4OVRA

Crystal structure of a trap periplasmic solute binding protein from xanthobacter autotrophicus py2, target efi-510329, with bound beta-d-galacturonate
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
298
structure length
298
Chain Sequence
RQYRSADVQPADYPTVKAVQSMSDELNKETNGKISIKVFPNSQLGSEKDTIEQVKLGALDFIRINSGTLNTVCPAMTVPVLPFLFRDKAHMRAVLDGPIGDEILADCASHGLVGLAFYDSGARSFYATTPIRKLEDLKGKKIRVQQSDIWVSMMKLLGANATPMPAGEVFTGLKSGLIDGAENNWPSYDNFHHYEAAKNYSLSEHSMAPEVLLISKRVFDSFTPEEQVQVRKAAKNSVGYMRQLWDAMEISSREKVEKAGVEVITIDKAPFQAAVQPLYDQFVTDPKLKDMITRIKAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRAP dicarboxylate transporter, DctP subunit
publication title Experimental strategies for functional annotation and metabolism discovery: targeted screening of solute binding proteins and unbiased panning of metabolomes.
pubmed doi rcsb
source organism Xanthobacter autotrophicus
molecule tags Solute-binding protein
total genus 97
structure length 298
sequence length 298
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4ovrA00
4MNPA 4NGUA 4PBHA 2XWIA 4P47A 5IM2A 4NG7A 4NX1A 2XWVA 4NHBA 2CEYA 4PCDA 4O94A 2ZZXA 2XA5A 4DI4B 4MNCA 2ZZVA 4N6DA 4XEQA 4N6KA 4PBQA 5IZZA 4OANA 2ZZWA 4MX6A 2HZLA 4OA4A 4N8GA 4N8YA 2CEXA 4PDDA 4MEVA 4P9KA 4YZZA 2WYKA 4PF8A 4P56A 4N4UA 4XFEA 2VPOA 3FXBA 4NF0A 2VPNA 3U65A 2WYPA 4PFRA 4O7MA 4MHFA 4MNIA 4OVRA 2XWOA 4X04A 4NQ8A 4MMPA 4MAGA 2HZKA 4PFBA 4P8BA 4YICA 4PAFA 4N17A 4OVSA 2PFZA 4LN5A 4PFIA 4O8MA 4UABA 2V4CA 5I7IA 4XF5A 4PDHA 4DI3D 5IGAA 4PC9A 2PFYA 4MIJA 4OVTA 4X8RA 4PAIA 4NN3A 4PGPA 4PF6A 2HPGA 4OVQA 4PAKA 5LTCA 2XWKA 4P1EA 3B50A 3GYYA 4PE3A 4PETA 2WX9A 4NAPA 4P1LA 4N91A 4P3LA 5I5PA 4OVPA 4MCOA 5CM6A 2XXKA 4N15A 4PGNA
chains in the Genus database with same CATH superfamily
1RDZA 4G8NA 1KA0A 4DCYA 1Q1KA 3PU5A 5FHOA 4FORA 4PFUA 4G68A 4GOTA 2XWVA 2O84X 2ANJA 5I2NB 1FQCA 1ZBMA 2GQ1A 2Y7IA 2Y5LA 5TPAA 4MNCA 2Q74A 1ZTYA 1NNFA 1B3GA 3MAMA 4KR5A 4ZEDA 3G3FA 4GLIA 4IO4A 1B3FA 3ODBA 1NH7A 1Y4TA 3SKPA 1LFIA 4NTLA 4RXLA 4AQ4A 5H8NA 4N8YA 4XTCQ 1SVXB 5IZ3A 1IMAA 4RNSA 2HEUA 4P56A 1GV8A 1JVYA 4UACA 2VPNA 3IOUA 3QMFA 3TZAA 4F19A 3V89B 5I58B 1B2HA 4JVIA 2WKYA 3Q26A 3DP4A 4LZ8A 1FTMA 3SDFA 1NMUA 2P1SA 1SI0A 4LVQA 5ISUA 5I57A 2THIA 1D9VA 1DSNA 1KWHA 2V4CA 5DEXA 2O68A 5ET8A 1Y4CA 1MDP1 1N7XA 1UTBB 1Y3QA 2F7BA 3IB0A 1MM6A 5EHSA 3FXRA 3IFAA 5A5XA 2XD3A 1FBGA 4WKMA 3QIMA 1DOTA 3MC2A 3QAXA 2VT5A 4KYEA 3R6UA 2DE3A 4IO7A 2R71A 5EYHA 2Q88A 1FJ9A 4C0RA 4NWDA 4NF4B 3U94A 3E3KA 4GXAA 4ZE9A 1FQBA 4PE5B 4NE4A 5TU0A 4NX1A 3G7WA 5LOMA 2OX3A 4DDDA 2Y5KA 4OYVA 4BDRA 5IKBA 2REGA 5ESYA 3MSTA 4U4SA 4I3YA 3MJNA 4E0WA 1Y20A 4GWXA 5ET7A 5HBCA 3VVDA 3FJMA 2NUVA 4LA9A 5I2NA 4OERA 4IGRA 1SW1A 3FVKA 4Q0CA 3RN8A 4NF6B 4NF0A 1IMBA 3OO8A 4EXLA 1FBFA 4MHFA 4MNIA 1DPPA 2XD2A 3PUYE 1FQDA 3U1OA 1FCKA 3K0VA 1VFEA 3CG1A 2B3FA 4YB6A 4F1YA 1A55A 2PFYA 1CB6A 5CMMA 5I58A 2PT2A 4JVCA 2HFBA 4EXKA 4O3BA 1ZU0A 4JBZA 3TFLA 2VOZA 1ZJLA 1JW4A 4QHQA 1UTBA 4BDOA 1Z7ME 3TMGA 1NKXA 1TFAA 2XXUA 3DM0A 4KI0E 2XXKA 4N15A 3VFJA 2XXQA 4PBHA 3BKIB 1PEBA 4M4GA 4NF8B 3MBPA 1N3WA 4H45A 4QFNA 3HHFA 1II5A 3O6GA 2FHYA 4JSOA 3H7MA 3H3GA 3Q29A 4OA4A 4F3GA 2XX8A 4DZ1A 4TOZA 1NV2A 3PGFA 1P1WA 4LQ5A 1NNTA 4YZZA 1M5CA 3N5LA 1FBPA 3UP9A 4HXVA 2HHMA 3OO9A 3V5AA 2DE4A 3MP1A 1AOVA 4AB6A 4NQ8A 2ZNSA 3TYHA 2QJEA 4X1BA 5T3JA 1FPLA 4PFBA 3UORA 1G0IA 4LZ5A 4NF6A 1PB7A 4LN5A 3MUQA 5CI5A 1IEJA 3IB1A 1XT8A 1Z7NE 4DE8A 1M5BA 5F7VA 1LGBC 1H43A 2QVUA 5H8HB 4PGPA 1Y3PA 4EDPA 4ND9A 3IOTA 3O66A 4LUBA 4Z0IA 1SYIA 1ZKBA 1FTOA 2QSXA 1LBCA 4ELRA 3F11A 1YAEA 4IO6A 3KC1A 3P7IA 4F3PA 4ESXA 1FPJA 2R9JA 4X1DA 3IOWA 1D3KA 2I0CA 4ELPA 1MPCA 4IY6A 2AYSA 2NVUB 4DXBA 2ZZVA 1NV3A 1A8FA 5AA1A 3PPOA 2O1LA 1SI1A 2D21A 3CFZA 5ELVA 1N7WA 1N84A 3B6QA 1B9JA 2DWIA 1LFHA 5EQ9A 3IO4A 1O64A 5DTBA 4UA8A 5J16A 4MLVA 4MX6A 3TTMA 2F6PA 1GGGA 4POXA 4QSDA 1QVSA 2CEXA 2RC9A 4NF8A 4PDDA 2P2AA 1LB8A 3TEPA 3K1MA 2P3NA 1QKBA 1LAGE 2V3QA 3PPQA 3RY3A 3RT8A 3OSRA 3HO7A 2RCAA 1QJMA 3TDJA 4YAHX 5L9OA 3RUMA 4QSCA 2Q2CA 3I6VA 4C1UA 4H8IA 1LB9A 1NV5A 1P1QA 4R9GA 4JWOA 3R7XA 1EZPA 3D4CA 2W7YA 3RTWB 4P1EA 3QXMA 2QPQA 3PTYA 3RYDA 1FQFA 1I69A 4O7IA 4DIGA 2X26A 1O63A 1FTLA 4P3LA 3SEVA 4NF5B 1YYZA 4KHZE 5H8HA 3IJOB 4R6YA 1SW2A 5EQAA 5EYFA 1JVXA 4N07A 4H8JA 1IIWA 3KSJA 4GWYA 4XKPA 4FEBA 3T1BA 1JETA 1LLSA 4U23A 1ZMGA 2HXRA 2CZHA 2ONKE 4N13A 4XKRA 4XKQA 1FPIA 5JEIA 4QF9A 2Z22A 3CSGA 1VFDA 1RDYA 2DOJA 4FIMA 4Q5TA 3A29A 3MZ1A 2RKMA 4G2ZA 3TQLA 2QMWA 2OWSA 4KCCA 3T96B 4C1TA 3TCGA 4G4PA 1A8EA 4JWXA 3EPEA 4G8HA 5BUUA 1MY0A 1SD3A 3MPKA 3JV9A 3H6UA 1JEVA 5CMBA 4PAFA 1MPDA 1MPBA 2OJTA 4H65A 3T9VA 4O3AA 1I6BA 3C35A 4F22A 1D9YA 1SDXA 1B7UA 1NFTA 1FTJA 5KDTB 1TWYA 3IR1A 4EQ7A 1MQIA 4PQJA 4PAKA 4H5FA 4ISUA 1FBHA 1NUXA 1EZ9A 3VDFA 4IB2A 4HE0A 1B0HA 2FBPA 1AL3A 3WAEA 1M5EA 1MY3A 1NNKA 4GWWA 5JK4A 3LSWA 1K9YA 3A3CA 3VLUA 3IX1A 4EF2A 1N3XA 5H8SA 4R74A 3IJXB 1IXGA 4NF5A 2NWJA 4N6DA 1XS5A 3EN3A 3V8XB 4OANA 3SZPA 3U93A 3T22A 3S9NC 4YKJA 5CMKA 2FNCA 1FSAA 3FXBA 4F39A 4WXJA 2RC7A 2IA4A 1DCUA 3RT6B 1NV4A 1SYHA 4F18A 1FQEA 2D3IA 4Q8RA 1PC3A 2I6EA 1PB8A 5DW8A 3IL1B 2HQ0A 5FTIA 3T66A 4YICA 2M8CA 1AWBA 3E79A 4PFIA 2Y7WA 1USYE 4GWOA 5IGAA 3SEWA 4OMBA 1ZIUA 1B5IA 1MXYA 3SEXA 2Q8MA 1FBDA 2AL4A 1B5HA 4PF6A 4OVQA 4N6PA 4GX4A 3LSFB 1USYH 3OD7A 1URDA 5B70A 1GTKA 3A09A 3IO6A 1VDWA 1EYJA 3MVZA 4MCOA 3PPNA 2GHBA 3IFCA 3THIA 3LC8A 2ZYKA 2CZLA 3MPLA 2XWIA 5KZTA 3FV2A 4GQOA 2CEYA 2FYIA 1US5A 4O94A 1QUJA 4JXIA 3LUZA 1BLFA 1LBZA 2DQVA 1MQDA 3N94A 2H25A 3T9XB 5ITPA 1OVTA 3N6TA 2L5VA 5H8QB 4KYSA 1B4HA 4GX6A 2O6AA 3CG3A 2NOOA 2Q8JA 4ELOA 4F2QA 3K6WA 3V83A 3W9WA 4PFWA 1DTZA 4XFEA 2H98A 4YU0A 1B46A 3TCFA 5CBSA 3LBSA 1IXHA 1MH4A 2XWOA 3EKIA 1NV7A 4K3FA 4AS5A 1QULA 4JDFA 1B58A 3USDA 4FE8A 2P0SA 2H4IA 1ZLQA 3KGCA 2PFZA 3ZKLA 4UABA 1KA1A 4X48A 3OOAA 2UVHA 2PYYA 5AE4A 1MQGA 1IMFA 1VR5A 3MVXA 1KZ8A 4F2OA 3RPWA 1EU8A 3O29A 1RDXA 5ICQA 4H46A 1VE4A 1PBPA 3O6IA 4XXUA 2ZNUA 4QBAA 1FPBA 4PE3A 1QUIA 4OFLA 2B65A 5A5LA 4P1LA 3I3VA 3MYUA 1R1NA 5I59B 3LSXA 5CM6A 1YCJA 2RF1A 4RJZA 1EZOA 2I49A 5CC2A 4JVDA 3FD3A 4G8MA 1LSTA 1QKAA 4ZEIA 3L6GA 4HE2A 3LUYA 1UTHB 2XXPA 4OTEA 4KD5A 5ET5A 1Y1MA 5H8FB 4BLAA 4PBQA 2CZKA 3UA8A 4MF3A 2QRYA 4I1DA 4ZE8A 4HS7A 1AIVA 4N8GA 1B52A 4P11A 4U21A 2DVZA 2Z8EA 3VV5A 4ZZAA 1EYKA 4OZ9A 1IQ7A 2PBWA 5AA4B 4H1XA 1UIUA 4F31B 3M3KA 2O69A 4I8CA 4NF4A 1IZ1A 2I0BA 5H8QA 4GFRA 4R2FA 2DS9A 1LBVA 3ZS6A 1T0KA 4G68C 3DLNA 3U72A 4MMPA 3K6UA 1N04A 3KC0A 3JYRA 4NMYA 5I56B 3DELB 3TUSA 4PP0A 4OVJA 3MQ9A 4GVOA 3BIHA 1MRPA 4O8MA 2WBBA 3KOTA 4YMAA 1DBZA 3OO7A 4DI3D 1NUYA 1OVBA 3GBBA 4GWZA 2OK2A 4PAIA 4EF1A 2Y84A 3VXBA 2F6GA 3RQTA 1YTVA 1WVJA 4HW8A 4FAJA 3FXUA 2Q2AA 2QS3A 4N91A 4GWSA 2QFLA 3C36A 4OHNA 4NGUA 3H6VA 1POTA 1F9BA 3IOVA 3CVGA 2YLNA 3C4MA 4PCDA 1R6ZA 3T93B 4DI4B 2UYEA 1FTAA 5I59A 5FHNA 5FTHA 3IORA 2PMSA 3S2VA 3NOHA 2VD3A 3EF7A 2YJPA 3FIRA 3UK4A 1P1NA 4BDNA 4IO2A 1UTHA 3PMVA 3K4UA 3TODA 4N4UA 2PVUA 5H8FA 2A5TB 4N81A 5AA2D 4O7MA 4RYAA 2HXWA 5I2KB 4H6DA 3VLWA 4QFKA 4JWYA 3BFUA 3FASA 4GXSB 4X9TA 5AA4A 1TFDA 2O7UA 3BFTA 2WBDA 1S7YA 4XF5A 1LBYA 4TQUQ 1VSOA 2OCUA 4X8RA 1FRPA 4KFQA 3CHGA 4HCYA 2XWKA 3IAZA 5I56A 1POY1 3CRBA 4ONYA 1ELJA 3GYYA 5ICTA 2V25A 3GXAA 1IXCA 3K00A 4F1VA 4RA1A 3CI8A 4XIGQ 2DP8A 2OZZA 5I84A 4OVPA 4HCWA 4ECFA 2X7PA 5F24A 2ZMBA 2DXYA 3VE1B 3TTKA 4AS4A 4P47A 3LR1A 2GFEA 2QS4A 2F5XA 4IR8A 1Y1ZA 4RPNA 1XI6A 2DWAA 4FATA 2ZNTA 1H3DA 5L9SA 1NNPA 3K2DA 1HSEA 2GHAA 1DMBA 4GWUA 3T0JA 4PFYA 1NV1A 4MJOA 4MEVA 2E1SA 5CMCA 1R9LA 3KFMA 1O7TA 1MXUA 4I62A 4U2RA 1BKAA 5IAIA 1P99A 3MP6A 4ZZEA 3MWBA 4MAGA 4Z7EA 5CBRA 1NV0A 2H9BA 3VLVA 4OQOA 2KR0A 4ZDMA 1ANFA 2A5TA 3UN6A 5HM4B 4H5GA 5I2KA 4JB7A 2HAUA 5HPQA 4FEDA 5H8NB 5LTCA 4YB7A 2XXTA 1A40A 1B7ZA 1H44A 1Y3NA 5K2YA 2Z23A 2B3BA 4LP2B 4OESA 1JQFA 2Q9TA 4QFOA 4M1VA 1B3EA 4I3EA 1URSA 1IMEA 3FVNA 1XOCA 5AA2B 4PGNA 3R26A 3UGWA 1UIVA 2I3VA 2O1MA 3TKDA 2V93A 3MP8A 5DVFA 1INPA 1B05A 3MW0A 1B40A 3AXFA 3TQWA 3VXCA 1A7LA 3VVEA 2ONRA 4N6KA 3FJ7A 5DEXB 1AH5A 1S50A 3C31A 2QS1A 4I40A 3RNNA 3HHGA 4WEPA 1P1UA 3PUWE 1NUWA 2HZLA 3KN8A 3KN3A 4HTGA 1CNQA 4U1ZA 2QS2A 4G61A 1B3LA 1N76A 3S4UA 3PUZE 2O7IA 4KPTA 4LZ7A 4R75A 5TP9B 2LAOA 1B7HA 3CFLA 4R72A 4KXPA 3M3FA 5FHMA 4YB5A 2XHDA 1UQWA 4O3CA 4OVSA 5IZ1A 5I7IA 3HSTA 1IXIA 4MIJA 2ESNA 4LQ2A 1QUKA 1MQHA 1JNFA 4MH5A 3I5OA 5ET6A 2ZYOA 1B51A 4OFOA 3KJTA 1FPEA 2F36A 3EHSA 1D4NA 1B0LA 3N26A 4PFTA 4ZEKA 2F3DA 4EQ9A 1HSJA 1SPIA 2XXYA 5I5PA 2DXRA 3ILUB 4DLDA 1EYIA 2V3TA 4OEUA 1MM7A 3W15C 5EQ8A 3IB2A 1FJ6A 3FV1A 4NG7A 5F1QA 1NUZA 2ALUA 3MZ9A 2F3BA 4ZECA 4MLQA 4AB5A 3O6HA 1NV6A 5IZZA 5AA2A 2KLFA 5KDTA 4H67A 3K01A 4U1OA 1BK4A 3SETA 2E0SA 4G77A 2OLBA 2I3WA 3A3UA 2HAVA 4NEDA 3OSQA 1US4A 2V84A 3C34A 3OEMA 1JW5A 1ATGA 2BJJX 1H45A 3H03A 2WYPA 3EHTA 3FATA 3S9MC 1WDNA 1K9ZA 1N0TA 2UVIA 2XX9A 2F8DA 4F1UA 2XXWA 3PPRA 4JSDA 3PD9A 3G3IA 3H4ZA 5DYHA 2UVJA 5J1DA 3TTRA 2OWZA 2QVVA 5TP9A 2I4BA 3QUFA 4RK2A 2ONSA 1FW0A 3FVOA 3LV0A 4TLLB 4H0WA 2HPGA 5L8DA 2DWJA 1LBWA 2XXVA 2F35A 4E0XA 4YKKA 1XHYA 4F3BA 5K2XA 2QL3A 2H5YA 1LAHE 4YKIA 4PETA 1XC1A 4GD5A 3B6WA 2Z8DA 1PDAA 2D5WA 1YXIA 1A99A 3ZKKA 3B6TA 5IM2A 3E78A 2RINA 1Y9UA 1MH3A 3KSXA 3Q28A 2ABHA 2H99A 1MG1A 1CE2A 5M2VA 1MXZA 4Q30B 2REJA 2XXIA 4ESWA 4MFIA 2GH9A 3TPAA 2DSFA 1WODA 3QUJA 1FPKA 3KJ7A 4R6HA 1B1XA 3GZGA 1TT1A 3GLBA 4RY1A 4I9DA 1MQJA 2F7CA 3JZJA 3TTLA 4DXCA 3ZSFA 3BIGA 3Q27A 4OVRA 2HCAA 3OO6A 5I3SA 4X04A 1OQHA 3FGSA 2UXAA 3PPPA 2F34A 3Q25A 3KZGA 1BIYA 1OMPA 3RLFE 1JEUA 5DVIA 3QK6A 3B7DA 3FUZA 4YKPA 3M8UA 4PDHA 4GL8A 3FJGA 4PC9A 4ZEBA 2QMXA 1BTJA 1XVYA 3S9LC 3FZVA 1MY1A 4QXDA 3KBZA 1FQAA 4OETA 3KEIA 4QRZA 1RKMA 2BJIA 2XXXA 4ELQA 4NAPA 1DK4A 1SBPA 1M5DA 1MS7A 2RCBA 1OIBA 1DPEA 3M3LA 2WEFA 5KCJB 2OWTA 3HV1A 3FXQA 2MKZA 1RYXA 1LCTA 2VGQA 1NL5A 1TXFA 2PX1A 4DXUA 1SW4A 1P1OA 3SERA 3K1NA 3UIFA 1YPNA 1QW0A 5LDZA 4RPOA 1QGXA 3RPLB 1L5TA 1OLAA 4F3SA 1B32A 4GBVA 5AA3A 3CFXA 1H76A 3ROJA 2WYKA 4PF8A 2XXHA 3PMXA 1IUDA 2CMOA 1J1NA 2FIXA 3CSBA 1AMFA 1PBQA 4XKNA 4ZEFA 3PUVE 3O28A 1MXWA 2DWHA 1FBEA 2VP1A 3PV0E 2YPNA 1I6AA 5B7DA 2DDKA 4EQBA 3TELA 2FVZA 2A5SA 3ECRA 3HFUA 1FPGA 4OWDA 4YMBA 3PMWA 2DE2A 2QVRA 1IMCA 3H6TA 1Q9DA 3IK6B 4GL0A 5EQ7A 5DT6A 4IY5A 3OELA 1S9TA 3SEYA 5JTYB 2GRVA 3K02A 3QSLA 2G93A 3B50A 2JJKA 2F78A 1A54A 4ZS9A 3PD8A 4P0IA 3ONMA 2KQZA 2O51A 4IO5A 3S9EA 3H6WA 3N6UA 1B1HA 3KG2A 4DCXA 2R6GE 3C33A 1BP5A 2IEEA 2Y7KA 4OXVA 4NWCA 1FBCA 3QYTA 2RC8A 2ZZXA 3SESA 3H06B 4HE1A 3HN0A 4GBWA 2V3UA 1PB9A 4P0GA 1FPDA 1SW5A 4R9FA 3OENA 3FBPA 4BDQA 1B4ZA 5KCJA 3HCQA 4FBPA 3E4RA 2DYXA 3T9UA 3E13X 2I4CA 3TTNA 3D1RA 2VPOA 3OMBA 5FBPA 5EYGA 3WAFA 1EH3A 3RPLA 2PCRA 1RYOA 3BBRA 3CIJA 3C9HA 4FJPA 2Q89A 3EHUA 3E9XA 1MXXA 2FIEA 4N17A 1B3HA 4R2BA 4GIZA 1MY2A 4OVTA 4PTKA 4GF8A 1B5JA 3K1PA 4KQPA 4NN3A 4L17A 2VHAA 2PT1A 3RGYA 3T9HB 4U4XA 3DP8A 4GRKA 2XXRA 3B8BA 4QFPA 4G68B 2R8TA 1LBXA 3ILTB 2CZIA 3OEKA 3C32A 2WX9A 4R6KA 5EHMA 2VD2A 3D4GA 5TPAB 3MVYA 2NXOA 3G3JA 2F7AA 4GX3A 3K6XA 3G3HA 2Y7RA 4MNPA 2P3VA 5JTYA 3RTFB 2ZYMA 2I58A 5L9MA 4NHBA 4OFJA 5IZ3B 4LATA 3VVFA 1I6QA 1FPFA 3EQ1A 4R73A 2XA5A 4WEDA 1FTKA 1YZ0A 3W9VA 4U22A 4XEQA 4TLMB 2ZYNA 2UYFA 2XX7A 1HSLA 1LCFA 3ISPA 1MDQA 3TAJA 3KN7A 2ZZWA 4IGTA 3MZBA 1OQGA 3G3GA 1LAFE 1XVXA 4OEVA 1LFGA 3U8QA 2FA7A 1LAXA 1LEVA 4KCDA 2OBGA 1JW1A 4P9KA 5CRYA 2AL5A 1OLCA 3CR9A 3U92A 5I57B 3MVWA 2DVCA 1G0HA 3U65A 2F97A 3DP6A 4PFRA 3SEUA 1SQYA 2B4MA 1GR2A 2Z8FA 1IMDA 1NI9A 4QSEA 1B6HA 1MXVA 1D9QA 4LONB 2HZKA 2Y7PA 3K6VA 5A5XB 4FECA 1GVCA 4KYDA 4P8BA 2G29A 1JP4A 1NH8A 5DVJA 3KOSA 3LSLA 1LBBA 4THIA 1DTGA 2B4LA 1Q35A 4BDMA 2AIXA 3O2AA 1M5FA 1MY4A 4MBPA 1URGA 1R9QA 3OXNA 2ZXTA 4OENA 4IO3A 4POWA 4EUOA 3TCHA 2I48A 1IITA 2X7QA 3HPIA 4QFLA 4RK9A 5BWJA 3O97A 3O9PA 2UVGA 3FVGA 3GBAA 4BDLA 5ITOA 3PUXE 3KBRA 3G3KA 3L6HA 4F29A
chains in the Genus database with same CATH topology
4NGUA 1RDZA 1YXIA 1KA0A 5IM2A 3E78A 4GWYA 2XWVA 3T1BA 4PCDA 2GQ1A 2Y5LA 4DI4B 4MNCA 1FTAA 2Q74A 2HXRA 2CZHA 3NOHA 1FPIA 4N8YA 1FPKA 1RDYA 5IZ3A 3A29A 1IMAA 4P56A 4N4UA 2VPNA 4N81A 3QMFA 4F19A 4O7MA 3BIGA 4OVRA 5I3SA 4X04A 4JVIA 4PAFA 4X9TA 2WBDA 2V4CA 4XF5A 1LBYA 4PDHA 5ET8A 4PC9A 4X8RA 1FRPA 3CHGA 4HCYA 3IFAA 1FBGA 4PAKA 2XWKA 1FBHA 4QXDA 3KBZA 2VT5A 1NUXA 3GYYA 2BJIA 2DE3A 4HE0A 2FBPA 5EYHA 4NAPA 4F1VA 1FJ9A 1DK4A 4OVPA 4HCWA 5F24A 4GWWA 5JK4A 4AS4A 4P47A 4NX1A 1K9YA 2WEFA 2F5XA 2OX3A 4IR8A 2MKZA 2Y5KA 1XI6A 4N6DA 5ESYA 3MSTA 4I3YA 4GWXA 5ET7A 4OANA 5LDZA 3RPLB 1QGXA 3SZPA 4GBVA 4GWUA 3T0JA 1NV1A 4MJOA 3ROJA 4MEVA 2WYKA 4PF8A 1FSAA 3FXBA 4NF0A 1IMBA 2FIXA 1FBFA 1DCUA 4MHFA 4MNIA 1NV4A 4F18A 1FBEA 4MAGA 5DW8A 2DDKA 1NV0A 2FVZA 4YICA 1AWBA 2KR0A 3HFUA 1FPGA 3E79A 4PFIA 2DE2A 2QVRA 1IMCA 1Q9DA 5IGAA 2PFYA 5EQ7A 4JVCA 1FBDA 2Q8MA 4PF6A 4OVQA 5LTCA 4GX4A 3B50A 2JJKA 2KQZA 2Q9TA 1VDWA 4M1VA 1EYJA 4MCOA 4I3EA 1IMEA 3IFCA 2XXKA 4N15A 4PGNA 4PBHA 2XWIA 1INPA 2CEYA 1FBCA 4O94A 2ZZXA 3LUZA 4HE1A 1LBZA 4N6KA 4H45A 4GBWA 1FPDA 2L5VA 4I40A 2FHYA 4GX6A 1NUWA 2HZLA 4OA4A 3FBPA 1CNQA 4G61A 1NV2A 3W9WA 4FBPA 4YZZA 3D1RA 4XFEA 1FBPA 2VPOA 4HXVA 5FBPA 2HHMA 5EYGA 2DE4A 2XWOA 3EKIA 4NQ8A 1NV7A 4KXPA 3RPLA 5T3JA 4AS5A 1FPLA 4PFBA 2PCRA 1G0IA 2FIEA 4N17A 4OVSA 5IZ1A 2PFZA 4LN5A 4UABA 5I7IA 1KA1A 4MIJA 4OVTA 4PTKA 1IMFA 2QVUA 5ET6A 4NN3A 4PGPA 1KZ8A 1FPEA 1RDXA 4H46A 3B8BA 2R8TA 4QBAA 2F3DA 1LBXA 1FPBA 2CZIA 4PE3A 1SPIA 2WX9A 5A5LA 4P1LA 5I5PA 3MYUA 3KC1A 4GX3A 5CM6A 1EYIA 1FPJA 4MNPA 2P3VA 5EQ8A 4JVDA 1FJ6A 4NG7A 1NUZA 4NHBA 5IZ3B 1FPFA 2F3BA 2XA5A 4HE2A 1YZ0A 3W9VA 2ZZVA 5ET5A 1NV3A 4XEQA 4PBQA 2CZKA 1NV6A 5EQ9A 3ISPA 5IZZA 5J16A 2ZZWA 1BK4A 4MX6A 4N8GA 2CEXA 2DVZA 4PDDA 1EYKA 1LEVA 4P9KA 2P3NA 2V3QA 1G0HA 3U65A 2WYPA 4PFRA 1LBVA 2B4MA 1IMDA 1NI9A 4MMPA 1D9QA 1K9ZA 2HZKA 3KC0A 4P8BA 1JP4A 4F1UA 3BIHA 1NV5A 2B4LA 4O8MA 2WBBA 1DBZA 5J1DA 4DI3D 1NUYA 2OWZA 2QVVA 4GWZA 4PAIA 3LV0A 2HPGA 4P1EA 1LBWA 2QPQA 3PTYA 3RYDA 4PETA 4O7IA 4P3LA 4N91A 4GWSA 1YYZA 2QFLA 5EQAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MNP A;  4NGU A;  4PBH A;  2XWI A;  4P47 A;  5IM2 A;  4NG7 A;  4NX1 A;  2XWV A;  4NHB A;  2CEY A;  4PCD A;  4O94 A;  2ZZX A;  2XA5 A;  4DI4 B;  4MNC A;  2ZZV A;  4N6D A;  4XEQ A;  4N6K A;  4PBQ A;  5IZZ A;  4OAN A;  2ZZW A;  4MX6 A;  2HZL A;  4OA4 A;  4N8G A;  4N8Y A;  2CEX A;  4PDD A;  4MEV A;  4P9K A;  4YZZ A;  2WYK A;  4PF8 A;  4P56 A;  4N4U A;  4XFE A;  2VPO A;  3FXB A;  4NF0 A;  2VPN A;  3U65 A;  2WYP A;  4PFR A;  4O7M A;  4MHF A;  4MNI A;  4OVR A;  2XWO A;  4X04 A;  4NQ8 A;  4MMP A;  4MAG A;  2HZK A;  4PFB A;  4P8B A;  4YIC A;  4PAF A;  4N17 A;  4OVS A;  2PFZ A;  4LN5 A;  4PFI A;  4O8M A;  4UAB A;  2V4C A;  5I7I A;  4XF5 A;  4PDH A;  4DI3 D;  5IGA A;  4PC9 A;  2PFY A;  4MIJ A;  4OVT A;  4X8R A;  4PAI A;  4NN3 A;  4PGP A;  4PF6 A;  2HPG A;  4OVQ A;  4PAK A;  5LTC A;  2XWK A;  4P1E A;  3B50 A;  3GYY A;  4PE3 A;  4PET A;  2WX9 A;  4NAP A;  4P1L A;  4N91 A;  4P3L A;  5I5P A;  4OVP A;  4MCO A;  5CM6 A;  2XXK A;  4N15 A;  4PGN A; 
#chains in the Genus database with same CATH topology
 1RDZ A;  4G8N A;  1KA0 A;  4DCY A;  1Q1K A;  3PU5 A;  5FHO A;  4FOR A;  4PFU A;  4G68 A;  4GOT A;  2XWV A;  2O84 X;  2ANJ A;  5I2N B;  1FQC A;  1ZBM A;  2GQ1 A;  2Y7I A;  2Y5L A;  5TPA A;  4MNC A;  2Q74 A;  1ZTY A;  1NNF A;  1B3G A;  3MAM A;  4KR5 A;  4ZED A;  3G3F A;  4GLI A;  4IO4 A;  1B3F A;  3ODB A;  1NH7 A;  1Y4T A;  3SKP A;  1LFI A;  4NTL A;  4RXL A;  4AQ4 A;  5H8N A;  4N8Y A;  4XTC Q;  1SVX B;  5IZ3 A;  1IMA A;  4RNS A;  2HEU A;  4P56 A;  1GV8 A;  1JVY A;  4UAC A;  2VPN A;  3IOU A;  3QMF A;  3TZA A;  4F19 A;  3V89 B;  5I58 B;  1B2H A;  4JVI A;  2WKY A;  3Q26 A;  3DP4 A;  4LZ8 A;  1FTM A;  3SDF A;  1NMU A;  2P1S A;  1SI0 A;  4LVQ A;  5ISU A;  5I57 A;  2THI A;  1D9V A;  1DSN A;  1KWH A;  2V4C A;  5DEX A;  2O68 A;  5ET8 A;  1Y4C A;  1MDP 1;  1N7X A;  1UTB B;  1Y3Q A;  2F7B A;  3IB0 A;  1MM6 A;  5EHS A;  3FXR A;  3IFA A;  5A5X A;  2XD3 A;  1FBG A;  4WKM A;  3QIM A;  1DOT A;  3MC2 A;  3QAX A;  2VT5 A;  4KYE A;  3R6U A;  2DE3 A;  4IO7 A;  2R71 A;  5EYH A;  2Q88 A;  1FJ9 A;  4C0R A;  4NWD A;  4NF4 B;  3U94 A;  3E3K A;  4GXA A;  4ZE9 A;  1FQB A;  4PE5 B;  4NE4 A;  5TU0 A;  4NX1 A;  3G7W A;  5LOM A;  2OX3 A;  4DDD A;  2Y5K A;  4OYV A;  4BDR A;  5IKB A;  2REG A;  5ESY A;  3MST A;  4U4S A;  4I3Y A;  3MJN A;  4E0W A;  1Y20 A;  4GWX A;  5ET7 A;  5HBC A;  3VVD A;  3FJM A;  2NUV A;  4LA9 A;  5I2N A;  4OER A;  4IGR A;  1SW1 A;  3FVK A;  4Q0C A;  3RN8 A;  4NF6 B;  4NF0 A;  1IMB A;  3OO8 A;  4EXL A;  1FBF A;  4MHF A;  4MNI A;  1DPP A;  2XD2 A;  3PUY E;  1FQD A;  3U1O A;  1FCK A;  3K0V A;  1VFE A;  3CG1 A;  2B3F A;  4YB6 A;  4F1Y A;  1A55 A;  2PFY A;  1CB6 A;  5CMM A;  5I58 A;  2PT2 A;  4JVC A;  2HFB A;  4EXK A;  4O3B A;  1ZU0 A;  4JBZ A;  3TFL A;  2VOZ A;  1ZJL A;  1JW4 A;  4QHQ A;  1UTB A;  4BDO A;  1Z7M E;  3TMG A;  1NKX A;  1TFA A;  2XXU A;  3DM0 A;  4KI0 E;  2XXK A;  4N15 A;  3VFJ A;  2XXQ A;  4PBH A;  3BKI B;  1PEB A;  4M4G A;  4NF8 B;  3MBP A;  1N3W A;  4H45 A;  4QFN A;  3HHF A;  1II5 A;  3O6G A;  2FHY A;  4JSO A;  3H7M A;  3H3G A;  3Q29 A;  4OA4 A;  4F3G A;  2XX8 A;  4DZ1 A;  4TOZ A;  1NV2 A;  3PGF A;  1P1W A;  4LQ5 A;  1NNT A;  4YZZ A;  1M5C A;  3N5L A;  1FBP A;  3UP9 A;  4HXV A;  2HHM A;  3OO9 A;  3V5A A;  2DE4 A;  3MP1 A;  1AOV A;  4AB6 A;  4NQ8 A;  2ZNS A;  3TYH A;  2QJE A;  4X1B A;  5T3J A;  1FPL A;  4PFB A;  3UOR A;  1G0I A;  4LZ5 A;  4NF6 A;  1PB7 A;  4LN5 A;  3MUQ A;  5CI5 A;  1IEJ A;  3IB1 A;  1XT8 A;  1Z7N E;  4DE8 A;  1M5B A;  5F7V A;  1LGB C;  1H43 A;  2QVU A;  5H8H B;  4PGP A;  1Y3P A;  4EDP A;  4ND9 A;  3IOT A;  3O66 A;  4LUB A;  4Z0I A;  1SYI A;  1ZKB A;  1FTO A;  2QSX A;  1LBC A;  4ELR A;  3F11 A;  1YAE A;  4IO6 A;  3KC1 A;  3P7I A;  4F3P A;  4ESX A;  1FPJ A;  2R9J A;  4X1D A;  3IOW A;  1D3K A;  2I0C A;  4ELP A;  1MPC A;  4IY6 A;  2AYS A;  2NVU B;  4DXB A;  2ZZV A;  1NV3 A;  1A8F A;  5AA1 A;  3PPO A;  2O1L A;  1SI1 A;  2D21 A;  3CFZ A;  5ELV A;  1N7W A;  1N84 A;  3B6Q A;  1B9J A;  2DWI A;  1LFH A;  5EQ9 A;  3IO4 A;  1O64 A;  5DTB A;  4UA8 A;  5J16 A;  4MLV A;  4MX6 A;  3TTM A;  2F6P A;  1GGG A;  4POX A;  4QSD A;  1QVS A;  2CEX A;  2RC9 A;  4NF8 A;  4PDD A;  2P2A A;  1LB8 A;  3TEP A;  3K1M A;  2P3N A;  1QKB A;  1LAG E;  2V3Q A;  3PPQ A;  3RY3 A;  3RT8 A;  3OSR A;  3HO7 A;  2RCA A;  1QJM A;  3TDJ A;  4YAH X;  5L9O A;  3RUM A;  4QSC A;  2Q2C A;  3I6V A;  4C1U A;  4H8I A;  1LB9 A;  1NV5 A;  1P1Q A;  4R9G A;  4JWO A;  3R7X A;  1EZP A;  3D4C A;  2W7Y A;  3RTW B;  4P1E A;  3QXM A;  2QPQ A;  3PTY A;  3RYD A;  1FQF A;  1I69 A;  4O7I A;  4DIG A;  2X26 A;  1O63 A;  1FTL A;  4P3L A;  3SEV A;  4NF5 B;  1YYZ A;  4KHZ E;  5H8H A;  3IJO B;  4R6Y A;  1SW2 A;  5EQA A;  5EYF A;  1JVX A;  4N07 A;  4H8J A;  1IIW A;  3KSJ A;  4GWY A;  4XKP A;  4FEB A;  3T1B A;  1JET A;  1LLS A;  4U23 A;  1ZMG A;  2HXR A;  2CZH A;  2ONK E;  4N13 A;  4XKR A;  4XKQ A;  1FPI A;  5JEI A;  4QF9 A;  2Z22 A;  3CSG A;  1VFD A;  1RDY A;  2DOJ A;  4FIM A;  4Q5T A;  3A29 A;  3MZ1 A;  2RKM A;  4G2Z A;  3TQL A;  2QMW A;  2OWS A;  4KCC A;  3T96 B;  4C1T A;  3TCG A;  4G4P A;  1A8E A;  4JWX A;  3EPE A;  4G8H A;  5BUU A;  1MY0 A;  1SD3 A;  3MPK A;  3JV9 A;  3H6U A;  1JEV A;  5CMB A;  4PAF A;  1MPD A;  1MPB A;  2OJT A;  4H65 A;  3T9V A;  4O3A A;  1I6B A;  3C35 A;  4F22 A;  1D9Y A;  1SDX A;  1B7U A;  1NFT A;  1FTJ A;  5KDT B;  1TWY A;  3IR1 A;  4EQ7 A;  1MQI A;  4PQJ A;  4PAK A;  4H5F A;  4ISU A;  1FBH A;  1NUX A;  1EZ9 A;  3VDF A;  4IB2 A;  4HE0 A;  1B0H A;  2FBP A;  1AL3 A;  3WAE A;  1M5E A;  1MY3 A;  1NNK A;  4GWW A;  5JK4 A;  3LSW A;  1K9Y A;  3A3C A;  3VLU A;  3IX1 A;  4EF2 A;  1N3X A;  5H8S A;  4R74 A;  3IJX B;  1IXG A;  4NF5 A;  2NWJ A;  4N6D A;  1XS5 A;  3EN3 A;  3V8X B;  4OAN A;  3SZP A;  3U93 A;  3T22 A;  3S9N C;  4YKJ A;  5CMK A;  2FNC A;  1FSA A;  3FXB A;  4F39 A;  4WXJ A;  2RC7 A;  2IA4 A;  1DCU A;  3RT6 B;  1NV4 A;  1SYH A;  4F18 A;  1FQE A;  2D3I A;  4Q8R A;  1PC3 A;  2I6E A;  1PB8 A;  5DW8 A;  3IL1 B;  2HQ0 A;  5FTI A;  3T66 A;  4YIC A;  2M8C A;  1AWB A;  3E79 A;  4PFI A;  2Y7W A;  1USY E;  4GWO A;  5IGA A;  3SEW A;  4OMB A;  1ZIU A;  1B5I A;  1MXY A;  3SEX A;  2Q8M A;  1FBD A;  2AL4 A;  1B5H A;  4PF6 A;  4OVQ A;  4N6P A;  4GX4 A;  3LSF B;  1USY H;  3OD7 A;  1URD A;  5B70 A;  1GTK A;  3A09 A;  3IO6 A;  1VDW A;  1EYJ A;  3MVZ A;  4MCO A;  3PPN A;  2GHB A;  3IFC A;  3THI A;  3LC8 A;  2ZYK A;  2CZL A;  3MPL A;  2XWI A;  5KZT A;  3FV2 A;  4GQO A;  2CEY A;  2FYI A;  1US5 A;  4O94 A;  1QUJ A;  4JXI A;  3LUZ A;  1BLF A;  1LBZ A;  2DQV A;  1MQD A;  3N94 A;  2H25 A;  3T9X B;  5ITP A;  1OVT A;  3N6T A;  2L5V A;  5H8Q B;  4KYS A;  1B4H A;  4GX6 A;  2O6A A;  3CG3 A;  2NOO A;  2Q8J A;  4ELO A;  4F2Q A;  3K6W A;  3V83 A;  3W9W A;  4PFW A;  1DTZ A;  4XFE A;  2H98 A;  4YU0 A;  1B46 A;  3TCF A;  5CBS A;  3LBS A;  1IXH A;  1MH4 A;  2XWO A;  3EKI A;  1NV7 A;  4K3F A;  4AS5 A;  1QUL A;  4JDF A;  1B58 A;  3USD A;  4FE8 A;  2P0S A;  2H4I A;  1ZLQ A;  3KGC A;  2PFZ A;  3ZKL A;  4UAB A;  1KA1 A;  4X48 A;  3OOA A;  2UVH A;  2PYY A;  5AE4 A;  1MQG A;  1IMF A;  1VR5 A;  3MVX A;  1KZ8 A;  4F2O A;  3RPW A;  1EU8 A;  3O29 A;  1RDX A;  5ICQ A;  4H46 A;  1VE4 A;  1PBP A;  3O6I A;  4XXU A;  2ZNU A;  4QBA A;  1FPB A;  4PE3 A;  1QUI A;  4OFL A;  2B65 A;  5A5L A;  4P1L A;  3I3V A;  3MYU A;  1R1N A;  5I59 B;  3LSX A;  5CM6 A;  1YCJ A;  2RF1 A;  4RJZ A;  1EZO A;  2I49 A;  5CC2 A;  4JVD A;  3FD3 A;  4G8M A;  1LST A;  1QKA A;  4ZEI A;  3L6G A;  4HE2 A;  3LUY A;  1UTH B;  2XXP A;  4OTE A;  4KD5 A;  5ET5 A;  1Y1M A;  5H8F B;  4BLA A;  4PBQ A;  2CZK A;  3UA8 A;  4MF3 A;  2QRY A;  4I1D A;  4ZE8 A;  4HS7 A;  1AIV A;  4N8G A;  1B52 A;  4P11 A;  4U21 A;  2DVZ A;  2Z8E A;  3VV5 A;  4ZZA A;  1EYK A;  4OZ9 A;  1IQ7 A;  2PBW A;  5AA4 B;  4H1X A;  1UIU A;  4F31 B;  3M3K A;  2O69 A;  4I8C A;  4NF4 A;  1IZ1 A;  2I0B A;  5H8Q A;  4GFR A;  4R2F A;  2DS9 A;  1LBV A;  3ZS6 A;  1T0K A;  4G68 C;  3DLN A;  3U72 A;  4MMP A;  3K6U A;  1N04 A;  3KC0 A;  3JYR A;  4NMY A;  5I56 B;  3DEL B;  3TUS A;  4PP0 A;  4OVJ A;  3MQ9 A;  4GVO A;  3BIH A;  1MRP A;  4O8M A;  2WBB A;  3KOT A;  4YMA A;  1DBZ A;  3OO7 A;  4DI3 D;  1NUY A;  1OVB A;  3GBB A;  4GWZ A;  2OK2 A;  4PAI A;  4EF1 A;  2Y84 A;  3VXB A;  2F6G A;  3RQT A;  1YTV A;  1WVJ A;  4HW8 A;  4FAJ A;  3FXU A;  2Q2A A;  2QS3 A;  4N91 A;  4GWS A;  2QFL A;  3C36 A;  4OHN A;  4NGU A;  3H6V A;  1POT A;  1F9B A;  3IOV A;  3CVG A;  2YLN A;  3C4M A;  4PCD A;  1R6Z A;  3T93 B;  4DI4 B;  2UYE A;  1FTA A;  5I59 A;  5FHN A;  5FTH A;  3IOR A;  2PMS A;  3S2V A;  3NOH A;  2VD3 A;  3EF7 A;  2YJP A;  3FIR A;  3UK4 A;  1P1N A;  4BDN A;  4IO2 A;  1UTH A;  3PMV A;  3K4U A;  3TOD A;  4N4U A;  2PVU A;  5H8F A;  2A5T B;  4N81 A;  5AA2 D;  4O7M A;  4RYA A;  2HXW A;  5I2K B;  4H6D A;  3VLW A;  4QFK A;  4JWY A;  3BFU A;  3FAS A;  4GXS B;  4X9T A;  5AA4 A;  1TFD A;  2O7U A;  3BFT A;  2WBD A;  1S7Y A;  4XF5 A;  1LBY A;  4TQU Q;  1VSO A;  2OCU A;  4X8R A;  1FRP A;  4KFQ A;  3CHG A;  4HCY A;  2XWK A;  3IAZ A;  5I56 A;  1POY 1;  3CRB A;  4ONY A;  1ELJ A;  3GYY A;  5ICT A;  2V25 A;  3GXA A;  1IXC A;  3K00 A;  4F1V A;  4RA1 A;  3CI8 A;  4XIG Q;  2DP8 A;  2OZZ A;  5I84 A;  4OVP A;  4HCW A;  4ECF A;  2X7P A;  5F24 A;  2ZMB A;  2DXY A;  3VE1 B;  3TTK A;  4AS4 A;  4P47 A;  3LR1 A;  2GFE A;  2QS4 A;  2F5X A;  4IR8 A;  1Y1Z A;  4RPN A;  1XI6 A;  2DWA A;  4FAT A;  2ZNT A;  1H3D A;  5L9S A;  1NNP A;  3K2D A;  1HSE A;  2GHA A;  1DMB A;  4GWU A;  3T0J A;  4PFY A;  1NV1 A;  4MJO A;  4MEV A;  2E1S A;  5CMC A;  1R9L A;  3KFM A;  1O7T A;  1MXU A;  4I62 A;  4U2R A;  1BKA A;  5IAI A;  1P99 A;  3MP6 A;  4ZZE A;  3MWB A;  4MAG A;  4Z7E A;  5CBR A;  1NV0 A;  2H9B A;  3VLV A;  4OQO A;  2KR0 A;  4ZDM A;  1ANF A;  2A5T A;  3UN6 A;  5HM4 B;  4H5G A;  5I2K A;  4JB7 A;  2HAU A;  5HPQ A;  4FED A;  5H8N B;  5LTC A;  4YB7 A;  2XXT A;  1A40 A;  1B7Z A;  1H44 A;  1Y3N A;  5K2Y A;  2Z23 A;  2B3B A;  4LP2 B;  4OES A;  1JQF A;  2Q9T A;  4QFO A;  4M1V A;  1B3E A;  4I3E A;  1URS A;  1IME A;  3FVN A;  1XOC A;  5AA2 B;  4PGN A;  3R26 A;  3UGW A;  1UIV A;  2I3V A;  2O1M A;  3TKD A;  2V93 A;  3MP8 A;  5DVF A;  1INP A;  1B05 A;  3MW0 A;  1B40 A;  3AXF A;  3TQW A;  3VXC A;  1A7L A;  3VVE A;  2ONR A;  4N6K A;  3FJ7 A;  5DEX B;  1AH5 A;  1S50 A;  3C31 A;  2QS1 A;  4I40 A;  3RNN A;  3HHG A;  4WEP A;  1P1U A;  3PUW E;  1NUW A;  2HZL A;  3KN8 A;  3KN3 A;  4HTG A;  1CNQ A;  4U1Z A;  2QS2 A;  4G61 A;  1B3L A;  1N76 A;  3S4U A;  3PUZ E;  2O7I A;  4KPT A;  4LZ7 A;  4R75 A;  5TP9 B;  2LAO A;  1B7H A;  3CFL A;  4R72 A;  4KXP A;  3M3F A;  5FHM A;  4YB5 A;  2XHD A;  1UQW A;  4O3C A;  4OVS A;  5IZ1 A;  5I7I A;  3HST A;  1IXI A;  4MIJ A;  2ESN A;  4LQ2 A;  1QUK A;  1MQH A;  1JNF A;  4MH5 A;  3I5O A;  5ET6 A;  2ZYO A;  1B51 A;  4OFO A;  3KJT A;  1FPE A;  2F36 A;  3EHS A;  1D4N A;  1B0L A;  3N26 A;  4PFT A;  4ZEK A;  2F3D A;  4EQ9 A;  1HSJ A;  1SPI A;  2XXY A;  5I5P A;  2DXR A;  3ILU B;  4DLD A;  1EYI A;  2V3T A;  4OEU A;  1MM7 A;  3W15 C;  5EQ8 A;  3IB2 A;  1FJ6 A;  3FV1 A;  4NG7 A;  5F1Q A;  1NUZ A;  2ALU A;  3MZ9 A;  2F3B A;  4ZEC A;  4MLQ A;  4AB5 A;  3O6H A;  1NV6 A;  5IZZ A;  5AA2 A;  2KLF A;  5KDT A;  4H67 A;  3K01 A;  4U1O A;  1BK4 A;  3SET A;  2E0S A;  4G77 A;  2OLB A;  2I3W A;  3A3U A;  2HAV A;  4NED A;  3OSQ A;  1US4 A;  2V84 A;  3C34 A;  3OEM A;  1JW5 A;  1ATG A;  2BJJ X;  1H45 A;  3H03 A;  2WYP A;  3EHT A;  3FAT A;  3S9M C;  1WDN A;  1K9Z A;  1N0T A;  2UVI A;  2XX9 A;  2F8D A;  4F1U A;  2XXW A;  3PPR A;  4JSD A;  3PD9 A;  3G3I A;  3H4Z A;  5DYH A;  2UVJ A;  5J1D A;  3TTR A;  2OWZ A;  2QVV A;  5TP9 A;  2I4B A;  3QUF A;  4RK2 A;  2ONS A;  1FW0 A;  3FVO A;  3LV0 A;  4TLL B;  4H0W A;  2HPG A;  5L8D A;  2DWJ A;  1LBW A;  2XXV A;  2F35 A;  4E0X A;  4YKK A;  1XHY A;  4F3B A;  5K2X A;  2QL3 A;  2H5Y A;  1LAH E;  4YKI A;  4PET A;  1XC1 A;  4GD5 A;  3B6W A;  2Z8D A;  1PDA A;  2D5W A;  1YXI A;  1A99 A;  3ZKK A;  3B6T A;  5IM2 A;  3E78 A;  2RIN A;  1Y9U A;  1MH3 A;  3KSX A;  3Q28 A;  2ABH A;  2H99 A;  1MG1 A;  1CE2 A;  5M2V A;  1MXZ A;  4Q30 B;  2REJ A;  2XXI A;  4ESW A;  4MFI A;  2GH9 A;  3TPA A;  2DSF A;  1WOD A;  3QUJ A;  1FPK A;  3KJ7 A;  4R6H A;  1B1X A;  3GZG A;  1TT1 A;  3GLB A;  4RY1 A;  4I9D A;  1MQJ A;  2F7C A;  3JZJ A;  3TTL A;  4DXC A;  3ZSF A;  3BIG A;  3Q27 A;  4OVR A;  2HCA A;  3OO6 A;  5I3S A;  4X04 A;  1OQH A;  3FGS A;  2UXA A;  3PPP A;  2F34 A;  3Q25 A;  3KZG A;  1BIY A;  1OMP A;  3RLF E;  1JEU A;  5DVI A;  3QK6 A;  3B7D A;  3FUZ A;  4YKP A;  3M8U A;  4PDH A;  4GL8 A;  3FJG A;  4PC9 A;  4ZEB A;  2QMX A;  1BTJ A;  1XVY A;  3S9L C;  3FZV A;  1MY1 A;  4QXD A;  3KBZ A;  1FQA A;  4OET A;  3KEI A;  4QRZ A;  1RKM A;  2BJI A;  2XXX A;  4ELQ A;  4NAP A;  1DK4 A;  1SBP A;  1M5D A;  1MS7 A;  2RCB A;  1OIB A;  1DPE A;  3M3L A;  2WEF A;  5KCJ B;  2OWT A;  3HV1 A;  3FXQ A;  2MKZ A;  1RYX A;  1LCT A;  2VGQ A;  1NL5 A;  1TXF A;  2PX1 A;  4DXU A;  1SW4 A;  1P1O A;  3SER A;  3K1N A;  3UIF A;  1YPN A;  1QW0 A;  5LDZ A;  4RPO A;  1QGX A;  3RPL B;  1L5T A;  1OLA A;  4F3S A;  1B32 A;  4GBV A;  5AA3 A;  3CFX A;  1H76 A;  3ROJ A;  2WYK A;  4PF8 A;  2XXH A;  3PMX A;  1IUD A;  2CMO A;  1J1N A;  2FIX A;  3CSB A;  1AMF A;  1PBQ A;  4XKN A;  4ZEF A;  3PUV E;  3O28 A;  1MXW A;  2DWH A;  1FBE A;  2VP1 A;  3PV0 E;  2YPN A;  1I6A A;  5B7D A;  2DDK A;  4EQB A;  3TEL A;  2FVZ A;  2A5S A;  3ECR A;  3HFU A;  1FPG A;  4OWD A;  4YMB A;  3PMW A;  2DE2 A;  2QVR A;  1IMC A;  3H6T A;  1Q9D A;  3IK6 B;  4GL0 A;  5EQ7 A;  5DT6 A;  4IY5 A;  3OEL A;  1S9T A;  3SEY A;  5JTY B;  2GRV A;  3K02 A;  3QSL A;  2G93 A;  3B50 A;  2JJK A;  2F78 A;  1A54 A;  4ZS9 A;  3PD8 A;  4P0I A;  3ONM A;  2KQZ A;  2O51 A;  4IO5 A;  3S9E A;  3H6W A;  3N6U A;  1B1H A;  3KG2 A;  4DCX A;  2R6G E;  3C33 A;  1BP5 A;  2IEE A;  2Y7K A;  4OXV A;  4NWC A;  1FBC A;  3QYT A;  2RC8 A;  2ZZX A;  3SES A;  3H06 B;  4HE1 A;  3HN0 A;  4GBW A;  2V3U A;  1PB9 A;  4P0G A;  1FPD A;  1SW5 A;  4R9F A;  3OEN A;  3FBP A;  4BDQ A;  1B4Z A;  5KCJ A;  3HCQ A;  4FBP A;  3E4R A;  2DYX A;  3T9U A;  3E13 X;  2I4C A;  3TTN A;  3D1R A;  2VPO A;  3OMB A;  5FBP A;  5EYG A;  3WAF A;  1EH3 A;  3RPL A;  2PCR A;  1RYO A;  3BBR A;  3CIJ A;  3C9H A;  4FJP A;  2Q89 A;  3EHU A;  3E9X A;  1MXX A;  2FIE A;  4N17 A;  1B3H A;  4R2B A;  4GIZ A;  1MY2 A;  4OVT A;  4PTK A;  4GF8 A;  1B5J A;  3K1P A;  4KQP A;  4NN3 A;  4L17 A;  2VHA A;  2PT1 A;  3RGY A;  3T9H B;  4U4X A;  3DP8 A;  4GRK A;  2XXR A;  3B8B A;  4QFP A;  4G68 B;  2R8T A;  1LBX A;  3ILT B;  2CZI A;  3OEK A;  3C32 A;  2WX9 A;  4R6K A;  5EHM A;  2VD2 A;  3D4G A;  5TPA B;  3MVY A;  2NXO A;  3G3J A;  2F7A A;  4GX3 A;  3K6X A;  3G3H A;  2Y7R A;  4MNP A;  2P3V A;  5JTY A;  3RTF B;  2ZYM A;  2I58 A;  5L9M A;  4NHB A;  4OFJ A;  5IZ3 B;  4LAT A;  3VVF A;  1I6Q A;  1FPF A;  3EQ1 A;  4R73 A;  2XA5 A;  4WED A;  1FTK A;  1YZ0 A;  3W9V A;  4U22 A;  4XEQ A;  4TLM B;  2ZYN A;  2UYF A;  2XX7 A;  1HSL A;  1LCF A;  3ISP A;  1MDQ A;  3TAJ A;  3KN7 A;  2ZZW A;  4IGT A;  3MZB A;  1OQG A;  3G3G A;  1LAF E;  1XVX A;  4OEV A;  1LFG A;  3U8Q A;  2FA7 A;  1LAX A;  1LEV A;  4KCD A;  2OBG A;  1JW1 A;  4P9K A;  5CRY A;  2AL5 A;  1OLC A;  3CR9 A;  3U92 A;  5I57 B;  3MVW A;  2DVC A;  1G0H A;  3U65 A;  2F97 A;  3DP6 A;  4PFR A;  3SEU A;  1SQY A;  2B4M A;  1GR2 A;  2Z8F A;  1IMD A;  1NI9 A;  4QSE A;  1B6H A;  1MXV A;  1D9Q A;  4LON B;  2HZK A;  2Y7P A;  3K6V A;  5A5X B;  4FEC A;  1GVC A;  4KYD A;  4P8B A;  2G29 A;  1JP4 A;  1NH8 A;  5DVJ A;  3KOS A;  3LSL A;  1LBB A;  4THI A;  1DTG A;  2B4L A;  1Q35 A;  4BDM A;  2AIX A;  3O2A A;  1M5F A;  1MY4 A;  4MBP A;  1URG A;  1R9Q A;  3OXN A;  2ZXT A;  4OEN A;  4IO3 A;  4POW A;  4EUO A;  3TCH A;  2I48 A;  1IIT A;  2X7Q A;  3HPI A;  4QFL A;  4RK9 A;  5BWJ A;  3O97 A;  3O9P A;  2UVG A;  3FVG A;  3GBA A;  4BDL A;  5ITO A;  3PUX E;  3KBR A;  3G3K A;  3L6H A;  4F29 A; 
#chains in the Genus database with same CATH homology
 4NGU A;  1RDZ A;  1YXI A;  1KA0 A;  5IM2 A;  3E78 A;  4GWY A;  2XWV A;  3T1B A;  4PCD A;  2GQ1 A;  2Y5L A;  4DI4 B;  4MNC A;  1FTA A;  2Q74 A;  2HXR A;  2CZH A;  3NOH A;  1FPI A;  4N8Y A;  1FPK A;  1RDY A;  5IZ3 A;  3A29 A;  1IMA A;  4P56 A;  4N4U A;  2VPN A;  4N81 A;  3QMF A;  4F19 A;  4O7M A;  3BIG A;  4OVR A;  5I3S A;  4X04 A;  4JVI A;  4PAF A;  4X9T A;  2WBD A;  2V4C A;  4XF5 A;  1LBY A;  4PDH A;  5ET8 A;  4PC9 A;  4X8R A;  1FRP A;  3CHG A;  4HCY A;  3IFA A;  1FBG A;  4PAK A;  2XWK A;  1FBH A;  4QXD A;  3KBZ A;  2VT5 A;  1NUX A;  3GYY A;  2BJI A;  2DE3 A;  4HE0 A;  2FBP A;  5EYH A;  4NAP A;  4F1V A;  1FJ9 A;  1DK4 A;  4OVP A;  4HCW A;  5F24 A;  4GWW A;  5JK4 A;  4AS4 A;  4P47 A;  4NX1 A;  1K9Y A;  2WEF A;  2F5X A;  2OX3 A;  4IR8 A;  2MKZ A;  2Y5K A;  1XI6 A;  4N6D A;  5ESY A;  3MST A;  4I3Y A;  4GWX A;  5ET7 A;  4OAN A;  5LDZ A;  3RPL B;  1QGX A;  3SZP A;  4GBV A;  4GWU A;  3T0J A;  1NV1 A;  4MJO A;  3ROJ A;  4MEV A;  2WYK A;  4PF8 A;  1FSA A;  3FXB A;  4NF0 A;  1IMB A;  2FIX A;  1FBF A;  1DCU A;  4MHF A;  4MNI A;  1NV4 A;  4F18 A;  1FBE A;  4MAG A;  5DW8 A;  2DDK A;  1NV0 A;  2FVZ A;  4YIC A;  1AWB A;  2KR0 A;  3HFU A;  1FPG A;  3E79 A;  4PFI A;  2DE2 A;  2QVR A;  1IMC A;  1Q9D A;  5IGA A;  2PFY A;  5EQ7 A;  4JVC A;  1FBD A;  2Q8M A;  4PF6 A;  4OVQ A;  5LTC A;  4GX4 A;  3B50 A;  2JJK A;  2KQZ A;  2Q9T A;  1VDW A;  4M1V A;  1EYJ A;  4MCO A;  4I3E A;  1IME A;  3IFC A;  2XXK A;  4N15 A;  4PGN A;  4PBH A;  2XWI A;  1INP A;  2CEY A;  1FBC A;  4O94 A;  2ZZX A;  3LUZ A;  4HE1 A;  1LBZ A;  4N6K A;  4H45 A;  4GBW A;  1FPD A;  2L5V A;  4I40 A;  2FHY A;  4GX6 A;  1NUW A;  2HZL A;  4OA4 A;  3FBP A;  1CNQ A;  4G61 A;  1NV2 A;  3W9W A;  4FBP A;  4YZZ A;  3D1R A;  4XFE A;  1FBP A;  2VPO A;  4HXV A;  5FBP A;  2HHM A;  5EYG A;  2DE4 A;  2XWO A;  3EKI A;  4NQ8 A;  1NV7 A;  4KXP A;  3RPL A;  5T3J A;  4AS5 A;  1FPL A;  4PFB A;  2PCR A;  1G0I A;  2FIE A;  4N17 A;  4OVS A;  5IZ1 A;  2PFZ A;  4LN5 A;  4UAB A;  5I7I A;  1KA1 A;  4MIJ A;  4OVT A;  4PTK A;  1IMF A;  2QVU A;  5ET6 A;  4NN3 A;  4PGP A;  1KZ8 A;  1FPE A;  1RDX A;  4H46 A;  3B8B A;  2R8T A;  4QBA A;  2F3D A;  1LBX A;  1FPB A;  2CZI A;  4PE3 A;  1SPI A;  2WX9 A;  5A5L A;  4P1L A;  5I5P A;  3MYU A;  3KC1 A;  4GX3 A;  5CM6 A;  1EYI A;  1FPJ A;  4MNP A;  2P3V A;  5EQ8 A;  4JVD A;  1FJ6 A;  4NG7 A;  1NUZ A;  4NHB A;  5IZ3 B;  1FPF A;  2F3B A;  2XA5 A;  4HE2 A;  1YZ0 A;  3W9V A;  2ZZV A;  5ET5 A;  1NV3 A;  4XEQ A;  4PBQ A;  2CZK A;  1NV6 A;  5EQ9 A;  3ISP A;  5IZZ A;  5J16 A;  2ZZW A;  1BK4 A;  4MX6 A;  4N8G A;  2CEX A;  2DVZ A;  4PDD A;  1EYK A;  1LEV A;  4P9K A;  2P3N A;  2V3Q A;  1G0H A;  3U65 A;  2WYP A;  4PFR A;  1LBV A;  2B4M A;  1IMD A;  1NI9 A;  4MMP A;  1D9Q A;  1K9Z A;  2HZK A;  3KC0 A;  4P8B A;  1JP4 A;  4F1U A;  3BIH A;  1NV5 A;  2B4L A;  4O8M A;  2WBB A;  1DBZ A;  5J1D A;  4DI3 D;  1NUY A;  2OWZ A;  2QVV A;  4GWZ A;  4PAI A;  3LV0 A;  2HPG A;  4P1E A;  1LBW A;  2QPQ A;  3PTY A;  3RYD A;  4PET A;  4O7I A;  4P3L A;  4N91 A;  4GWS A;  1YYZ A;  2QFL A;  5EQA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...