4OVRA

Crystal structure of a trap periplasmic solute binding protein from xanthobacter autotrophicus py2, target efi-510329, with bound beta-d-galacturonate
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
298
structure length
298
Chain Sequence
RQYRSADVQPADYPTVKAVQSMSDELNKETNGKISIKVFPNSQLGSEKDTIEQVKLGALDFIRINSGTLNTVCPAMTVPVLPFLFRDKAHMRAVLDGPIGDEILADCASHGLVGLAFYDSGARSFYATTPIRKLEDLKGKKIRVQQSDIWVSMMKLLGANATPMPAGEVFTGLKSGLIDGAENNWPSYDNFHHYEAAKNYSLSEHSMAPEVLLISKRVFDSFTPEEQVQVRKAAKNSVGYMRQLWDAMEISSREKVEKAGVEVITIDKAPFQAAVQPLYDQFVTDPKLKDMITRIKAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Experimental strategies for functional annotation and metabolism discovery: targeted screening of solute binding proteins and unbiased panning of metabolomes.
pubmed doi rcsb
source organism Xanthobacter autotrophicus
molecule tags Solute-binding protein
molecule keywords TRAP dicarboxylate transporter, DctP subunit
total genus 97
structure length 298
sequence length 298
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4ovrA00
4PFBA 2HPGA 2ZZWA 3B50A 4PF6A 5IGAA 2PFYA 4MMPA 4MX6A 4N17A 4N91A 4N4UA 4X04A 4PETA 4PE3A 4N8YA 4PFIA 4PGPA 4P47A 4N6DA 4N6KA 4P9KA 4NG7A 2WYKA 2V4CA 4XEQA 4PDDA 2WX9A 2XXKA 2XWOA 4P3LA 4NN3A 5IM2A 4MIJA 4PBQA 4YZZA 4MAGA 4PC9A 4X8RA 5CM6A 4NHBA 4NF0A 4O7MA 2VPNA 4P1LA 5I7IA 4NGUA 4MHFA 4OVQA 4XFEA 2XWVA 4MNPA 2CEYA 4OA4A 4DI3D 4P1EA 4MNIA 4PGNA 4MCOA 4MEVA 4OVTA 4PDHA 4LN5A 2PFZA 3U65A 4NQ8A 2CEXA 4OVPA 5I5PA 4PCDA 4O8MA 2WYPA 4MNCA 4PAIA 4P56A 4PF8A 4OVRA 4PAKA 4DI4B 4XF5A 4NAPA 4N15A 2ZZXA 4O94A 2HZLA 4OVSA 4OANA 2XWKA 2HZKA 4NX1A 5IZZA 4PAFA 2XWIA 4PFRA 2ZZVA 2XA5A 5LTCA 4YICA 4PBHA 2VPOA 3FXBA 3GYYA 4UABA 4N8GA 4P8BA
chains in the Genus database with same CATH superfamily
4H65A 4PFWA 2DS9A 2QS4A 4HTGA 1RDYA 2I4CA 2VP1A 2XXHA 4LZ7A 4N81A 1FPGA 4FECA 2V84A 3OSRA 3SETA 4ZEIA 4N8YA 4PFIA 1QULA 1EU8A 1LFGA 4IGRA 2RC8A 4N6KA 1P1OA 4ZE8A 1MDP1 4ZZEA 1IMCA 3K1NA 5B70A 4U23A 4YU0A 2H25A 4LZ5A 5ESYA 1FPJA 2XX8A 4F3SA 4F29A 1DBZA 2DXYA 5I7IA 1FTMA 1US4A 1PBPA 3CHGA 3PTYA 1J1NA 3KEIA 4MCOA 4PDHA 3P7IA 3U1OA 1B3EA 2Y7WA 4O8MA 3TCHA 3FVGA 4PAIA 4ZEDA 5F7VA 3K6WA 2FYIA 4I40A 4I1DA 1QUIA 4NF8B 4Z7EA 5H8SA 5IZ1A 2I48A 2Y5KA 4THIA 4OFOA 3RTFB 1JETA 2A5TA 3CFLA 4ZE9A 3IK6B 2R9JA 4QFNA 2HCAA 3OEKA 1SW4A 3K1MA 3R6UA 1Z7ME 1JVYA 4OESA 3VLUA 5FTHA 1FPBA 1AOVA 2AL4A 1PB7A 2ONKE 1UTHB 1B46A 1MDQA 1YPNA 3V5AA 4NTLA 5ET5A 5L8DA 3A09A 2F34A 1IUDA 5EYHA 3TCGA 5EYGA 1KWHA 1R9QA 2Y7RA 3R26A 3B6QA 1OVTA 1EZOA 1JEVA 2WX9A 3MP8A 4NN3A 2E0SA 4P0IA 4GWYA 1R6ZA 4OYVA 3T9XB 4NHBA 4H6DA 4O7MA 4OENA 4MHFA 1LBXA 3OO8A 4XFEA 2KR0A 2X7QA 4IO2A 4Q0CA 2H98A 4ONYA 4PTKA 4QHQA 4IR8A 3W9VA 3OO6A 4XKQA 1I6AA 2V3TA 4NQ8A 2YPNA 4MF3A 2UXAA 1USYH 4ESXA 4YKJA 2F5XA 3IB1A 4U21A 1US5A 4G61A 3O6IA 1BKAA 2DWIA 3KG2A 5FTIA 4KYSA 4DI4B 1B4ZA 4NAPA 3MAMA 4ISUA 3T96B 2I4BA 3VV5A 3CVGA 3RPWA 4G68A 3O97A 1Y4CA 2Q2CA 4H5GA 5HM4B 5A5LA 3TDJA 4LUBA 4IO5A 2XX7A 2ZNTA 3EHTA 1JVXA 5LTCA 2Q2AA 1NV7A 3L6GA 3UN6A 4IO3A 2R8TA 4IO7A 3O28A 1YXIA 1O64A 2DOJA 1IMFA 3CIJA 4KI0E 4I62A 1AH5A 1TT1A 4ZEFA 4GBVA 3T22A 4HE2A 4I8CA 2I6EA 4N91A 2QFLA 2Q8MA 4G2ZA 5CMBA 3RTWB 4N4UA 3RT8A 2Y7IA 4HE1A 1FQAA 4JBZA 1N7XA 5IZ3A 2DE3A 4AB6A 4F2QA 1D3KA 4P0GA 3M8UA 5H8HA 4R6YA 5TPAA 1LBVA 3G3HA 3FGSA 2R71A 1LAHE 3A29A 3UP9A 2YJPA 1MPCA 2F35A 3K2DA 2O7UA 2I0BA 2A5TB 1DSNA 1RDXA 4WEDA 4KYDA 2VD3A 4JSDA 2NWJA 2GH9A 1OQHA 1H3DA 1S50A 4DXBA 1MPBA 4Q5TA 4ELOA 3D4GA 3KJTA 1OVBA 3VXCA 1N04A 3HV1A 2DE4A 4LQ2A 4H46A 3HPIA 2HAVA 4QF9A 4OVRA 3TUSA 1SW2A 5I2NB 3DP8A 3E3KA 4LATA 1FBCA 4OANA 3C31A 4C1UA 2P1SA 3FV2A 4XKPA 2ZZVA 5L9MA 4KFQA 3C4MA 4EQ7A 1NV1A 2UYEA 4F2OA 5AA1A 5I2NA 2XHDA 4IO6A 1MM7A 4F39A 1A99A 3K00A 2HHMA 2KLFA 4QRZA 4MH5A 1FPLA 3MZBA 3FATA 3RY3A 1EH3A 5KCJB 3N94A 1VE4A 2IA4A 2OK2A 5TU0A 3IAZA 4MLVA 1NNPA 2NUVA 3QUFA 1FTAA 1FTKA 3TYHA 4YKIA 1Y3PA 3S9NC 2B3FA 3T0JA 1FPKA 4DXCA 2PYYA 3AXFA 3B7DA 3FASA 2OCUA 3F11A 5ITOA 1A8EA 1DPEA 4O3AA 2QRYA 5FBPA 5AA4B 3DM0A 3MVWA 4PFYA 2XXRA 2XD2A 1B3FA 5ISUA 4RPOA 3ROJA 4LP2B 2RC9A 1BP5A 1UIUA 4JWXA 1D9QA 3ILUB 2PFZA 4GWSA 4OVPA 1XC1A 3CFZA 4P11A 5CBSA 4OZ9A 4GIZA 1FSAA 4NMYA 1T0KA 2PBWA 3TODA 2DDKA 3CRBA 4XF5A 3HHFA 4N15A 4RNSA 5I57A 4PE5B 1GR2A 5T3JA 2HEUA 3RT6B 1FTOA 1SD3A 2HZKA 2DE2A 4ELPA 3K01A 3I6VA 3PMXA 3G3GA 4ECFA 4GWXA 5K2XA 1LBBA 1NFTA 4YKPA 3GYYA 4OEVA 3KC1A 4X1BA 1N76A 3BIGA 4GWZA 1LGBC 3KSJA 2IEEA 3IO4A 1IXIA 3B50A 3PUXE 5DEXA 4N07A 5H8NB 1LBZA 3CI8A 1FBPA 3B6WA 1MY0A 1LBCA 4R75A 4EF2A 2ZXTA 2F78A 1MXVA 4G68B 3LUYA 1Y1ZA 2PVUA 2DWJA 3KFMA 3U94A 4F1VA 2F6GA 3KBZA 3Q25A 3IX1A 4LA9A 1A40A 5DT6A 4PBQA 1LAFE 2UVGA 1YTVA 3PUZE 1FRPA 4JWYA 1ANFA 5L9SA 1QW0A 1BLFA 1NMUA 4NF0A 4UACA 1PB8A 1LBWA 1QKBA 2XWVA 5EQ8A 1GV8A 4OA4A 1NUYA 1FTLA 1FPEA 4PGNA 4G8MA 3RLFE 2RKMA 3VVFA 3UIFA 1ZBMA 1MQDA 2FA7A 1EYKA 4PCDA 1MY3A 1Y9UA 4GWOA 4RK9A 2B3BA 1FPDA 1N7WA 4PAKA 3NOHA 1B3LA 1RYXA 5I59B 4NF6A 1EYJA 2QMWA 2XXVA 4GOTA 4NF4B 2AL5A 1DK4A 1TXFA 3S9EA 1RYOA 2XXYA 2PT1A 1B4HA 5CRYA 2Z8EA 1WVJA 2F6PA 3B8BA 3CFXA 2GHAA 5I57B 1FCKA 4P8BA 2Z23A 3SEYA 4PFUA 1URDA 2HPGA 5TP9A 3QUJA 2KQZA 2Y84A 1Y3NA 2MKZA 4KCCA 4JDFA 2B65A 1OIBA 1DPPA 3KOSA 4HCYA 1XOCA 4MBPA 3DLNA 5AA2A 1FQEA 3T1BA 3M3KA 4OXVA 4OERA 4R6KA 2E1SA 4WXJA 1B6HA 1AL3A 2Z8DA 3MQ9A 3MVXA 1LBYA 2HQ0A 1YCJA 4L17A 3TCFA 4GWWA 4P3LA 1TFDA 4OQOA 4NF6B 3TPAA 2XX9A 4U22A 2NVUB 4IGTA 3RPLB 3OXNA 3PPPA 4QFKA 4FEBA 3H06B 3FXRA 1RKMA 2XXWA 3O29A 4N13A 3HN0A 1B3HA 2ESNA 1XHYA 1UTBA 2JJKA 3M3LA 3E78A 4G77A 4AS5A 5I5PA 1DMBA 3VVDA 4Q30B 3IOTA 4OFLA 5TPAB 4ZDMA 3WAFA 1NV6A 2L5VA 5IAIA 5H8QB 3MW0A 4KR5A 1B9JA 4KQPA 2HZLA 2O84X 2XXUA 4FIMA 1B40A 2ZYNA 1TWYA 3MPKA 3RNNA 1AMFA 2PT2A 3Q27A 4C0RA 1GGGA 1FBHA 3PUYE 2FNCA 2V93A 4KXPA 5H8QA 4G8NA 4FJPA 3GZGA 4TQUQ 4OFJA 1II5A 1FPIA 3D4CA 1PB9A 5EQ9A 2QVVA 1MRPA 3C35A 1MXYA 3TQLA 4KHZE 2Q8JA 1Z7NE 2QS3A 2F7BA 4HCWA 4PGPA 3H3GA 2UVJA 2FIEA 1B51A 4DCYA 4GL8A 3FJ7A 1USYE 2XWOA 5TP9B 4NWDA 1XVYA 5ELVA 2Y7PA 2OJTA 4TOZA 1CB6A 4X8RA 3T66A 1S7YA 5I3SA 4M1VA 1AIVA 4OVQA 1XI6A 3LSWA 5HPQA 4JWOA 3O2AA 4O3CA 3FXUA 1IQ7A 3PGFA 1FBFA 2F97A 2I3VA 3JZJA 3H4ZA 2BJJX 3PUVE 3K02A 2ABHA 2F7AA 4R74A 2F7CA 4YKKA 1LB8A 5CMCA 4BDOA 4YB6A 1YAEA 3O9PA 2OLBA 3PV0E 2HXRA 1MH3A 3FBPA 3O6HA 4OVSA 1AWBA 2REGA 3Q28A 5DEXB 2ONSA 3D1RA 5IZZA 1S9TA 3G3IA 1A55A 3KGCA 2Q89A 1ATGA 4PFTA 2V3UA 4YMAA 4RPNA 3MZ9A 2ZYMA 2CMOA 2D21A 3ODBA 2GFEA 3VDFA 2B4MA 2DWAA 2D5WA 3QYTA 1YYZA 4H8JA 1MY4A 2ZZWA 2WBBA 4JVIA 3U8QA 4MMPA 2HFBA 4EQBA 2QMXA 3Q26A 3IL1B 1HSLA 3B6TA 2ZMBA 1POTA 5JTYA 1Q35A 3LSLA 1OLAA 1OMPA 3A3CA 1O63A 3ZKKA 3KN3A 1CE2A 4HE0A 3TFLA 2Q9TA 4X9TA 2RCBA 4NE4A 1MPDA 3BKIB 2VPNA 4P1LA 2VT5A 4XKNA 1ZKBA 1FQBA 1INPA 1B32A 1VFEA 1FBEA 4F3BA 2DWHA 1PBQA 5H8HB 3FVOA 4F18A 4PQJA 3WAEA 2P3NA 5FHOA 3ZSFA 4RXLA 4F3PA 1RDZA 2H99A 3R7XA 1P99A 4JVCA 5KCJA 4HW8A 3HO7A 2PCRA 1R9LA 1H45A 3U72A 3K6VA 5CC2A 4PAFA 4EXLA 4F3GA 2WBDA 1LSTA 2OWTA 3QK6A 3RGYA 3VE1B 1EZPA 4QSDA 3OELA 3ILTB 3E9XA 3G3JA 2PX1A 4U4XA 1QGXA 4BDLA 1NV4A 3PU5A 4JSOA 4NWCA 3H6VA 3ZS6A 1H43A 4KYEA 4RA1A 4FE8A 3VVEA 1DTZA 1GTKA 1SI1A 3LC8A 2AIXA 5HBCA 4WEPA 1DOTA 3S9LC 2DQVA 5EHMA 1B3GA 4G4PA 2B4LA 2GQ1A 4OHNA 5KZTA 3FVKA 1O7TA 2FHYA 2Y7KA 4EQ9A 4I3EA 3MYUA 4N6DA 3USDA 3T93B 3K0VA 2FVZA 1LB9A 4U2RA 2Z8FA 2ZNUA 4GRKA 4DLDA 1MQGA 1LCFA 2DVZA 4XIGQ 4X1DA 4GX4A 3I3VA 5ITPA 4AB5A 4LN5A 4NF4A 1MM6A 1NKXA 1OLCA 1FQCA 5ET8A 1MY2A 3K1PA 2O7IA 4PF8A 3RN8A 3SESA 5I56B 3Q29A 3HCQA 1LLSA 5AA3A 3GLBA 4H5FA 1A54A 1B7ZA 4LZ8A 1FQFA 4JVDA 5L9OA 2WEFA 3KC0A 3TQWA 4GFRA 4GXAA 2VHAA 1QUKA 1F9BA 3C9HA 5IZ3B 5I2KA 3LUZA 2VPOA 2ZNSA 5AA2B 1MH4A 4F1UA 2X26A 2DP8A 4BDRA 3QSLA 5F1QA 3T9UA 1ZMGA 4YB7A 2QPQA 4FBPA 4O3BA 4R2BA 3CSGA 3QIMA 2UVHA 3A3UA 1ZU0A 2CZKA 4LQ5A 5CMKA 1VR5A 4XXUA 5CBRA 1FJ9A 3IFAA 4GBWA 2RF1A 1MG1A 3O66A 4H67A 2WYKA 5JK4A 1B58A 3RQTA 3DP4A 4GD5A 1D9VA 3PPOA 2O68A 1QVSA 4ESWA 4TLMB 3VLWA 1IIWA 1M5FA 1NV2A 3PPNA 3SERA 1A8FA 2OX3A 3I5OA 2CEYA 1MXZA 4P1EA 1IMBA 1NNFA 2OWZA 3QMFA 3FXQA 4XTCQ 1ZJLA 5I59A 4G8HA 3S2VA 3W9WA 4LONB 2QVRA 1ZTYA 1EYIA 4OTEA 4QSCA 4QFPA 5H8FA 1TFAA 2Z22A 1URGA 4O94A 1K9ZA 1MXUA 1NI9A 3C33A 1P1NA 1B52A 1NL5A 3G3KA 2FBPA 4ZS9A 1Y4TA 4MFIA 3FXBA 1B5HA 2V3QA 5ET6A 3N6UA 4F31B 4DIGA 1MS7A 2O1LA 4F22A 4MX6A 3IB2A 4MLQA 4Q8RA 2D3IA 5EQAA 3C34A 3MP1A 4BLAA 4GWUA 4X04A 2DVCA 2I3WA 4GX3A 3U92A 3CG3A 3RYDA 3C36A 3H6WA 3LV0A 4JB7A 4ZEKA 4EXKA 1CNQA 5CMMA 2CZLA 3BBRA 4N6PA 3G3FA 1KZ8A 3KBRA 4XEQA 3H03A 3THIA 4GXSB 4MIJA 5H8FB 4R9GA 3FZVA 4YAHX 5A5XA 3ECRA 1ZIUA 3CR9A 2VOZA 1XS5A 4GF8A 2ZYOA 2F36A 3UGWA 2I49A 4FEDA 4DI3D 2W7YA 3MJNA 3EQ1A 4YB5A 1DTGA 2M8CA 3VLVA 3OMBA 3SZPA 5DTBA 5BWJA 2XD3A 5AE4A 4MNCA 1PDAA 2P0SA 4OMBA 2ZZXA 2BJIA 1VSOA 5FHNA 2H4IA 2RCAA 1YZ0A 1M5DA 1Y3QA 3DP6A 3L6HA 2LAOA 3SKPA 3MUQA 1LEVA 1EZ9A 3IR1A 3EPEA 1NV3A 3CG1A 3TTLA 3DELB 3PMWA 1H44A 3HSTA 4UABA 2QS1A 2RINA 1ZLQA 1URSA 4MJOA 4PFBA 4K3FA 2O51A 2ONRA 4PF6A 1NV5A 4R73A 5I58A 5H8NA 1SDXA 4PETA 3MSTA 4PE3A 1WDNA 2DXRA 1IXCA 4IY5A 1LAXA 1FBGA 1MQIA 4QSEA 1FPFA 3S9MC 2H5YA 4EF1A 3PUWE 4PDDA 5FHMA 2VD2A 3OD7A 1VDWA 4PP0A 4ND9A 4U1OA 3BFUA 5I56A 3HFUA 3VFJA 1PC3A 1UIVA 2I58A 1JEUA 3T9VA 5I84A 1IZ1A 4MNPA 2NOOA 4AQ4A 1SW5A 3FJGA 1JW1A 1IEJA 4DXUA 2P2AA 1NUXA 3IFCA 4DCXA 3UK4A 4QBAA 4G68C 1NNTA 4ELRA 5A5XB 1LCTA 1Y1MA 1GVCA 1LFIA 3KSXA 3CSBA 4I3YA 1HSJA 3S4UA 1L5TA 2QS2A 3M3FA 2P3VA 4ZECA 2ZYKA 1BIYA 1DCUA 3TZAA 1M5CA 3OSQA 4NX1A 2QJEA 4H8IA 2XWIA 4GL0A 1MQJA 4PFRA 4ZZAA 4EDPA 4PBHA 1OQGA 5LOMA 4N8GA 2I0CA 3ZKLA 2XXPA 3PPRA 1Q1KA 4H0WA 4E0WA 2PFYA 3K4UA 2XXXA 5J1DA 1FW0A 3V8XB 1JQFA 2CZIA 1FJ6A 4FAJA 1NUWA 3HHGA 3KN8A 1XVXA 3FIRA 4R6HA 3MPLA 3FD3A 4P47A 1IMEA 1M5EA 3FVNA 1FQDA 4O7IA 3KOTA 5EQ7A 3C32A 3TKDA 5DYHA 5B7DA 4NF5A 4NEDA 1NUZA 3IO6A 2WKYA 4R2FA 3H7MA 4YZZA 5AA2D 4LVQA 2Q88A 5DVJA 4GX6A 4KCDA 4NGUA 1I6BA 3RPLA 2X7PA 1LFHA 4YMBA 1UTHA 1N84A 4MNIA 1BK4A 3QAXA 4OVTA 1MXXA 5ICQA 3TMGA 3MWBA 3U65A 2PMSA 2OWSA 4KD5A 1B0HA 2QVUA 2VGQA 2O6AA 4P56A 2YLNA 4WKMA 4GQOA 3KJ7A 3SEWA 3KN7A 4DDDA 3GXAA 3IB0A 1N3XA 4KPTA 5CI5A 3LSFB 4RY1A 2GHBA 4IO4A 3UORA 2HAUA 2CZHA 3ONMA 3TTKA 4YICA 1Y20A 1NH8A 1IXGA 3TAJA 5J16A 3V89B 2F8DA 1SQYA 1KA1A 1SVXB 2O69A 2DSFA 3EHUA 4DZ1A 4AS4A 1B7UA 3N5LA 1ELJA 1R1NA 4FORA 3UA8A 4JXIA 1Q9DA 2AYSA 1UQWA 3SEUA 4R72A 5DVIA 3JV9A 5JEIA 3GBAA 4RYAA 4X48A 1B05A 4P9KA 5M2VA 1SBPA 2XXKA 3T9HB 1NNKA 4OEUA 4U4SA 5IM2A 3H6TA 3SDFA 3OO7A 1IITA 1FBDA 3MVZA 5CM6A 5KDTA 1G0IA 1M5BA 2G93A 3RUMA 2O1MA 3EF7A 3SEXA 4MEVA 4HXVA 5I58B 2NXOA 3OENA 5EYFA 2CEXA 4IY6A 5JTYB 4R9FA 3K6UA 4QFOA 3TTRA 1MXWA 4Z0IA 3FV1A 4E0XA 3LBSA 2XXIA 4IB2A 4OWDA 2FIXA 4POXA 3H6UA 4BDNA 4ZEBA 3K6XA 1A7LA 5BUUA 3FJMA 4F19A 2OBGA 3TTNA 5IKBA 4RK2A 2QL3A 5EHSA 3FUZA 3KZGA 3LSXA 5IGAA 5LDZA 3E79A 3E4RA 4N17A 4GVOA 2Q74A 3MZ1A 1SYIA 1IMAA 2QSXA 3BFTA 1JW5A 5K2YA 4C1TA 5I2KB 1WODA 4EUOA 5ET7A 1K9YA 5DVFA 3MP6A 3N26A 4BDQA 4NG7A 1FTJA 4U1ZA 4DE8A 3OO9A 3MC2A 1SI0A 2Y5LA 1IMDA 4QFLA 2THIA 3LR1A 4MAGA 3IORA 4PC9A 1I69A 2UYFA 2ANJA 1HSEA 1B5JA 2HXWA 4M4GA 3IOUA 3IOVA 1UTBB 5AA4A 1MQHA 1I6QA 3IJXB 3QXMA 5ICTA 3U93A 1D4NA 2XXTA 2V25A 4POWA 2UVIA 1QUJA 4OVJA 1VFDA 3SEVA 3GBBA 1B1XA 4HS7A 1B1HA 1PEBA 1JW4A 5KDTB 3PMVA 4RJZA 1QKAA 2XWKA 3ISPA 4QXDA 2F3DA 4BDMA 2XA5A 3O6GA 3BIHA 3OOAA 4FATA 1D9YA 2XXQA 1B7HA 2GRVA 4OETA 4GLIA 4H45A 4NF5B 3PD8A 1B2HA 1SPIA 4XKRA 3W15C 3EHSA 2ALUA 1IXHA 1G0HA 3IOWA 4UA8A 3N6TA 3EN3A 3OEMA 2OZZA 2V4CA 3MVYA 1NH7A 1SW1A 2DYXA 1B5IA 2A5SA 1B0LA 1JNFA 1XT8A 2RC7A 4H1XA 1SYHA 1QJMA 2G29A 3G7WA 1N3WA 3TEPA 4NF8A 3V83A 1POY1 1BTJA 3EKIA 3E13X 4F1YA 1JP4A 5DW8A 1NV0A 1LAGE 2R6GE 3MBPA 3TTMA 1MY1A 2REJA 2F3BA 2WYPA 3JYRA 1H76A 5F24A 3TELA 3IJOB 4ELQA 3VXBA 4I9DA 1P1UA 3PPQA 4TLLB 1N0TA 1P1WA 1KA0A 1P1QA 2H9BA 3PD9A
chains in the Genus database with same CATH topology
1NV4A 1YXIA 4KXPA 3BIGA 1IMFA 2V3QA 2B4MA 4GWZA 4H45A 4MJOA 4PFBA 5ET6A 1YYZA 1KA1A 2HPGA 1RDYA 1FPIA 2KQZA 4GBVA 2ZZWA 3B50A 2WBBA 4PF6A 5IGAA 2MKZA 4JVIA 3E79A 2HHMA 2PFYA 2QPQA 4FBPA 5EQ9A 2QVVA 4HE2A 1FPBA 1SPIA 4MMPA 4MX6A 4N81A 1LBZA 1FPGA 1FPLA 4N17A 4N91A 4AS4A 2QFLA 5EQAA 5J1DA 1FBPA 2Q8MA 2Q74A 2CZIA 2CZKA 1FJ6A 1NV5A 4N4UA 1IMAA 4GWUA 1G0HA 4HCYA 4X04A 2B4LA 1NUWA 4GX3A 2GQ1A 1FJ9A 5ET5A 4HE1A 3RYDA 1Q9DA 3IFAA 2FHYA 4GBWA 4N8YA 3LV0A 1FTAA 3MSTA 4PETA 4PE3A 1CNQA 5EYHA 4HCWA 4I3EA 4PFIA 4P47A 3MYUA 2DE3A 4PGPA 5EYGA 4N6DA 5ET7A 1K9YA 1IMEA 1FBGA 2FIEA 4O7IA 4N6KA 1FPFA 4P9KA 4NG7A 1KZ8A 2V4CA 2WYKA 5EQ7A 1LBVA 4XEQA 4F1VA 5JK4A 3KBZA 2FVZA 3T1BA 1IMCA 3A29A 4PDDA 3T0JA 1LBYA 1FPKA 2WX9A 2XXKA 2XWOA 4HE0A 2Y5LA 4GWWA 1IMDA 1NUZA 4NN3A 4P3LA 1VDWA 5IM2A 4MIJA 4PBQA 5LDZA 2Q9TA 4GWYA 4YZZA 4X9TA 3W9VA 3HFUA 3RPLB 1FRPA 5ESYA 1FPJA 4MAGA 1FBDA 4PC9A 4X8RA 4NHBA 1NV2A 5CM6A 5FBPA 1RDXA 1DBZA 4GX6A 4NF0A 2VPNA 1G0IA 2DVZA 4M1VA 4O7MA 4P1LA 1LBWA 4NGUA 5I7IA 4MHFA 1LBXA 4OVQA 2VT5A 4XFEA 3RPLA 2OX3A 2XWVA 4MNPA 5EQ8A 2CEYA 3CHGA 2KR0A 3PTYA 3ROJA 1XI6A 1INPA 1NUYA 4GX4A 4OA4A 4P1EA 4PTKA 4DI3D 1FPEA 1BK4A 1IMBA 3EKIA 4IR8A 4MCOA 4MEVA 4HXVA 4MNIA 4LN5A 1FBEA 1JP4A 4OVTA 1D9QA 4PDHA 1NV0A 5DW8A 2PFZA 3U65A 2OWZA 1NUXA 3QMFA 5I3SA 3IFCA 4F18A 4NQ8A 4GWSA 2CEXA 4P8BA 4OVPA 2P3NA 2JJKA 1FBFA 3E78A 4QBAA 2F5XA 5ET8A 4AS5A 3SZPA 1EYKA 5I5PA 4G61A 2DE4A 2F3BA 4O8MA 1FSAA 4PCDA 2WYPA 4H46A 2QVUA 4MNCA 4PAIA 4P56A 4PF8A 1RDZA 3W9WA 4OVRA 1FPDA 2DDKA 1NV6A 4I3YA 4PAKA 3NOHA 4DI4B 2QVRA 4XF5A 2L5VA 4JVCA 5IZ3A 4NAPA 1EYIA 2P3VA 4N15A 5F24A 4I40A 1EYJA 2BJIA 2HXRA 2ZZXA 3FBPA 4O94A 2PCRA 1FBCA 1DCUA 2HZLA 1AWBA 4OVSA 5T3JA 1K9ZA 4OANA 2XWKA 4JVDA 2HZKA 1NI9A 4NX1A 1YZ0A 2DE2A 1DK4A 2WEFA 3D1RA 5IZZA 4PAFA 5IZ1A 3KC0A 5A5LA 2Y5KA 3ISPA 2XWIA 4QXDA 2WBDA 4PFRA 2ZZVA 2F3DA 1LEVA 2FIXA 2FBPA 2CZHA 1NV3A 2XA5A 1FBHA 5LTCA 1NV7A 3B8BA 4YICA 3BIHA 5IZ3B 4GWXA 4PBHA 1NV1A 1KA0A 2VPOA 3FXBA 3LUZA 4PGNA 3GYYA 4UABA 4F19A 5J16A 2R8TA 3KC1A 4N8GA 4F1UA 1QGXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PFB A;  2HPG A;  2ZZW A;  3B50 A;  4PF6 A;  5IGA A;  2PFY A;  4MMP A;  4MX6 A;  4N17 A;  4N91 A;  4N4U A;  4X04 A;  4PET A;  4PE3 A;  4N8Y A;  4PFI A;  4PGP A;  4P47 A;  4N6D A;  4N6K A;  4P9K A;  4NG7 A;  2WYK A;  2V4C A;  4XEQ A;  4PDD A;  2WX9 A;  2XXK A;  2XWO A;  4P3L A;  4NN3 A;  5IM2 A;  4MIJ A;  4PBQ A;  4YZZ A;  4MAG A;  4PC9 A;  4X8R A;  5CM6 A;  4NHB A;  4NF0 A;  4O7M A;  2VPN A;  4P1L A;  5I7I A;  4NGU A;  4MHF A;  4OVQ A;  4XFE A;  2XWV A;  4MNP A;  2CEY A;  4OA4 A;  4DI3 D;  4P1E A;  4MNI A;  4PGN A;  4MCO A;  4MEV A;  4OVT A;  4PDH A;  4LN5 A;  2PFZ A;  3U65 A;  4NQ8 A;  2CEX A;  4OVP A;  5I5P A;  4PCD A;  4O8M A;  2WYP A;  4MNC A;  4PAI A;  4P56 A;  4PF8 A;  4OVR A;  4PAK A;  4DI4 B;  4XF5 A;  4NAP A;  4N15 A;  2ZZX A;  4O94 A;  2HZL A;  4OVS A;  4OAN A;  2XWK A;  2HZK A;  4NX1 A;  5IZZ A;  4PAF A;  2XWI A;  4PFR A;  2ZZV A;  2XA5 A;  5LTC A;  4YIC A;  4PBH A;  2VPO A;  3FXB A;  3GYY A;  4UAB A;  4N8G A;  4P8B A; 
#chains in the Genus database with same CATH topology
 4H65 A;  4PFW A;  2DS9 A;  2QS4 A;  4HTG A;  1RDY A;  2I4C A;  2VP1 A;  2XXH A;  4LZ7 A;  4N81 A;  1FPG A;  4FEC A;  2V84 A;  3OSR A;  3SET A;  4ZEI A;  4N8Y A;  4PFI A;  1QUL A;  1EU8 A;  1LFG A;  4IGR A;  2RC8 A;  4N6K A;  1P1O A;  4ZE8 A;  1MDP 1;  4ZZE A;  1IMC A;  3K1N A;  5B70 A;  4U23 A;  4YU0 A;  2H25 A;  4LZ5 A;  5ESY A;  1FPJ A;  2XX8 A;  4F3S A;  4F29 A;  1DBZ A;  2DXY A;  5I7I A;  1FTM A;  1US4 A;  1PBP A;  3CHG A;  3PTY A;  1J1N A;  3KEI A;  4MCO A;  4PDH A;  3P7I A;  3U1O A;  1B3E A;  2Y7W A;  4O8M A;  3TCH A;  3FVG A;  4PAI A;  4ZED A;  5F7V A;  3K6W A;  2FYI A;  4I40 A;  4I1D A;  1QUI A;  4NF8 B;  4Z7E A;  5H8S A;  5IZ1 A;  2I48 A;  2Y5K A;  4THI A;  4OFO A;  3RTF B;  1JET A;  2A5T A;  3CFL A;  4ZE9 A;  3IK6 B;  2R9J A;  4QFN A;  2HCA A;  3OEK A;  1SW4 A;  3K1M A;  3R6U A;  1Z7M E;  1JVY A;  4OES A;  3VLU A;  5FTH A;  1FPB A;  1AOV A;  2AL4 A;  1PB7 A;  2ONK E;  1UTH B;  1B46 A;  1MDQ A;  1YPN A;  3V5A A;  4NTL A;  5ET5 A;  5L8D A;  3A09 A;  2F34 A;  1IUD A;  5EYH A;  3TCG A;  5EYG A;  1KWH A;  1R9Q A;  2Y7R A;  3R26 A;  3B6Q A;  1OVT A;  1EZO A;  1JEV A;  2WX9 A;  3MP8 A;  4NN3 A;  2E0S A;  4P0I A;  4GWY A;  1R6Z A;  4OYV A;  3T9X B;  4NHB A;  4H6D A;  4O7M A;  4OEN A;  4MHF A;  1LBX A;  3OO8 A;  4XFE A;  2KR0 A;  2X7Q A;  4IO2 A;  4Q0C A;  2H98 A;  4ONY A;  4PTK A;  4QHQ A;  4IR8 A;  3W9V A;  3OO6 A;  4XKQ A;  1I6A A;  2V3T A;  4NQ8 A;  2YPN A;  4MF3 A;  2UXA A;  1USY H;  4ESX A;  4YKJ A;  2F5X A;  3IB1 A;  4U21 A;  1US5 A;  4G61 A;  3O6I A;  1BKA A;  2DWI A;  3KG2 A;  5FTI A;  4KYS A;  4DI4 B;  1B4Z A;  4NAP A;  3MAM A;  4ISU A;  3T96 B;  2I4B A;  3VV5 A;  3CVG A;  3RPW A;  4G68 A;  3O97 A;  1Y4C A;  2Q2C A;  4H5G A;  5HM4 B;  5A5L A;  3TDJ A;  4LUB A;  4IO5 A;  2XX7 A;  2ZNT A;  3EHT A;  1JVX A;  5LTC A;  2Q2A A;  1NV7 A;  3L6G A;  3UN6 A;  4IO3 A;  2R8T A;  4IO7 A;  3O28 A;  1YXI A;  1O64 A;  2DOJ A;  1IMF A;  3CIJ A;  4KI0 E;  4I62 A;  1AH5 A;  1TT1 A;  4ZEF A;  4GBV A;  3T22 A;  4HE2 A;  4I8C A;  2I6E A;  4N91 A;  2QFL A;  2Q8M A;  4G2Z A;  5CMB A;  3RTW B;  4N4U A;  3RT8 A;  2Y7I A;  4HE1 A;  1FQA A;  4JBZ A;  1N7X A;  5IZ3 A;  2DE3 A;  4AB6 A;  4F2Q A;  1D3K A;  4P0G A;  3M8U A;  5H8H A;  4R6Y A;  5TPA A;  1LBV A;  3G3H A;  3FGS A;  2R71 A;  1LAH E;  3A29 A;  3UP9 A;  2YJP A;  1MPC A;  2F35 A;  3K2D A;  2O7U A;  2I0B A;  2A5T B;  1DSN A;  1RDX A;  4WED A;  4KYD A;  2VD3 A;  4JSD A;  2NWJ A;  2GH9 A;  1OQH A;  1H3D A;  1S50 A;  4DXB A;  1MPB A;  4Q5T A;  4ELO A;  3D4G A;  3KJT A;  1OVB A;  3VXC A;  1N04 A;  3HV1 A;  2DE4 A;  4LQ2 A;  4H46 A;  3HPI A;  2HAV A;  4QF9 A;  4OVR A;  3TUS A;  1SW2 A;  5I2N B;  3DP8 A;  3E3K A;  4LAT A;  1FBC A;  4OAN A;  3C31 A;  4C1U A;  2P1S A;  3FV2 A;  4XKP A;  2ZZV A;  5L9M A;  4KFQ A;  3C4M A;  4EQ7 A;  1NV1 A;  2UYE A;  4F2O A;  5AA1 A;  5I2N A;  2XHD A;  4IO6 A;  1MM7 A;  4F39 A;  1A99 A;  3K00 A;  2HHM A;  2KLF A;  4QRZ A;  4MH5 A;  1FPL A;  3MZB A;  3FAT A;  3RY3 A;  1EH3 A;  5KCJ B;  3N94 A;  1VE4 A;  2IA4 A;  2OK2 A;  5TU0 A;  3IAZ A;  4MLV A;  1NNP A;  2NUV A;  3QUF A;  1FTA A;  1FTK A;  3TYH A;  4YKI A;  1Y3P A;  3S9N C;  2B3F A;  3T0J A;  1FPK A;  4DXC A;  2PYY A;  3AXF A;  3B7D A;  3FAS A;  2OCU A;  3F11 A;  5ITO A;  1A8E A;  1DPE A;  4O3A A;  2QRY A;  5FBP A;  5AA4 B;  3DM0 A;  3MVW A;  4PFY A;  2XXR A;  2XD2 A;  1B3F A;  5ISU A;  4RPO A;  3ROJ A;  4LP2 B;  2RC9 A;  1BP5 A;  1UIU A;  4JWX A;  1D9Q A;  3ILU B;  2PFZ A;  4GWS A;  4OVP A;  1XC1 A;  3CFZ A;  4P11 A;  5CBS A;  4OZ9 A;  4GIZ A;  1FSA A;  4NMY A;  1T0K A;  2PBW A;  3TOD A;  2DDK A;  3CRB A;  4XF5 A;  3HHF A;  4N15 A;  4RNS A;  5I57 A;  4PE5 B;  1GR2 A;  5T3J A;  2HEU A;  3RT6 B;  1FTO A;  1SD3 A;  2HZK A;  2DE2 A;  4ELP A;  3K01 A;  3I6V A;  3PMX A;  3G3G A;  4ECF A;  4GWX A;  5K2X A;  1LBB A;  1NFT A;  4YKP A;  3GYY A;  4OEV A;  3KC1 A;  4X1B A;  1N76 A;  3BIG A;  4GWZ A;  1LGB C;  3KSJ A;  2IEE A;  3IO4 A;  1IXI A;  3B50 A;  3PUX E;  5DEX A;  4N07 A;  5H8N B;  1LBZ A;  3CI8 A;  1FBP A;  3B6W A;  1MY0 A;  1LBC A;  4R75 A;  4EF2 A;  2ZXT A;  2F78 A;  1MXV A;  4G68 B;  3LUY A;  1Y1Z A;  2PVU A;  2DWJ A;  3KFM A;  3U94 A;  4F1V A;  2F6G A;  3KBZ A;  3Q25 A;  3IX1 A;  4LA9 A;  1A40 A;  5DT6 A;  4PBQ A;  1LAF E;  2UVG A;  1YTV A;  3PUZ E;  1FRP A;  4JWY A;  1ANF A;  5L9S A;  1QW0 A;  1BLF A;  1NMU A;  4NF0 A;  4UAC A;  1PB8 A;  1LBW A;  1QKB A;  2XWV A;  5EQ8 A;  1GV8 A;  4OA4 A;  1NUY A;  1FTL A;  1FPE A;  4PGN A;  4G8M A;  3RLF E;  2RKM A;  3VVF A;  3UIF A;  1ZBM A;  1MQD A;  2FA7 A;  1EYK A;  4PCD A;  1MY3 A;  1Y9U A;  4GWO A;  4RK9 A;  2B3B A;  1FPD A;  1N7W A;  4PAK A;  3NOH A;  1B3L A;  1RYX A;  5I59 B;  4NF6 A;  1EYJ A;  2QMW A;  2XXV A;  4GOT A;  4NF4 B;  2AL5 A;  1DK4 A;  1TXF A;  3S9E A;  1RYO A;  2XXY A;  2PT1 A;  1B4H A;  5CRY A;  2Z8E A;  1WVJ A;  2F6P A;  3B8B A;  3CFX A;  2GHA A;  5I57 B;  1FCK A;  4P8B A;  2Z23 A;  3SEY A;  4PFU A;  1URD A;  2HPG A;  5TP9 A;  3QUJ A;  2KQZ A;  2Y84 A;  1Y3N A;  2MKZ A;  4KCC A;  4JDF A;  2B65 A;  1OIB A;  1DPP A;  3KOS A;  4HCY A;  1XOC A;  4MBP A;  3DLN A;  5AA2 A;  1FQE A;  3T1B A;  3M3K A;  4OXV A;  4OER A;  4R6K A;  2E1S A;  4WXJ A;  1B6H A;  1AL3 A;  2Z8D A;  3MQ9 A;  3MVX A;  1LBY A;  2HQ0 A;  1YCJ A;  4L17 A;  3TCF A;  4GWW A;  4P3L A;  1TFD A;  4OQO A;  4NF6 B;  3TPA A;  2XX9 A;  4U22 A;  2NVU B;  4IGT A;  3RPL B;  3OXN A;  3PPP A;  4QFK A;  4FEB A;  3H06 B;  3FXR A;  1RKM A;  2XXW A;  3O29 A;  4N13 A;  3HN0 A;  1B3H A;  2ESN A;  1XHY A;  1UTB A;  2JJK A;  3M3L A;  3E78 A;  4G77 A;  4AS5 A;  5I5P A;  1DMB A;  3VVD A;  4Q30 B;  3IOT A;  4OFL A;  5TPA B;  4ZDM A;  3WAF A;  1NV6 A;  2L5V A;  5IAI A;  5H8Q B;  3MW0 A;  4KR5 A;  1B9J A;  4KQP A;  2HZL A;  2O84 X;  2XXU A;  4FIM A;  1B40 A;  2ZYN A;  1TWY A;  3MPK A;  3RNN A;  1AMF A;  2PT2 A;  3Q27 A;  4C0R A;  1GGG A;  1FBH A;  3PUY E;  2FNC A;  2V93 A;  4KXP A;  5H8Q A;  4G8N A;  4FJP A;  3GZG A;  4TQU Q;  4OFJ A;  1II5 A;  1FPI A;  3D4C A;  1PB9 A;  5EQ9 A;  2QVV A;  1MRP A;  3C35 A;  1MXY A;  3TQL A;  4KHZ E;  2Q8J A;  1Z7N E;  2QS3 A;  2F7B A;  4HCW A;  4PGP A;  3H3G A;  2UVJ A;  2FIE A;  1B51 A;  4DCY A;  4GL8 A;  3FJ7 A;  1USY E;  2XWO A;  5TP9 B;  4NWD A;  1XVY A;  5ELV A;  2Y7P A;  2OJT A;  4TOZ A;  1CB6 A;  4X8R A;  3T66 A;  1S7Y A;  5I3S A;  4M1V A;  1AIV A;  4OVQ A;  1XI6 A;  3LSW A;  5HPQ A;  4JWO A;  3O2A A;  4O3C A;  3FXU A;  1IQ7 A;  3PGF A;  1FBF A;  2F97 A;  2I3V A;  3JZJ A;  3H4Z A;  2BJJ X;  3PUV E;  3K02 A;  2ABH A;  2F7A A;  4R74 A;  2F7C A;  4YKK A;  1LB8 A;  5CMC A;  4BDO A;  4YB6 A;  1YAE A;  3O9P A;  2OLB A;  3PV0 E;  2HXR A;  1MH3 A;  3FBP A;  3O6H A;  4OVS A;  1AWB A;  2REG A;  3Q28 A;  5DEX B;  2ONS A;  3D1R A;  5IZZ A;  1S9T A;  3G3I A;  1A55 A;  3KGC A;  2Q89 A;  1ATG A;  4PFT A;  2V3U A;  4YMA A;  4RPN A;  3MZ9 A;  2ZYM A;  2CMO A;  2D21 A;  3ODB A;  2GFE A;  3VDF A;  2B4M A;  2DWA A;  2D5W A;  3QYT A;  1YYZ A;  4H8J A;  1MY4 A;  2ZZW A;  2WBB A;  4JVI A;  3U8Q A;  4MMP A;  2HFB A;  4EQB A;  2QMX A;  3Q26 A;  3IL1 B;  1HSL A;  3B6T A;  2ZMB A;  1POT A;  5JTY A;  1Q35 A;  3LSL A;  1OLA A;  1OMP A;  3A3C A;  1O63 A;  3ZKK A;  3KN3 A;  1CE2 A;  4HE0 A;  3TFL A;  2Q9T A;  4X9T A;  2RCB A;  4NE4 A;  1MPD A;  3BKI B;  2VPN A;  4P1L A;  2VT5 A;  4XKN A;  1ZKB A;  1FQB A;  1INP A;  1B32 A;  1VFE A;  1FBE A;  4F3B A;  2DWH A;  1PBQ A;  5H8H B;  3FVO A;  4F18 A;  4PQJ A;  3WAE A;  2P3N A;  5FHO A;  3ZSF A;  4RXL A;  4F3P A;  1RDZ A;  2H99 A;  3R7X A;  1P99 A;  4JVC A;  5KCJ A;  4HW8 A;  3HO7 A;  2PCR A;  1R9L A;  1H45 A;  3U72 A;  3K6V A;  5CC2 A;  4PAF A;  4EXL A;  4F3G A;  2WBD A;  1LST A;  2OWT A;  3QK6 A;  3RGY A;  3VE1 B;  1EZP A;  4QSD A;  3OEL A;  3ILT B;  3E9X A;  3G3J A;  2PX1 A;  4U4X A;  1QGX A;  4BDL A;  1NV4 A;  3PU5 A;  4JSO A;  4NWC A;  3H6V A;  3ZS6 A;  1H43 A;  4KYE A;  4RA1 A;  4FE8 A;  3VVE A;  1DTZ A;  1GTK A;  1SI1 A;  3LC8 A;  2AIX A;  5HBC A;  4WEP A;  1DOT A;  3S9L C;  2DQV A;  5EHM A;  1B3G A;  4G4P A;  2B4L A;  2GQ1 A;  4OHN A;  5KZT A;  3FVK A;  1O7T A;  2FHY A;  2Y7K A;  4EQ9 A;  4I3E A;  3MYU A;  4N6D A;  3USD A;  3T93 B;  3K0V A;  2FVZ A;  1LB9 A;  4U2R A;  2Z8F A;  2ZNU A;  4GRK A;  4DLD A;  1MQG A;  1LCF A;  2DVZ A;  4XIG Q;  4X1D A;  4GX4 A;  3I3V A;  5ITP A;  4AB5 A;  4LN5 A;  4NF4 A;  1MM6 A;  1NKX A;  1OLC A;  1FQC A;  5ET8 A;  1MY2 A;  3K1P A;  2O7I A;  4PF8 A;  3RN8 A;  3SES A;  5I56 B;  3Q29 A;  3HCQ A;  1LLS A;  5AA3 A;  3GLB A;  4H5F A;  1A54 A;  1B7Z A;  4LZ8 A;  1FQF A;  4JVD A;  5L9O A;  2WEF A;  3KC0 A;  3TQW A;  4GFR A;  4GXA A;  2VHA A;  1QUK A;  1F9B A;  3C9H A;  5IZ3 B;  5I2K A;  3LUZ A;  2VPO A;  2ZNS A;  5AA2 B;  1MH4 A;  4F1U A;  2X26 A;  2DP8 A;  4BDR A;  3QSL A;  5F1Q A;  3T9U A;  1ZMG A;  4YB7 A;  2QPQ A;  4FBP A;  4O3B A;  4R2B A;  3CSG A;  3QIM A;  2UVH A;  3A3U A;  1ZU0 A;  2CZK A;  4LQ5 A;  5CMK A;  1VR5 A;  4XXU A;  5CBR A;  1FJ9 A;  3IFA A;  4GBW A;  2RF1 A;  1MG1 A;  3O66 A;  4H67 A;  2WYK A;  5JK4 A;  1B58 A;  3RQT A;  3DP4 A;  4GD5 A;  1D9V A;  3PPO A;  2O68 A;  1QVS A;  4ESW A;  4TLM B;  3VLW A;  1IIW A;  1M5F A;  1NV2 A;  3PPN A;  3SER A;  1A8F A;  2OX3 A;  3I5O A;  2CEY A;  1MXZ A;  4P1E A;  1IMB A;  1NNF A;  2OWZ A;  3QMF A;  3FXQ A;  4XTC Q;  1ZJL A;  5I59 A;  4G8H A;  3S2V A;  3W9W A;  4LON B;  2QVR A;  1ZTY A;  1EYI A;  4OTE A;  4QSC A;  4QFP A;  5H8F A;  1TFA A;  2Z22 A;  1URG A;  4O94 A;  1K9Z A;  1MXU A;  1NI9 A;  3C33 A;  1P1N A;  1B52 A;  1NL5 A;  3G3K A;  2FBP A;  4ZS9 A;  1Y4T A;  4MFI A;  3FXB A;  1B5H A;  2V3Q A;  5ET6 A;  3N6U A;  4F31 B;  4DIG A;  1MS7 A;  2O1L A;  4F22 A;  4MX6 A;  3IB2 A;  4MLQ A;  4Q8R A;  2D3I A;  5EQA A;  3C34 A;  3MP1 A;  4BLA A;  4GWU A;  4X04 A;  2DVC A;  2I3W A;  4GX3 A;  3U92 A;  3CG3 A;  3RYD A;  3C36 A;  3H6W A;  3LV0 A;  4JB7 A;  4ZEK A;  4EXK A;  1CNQ A;  5CMM A;  2CZL A;  3BBR A;  4N6P A;  3G3F A;  1KZ8 A;  3KBR A;  4XEQ A;  3H03 A;  3THI A;  4GXS B;  4MIJ A;  5H8F B;  4R9G A;  3FZV A;  4YAH X;  5A5X A;  3ECR A;  1ZIU A;  3CR9 A;  2VOZ A;  1XS5 A;  4GF8 A;  2ZYO A;  2F36 A;  3UGW A;  2I49 A;  4FED A;  4DI3 D;  2W7Y A;  3MJN A;  3EQ1 A;  4YB5 A;  1DTG A;  2M8C A;  3VLV A;  3OMB A;  3SZP A;  5DTB A;  5BWJ A;  2XD3 A;  5AE4 A;  4MNC A;  1PDA A;  2P0S A;  4OMB A;  2ZZX A;  2BJI A;  1VSO A;  5FHN A;  2H4I A;  2RCA A;  1YZ0 A;  1M5D A;  1Y3Q A;  3DP6 A;  3L6H A;  2LAO A;  3SKP A;  3MUQ A;  1LEV A;  1EZ9 A;  3IR1 A;  3EPE A;  1NV3 A;  3CG1 A;  3TTL A;  3DEL B;  3PMW A;  1H44 A;  3HST A;  4UAB A;  2QS1 A;  2RIN A;  1ZLQ A;  1URS A;  4MJO A;  4PFB A;  4K3F A;  2O51 A;  2ONR A;  4PF6 A;  1NV5 A;  4R73 A;  5I58 A;  5H8N A;  1SDX A;  4PET A;  3MST A;  4PE3 A;  1WDN A;  2DXR A;  1IXC A;  4IY5 A;  1LAX A;  1FBG A;  1MQI A;  4QSE A;  1FPF A;  3S9M C;  2H5Y A;  4EF1 A;  3PUW E;  4PDD A;  5FHM A;  2VD2 A;  3OD7 A;  1VDW A;  4PP0 A;  4ND9 A;  4U1O A;  3BFU A;  5I56 A;  3HFU A;  3VFJ A;  1PC3 A;  1UIV A;  2I58 A;  1JEU A;  3T9V A;  5I84 A;  1IZ1 A;  4MNP A;  2NOO A;  4AQ4 A;  1SW5 A;  3FJG A;  1JW1 A;  1IEJ A;  4DXU A;  2P2A A;  1NUX A;  3IFC A;  4DCX A;  3UK4 A;  4QBA A;  4G68 C;  1NNT A;  4ELR A;  5A5X B;  1LCT A;  1Y1M A;  1GVC A;  1LFI A;  3KSX A;  3CSB A;  4I3Y A;  1HSJ A;  3S4U A;  1L5T A;  2QS2 A;  3M3F A;  2P3V A;  4ZEC A;  2ZYK A;  1BIY A;  1DCU A;  3TZA A;  1M5C A;  3OSQ A;  4NX1 A;  2QJE A;  4H8I A;  2XWI A;  4GL0 A;  1MQJ A;  4PFR A;  4ZZA A;  4EDP A;  4PBH A;  1OQG A;  5LOM A;  4N8G A;  2I0C A;  3ZKL A;  2XXP A;  3PPR A;  1Q1K A;  4H0W A;  4E0W A;  2PFY A;  3K4U A;  2XXX A;  5J1D A;  1FW0 A;  3V8X B;  1JQF A;  2CZI A;  1FJ6 A;  4FAJ A;  1NUW A;  3HHG A;  3KN8 A;  1XVX A;  3FIR A;  4R6H A;  3MPL A;  3FD3 A;  4P47 A;  1IME A;  1M5E A;  3FVN A;  1FQD A;  4O7I A;  3KOT A;  5EQ7 A;  3C32 A;  3TKD A;  5DYH A;  5B7D A;  4NF5 A;  4NED A;  1NUZ A;  3IO6 A;  2WKY A;  4R2F A;  3H7M A;  4YZZ A;  5AA2 D;  4LVQ A;  2Q88 A;  5DVJ A;  4GX6 A;  4KCD A;  4NGU A;  1I6B A;  3RPL A;  2X7P A;  1LFH A;  4YMB A;  1UTH A;  1N84 A;  4MNI A;  1BK4 A;  3QAX A;  4OVT A;  1MXX A;  5ICQ A;  3TMG A;  3MWB A;  3U65 A;  2PMS A;  2OWS A;  4KD5 A;  1B0H A;  2QVU A;  2VGQ A;  2O6A A;  4P56 A;  2YLN A;  4WKM A;  4GQO A;  3KJ7 A;  3SEW A;  3KN7 A;  4DDD A;  3GXA A;  3IB0 A;  1N3X A;  4KPT A;  5CI5 A;  3LSF B;  4RY1 A;  2GHB A;  4IO4 A;  3UOR A;  2HAU A;  2CZH A;  3ONM A;  3TTK A;  4YIC A;  1Y20 A;  1NH8 A;  1IXG A;  3TAJ A;  5J16 A;  3V89 B;  2F8D A;  1SQY A;  1KA1 A;  1SVX B;  2O69 A;  2DSF A;  3EHU A;  4DZ1 A;  4AS4 A;  1B7U A;  3N5L A;  1ELJ A;  1R1N A;  4FOR A;  3UA8 A;  4JXI A;  1Q9D A;  2AYS A;  1UQW A;  3SEU A;  4R72 A;  5DVI A;  3JV9 A;  5JEI A;  3GBA A;  4RYA A;  4X48 A;  1B05 A;  4P9K A;  5M2V A;  1SBP A;  2XXK A;  3T9H B;  1NNK A;  4OEU A;  4U4S A;  5IM2 A;  3H6T A;  3SDF A;  3OO7 A;  1IIT A;  1FBD A;  3MVZ A;  5CM6 A;  5KDT A;  1G0I A;  1M5B A;  2G93 A;  3RUM A;  2O1M A;  3EF7 A;  3SEX A;  4MEV A;  4HXV A;  5I58 B;  2NXO A;  3OEN A;  5EYF A;  2CEX A;  4IY6 A;  5JTY B;  4R9F A;  3K6U A;  4QFO A;  3TTR A;  1MXW A;  4Z0I A;  3FV1 A;  4E0X A;  3LBS A;  2XXI A;  4IB2 A;  4OWD A;  2FIX A;  4POX A;  3H6U A;  4BDN A;  4ZEB A;  3K6X A;  1A7L A;  5BUU A;  3FJM A;  4F19 A;  2OBG A;  3TTN A;  5IKB A;  4RK2 A;  2QL3 A;  5EHS A;  3FUZ A;  3KZG A;  3LSX A;  5IGA A;  5LDZ A;  3E79 A;  3E4R A;  4N17 A;  4GVO A;  2Q74 A;  3MZ1 A;  1SYI A;  1IMA A;  2QSX A;  3BFT A;  1JW5 A;  5K2Y A;  4C1T A;  5I2K B;  1WOD A;  4EUO A;  5ET7 A;  1K9Y A;  5DVF A;  3MP6 A;  3N26 A;  4BDQ A;  4NG7 A;  1FTJ A;  4U1Z A;  4DE8 A;  3OO9 A;  3MC2 A;  1SI0 A;  2Y5L A;  1IMD A;  4QFL A;  2THI A;  3LR1 A;  4MAG A;  3IOR A;  4PC9 A;  1I69 A;  2UYF A;  2ANJ A;  1HSE A;  1B5J A;  2HXW A;  4M4G A;  3IOU A;  3IOV A;  1UTB B;  5AA4 A;  1MQH A;  1I6Q A;  3IJX B;  3QXM A;  5ICT A;  3U93 A;  1D4N A;  2XXT A;  2V25 A;  4POW A;  2UVI A;  1QUJ A;  4OVJ A;  1VFD A;  3SEV A;  3GBB A;  1B1X A;  4HS7 A;  1B1H A;  1PEB A;  1JW4 A;  5KDT B;  3PMV A;  4RJZ A;  1QKA A;  2XWK A;  3ISP A;  4QXD A;  2F3D A;  4BDM A;  2XA5 A;  3O6G A;  3BIH A;  3OOA A;  4FAT A;  1D9Y A;  2XXQ A;  1B7H A;  2GRV A;  4OET A;  4GLI A;  4H45 A;  4NF5 B;  3PD8 A;  1B2H A;  1SPI A;  4XKR A;  3W15 C;  3EHS A;  2ALU A;  1IXH A;  1G0H A;  3IOW A;  4UA8 A;  3N6T A;  3EN3 A;  3OEM A;  2OZZ A;  2V4C A;  3MVY A;  1NH7 A;  1SW1 A;  2DYX A;  1B5I A;  2A5S A;  1B0L A;  1JNF A;  1XT8 A;  2RC7 A;  4H1X A;  1SYH A;  1QJM A;  2G29 A;  3G7W A;  1N3W A;  3TEP A;  4NF8 A;  3V83 A;  1POY 1;  1BTJ A;  3EKI A;  3E13 X;  4F1Y A;  1JP4 A;  5DW8 A;  1NV0 A;  1LAG E;  2R6G E;  3MBP A;  3TTM A;  1MY1 A;  2REJ A;  2F3B A;  2WYP A;  3JYR A;  1H76 A;  5F24 A;  3TEL A;  3IJO B;  4ELQ A;  3VXB A;  4I9D A;  1P1U A;  3PPQ A;  4TLL B;  1N0T A;  1P1W A;  1KA0 A;  1P1Q A;  2H9B A;  3PD9 A; 
#chains in the Genus database with same CATH homology
 1NV4 A;  1YXI A;  4KXP A;  3BIG A;  1IMF A;  2V3Q A;  2B4M A;  4GWZ A;  4H45 A;  4MJO A;  4PFB A;  5ET6 A;  1YYZ A;  1KA1 A;  2HPG A;  1RDY A;  1FPI A;  2KQZ A;  4GBV A;  2ZZW A;  3B50 A;  2WBB A;  4PF6 A;  5IGA A;  2MKZ A;  4JVI A;  3E79 A;  2HHM A;  2PFY A;  2QPQ A;  4FBP A;  5EQ9 A;  2QVV A;  4HE2 A;  1FPB A;  1SPI A;  4MMP A;  4MX6 A;  4N81 A;  1LBZ A;  1FPG A;  1FPL A;  4N17 A;  4N91 A;  4AS4 A;  2QFL A;  5EQA A;  5J1D A;  1FBP A;  2Q8M A;  2Q74 A;  2CZI A;  2CZK A;  1FJ6 A;  1NV5 A;  4N4U A;  1IMA A;  4GWU A;  1G0H A;  4HCY A;  4X04 A;  2B4L A;  1NUW A;  4GX3 A;  2GQ1 A;  1FJ9 A;  5ET5 A;  4HE1 A;  3RYD A;  1Q9D A;  3IFA A;  2FHY A;  4GBW A;  4N8Y A;  3LV0 A;  1FTA A;  3MST A;  4PET A;  4PE3 A;  1CNQ A;  5EYH A;  4HCW A;  4I3E A;  4PFI A;  4P47 A;  3MYU A;  2DE3 A;  4PGP A;  5EYG A;  4N6D A;  5ET7 A;  1K9Y A;  1IME A;  1FBG A;  2FIE A;  4O7I A;  4N6K A;  1FPF A;  4P9K A;  4NG7 A;  1KZ8 A;  2V4C A;  2WYK A;  5EQ7 A;  1LBV A;  4XEQ A;  4F1V A;  5JK4 A;  3KBZ A;  2FVZ A;  3T1B A;  1IMC A;  3A29 A;  4PDD A;  3T0J A;  1LBY A;  1FPK A;  2WX9 A;  2XXK A;  2XWO A;  4HE0 A;  2Y5L A;  4GWW A;  1IMD A;  1NUZ A;  4NN3 A;  4P3L A;  1VDW A;  5IM2 A;  4MIJ A;  4PBQ A;  5LDZ A;  2Q9T A;  4GWY A;  4YZZ A;  4X9T A;  3W9V A;  3HFU A;  3RPL B;  1FRP A;  5ESY A;  1FPJ A;  4MAG A;  1FBD A;  4PC9 A;  4X8R A;  4NHB A;  1NV2 A;  5CM6 A;  5FBP A;  1RDX A;  1DBZ A;  4GX6 A;  4NF0 A;  2VPN A;  1G0I A;  2DVZ A;  4M1V A;  4O7M A;  4P1L A;  1LBW A;  4NGU A;  5I7I A;  4MHF A;  1LBX A;  4OVQ A;  2VT5 A;  4XFE A;  3RPL A;  2OX3 A;  2XWV A;  4MNP A;  5EQ8 A;  2CEY A;  3CHG A;  2KR0 A;  3PTY A;  3ROJ A;  1XI6 A;  1INP A;  1NUY A;  4GX4 A;  4OA4 A;  4P1E A;  4PTK A;  4DI3 D;  1FPE A;  1BK4 A;  1IMB A;  3EKI A;  4IR8 A;  4MCO A;  4MEV A;  4HXV A;  4MNI A;  4LN5 A;  1FBE A;  1JP4 A;  4OVT A;  1D9Q A;  4PDH A;  1NV0 A;  5DW8 A;  2PFZ A;  3U65 A;  2OWZ A;  1NUX A;  3QMF A;  5I3S A;  3IFC A;  4F18 A;  4NQ8 A;  4GWS A;  2CEX A;  4P8B A;  4OVP A;  2P3N A;  2JJK A;  1FBF A;  3E78 A;  4QBA A;  2F5X A;  5ET8 A;  4AS5 A;  3SZP A;  1EYK A;  5I5P A;  4G61 A;  2DE4 A;  2F3B A;  4O8M A;  1FSA A;  4PCD A;  2WYP A;  4H46 A;  2QVU A;  4MNC A;  4PAI A;  4P56 A;  4PF8 A;  1RDZ A;  3W9W A;  4OVR A;  1FPD A;  2DDK A;  1NV6 A;  4I3Y A;  4PAK A;  3NOH A;  4DI4 B;  2QVR A;  4XF5 A;  2L5V A;  4JVC A;  5IZ3 A;  4NAP A;  1EYI A;  2P3V A;  4N15 A;  5F24 A;  4I40 A;  1EYJ A;  2BJI A;  2HXR A;  2ZZX A;  3FBP A;  4O94 A;  2PCR A;  1FBC A;  1DCU A;  2HZL A;  1AWB A;  4OVS A;  5T3J A;  1K9Z A;  4OAN A;  2XWK A;  4JVD A;  2HZK A;  1NI9 A;  4NX1 A;  1YZ0 A;  2DE2 A;  1DK4 A;  2WEF A;  3D1R A;  5IZZ A;  4PAF A;  5IZ1 A;  3KC0 A;  5A5L A;  2Y5K A;  3ISP A;  2XWI A;  4QXD A;  2WBD A;  4PFR A;  2ZZV A;  2F3D A;  1LEV A;  2FIX A;  2FBP A;  2CZH A;  1NV3 A;  2XA5 A;  1FBH A;  5LTC A;  1NV7 A;  3B8B A;  4YIC A;  3BIH A;  5IZ3 B;  4GWX A;  4PBH A;  1NV1 A;  1KA0 A;  2VPO A;  3FXB A;  3LUZ A;  4PGN A;  3GYY A;  4UAB A;  4F19 A;  5J16 A;  2R8T A;  3KC1 A;  4N8G A;  4F1U A;  1QGX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...