 1Y4CA 2CZLA 4R72A 1LB9A 3DP4A 1BLFA 1Y20A 1MXUA 3RGYA 4EUOA 5EQ9A 4LUBA 3K2DA 1URDA 3VDFA 1VE4A 5B70A 3K6VA 3MUQA 1IXGA 3JYRA 2F7BA 5H8QA 2ZYMA 3MC2A 1USYE 3MZBA 4I8CA 3GXAA 2DYXA 4IB2A 3VVDA 1LBVA 1FPJA 2JJKA 4YKPA 5IZZA 4OXVA 4MAGA 1I69A 4OZ9A 2XXKA 2ESNA 3IFCA 2ONSA 4PETA 1FBPA 4BDLA 3C4MA 2PT1A 4QFPA 4EQ7A 4RJZA 2B4MA 2Y5KA 4ZEFA 3CFLA 4GBVA 4GX6A 1KA1A 3KSJA 4RY1A 1GR2A 1PB7A 1A40A 1FPDA 1NL5A 3ZKLA 3QMFA 3T9VA 4NAPA 1LCFA 4OA4A 5ELVA 5LDZA 1R9QA 3TODA 4BDMA 2D3IA 4I62A 3VLUA 3Q27A 3FXUA 2I0BA 5ISUA 2VP1A 1M5FA 4R6HA 3O2AA 3MVWA 1URSA 2QJEA 4OYVA 4XIGQ 1FBHA 2XWVA 1XT8A 5DVIA 1POY1 4OQOA 1EH3A 4XTCQ 3TQLA 1ZIUA 3U65A 1B0HA 2V93A 4LZ7A 4C1UA 3MP1A 1NV0A 2F3BA 4U22A 3O28A 3KN3A 5A5XB 4H6DA 1FPBA 1BTJA 2KQZA 3PD9A 4NF4B 5K2XA 4XKPA 1FQBA 2F97A 4F1UA 2H98A 2I3VA 3FZVA 4GOTA 1B52A 4XXUA 4GXSB 3T9HB 3O6IA 3KSXA 3PGFA 2CEYA 3FBPA 3CR9A 4NEDA 4QRZA 1MPCA 1LBCA 4MFIA 1LB8A 1OLAA 2O68A 4JVCA 2O1LA 1YZ0A 4DI3D 1B9JA 4I40A 1NV4A 4X48A 3RT8A 4G2ZA 3K00A 2HHMA 3EKIA 2OX3A 2REGA 3OEKA 4P1LA 1LFGA 4K3FA 5DVJA 2W7YA 2ONRA 2HEUA 5F7VA 4YB6A 2QPQA 4F3GA 1N7WA 4F2OA 4G61A 4X1BA 4NF5B 4WEPA 3MVYA 1IMEA 3HN0A 4BLAA 2GHBA 2QMXA 3HO7A 5M2VA 1B1XA 1BK4A 4U1ZA 4G68A 4G68B 1PBQA 3C33A 3C34A 1IMCA 1RDXA 4PDHA 3SEWA 4R6KA 4GIZA 3K6XA 2V3QA 3RLFE 1JETA 2DVZA 3SEYA 4PF6A 2X26A 3K1NA 3C32A 1FSAA 4NF0A 4F39A 3O6GA 3RUMA 3SEVA 5CM6A 1M5DA 4N4UA 1N84A 1B4ZA 3CFXA 3QAXA 4Q5TA 1B51A 3OSQA 3IOUA 3TTKA 3DP8A 1VFEA 1LAXA 2Q8JA 3RYDA 5DTBA 5ICQA 3EPEA 1MXVA 1Y3NA 4G4PA 3TCGA 1VSOA 2XA5A 3D4CA 5FHOA 1LAGE 2CZHA 2Y7KA 2Q2AA 4C0RA 1LBZA 1FPIA 5HM4B 4Z0IA 5EQAA 2QMWA 2ZNSA 3ZKKA 5I5PA 2ZXTA 4BDNA 3K1MA 3CG1A 1M5CA 5KCJA 2WX9A 2Z22A 3IOWA 5KCJB 4H46A 4EF1A 3H4ZA 1GVCA 4Z7EA 4GWXA 4DZ1A 2HCAA 4KQPA 1L5TA 4F29A 5TP9B 3A3CA 4OMBA 1D9YA 1FRPA 1MQDA 1AL3A 1HSLA 4IO2A 3T96B 5TPAA 4P56A 4POXA 5TPAB 1B40A 4R73A 4F1YA 2I4BA 2OK2A 3KOSA 5DW8A 2PFZA 4PBQA 4PFTA 2IEEA 1GV8A 4O7MA 3G3FA 4FEDA 2F6PA 2Z8DA 4DIGA 4G68C 1FPGA 2XX7A 1MQGA 4F3BA 4ESWA 4I3YA 3BIHA 4XKRA 5IZ3B 1NNTA 1JNFA 2H5YA 1P1OA 2XXYA 1Y1MA 1KWHA 1H44A 4DXUA 4DE8A 2GFEA 2Y7WA 4TQUQ 3OENA 3ILTB 3M3LA 4POWA 4KCDA 3CIJA 3VXCA 3SETA 3K6UA 4LQ2A 3GYYA 3BKIB 2OZZA 1A8EA 5ICTA 1D9QA 3V8XB 3EHTA 2HXWA 3T66A 4OVQA 4MHFA 4NMYA 1YPNA 2RC7A 4N8GA 4EDPA 3E79A 3N6TA 4KYEA 2OWZA 3V5AA 4Q8RA 1FQFA 2MKZA 1FBDA 4H8JA 4GX4A 1YTVA 3B8BA 4PE3A 4QFKA 1G0HA 4QHQA 1EYIA 3KEIA 4LONB 3N5LA 2DS9A 5CI5A 3W9VA 2WYPA 4DDDA 3MW0A 5B7DA 4QF9A 2O51A 2I6EA 5IAIA 3IB2A 3KC0A 4MNPA 4G8HA 2ABHA 4KI0E 1FPFA 4H8IA 5I2KA 1SBPA 4N17A 3S9NC 2DQVA 4PC9A 1H45A 4PFWA 2F35A 1FTOA 2V3TA 3JZJA 4F18A 1NV3A 4WEDA 2B65A 4KR5A 4O94A 1FW0A 2DVCA 1SI1A 1DOTA 4N6PA 1DBZA 2QL3A 3I5OA 1NV7A 3ODBA 1FTLA 1B58A 2HPGA 3EF7A 3GZGA 4GWZA 3G3JA 5FHMA 3E13X 2ZNTA 1DK4A 4ELOA 3HHFA 2O7IA 4PF8A 1FJ9A 5DYHA 4GWUA 3PPNA 1MH4A 4TOZA 1B6HA 1YAEA 3SDFA 5BUUA 2OWTA 3MPKA 2XXQA 4IGTA 2PBWA 1TFAA 3C36A 2ANJA 2V4CA 1FPKA 3O66A 3DM0A 4PAFA 2HXRA 1B3FA 2XD3A 3ROJA 3ECRA 1FPLA 3GBBA 3S9LC 4BDQA 2XXXA 3O9PA 1A7LA 2DWHA 4ISUA 1FBEA 2FBPA 4YKJA 2OBGA 1Z7ME 4HE2A 4IY5A 1ANFA 1MXZA 3WAEA 3LSFB 3TCHA 4P1EA 4U4XA 1P1WA 1QVSA 1GTKA 3LV0A 3R6UA 4YB7A 4O3AA 2VPOA 5ESYA 2NXOA 3TQWA 4GVOA 4MEVA 4OVJA 5H8HA 3U92A 2XXIA 4F3SA 3FV1A 2RC8A 4PGPA 1MQJA 1FTMA 3OO7A 3KC1A 4GBWA 4G77A 3RTWB 4M4GA 1IXCA 3LBSA 1I6QA 3EHUA 3G3HA 5F24A 1LCTA 4GFRA 2DWAA 1NH7A 3QYTA 2E1SA 3C35A 3QUFA 3H6WA 3OOAA 4DXBA 2Y84A 3T1BA 4DI4B 5H8QB 4OESA 3G3IA 2P0SA 3QIMA 1R9LA 2A5TA 3VV5A 2A5TB 4ZEBA 3MZ1A 3N94A 1MY3A 3FD3A 2HAVA 3M3FA 1OLCA 5I57A 3HCQA 3MQ9A 5IZ1A 5I57B 3LSWA 3THIA 1NKXA 1LLSA 2DSFA 4Q30B 3QK6A 3CSBA 1NI9A 3D4GA 3IR1A 4PFUA 1LAFE 1J1NA 2UVHA 1NV2A 4EF2A 4U21A 1B7UA 4H5FA 3DELB 5KDTA 2RINA 5KDTB 3FXRA 3CRBA 5I58A 5AA3A 3PPRA 3Q26A 5I59A 2XWOA 5I58B 5I59B 1MXXA 1MH3A 4BDOA 5AA1A 3ISPA 5CMCA 1JW1A 3IX1A 4LA9A 4RPOA 4GWWA 2L5VA 3PMXA 4JBZA 4O3BA 5EHSA 1IXIA 3FIRA 3PUZE 3CG3A 2D5WA 1DCUA 2O84X 4P11A 3IL1B 1FJ6A 2ZZXA 2R8TA 4H0WA 2QVRA 5I84A 2RC9A 5FTIA 1MY1A 4XFEA 4ZE8A 4QXDA 4EQBA 4R6YA 2XD2A 1Y4TA 3W15C 2R9JA 4OEVA 2PMSA 2I0CA 4NTLA 4QSCA 4THIA 2Z8EA 3IO6A 4IY6A 3MWBA 1IITA 3IOVA 3O6HA 3U1OA 2Y7IA 1PEBA 5ITOA 2Q9TA 4MCOA 5DVFA 3N26A 3UA8A 2O7UA 2DWJA 3A29A 3H7MA 5CC2A 4U23A 3MBPA 4R2BA 3G7WA 4P47A 4PFRA 2NOOA 2VPNA 4HW8A 1US5A 1SQYA 1NUYA 3KZGA 4ZZEA 5DEXA 5DEXB 1QGXA 1MQIA 2XWKA 3SKPA 4FORA 2DXYA 1MPBA 1KA0A 1NNFA 3V83A 3CI8A 5H8NA 4NQ8A 1EZOA 1H76A 5H8NB 1II5A 4F2QA 4YKKA 1MS7A 4QBAA 1DTZA 1EZ9A 1NMUA 1QUJA 1MDP1 4OVRA 4JVIA 5H8FA 4JSOA 5I56A 5H8FB 3TELA 3MYUA 3MZ9A 2QS4A 2DE4A 4DXCA 4FATA 3K02A 3MPLA 4RK9A 4YMAA 5LOMA 3BBRA 3OO9A 4C1TA 1YCJA 2UXAA 4NF6A 3FJ7A 3OEMA 3B50A 3DP6A 4MIJA 3A09A 1OVTA 1XOCA 3U93A 1BP5A 1WDNA 4JXIA 4GWOA 4ELRA 4E0XA 1ZKBA 3KBRA 4P0GA 5J16A 4EXLA 1Q35A 1ZMGA 4ZE9A 1SYHA 4OVPA 1FBCA 4ZECA 1QUKA 2VOZA 2D21A 4O8MA 1TFDA 3TFLA 4RYAA 5L9OA 3IJXB 1XC1A 3Q29A 2DDKA 2I49A 3FVOA 4IO4A 1JP4A 4GRKA 2Q8MA 4HCYA 4GL8A 1N7XA 4AS5A 1VFDA 4NG7A 4MNIA 2AYSA 4AB6A 1N3WA 3KFMA 3TZAA 1CNQA 3IB0A 4R75A 3UK4A 4OFLA 2IA4A 1USYH 1P99A 3FVNA 2AL5A 2AL4A 1Q1KA 3E78A 1YXIA 5AA2A 3B6WA 5LTCA 4HE1A 3UGWA 2FHYA 1QKAA 4R9GA 3O29A 2F8DA 4BDRA 3MP8A 2PVUA 2GH9A 1NUZA 2ZZVA 1UIUA 2FIEA 1F9BA 2WBBA 2HZLA 1MQHA 4MMPA 2AIXA 1DPPA 4OVSA 4F3PA 2P1SA 5AE4A 2CZKA 1IUDA 4PGNA 4MJOA 4O3CA 4YAHX 5AA2D 3USDA 3SESA 1RDYA 2R6GE 2WBDA 2CZIA 4AB5A 2LAOA 4NWDA 4IO6A 2GQ1A 2UYEA 1LFHA 1PC3A 1XVXA 3AXFA 2Y7RA 4OFOA 1IIWA 2Q88A 4IO5A 1SDXA 3L6HA 2Q2CA 1LSTA 1LBBA 1NFTA 2A5SA 3TTLA 4AQ4A 3EN3A 4HE0A 3SERA 1Y9UA 3GLBA 3TDJA 4OHNA 4HXVA 4HCWA 5CMKA 2RCBA 3TTNA 3VFJA 2ZNUA 3OSRA 3VLVA 4YB5A 2F78A 4LATA 3FV2A 1XI6A 3H03A 3FXQA 1CE2A 3FJMA 2RCAA 3K0VA 4DLDA 3IJOB 1AH5A 4XEQA 3BFUA 4F31B 1ATGA 2HFBA 1NNKA 3ONMA 4QFLA 4XKNA 3VLWA 2I4CA 1NV6A 1D9VA 5EQ8A 1R1NA 1QW0A 3S2VA 1UTBA 1UTBB 3VXBA 1MM7A 2FVZA 4X04A 4PE5B 1I6BA 3Q25A 3IB1A 4QSEA 5I2NA 5I2KB 5I2NB 1XHYA 2ZZWA 2P2AA 5L9MA 4I1DA 5T3JA 4MNCA 3TTMA 4MLQA 2VD3A 1S9TA 4NWCA 2X7PA 4GWSA 4IO3A 4OEUA 1N0TA 4XF5A 3IK6B 2O69A 1MY0A 3EHSA 1JW5A 1DMBA 1PBPA 2H4IA 2BJJX 1H3DA 3FVKA 1SW5A 1Y3PA 3MJNA 3SEUA 3E3KA 4H65A 4MF3A 1O64A 4NX1A 1B5JA 3PPOA 4Q0CA 5HPQA 2F7CA 4PTKA 4PAIA 2ZYOA 2V25A 2F3DA 1AMFA 5CRYA 4UACA 3T0JA 2XX8A 4R2FA 1LFIA 1AWBA 5AA4A 4N13A 1NUWA 4U1OA 5CBSA 3LC8A 1M5EA 4KFQA 1XVYA 1OVBA 1SVXB 3PPQA 4N15A 1A8FA 4R74A 4QSDA 4GF8A 3DLNA 3RQTA 2QVUA 3U8QA 1Q9DA 1IQ7A 4GL0A 5L9SA 2QSXA 1NV1A 4DCYA 4GWYA 1B7HA 3H6VA 1FBFA 2BJIA 1M5BA 5EYFA 5H8HB 4HS7A 1FCKA 5BWJA 1ZU0A 2THIA 3JV9A 4N91A 4N6DA 2G29A 4OERA 3E9XA 2F6GA 2ALUA 2DE3A 4MX6A 3KGCA 1O63A 2V3UA 3G3GA 3V89B 4EXKA 2VGQA 4P3LA 5CMMA 3R26A 2Q89A 1MM6A 4PQJA 3KOTA 4ELQA 3FGSA 4KYDA 2Q74A 1FBGA 2VHAA 3M8UA 4JWYA 2UVJA 1T0KA 3SEXA 5F1QA 3I6VA 3NOHA 1SW4A 3KJ7A 3TUSA 2HQ0A 3KG2A 2V84A 2REJA 2P3NA 4YMBA 3GBAA 2OLBA 3I3VA 4F1VA 2XX9A 4PFIA 1LEVA 3A3UA 4MLVA 2XXWA 3KN7A 3MSTA 1AOVA 2XXPA 3H6UA 2VD2A 4ZS9A 3CVGA 3H06B 1QKBA 3HV1A 5EYHA 3PMWA 1B5IA 4KPTA 2F5XA 3T9UA 1Y1ZA 5FBPA 4FECA 4GXAA 2OJTA 2PFYA 4ECFA 4ZEKA 3PPPA 3T22A 2OCUA 4FIMA 2GRVA 5ET5A 1MG1A 1A54A 2KLFA 1SI0A 4KHZE 3K6WA 5ITPA 4YU0A 1QULA 3PMVA 2DP8A 1FTAA 1B46A 2ONKE 4MBPA 1HSJA 3PUYE 2B3FA 4NGUA 4P9KA 4WKMA 1OIBA 3OMBA 5EYGA 1B3LA 2X7QA 5L8DA 4L17A 3LUZA 1LGBC 1PB9A 3RY3A 2XXHA 3LSLA 3KJTA 4FEBA 4GD5A 4TLLB 1HSEA 4NF8A 3FJGA 4NF8B 1EU8A 3RN8A 1UTHA 3IORA 1UTHB 4FAJA 4OVTA 3KN8A 3S9MC 1K9YA 1JVYA 1B05A 3B7DA 1YYZA 4OETA 4R9FA 2ZYKA 5A5XA 4G8NA 2M8CA 5IGAA 4NF4A 4GLIA 1TWYA 5IM2A 4I3EA 4H5GA 1MY2A 2YPNA 1ZJLA 2KR0A 4X9TA 5EHMA 1IZ1A 1NUXA 3FATA 3T93B 2H99A 2F7AA 2I48A 3SZPA 4FE8A 1LAHE 3IAZA 4M1VA 3PTYA 4E0WA 3HHGA 5I3SA 1MXWA 3PUXE 1PDAA 4ONYA 4PFBA 5TU0A 5I56B 5JEIA 1CB6A 3TEPA 1WODA 3L6GA 1B3EA 4PCDA 2FA7A 1SW2A 4KXPA 3TYHA 1FQAA 4YKIA 5JTYA 1B7ZA 4XKQA 3MAMA 4MH5A 5JTYB 4QFNA 4NF5A 4H45A 2UVGA 1FPEA 3RPLA 3B6QA 3QXMA 3RPLB 5ET8A 5A5LA 2B3BA 3E4RA 4NF6B 3OXNA 3UIFA 3K1PA 3HSTA 4ZEDA 4U2RA 3HPIA 2GHAA 4N6KA 1SYIA 1N76A 3TTRA 3ZS6A 3ILUB 2OWSA 1LBXA 1SD3A 4P8BA 3U94A 3QUJA 4IO7A 4OWDA 1XS5A 4NHBA 3RTFB 1B2HA 4U4SA 2F34A 3H3GA 4LP2B 3PUVE 5KZTA 1JQFA 4KYSA 1MPDA 1B3GA 1P1UA 1JW4A 2P3VA 4OFJA 3Q28A 4ZDMA 3S4UA 1TT1A 1EYJA 1NV5A 1MY4A 3S9EA 4JB7A 3ZSFA 4PDDA 1KZ8A 4N07A 3K4UA 2PYYA 2NVUB 3F11A 4LZ5A 4JVDA 2O1MA 1FQDA 2QRYA 4O7IA 5I7IA 2DXRA 5K2YA 1B3HA 1Z7NE 1ZTYA 4H1XA 4N81A 3TMGA 3T9XB 2NWJA 4OENA 4NE4A 1BIYA 3G3KA 4YICA 1MRPA 2DE2A 3FXBA 1PB8A 4RNSA 1LBWA 1LBYA 3N6UA 5AA2B 1MDQA 1DSNA 2XWIA 3QSLA 4GX3A 5ET6A 3MP6A 3IOTA 2F36A 4RPNA 4LN5A 3M3KA 2XHDA 5TP9A 2RF1A 3U72A 4ZEIA 3UORA 1IEJA 2CEXA 1VDWA 3MVXA 5CBRA 4FBPA 4KCCA 3PD8A 1NNPA 2Y7PA 3TPAA 4RK2A 2G93A 2UYFA 3TKDA 4N8YA 1EYKA 3CSGA 1EZPA 3TAJA 4RXLA 2ZMBA
chains in the Genus database with same CATH topology
4G61A 3HFUA 3KBZA 1IMEA 4NX1A 4UABA 2XWOA 5J1DA 1BK4A 5IZ3A 4PTKA 3ISPA 4PAIA 2F3DA 1IMCA 4GWWA 3T0JA 1RDXA 2L5VA 4PDHA 1AWBA 2V3QA 1NUWA 1IMFA 2DVZA 1DCUA 1G0IA 4PF6A 1FJ6A 1FSAA 2ZZXA 4NF0A 2R8TA 2QVRA 4N15A 2WEFA 4XFEA 4QXDA 2QVUA 1Q9DA 2PCRA 5CM6A 4N4UA 1NV1A 4GWYA 1FBFA 2BJIA 5JK4A 3RYDA 4OANA 1INPA 4N91A 2Y5LA 2XA5A 4N6DA 2Q9TA 3IFAA 4MCOA 1SPIA 2CZHA 1K9ZA 1LBZA 1FPIA 2DE3A 4MX6A 5EQAA 3A29A 4P3LA 1IMDA 5I5PA 4P47A 2Q74A 4PFRA 2VPNA 1FBGA 2WX9A 4PAKA 4X8RA 4H46A 1NUYA 4GWXA 3NOHA 2QFLA 1QGXA 2XWKA 5ET7A 1FRPA 2P3NA 1KA0A 4F1VA 3W9WA 4NQ8A 4P56A 4PFIA 1LEVA 4QBAA 3MSTA 5DW8A 2PFZA 4PBQA 4O7MA 2B4LA 1IMBA 3D1RA 4OVRA 5EYHA 4JVIA 3CHGA 1FPGA 4PBHA 4AS4A 2F5XA 4I3YA 5FBPA 2PFYA 3BIHA 3MYUA 5IZ3B 2FIXA 2DE4A 4YZZA 5ET5A 4NN3A 5EQ7A 3B50A 1FTAA 4IR8A 3GYYA 4MIJA 1D9QA 4NGUA 4P9KA 1IMAA 5EYGA 4OVQA 5J16A 4MHFA 4F19A 4N8GA 3LUZA 2HZKA 3E79A 4OVPA 1FBCA 2OWZA 3BIGA 4O8MA 2MKZA 2VT5A 1FBDA 2DDKA 4GX4A 3B8BA 4PE3A 1JP4A 1G0HA 2QVVA 2Q8MA 4HCYA 1RDZA 1EYIA 4OVTA 1K9YA 2WYKA 4AS5A 3W9VA 2WYPA 1YYZA 4NG7A 4MNIA 5IGAA 1CNQA 3KC0A 5EQ9A 5IM2A 4I3EA 4MNPA 2KR0A 4X9TA 1FPFA 3E78A 1YXIA 4N17A 5LTCA 4PC9A 4HE1A 1NUXA 2FHYA 4F18A 1NV3A 1LBVA 1FPJA 4O94A 3SZPA 2JJKA 1NUZA 2ZZVA 5IZZA 2FIEA 4M1VA 4MAGA 3PTYA 1DBZA 2XXKA 3IFCA 5I3SA 2WBBA 2HZLA 1NV7A 4MMPA 4OVSA 1FBPA 4PETA 4PFBA 2HPGA 2CZKA 4GWZA 4PGNA 4PCDA 4KXPA 4MJOA 1DK4A 2B4MA 2Y5KA 1RDYA 2WBDA 4GBVA 2CZIA 1FJ9A 4PF8A 4GWUA 4GX6A 1KA1A 4H45A 2GQ1A 1FPEA 3RPLA 3RPLB 5ET8A 5A5LA 1FPDA 3QMFA 4NAPA 4OA4A 5LDZA 2V4CA 1FPKA 4PAFA 2HXRA 4N6KA 3ROJA 1FPLA 4HE0A 1LBXA 4P8BA 1FBEA 2FBPA 4HE2A 4NHBA 4HXVA 4HCWA 4P1EA 3LV0A 1FBHA 2P3VA 2XWVA 2VPOA 1EYJA 1XI6A 5ESYA 1NV5A 4MEVA 4PDDA 3U65A 1KZ8A 4XEQA 4PGPA 3KC1A 1NV0A 4JVDA 4GBWA 2F3BA 4O7IA 5I7IA 1NV6A 5EQ8A 1FPBA 2KQZA 5F24A 4N81A 4F1UA 4YICA 2FVZA 4X04A 2DE2A 3FXBA 3T1BA 4DI4B 1LBWA 1LBYA 2CEYA 3FBPA 2ZZWA 2XWIA 4GX3A 5ET6A 4LN5A 5T3JA 4MNCA 4JVCA 1YZ0A 4DI3D 4GWSA 2CEXA 5IZ1A 1VDWA 4I40A 1NV4A 4FBPA 4XF5A 2HHMA 3EKIA 1NI9A 2OX3A 1NV2A 4P1LA 4N8YA 1EYKA 2QPQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PE3 A;  4NX1 A;  2XWK A;  4UAB A;  4P8B A;  2XWO A;  4OVT A;  2WYK A;  4NHB A;  4NQ8 A;  2WYP A;  4P56 A;  4PFI A;  4P1E A;  4PAI A;  4NG7 A;  4MNI A;  5IGA A;  2PFZ A;  4PBQ A;  4O7M A;  2XWV A;  4OVR A;  2VPO A;  5IM2 A;  4PDH A;  4PBH A;  4MNP A;  4MEV A;  4PDD A;  3U65 A;  4XEQ A;  4N17 A;  4PF6 A;  4PGP A;  5LTC A;  2ZZX A;  4NF0 A;  4PC9 A;  2PFY A;  4N15 A;  4XFE A;  4YZZ A;  5I7I A;  4O94 A;  5CM6 A;  2ZZV A;  4N4U A;  5IZZ A;  4MAG A;  4NN3 A;  2XXK A;  4YIC A;  2HZL A;  4MMP A;  4OVS A;  4PET A;  4X04 A;  4PFB A;  2HPG A;  3FXB A;  4DI4 B;  4PGN A;  4PCD A;  4OAN A;  4N91 A;  3B50 A;  2CEY A;  2ZZW A;  2XWI A;  2XA5 A;  4N6D A;  4MCO A;  4LN5 A;  3GYY A;  4MIJ A;  4MNC A;  4PF8 A;  4NGU A;  4P9K A;  4DI3 D;  4MX6 A;  4OVQ A;  2CEX A;  4MHF A;  4P3L A;  4N8G A;  5I5P A;  2HZK A;  4P47 A;  4XF5 A;  4OVP A;  4PFR A;  2VPN A;  4NAP A;  4OA4 A;  4P1L A;  2WX9 A;  4O8M A;  4PAK A;  2V4C A;  4X8R A;  4N8Y A;  4PAF A;  4N6K A; 
#chains in the Genus database with same CATH topology
 2XXR A;  1IXH A;  2H25 A;  1N3X A;  3HFU A;  3KBZ A;  4UAB A;  5J1D A;  1R6Z A;  4F22 A;  4PFY A;  5IZ3 A;  4PP0 A;  1WVJ A;  3PV0 E;  1AIV A;  1OMP A;  1RYX A;  3CFZ A;  2YLN A;  2ZYN A;  2XXV A;  1DTG A;  1RYO A;  5FHN A;  3UP9 A;  1GGG A;  2QS1 A;  3FUZ A;  1SW1 A;  3MVZ A;  5HBC A;  1IMF A;  5H8S A;  1G0I A;  2E0S A;  3O97 A;  3PUW E;  1URG A;  1FQC A;  2DWI A;  4FJP A;  1JEU A;  2XXT A;  2DOJ A;  2WEF A;  1B0L A;  2PCR A;  2PX1 A;  1A55 A;  4QFO A;  2FYI A;  1POT A;  3RNN A;  1FTJ A;  3LSX A;  4ZZA A;  1OQG A;  2WKY A;  5JK4 A;  2NUV A;  4OAN A;  1INP A;  2Y5L A;  1P1Q A;  4KD5 A;  3IFA A;  1SPI A;  2I3W A;  4HTG A;  1QJM A;  4DCX A;  1K9Z A;  3FVG A;  1UQW A;  3C9H A;  1VR5 A;  2XXU A;  4GQO A;  1Y3Q A;  1ZLQ A;  1IMD A;  2QS3 A;  2PT2 A;  3RPW A;  4RA1 A;  1P1N A;  1RKM A;  1QUI A;  4PAK A;  4X8R A;  2RKM A;  2R71 A;  4LQ5 A;  4LVQ A;  3H6T A;  2QFL A;  4X1D A;  5FTH A;  4JWX A;  4TLM B;  3RT6 B;  1D4N A;  5DT6 A;  3FAS A;  5ET7 A;  3UN6 A;  2UVI A;  3W9W A;  4WXJ A;  1US4 A;  3BFT A;  2QS2 A;  2I58 A;  1H43 A;  2B4L A;  3B6T A;  4EQ9 A;  1IMB A;  3D1R A;  3PU5 A;  4OTE A;  3CHG A;  1B5H A;  4PBH A;  2FNC A;  4AS4 A;  4I9D A;  5IKB A;  1B4H A;  1S7Y A;  1MXY A;  4JSD A;  1JEV A;  2FIX A;  3OO6 A;  3TCF A;  4YZZ A;  1ELJ A;  4UA8 A;  3OD7 A;  1S50 A;  3K01 A;  3WAF A;  1UIV A;  2H9B A;  4NN3 A;  2YJP A;  5CMB A;  4JDF A;  3C31 A;  1B1H A;  5EQ7 A;  5AA4 B;  4H67 A;  1A99 A;  1I6A A;  4G8M A;  1N04 A;  3VE1 B;  1DPE A;  3OO8 A;  1JVX A;  1ZBM A;  4IR8 A;  3LUY A;  3VVE A;  4P0I A;  1IMA A;  1O7T A;  2O6A A;  1OQH A;  4F19 A;  4ESX A;  4IGR A;  1NH8 A;  4JWO A;  3EQ1 A;  1BKA A;  1D3K A;  2HZK A;  4ELP A;  3R7X A;  1B32 A;  3BIG A;  3LR1 A;  3OEL A;  3IO4 A;  1FTK A;  4LZ8 A;  2VT5 A;  2Z8F A;  1TXF A;  2HAU A;  1FQE A;  3P7I A;  2QVV A;  4ND9 A;  1RDZ A;  2Z23 A;  3VVF A;  2CMO A;  2WYK A;  1Y4C A;  2CZL A;  4R72 A;  1LB9 A;  3DP4 A;  1BLF A;  1Y20 A;  1MXU A;  3RGY A;  4EUO A;  5EQ9 A;  4LUB A;  3K2D A;  1URD A;  3VDF A;  1VE4 A;  5B70 A;  3K6V A;  3MUQ A;  1IXG A;  3JYR A;  2F7B A;  5H8Q A;  2ZYM A;  3MC2 A;  1USY E;  3MZB A;  4I8C A;  3GXA A;  2DYX A;  4IB2 A;  3VVD A;  1LBV A;  1FPJ A;  2JJK A;  4YKP A;  5IZZ A;  4OXV A;  4MAG A;  1I69 A;  4OZ9 A;  2XXK A;  2ESN A;  3IFC A;  2ONS A;  4PET A;  1FBP A;  4BDL A;  3C4M A;  2PT1 A;  4QFP A;  4EQ7 A;  4RJZ A;  2B4M A;  2Y5K A;  4ZEF A;  3CFL A;  4GBV A;  4GX6 A;  1KA1 A;  3KSJ A;  4RY1 A;  1GR2 A;  1PB7 A;  1A40 A;  1FPD A;  1NL5 A;  3ZKL A;  3QMF A;  3T9V A;  4NAP A;  1LCF A;  4OA4 A;  5ELV A;  5LDZ A;  1R9Q A;  3TOD A;  4BDM A;  2D3I A;  4I62 A;  3VLU A;  3Q27 A;  3FXU A;  2I0B A;  5ISU A;  2VP1 A;  1M5F A;  4R6H A;  3O2A A;  3MVW A;  1URS A;  2QJE A;  4OYV A;  4XIG Q;  1FBH A;  2XWV A;  1XT8 A;  5DVI A;  1POY 1;  4OQO A;  1EH3 A;  4XTC Q;  3TQL A;  1ZIU A;  3U65 A;  1B0H A;  2V93 A;  4LZ7 A;  4C1U A;  3MP1 A;  1NV0 A;  2F3B A;  4U22 A;  3O28 A;  3KN3 A;  5A5X B;  4H6D A;  1FPB A;  1BTJ A;  2KQZ A;  3PD9 A;  4NF4 B;  5K2X A;  4XKP A;  1FQB A;  2F97 A;  4F1U A;  2H98 A;  2I3V A;  3FZV A;  4GOT A;  1B52 A;  4XXU A;  4GXS B;  3T9H B;  3O6I A;  3KSX A;  3PGF A;  2CEY A;  3FBP A;  3CR9 A;  4NED A;  4QRZ A;  1MPC A;  1LBC A;  4MFI A;  1LB8 A;  1OLA A;  2O68 A;  4JVC A;  2O1L A;  1YZ0 A;  4DI3 D;  1B9J A;  4I40 A;  1NV4 A;  4X48 A;  3RT8 A;  4G2Z A;  3K00 A;  2HHM A;  3EKI A;  2OX3 A;  2REG A;  3OEK A;  4P1L A;  1LFG A;  4K3F A;  5DVJ A;  2W7Y A;  2ONR A;  2HEU A;  5F7V A;  4YB6 A;  2QPQ A;  4F3G A;  1N7W A;  4F2O A;  4G61 A;  4X1B A;  4NF5 B;  4WEP A;  3MVY A;  1IME A;  3HN0 A;  4BLA A;  2GHB A;  2QMX A;  3HO7 A;  5M2V A;  1B1X A;  1BK4 A;  4U1Z A;  4G68 A;  4G68 B;  1PBQ A;  3C33 A;  3C34 A;  1IMC A;  1RDX A;  4PDH A;  3SEW A;  4R6K A;  4GIZ A;  3K6X A;  2V3Q A;  3RLF E;  1JET A;  2DVZ A;  3SEY A;  4PF6 A;  2X26 A;  3K1N A;  3C32 A;  1FSA A;  4NF0 A;  4F39 A;  3O6G A;  3RUM A;  3SEV A;  5CM6 A;  1M5D A;  4N4U A;  1N84 A;  1B4Z A;  3CFX A;  3QAX A;  4Q5T A;  1B51 A;  3OSQ A;  3IOU A;  3TTK A;  3DP8 A;  1VFE A;  1LAX A;  2Q8J A;  3RYD A;  5DTB A;  5ICQ A;  3EPE A;  1MXV A;  1Y3N A;  4G4P A;  3TCG A;  1VSO A;  2XA5 A;  3D4C A;  5FHO A;  1LAG E;  2CZH A;  2Y7K A;  2Q2A A;  4C0R A;  1LBZ A;  1FPI A;  5HM4 B;  4Z0I A;  5EQA A;  2QMW A;  2ZNS A;  3ZKK A;  5I5P A;  2ZXT A;  4BDN A;  3K1M A;  3CG1 A;  1M5C A;  5KCJ A;  2WX9 A;  2Z22 A;  3IOW A;  5KCJ B;  4H46 A;  4EF1 A;  3H4Z A;  1GVC A;  4Z7E A;  4GWX A;  4DZ1 A;  2HCA A;  4KQP A;  1L5T A;  4F29 A;  5TP9 B;  3A3C A;  4OMB A;  1D9Y A;  1FRP A;  1MQD A;  1AL3 A;  1HSL A;  4IO2 A;  3T96 B;  5TPA A;  4P56 A;  4POX A;  5TPA B;  1B40 A;  4R73 A;  4F1Y A;  2I4B A;  2OK2 A;  3KOS A;  5DW8 A;  2PFZ A;  4PBQ A;  4PFT A;  2IEE A;  1GV8 A;  4O7M A;  3G3F A;  4FED A;  2F6P A;  2Z8D A;  4DIG A;  4G68 C;  1FPG A;  2XX7 A;  1MQG A;  4F3B A;  4ESW A;  4I3Y A;  3BIH A;  4XKR A;  5IZ3 B;  1NNT A;  1JNF A;  2H5Y A;  1P1O A;  2XXY A;  1Y1M A;  1KWH A;  1H44 A;  4DXU A;  4DE8 A;  2GFE A;  2Y7W A;  4TQU Q;  3OEN A;  3ILT B;  3M3L A;  4POW A;  4KCD A;  3CIJ A;  3VXC A;  3SET A;  3K6U A;  4LQ2 A;  3GYY A;  3BKI B;  2OZZ A;  1A8E A;  5ICT A;  1D9Q A;  3V8X B;  3EHT A;  2HXW A;  3T66 A;  4OVQ A;  4MHF A;  4NMY A;  1YPN A;  2RC7 A;  4N8G A;  4EDP A;  3E79 A;  3N6T A;  4KYE A;  2OWZ A;  3V5A A;  4Q8R A;  1FQF A;  2MKZ A;  1FBD A;  4H8J A;  4GX4 A;  1YTV A;  3B8B A;  4PE3 A;  4QFK A;  1G0H A;  4QHQ A;  1EYI A;  3KEI A;  4LON B;  3N5L A;  2DS9 A;  5CI5 A;  3W9V A;  2WYP A;  4DDD A;  3MW0 A;  5B7D A;  4QF9 A;  2O51 A;  2I6E A;  5IAI A;  3IB2 A;  3KC0 A;  4MNP A;  4G8H A;  2ABH A;  4KI0 E;  1FPF A;  4H8I A;  5I2K A;  1SBP A;  4N17 A;  3S9N C;  2DQV A;  4PC9 A;  1H45 A;  4PFW A;  2F35 A;  1FTO A;  2V3T A;  3JZJ A;  4F18 A;  1NV3 A;  4WED A;  2B65 A;  4KR5 A;  4O94 A;  1FW0 A;  2DVC A;  1SI1 A;  1DOT A;  4N6P A;  1DBZ A;  2QL3 A;  3I5O A;  1NV7 A;  3ODB A;  1FTL A;  1B58 A;  2HPG A;  3EF7 A;  3GZG A;  4GWZ A;  3G3J A;  5FHM A;  3E13 X;  2ZNT A;  1DK4 A;  4ELO A;  3HHF A;  2O7I A;  4PF8 A;  1FJ9 A;  5DYH A;  4GWU A;  3PPN A;  1MH4 A;  4TOZ A;  1B6H A;  1YAE A;  3SDF A;  5BUU A;  2OWT A;  3MPK A;  2XXQ A;  4IGT A;  2PBW A;  1TFA A;  3C36 A;  2ANJ A;  2V4C A;  1FPK A;  3O66 A;  3DM0 A;  4PAF A;  2HXR A;  1B3F A;  2XD3 A;  3ROJ A;  3ECR A;  1FPL A;  3GBB A;  3S9L C;  4BDQ A;  2XXX A;  3O9P A;  1A7L A;  2DWH A;  4ISU A;  1FBE A;  2FBP A;  4YKJ A;  2OBG A;  1Z7M E;  4HE2 A;  4IY5 A;  1ANF A;  1MXZ A;  3WAE A;  3LSF B;  3TCH A;  4P1E A;  4U4X A;  1P1W A;  1QVS A;  1GTK A;  3LV0 A;  3R6U A;  4YB7 A;  4O3A A;  2VPO A;  5ESY A;  2NXO A;  3TQW A;  4GVO A;  4MEV A;  4OVJ A;  5H8H A;  3U92 A;  2XXI A;  4F3S A;  3FV1 A;  2RC8 A;  4PGP A;  1MQJ A;  1FTM A;  3OO7 A;  3KC1 A;  4GBW A;  4G77 A;  3RTW B;  4M4G A;  1IXC A;  3LBS A;  1I6Q A;  3EHU A;  3G3H A;  5F24 A;  1LCT A;  4GFR A;  2DWA A;  1NH7 A;  3QYT A;  2E1S A;  3C35 A;  3QUF A;  3H6W A;  3OOA A;  4DXB A;  2Y84 A;  3T1B A;  4DI4 B;  5H8Q B;  4OES A;  3G3I A;  2P0S A;  3QIM A;  1R9L A;  2A5T A;  3VV5 A;  2A5T B;  4ZEB A;  3MZ1 A;  3N94 A;  1MY3 A;  3FD3 A;  2HAV A;  3M3F A;  1OLC A;  5I57 A;  3HCQ A;  3MQ9 A;  5IZ1 A;  5I57 B;  3LSW A;  3THI A;  1NKX A;  1LLS A;  2DSF A;  4Q30 B;  3QK6 A;  3CSB A;  1NI9 A;  3D4G A;  3IR1 A;  4PFU A;  1LAF E;  1J1N A;  2UVH A;  1NV2 A;  4EF2 A;  4U21 A;  1B7U A;  4H5F A;  3DEL B;  5KDT A;  2RIN A;  5KDT B;  3FXR A;  3CRB A;  5I58 A;  5AA3 A;  3PPR A;  3Q26 A;  5I59 A;  2XWO A;  5I58 B;  5I59 B;  1MXX A;  1MH3 A;  4BDO A;  5AA1 A;  3ISP A;  5CMC A;  1JW1 A;  3IX1 A;  4LA9 A;  4RPO A;  4GWW A;  2L5V A;  3PMX A;  4JBZ A;  4O3B A;  5EHS A;  1IXI A;  3FIR A;  3PUZ E;  3CG3 A;  2D5W A;  1DCU A;  2O84 X;  4P11 A;  3IL1 B;  1FJ6 A;  2ZZX A;  2R8T A;  4H0W A;  2QVR A;  5I84 A;  2RC9 A;  5FTI A;  1MY1 A;  4XFE A;  4ZE8 A;  4QXD A;  4EQB A;  4R6Y A;  2XD2 A;  1Y4T A;  3W15 C;  2R9J A;  4OEV A;  2PMS A;  2I0C A;  4NTL A;  4QSC A;  4THI A;  2Z8E A;  3IO6 A;  4IY6 A;  3MWB A;  1IIT A;  3IOV A;  3O6H A;  3U1O A;  2Y7I A;  1PEB A;  5ITO A;  2Q9T A;  4MCO A;  5DVF A;  3N26 A;  3UA8 A;  2O7U A;  2DWJ A;  3A29 A;  3H7M A;  5CC2 A;  4U23 A;  3MBP A;  4R2B A;  3G7W A;  4P47 A;  4PFR A;  2NOO A;  2VPN A;  4HW8 A;  1US5 A;  1SQY A;  1NUY A;  3KZG A;  4ZZE A;  5DEX A;  5DEX B;  1QGX A;  1MQI A;  2XWK A;  3SKP A;  4FOR A;  2DXY A;  1MPB A;  1KA0 A;  1NNF A;  3V83 A;  3CI8 A;  5H8N A;  4NQ8 A;  1EZO A;  1H76 A;  5H8N B;  1II5 A;  4F2Q A;  4YKK A;  1MS7 A;  4QBA A;  1DTZ A;  1EZ9 A;  1NMU A;  1QUJ A;  1MDP 1;  4OVR A;  4JVI A;  5H8F A;  4JSO A;  5I56 A;  5H8F B;  3TEL A;  3MYU A;  3MZ9 A;  2QS4 A;  2DE4 A;  4DXC A;  4FAT A;  3K02 A;  3MPL A;  4RK9 A;  4YMA A;  5LOM A;  3BBR A;  3OO9 A;  4C1T A;  1YCJ A;  2UXA A;  4NF6 A;  3FJ7 A;  3OEM A;  3B50 A;  3DP6 A;  4MIJ A;  3A09 A;  1OVT A;  1XOC A;  3U93 A;  1BP5 A;  1WDN A;  4JXI A;  4GWO A;  4ELR A;  4E0X A;  1ZKB A;  3KBR A;  4P0G A;  5J16 A;  4EXL A;  1Q35 A;  1ZMG A;  4ZE9 A;  1SYH A;  4OVP A;  1FBC A;  4ZEC A;  1QUK A;  2VOZ A;  2D21 A;  4O8M A;  1TFD A;  3TFL A;  4RYA A;  5L9O A;  3IJX B;  1XC1 A;  3Q29 A;  2DDK A;  2I49 A;  3FVO A;  4IO4 A;  1JP4 A;  4GRK A;  2Q8M A;  4HCY A;  4GL8 A;  1N7X A;  4AS5 A;  1VFD A;  4NG7 A;  4MNI A;  2AYS A;  4AB6 A;  1N3W A;  3KFM A;  3TZA A;  1CNQ A;  3IB0 A;  4R75 A;  3UK4 A;  4OFL A;  2IA4 A;  1USY H;  1P99 A;  3FVN A;  2AL5 A;  2AL4 A;  1Q1K A;  3E78 A;  1YXI A;  5AA2 A;  3B6W A;  5LTC A;  4HE1 A;  3UGW A;  2FHY A;  1QKA A;  4R9G A;  3O29 A;  2F8D A;  4BDR A;  3MP8 A;  2PVU A;  2GH9 A;  1NUZ A;  2ZZV A;  1UIU A;  2FIE A;  1F9B A;  2WBB A;  2HZL A;  1MQH A;  4MMP A;  2AIX A;  1DPP A;  4OVS A;  4F3P A;  2P1S A;  5AE4 A;  2CZK A;  1IUD A;  4PGN A;  4MJO A;  4O3C A;  4YAH X;  5AA2 D;  3USD A;  3SES A;  1RDY A;  2R6G E;  2WBD A;  2CZI A;  4AB5 A;  2LAO A;  4NWD A;  4IO6 A;  2GQ1 A;  2UYE A;  1LFH A;  1PC3 A;  1XVX A;  3AXF A;  2Y7R A;  4OFO A;  1IIW A;  2Q88 A;  4IO5 A;  1SDX A;  3L6H A;  2Q2C A;  1LST A;  1LBB A;  1NFT A;  2A5S A;  3TTL A;  4AQ4 A;  3EN3 A;  4HE0 A;  3SER A;  1Y9U A;  3GLB A;  3TDJ A;  4OHN A;  4HXV A;  4HCW A;  5CMK A;  2RCB A;  3TTN A;  3VFJ A;  2ZNU A;  3OSR A;  3VLV A;  4YB5 A;  2F78 A;  4LAT A;  3FV2 A;  1XI6 A;  3H03 A;  3FXQ A;  1CE2 A;  3FJM A;  2RCA A;  3K0V A;  4DLD A;  3IJO B;  1AH5 A;  4XEQ A;  3BFU A;  4F31 B;  1ATG A;  2HFB A;  1NNK A;  3ONM A;  4QFL A;  4XKN A;  3VLW A;  2I4C A;  1NV6 A;  1D9V A;  5EQ8 A;  1R1N A;  1QW0 A;  3S2V A;  1UTB A;  1UTB B;  3VXB A;  1MM7 A;  2FVZ A;  4X04 A;  4PE5 B;  1I6B A;  3Q25 A;  3IB1 A;  4QSE A;  5I2N A;  5I2K B;  5I2N B;  1XHY A;  2ZZW A;  2P2A A;  5L9M A;  4I1D A;  5T3J A;  4MNC A;  3TTM A;  4MLQ A;  2VD3 A;  1S9T A;  4NWC A;  2X7P A;  4GWS A;  4IO3 A;  4OEU A;  1N0T A;  4XF5 A;  3IK6 B;  2O69 A;  1MY0 A;  3EHS A;  1JW5 A;  1DMB A;  1PBP A;  2H4I A;  2BJJ X;  1H3D A;  3FVK A;  1SW5 A;  1Y3P A;  3MJN A;  3SEU A;  3E3K A;  4H65 A;  4MF3 A;  1O64 A;  4NX1 A;  1B5J A;  3PPO A;  4Q0C A;  5HPQ A;  2F7C A;  4PTK A;  4PAI A;  2ZYO A;  2V25 A;  2F3D A;  1AMF A;  5CRY A;  4UAC A;  3T0J A;  2XX8 A;  4R2F A;  1LFI A;  1AWB A;  5AA4 A;  4N13 A;  1NUW A;  4U1O A;  5CBS A;  3LC8 A;  1M5E A;  4KFQ A;  1XVY A;  1OVB A;  1SVX B;  3PPQ A;  4N15 A;  1A8F A;  4R74 A;  4QSD A;  4GF8 A;  3DLN A;  3RQT A;  2QVU A;  3U8Q A;  1Q9D A;  1IQ7 A;  4GL0 A;  5L9S A;  2QSX A;  1NV1 A;  4DCY A;  4GWY A;  1B7H A;  3H6V A;  1FBF A;  2BJI A;  1M5B A;  5EYF A;  5H8H B;  4HS7 A;  1FCK A;  5BWJ A;  1ZU0 A;  2THI A;  3JV9 A;  4N91 A;  4N6D A;  2G29 A;  4OER A;  3E9X A;  2F6G A;  2ALU A;  2DE3 A;  4MX6 A;  3KGC A;  1O63 A;  2V3U A;  3G3G A;  3V89 B;  4EXK A;  2VGQ A;  4P3L A;  5CMM A;  3R26 A;  2Q89 A;  1MM6 A;  4PQJ A;  3KOT A;  4ELQ A;  3FGS A;  4KYD A;  2Q74 A;  1FBG A;  2VHA A;  3M8U A;  4JWY A;  2UVJ A;  1T0K A;  3SEX A;  5F1Q A;  3I6V A;  3NOH A;  1SW4 A;  3KJ7 A;  3TUS A;  2HQ0 A;  3KG2 A;  2V84 A;  2REJ A;  2P3N A;  4YMB A;  3GBA A;  2OLB A;  3I3V A;  4F1V A;  2XX9 A;  4PFI A;  1LEV A;  3A3U A;  4MLV A;  2XXW A;  3KN7 A;  3MST A;  1AOV A;  2XXP A;  3H6U A;  2VD2 A;  4ZS9 A;  3CVG A;  3H06 B;  1QKB A;  3HV1 A;  5EYH A;  3PMW A;  1B5I A;  4KPT A;  2F5X A;  3T9U A;  1Y1Z A;  5FBP A;  4FEC A;  4GXA A;  2OJT A;  2PFY A;  4ECF A;  4ZEK A;  3PPP A;  3T22 A;  2OCU A;  4FIM A;  2GRV A;  5ET5 A;  1MG1 A;  1A54 A;  2KLF A;  1SI0 A;  4KHZ E;  3K6W A;  5ITP A;  4YU0 A;  1QUL A;  3PMV A;  2DP8 A;  1FTA A;  1B46 A;  2ONK E;  4MBP A;  1HSJ A;  3PUY E;  2B3F A;  4NGU A;  4P9K A;  4WKM A;  1OIB A;  3OMB A;  5EYG A;  1B3L A;  2X7Q A;  5L8D A;  4L17 A;  3LUZ A;  1LGB C;  1PB9 A;  3RY3 A;  2XXH A;  3LSL A;  3KJT A;  4FEB A;  4GD5 A;  4TLL B;  1HSE A;  4NF8 A;  3FJG A;  4NF8 B;  1EU8 A;  3RN8 A;  1UTH A;  3IOR A;  1UTH B;  4FAJ A;  4OVT A;  3KN8 A;  3S9M C;  1K9Y A;  1JVY A;  1B05 A;  3B7D A;  1YYZ A;  4OET A;  4R9F A;  2ZYK A;  5A5X A;  4G8N A;  2M8C A;  5IGA A;  4NF4 A;  4GLI A;  1TWY A;  5IM2 A;  4I3E A;  4H5G A;  1MY2 A;  2YPN A;  1ZJL A;  2KR0 A;  4X9T A;  5EHM A;  1IZ1 A;  1NUX A;  3FAT A;  3T93 B;  2H99 A;  2F7A A;  2I48 A;  3SZP A;  4FE8 A;  1LAH E;  3IAZ A;  4M1V A;  3PTY A;  4E0W A;  3HHG A;  5I3S A;  1MXW A;  3PUX E;  1PDA A;  4ONY A;  4PFB A;  5TU0 A;  5I56 B;  5JEI A;  1CB6 A;  3TEP A;  1WOD A;  3L6G A;  1B3E A;  4PCD A;  2FA7 A;  1SW2 A;  4KXP A;  3TYH A;  1FQA A;  4YKI A;  5JTY A;  1B7Z A;  4XKQ A;  3MAM A;  4MH5 A;  5JTY B;  4QFN A;  4NF5 A;  4H45 A;  2UVG A;  1FPE A;  3RPL A;  3B6Q A;  3QXM A;  3RPL B;  5ET8 A;  5A5L A;  2B3B A;  3E4R A;  4NF6 B;  3OXN A;  3UIF A;  3K1P A;  3HST A;  4ZED A;  4U2R A;  3HPI A;  2GHA A;  4N6K A;  1SYI A;  1N76 A;  3TTR A;  3ZS6 A;  3ILU B;  2OWS A;  1LBX A;  1SD3 A;  4P8B A;  3U94 A;  3QUJ A;  4IO7 A;  4OWD A;  1XS5 A;  4NHB A;  3RTF B;  1B2H A;  4U4S A;  2F34 A;  3H3G A;  4LP2 B;  3PUV E;  5KZT A;  1JQF A;  4KYS A;  1MPD A;  1B3G A;  1P1U A;  1JW4 A;  2P3V A;  4OFJ A;  3Q28 A;  4ZDM A;  3S4U A;  1TT1 A;  1EYJ A;  1NV5 A;  1MY4 A;  3S9E A;  4JB7 A;  3ZSF A;  4PDD A;  1KZ8 A;  4N07 A;  3K4U A;  2PYY A;  2NVU B;  3F11 A;  4LZ5 A;  4JVD A;  2O1M A;  1FQD A;  2QRY A;  4O7I A;  5I7I A;  2DXR A;  5K2Y A;  1B3H A;  1Z7N E;  1ZTY A;  4H1X A;  4N81 A;  3TMG A;  3T9X B;  2NWJ A;  4OEN A;  4NE4 A;  1BIY A;  3G3K A;  4YIC A;  1MRP A;  2DE2 A;  3FXB A;  1PB8 A;  4RNS A;  1LBW A;  1LBY A;  3N6U A;  5AA2 B;  1MDQ A;  1DSN A;  2XWI A;  3QSL A;  4GX3 A;  5ET6 A;  3MP6 A;  3IOT A;  2F36 A;  4RPN A;  4LN5 A;  3M3K A;  2XHD A;  5TP9 A;  2RF1 A;  3U72 A;  4ZEI A;  3UOR A;  1IEJ A;  2CEX A;  1VDW A;  3MVX A;  5CBR A;  4FBP A;  4KCC A;  3PD8 A;  1NNP A;  2Y7P A;  3TPA A;  4RK2 A;  2G93 A;  2UYF A;  3TKD A;  4N8Y A;  1EYK A;  3CSG A;  1EZP A;  3TAJ A;  4RXL A;  2ZMB A; 
#chains in the Genus database with same CATH homology
 4G61 A;  3HFU A;  3KBZ A;  1IME A;  4NX1 A;  4UAB A;  2XWO A;  5J1D A;  1BK4 A;  5IZ3 A;  4PTK A;  3ISP A;  4PAI A;  2F3D A;  1IMC A;  4GWW A;  3T0J A;  1RDX A;  2L5V A;  4PDH A;  1AWB A;  2V3Q A;  1NUW A;  1IMF A;  2DVZ A;  1DCU A;  1G0I A;  4PF6 A;  1FJ6 A;  1FSA A;  2ZZX A;  4NF0 A;  2R8T A;  2QVR A;  4N15 A;  2WEF A;  4XFE A;  4QXD A;  2QVU A;  1Q9D A;  2PCR A;  5CM6 A;  4N4U A;  1NV1 A;  4GWY A;  1FBF A;  2BJI A;  5JK4 A;  3RYD A;  4OAN A;  1INP A;  4N91 A;  2Y5L A;  2XA5 A;  4N6D A;  2Q9T A;  3IFA A;  4MCO A;  1SPI A;  2CZH A;  1K9Z A;  1LBZ A;  1FPI A;  2DE3 A;  4MX6 A;  5EQA A;  3A29 A;  4P3L A;  1IMD A;  5I5P A;  4P47 A;  2Q74 A;  4PFR A;  2VPN A;  1FBG A;  2WX9 A;  4PAK A;  4X8R A;  4H46 A;  1NUY A;  4GWX A;  3NOH A;  2QFL A;  1QGX A;  2XWK A;  5ET7 A;  1FRP A;  2P3N A;  1KA0 A;  4F1V A;  3W9W A;  4NQ8 A;  4P56 A;  4PFI A;  1LEV A;  4QBA A;  3MST A;  5DW8 A;  2PFZ A;  4PBQ A;  4O7M A;  2B4L A;  1IMB A;  3D1R A;  4OVR A;  5EYH A;  4JVI A;  3CHG A;  1FPG A;  4PBH A;  4AS4 A;  2F5X A;  4I3Y A;  5FBP A;  2PFY A;  3BIH A;  3MYU A;  5IZ3 B;  2FIX A;  2DE4 A;  4YZZ A;  5ET5 A;  4NN3 A;  5EQ7 A;  3B50 A;  1FTA A;  4IR8 A;  3GYY A;  4MIJ A;  1D9Q A;  4NGU A;  4P9K A;  1IMA A;  5EYG A;  4OVQ A;  5J16 A;  4MHF A;  4F19 A;  4N8G A;  3LUZ A;  2HZK A;  3E79 A;  4OVP A;  1FBC A;  2OWZ A;  3BIG A;  4O8M A;  2MKZ A;  2VT5 A;  1FBD A;  2DDK A;  4GX4 A;  3B8B A;  4PE3 A;  1JP4 A;  1G0H A;  2QVV A;  2Q8M A;  4HCY A;  1RDZ A;  1EYI A;  4OVT A;  1K9Y A;  2WYK A;  4AS5 A;  3W9V A;  2WYP A;  1YYZ A;  4NG7 A;  4MNI A;  5IGA A;  1CNQ A;  3KC0 A;  5EQ9 A;  5IM2 A;  4I3E A;  4MNP A;  2KR0 A;  4X9T A;  1FPF A;  3E78 A;  1YXI A;  4N17 A;  5LTC A;  4PC9 A;  4HE1 A;  1NUX A;  2FHY A;  4F18 A;  1NV3 A;  1LBV A;  1FPJ A;  4O94 A;  3SZP A;  2JJK A;  1NUZ A;  2ZZV A;  5IZZ A;  2FIE A;  4M1V A;  4MAG A;  3PTY A;  1DBZ A;  2XXK A;  3IFC A;  5I3S A;  2WBB A;  2HZL A;  1NV7 A;  4MMP A;  4OVS A;  1FBP A;  4PET A;  4PFB A;  2HPG A;  2CZK A;  4GWZ A;  4PGN A;  4PCD A;  4KXP A;  4MJO A;  1DK4 A;  2B4M A;  2Y5K A;  1RDY A;  2WBD A;  4GBV A;  2CZI A;  1FJ9 A;  4PF8 A;  4GWU A;  4GX6 A;  1KA1 A;  4H45 A;  2GQ1 A;  1FPE A;  3RPL A;  3RPL B;  5ET8 A;  5A5L A;  1FPD A;  3QMF A;  4NAP A;  4OA4 A;  5LDZ A;  2V4C A;  1FPK A;  4PAF A;  2HXR A;  4N6K A;  3ROJ A;  1FPL A;  4HE0 A;  1LBX A;  4P8B A;  1FBE A;  2FBP A;  4HE2 A;  4NHB A;  4HXV A;  4HCW A;  4P1E A;  3LV0 A;  1FBH A;  2P3V A;  2XWV A;  2VPO A;  1EYJ A;  1XI6 A;  5ESY A;  1NV5 A;  4MEV A;  4PDD A;  3U65 A;  1KZ8 A;  4XEQ A;  4PGP A;  3KC1 A;  1NV0 A;  4JVD A;  4GBW A;  2F3B A;  4O7I A;  5I7I A;  1NV6 A;  5EQ8 A;  1FPB A;  2KQZ A;  5F24 A;  4N81 A;  4F1U A;  4YIC A;  2FVZ A;  4X04 A;  2DE2 A;  3FXB A;  3T1B A;  4DI4 B;  1LBW A;  1LBY A;  2CEY A;  3FBP A;  2ZZW A;  2XWI A;  4GX3 A;  5ET6 A;  4LN5 A;  5T3J A;  4MNC A;  4JVC A;  1YZ0 A;  4DI3 D;  4GWS A;  2CEX A;  5IZ1 A;  1VDW A;  4I40 A;  1NV4 A;  4FBP A;  4XF5 A;  2HHM A;  3EKI A;  1NI9 A;  2OX3 A;  1NV2 A;  4P1L A;  4N8Y A;  1EYK A;  2QPQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...