4OVRA

Crystal structure of a trap periplasmic solute binding protein from xanthobacter autotrophicus py2, target efi-510329, with bound beta-d-galacturonate
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
298
structure length
298
Chain Sequence
RQYRSADVQPADYPTVKAVQSMSDELNKETNGKISIKVFPNSQLGSEKDTIEQVKLGALDFIRINSGTLNTVCPAMTVPVLPFLFRDKAHMRAVLDGPIGDEILADCASHGLVGLAFYDSGARSFYATTPIRKLEDLKGKKIRVQQSDIWVSMMKLLGANATPMPAGEVFTGLKSGLIDGAENNWPSYDNFHHYEAAKNYSLSEHSMAPEVLLISKRVFDSFTPEEQVQVRKAAKNSVGYMRQLWDAMEISSREKVEKAGVEVITIDKAPFQAAVQPLYDQFVTDPKLKDMITRIKAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Experimental strategies for functional annotation and metabolism discovery: targeted screening of solute binding proteins and unbiased panning of metabolomes.
pubmed doi rcsb
source organism Xanthobacter autotrophicus
molecule tags Solute-binding protein
molecule keywords TRAP dicarboxylate transporter, DctP subunit
total genus 97
structure length 298
sequence length 298
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4ovrA00
2WX9A 4P56A 4OANA 4X04A 4MEVA 4NN3A 4MIJA 4N8GA 2VPOA 4O8MA 2XXKA 5CM6A 4MNIA 4PBQA 2HPGA 2XA5A 4MNPA 4PF6A 4PGNA 5I5PA 2WYPA 4PF8A 4YZZA 5I7IA 4PFIA 4DI4B 4N8YA 4NHBA 2V4CA 5IM2A 2HZLA 4PETA 3B50A 4XFEA 2XWIA 2ZZXA 4N91A 4P1LA 4XF5A 4PBHA 4N6KA 4PDHA 3U65A 4N4UA 4PAIA 3FXBA 4UABA 4MCOA 4XEQA 4OA4A 4NGUA 4O94A 4O7MA 4P1EA 4MAGA 4X8RA 4NAPA 2HZKA 4LN5A 4OVQA 4YICA 2PFYA 4MNCA 4DI3D 2ZZVA 4P8BA 4PDDA 2XWOA 4P47A 4PE3A 2WYKA 2ZZWA 4PFBA 4NG7A 4PAFA 4OVRA 4N6DA 4NQ8A 2VPNA 4N15A 2XWVA 4NF0A 4OVTA 4OVPA 5IZZA 3GYYA 2CEYA 2XWKA 5LTCA 4P9KA 4OVSA 5IGAA 4N17A 4MX6A 4MMPA 4PC9A 4P3LA 4MHFA 4PCDA 2CEXA 4PAKA 4PFRA 4PGPA 4NX1A 2PFZA
chains in the Genus database with same CATH superfamily
4ZE8A 1VE4A 2P2AA 2PVUA 3RGYA 4ELOA 1SW2A 4N8GA 5DEXA 4G68B 5CM6A 2THIA 4TOZA 1QKAA 2NXOA 3WAEA 4U2RA 1D3KA 3PUZE 4I40A 3PPQA 3C31A 2DE3A 2W7YA 3U8QA 4PFYA 2QJEA 5IM2A 1FTJA 5EQ9A 3BBRA 3THIA 1MQGA 2RCBA 1B7ZA 4KYSA 2QS1A 4Q5TA 3OD7A 4H0WA 3FXRA 3FIRA 2WKYA 1FSAA 3V89B 2O1MA 1EZ9A 1MQHA 4YB7A 3MP1A 1S9TA 3IB2A 2F3DA 5HPQA 2ZYNA 1B3EA 1HSLA 4NF5A 3C35A 3Q25A 1S7YA 4XIGQ 1B6HA 4R75A 3QMFA 2AL5A 3KFMA 1NV0A 1LFIA 1SQYA 1FBFA 5IZ3B 4JB7A 1B1XA 3Q28A 1A8FA 1B5JA 2XXIA 1O64A 4MBPA 3U93A 1FTKA 3T0JA 3L6HA 5I84A 3O66A 2DWJA 3LR1A 4P9KA 4F1YA 2P3NA 2Z8EA 4GWOA 5KDTB 3JV9A 2DE2A 1JVXA 4F3GA 4ZDMA 3CVGA 1FPIA 3RPLA 5FHMA 1JNFA 5KZTA 4MEVA 4X1DA 3K1PA 4IY6A 2VHAA 4P11A 5H8HA 4H8IA 2WBDA 4KXPA 1XS5A 4DE8A 3CG1A 2R9JA 5ET8A 2NUVA 4PFUA 1R6ZA 2V3QA 4H5FA 4PFIA 1D9QA 3Q29A 4G8MA 4IO5A 2V4CA 2KQZA 3CSBA 3K00A 4GD5A 4N91A 3MPKA 1BLFA 3RPLB 3TQWA 3RLFE 3RYDA 3SESA 4LQ5A 1M5DA 1XVYA 2AYSA 4UABA 3OO9A 3LSLA 4PFWA 1AMFA 1TWYA 3K6VA 3OO6A 4O94A 5A5XA 3O9PA 1MH3A 3B7DA 3MUQA 5AA1A 4GWWA 4NAPA 3SEUA 2R6GE 3HO7A 5ITPA 4LONB 2XXYA 4GIZA 3E13X 5HM4B 3FGSA 1FPEA 1VSOA 3K6XA 2ZZWA 2QVVA 4GVOA 1IZ1A 2RCAA 2ZYOA 2GFEA 4OXVA 3SZPA 3EN3A 1JETA 4NF0A 3O2AA 1MM6A 1H43A 4QXDA 4UACA 4EQ7A 4LZ5A 2XWKA 4O3CA 2FHYA 3TTRA 1UTHB 5ELVA 1M5BA 1FQDA 3TTMA 2FIXA 1LBVA 4IGRA 1SYHA 3RY3A 4OHNA 3QSLA 2GQ1A 3B6WA 2Y7WA 1FBCA 1T0KA 4C1TA 3N6UA 1GGGA 1B32A 4QF9A 2XXTA 2Z8FA 2PT1A 4O8MA 4P0IA 3GBAA 2DWIA 4OFJA 5CBSA 3QYTA 3MW0A 2P1SA 2QFLA 3PV0E 4ELQA 1NUZA 3OO7A 4O3AA 2ZNSA 3CFXA 3RT8A 4IO2A 1IMBA 3OEKA 3V83A 2HQ0A 4PETA 5DEXB 4I8CA 1FPKA 1MH4A 1SDXA 3DP4A 4JXIA 4JVCA 1IXIA 3TPAA 4ESXA 4FORA 2GH9A 2D3IA 3FBPA 5I2KA 4P47A 3UA8A 2OX3A 1OMPA 4ZEFA 3S9EA 4DXCA 2I49A 1FQFA 3HHGA 1JW5A 2Y7PA 3G3KA 4GL0A 1H44A 4DXBA 4F31B 5H8NA 3RUMA 4OVTA 3IL1B 3C32A 3DLNA 3MSTA 2P0SA 2PX1A 1FTOA 4QFOA 3IR1A 2RC7A 3DM0A 3G3IA 4EDPA 2ZYMA 4EQBA 4TLMB 2DQVA 4NWDA 2ZNTA 4DLDA 4PAKA 2ZNUA 3VLUA 3FUZA 4POXA 1RDXA 5DVJA 4R2FA 3PD9A 1RYXA 1Y1ZA 3LBSA 5ISUA 1EYIA 4IR8A 1YYZA 2VPOA 4OWDA 4JBZA 4POWA 3T96B 3MZ1A 4QFPA 3O6GA 2F36A 4HW8A 5I59A 4FATA 2JJKA 3IORA 5M2VA 1A99A 3MWBA 2Q74A 1IEJA 2XX7A 2E0SA 1NUYA 4XF5A 2FIEA 4N6KA 4QSCA 1K9ZA 1HSJA 4FJPA 1B1HA 3U92A 5ET5A 4P1EA 1NV1A 1LBYA 4KPTA 1XT8A 1MY2A 4MLVA 4YKKA 1LAXA 1FBPA 3G3HA 3C4MA 1OIBA 2QMWA 4N07A 4EQ9A 1A40A 4PE5B 1OLAA 1FPFA 3RNNA 5FTIA 4N13A 3OELA 3FATA 2QVRA 2L5VA 1N3XA 5DW8A 1B46A 2OWZA 1HSEA 3RQTA 3FVOA 1LBBA 3D4GA 1K9YA 1IXGA 3OXNA 4OYVA 2F97A 1SYIA 2QMXA 1FW0A 4PC9A 1BIYA 1MXWA 1Q1KA 3DELB 4NF8A 1Y9UA 2Y84A 3OSRA 3KOTA 1TFAA 3H03A 3UGWA 3R6UA 4FIMA 2RINA 2O51A 1LAHE 4GFRA 5LOMA 4U21A 2DWAA 3FV2A 2X26A 5JTYA 4MNPA 3VFJA 4DCYA 3GLBA 4LVQA 2WYPA 3V5AA 1LGBC 4PF8A 4QFKA 5ICQA 1MXXA 2UYEA 2GHAA 3Q27A 3K1NA 2ALUA 4LP2B 2F8DA 4U23A 1LB8A 3A3UA 3KGCA 3CSGA 1QW0A 3MZBA 1NFTA 4NTLA 1B0LA 3RN8A 4PAIA 2I48A 3PPPA 4GQOA 4HE0A 1B3HA 4HXVA 2UVGA 3T1BA 3B8BA 3VXBA 1JW4A 2WYKA 3GBBA 1Q35A 4NMYA 1KWHA 1DSNA 5LDZA 3TCGA 2H9BA 4ELPA 1UIVA 5DVFA 1FBHA 5TU0A 4IGTA 3S9LC 1ZTYA 4BDLA 4P3LA 3C33A 4MHFA 5K2XA 1OQGA 1FPGA 1PBPA 4PFRA 3TDJA 3A3CA 2NWJA 2HAVA 3A09A 1MG1A 5JTYB 3HN0A 4GWZA 3W15C 4X04A 2REGA 2OWTA 3RPWA 1DPPA 1WVJA 2QRYA 1LBCA 4BDRA 4KQPA 4AS4A 3TTLA 3MZ9A 4JSOA 4ZEBA 4PGNA 5CC2A 2QSXA 2I0BA 2UVIA 5I3SA 2H5YA 2DP8A 3CFLA 1QULA 4R74A 3CRBA 4EF2A 3EPEA 2XWIA 3IOUA 4HS7A 1OVBA 5ICTA 4WKMA 2HHMA 1EH3A 1N7WA 4RY1A 5J16A 2I3WA 3CR9A 3U94A 2B3BA 3WAFA 3ODBA 2DOJA 2PFYA 3T9HB 1USYH 3H3GA 2XWOA 3IO4A 3TCFA 1NUXA 3UP9A 3PUXE 1ZIUA 1CB6A 4ECFA 3IFAA 4H6DA 5DT6A 2H4IA 3IX1A 3G7WA 1MXZA 1NV4A 5DTBA 1ANFA 1MXYA 2I4CA 4GOTA 1EZPA 2A5TA 5H8SA 1MQJA 2I4BA 4BDMA 4ELRA 1B4HA 2CZHA 5CMKA 3OMBA 3SEXA 2VP1A 4NX1A 4K3FA 1QUJA 4HE2A 3VXCA 3ZSFA 4AB5A 2ONSA 3HV1A 4OZ9A 4RXLA 1B3LA 5ET7A 3KN3A 2XXKA 1IXCA 4LZ8A 1IIWA 2A5TB 2O84X 1SD3A 2DDKA 5B7DA 2CZKA 1NNTA 2HXRA 3ILUB 3U1OA 1LAFE 4O7IA 1QUIA 1NV3A 1US5A 1LSTA 2I0CA 2VGQA 1NV7A 2PT2A 4MLQA 5AA4B 3CFZA 1XI6A 2F34A 1B2HA 2PMSA 1LFGA 5JEIA 3B50A 1FPJA 4G4PA 5ET6A 5I57A 3IFCA 3TELA 3T93B 1YCJA 3C9HA 3FXBA 4NF5B 1IMCA 1VR5A 3C36A 3SEWA 1B4ZA 1NUWA 1UTBB 5AA2A 2ONRA 3IAZA 1NI9A 3PPOA 1Y3QA 1PB7A 3QUJA 2ESNA 4OFLA 3IK6B 3CIJA 5EYGA 1RDZA 1NL5A 3LV0A 3IOVA 3H06B 1TXFA 1NV2A 4JWXA 4U1OA 1GTKA 3LC8A 4LATA 2PCRA 2O6AA 1FTMA 1MY0A 4C0RA 1POY1 2B4LA 4PP0A 5IZ3A 3M3KA 5IGAA 4YMAA 5B70A 3UORA 4ISUA 1ZU0A 2VOZA 2I6EA 5I2KB 2F5XA 2R71A 5KCJB 4M1VA 1USYE 1LB9A 1CNQA 2ABHA 1I6QA 1H45A 4NEDA 4H65A 4FEDA 1VDWA 4PTKA 4DXUA 1GR2A 2XA5A 1MPBA 1SI1A 3U72A 3IOWA 3OENA 5I5PA 4XKQA 4RPOA 4FBPA 2XXXA 2DXYA 1UTBA 4XFEA 2A5SA 3DP6A 4G2ZA 3IO6A 2Z22A 3I3VA 3K1MA 1B9JA 1KA1A 4X8RA 1ZMGA 4ZEKA 2Q8MA 1RYOA 3FZVA 4MNCA 4XKNA 3CI8A 1INPA 1PBQA 1SW1A 3MVYA 1D4NA 1B7UA 2WEFA 2XHDA 5FHNA 2QPQA 4KI0E 2XXRA 3D1RA 4OVPA 1DTGA 2XD2A 1FQAA 4C1UA 4M4GA 4KCDA 3T9XB 4RYAA 2HEUA 2ANJA 2CEXA 3L6GA 1FPDA 4Q30B 1QUKA 4ND9A 3W9VA 4DZ1A 1M5FA 1MXUA 4N6PA 4F22A 1B0HA 4I3EA 5ITOA 4MIJA 5KDTA 2HFBA 1JQFA 4R73A 4F3PA 4EXLA 5AA4A 1AH5A 2Y7KA 5DVIA 5EQ7A 4H5GA 3T22A 4N81A 1Y20A 2UVJA 3QXMA 2Z8DA 3M3FA 5IAIA 4QFLA 3C34A 4TQUQ 1OQHA 4OEUA 2DSFA 4R2BA 3RT6B 1DCUA 2XX8A 1DK4A 3KJ7A 3FJ7A 1LEVA 2E1SA 2DVZA 5TPAA 2F78A 4MCOA 4X48A 2XX9A 4UA8A 3F11A 4IO3A 4LZ7A 2HZKA 3CG3A 4OVQA 4P8BA 4YB6A 3FD3A 1B3GA 2Q8JA 3PUYE 3BFUA 3EF7A 2RKMA 5EYHA 1XVXA 4G8NA 3PTYA 1JP4A 4PAFA 3TKDA 2V93A 5F7VA 3H6UA 4GX3A 3H6TA 4U4XA 1N7XA 3ZKLA 3KSJA 4KYDA 3TQLA 4GWSA 4R72A 4F3SA 1DBZA 4Z0IA 3KOSA 4N17A 4ZS9A 5HBCA 2RF1A 5J1DA 1DTZA 3ZKKA 4H8JA 1B5IA 5TP9A 3LUYA 1P99A 4BDNA 3IB0A 3T66A 2B65A 1A7LA 3LSXA 4XXUA 4XKRA 5AA3A 4FEBA 3W9WA 3JYRA 4F3BA 1LLSA 1FPLA 5EYFA 2CMOA 1B05A 1URSA 2Z23A 4YAHX 1EYKA 2VD3A 4OTEA 2UXAA 1PB8A 2IA4A 4WEPA 1FJ6A 3BIHA 4F2OA 1I6AA 5EQAA 2FVZA 1YAEA 4F39A 2QS3A 2WBBA 2X7PA 2OZZA 3S4UA 4G61A 3E79A 4MJOA 2Q9TA 4OERA 1NV5A 5EHMA 4BLAA 4GXSB 1SW4A 3USDA 3IB1A 1P1WA 3HPIA 4YB5A 4U1ZA 1GVCA 3FVGA 3M8UA 4KFQA 4DI3D 1IXHA 3N26A 4YMBA 3ISPA 4PFBA 2UYFA 3H4ZA 4GL8A 2XXWA 3K02A 2Q89A 4Q0CA 4U4SA 4O3BA 1FJ9A 5H8FB 1P1UA 4N6DA 2P3VA 1AWBA 5TP9B 1NNFA 2VPNA 3I5OA 3PUWE 2Y7RA 1ZBMA 1IMAA 3SKPA 3IJXB 1IMFA 1NNKA 1UIUA 3IJOB 3EHUA 1B52A 3OO8A 3OSQA 1NNPA 3K6WA 4GWUA 2DE4A 1N76A 2IEEA 3KN7A 3VE1B 4BDOA 1G0IA 4GWXA 4PBQA 3B6QA 3FJGA 4AS5A 3TTKA 4X9TA 2H98A 1AIVA 3MVWA 3MYUA 2PYYA 2F7AA 4JVDA 1LBWA 5FTHA 1LFHA 2VT5A 5IZ1A 3R7XA 3PUVE 2ZZXA 4R9FA 5L9OA 4OVJA 2ZMBA 1H76A 2DS9A 2ONKE 3SETA 4QSEA 2QVUA 3QAXA 4ZZEA 1URDA 3PPNA 3IOTA 2Q88A 2OBGA 1J1NA 3BFTA 2XD3A 1G0HA 1Q9DA 1XHYA 2ZZVA 4HTGA 3TODA 5I59B 4GX6A 2V25A 1US4A 1PB9A 1BP5A 3MVZA 2FA7A 1FBEA 2HXWA 2YJPA 5FBPA 3K2DA 1MXVA 4EXKA 2HAUA 4ZE9A 1Y1MA 2REJA 2NVUB 4FE8A 5BUUA 4MH5A 3O6IA 3A29A 1JVYA 4KCCA 4NF6B 2O7UA 1PDAA 3FXQA 1O7TA 4OETA 4Z7EA 3KEIA 1ZKBA 3VVFA 1BTJA 3SEYA 1M5EA 1BKAA 1II5A 1VFEA 2RC9A 2WX9A 4P56A 5FHOA 1N04A 1Y4TA 1EYJA 3K01A 1B3FA 2HPGA 4AB6A 1QVSA 5CRYA 1IITA 3CHGA 3FV1A 4NF4B 1RKMA 2O68A 2V84A 5CMBA 4RA1A 5I7IA 5KCJA 1N0TA 5I58A 4N8YA 2FNCA 1LBZA 4F2QA 1FBGA 4OFOA 3R26A 1Y3NA 1NKXA 4H67A 4ESWA 2BJIA 4YKIA 4N4UA 2NOOA 1AL3A 2OCUA 1NH7A 3BKIB 3KN8A 4LQ2A 1AOVA 5F24A 3V8XB 5I2NA 3TYHA 4IO6A 1FQBA 3O29A 2R8TA 1PEBA 2UVHA 3TCHA 2OLBA 2AIXA 4IY5A 4XTCQ 1IMEA 4GRKA 2ZYKA 4U22A 3VVEA 1MDP1 1JEUA 1KZ8A 3PMWA 3PD8A 3TMGA 2GRVA 3HCQA 3HHFA 5IZZA 4WXJA 3H6VA 4R6YA 4GX4A 3ZS6A 5H8HB 2D21A 4L17A 4DDDA 2Y5LA 5AA2B 4I3YA 4PCDA 5T3JA 3M3LA 4QSDA 3ECRA 5A5XB 4OANA 5I56B 4KYEA 3AXFA 3BIGA 3TFLA 1D9YA 4OEVA 3O97A 4DCXA 2QL3A 1Y4CA 4G68A 4GLIA 2F7BA 3G3FA 3S2VA 2AL4A 3SEVA 3TZAA 1MM7A 4FECA 1FTLA 3MBPA 5I58B 1MY1A 3FVNA 4DIGA 2F6GA 2V3UA 3MVXA 3KJTA 4GF8A 4PFTA 4QRZA 4JSDA 4IO7A 4QHQA 1IQ7A 2H99A 1FQEA 1MQIA 1FTAA 1POTA 1UTHA 5AA2D 1JEVA 2Y5KA 3DP8A 4R9GA 3E3KA 1L5TA 3QIMA 3FXUA 3FJMA 2MKZA 1ZJLA 4XEQA 4OQOA 3O6HA 1MQDA 3S9NC 1Z7ME 4GWYA 3FVKA 3G3JA 2XXQA 4MAGA 3VLWA 4F29A 2LAOA 4OMBA 4ZEDA 2XXHA 2BJJX 4F1VA 3HSTA 4E0XA 4PE3A 4LA9A 4ZEIA 1D9VA 5K2YA 4OVRA 2XXPA 2M8CA 4NQ8A 1PC3A 4Q8RA 5TPAB 5BWJA 1R9LA 4QFNA 1B40A 1SVXB 1ZLQA 2F35A 5L8DA 3UIFA 1DOTA 3E78A 4HCYA 5CMCA 3MP8A 3H6WA 5L9SA 2O69A 1FQCA 1SW5A 2G29A 4F1UA 1ELJA 3ONMA 3KSXA 2GHBA 2PFZA 4R6HA 3EKIA 4G8HA 3K0VA 4F19A 3T9UA 3PGFA 4AQ4A 1P1NA 3PU5A 1S50A 1TT1A 2F7CA 4RPNA 5JK4A 4YZZA 4H1XA 2XXUA 3FASA 4THIA 5H8QB 2FBPA 2QS2A 4LUBA 2KLFA 1B51A 4MF3A 1TFDA 4GXAA 1F9BA 1QGXA 3LSFB 4HCWA 5CBRA 3P7IA 5I57B 3Q26A 4H45A 3PMVA 2DWHA 4WEDA 3MC2A 3SDFA 5H8NB 4FAJA 4NF6A 4YICA 1FPBA 5CMMA 4JDFA 1P1QA 4PDDA 4MFIA 1R1NA 2FYIA 2RC8A 1FCKA 4X1BA 1A54A 5AE4A 1XOCA 4OESA 1I6BA 4IO4A 3UN6A 1CE2A 1LCFA 5CI5A 1EU8A 4YKJA 4KHZE 3GYYA 4R6KA 2CEYA 3MPLA 3MQ9A 4NF4A 2X7QA 3ILTB 1BK4A 4MX6A 3ROJA 1YTVA 4I62A 4I9DA 1A8EA 3LUZA 3KBRA 1YXIA 3QK6A 3E9XA 4PGPA 5I2NB 1IUDA 1MRPA 5A5LA 4ONYA 3OEMA 3D4CA 3KC1A 5EHSA 3N6TA 3TAJA 4KR5A 1MS7A 1B5HA 3T9VA 1NH8A 3MAMA 4HE1A 1MY4A 1MPCA 4TLLB 2Q2CA 1R9QA 4MNIA 2B3FA 5DYHA 3VV5A 5I56A 1M5CA 1LAGE 4RJZA 4DI4B 2OJTA 1YPNA 4NHBA 2Y7IA 2HZLA 2H25A 1WDNA 2B4MA 4KD5A 1RDYA 4PBHA 2CZIA 4PDHA 1JW1A 2OK2A 1A55A 1OLCA 3E4RA 5EQ8A 1LBXA 2Q2AA 3MP6A 4ZZAA 1I69A 1QKBA 1VFDA 4EUOA 3EQ1A 4O7MA 4JWOA 1LCTA 4LN5A 4YU0A 1P1OA 1FBDA 1XC1A 4NWCA 4JWYA 1WODA 1NV6A 4G77A 3RTFB 3TTNA 1QJMA 2HCAA 3KG2A 3B6TA 2XWVA 2KR0A 3VLVA 4E0WA 3KBZA 5ESYA 3G3GA 1URGA 1KA0A 1B58A 1NMUA 1MY3A 5LTCA 3GXAA 4YKPA 3N94A 2F6PA 4OENA 4MMPA 1IMDA 3MJNA 3SERA 4RK9A 3KC0A 5L9MA 2D5WA 2OWSA 1DMBA 3OOAA 3PMXA 4NN3A 4ZECA 1UQWA 2YLNA 4F18A 1OVTA 4NE4A 1GV8A 2YPNA 1Z7NE 4XKPA 1MDQA 3LSWA 3N5LA 3HFUA 2O7IA 4PF6A 2DVCA 2PBWA 1SPIA 1SBPA 3VDFA 1ATGA 1O63A 3RTWB 3KZGA 4P1LA 4G68C 1EZOA 2V3TA 3H7MA 2F3BA 2I58A 4GBVA 2VD2A 1B7HA 4BDQA 3U65A 4H46A 3NOHA 4EF1A 4OA4A 3TEPA 3EHSA 4NGUA 3GZGA 4I1DA 3I6VA 1N84A 3O28A 4NF8B 3K4UA 1SI0A 3S9MC 2DXRA 2CZLA 4NG7A 2I3VA 2XXVA 1YZ0A 5IKBA 3UK4A 1N3WA 2ZXTA 4N15A 1Y3PA 1H3DA 5H8QA 3VVDA 4JVIA 4QBAA 2QS4A 5F1QA 2G93A 4IB2A 1MPDA 5H8FA 2DYXA 2O1LA 4GBWA 3K6UA 4OVSA 4PQJA 3EHTA 4P0GA 3QUFA 1DPEA 3TUSA 4RNSA 3JZJA 1FRPA 4RK2A 3PPRA
chains in the Genus database with same CATH topology
4HE2A 3KC1A 1FPIA 1FBCA 3RPLA 2WX9A 4GWZA 4P56A 1CNQA 4F19A 4OANA 4X04A 4MEVA 4NN3A 4I3EA 1EYIA 4MIJA 4IR8A 1YYZA 4HE1A 5ET7A 4N8GA 1EYJA 3BIGA 1G0IA 4F18A 2VPOA 4O8MA 3W9WA 2XXKA 5CM6A 4GWXA 4MNIA 1VDWA 2HPGA 4PBQA 4PTKA 4AS4A 2DDKA 2WBDA 1FPLA 5EQ7A 4AS5A 4N81A 2XA5A 4I40A 3HFUA 3CHGA 2CZKA 4KXPA 4MNPA 4PF6A 1EYKA 2HXRA 4PGNA 4X9TA 2DE3A 1FJ6A 2QFLA 2WYPA 3BIHA 4O7IA 5ET8A 5I5PA 1NV3A 1NUZA 2FVZA 4PF8A 2JJKA 4YZZA 1SPIA 5EQAA 2V3QA 3MYUA 5I3SA 5I7IA 4PFIA 1NV7A 4FBPA 4DI4B 4JVDA 4N8YA 1LBWA 1D9QA 4NHBA 2Q74A 1IMBA 1XI6A 2V4CA 5IM2A 2VT5A 2WBBA 1LBZA 2KQZA 5IZ1A 2HZLA 4PETA 3B50A 1DCUA 2FBPA 1FBGA 1FPJA 2XWIA 2ZZXA 4N91A 4P1LA 4XFEA 1DK4A 5EQ9A 4G61A 1NUYA 3E79A 2B4MA 2HHMA 4MJOA 1FPKA 1RDYA 2CZIA 1FTAA 2FIEA 2F3BA 4PBHA 4XF5A 1LEVA 2Q9TA 3IFCA 4GBVA 3EKIA 4N6KA 4PDHA 3RYDA 1NV5A 2DVZA 1QGXA 2Y5KA 4HCWA 4JVCA 3U65A 5JK4A 1K9ZA 2BJIA 4N4UA 4H46A 3NOHA 4PAIA 1LBXA 3FXBA 2MKZA 1IMCA 4MCOA 4UABA 4XEQA 4OA4A 5EQ8A 5J16A 4GWYA 4H45A 4NGUA 2QVUA 5ET6A 1NUWA 4HE0A 4O94A 1FSAA 1KA1A 4O7MA 5ET5A 4P1EA 4MAGA 4X8RA 5F24A 1NV1A 1NI9A 2HZKA 4GWWA 4NAPA 1LBYA 4HXVA 3T1BA 4LN5A 4OVQA 4YICA 2Q8MA 1FPBA 2PFYA 4MNCA 1FBDA 1G0HA 1Q9DA 4DI3D 2ZZVA 2F3DA 4F1VA 3B8BA 4P8BA 1FBPA 3FBPA 1INPA 4PDDA 2XWOA 4P47A 4GX6A 4PE3A 2OX3A 5EYGA 1RDZA 2R8TA 1FPEA 1NUXA 2WYKA 3ISPA 2ZZWA 4PFBA 2QVVA 1NV6A 3QMFA 3LV0A 5EYHA 4NG7A 1YZ0A 1FPFA 1IMEA 1NV0A 1FJ9A 3IFAA 1FBFA 5IZ3B 3PTYA 1FBEA 1JP4A 1NV2A 4PAFA 4OVRA 5FBPA 4N6DA 1NV4A 2P3VA 3SZPA 2WEFA 1AWBA 4NQ8A 2QVRA 2L5VA 2VPNA 5DW8A 1KZ8A 4N15A 2XWVA 2KR0A 4GX3A 2OWZA 4JVIA 4NF0A 4QBAA 2QPQA 4OVTA 5LDZA 2PCRA 3KBZA 3D1RA 5ESYA 3T0JA 1IMAA 3MSTA 1IMFA 1FBHA 1KA0A 3GYYA 4OVPA 5IZZA 4QXDA 3RPLB 2CEYA 1K9YA 2B4LA 5IZ3A 4GWSA 4GBWA 2XWKA 5LTCA 2CZHA 1DBZA 4P9KA 4OVSA 5IGAA 3A29A 3E78A 1BK4A 4GX4A 4MX6A 2FHYA 4MMPA 2P3NA 4HCYA 4N17A 4PC9A 3ROJA 4P3LA 2FIXA 2F5XA 2Y5LA 1LBVA 3LUZA 4I3YA 1IMDA 1YXIA 4MHFA 4PCDA 1FPGA 5T3JA 2CEXA 2DE2A 5J1DA 4PAKA 4GWUA 4PFRA 1FPDA 4F1UA 2DE4A 1RDXA 4PGPA 4M1VA 4NX1A 3KC0A 5A5LA 3W9VA 2PFZA 1FRPA 2GQ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WX9 A;  4P56 A;  4OAN A;  4X04 A;  4MEV A;  4NN3 A;  4MIJ A;  4N8G A;  2VPO A;  4O8M A;  2XXK A;  5CM6 A;  4MNI A;  4PBQ A;  2HPG A;  2XA5 A;  4MNP A;  4PF6 A;  4PGN A;  5I5P A;  2WYP A;  4PF8 A;  4YZZ A;  5I7I A;  4PFI A;  4DI4 B;  4N8Y A;  4NHB A;  2V4C A;  5IM2 A;  2HZL A;  4PET A;  3B50 A;  4XFE A;  2XWI A;  2ZZX A;  4N91 A;  4P1L A;  4XF5 A;  4PBH A;  4N6K A;  4PDH A;  3U65 A;  4N4U A;  4PAI A;  3FXB A;  4UAB A;  4MCO A;  4XEQ A;  4OA4 A;  4NGU A;  4O94 A;  4O7M A;  4P1E A;  4MAG A;  4X8R A;  4NAP A;  2HZK A;  4LN5 A;  4OVQ A;  4YIC A;  2PFY A;  4MNC A;  4DI3 D;  2ZZV A;  4P8B A;  4PDD A;  2XWO A;  4P47 A;  4PE3 A;  2WYK A;  2ZZW A;  4PFB A;  4NG7 A;  4PAF A;  4OVR A;  4N6D A;  4NQ8 A;  2VPN A;  4N15 A;  2XWV A;  4NF0 A;  4OVT A;  4OVP A;  5IZZ A;  3GYY A;  2CEY A;  2XWK A;  5LTC A;  4P9K A;  4OVS A;  5IGA A;  4N17 A;  4MX6 A;  4MMP A;  4PC9 A;  4P3L A;  4MHF A;  4PCD A;  2CEX A;  4PAK A;  4PFR A;  4PGP A;  4NX1 A;  2PFZ A; 
#chains in the Genus database with same CATH topology
 4ZE8 A;  1VE4 A;  2P2A A;  2PVU A;  3RGY A;  4ELO A;  1SW2 A;  4N8G A;  5DEX A;  4G68 B;  5CM6 A;  2THI A;  4TOZ A;  1QKA A;  2NXO A;  3WAE A;  4U2R A;  1D3K A;  3PUZ E;  4I40 A;  3PPQ A;  3C31 A;  2DE3 A;  2W7Y A;  3U8Q A;  4PFY A;  2QJE A;  5IM2 A;  1FTJ A;  5EQ9 A;  3BBR A;  3THI A;  1MQG A;  2RCB A;  1B7Z A;  4KYS A;  2QS1 A;  4Q5T A;  3OD7 A;  4H0W A;  3FXR A;  3FIR A;  2WKY A;  1FSA A;  3V89 B;  2O1M A;  1EZ9 A;  1MQH A;  4YB7 A;  3MP1 A;  1S9T A;  3IB2 A;  2F3D A;  5HPQ A;  2ZYN A;  1B3E A;  1HSL A;  4NF5 A;  3C35 A;  3Q25 A;  1S7Y A;  4XIG Q;  1B6H A;  4R75 A;  3QMF A;  2AL5 A;  3KFM A;  1NV0 A;  1LFI A;  1SQY A;  1FBF A;  5IZ3 B;  4JB7 A;  1B1X A;  3Q28 A;  1A8F A;  1B5J A;  2XXI A;  1O64 A;  4MBP A;  3U93 A;  1FTK A;  3T0J A;  3L6H A;  5I84 A;  3O66 A;  2DWJ A;  3LR1 A;  4P9K A;  4F1Y A;  2P3N A;  2Z8E A;  4GWO A;  5KDT B;  3JV9 A;  2DE2 A;  1JVX A;  4F3G A;  4ZDM A;  3CVG A;  1FPI A;  3RPL A;  5FHM A;  1JNF A;  5KZT A;  4MEV A;  4X1D A;  3K1P A;  4IY6 A;  2VHA A;  4P11 A;  5H8H A;  4H8I A;  2WBD A;  4KXP A;  1XS5 A;  4DE8 A;  3CG1 A;  2R9J A;  5ET8 A;  2NUV A;  4PFU A;  1R6Z A;  2V3Q A;  4H5F A;  4PFI A;  1D9Q A;  3Q29 A;  4G8M A;  4IO5 A;  2V4C A;  2KQZ A;  3CSB A;  3K00 A;  4GD5 A;  4N91 A;  3MPK A;  1BLF A;  3RPL B;  3TQW A;  3RLF E;  3RYD A;  3SES A;  4LQ5 A;  1M5D A;  1XVY A;  2AYS A;  4UAB A;  3OO9 A;  3LSL A;  4PFW A;  1AMF A;  1TWY A;  3K6V A;  3OO6 A;  4O94 A;  5A5X A;  3O9P A;  1MH3 A;  3B7D A;  3MUQ A;  5AA1 A;  4GWW A;  4NAP A;  3SEU A;  2R6G E;  3HO7 A;  5ITP A;  4LON B;  2XXY A;  4GIZ A;  3E13 X;  5HM4 B;  3FGS A;  1FPE A;  1VSO A;  3K6X A;  2ZZW A;  2QVV A;  4GVO A;  1IZ1 A;  2RCA A;  2ZYO A;  2GFE A;  4OXV A;  3SZP A;  3EN3 A;  1JET A;  4NF0 A;  3O2A A;  1MM6 A;  1H43 A;  4QXD A;  4UAC A;  4EQ7 A;  4LZ5 A;  2XWK A;  4O3C A;  2FHY A;  3TTR A;  1UTH B;  5ELV A;  1M5B A;  1FQD A;  3TTM A;  2FIX A;  1LBV A;  4IGR A;  1SYH A;  3RY3 A;  4OHN A;  3QSL A;  2GQ1 A;  3B6W A;  2Y7W A;  1FBC A;  1T0K A;  4C1T A;  3N6U A;  1GGG A;  1B32 A;  4QF9 A;  2XXT A;  2Z8F A;  2PT1 A;  4O8M A;  4P0I A;  3GBA A;  2DWI A;  4OFJ A;  5CBS A;  3QYT A;  3MW0 A;  2P1S A;  2QFL A;  3PV0 E;  4ELQ A;  1NUZ A;  3OO7 A;  4O3A A;  2ZNS A;  3CFX A;  3RT8 A;  4IO2 A;  1IMB A;  3OEK A;  3V83 A;  2HQ0 A;  4PET A;  5DEX B;  4I8C A;  1FPK A;  1MH4 A;  1SDX A;  3DP4 A;  4JXI A;  4JVC A;  1IXI A;  3TPA A;  4ESX A;  4FOR A;  2GH9 A;  2D3I A;  3FBP A;  5I2K A;  4P47 A;  3UA8 A;  2OX3 A;  1OMP A;  4ZEF A;  3S9E A;  4DXC A;  2I49 A;  1FQF A;  3HHG A;  1JW5 A;  2Y7P A;  3G3K A;  4GL0 A;  1H44 A;  4DXB A;  4F31 B;  5H8N A;  3RUM A;  4OVT A;  3IL1 B;  3C32 A;  3DLN A;  3MST A;  2P0S A;  2PX1 A;  1FTO A;  4QFO A;  3IR1 A;  2RC7 A;  3DM0 A;  3G3I A;  4EDP A;  2ZYM A;  4EQB A;  4TLM B;  2DQV A;  4NWD A;  2ZNT A;  4DLD A;  4PAK A;  2ZNU A;  3VLU A;  3FUZ A;  4POX A;  1RDX A;  5DVJ A;  4R2F A;  3PD9 A;  1RYX A;  1Y1Z A;  3LBS A;  5ISU A;  1EYI A;  4IR8 A;  1YYZ A;  2VPO A;  4OWD A;  4JBZ A;  4POW A;  3T96 B;  3MZ1 A;  4QFP A;  3O6G A;  2F36 A;  4HW8 A;  5I59 A;  4FAT A;  2JJK A;  3IOR A;  5M2V A;  1A99 A;  3MWB A;  2Q74 A;  1IEJ A;  2XX7 A;  2E0S A;  1NUY A;  4XF5 A;  2FIE A;  4N6K A;  4QSC A;  1K9Z A;  1HSJ A;  4FJP A;  1B1H A;  3U92 A;  5ET5 A;  4P1E A;  1NV1 A;  1LBY A;  4KPT A;  1XT8 A;  1MY2 A;  4MLV A;  4YKK A;  1LAX A;  1FBP A;  3G3H A;  3C4M A;  1OIB A;  2QMW A;  4N07 A;  4EQ9 A;  1A40 A;  4PE5 B;  1OLA A;  1FPF A;  3RNN A;  5FTI A;  4N13 A;  3OEL A;  3FAT A;  2QVR A;  2L5V A;  1N3X A;  5DW8 A;  1B46 A;  2OWZ A;  1HSE A;  3RQT A;  3FVO A;  1LBB A;  3D4G A;  1K9Y A;  1IXG A;  3OXN A;  4OYV A;  2F97 A;  1SYI A;  2QMX A;  1FW0 A;  4PC9 A;  1BIY A;  1MXW A;  1Q1K A;  3DEL B;  4NF8 A;  1Y9U A;  2Y84 A;  3OSR A;  3KOT A;  1TFA A;  3H03 A;  3UGW A;  3R6U A;  4FIM A;  2RIN A;  2O51 A;  1LAH E;  4GFR A;  5LOM A;  4U21 A;  2DWA A;  3FV2 A;  2X26 A;  5JTY A;  4MNP A;  3VFJ A;  4DCY A;  3GLB A;  4LVQ A;  2WYP A;  3V5A A;  1LGB C;  4PF8 A;  4QFK A;  5ICQ A;  1MXX A;  2UYE A;  2GHA A;  3Q27 A;  3K1N A;  2ALU A;  4LP2 B;  2F8D A;  4U23 A;  1LB8 A;  3A3U A;  3KGC A;  3CSG A;  1QW0 A;  3MZB A;  1NFT A;  4NTL A;  1B0L A;  3RN8 A;  4PAI A;  2I48 A;  3PPP A;  4GQO A;  4HE0 A;  1B3H A;  4HXV A;  2UVG A;  3T1B A;  3B8B A;  3VXB A;  1JW4 A;  2WYK A;  3GBB A;  1Q35 A;  4NMY A;  1KWH A;  1DSN A;  5LDZ A;  3TCG A;  2H9B A;  4ELP A;  1UIV A;  5DVF A;  1FBH A;  5TU0 A;  4IGT A;  3S9L C;  1ZTY A;  4BDL A;  4P3L A;  3C33 A;  4MHF A;  5K2X A;  1OQG A;  1FPG A;  1PBP A;  4PFR A;  3TDJ A;  3A3C A;  2NWJ A;  2HAV A;  3A09 A;  1MG1 A;  5JTY B;  3HN0 A;  4GWZ A;  3W15 C;  4X04 A;  2REG A;  2OWT A;  3RPW A;  1DPP A;  1WVJ A;  2QRY A;  1LBC A;  4BDR A;  4KQP A;  4AS4 A;  3TTL A;  3MZ9 A;  4JSO A;  4ZEB A;  4PGN A;  5CC2 A;  2QSX A;  2I0B A;  2UVI A;  5I3S A;  2H5Y A;  2DP8 A;  3CFL A;  1QUL A;  4R74 A;  3CRB A;  4EF2 A;  3EPE A;  2XWI A;  3IOU A;  4HS7 A;  1OVB A;  5ICT A;  4WKM A;  2HHM A;  1EH3 A;  1N7W A;  4RY1 A;  5J16 A;  2I3W A;  3CR9 A;  3U94 A;  2B3B A;  3WAF A;  3ODB A;  2DOJ A;  2PFY A;  3T9H B;  1USY H;  3H3G A;  2XWO A;  3IO4 A;  3TCF A;  1NUX A;  3UP9 A;  3PUX E;  1ZIU A;  1CB6 A;  4ECF A;  3IFA A;  4H6D A;  5DT6 A;  2H4I A;  3IX1 A;  3G7W A;  1MXZ A;  1NV4 A;  5DTB A;  1ANF A;  1MXY A;  2I4C A;  4GOT A;  1EZP A;  2A5T A;  5H8S A;  1MQJ A;  2I4B A;  4BDM A;  4ELR A;  1B4H A;  2CZH A;  5CMK A;  3OMB A;  3SEX A;  2VP1 A;  4NX1 A;  4K3F A;  1QUJ A;  4HE2 A;  3VXC A;  3ZSF A;  4AB5 A;  2ONS A;  3HV1 A;  4OZ9 A;  4RXL A;  1B3L A;  5ET7 A;  3KN3 A;  2XXK A;  1IXC A;  4LZ8 A;  1IIW A;  2A5T B;  2O84 X;  1SD3 A;  2DDK A;  5B7D A;  2CZK A;  1NNT A;  2HXR A;  3ILU B;  3U1O A;  1LAF E;  4O7I A;  1QUI A;  1NV3 A;  1US5 A;  1LST A;  2I0C A;  2VGQ A;  1NV7 A;  2PT2 A;  4MLQ A;  5AA4 B;  3CFZ A;  1XI6 A;  2F34 A;  1B2H A;  2PMS A;  1LFG A;  5JEI A;  3B50 A;  1FPJ A;  4G4P A;  5ET6 A;  5I57 A;  3IFC A;  3TEL A;  3T93 B;  1YCJ A;  3C9H A;  3FXB A;  4NF5 B;  1IMC A;  1VR5 A;  3C36 A;  3SEW A;  1B4Z A;  1NUW A;  1UTB B;  5AA2 A;  2ONR A;  3IAZ A;  1NI9 A;  3PPO A;  1Y3Q A;  1PB7 A;  3QUJ A;  2ESN A;  4OFL A;  3IK6 B;  3CIJ A;  5EYG A;  1RDZ A;  1NL5 A;  3LV0 A;  3IOV A;  3H06 B;  1TXF A;  1NV2 A;  4JWX A;  4U1O A;  1GTK A;  3LC8 A;  4LAT A;  2PCR A;  2O6A A;  1FTM A;  1MY0 A;  4C0R A;  1POY 1;  2B4L A;  4PP0 A;  5IZ3 A;  3M3K A;  5IGA A;  4YMA A;  5B70 A;  3UOR A;  4ISU A;  1ZU0 A;  2VOZ A;  2I6E A;  5I2K B;  2F5X A;  2R71 A;  5KCJ B;  4M1V A;  1USY E;  1LB9 A;  1CNQ A;  2ABH A;  1I6Q A;  1H45 A;  4NED A;  4H65 A;  4FED A;  1VDW A;  4PTK A;  4DXU A;  1GR2 A;  2XA5 A;  1MPB A;  1SI1 A;  3U72 A;  3IOW A;  3OEN A;  5I5P A;  4XKQ A;  4RPO A;  4FBP A;  2XXX A;  2DXY A;  1UTB A;  4XFE A;  2A5S A;  3DP6 A;  4G2Z A;  3IO6 A;  2Z22 A;  3I3V A;  3K1M A;  1B9J A;  1KA1 A;  4X8R A;  1ZMG A;  4ZEK A;  2Q8M A;  1RYO A;  3FZV A;  4MNC A;  4XKN A;  3CI8 A;  1INP A;  1PBQ A;  1SW1 A;  3MVY A;  1D4N A;  1B7U A;  2WEF A;  2XHD A;  5FHN A;  2QPQ A;  4KI0 E;  2XXR A;  3D1R A;  4OVP A;  1DTG A;  2XD2 A;  1FQA A;  4C1U A;  4M4G A;  4KCD A;  3T9X B;  4RYA A;  2HEU A;  2ANJ A;  2CEX A;  3L6G A;  1FPD A;  4Q30 B;  1QUK A;  4ND9 A;  3W9V A;  4DZ1 A;  1M5F A;  1MXU A;  4N6P A;  4F22 A;  1B0H A;  4I3E A;  5ITO A;  4MIJ A;  5KDT A;  2HFB A;  1JQF A;  4R73 A;  4F3P A;  4EXL A;  5AA4 A;  1AH5 A;  2Y7K A;  5DVI A;  5EQ7 A;  4H5G A;  3T22 A;  4N81 A;  1Y20 A;  2UVJ A;  3QXM A;  2Z8D A;  3M3F A;  5IAI A;  4QFL A;  3C34 A;  4TQU Q;  1OQH A;  4OEU A;  2DSF A;  4R2B A;  3RT6 B;  1DCU A;  2XX8 A;  1DK4 A;  3KJ7 A;  3FJ7 A;  1LEV A;  2E1S A;  2DVZ A;  5TPA A;  2F78 A;  4MCO A;  4X48 A;  2XX9 A;  4UA8 A;  3F11 A;  4IO3 A;  4LZ7 A;  2HZK A;  3CG3 A;  4OVQ A;  4P8B A;  4YB6 A;  3FD3 A;  1B3G A;  2Q8J A;  3PUY E;  3BFU A;  3EF7 A;  2RKM A;  5EYH A;  1XVX A;  4G8N A;  3PTY A;  1JP4 A;  4PAF A;  3TKD A;  2V93 A;  5F7V A;  3H6U A;  4GX3 A;  3H6T A;  4U4X A;  1N7X A;  3ZKL A;  3KSJ A;  4KYD A;  3TQL A;  4GWS A;  4R72 A;  4F3S A;  1DBZ A;  4Z0I A;  3KOS A;  4N17 A;  4ZS9 A;  5HBC A;  2RF1 A;  5J1D A;  1DTZ A;  3ZKK A;  4H8J A;  1B5I A;  5TP9 A;  3LUY A;  1P99 A;  4BDN A;  3IB0 A;  3T66 A;  2B65 A;  1A7L A;  3LSX A;  4XXU A;  4XKR A;  5AA3 A;  4FEB A;  3W9W A;  3JYR A;  4F3B A;  1LLS A;  1FPL A;  5EYF A;  2CMO A;  1B05 A;  1URS A;  2Z23 A;  4YAH X;  1EYK A;  2VD3 A;  4OTE A;  2UXA A;  1PB8 A;  2IA4 A;  4WEP A;  1FJ6 A;  3BIH A;  4F2O A;  1I6A A;  5EQA A;  2FVZ A;  1YAE A;  4F39 A;  2QS3 A;  2WBB A;  2X7P A;  2OZZ A;  3S4U A;  4G61 A;  3E79 A;  4MJO A;  2Q9T A;  4OER A;  1NV5 A;  5EHM A;  4BLA A;  4GXS B;  1SW4 A;  3USD A;  3IB1 A;  1P1W A;  3HPI A;  4YB5 A;  4U1Z A;  1GVC A;  3FVG A;  3M8U A;  4KFQ A;  4DI3 D;  1IXH A;  3N26 A;  4YMB A;  3ISP A;  4PFB A;  2UYF A;  3H4Z A;  4GL8 A;  2XXW A;  3K02 A;  2Q89 A;  4Q0C A;  4U4S A;  4O3B A;  1FJ9 A;  5H8F B;  1P1U A;  4N6D A;  2P3V A;  1AWB A;  5TP9 B;  1NNF A;  2VPN A;  3I5O A;  3PUW E;  2Y7R A;  1ZBM A;  1IMA A;  3SKP A;  3IJX B;  1IMF A;  1NNK A;  1UIU A;  3IJO B;  3EHU A;  1B52 A;  3OO8 A;  3OSQ A;  1NNP A;  3K6W A;  4GWU A;  2DE4 A;  1N76 A;  2IEE A;  3KN7 A;  3VE1 B;  4BDO A;  1G0I A;  4GWX A;  4PBQ A;  3B6Q A;  3FJG A;  4AS5 A;  3TTK A;  4X9T A;  2H98 A;  1AIV A;  3MVW A;  3MYU A;  2PYY A;  2F7A A;  4JVD A;  1LBW A;  5FTH A;  1LFH A;  2VT5 A;  5IZ1 A;  3R7X A;  3PUV E;  2ZZX A;  4R9F A;  5L9O A;  4OVJ A;  2ZMB A;  1H76 A;  2DS9 A;  2ONK E;  3SET A;  4QSE A;  2QVU A;  3QAX A;  4ZZE A;  1URD A;  3PPN A;  3IOT A;  2Q88 A;  2OBG A;  1J1N A;  3BFT A;  2XD3 A;  1G0H A;  1Q9D A;  1XHY A;  2ZZV A;  4HTG A;  3TOD A;  5I59 B;  4GX6 A;  2V25 A;  1US4 A;  1PB9 A;  1BP5 A;  3MVZ A;  2FA7 A;  1FBE A;  2HXW A;  2YJP A;  5FBP A;  3K2D A;  1MXV A;  4EXK A;  2HAU A;  4ZE9 A;  1Y1M A;  2REJ A;  2NVU B;  4FE8 A;  5BUU A;  4MH5 A;  3O6I A;  3A29 A;  1JVY A;  4KCC A;  4NF6 B;  2O7U A;  1PDA A;  3FXQ A;  1O7T A;  4OET A;  4Z7E A;  3KEI A;  1ZKB A;  3VVF A;  1BTJ A;  3SEY A;  1M5E A;  1BKA A;  1II5 A;  1VFE A;  2RC9 A;  2WX9 A;  4P56 A;  5FHO A;  1N04 A;  1Y4T A;  1EYJ A;  3K01 A;  1B3F A;  2HPG A;  4AB6 A;  1QVS A;  5CRY A;  1IIT A;  3CHG A;  3FV1 A;  4NF4 B;  1RKM A;  2O68 A;  2V84 A;  5CMB A;  4RA1 A;  5I7I A;  5KCJ A;  1N0T A;  5I58 A;  4N8Y A;  2FNC A;  1LBZ A;  4F2Q A;  1FBG A;  4OFO A;  3R26 A;  1Y3N A;  1NKX A;  4H67 A;  4ESW A;  2BJI A;  4YKI A;  4N4U A;  2NOO A;  1AL3 A;  2OCU A;  1NH7 A;  3BKI B;  3KN8 A;  4LQ2 A;  1AOV A;  5F24 A;  3V8X B;  5I2N A;  3TYH A;  4IO6 A;  1FQB A;  3O29 A;  2R8T A;  1PEB A;  2UVH A;  3TCH A;  2OLB A;  2AIX A;  4IY5 A;  4XTC Q;  1IME A;  4GRK A;  2ZYK A;  4U22 A;  3VVE A;  1MDP 1;  1JEU A;  1KZ8 A;  3PMW A;  3PD8 A;  3TMG A;  2GRV A;  3HCQ A;  3HHF A;  5IZZ A;  4WXJ A;  3H6V A;  4R6Y A;  4GX4 A;  3ZS6 A;  5H8H B;  2D21 A;  4L17 A;  4DDD A;  2Y5L A;  5AA2 B;  4I3Y A;  4PCD A;  5T3J A;  3M3L A;  4QSD A;  3ECR A;  5A5X B;  4OAN A;  5I56 B;  4KYE A;  3AXF A;  3BIG A;  3TFL A;  1D9Y A;  4OEV A;  3O97 A;  4DCX A;  2QL3 A;  1Y4C A;  4G68 A;  4GLI A;  2F7B A;  3G3F A;  3S2V A;  2AL4 A;  3SEV A;  3TZA A;  1MM7 A;  4FEC A;  1FTL A;  3MBP A;  5I58 B;  1MY1 A;  3FVN A;  4DIG A;  2F6G A;  2V3U A;  3MVX A;  3KJT A;  4GF8 A;  4PFT A;  4QRZ A;  4JSD A;  4IO7 A;  4QHQ A;  1IQ7 A;  2H99 A;  1FQE A;  1MQI A;  1FTA A;  1POT A;  1UTH A;  5AA2 D;  1JEV A;  2Y5K A;  3DP8 A;  4R9G A;  3E3K A;  1L5T A;  3QIM A;  3FXU A;  3FJM A;  2MKZ A;  1ZJL A;  4XEQ A;  4OQO A;  3O6H A;  1MQD A;  3S9N C;  1Z7M E;  4GWY A;  3FVK A;  3G3J A;  2XXQ A;  4MAG A;  3VLW A;  4F29 A;  2LAO A;  4OMB A;  4ZED A;  2XXH A;  2BJJ X;  4F1V A;  3HST A;  4E0X A;  4PE3 A;  4LA9 A;  4ZEI A;  1D9V A;  5K2Y A;  4OVR A;  2XXP A;  2M8C A;  4NQ8 A;  1PC3 A;  4Q8R A;  5TPA B;  5BWJ A;  1R9L A;  4QFN A;  1B40 A;  1SVX B;  1ZLQ A;  2F35 A;  5L8D A;  3UIF A;  1DOT A;  3E78 A;  4HCY A;  5CMC A;  3MP8 A;  3H6W A;  5L9S A;  2O69 A;  1FQC A;  1SW5 A;  2G29 A;  4F1U A;  1ELJ A;  3ONM A;  3KSX A;  2GHB A;  2PFZ A;  4R6H A;  3EKI A;  4G8H A;  3K0V A;  4F19 A;  3T9U A;  3PGF A;  4AQ4 A;  1P1N A;  3PU5 A;  1S50 A;  1TT1 A;  2F7C A;  4RPN A;  5JK4 A;  4YZZ A;  4H1X A;  2XXU A;  3FAS A;  4THI A;  5H8Q B;  2FBP A;  2QS2 A;  4LUB A;  2KLF A;  1B51 A;  4MF3 A;  1TFD A;  4GXA A;  1F9B A;  1QGX A;  3LSF B;  4HCW A;  5CBR A;  3P7I A;  5I57 B;  3Q26 A;  4H45 A;  3PMV A;  2DWH A;  4WED A;  3MC2 A;  3SDF A;  5H8N B;  4FAJ A;  4NF6 A;  4YIC A;  1FPB A;  5CMM A;  4JDF A;  1P1Q A;  4PDD A;  4MFI A;  1R1N A;  2FYI A;  2RC8 A;  1FCK A;  4X1B A;  1A54 A;  5AE4 A;  1XOC A;  4OES A;  1I6B A;  4IO4 A;  3UN6 A;  1CE2 A;  1LCF A;  5CI5 A;  1EU8 A;  4YKJ A;  4KHZ E;  3GYY A;  4R6K A;  2CEY A;  3MPL A;  3MQ9 A;  4NF4 A;  2X7Q A;  3ILT B;  1BK4 A;  4MX6 A;  3ROJ A;  1YTV A;  4I62 A;  4I9D A;  1A8E A;  3LUZ A;  3KBR A;  1YXI A;  3QK6 A;  3E9X A;  4PGP A;  5I2N B;  1IUD A;  1MRP A;  5A5L A;  4ONY A;  3OEM A;  3D4C A;  3KC1 A;  5EHS A;  3N6T A;  3TAJ A;  4KR5 A;  1MS7 A;  1B5H A;  3T9V A;  1NH8 A;  3MAM A;  4HE1 A;  1MY4 A;  1MPC A;  4TLL B;  2Q2C A;  1R9Q A;  4MNI A;  2B3F A;  5DYH A;  3VV5 A;  5I56 A;  1M5C A;  1LAG E;  4RJZ A;  4DI4 B;  2OJT A;  1YPN A;  4NHB A;  2Y7I A;  2HZL A;  2H25 A;  1WDN A;  2B4M A;  4KD5 A;  1RDY A;  4PBH A;  2CZI A;  4PDH A;  1JW1 A;  2OK2 A;  1A55 A;  1OLC A;  3E4R A;  5EQ8 A;  1LBX A;  2Q2A A;  3MP6 A;  4ZZA A;  1I69 A;  1QKB A;  1VFD A;  4EUO A;  3EQ1 A;  4O7M A;  4JWO A;  1LCT A;  4LN5 A;  4YU0 A;  1P1O A;  1FBD A;  1XC1 A;  4NWC A;  4JWY A;  1WOD A;  1NV6 A;  4G77 A;  3RTF B;  3TTN A;  1QJM A;  2HCA A;  3KG2 A;  3B6T A;  2XWV A;  2KR0 A;  3VLV A;  4E0W A;  3KBZ A;  5ESY A;  3G3G A;  1URG A;  1KA0 A;  1B58 A;  1NMU A;  1MY3 A;  5LTC A;  3GXA A;  4YKP A;  3N94 A;  2F6P A;  4OEN A;  4MMP A;  1IMD A;  3MJN A;  3SER A;  4RK9 A;  3KC0 A;  5L9M A;  2D5W A;  2OWS A;  1DMB A;  3OOA A;  3PMX A;  4NN3 A;  4ZEC A;  1UQW A;  2YLN A;  4F18 A;  1OVT A;  4NE4 A;  1GV8 A;  2YPN A;  1Z7N E;  4XKP A;  1MDQ A;  3LSW A;  3N5L A;  3HFU A;  2O7I A;  4PF6 A;  2DVC A;  2PBW A;  1SPI A;  1SBP A;  3VDF A;  1ATG A;  1O63 A;  3RTW B;  3KZG A;  4P1L A;  4G68 C;  1EZO A;  2V3T A;  3H7M A;  2F3B A;  2I58 A;  4GBV A;  2VD2 A;  1B7H A;  4BDQ A;  3U65 A;  4H46 A;  3NOH A;  4EF1 A;  4OA4 A;  3TEP A;  3EHS A;  4NGU A;  3GZG A;  4I1D A;  3I6V A;  1N84 A;  3O28 A;  4NF8 B;  3K4U A;  1SI0 A;  3S9M C;  2DXR A;  2CZL A;  4NG7 A;  2I3V A;  2XXV A;  1YZ0 A;  5IKB A;  3UK4 A;  1N3W A;  2ZXT A;  4N15 A;  1Y3P A;  1H3D A;  5H8Q A;  3VVD A;  4JVI A;  4QBA A;  2QS4 A;  5F1Q A;  2G93 A;  4IB2 A;  1MPD A;  5H8F A;  2DYX A;  2O1L A;  4GBW A;  3K6U A;  4OVS A;  4PQJ A;  3EHT A;  4P0G A;  3QUF A;  1DPE A;  3TUS A;  4RNS A;  3JZJ A;  1FRP A;  4RK2 A;  3PPR A; 
#chains in the Genus database with same CATH homology
 4HE2 A;  3KC1 A;  1FPI A;  1FBC A;  3RPL A;  2WX9 A;  4GWZ A;  4P56 A;  1CNQ A;  4F19 A;  4OAN A;  4X04 A;  4MEV A;  4NN3 A;  4I3E A;  1EYI A;  4MIJ A;  4IR8 A;  1YYZ A;  4HE1 A;  5ET7 A;  4N8G A;  1EYJ A;  3BIG A;  1G0I A;  4F18 A;  2VPO A;  4O8M A;  3W9W A;  2XXK A;  5CM6 A;  4GWX A;  4MNI A;  1VDW A;  2HPG A;  4PBQ A;  4PTK A;  4AS4 A;  2DDK A;  2WBD A;  1FPL A;  5EQ7 A;  4AS5 A;  4N81 A;  2XA5 A;  4I40 A;  3HFU A;  3CHG A;  2CZK A;  4KXP A;  4MNP A;  4PF6 A;  1EYK A;  2HXR A;  4PGN A;  4X9T A;  2DE3 A;  1FJ6 A;  2QFL A;  2WYP A;  3BIH A;  4O7I A;  5ET8 A;  5I5P A;  1NV3 A;  1NUZ A;  2FVZ A;  4PF8 A;  2JJK A;  4YZZ A;  1SPI A;  5EQA A;  2V3Q A;  3MYU A;  5I3S A;  5I7I A;  4PFI A;  1NV7 A;  4FBP A;  4DI4 B;  4JVD A;  4N8Y A;  1LBW A;  1D9Q A;  4NHB A;  2Q74 A;  1IMB A;  1XI6 A;  2V4C A;  5IM2 A;  2VT5 A;  2WBB A;  1LBZ A;  2KQZ A;  5IZ1 A;  2HZL A;  4PET A;  3B50 A;  1DCU A;  2FBP A;  1FBG A;  1FPJ A;  2XWI A;  2ZZX A;  4N91 A;  4P1L A;  4XFE A;  1DK4 A;  5EQ9 A;  4G61 A;  1NUY A;  3E79 A;  2B4M A;  2HHM A;  4MJO A;  1FPK A;  1RDY A;  2CZI A;  1FTA A;  2FIE A;  2F3B A;  4PBH A;  4XF5 A;  1LEV A;  2Q9T A;  3IFC A;  4GBV A;  3EKI A;  4N6K A;  4PDH A;  3RYD A;  1NV5 A;  2DVZ A;  1QGX A;  2Y5K A;  4HCW A;  4JVC A;  3U65 A;  5JK4 A;  1K9Z A;  2BJI A;  4N4U A;  4H46 A;  3NOH A;  4PAI A;  1LBX A;  3FXB A;  2MKZ A;  1IMC A;  4MCO A;  4UAB A;  4XEQ A;  4OA4 A;  5EQ8 A;  5J16 A;  4GWY A;  4H45 A;  4NGU A;  2QVU A;  5ET6 A;  1NUW A;  4HE0 A;  4O94 A;  1FSA A;  1KA1 A;  4O7M A;  5ET5 A;  4P1E A;  4MAG A;  4X8R A;  5F24 A;  1NV1 A;  1NI9 A;  2HZK A;  4GWW A;  4NAP A;  1LBY A;  4HXV A;  3T1B A;  4LN5 A;  4OVQ A;  4YIC A;  2Q8M A;  1FPB A;  2PFY A;  4MNC A;  1FBD A;  1G0H A;  1Q9D A;  4DI3 D;  2ZZV A;  2F3D A;  4F1V A;  3B8B A;  4P8B A;  1FBP A;  3FBP A;  1INP A;  4PDD A;  2XWO A;  4P47 A;  4GX6 A;  4PE3 A;  2OX3 A;  5EYG A;  1RDZ A;  2R8T A;  1FPE A;  1NUX A;  2WYK A;  3ISP A;  2ZZW A;  4PFB A;  2QVV A;  1NV6 A;  3QMF A;  3LV0 A;  5EYH A;  4NG7 A;  1YZ0 A;  1FPF A;  1IME A;  1NV0 A;  1FJ9 A;  3IFA A;  1FBF A;  5IZ3 B;  3PTY A;  1FBE A;  1JP4 A;  1NV2 A;  4PAF A;  4OVR A;  5FBP A;  4N6D A;  1NV4 A;  2P3V A;  3SZP A;  2WEF A;  1AWB A;  4NQ8 A;  2QVR A;  2L5V A;  2VPN A;  5DW8 A;  1KZ8 A;  4N15 A;  2XWV A;  2KR0 A;  4GX3 A;  2OWZ A;  4JVI A;  4NF0 A;  4QBA A;  2QPQ A;  4OVT A;  5LDZ A;  2PCR A;  3KBZ A;  3D1R A;  5ESY A;  3T0J A;  1IMA A;  3MST A;  1IMF A;  1FBH A;  1KA0 A;  3GYY A;  4OVP A;  5IZZ A;  4QXD A;  3RPL B;  2CEY A;  1K9Y A;  2B4L A;  5IZ3 A;  4GWS A;  4GBW A;  2XWK A;  5LTC A;  2CZH A;  1DBZ A;  4P9K A;  4OVS A;  5IGA A;  3A29 A;  3E78 A;  1BK4 A;  4GX4 A;  4MX6 A;  2FHY A;  4MMP A;  2P3N A;  4HCY A;  4N17 A;  4PC9 A;  3ROJ A;  4P3L A;  2FIX A;  2F5X A;  2Y5L A;  1LBV A;  3LUZ A;  4I3Y A;  1IMD A;  1YXI A;  4MHF A;  4PCD A;  1FPG A;  5T3J A;  2CEX A;  2DE2 A;  5J1D A;  4PAK A;  4GWU A;  4PFR A;  1FPD A;  4F1U A;  2DE4 A;  1RDX A;  4PGP A;  4M1V A;  4NX1 A;  3KC0 A;  5A5L A;  3W9V A;  2PFZ A;  1FRP A;  2GQ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...