4O7MA

Crystal structure of a trap periplasmic solute binding protein from shewanella loihica pv-4, target efi-510273, with bound l-malate
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
304
structure length
304
Chain Sequence
PTEIKFSHVVAENTPKGQMALKFKQLVEERLPGEYQVNVFPNSQLFGDNNELSALLLNDVQFVAPSLSKFERYTKKLQLFDLPFLFKDMDAVNRFQQSDAGQQLLNSMKRKGVVGLGYLHNGMKQFSASSPLVLPEDAQGKKFRIMASDVLAAQFQAVEAIPVKKPFSEVFTLLQTRAIDGQENTWSNIYSKKFYEVQSNITESNHGVLDYMVVTSNTFWKSLPADKRKVIKASLDEAIAYGNEIAAAKVNKDKQAIIDSKRSEVTYLTPEQRAAWVNAMKPVWAQFEDKIGKDLIDAAVASNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Experimental strategies for functional annotation and metabolism discovery: targeted screening of solute binding proteins and unbiased panning of metabolomes.
pubmed doi rcsb
source organism Shewanella loihica
molecule tags Transport protein
molecule keywords TRAP dicarboxylate transporter, DctP subunit
total genus 106
structure length 304
sequence length 304
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-12-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4o7mA00
2WYKA 4MEVA 4PGPA 4P47A 5I7IA 5LTCA 3B50A 4P56A 4N8GA 4NF0A 4P3LA 4P8BA 4PBHA 4NGUA 4PAIA 4PFBA 4MMPA 4X04A 4NN3A 4O7MA 4DI4B 4OANA 2ZZWA 4P9KA 4UABA 4N4UA 4P1LA 4NG7A 4MIJA 4PFIA 4PCDA 4MNIA 4N6KA 4MX6A 4PF6A 3GYYA 2CEXA 4N91A 2VPOA 4YICA 4NX1A 4PBQA 2WX9A 4MCOA 2CEYA 4MAGA 4PETA 4MNPA 2HZKA 2VPNA 4N15A 5IZZA 5IM2A 2ZZVA 3FXBA 2XWKA 2XA5A 4PAFA 4O94A 2XWVA 4YZZA 2WYPA 2HZLA 4OVSA 4OVPA 2XWIA 2XXKA 4O8MA 4PFRA 4PE3A 4X8RA 4PDHA 4N6DA 5I5PA 4PGNA 4LN5A 4MNCA 3U65A 2HPGA 4OVTA 4OVQA 4XEQA 4N17A 4XF5A 4NQ8A 2PFYA 4PC9A 4PF8A 4OVRA 4DI3D 2PFZA 4P1EA 4PAKA 2V4CA 2ZZXA 5IGAA 5CM6A 4XFEA 4NHBA 4PDDA 4MHFA 4OA4A 2XWOA 4NAPA 4N8YA
chains in the Genus database with same CATH superfamily
4GL8A 4NF6A 1NV6A 2DWJA 3K4UA 1PB7A 4TQUQ 2GHAA 1NUWA 1DPEA 1NNTA 5F7VA 1F9BA 1R9QA 1SW4A 3ZSFA 3EHUA 1SD3A 4NE4A 4ELRA 2YLNA 2WKYA 3RTFB 5FTIA 2RC9A 1B5JA 5KDTA 4OFOA 1LAXA 1WVJA 4I3EA 4DI4B 4OANA 3N6TA 4ELOA 4P1LA 2HQ0A 3LSWA 4N4UA 2AYSA 4NF8A 2KLFA 3PPRA 1IXHA 3IJOB 4LQ2A 3TKDA 2B65A 1SI0A 1MDQA 3PU5A 3TCGA 4PETA 3S9MC 4BDMA 1Y3QA 3D1RA 1B46A 1OLCA 2V25A 4LONB 3ECRA 2QS2A 3EHTA 1K9YA 3VVDA 3H6UA 2XXXA 1LEVA 3MYUA 4OHNA 4ZS9A 3MW0A 1TT1A 4KHZE 4GIZA 4DE8A 4RXLA 2XXVA 4WEDA 1CB6A 4PF8A 1S7YA 4AS4A 4IO2A 5IGAA 3MVWA 4OZ9A 1B4ZA 4TLMB 4Q0CA 1JW5A 1ZMGA 4NWCA 1N7WA 3PUVE 3W9VA 3B6QA 4IY6A 3KJ7A 1OQHA 1MY4A 2XWOA 4RJZA 3IAZA 1OQGA 4GWYA 4WXJA 4EDPA 3VLWA 1BLFA 1USYH 4ELQA 1MQHA 2ONKE 2M8CA 3KJTA 5I2NB 3KZGA 4Q8RA 3VFJA 4RPNA 3T93B 5CMCA 4GBWA 3IFAA 5AA3A 5F1QA 1N04A 1B0LA 1ZLQA 4OQOA 3SETA 1FQEA 1H43A 4OMBA 4IR8A 3PD9A 1DTZA 1ANFA 2F7CA 1DPPA 5ELVA 4RY1A 3ILUB 4U1OA 3TPAA 2Z8FA 4PFUA 4I3YA 2Q8MA 1FTKA 2F34A 1DBZA 3RT8A 2VPNA 3E4RA 1FQAA 1N84A 1O7TA 3E78A 2OCUA 4OYVA 3PV0E 2XWKA 2I0BA 4POXA 4DLDA 4JVIA 3Q26A 2D3IA 4AB5A 1ZJLA 5FHOA 3L6HA 4X8RA 2XWIA 3H6TA 3VV5A 1FPKA 2IA4A 3TTRA 3F11A 1LBYA 4XXUA 3U72A 1FBPA 4YU0A 4PE5B 3KN7A 3IOVA 3WAEA 3TMGA 4QRZA 4NQ8A 4XF5A 1B5HA 4DI3D 2IEEA 2DE4A 1IMFA 1B2HA 3K01A 3PPNA 5ET5A 1MH3A 1IITA 4G68A 3N5LA 3MC2A 1SYHA 2O68A 5DEXB 3IK6B 4JWOA 1TXFA 4P0IA 1FPGA 4HCWA 2Q88A 2PVUA 3B50A 3H3GA 1FBCA 4QF9A 2DVCA 1EYKA 2ALUA 4U2RA 1OVTA 2XXRA 4NF6B 3UGWA 4JSDA 4KR5A 3T9UA 3BBRA 2ZZWA 4IO3A 4LZ8A 1US4A 4THIA 3QSLA 4LQ5A 2UXAA 1B0HA 1URGA 4G8NA 4F1YA 3QIMA 1HSJA 4N91A 5EYGA 3KBZA 2XX7A 5TU0A 4G68B 3QAXA 2I6EA 4ZEDA 4E0XA 3LSFB 4LVQA 3N26A 2Q8JA 4GWZA 5A5LA 1J1NA 2OZZA 4GQOA 5CI5A 3CSBA 2Q89A 3TELA 3VXCA 3SDFA 1PBQA 2BJJX 4YZZA 1B3LA 1NNPA 4MLQA 3SEUA 3G3FA 5F24A 1UTHB 2QSXA 2F6PA 3K1NA 1NUZA 3SEXA 3HHFA 1Y9UA 1FJ9A 3EKIA 3HFUA 3K6VA 4JVCA 3T0JA 1DSNA 1A55A 2XD2A 3MZ1A 3HPIA 3TYHA 4NAPA 2E0SA 1P99A 2O51A 4RK9A 1MXXA 3G3GA 1R1NA 1NFTA 5I84A 2PBWA 3DP4A 2REGA 1ZBMA 4OXVA 3FZVA 2ZNSA 3U94A 2R6GE 2WBBA 2P0SA 2O84X 5H8QB 4PAIA 4XKRA 1LGBC 3FXQA 4JXIA 4QSDA 3OELA 4OEVA 5AA4B 1VFEA 2JJKA 3FJ7A 2VD2A 1MQIA 5HBCA 4R9FA 1US5A 3A29A 5CRYA 4E0WA 5ICTA 3I3VA 3O97A 1D9YA 1L5TA 3FIRA 2CMOA 1DTGA 4Q5TA 3GBBA 5IZ3A 4U21A 3RPWA 3ONMA 3PUZE 5ET8A 3PMVA 1ATGA 4KFQA 3IB0A 1MY0A 4HE0A 1QUJA 4O8MA 4GWSA 3R26A 2Y7KA 4IO6A 2HAVA 2Q9TA 1IEJA 2O69A 1SBPA 2R71A 4OVRA 4R72A 1QUIA 4NEDA 1IMCA 1URSA 1Y1MA 5H8HA 1LAHE 3VLUA 2XXHA 1IMDA 2BJIA 3THIA 2OLBA 4C0RA 1RYOA 2CZHA 3TUSA 1B58A 4YAHX 4ECFA 3LBSA 1B7UA 1QW0A 4ND9A 5ESYA 3O28A 3PGFA 2NOOA 4JSOA 3RY3A 4MH5A 3C9HA 4IGRA 4N8GA 3R7XA 1B05A 4NN3A 1DOTA 2H5YA 3PMXA 4O7MA 3S9EA 4P9KA 1HSLA 1LFHA 4N81A 4H65A 2F7AA 1MPBA 5DTBA 5CMKA 2GQ1A 3TQLA 1FBFA 5CBRA 4GX6A 1SDXA 4NX1A 2RF1A 5FHMA 4MAGA 1RKMA 2B4MA 4H67A 3T1BA 1NUXA 4NWDA 3RPLA 2HFBA 2O1MA 2XA5A 2NUVA 3EN3A 1KZ8A 4ZE8A 4R74A 1FPLA 1SI1A 4QSCA 1R9LA 2I0CA 3FVGA 3RYDA 2VP1A 3C31A 5CBSA 1SW5A 3ZKKA 4R9GA 1RDXA 1WDNA 5JK4A 2DWAA 4RPOA 3H7MA 4ELPA 3U65A 4UACA 2ABHA 2DSFA 4QFLA 3TAJA 2WBDA 1NI9A 5ET6A 5IZ1A 1GV8A 3MP1A 3VVEA 5J16A 2PFZA 5L8DA 2UVHA 3V5AA 1DCUA 1I69A 2ZNUA 1QULA 2FHYA 3RQTA 4PDDA 1MM6A 1PEBA 2NVUB 3C34A 4U1ZA 2THIA 4JVDA 5CC2A 2Y84A 4I1DA 3CG1A 2XHDA 4H6DA 4EXKA 4G4PA 3SEVA 3NOHA 2UVGA 3H6WA 2ONRA 2XX9A 4P47A 4HTGA 1NNFA 3IO4A 1JP4A 1FQBA 3B6TA 4KYSA 4P56A 1M5BA 5H8FB 4X04A 3ISPA 2F6GA 1JW1A 1LBCA 2HCAA 4XIGQ 4UABA 3UK4A 2QVUA 2HAUA 1OLAA 1XT8A 2CEXA 1SYIA 3VXBA 1AWBA 5CMBA 4AS5A 3K0VA 4H5FA 4RNSA 4BLAA 2RCBA 1JEVA 2F5XA 2ZYMA 4F1UA 5IZZA 1UIVA 4YB6A 4PP0A 4O94A 1IXIA 4ONYA 2RKMA 1CNQA 3RT6B 4JWXA 5KDTB 3QXMA 1NV4A 4OFJA 2QRYA 3GBAA 4N07A 2P2AA 1A8EA 1MQJA 1TFDA 1P1QA 1R6ZA 4O3AA 1AIVA 2QMWA 3O6GA 2DWIA 2KQZA 4O3CA 5H8FA 1CE2A 4EF1A 3MP6A 4WEPA 1SPIA 2PCRA 4LATA 1N0TA 3ROJA 3FXUA 4OA4A 4FE8A 4GWWA 3MAMA 2I48A 5TPAA 1FQDA 4EQ7A 3U92A 3Q28A 1Z7ME 2VGQA 4H46A 3KC0A 1INPA 2AIXA 4BDQA 1B1HA 1AL3A 3PPPA 1II5A 1MXVA 1WODA 1EH3A 3IOTA 4MFIA 3MQ9A 1VE4A 2VD3A 4DIGA 3LUZA 1NV7A 3UORA 3ODBA 3T9HB 1NV2A 2ZYNA 3OEKA 3FGSA 2XXTA 3MVXA 3CFLA 5DYHA 3LR1A 4MCOA 4NF4B 1EZ9A 3A09A 3MP8A 4F18A 1QKBA 2I58A 4ZEFA 1VDWA 1FBDA 1IMAA 4QFKA 4H0WA 3VLVA 3I5OA 3OOAA 3UP9A 4G77A 2HZLA 3OO8A 2DVZA 3PD8A 3FVNA 2Z8DA 3T9XB 2HPGA 1Q35A 1FTAA 4GOTA 4XEQA 1NUYA 3C4MA 1MXWA 1NL5A 4N17A 4PC9A 4F3GA 4QFNA 4PAKA 3TTNA 4OVJA 1B5IA 4OERA 1AH5A 3TTKA 3RTWB 4GXAA 3G3JA 1Y20A 3KN8A 3PUYE 1OVBA 1LFIA 1LBXA 3PMWA 1FQCA 3K6WA 4JBZA 4KD5A 3IB1A 2DOJA 2RC8A 4KQPA 3E79A 2YJPA 4R2BA 3U1OA 1FPBA 5EHSA 5I7IA 2VT5A 1QGXA 2ANJA 4NF0A 4NGUA 2YPNA 4BDLA 4X1DA 1HSEA 2PX1A 4NG7A 1LBWA 1UTBA 4PFIA 3IOUA 4YB5A 2Y7WA 4YMBA 4GWUA 4IY5A 1O63A 3K02A 1IMEA 4L17A 3ZKLA 4K3FA 1MPDA 5AA2D 3VE1B 1P1OA 5I56B 1XVYA 4RYAA 5IM2A 3JV9A 5L9MA 1B40A 3MVYA 2FIXA 4LP2B 4F29A 2Y7RA 4KCCA 5L9OA 5FBPA 3HO7A 5J1DA 1B6HA 5IZ3B 3KGCA 3DLNA 1ZKBA 2PMSA 1PB9A 3TFLA 4AQ4A 4DXBA 2GHBA 1VFDA 4ZDMA 4LN5A 3EQ1A 1G0HA 5FTHA 4FATA 3IOWA 1RYXA 2PFYA 3D4CA 4X48A 1MS7A 1BIYA 1LAGE 1JVYA 4OENA 2GFEA 4G2ZA 3QUFA 3KOSA 3UA8A 3W15C 1GTKA 4R2FA 1B3FA 4N13A 3O66A 1MXUA 3RUMA 4F19A 1H45A 4QFOA 2OWSA 4ZE9A 4BDOA 2I3WA 4JB7A 1P1UA 2F7BA 3FATA 4PGPA 2H25A 1FTLA 3C32A 5LTCA 4FBPA 5EQAA 1FCKA 1POY1 1H76A 4NF5A 1MXZA 1EZPA 4HE2A 4PFBA 4DCXA 4DZ1A 4G8HA 3TCFA 4IB2A 3KFMA 4MLVA 3BFTA 2Y5KA 2P3NA 4PFYA 1NV0A 3DP8A 5ITPA 1IZ1A 4ESWA 4ISUA 2NWJA 4KYEA 4DCYA 4XKPA 1MM7A 5DVJA 2H4IA 4X1BA 4GF8A 1NV3A 1FTOA 1B3EA 1BTJA 4YKKA 2ZZVA 5I2KB 1XS5A 4PAFA 1LB8A 1FPFA 4GXSB 2WYPA 2W7YA 3CFZA 4F39A 3OENA 2XXWA 4NF8B 3DP6A 4QSEA 1N3XA 4PTKA 4HS7A 2Y7IA 4MNCA 4DDDA 3P7IA 4I62A 1JNFA 3H03A 5IKBA 4NF5B 4U4XA 4TOZA 3IX1A 3LSXA 3KC1A 3KSJA 3PTYA 1MRPA 4LZ5A 3CI8A 4NHBA 1N3WA 3PPQA 3FBPA 4MHFA 2RC7A 4GVOA 4P3LA 1FRPA 2O1LA 4N8YA 4R6KA 1YYZA 3LC8A 3PPOA 3Q25A 3FJGA 4OESA 4MEVA 1YZ0A 3CR9A 2DXYA 3MSTA 4MMPA 3B6WA 5B70A 4ZEIA 2OWZA 2CZLA 3TZAA 3MPKA 4MNIA 2DDKA 5H8HB 2A5TA 5I57B 4NMYA 1FPJA 4HE1A 3EF7A 3E9XA 3C35A 3KBRA 3QYTA 1SW2A 2V93A 1MY3A 3PUWE 4KXPA 1MG1A 2FYIA 2F8DA 4F2OA 1GVCA 1TWYA 5A5XA 3K1MA 1B4HA 2KR0A 3EHSA 4FJPA 3OXNA 1OMPA 4IGTA 5BWJA 1AMFA 3RNNA 2XXKA 1LFGA 3EPEA 3CRBA 5KCJB 3IR1A 1Y1ZA 4N6PA 4OVTA 3IB2A 4R6YA 2G93A 5AA2A 1B52A 2ZYOA 2F97A 4U22A 3E3KA 4XFEA 2X7QA 3V8XB 1ZIUA 4PQJA 4G68C 1QJMA 3K1PA 1IMBA 5KCJA 3MZBA 1EU8A 4ZZEA 3FXRA 3MBPA 5JEIA 2V84A 1YPNA 5EQ9A 1LSTA 2F3DA 5B7DA 3L6GA 2B3FA 5BUUA 2L5VA 1Y3PA 2UYFA 3FASA 2DS9A 1SQYA 3OD7A 4XTCQ 1UQWA 4JDFA 1KA1A 4R6HA 4Q30B 3GZGA 1UTBB 5AE4A 4MX6A 4XKNA 1IXCA 4DXCA 5AA2B 1TFAA 4YICA 3OO7A 2FIEA 3QK6A 5I2KA 1FTJA 4YKPA 2H98A 2XXIA 1LB9A 5I59B 1QKAA 4G8MA 1LBVA 3MPLA 4PFRA 1KA0A 1N7XA 2LAOA 4FEBA 1B7HA 4H1XA 4OETA 2QPQA 3N94A 4F3BA 4F3PA 2D21A 2QVRA 1Q9DA 1SVXB 1M5EA 4C1UA 2F36A 3RLFE 4LA9A 2V4CA 2ZZXA 3U8QA 2UVIA 3E13X 2B4LA 5CM6A 1I6QA 1D9VA 4POWA 2DYXA 3FVOA 4OEUA 3B7DA 5I56A 3H6VA 2QS1A 4EXLA 2PYYA 1JW4A 2Z23A 3HSTA 1RDZA 1D9QA 1GR2A 4PFWA 1EYIA 1SW1A 2X26A 5I57A 2ZNTA 1A40A 4I9DA 3DELB 4PBHA 1MH4A 4KI0E 3KG2A 4DXUA 3OSRA 3IO6A 1K9ZA 3M3FA 3K6UA 2ZYKA 2B3BA 5I58B 1PB8A 1FTMA 3T9VA 5DVFA 1FQFA 2MKZA 3C33A 3GYYA 3CFXA 2VPOA 5DVIA 2GRVA 3TODA 2OBGA 5LDZA 2WX9A 3FJMA 1Q1KA 1NKXA 1EZOA 4MNPA 3TTLA 3IJXB 3RN8A 3S4UA 3SESA 3QMFA 3FXBA 1M5DA 3BIHA 3FUZA 5M2VA 3C36A 1NH7A 1ZU0A 5JTYB 2QJEA 2QL3A 1Y3NA 1D4NA 2I4BA 4EUOA 5A5XB 4KPTA 1PBPA 3HCQA 3KSXA 3SERA 1LAFE 1GGGA 4X9TA 4GRKA 2ZXTA 4P11A 4EQBA 3MZ9A 3GXAA 1UTHA 2UYEA 4F2QA 4GL0A 1Y4CA 2XD3A 3I6VA 1OIBA 3T66A 1BK4A 4FEDA 2OX3A 2XXUA 5JTYA 3SKPA 3KOTA 5EYFA 4GFRA 2UVJA 3VDFA 1S50A 5DW8A 5H8SA 3TDJA 2O7IA 3T22A 4PFTA 5T3JA 3O6HA 2OK2A 3DM0A 1KWHA 2AL4A 1NMUA 1H3DA 2F3BA 3CIJA 2GH9A 1ELJA 2XX8A 4QHQA 3CVGA 4F22A 3OO6A 3A3CA 1VSOA 4ZZAA 1FSAA 3G3KA 4HXVA 4KCDA 1FPIA 4LUBA 2XXPA 4N6KA 3K2DA 3CG3A 4GWOA 1QVSA 1NNKA 3SEWA 4UA8A 4OTEA 3RGYA 5K2XA 5AA4A 3OMBA 2OJTA 2F78A 2RINA 1JVXA 2QMXA 3H4ZA 1D3KA 4FORA 5KZTA 4EQ9A 1M5FA 3MJNA 4PE3A 1YAEA 2DP8A 2REJA 3SZPA 2Y5LA 4XKQA 2VOZA 3VVFA 3G7WA 2I49A 3FV1A 2P3VA 3KEIA 2CZKA 2PT2A 1B9JA 5EQ8A 1O64A 2Q2CA 2HEUA 3O29A 4Z0IA 4R75A 5HPQA 4QXDA 1MQGA 3BIGA 1I6BA 3CHGA 4FAJA 1B7ZA 2Z22A 4QFPA 3R6UA 3QUJA 4BDNA 2WYKA 2O7UA 4IO5A 4M1VA 5TP9B 5LOMA 1LBBA 2RCAA 4NF4A 3FVKA 2Z8EA 3U93A 1LCFA 4PCDA 1BP5A 4IO7A 4FECA 4Z7EA 1FBGA 3A3UA 2OWTA 1FBEA 3MUQA 2VHAA 1IIWA 3O9PA 4R73A 4O7IA 4FIMA 2DWHA 3HV1A 4YKIA 3MVZA 1ZTYA 3JYRA 4BDRA 1MY2A 4NTLA 1FPEA 3UIFA 5HM4B 1T0KA 1G0IA 4OVSA 1RDYA 5DEXA 4OVPA 4PDHA 2DE2A 3TTMA 3S9LC 4KYDA 2X7PA 4I40A 4OVQA 4ZEBA 4U23A 5FHNA 4TLLB 4H45A 4P0GA 1MXYA 5L9SA 1POTA 1XI6A 1XHYA 2FNCA 5DT6A 1PC3A 3LSLA 5H8QA 3OSQA 2R9JA 1MPCA 3O2AA 2WEFA 3M3LA 1P1NA 1B3HA 1URDA 4F1VA 2P1SA 3V89B 4ZECA 1LLSA 4AB6A 1Y4TA 1XC1A 5ITOA 2HHMA 2Q74A 3TQWA 5AA1A 4YB7A 2NXOA 2O6AA 1MQDA 4MF3A 1NV1A 3HHGA 1USYE 2R8TA 4O3BA 2A5SA 4MIJA 5EHMA 3CSGA 4H8JA 1XVXA 3B8BA 1B32A 1S9TA 1IQ7A 3USDA 2HXRA 5I2NA 2V3UA 4GLIA 3AXFA 2HZKA 2ESNA 3KN3A 4QBAA 4RA1A 3LUYA 2A5TB 3WAFA 4U4SA 1BKAA 1A8FA 1H44A 3RPLB 1FW0A 1NH8A 2ONSA 1YCJA 2XWVA 4H8IA 1M5CA 4GX4A 3V83A 3IFCA 3IL1B 1MDP1 3OEMA 4F31B 5CMMA 4JWYA 4GBVA 5I5PA 1NV5A 5H8NB 2QS3A 3ILTB 4OFLA 1JEUA 4G61A 4YKJA 1P1WA 2E1SA 4GD5A 4WKMA 3FD3A 3O6IA 5TP9A 1QUKA 4IO4A 1IXGA 1PDAA 5ICQA 2QFLA 4F3SA 3H06B 3T96B 1AOVA 1FPDA 3G3IA 1Z7NE 1JQFA 4C1TA 1DMBA 2CZIA 2V3QA 2D5WA 3N6UA 2H9BA 3M3KA 3FV2A 3UN6A 1A99A 4LZ7A 4M4GA 3W9WA 5I59A 1MY1A 3D4GA 4MBPA 1YXIA 2DXRA 1N76A 3BFUA 1JETA 4P8BA 5TPAB 4EF2A 2FVZA 3BKIB 2QVVA 5EQ7A 3K6XA 1A54A 1IUDA 1VR5A 2XXQA 1DK4A 1EYJA 4HCYA 4ZEKA 1B3GA 4PF6A 3TEPA 5I3SA 3LV0A 4RK2A 3S9NC 4GWXA 2I4CA 3PUXE 5H8NA 3IORA 5ISUA 3ZS6A 4PBQA 3TCHA 2XXYA 2CEYA 2FA7A 2Q2AA 4HW8A 4N15A 3SEYA 1YTVA 2FBPA 3MWBA 1I6AA 2G29A 4H5GA 4I8CA 2QS4A 4GX3A 1UIUA 3M8UA 2HXWA 5ET7A 2ZMBA 2PT1A 4YMAA 3G3HA 2AL5A 3GLBA 4N6DA 2DE3A 4MJOA 4PGNA 3HN0A 1B51A 3OO9A 1LCTA 3K00A 3JZJA 1LBZA 3Q29A 3S2VA 5I58A 4P1EA 4OWDA 1XOCA 3Q27A 5K2YA 1FJ6A 4ESXA 2F35A 2DQVA 2H99A 5IAIA 2Y7PA 1FBHA 5EYHA 1A7LA 1B1XA 2V3TA 2I3VA
chains in the Genus database with same CATH topology
3CHGA 4F19A 2CZHA 1LBXA 1YYZA 2CZIA 2V3QA 1IMBA 1NV6A 4F1VA 5DW8A 2WYKA 1NUWA 4M1VA 1RDZA 1FPGA 4PFRA 1D9QA 4HCWA 3NOHA 3E79A 3W9WA 1EYIA 1FPBA 4H46A 3KC0A 1INPA 1YXIA 4MEVA 4PGPA 5EQ9A 5T3JA 5ESYA 2F3DA 1YZ0A 4P47A 5I7IA 5LTCA 4FBPA 5EQAA 2HHMA 2Q74A 1JP4A 2VT5A 3B50A 4P56A 1QGXA 2WBBA 1FBCA 3IFAA 4GBWA 4N8GA 4NF0A 1EYKA 4P3LA 2FVZA 4P8BA 4PBHA 2L5VA 4NGUA 4HE2A 3MSTA 2F3BA 4PAIA 4PFBA 2QVVA 5EQ7A 4MMPA 4X04A 4I3EA 1K9ZA 3ISPA 4NN3A 4O7MA 4DI4B 4OANA 2OWZA 4IR8A 1NV1A 2ZZWA 1DK4A 1EYJA 4X8RA 1FSAA 1KA1A 2R8TA 4P9KA 2Y5KA 4N4UA 4P1LA 4UABA 2P3NA 1LBWA 2QVUA 4MIJA 4HCYA 4HXVA 4N81A 2MKZA 1NV0A 1FPIA 4MNIA 4N6KA 4PCDA 2DDKA 3B8BA 3LUZA 4MX6A 1NV7A 4PFIA 4PF6A 2JJKA 1FBGA 3GYYA 2CEXA 2GQ1A 4N91A 1FBFA 5I3SA 3LV0A 1FBEA 1FPJA 2VPOA 1NV2A 1AWBA 2HXRA 4GWXA 4GWUA 4GX6A 4HE1A 5EYGA 4YICA 3A29A 1IMEA 3KBZA 4I3YA 2Q8MA 5LDZA 4NX1A 4PBQA 4AS5A 2FIEA 2WX9A 4MCOA 2CEYA 1NV3A 1DBZA 4MAGA 4PETA 4MNPA 2HZKA 4QBAA 2F5XA 2VPNA 4KXPA 2B4MA 3T1BA 1NUXA 4N15A 4O7IA 4F1UA 4GWZA 4F18A 5IZZA 2FBPA 5IZ3A 5A5LA 1VDWA 1FBDA 3QMFA 5IM2A 2ZZVA 3E78A 3FXBA 3RPLA 3D1RA 2XWKA 1IMAA 5ET8A 2XA5A 4PAFA 3BIHA 4JVIA 4O94A 1KZ8A 2FIXA 2KR0A 1FPFA 1FPEA 1FPLA 2XWVA 4YZZA 4GX4A 3RPLB 5FBPA 5J1DA 2WYPA 1CNQA 2HZLA 5IZ3B 1G0IA 3IFCA 1K9YA 1LBVA 1RDYA 4GX3A 4OVSA 2DVZA 3RYDA 4HE0A 4OVPA 2XWIA 2XXKA 4O8MA 1KA0A 1NV4A 1LEVA 4PE3A 4GWSA 1FPKA 1RDXA 4PDHA 5ET7A 5JK4A 2DE2A 4GBVA 3MYUA 3SZPA 4N6DA 5I5PA 1LBYA 2DE3A 1NV5A 4MJOA 4PGNA 2QPQA 2Y5LA 4PTKA 5F24A 1FBPA 4LN5A 4N8YA 4MNCA 3U65A 1G0HA 2HPGA 4I40A 4NG7A 4OVTA 4X9TA 1FTAA 2Q9TA 4OVQA 4XEQA 1NUYA 2WBDA 2QVRA 4G61A 5IGAA 1Q9DA 1NUZA 4H45A 1NI9A 4N17A 4NQ8A 4XF5A 1LBZA 2PFYA 4PC9A 5ET6A 5IZ1A 4PF8A 4OVRA 5J16A 4DI3D 2PFZA 4AS4A 4P1EA 1XI6A 4PAKA 2DE4A 1IMCA 1IMFA 2V4CA 2P3VA 1FJ9A 2ZZXA 3KC1A 1DCUA 3PTYA 1FJ6A 3EKIA 3HFUA 2KQZA 4JVCA 5ET5A 3T0JA 2B4LA 2CZKA 5CM6A 4XFEA 5EQ8A 1SPIA 2FHYA 2PCRA 1IMDA 4NHBA 2BJIA 4PDDA 2QFLA 3W9VA 4QXDA 3ROJA 1FBHA 1FPDA 4JVDA 1BK4A 3FBPA 4MHFA 2WEFA 4OA4A 5EYHA 2OX3A 2XWOA 4NAPA 4GWWA 4GWYA 1FRPA 3BIGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WYK A;  4MEV A;  4PGP A;  4P47 A;  5I7I A;  5LTC A;  3B50 A;  4P56 A;  4N8G A;  4NF0 A;  4P3L A;  4P8B A;  4PBH A;  4NGU A;  4PAI A;  4PFB A;  4MMP A;  4X04 A;  4NN3 A;  4O7M A;  4DI4 B;  4OAN A;  2ZZW A;  4P9K A;  4UAB A;  4N4U A;  4P1L A;  4NG7 A;  4MIJ A;  4PFI A;  4PCD A;  4MNI A;  4N6K A;  4MX6 A;  4PF6 A;  3GYY A;  2CEX A;  4N91 A;  2VPO A;  4YIC A;  4NX1 A;  4PBQ A;  2WX9 A;  4MCO A;  2CEY A;  4MAG A;  4PET A;  4MNP A;  2HZK A;  2VPN A;  4N15 A;  5IZZ A;  5IM2 A;  2ZZV A;  3FXB A;  2XWK A;  2XA5 A;  4PAF A;  4O94 A;  2XWV A;  4YZZ A;  2WYP A;  2HZL A;  4OVS A;  4OVP A;  2XWI A;  2XXK A;  4O8M A;  4PFR A;  4PE3 A;  4X8R A;  4PDH A;  4N6D A;  5I5P A;  4PGN A;  4LN5 A;  4MNC A;  3U65 A;  2HPG A;  4OVT A;  4OVQ A;  4XEQ A;  4N17 A;  4XF5 A;  4NQ8 A;  2PFY A;  4PC9 A;  4PF8 A;  4OVR A;  4DI3 D;  2PFZ A;  4P1E A;  4PAK A;  2V4C A;  2ZZX A;  5IGA A;  5CM6 A;  4XFE A;  4NHB A;  4PDD A;  4MHF A;  4OA4 A;  2XWO A;  4NAP A;  4N8Y A; 
#chains in the Genus database with same CATH topology
 4GL8 A;  4NF6 A;  1NV6 A;  2DWJ A;  3K4U A;  1PB7 A;  4TQU Q;  2GHA A;  1NUW A;  1DPE A;  1NNT A;  5F7V A;  1F9B A;  1R9Q A;  1SW4 A;  3ZSF A;  3EHU A;  1SD3 A;  4NE4 A;  4ELR A;  2YLN A;  2WKY A;  3RTF B;  5FTI A;  2RC9 A;  1B5J A;  5KDT A;  4OFO A;  1LAX A;  1WVJ A;  4I3E A;  4DI4 B;  4OAN A;  3N6T A;  4ELO A;  4P1L A;  2HQ0 A;  3LSW A;  4N4U A;  2AYS A;  4NF8 A;  2KLF A;  3PPR A;  1IXH A;  3IJO B;  4LQ2 A;  3TKD A;  2B65 A;  1SI0 A;  1MDQ A;  3PU5 A;  3TCG A;  4PET A;  3S9M C;  4BDM A;  1Y3Q A;  3D1R A;  1B46 A;  1OLC A;  2V25 A;  4LON B;  3ECR A;  2QS2 A;  3EHT A;  1K9Y A;  3VVD A;  3H6U A;  2XXX A;  1LEV A;  3MYU A;  4OHN A;  4ZS9 A;  3MW0 A;  1TT1 A;  4KHZ E;  4GIZ A;  4DE8 A;  4RXL A;  2XXV A;  4WED A;  1CB6 A;  4PF8 A;  1S7Y A;  4AS4 A;  4IO2 A;  5IGA A;  3MVW A;  4OZ9 A;  1B4Z A;  4TLM B;  4Q0C A;  1JW5 A;  1ZMG A;  4NWC A;  1N7W A;  3PUV E;  3W9V A;  3B6Q A;  4IY6 A;  3KJ7 A;  1OQH A;  1MY4 A;  2XWO A;  4RJZ A;  3IAZ A;  1OQG A;  4GWY A;  4WXJ A;  4EDP A;  3VLW A;  1BLF A;  1USY H;  4ELQ A;  1MQH A;  2ONK E;  2M8C A;  3KJT A;  5I2N B;  3KZG A;  4Q8R A;  3VFJ A;  4RPN A;  3T93 B;  5CMC A;  4GBW A;  3IFA A;  5AA3 A;  5F1Q A;  1N04 A;  1B0L A;  1ZLQ A;  4OQO A;  3SET A;  1FQE A;  1H43 A;  4OMB A;  4IR8 A;  3PD9 A;  1DTZ A;  1ANF A;  2F7C A;  1DPP A;  5ELV A;  4RY1 A;  3ILU B;  4U1O A;  3TPA A;  2Z8F A;  4PFU A;  4I3Y A;  2Q8M A;  1FTK A;  2F34 A;  1DBZ A;  3RT8 A;  2VPN A;  3E4R A;  1FQA A;  1N84 A;  1O7T A;  3E78 A;  2OCU A;  4OYV A;  3PV0 E;  2XWK A;  2I0B A;  4POX A;  4DLD A;  4JVI A;  3Q26 A;  2D3I A;  4AB5 A;  1ZJL A;  5FHO A;  3L6H A;  4X8R A;  2XWI A;  3H6T A;  3VV5 A;  1FPK A;  2IA4 A;  3TTR A;  3F11 A;  1LBY A;  4XXU A;  3U72 A;  1FBP A;  4YU0 A;  4PE5 B;  3KN7 A;  3IOV A;  3WAE A;  3TMG A;  4QRZ A;  4NQ8 A;  4XF5 A;  1B5H A;  4DI3 D;  2IEE A;  2DE4 A;  1IMF A;  1B2H A;  3K01 A;  3PPN A;  5ET5 A;  1MH3 A;  1IIT A;  4G68 A;  3N5L A;  3MC2 A;  1SYH A;  2O68 A;  5DEX B;  3IK6 B;  4JWO A;  1TXF A;  4P0I A;  1FPG A;  4HCW A;  2Q88 A;  2PVU A;  3B50 A;  3H3G A;  1FBC A;  4QF9 A;  2DVC A;  1EYK A;  2ALU A;  4U2R A;  1OVT A;  2XXR A;  4NF6 B;  3UGW A;  4JSD A;  4KR5 A;  3T9U A;  3BBR A;  2ZZW A;  4IO3 A;  4LZ8 A;  1US4 A;  4THI A;  3QSL A;  4LQ5 A;  2UXA A;  1B0H A;  1URG A;  4G8N A;  4F1Y A;  3QIM A;  1HSJ A;  4N91 A;  5EYG A;  3KBZ A;  2XX7 A;  5TU0 A;  4G68 B;  3QAX A;  2I6E A;  4ZED A;  4E0X A;  3LSF B;  4LVQ A;  3N26 A;  2Q8J A;  4GWZ A;  5A5L A;  1J1N A;  2OZZ A;  4GQO A;  5CI5 A;  3CSB A;  2Q89 A;  3TEL A;  3VXC A;  3SDF A;  1PBQ A;  2BJJ X;  4YZZ A;  1B3L A;  1NNP A;  4MLQ A;  3SEU A;  3G3F A;  5F24 A;  1UTH B;  2QSX A;  2F6P A;  3K1N A;  1NUZ A;  3SEX A;  3HHF A;  1Y9U A;  1FJ9 A;  3EKI A;  3HFU A;  3K6V A;  4JVC A;  3T0J A;  1DSN A;  1A55 A;  2XD2 A;  3MZ1 A;  3HPI A;  3TYH A;  4NAP A;  2E0S A;  1P99 A;  2O51 A;  4RK9 A;  1MXX A;  3G3G A;  1R1N A;  1NFT A;  5I84 A;  2PBW A;  3DP4 A;  2REG A;  1ZBM A;  4OXV A;  3FZV A;  2ZNS A;  3U94 A;  2R6G E;  2WBB A;  2P0S A;  2O84 X;  5H8Q B;  4PAI A;  4XKR A;  1LGB C;  3FXQ A;  4JXI A;  4QSD A;  3OEL A;  4OEV A;  5AA4 B;  1VFE A;  2JJK A;  3FJ7 A;  2VD2 A;  1MQI A;  5HBC A;  4R9F A;  1US5 A;  3A29 A;  5CRY A;  4E0W A;  5ICT A;  3I3V A;  3O97 A;  1D9Y A;  1L5T A;  3FIR A;  2CMO A;  1DTG A;  4Q5T A;  3GBB A;  5IZ3 A;  4U21 A;  3RPW A;  3ONM A;  3PUZ E;  5ET8 A;  3PMV A;  1ATG A;  4KFQ A;  3IB0 A;  1MY0 A;  4HE0 A;  1QUJ A;  4O8M A;  4GWS A;  3R26 A;  2Y7K A;  4IO6 A;  2HAV A;  2Q9T A;  1IEJ A;  2O69 A;  1SBP A;  2R71 A;  4OVR A;  4R72 A;  1QUI A;  4NED A;  1IMC A;  1URS A;  1Y1M A;  5H8H A;  1LAH E;  3VLU A;  2XXH A;  1IMD A;  2BJI A;  3THI A;  2OLB A;  4C0R A;  1RYO A;  2CZH A;  3TUS A;  1B58 A;  4YAH X;  4ECF A;  3LBS A;  1B7U A;  1QW0 A;  4ND9 A;  5ESY A;  3O28 A;  3PGF A;  2NOO A;  4JSO A;  3RY3 A;  4MH5 A;  3C9H A;  4IGR A;  4N8G A;  3R7X A;  1B05 A;  4NN3 A;  1DOT A;  2H5Y A;  3PMX A;  4O7M A;  3S9E A;  4P9K A;  1HSL A;  1LFH A;  4N81 A;  4H65 A;  2F7A A;  1MPB A;  5DTB A;  5CMK A;  2GQ1 A;  3TQL A;  1FBF A;  5CBR A;  4GX6 A;  1SDX A;  4NX1 A;  2RF1 A;  5FHM A;  4MAG A;  1RKM A;  2B4M A;  4H67 A;  3T1B A;  1NUX A;  4NWD A;  3RPL A;  2HFB A;  2O1M A;  2XA5 A;  2NUV A;  3EN3 A;  1KZ8 A;  4ZE8 A;  4R74 A;  1FPL A;  1SI1 A;  4QSC A;  1R9L A;  2I0C A;  3FVG A;  3RYD A;  2VP1 A;  3C31 A;  5CBS A;  1SW5 A;  3ZKK A;  4R9G A;  1RDX A;  1WDN A;  5JK4 A;  2DWA A;  4RPO A;  3H7M A;  4ELP A;  3U65 A;  4UAC A;  2ABH A;  2DSF A;  4QFL A;  3TAJ A;  2WBD A;  1NI9 A;  5ET6 A;  5IZ1 A;  1GV8 A;  3MP1 A;  3VVE A;  5J16 A;  2PFZ A;  5L8D A;  2UVH A;  3V5A A;  1DCU A;  1I69 A;  2ZNU A;  1QUL A;  2FHY A;  3RQT A;  4PDD A;  1MM6 A;  1PEB A;  2NVU B;  3C34 A;  4U1Z A;  2THI A;  4JVD A;  5CC2 A;  2Y84 A;  4I1D A;  3CG1 A;  2XHD A;  4H6D A;  4EXK A;  4G4P A;  3SEV A;  3NOH A;  2UVG A;  3H6W A;  2ONR A;  2XX9 A;  4P47 A;  4HTG A;  1NNF A;  3IO4 A;  1JP4 A;  1FQB A;  3B6T A;  4KYS A;  4P56 A;  1M5B A;  5H8F B;  4X04 A;  3ISP A;  2F6G A;  1JW1 A;  1LBC A;  2HCA A;  4XIG Q;  4UAB A;  3UK4 A;  2QVU A;  2HAU A;  1OLA A;  1XT8 A;  2CEX A;  1SYI A;  3VXB A;  1AWB A;  5CMB A;  4AS5 A;  3K0V A;  4H5F A;  4RNS A;  4BLA A;  2RCB A;  1JEV A;  2F5X A;  2ZYM A;  4F1U A;  5IZZ A;  1UIV A;  4YB6 A;  4PP0 A;  4O94 A;  1IXI A;  4ONY A;  2RKM A;  1CNQ A;  3RT6 B;  4JWX A;  5KDT B;  3QXM A;  1NV4 A;  4OFJ A;  2QRY A;  3GBA A;  4N07 A;  2P2A A;  1A8E A;  1MQJ A;  1TFD A;  1P1Q A;  1R6Z A;  4O3A A;  1AIV A;  2QMW A;  3O6G A;  2DWI A;  2KQZ A;  4O3C A;  5H8F A;  1CE2 A;  4EF1 A;  3MP6 A;  4WEP A;  1SPI A;  2PCR A;  4LAT A;  1N0T A;  3ROJ A;  3FXU A;  4OA4 A;  4FE8 A;  4GWW A;  3MAM A;  2I48 A;  5TPA A;  1FQD A;  4EQ7 A;  3U92 A;  3Q28 A;  1Z7M E;  2VGQ A;  4H46 A;  3KC0 A;  1INP A;  2AIX A;  4BDQ A;  1B1H A;  1AL3 A;  3PPP A;  1II5 A;  1MXV A;  1WOD A;  1EH3 A;  3IOT A;  4MFI A;  3MQ9 A;  1VE4 A;  2VD3 A;  4DIG A;  3LUZ A;  1NV7 A;  3UOR A;  3ODB A;  3T9H B;  1NV2 A;  2ZYN A;  3OEK A;  3FGS A;  2XXT A;  3MVX A;  3CFL A;  5DYH A;  3LR1 A;  4MCO A;  4NF4 B;  1EZ9 A;  3A09 A;  3MP8 A;  4F18 A;  1QKB A;  2I58 A;  4ZEF A;  1VDW A;  1FBD A;  1IMA A;  4QFK A;  4H0W A;  3VLV A;  3I5O A;  3OOA A;  3UP9 A;  4G77 A;  2HZL A;  3OO8 A;  2DVZ A;  3PD8 A;  3FVN A;  2Z8D A;  3T9X B;  2HPG A;  1Q35 A;  1FTA A;  4GOT A;  4XEQ A;  1NUY A;  3C4M A;  1MXW A;  1NL5 A;  4N17 A;  4PC9 A;  4F3G A;  4QFN A;  4PAK A;  3TTN A;  4OVJ A;  1B5I A;  4OER A;  1AH5 A;  3TTK A;  3RTW B;  4GXA A;  3G3J A;  1Y20 A;  3KN8 A;  3PUY E;  1OVB A;  1LFI A;  1LBX A;  3PMW A;  1FQC A;  3K6W A;  4JBZ A;  4KD5 A;  3IB1 A;  2DOJ A;  2RC8 A;  4KQP A;  3E79 A;  2YJP A;  4R2B A;  3U1O A;  1FPB A;  5EHS A;  5I7I A;  2VT5 A;  1QGX A;  2ANJ A;  4NF0 A;  4NGU A;  2YPN A;  4BDL A;  4X1D A;  1HSE A;  2PX1 A;  4NG7 A;  1LBW A;  1UTB A;  4PFI A;  3IOU A;  4YB5 A;  2Y7W A;  4YMB A;  4GWU A;  4IY5 A;  1O63 A;  3K02 A;  1IME A;  4L17 A;  3ZKL A;  4K3F A;  1MPD A;  5AA2 D;  3VE1 B;  1P1O A;  5I56 B;  1XVY A;  4RYA A;  5IM2 A;  3JV9 A;  5L9M A;  1B40 A;  3MVY A;  2FIX A;  4LP2 B;  4F29 A;  2Y7R A;  4KCC A;  5L9O A;  5FBP A;  3HO7 A;  5J1D A;  1B6H A;  5IZ3 B;  3KGC A;  3DLN A;  1ZKB A;  2PMS A;  1PB9 A;  3TFL A;  4AQ4 A;  4DXB A;  2GHB A;  1VFD A;  4ZDM A;  4LN5 A;  3EQ1 A;  1G0H A;  5FTH A;  4FAT A;  3IOW A;  1RYX A;  2PFY A;  3D4C A;  4X48 A;  1MS7 A;  1BIY A;  1LAG E;  1JVY A;  4OEN A;  2GFE A;  4G2Z A;  3QUF A;  3KOS A;  3UA8 A;  3W15 C;  1GTK A;  4R2F A;  1B3F A;  4N13 A;  3O66 A;  1MXU A;  3RUM A;  4F19 A;  1H45 A;  4QFO A;  2OWS A;  4ZE9 A;  4BDO A;  2I3W A;  4JB7 A;  1P1U A;  2F7B A;  3FAT A;  4PGP A;  2H25 A;  1FTL A;  3C32 A;  5LTC A;  4FBP A;  5EQA A;  1FCK A;  1POY 1;  1H76 A;  4NF5 A;  1MXZ A;  1EZP A;  4HE2 A;  4PFB A;  4DCX A;  4DZ1 A;  4G8H A;  3TCF A;  4IB2 A;  3KFM A;  4MLV A;  3BFT A;  2Y5K A;  2P3N A;  4PFY A;  1NV0 A;  3DP8 A;  5ITP A;  1IZ1 A;  4ESW A;  4ISU A;  2NWJ A;  4KYE A;  4DCY A;  4XKP A;  1MM7 A;  5DVJ A;  2H4I A;  4X1B A;  4GF8 A;  1NV3 A;  1FTO A;  1B3E A;  1BTJ A;  4YKK A;  2ZZV A;  5I2K B;  1XS5 A;  4PAF A;  1LB8 A;  1FPF A;  4GXS B;  2WYP A;  2W7Y A;  3CFZ A;  4F39 A;  3OEN A;  2XXW A;  4NF8 B;  3DP6 A;  4QSE A;  1N3X A;  4PTK A;  4HS7 A;  2Y7I A;  4MNC A;  4DDD A;  3P7I A;  4I62 A;  1JNF A;  3H03 A;  5IKB A;  4NF5 B;  4U4X A;  4TOZ A;  3IX1 A;  3LSX A;  3KC1 A;  3KSJ A;  3PTY A;  1MRP A;  4LZ5 A;  3CI8 A;  4NHB A;  1N3W A;  3PPQ A;  3FBP A;  4MHF A;  2RC7 A;  4GVO A;  4P3L A;  1FRP A;  2O1L A;  4N8Y A;  4R6K A;  1YYZ A;  3LC8 A;  3PPO A;  3Q25 A;  3FJG A;  4OES A;  4MEV A;  1YZ0 A;  3CR9 A;  2DXY A;  3MST A;  4MMP A;  3B6W A;  5B70 A;  4ZEI A;  2OWZ A;  2CZL A;  3TZA A;  3MPK A;  4MNI A;  2DDK A;  5H8H B;  2A5T A;  5I57 B;  4NMY A;  1FPJ A;  4HE1 A;  3EF7 A;  3E9X A;  3C35 A;  3KBR A;  3QYT A;  1SW2 A;  2V93 A;  1MY3 A;  3PUW E;  4KXP A;  1MG1 A;  2FYI A;  2F8D A;  4F2O A;  1GVC A;  1TWY A;  5A5X A;  3K1M A;  1B4H A;  2KR0 A;  3EHS A;  4FJP A;  3OXN A;  1OMP A;  4IGT A;  5BWJ A;  1AMF A;  3RNN A;  2XXK A;  1LFG A;  3EPE A;  3CRB A;  5KCJ B;  3IR1 A;  1Y1Z A;  4N6P A;  4OVT A;  3IB2 A;  4R6Y A;  2G93 A;  5AA2 A;  1B52 A;  2ZYO A;  2F97 A;  4U22 A;  3E3K A;  4XFE A;  2X7Q A;  3V8X B;  1ZIU A;  4PQJ A;  4G68 C;  1QJM A;  3K1P A;  1IMB A;  5KCJ A;  3MZB A;  1EU8 A;  4ZZE A;  3FXR A;  3MBP A;  5JEI A;  2V84 A;  1YPN A;  5EQ9 A;  1LST A;  2F3D A;  5B7D A;  3L6G A;  2B3F A;  5BUU A;  2L5V A;  1Y3P A;  2UYF A;  3FAS A;  2DS9 A;  1SQY A;  3OD7 A;  4XTC Q;  1UQW A;  4JDF A;  1KA1 A;  4R6H A;  4Q30 B;  3GZG A;  1UTB B;  5AE4 A;  4MX6 A;  4XKN A;  1IXC A;  4DXC A;  5AA2 B;  1TFA A;  4YIC A;  3OO7 A;  2FIE A;  3QK6 A;  5I2K A;  1FTJ A;  4YKP A;  2H98 A;  2XXI A;  1LB9 A;  5I59 B;  1QKA A;  4G8M A;  1LBV A;  3MPL A;  4PFR A;  1KA0 A;  1N7X A;  2LAO A;  4FEB A;  1B7H A;  4H1X A;  4OET A;  2QPQ A;  3N94 A;  4F3B A;  4F3P A;  2D21 A;  2QVR A;  1Q9D A;  1SVX B;  1M5E A;  4C1U A;  2F36 A;  3RLF E;  4LA9 A;  2V4C A;  2ZZX A;  3U8Q A;  2UVI A;  3E13 X;  2B4L A;  5CM6 A;  1I6Q A;  1D9V A;  4POW A;  2DYX A;  3FVO A;  4OEU A;  3B7D A;  5I56 A;  3H6V A;  2QS1 A;  4EXL A;  2PYY A;  1JW4 A;  2Z23 A;  3HST A;  1RDZ A;  1D9Q A;  1GR2 A;  4PFW A;  1EYI A;  1SW1 A;  2X26 A;  5I57 A;  2ZNT A;  1A40 A;  4I9D A;  3DEL B;  4PBH A;  1MH4 A;  4KI0 E;  3KG2 A;  4DXU A;  3OSR A;  3IO6 A;  1K9Z A;  3M3F A;  3K6U A;  2ZYK A;  2B3B A;  5I58 B;  1PB8 A;  1FTM A;  3T9V A;  5DVF A;  1FQF A;  2MKZ A;  3C33 A;  3GYY A;  3CFX A;  2VPO A;  5DVI A;  2GRV A;  3TOD A;  2OBG A;  5LDZ A;  2WX9 A;  3FJM A;  1Q1K A;  1NKX A;  1EZO A;  4MNP A;  3TTL A;  3IJX B;  3RN8 A;  3S4U A;  3SES A;  3QMF A;  3FXB A;  1M5D A;  3BIH A;  3FUZ A;  5M2V A;  3C36 A;  1NH7 A;  1ZU0 A;  5JTY B;  2QJE A;  2QL3 A;  1Y3N A;  1D4N A;  2I4B A;  4EUO A;  5A5X B;  4KPT A;  1PBP A;  3HCQ A;  3KSX A;  3SER A;  1LAF E;  1GGG A;  4X9T A;  4GRK A;  2ZXT A;  4P11 A;  4EQB A;  3MZ9 A;  3GXA A;  1UTH A;  2UYE A;  4F2Q A;  4GL0 A;  1Y4C A;  2XD3 A;  3I6V A;  1OIB A;  3T66 A;  1BK4 A;  4FED A;  2OX3 A;  2XXU A;  5JTY A;  3SKP A;  3KOT A;  5EYF A;  4GFR A;  2UVJ A;  3VDF A;  1S50 A;  5DW8 A;  5H8S A;  3TDJ A;  2O7I A;  3T22 A;  4PFT A;  5T3J A;  3O6H A;  2OK2 A;  3DM0 A;  1KWH A;  2AL4 A;  1NMU A;  1H3D A;  2F3B A;  3CIJ A;  2GH9 A;  1ELJ A;  2XX8 A;  4QHQ A;  3CVG A;  4F22 A;  3OO6 A;  3A3C A;  1VSO A;  4ZZA A;  1FSA A;  3G3K A;  4HXV A;  4KCD A;  1FPI A;  4LUB A;  2XXP A;  4N6K A;  3K2D A;  3CG3 A;  4GWO A;  1QVS A;  1NNK A;  3SEW A;  4UA8 A;  4OTE A;  3RGY A;  5K2X A;  5AA4 A;  3OMB A;  2OJT A;  2F78 A;  2RIN A;  1JVX A;  2QMX A;  3H4Z A;  1D3K A;  4FOR A;  5KZT A;  4EQ9 A;  1M5F A;  3MJN A;  4PE3 A;  1YAE A;  2DP8 A;  2REJ A;  3SZP A;  2Y5L A;  4XKQ A;  2VOZ A;  3VVF A;  3G7W A;  2I49 A;  3FV1 A;  2P3V A;  3KEI A;  2CZK A;  2PT2 A;  1B9J A;  5EQ8 A;  1O64 A;  2Q2C A;  2HEU A;  3O29 A;  4Z0I A;  4R75 A;  5HPQ A;  4QXD A;  1MQG A;  3BIG A;  1I6B A;  3CHG A;  4FAJ A;  1B7Z A;  2Z22 A;  4QFP A;  3R6U A;  3QUJ A;  4BDN A;  2WYK A;  2O7U A;  4IO5 A;  4M1V A;  5TP9 B;  5LOM A;  1LBB A;  2RCA A;  4NF4 A;  3FVK A;  2Z8E A;  3U93 A;  1LCF A;  4PCD A;  1BP5 A;  4IO7 A;  4FEC A;  4Z7E A;  1FBG A;  3A3U A;  2OWT A;  1FBE A;  3MUQ A;  2VHA A;  1IIW A;  3O9P A;  4R73 A;  4O7I A;  4FIM A;  2DWH A;  3HV1 A;  4YKI A;  3MVZ A;  1ZTY A;  3JYR A;  4BDR A;  1MY2 A;  4NTL A;  1FPE A;  3UIF A;  5HM4 B;  1T0K A;  1G0I A;  4OVS A;  1RDY A;  5DEX A;  4OVP A;  4PDH A;  2DE2 A;  3TTM A;  3S9L C;  4KYD A;  2X7P A;  4I40 A;  4OVQ A;  4ZEB A;  4U23 A;  5FHN A;  4TLL B;  4H45 A;  4P0G A;  1MXY A;  5L9S A;  1POT A;  1XI6 A;  1XHY A;  2FNC A;  5DT6 A;  1PC3 A;  3LSL A;  5H8Q A;  3OSQ A;  2R9J A;  1MPC A;  3O2A A;  2WEF A;  3M3L A;  1P1N A;  1B3H A;  1URD A;  4F1V A;  2P1S A;  3V89 B;  4ZEC A;  1LLS A;  4AB6 A;  1Y4T A;  1XC1 A;  5ITO A;  2HHM A;  2Q74 A;  3TQW A;  5AA1 A;  4YB7 A;  2NXO A;  2O6A A;  1MQD A;  4MF3 A;  1NV1 A;  3HHG A;  1USY E;  2R8T A;  4O3B A;  2A5S A;  4MIJ A;  5EHM A;  3CSG A;  4H8J A;  1XVX A;  3B8B A;  1B32 A;  1S9T A;  1IQ7 A;  3USD A;  2HXR A;  5I2N A;  2V3U A;  4GLI A;  3AXF A;  2HZK A;  2ESN A;  3KN3 A;  4QBA A;  4RA1 A;  3LUY A;  2A5T B;  3WAF A;  4U4S A;  1BKA A;  1A8F A;  1H44 A;  3RPL B;  1FW0 A;  1NH8 A;  2ONS A;  1YCJ A;  2XWV A;  4H8I A;  1M5C A;  4GX4 A;  3V83 A;  3IFC A;  3IL1 B;  1MDP 1;  3OEM A;  4F31 B;  5CMM A;  4JWY A;  4GBV A;  5I5P A;  1NV5 A;  5H8N B;  2QS3 A;  3ILT B;  4OFL A;  1JEU A;  4G61 A;  4YKJ A;  1P1W A;  2E1S A;  4GD5 A;  4WKM A;  3FD3 A;  3O6I A;  5TP9 A;  1QUK A;  4IO4 A;  1IXG A;  1PDA A;  5ICQ A;  2QFL A;  4F3S A;  3H06 B;  3T96 B;  1AOV A;  1FPD A;  3G3I A;  1Z7N E;  1JQF A;  4C1T A;  1DMB A;  2CZI A;  2V3Q A;  2D5W A;  3N6U A;  2H9B A;  3M3K A;  3FV2 A;  3UN6 A;  1A99 A;  4LZ7 A;  4M4G A;  3W9W A;  5I59 A;  1MY1 A;  3D4G A;  4MBP A;  1YXI A;  2DXR A;  1N76 A;  3BFU A;  1JET A;  4P8B A;  5TPA B;  4EF2 A;  2FVZ A;  3BKI B;  2QVV A;  5EQ7 A;  3K6X A;  1A54 A;  1IUD A;  1VR5 A;  2XXQ A;  1DK4 A;  1EYJ A;  4HCY A;  4ZEK A;  1B3G A;  4PF6 A;  3TEP A;  5I3S A;  3LV0 A;  4RK2 A;  3S9N C;  4GWX A;  2I4C A;  3PUX E;  5H8N A;  3IOR A;  5ISU A;  3ZS6 A;  4PBQ A;  3TCH A;  2XXY A;  2CEY A;  2FA7 A;  2Q2A A;  4HW8 A;  4N15 A;  3SEY A;  1YTV A;  2FBP A;  3MWB A;  1I6A A;  2G29 A;  4H5G A;  4I8C A;  2QS4 A;  4GX3 A;  1UIU A;  3M8U A;  2HXW A;  5ET7 A;  2ZMB A;  2PT1 A;  4YMA A;  3G3H A;  2AL5 A;  3GLB A;  4N6D A;  2DE3 A;  4MJO A;  4PGN A;  3HN0 A;  1B51 A;  3OO9 A;  1LCT A;  3K00 A;  3JZJ A;  1LBZ A;  3Q29 A;  3S2V A;  5I58 A;  4P1E A;  4OWD A;  1XOC A;  3Q27 A;  5K2Y A;  1FJ6 A;  4ESX A;  2F35 A;  2DQV A;  2H99 A;  5IAI A;  2Y7P A;  1FBH A;  5EYH A;  1A7L A;  1B1X A;  2V3T A;  2I3V A; 
#chains in the Genus database with same CATH homology
 3CHG A;  4F19 A;  2CZH A;  1LBX A;  1YYZ A;  2CZI A;  2V3Q A;  1IMB A;  1NV6 A;  4F1V A;  5DW8 A;  2WYK A;  1NUW A;  4M1V A;  1RDZ A;  1FPG A;  4PFR A;  1D9Q A;  4HCW A;  3NOH A;  3E79 A;  3W9W A;  1EYI A;  1FPB A;  4H46 A;  3KC0 A;  1INP A;  1YXI A;  4MEV A;  4PGP A;  5EQ9 A;  5T3J A;  5ESY A;  2F3D A;  1YZ0 A;  4P47 A;  5I7I A;  5LTC A;  4FBP A;  5EQA A;  2HHM A;  2Q74 A;  1JP4 A;  2VT5 A;  3B50 A;  4P56 A;  1QGX A;  2WBB A;  1FBC A;  3IFA A;  4GBW A;  4N8G A;  4NF0 A;  1EYK A;  4P3L A;  2FVZ A;  4P8B A;  4PBH A;  2L5V A;  4NGU A;  4HE2 A;  3MST A;  2F3B A;  4PAI A;  4PFB A;  2QVV A;  5EQ7 A;  4MMP A;  4X04 A;  4I3E A;  1K9Z A;  3ISP A;  4NN3 A;  4O7M A;  4DI4 B;  4OAN A;  2OWZ A;  4IR8 A;  1NV1 A;  2ZZW A;  1DK4 A;  1EYJ A;  4X8R A;  1FSA A;  1KA1 A;  2R8T A;  4P9K A;  2Y5K A;  4N4U A;  4P1L A;  4UAB A;  2P3N A;  1LBW A;  2QVU A;  4MIJ A;  4HCY A;  4HXV A;  4N81 A;  2MKZ A;  1NV0 A;  1FPI A;  4MNI A;  4N6K A;  4PCD A;  2DDK A;  3B8B A;  3LUZ A;  4MX6 A;  1NV7 A;  4PFI A;  4PF6 A;  2JJK A;  1FBG A;  3GYY A;  2CEX A;  2GQ1 A;  4N91 A;  1FBF A;  5I3S A;  3LV0 A;  1FBE A;  1FPJ A;  2VPO A;  1NV2 A;  1AWB A;  2HXR A;  4GWX A;  4GWU A;  4GX6 A;  4HE1 A;  5EYG A;  4YIC A;  3A29 A;  1IME A;  3KBZ A;  4I3Y A;  2Q8M A;  5LDZ A;  4NX1 A;  4PBQ A;  4AS5 A;  2FIE A;  2WX9 A;  4MCO A;  2CEY A;  1NV3 A;  1DBZ A;  4MAG A;  4PET A;  4MNP A;  2HZK A;  4QBA A;  2F5X A;  2VPN A;  4KXP A;  2B4M A;  3T1B A;  1NUX A;  4N15 A;  4O7I A;  4F1U A;  4GWZ A;  4F18 A;  5IZZ A;  2FBP A;  5IZ3 A;  5A5L A;  1VDW A;  1FBD A;  3QMF A;  5IM2 A;  2ZZV A;  3E78 A;  3FXB A;  3RPL A;  3D1R A;  2XWK A;  1IMA A;  5ET8 A;  2XA5 A;  4PAF A;  3BIH A;  4JVI A;  4O94 A;  1KZ8 A;  2FIX A;  2KR0 A;  1FPF A;  1FPE A;  1FPL A;  2XWV A;  4YZZ A;  4GX4 A;  3RPL B;  5FBP A;  5J1D A;  2WYP A;  1CNQ A;  2HZL A;  5IZ3 B;  1G0I A;  3IFC A;  1K9Y A;  1LBV A;  1RDY A;  4GX3 A;  4OVS A;  2DVZ A;  3RYD A;  4HE0 A;  4OVP A;  2XWI A;  2XXK A;  4O8M A;  1KA0 A;  1NV4 A;  1LEV A;  4PE3 A;  4GWS A;  1FPK A;  1RDX A;  4PDH A;  5ET7 A;  5JK4 A;  2DE2 A;  4GBV A;  3MYU A;  3SZP A;  4N6D A;  5I5P A;  1LBY A;  2DE3 A;  1NV5 A;  4MJO A;  4PGN A;  2QPQ A;  2Y5L A;  4PTK A;  5F24 A;  1FBP A;  4LN5 A;  4N8Y A;  4MNC A;  3U65 A;  1G0H A;  2HPG A;  4I40 A;  4NG7 A;  4OVT A;  4X9T A;  1FTA A;  2Q9T A;  4OVQ A;  4XEQ A;  1NUY A;  2WBD A;  2QVR A;  4G61 A;  5IGA A;  1Q9D A;  1NUZ A;  4H45 A;  1NI9 A;  4N17 A;  4NQ8 A;  4XF5 A;  1LBZ A;  2PFY A;  4PC9 A;  5ET6 A;  5IZ1 A;  4PF8 A;  4OVR A;  5J16 A;  4DI3 D;  2PFZ A;  4AS4 A;  4P1E A;  1XI6 A;  4PAK A;  2DE4 A;  1IMC A;  1IMF A;  2V4C A;  2P3V A;  1FJ9 A;  2ZZX A;  3KC1 A;  1DCU A;  3PTY A;  1FJ6 A;  3EKI A;  3HFU A;  2KQZ A;  4JVC A;  5ET5 A;  3T0J A;  2B4L A;  2CZK A;  5CM6 A;  4XFE A;  5EQ8 A;  1SPI A;  2FHY A;  2PCR A;  1IMD A;  4NHB A;  2BJI A;  4PDD A;  2QFL A;  3W9V A;  4QXD A;  3ROJ A;  1FBH A;  1FPD A;  4JVD A;  1BK4 A;  3FBP A;  4MHF A;  2WEF A;  4OA4 A;  5EYH A;  2OX3 A;  2XWO A;  4NAP A;  4GWW A;  4GWY A;  1FRP A;  3BIG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...