4O7MA

Crystal structure of a trap periplasmic solute binding protein from shewanella loihica pv-4, target efi-510273, with bound l-malate
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
304
structure length
304
Chain Sequence
PTEIKFSHVVAENTPKGQMALKFKQLVEERLPGEYQVNVFPNSQLFGDNNELSALLLNDVQFVAPSLSKFERYTKKLQLFDLPFLFKDMDAVNRFQQSDAGQQLLNSMKRKGVVGLGYLHNGMKQFSASSPLVLPEDAQGKKFRIMASDVLAAQFQAVEAIPVKKPFSEVFTLLQTRAIDGQENTWSNIYSKKFYEVQSNITESNHGVLDYMVVTSNTFWKSLPADKRKVIKASLDEAIAYGNEIAAAKVNKDKQAIIDSKRSEVTYLTPEQRAAWVNAMKPVWAQFEDKIGKDLIDAAVASNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRAP dicarboxylate transporter, DctP subunit
publication title Experimental strategies for functional annotation and metabolism discovery: targeted screening of solute binding proteins and unbiased panning of metabolomes.
pubmed doi rcsb
source organism Shewanella loihica
molecule tags Transport protein
total genus 106
structure length 304
sequence length 304
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-12-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4o7mA00
4MCOA 2WX9A 2HZKA 4DI4B 4MNIA 4P1EA 4PFRA 2XA5A 4PC9A 4MNCA 2WYPA 4OANA 4P56A 2ZZXA 3B50A 4PF8A 4N91A 4PF6A 2VPOA 4OVTA 4NF0A 4X04A 2VPNA 2ZZVA 2CEYA 2WYKA 4NAPA 4YICA 4PGPA 4N8GA 4P9KA 2XXKA 4N6KA 4PAKA 2XWOA 4PBHA 4OVRA 4PAFA 4N17A 4DI3D 4OVPA 5I5PA 4UABA 4N8YA 4N4UA 4OVQA 4P3LA 4P1LA 3U65A 4PDDA 4NX1A 2HPGA 4PFBA 4P47A 4PDHA 4P8BA 2HZLA 4NQ8A 4OVSA 2PFZA 4MIJA 4MEVA 4N15A 4NN3A 4O8MA 4X8RA 5LTCA 4PBQA 3FXBA 4PE3A 4XFEA 2PFYA 4N6DA 2V4CA 2XWVA 4LN5A 4O7MA 5IZZA 2CEXA 4PCDA 5IM2A 4PETA 4OA4A 4MAGA 4MHFA 4O94A 3GYYA 4NHBA 4NGUA 4MX6A 5CM6A 4NG7A 4XEQA 2XWIA 2XWKA 4MMPA 4PFIA 4XF5A 2ZZWA 4YZZA 4PGNA 4MNPA 5I7IA 5IGAA 4PAIA
chains in the Genus database with same CATH superfamily
1IITA 2G29A 3E79A 2H5YA 5DYHA 1FBPA 4GWZA 2XX8A 1F9BA 2F7AA 1T0KA 2PX1A 1N04A 4HE0A 3PPOA 4OZ9A 2RINA 3S9EA 4ZZAA 1FPFA 1IEJA 4QRZA 5BWJA 3DM0A 2XXIA 3R7XA 2AYSA 1MXZA 2QPQA 4YKIA 3THIA 4PFUA 1IIWA 2R8TA 4LQ2A 3TCGA 3FV2A 5EYFA 1N3XA 2MKZA 1VFEA 2OBGA 1SYIA 4KCDA 3G7WA 4G4PA 4NX1A 5I58B 1B1HA 4ZECA 5H8HB 3S9LC 3H6WA 3RPLB 5IZ3B 3OOAA 3JZJA 4GWWA 1FPDA 1FJ9A 1JQFA 2CMOA 1RYXA 3NOHA 1II5A 4YAHX 1US4A 3DP8A 3GBAA 4JSDA 3RTWB 4KYEA 2DP8A 3O9PA 4Z7EA 2VP1A 3LSWA 3FVNA 3B6QA 2OX3A 4H1XA 4NF6B 1Y3NA 2F36A 4JWYA 4WKMA 3UGWA 1FQAA 1BTJA 5JEIA 2I4CA 4OENA 2Z8EA 5H8SA 3RLFE 1SYHA 1LFIA 1QGXA 2ESNA 1NV1A 3K6VA 1N76A 2P2AA 1CB6A 3VVEA 3SEWA 1I6QA 1FBGA 3CR9A 4K3FA 3RY3A 2DSFA 1XC1A 4U4XA 3K6XA 4E0XA 4LZ7A 2IA4A 1Y4CA 3MVWA 3HPIA 4ZEIA 2I58A 2ZMBA 4POXA 1B5JA 3G3IA 3PPQA 1FTLA 1LBBA 4DXUA 4OXVA 2O68A 4RY1A 3MZ1A 3UN6A 3QSLA 3B6WA 3ZS6A 3M3KA 4F18A 3IJOB 4F39A 2ZYNA 1MPDA 3Q28A 3PMVA 4BDLA 3K1PA 5I2KB 3HO7A 3RYDA 3L6HA 3LSFB 4N8YA 3MUQA 2V3TA 1Y1ZA 4OQOA 4U1ZA 3Q25A 2ONRA 2PFZA 2NUVA 1CE2A 2P0SA 1Y4TA 2PFYA 1YTVA 1XVYA 1H43A 1G0HA 2V4CA 2XWVA 2ABHA 5HM4B 4GLIA 2I6EA 4HTGA 4R2BA 4I9DA 2M8CA 4XTCQ 1POTA 2P1SA 4I3YA 1YXIA 3IOWA 5CMKA 3MPKA 1MQGA 2Z22A 4FEBA 2Y5KA 4YKKA 2HEUA 4GXAA 2DE2A 3H4ZA 3OENA 4POWA 5ET8A 4TQUQ 1FPIA 2V3UA 3M3LA 4WEPA 3QMFA 1MQDA 4AQ4A 2Q2CA 3FATA 1USYH 4XXUA 3RNNA 1UTHB 5A5LA 3BFUA 2I48A 4RJZA 4GX6A 3LSLA 1FPEA 2R6GE 4H8JA 3K1NA 4QF9A 4GIZA 3WAFA 1HSJA 4X04A 1WDNA 3V83A 3CRBA 1A55A 4F22A 3G3KA 3LBSA 1DMBA 3W9VA 4P9KA 3R26A 3H3GA 4H46A 3UORA 3KGCA 2Y5LA 1TT1A 2WBBA 1SI0A 4Q8RA 1EU8A 2HCAA 5K2XA 3SEYA 3T96B 4F1YA 4IB2A 4OVQA 3KJ7A 2UYEA 1PBPA 1LEVA 4AS4A 3CFZA 4N15A 3TDJA 1B2HA 2HAVA 1FBEA 4PBQA 2FA7A 3FXBA 2PCRA 1MDP1 5M2VA 1JW4A 4GWUA 3EN3A 5AA3A 5K2YA 1FJ6A 5B7DA 4FJPA 3PUVE 1MXVA 2GQ1A 1MY4A 1IMEA 1FQFA 2I0BA 2LAOA 3C33A 2VT5A 3FVGA 1FBCA 1B3LA 3B6TA 3EKIA 4NF5A 3IOUA 5I2NB 1I69A 4KXPA 5DEXA 3CSGA 3RT6B 1OIBA 2QSXA 3BFTA 1OVBA 3PMWA 1LAXA 1FPLA 2E1SA 2XXVA 3UP9A 4MLQA 4C0RA 3F11A 1RKMA 4IO7A 1B7ZA 4BDQA 5B70A 2GFEA 3E13X 1JEUA 4LQ5A 4M1VA 1URDA 1B58A 2QS3A 3QYTA 3VDFA 3G3FA 3C36A 3H6TA 4F3PA 1MY2A 1FQDA 5EQ9A 3K00A 2B3FA 4OFLA 2Y84A 3KEIA 4N17A 4RA1A 2FBPA 3KSXA 4U1OA 3U65A 3SKPA 5AE4A 4GXSB 1XS5A 4ELOA 4X8RA 4EQ7A 4X1BA 2DQVA 3IO6A 2F78A 4KI0E 4PFWA 3IOVA 1B0HA 4EDPA 1EYKA 2F34A 3T0JA 1RDXA 1CNQA 1N7WA 2DVZA 5BUUA 1B46A 1N3WA 3MZ9A 1O63A 3OELA 5CM6A 5DVIA 4NG7A 2B3BA 3EF7A 2XWKA 3RPWA 2PMSA 4ZEFA 5H8FA 1SBPA 4NMYA 2PYYA 2CZKA 4ELQA 1A8EA 4MNIA 1MXYA 4JWOA 5TPAB 5AA2B 5KZTA 4P56A 2QVVA 1IZ1A 1US5A 4P0IA 3U93A 4JVDA 4IY5A 4G8HA 4F1UA 1JW5A 3I6VA 4R72A 4JDFA 3OMBA 1EZPA 2RC7A 3A3CA 2DE3A 3MSTA 4O3BA 5I56A 5AA4A 3KZGA 4GWOA 4G68A 4C1TA 4MH5A 4OMBA 3ECRA 4ONYA 4NQ8A 5EQAA 4LONB 1EYIA 1S7YA 2DWJA 3OO6A 4H65A 4N6PA 4NN3A 3MZBA 3Q26A 4NWCA 2Y7PA 4QSCA 2H9BA 4PE3A 3MW0A 3OEKA 4XKPA 2OWZA 1OQHA 1NV3A 4OFJA 4JB7A 4G61A 2ONKE 3C31A 2DE4A 3DP6A 1P1WA 4QBAA 4PCDA 1S9TA 2XX7A 4GX3A 3QUJA 2NOOA 2OK2A 3E9XA 2F97A 2RF1A 2WBDA 3SZPA 1OLCA 3EHTA 4I8CA 1MXXA 4QSEA 1Q9DA 3PPRA 2H99A 4G68C 1P1NA 4HS7A 1FTAA 1LB9A 1M5CA 1SW1A 1FQEA 3HCQA 4AB5A 4WXJA 5I57A 1Y1MA 1FTKA 4PF6A 1NV2A 1DBZA 4R9FA 1NV0A 4KQPA 1B51A 2V93A 5L9SA 3ISPA 5ET5A 1NMUA 4TLMB 1B3HA 3O6GA 2WYKA 4FATA 4QFPA 4N8GA 2B4MA 1IXGA 1SW5A 4FORA 4PBHA 4ISUA 1VR5A 1ZU0A 5IAIA 1IMFA 3GLBA 3IFAA 5L8DA 2XX9A 3H6UA 3HFUA 3MP8A 1S50A 4ZEKA 2UVJA 3V89B 2DS9A 3TEPA 4FEDA 4Q0CA 3VLUA 4FBPA 1D9VA 1Y20A 3D4GA 1SW4A 1MRPA 4KCCA 2KQZA 2F3DA 5JTYB 4U21A 1UTBA 4YMAA 1WVJA 2HHMA 4DLDA 5IKBA 1M5EA 3U1OA 3LR1A 2XHDA 3CVGA 4MX6A 3FZVA 1NH7A 3QUFA 2ZZWA 2RC8A 3O29A 5F1QA 4UA8A 4OEVA 3KOSA 1NUWA 1MQJA 3T66A 3EHUA 4MNCA 1EZ9A 2D3IA 1IMAA 2XXPA 3KOTA 4HE1A 3VFJA 4NEDA 4JVIA 3CFLA 2HQ0A 1Y3PA 1B1XA 3SEXA 4IO3A 2DVCA 2QVUA 3TTRA 3KN8A 2ZNSA 5DVFA 1EYJA 4QSDA 1H76A 4L17A 1B32A 1SI1A 4H0WA 4PTKA 1J1NA 3UIFA 1A40A 4ZE9A 1XI6A 2DYXA 1M5DA 3UK4A 2XWOA 1LSTA 3SEUA 2ONSA 3T9XB 4PE5B 2OZZA 4NTLA 1URSA 3ZSFA 4R2FA 1BIYA 2XXYA 3ODBA 3HHGA 4MIJA 5LTCA 1FQBA 1FBHA 4GBVA 1FPJA 3B8BA 4YB7A 5AA2D 3ILUB 1MY3A 1KZ8A 1Y9UA 1NNPA 2W7YA 2BJIA 2OWSA 5TU0A 5I3SA 4DCXA 3FXQA 4XEQA 4O7IA 3OD7A 3IR1A 5ESYA 2L5VA 2Q88A 3ILTB 2A5TA 1XOCA 3IB0A 3RPLA 2I3VA 5J1DA 3IB2A 4P1EA 4ESWA 3KJTA 1GR2A 3IX1A 2O6AA 4PF8A 1AMFA 4UACA 3FVKA 2Z8FA 4JXIA 4OVTA 1K9YA 3K0VA 1IMCA 1MPCA 1MS7A 2V25A 3SETA 3VVDA 4KD5A 3ZKLA 5DEXB 2WKYA 2Q2AA 1B05A 5EQ7A 1NNKA 3TFLA 5ET6A 4HW8A 1FRPA 4ELRA 5I59A 5TP9A 2XXTA 4NE4A 4OESA 3OSQA 4OVPA 3Q27A 5J16A 2UVIA 1YCJA 1D3KA 3C34A 4PDDA 4R75A 3FXUA 3K2DA 1NFTA 4EQ9A 1I6BA 4N07A 4HXVA 3TTMA 4OVSA 3V5AA 2ZYMA 1N7XA 2FIXA 4M4GA 4GWSA 1IQ7A 5ISUA 5CBRA 4MJOA 5H8NB 4C1UA 3O6HA 4N6DA 1NUYA 1LBXA 1MQHA 4LUBA 2I49A 4F3BA 1SW2A 3KBZA 2I3WA 3TUSA 3RN8A 5DTBA 4PETA 1MM6A 3G3GA 3FUZA 3N5LA 5HPQA 5ICTA 2YLNA 4IGRA 3N26A 3A09A 1JVYA 4WEDA 4LA9A 4H45A 3ZKKA 3C35A 1JVXA 2XWIA 4R9GA 5CMBA 4PFIA 4XF5A 1IUDA 1EZOA 1MY1A 4X1DA 4JBZA 1PB8A 4PP0A 3MVZA 4RK2A 3VE1B 2WX9A 3LSXA 1DOTA 2FYIA 2XD3A 3S9MC 2Z23A 2F35A 1LLSA 1B4ZA 3QIMA 2ALUA 4PFRA 2QMXA 4KR5A 3TTLA 1B5HA 3MP1A 4H67A 4OERA 1P1QA 2I4BA 2AL5A 2QFLA 3QXMA 5H8FB 2H98A 1VE4A 4YMBA 1LGBC 4PFYA 1AH5A 2THIA 1Z7ME 4P0GA 1NNFA 3BIGA 1AOVA 5EHMA 1URGA 1FQCA 3K1MA 1NUZA 3S2VA 1LB8A 4FECA 2YPNA 4EXKA 4OFOA 1DCUA 3TZAA 2Q8JA 1KWHA 3PD9A 4PFBA 5F7VA 1QUIA 3CI8A 2O51A 4RYAA 4I3EA 2DXYA 1UQWA 4MEVA 5KCJA 1UTHA 1P99A 4IO5A 1YYZA 5CBSA 2DDKA 3TPAA 4BDNA 4X9TA 5I56B 5AA4B 1A54A 4NWDA 2JJKA 4G68B 4GD5A 1QW0A 4OHNA 4GOTA 5IM2A 3O6IA 3LC8A 3QK6A 3DP4A 4KFQA 3I3VA 4RNSA 1K9ZA 4O3CA 2Y7RA 4YB6A 1UIUA 1A8FA 1YPNA 3P7IA 3OXNA 2DWHA 1PBQA 4MLVA 4AS5A 2DWIA 2R9JA 3MP6A 4MNPA 4NF8A 3MVXA 1LBZA 4R74A 2I0CA 4U2RA 3SESA 1P1OA 2H25A 3OEMA 2FNCA 1FTOA 3HN0A 3VV5A 2A5SA 3CSBA 4NF4B 1IXIA 4PC9A 4H8IA 1B5IA 2F5XA 3PD8A 3N94A 4XKRA 2PT2A 4YU0A 4P11A 3KFMA 4DZ1A 1QUJA 3TCHA 1TFAA 3K6UA 5A5XA 4IO6A 4JVCA 3TELA 4BDMA 2VPNA 4BLAA 1GVCA 1ZIUA 4KYSA 5KDTB 4ESXA 4YICA 5ITPA 2HXRA 4EF2A 5I57B 4N6KA 3FJMA 5DVJA 4DXCA 3FBPA 2FHYA 3OO9A 1KA1A 4N13A 1FPBA 1A7LA 3IOTA 2V84A 4X48A 4GL0A 4TOZA 1RDZA 3T9HB 4AB6A 4GL8A 3K02A 3FASA 1DPEA 4I62A 3H06B 4TLLB 4YKPA 3SEVA 2KLFA 4GFRA 1O7TA 1JW1A 1LFGA 3KC0A 2XXWA 4DCYA 2REJA 2GHBA 1KA0A 3KN3A 4QFKA 1G0IA 4ZS9A 2E0SA 2NXOA 1MM7A 1NNTA 4KHZE 5H8QA 1TXFA 4YZZA 2RCBA 5JK4A 2NWJA 3TYHA 2CZHA 4MCOA 1VSOA 2XXHA 3VLVA 1B7UA 1VFDA 4RK9A 2X26A 2F6PA 1SPIA 1FTJA 2PT1A 4ND9A 3HHFA 3B50A 1OMPA 2F3BA 2RKMA 3GBBA 1NI9A 1YZ0A 3TODA 3RTFB 3RQTA 3PUWE 4XIGQ 3MAMA 4R6KA 4F2QA 3KC1A 3QAXA 3CIJA 4NAPA 3MC2A 4EXLA 3VLWA 3D1RA 4JWXA 5ELVA 1MG1A 5EYHA 1Q35A 2HXWA 4EUOA 4GF8A 3PU5A 2HFBA 2Q9TA 4P47A 3BBRA 3AXFA 1AWBA 3T9VA 1NUXA 4EF1A 3H03A 2F8DA 2O69A 4N81A 1HSLA 3W9WA 5AA2A 3E78A 1H45A 4I1DA 4XFEA 3MPLA 1B52A 1QKBA 1EH3A 4QFLA 2PVUA 1QKAA 1RYOA 4QXDA 3JYRA 4U4SA 1NH8A 4GRKA 3S9NC 4OA4A 4MAGA 3MWBA 2RC9A 3C4MA 4MHFA 1FPKA 2ANJA 4DIGA 1FPGA 3FJ7A 4IGTA 1MQIA 1A99A 3U92A 3PUXE 1IMDA 4GBWA 3O66A 3USDA 1BK4A 4U23A 3M3FA 1SD3A 2O84X 1R1NA 3UA8A 4BDRA 2YJPA 4U22A 4FIMA 2XA5A 1H44A 1NL5A 1NKXA 4OANA 2F6GA 3K01A 2ZNUA 2X7PA 4GX4A 3OO8A 2XXXA 3LUYA 2A5TB 2Q89A 1GTKA 4LP2B 4EQBA 4DE8A 2R71A 2VD2A 3DLNA 5EQ8A 1RDYA 2RCAA 4THIA 3I5OA 4PAFA 3VXCA 5I5PA 3S4UA 2GRVA 3U72A 4E0WA 4P3LA 4ECFA 4LZ8A 1B3EA 2O7UA 3M8UA 3D4CA 4LZ5A 1UIVA 3RUMA 5I84A 3PMXA 4F19A 5AA1A 3IO4A 5I59B 5TP9B 2P3VA 5EYGA 4ZDMA 3U8QA 1LAHE 2D21A 1HSEA 1QVSA 3G3HA 2CEXA 1IMBA 3KN7A 1DTGA 3PPPA 4OTEA 2QRYA 5CRYA 2ZYOA 2XD2A 3TQWA 2QS1A 2XXQA 1MH3A 3FJGA 3O28A 2QS2A 3BKIB 1N0TA 3CHGA 4PGNA 1D9YA 5FTIA 2UYFA 3C32A 4Q5TA 3R6UA 3MJNA 3CG1A 3GZGA 2ZYKA 5CMMA 2WYPA 5ICQA 3E4RA 1QULA 4N91A 3TQLA 3PPNA 1ZBMA 1LCTA 1B9JA 3IB1A 5JTYA 1D9QA 2V3QA 5F24A 1B3GA 5I58A 3C9HA 5H8HA 5IZ3A 4ZEDA 3JV9A 4O3AA 2OLBA 4MFIA 2OWTA 4UABA 2G93A 1VDWA 4N4UA 4PFTA 2VHAA 4NF6A 2UVHA 2VD3A 4NF5B 4PDHA 3O2AA 3T93B 2XXUA 1L5TA 4F3SA 5T3JA 2ZNTA 3FD3A 4GWXA 4O8MA 4F29A 1LAGE 3H6VA 3T1BA 3FV1A 4H5GA 5CC2A 5ET7A 1XVXA 4OETA 1JP4A 4PQJA 2DOJA 1FTMA 3TTNA 1Z7NE 4LN5A 4I40A 4QHQA 5EHSA 1LAFE 1ZLQA 5KCJB 1QUKA 3PV0E 4O94A 4FAJA 1PEBA 1OQGA 4HCYA 4F31B 2H4IA 1LBWA 1NV4A 4QFNA 4H6DA 4LVQA 5IGAA 3TKDA 1SVXB 4OVJA 2B65A 1P1UA 2HZKA 2QS4A 5DW8A 3BIHA 3KG2A 3A3UA 1MY0A 1M5BA 2ZZXA 4IY6A 4RPNA 5I2KA 4NF8B 4F2OA 5FBPA 2CEYA 1H3DA 3Q29A 1JEVA 3WAEA 1LFHA 2GHAA 2NVUB 3EHSA 1B6HA 4XKNA 4PAKA 1B7HA 4OVRA 5A5XB 3CFXA 1FW0A 5FHNA 1D4NA 4P1LA 5FHOA 4IR8A 1BP5A 1R6ZA 4ZEBA 4IO4A 1Q1KA 2B4LA 3KBRA 3U94A 4QFOA 1NV5A 3VVFA 1DSNA 1GV8A 3T22A 1LBVA 1ANFA 2F7CA 2O1MA 1R9LA 2Y7WA 3FIRA 1WODA 3FGSA 4O7MA 2IEEA 3ROJA 2X7QA 1IXCA 3OO7A 3K6WA 2F7BA 2KR0A 3N6UA 3GYYA 4DDDA 5L9MA 4NGUA 3SERA 3IORA 4GQOA 2DWAA 1MXWA 2CZLA 4GVOA 3GXAA 4JSOA 3W15C 1I6AA 4GWYA 3MBPA 4DI4B 1INPA 2Y7KA 2P3NA 3B7DA 3K4UA 2Q8MA 1ZKBA 4F3GA 1GGGA 3TAJA 4XKQA 3OSRA 4Q30B 1N84A 3RGYA 1POY1 1FCKA 3TTKA 5H8QB 2DXRA 5H8NA 4Z0IA 2VPOA 2UVGA 3IFCA 2PBWA 2AIXA 3EQ1A 4G8NA 4NF0A 5IZ1A 4LATA 2QL3A 2XXRA 3MYUA 4IO2A 3RT8A 4OEUA 2QVRA 4FE8A 1TWYA 1SDXA 1XT8A 1MPBA 1USYE 4DI3D 4KYDA 4OYVA 1ATGA 2FVZA 4ZE8A 4MF3A 2OCUA 2HPGA 2WEFA 3KSJA 3SDFA 2Z8DA 1M5FA 2BJJX 1PC3A 1LCFA 1B4HA 3ONMA 1FBDA 2HAUA 1FBFA 1OLAA 1YAEA 1LBYA 3H7MA 5LOMA 3L6GA 5IZZA 5FHMA 2CZIA 2O1LA 3TMGA 1BLFA 3EPEA 1QJMA 5I2NA 4NHBA 4G2ZA 2AL4A 2Q74A 2VOZA 1MDQA 4R6YA 1AIVA 4MMPA 2O7IA 3LV0A 5CI5A 3TCFA 3PGFA 4G77A 1IXHA 4R6HA 3MVYA 4HE2A 4RXLA 3N6TA 4G8MA 3T9UA 3IAZA 3PTYA 4KPTA 2QMWA 3IL1B 1Y3QA 1PB9A 3FXRA 1ELJA 2ZXTA 4HCWA 1UTBB 2FIEA 1JNFA 2ZZVA 1DK4A 3CG3A 5DT6A 3HSTA 4PGPA 1MXUA 3E3KA 2REGA 5CMCA 3A29A 1ZTYA 2XXKA 1NV7A 3PUYE 4F1VA 5L9OA 4OWDA 2VGQA 1ZMGA 1DPPA 4MBPA 3FVOA 4P8BA 2HZLA 2GH9A 1FSAA 1MH4A 1JETA 4BDOA 5LDZA 1SQYA 4NF4A 3V8XB 1PB7A 3MQ9A 1B40A 4YKJA 1LBCA 1R9QA 5HBCA 4YB5A 3PUZE 2UXAA 2OJTA 5FTHA 1DTZA 1ZJLA 3G3JA 3HV1A 1B0LA 4H5FA 1O64A 2D5WA 3O97A 5ITOA 4ZZEA 1AL3A 5KDTA 5TPAA 3IJXB 1B3FA 4RPOA 3IK6B 4ELPA 4R73A 1BKAA 1NV6A 3LUZA 1PDAA 1XHYA 3VXBA 1OVTA 2Y7IA 2QJEA 4DXBA 1TFDA 5I7IA 3DELB 4PAIA
chains in the Genus database with same CATH topology
2WX9A 4MNIA 3E79A 1FBPA 4PFRA 4GWZA 2WYPA 4P56A 2QFLA 4HE0A 4N91A 2QVVA 1FPFA 1D9QA 2V3QA 5F24A 3BIGA 4JVDA 4F1UA 5IZ3A 2QPQA 2R8TA 1NUZA 2DE3A 2MKZA 3MSTA 4UABA 1DCUA 1VDWA 4N4UA 4NX1A 4PFBA 4PDHA 3RPLB 5IZ3B 4NQ8A 5EQAA 5T3JA 1EYIA 4I3EA 4MEVA 4GWWA 1FPDA 4GWXA 4NN3A 4O8MA 1FJ9A 3T1BA 5ET7A 1YYZA 4PE3A 2DDKA 3NOHA 2OWZA 4X9TA 1JP4A 1NV3A 4G61A 2JJKA 4LN5A 2DE4A 2OX3A 4QBAA 4I40A 4PCDA 5IM2A 4GX3A 1K9ZA 4O94A 4HCYA 1QGXA 1NV1A 1LBWA 1NV4A 2WBDA 3SZPA 1FBGA 4AS5A 4MNPA 5IGAA 1Q9DA 1LBZA 2HZKA 5DW8A 1FTAA 3BIHA 4PC9A 2F5XA 2ZZXA 4PF6A 1NV2A 1DBZA 4JVCA 1NV0A 2VPNA 5FBPA 3ISPA 5ET5A 2CEYA 4F18A 2WYKA 4YICA 4N8GA 2B4MA 2HXRA 4N6KA 4PAKA 4PBHA 4OVRA 3RYDA 3FBPA 2FHYA 1IMFA 3IFAA 1KA1A 4N8YA 1FPBA 4P1LA 3HFUA 4IR8A 1RDZA 2B4LA 2PFZA 1NV5A 4FBPA 1LBVA 2PFYA 1G0HA 2V4CA 2XWVA 2KQZA 2F3DA 4O7MA 3ROJA 3KC0A 2HHMA 4I3YA 1YXIA 1KA0A 2KR0A 3GYYA 1G0IA 4NGUA 2Y5KA 4MX6A 2DE2A 2ZZWA 4YZZA 5ET8A 5JK4A 1FPIA 2CZHA 3QMFA 4MCOA 4GWYA 4DI4B 1INPA 2P3NA 2Q8MA 1NUWA 5A5LA 1SPIA 4MNCA 1IMAA 4HE1A 4GX6A 3B50A 4JVIA 2F3BA 1FPEA 2VPOA 1NI9A 3IFCA 1YZ0A 4NF0A 5IZ1A 2QVUA 4X04A 1EYJA 3KC1A 4PTKA 3MYUA 4NAPA 2QVRA 3W9VA 1XI6A 4P9KA 4H46A 3D1RA 2XWOA 2WBBA 2Y5LA 4DI3D 5EYHA 2FVZA 4OVQA 2HPGA 1LEVA 2WEFA 2Q9TA 4P47A 4AS4A 1AWBA 4MIJA 4N15A 1NUXA 5LTCA 4N81A 1FBEA 4PBQA 3W9WA 1FBDA 3FXBA 2PCRA 3E78A 1FBFA 4XFEA 1FBHA 4GBVA 1FPJA 3B8BA 1LBYA 4GWUA 1KZ8A 1FJ6A 5IZZA 2BJIA 4QXDA 2CZIA 5I3SA 2GQ1A 4OA4A 4MAGA 1IMEA 4MHFA 1FPKA 1FPGA 4NHBA 2Q74A 4XEQA 1IMDA 4GBWA 4MMPA 2VT5A 4O7IA 3LV0A 1BK4A 5ESYA 2L5VA 1FBCA 3EKIA 3RPLA 4HE2A 5J1DA 4KXPA 4P1EA 2XA5A 3PTYA 4OANA 4PF8A 4GX4A 4OVTA 1FPLA 4HCWA 1K9YA 2FIEA 1IMCA 2ZZVA 1DK4A 5EQ8A 1RDYA 4M1VA 4PGPA 5EQ7A 5ET6A 3A29A 2XXKA 1FRPA 5EQ9A 4PAFA 1NV7A 4N17A 2FBPA 4OVPA 4F1VA 5I5PA 5J16A 4P3LA 3U65A 4PDDA 4P8BA 2HZLA 1FSAA 4HXVA 4OVSA 5LDZA 4X8RA 4F19A 2FIXA 4GWSA 4MJOA 2P3VA 5EYGA 4N6DA 1NUYA 1LBXA 1EYKA 3T0JA 2CEXA 1IMBA 3KBZA 1RDXA 1CNQA 4PETA 2DVZA 4H45A 5CM6A 4NG7A 1NV6A 3LUZA 2XWIA 2XWKA 4PFIA 4XF5A 3CHGA 4PGNA 5I7IA 4PAIA 2CZKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MCO A;  2WX9 A;  2HZK A;  4DI4 B;  4MNI A;  4P1E A;  4PFR A;  2XA5 A;  4PC9 A;  4MNC A;  2WYP A;  4OAN A;  4P56 A;  2ZZX A;  3B50 A;  4PF8 A;  4N91 A;  4PF6 A;  2VPO A;  4OVT A;  4NF0 A;  4X04 A;  2VPN A;  2ZZV A;  2CEY A;  2WYK A;  4NAP A;  4YIC A;  4PGP A;  4N8G A;  4P9K A;  2XXK A;  4N6K A;  4PAK A;  2XWO A;  4PBH A;  4OVR A;  4PAF A;  4N17 A;  4DI3 D;  4OVP A;  5I5P A;  4UAB A;  4N8Y A;  4N4U A;  4OVQ A;  4P3L A;  4P1L A;  3U65 A;  4PDD A;  4NX1 A;  2HPG A;  4PFB A;  4P47 A;  4PDH A;  4P8B A;  2HZL A;  4NQ8 A;  4OVS A;  2PFZ A;  4MIJ A;  4MEV A;  4N15 A;  4NN3 A;  4O8M A;  4X8R A;  5LTC A;  4PBQ A;  3FXB A;  4PE3 A;  4XFE A;  2PFY A;  4N6D A;  2V4C A;  2XWV A;  4LN5 A;  4O7M A;  5IZZ A;  2CEX A;  4PCD A;  5IM2 A;  4PET A;  4OA4 A;  4MAG A;  4MHF A;  4O94 A;  3GYY A;  4NHB A;  4NGU A;  4MX6 A;  5CM6 A;  4NG7 A;  4XEQ A;  2XWI A;  2XWK A;  4MMP A;  4PFI A;  4XF5 A;  2ZZW A;  4YZZ A;  4PGN A;  4MNP A;  5I7I A;  5IGA A;  4PAI A; 
#chains in the Genus database with same CATH topology
 1IIT A;  2G29 A;  3E79 A;  2H5Y A;  5DYH A;  1FBP A;  4GWZ A;  2XX8 A;  1F9B A;  2F7A A;  1T0K A;  2PX1 A;  1N04 A;  4HE0 A;  3PPO A;  4OZ9 A;  2RIN A;  3S9E A;  4ZZA A;  1FPF A;  1IEJ A;  4QRZ A;  5BWJ A;  3DM0 A;  2XXI A;  3R7X A;  2AYS A;  1MXZ A;  2QPQ A;  4YKI A;  3THI A;  4PFU A;  1IIW A;  2R8T A;  4LQ2 A;  3TCG A;  3FV2 A;  5EYF A;  1N3X A;  2MKZ A;  1VFE A;  2OBG A;  1SYI A;  4KCD A;  3G7W A;  4G4P A;  4NX1 A;  5I58 B;  1B1H A;  4ZEC A;  5H8H B;  3S9L C;  3H6W A;  3RPL B;  5IZ3 B;  3OOA A;  3JZJ A;  4GWW A;  1FPD A;  1FJ9 A;  1JQF A;  2CMO A;  1RYX A;  3NOH A;  1II5 A;  4YAH X;  1US4 A;  3DP8 A;  3GBA A;  4JSD A;  3RTW B;  4KYE A;  2DP8 A;  3O9P A;  4Z7E A;  2VP1 A;  3LSW A;  3FVN A;  3B6Q A;  2OX3 A;  4H1X A;  4NF6 B;  1Y3N A;  2F36 A;  4JWY A;  4WKM A;  3UGW A;  1FQA A;  1BTJ A;  5JEI A;  2I4C A;  4OEN A;  2Z8E A;  5H8S A;  3RLF E;  1SYH A;  1LFI A;  1QGX A;  2ESN A;  1NV1 A;  3K6V A;  1N76 A;  2P2A A;  1CB6 A;  3VVE A;  3SEW A;  1I6Q A;  1FBG A;  3CR9 A;  4K3F A;  3RY3 A;  2DSF A;  1XC1 A;  4U4X A;  3K6X A;  4E0X A;  4LZ7 A;  2IA4 A;  1Y4C A;  3MVW A;  3HPI A;  4ZEI A;  2I58 A;  2ZMB A;  4POX A;  1B5J A;  3G3I A;  3PPQ A;  1FTL A;  1LBB A;  4DXU A;  4OXV A;  2O68 A;  4RY1 A;  3MZ1 A;  3UN6 A;  3QSL A;  3B6W A;  3ZS6 A;  3M3K A;  4F18 A;  3IJO B;  4F39 A;  2ZYN A;  1MPD A;  3Q28 A;  3PMV A;  4BDL A;  3K1P A;  5I2K B;  3HO7 A;  3RYD A;  3L6H A;  3LSF B;  4N8Y A;  3MUQ A;  2V3T A;  1Y1Z A;  4OQO A;  4U1Z A;  3Q25 A;  2ONR A;  2PFZ A;  2NUV A;  1CE2 A;  2P0S A;  1Y4T A;  2PFY A;  1YTV A;  1XVY A;  1H43 A;  1G0H A;  2V4C A;  2XWV A;  2ABH A;  5HM4 B;  4GLI A;  2I6E A;  4HTG A;  4R2B A;  4I9D A;  2M8C A;  4XTC Q;  1POT A;  2P1S A;  4I3Y A;  1YXI A;  3IOW A;  5CMK A;  3MPK A;  1MQG A;  2Z22 A;  4FEB A;  2Y5K A;  4YKK A;  2HEU A;  4GXA A;  2DE2 A;  3H4Z A;  3OEN A;  4POW A;  5ET8 A;  4TQU Q;  1FPI A;  2V3U A;  3M3L A;  4WEP A;  3QMF A;  1MQD A;  4AQ4 A;  2Q2C A;  3FAT A;  1USY H;  4XXU A;  3RNN A;  1UTH B;  5A5L A;  3BFU A;  2I48 A;  4RJZ A;  4GX6 A;  3LSL A;  1FPE A;  2R6G E;  4H8J A;  3K1N A;  4QF9 A;  4GIZ A;  3WAF A;  1HSJ A;  4X04 A;  1WDN A;  3V83 A;  3CRB A;  1A55 A;  4F22 A;  3G3K A;  3LBS A;  1DMB A;  3W9V A;  4P9K A;  3R26 A;  3H3G A;  4H46 A;  3UOR A;  3KGC A;  2Y5L A;  1TT1 A;  2WBB A;  1SI0 A;  4Q8R A;  1EU8 A;  2HCA A;  5K2X A;  3SEY A;  3T96 B;  4F1Y A;  4IB2 A;  4OVQ A;  3KJ7 A;  2UYE A;  1PBP A;  1LEV A;  4AS4 A;  3CFZ A;  4N15 A;  3TDJ A;  1B2H A;  2HAV A;  1FBE A;  4PBQ A;  2FA7 A;  3FXB A;  2PCR A;  1MDP 1;  5M2V A;  1JW4 A;  4GWU A;  3EN3 A;  5AA3 A;  5K2Y A;  1FJ6 A;  5B7D A;  4FJP A;  3PUV E;  1MXV A;  2GQ1 A;  1MY4 A;  1IME A;  1FQF A;  2I0B A;  2LAO A;  3C33 A;  2VT5 A;  3FVG A;  1FBC A;  1B3L A;  3B6T A;  3EKI A;  4NF5 A;  3IOU A;  5I2N B;  1I69 A;  4KXP A;  5DEX A;  3CSG A;  3RT6 B;  1OIB A;  2QSX A;  3BFT A;  1OVB A;  3PMW A;  1LAX A;  1FPL A;  2E1S A;  2XXV A;  3UP9 A;  4MLQ A;  4C0R A;  3F11 A;  1RKM A;  4IO7 A;  1B7Z A;  4BDQ A;  5B70 A;  2GFE A;  3E13 X;  1JEU A;  4LQ5 A;  4M1V A;  1URD A;  1B58 A;  2QS3 A;  3QYT A;  3VDF A;  3G3F A;  3C36 A;  3H6T A;  4F3P A;  1MY2 A;  1FQD A;  5EQ9 A;  3K00 A;  2B3F A;  4OFL A;  2Y84 A;  3KEI A;  4N17 A;  4RA1 A;  2FBP A;  3KSX A;  4U1O A;  3U65 A;  3SKP A;  5AE4 A;  4GXS B;  1XS5 A;  4ELO A;  4X8R A;  4EQ7 A;  4X1B A;  2DQV A;  3IO6 A;  2F78 A;  4KI0 E;  4PFW A;  3IOV A;  1B0H A;  4EDP A;  1EYK A;  2F34 A;  3T0J A;  1RDX A;  1CNQ A;  1N7W A;  2DVZ A;  5BUU A;  1B46 A;  1N3W A;  3MZ9 A;  1O63 A;  3OEL A;  5CM6 A;  5DVI A;  4NG7 A;  2B3B A;  3EF7 A;  2XWK A;  3RPW A;  2PMS A;  4ZEF A;  5H8F A;  1SBP A;  4NMY A;  2PYY A;  2CZK A;  4ELQ A;  1A8E A;  4MNI A;  1MXY A;  4JWO A;  5TPA B;  5AA2 B;  5KZT A;  4P56 A;  2QVV A;  1IZ1 A;  1US5 A;  4P0I A;  3U93 A;  4JVD A;  4IY5 A;  4G8H A;  4F1U A;  1JW5 A;  3I6V A;  4R72 A;  4JDF A;  3OMB A;  1EZP A;  2RC7 A;  3A3C A;  2DE3 A;  3MST A;  4O3B A;  5I56 A;  5AA4 A;  3KZG A;  4GWO A;  4G68 A;  4C1T A;  4MH5 A;  4OMB A;  3ECR A;  4ONY A;  4NQ8 A;  5EQA A;  4LON B;  1EYI A;  1S7Y A;  2DWJ A;  3OO6 A;  4H65 A;  4N6P A;  4NN3 A;  3MZB A;  3Q26 A;  4NWC A;  2Y7P A;  4QSC A;  2H9B A;  4PE3 A;  3MW0 A;  3OEK A;  4XKP A;  2OWZ A;  1OQH A;  1NV3 A;  4OFJ A;  4JB7 A;  4G61 A;  2ONK E;  3C31 A;  2DE4 A;  3DP6 A;  1P1W A;  4QBA A;  4PCD A;  1S9T A;  2XX7 A;  4GX3 A;  3QUJ A;  2NOO A;  2OK2 A;  3E9X A;  2F97 A;  2RF1 A;  2WBD A;  3SZP A;  1OLC A;  3EHT A;  4I8C A;  1MXX A;  4QSE A;  1Q9D A;  3PPR A;  2H99 A;  4G68 C;  1P1N A;  4HS7 A;  1FTA A;  1LB9 A;  1M5C A;  1SW1 A;  1FQE A;  3HCQ A;  4AB5 A;  4WXJ A;  5I57 A;  1Y1M A;  1FTK A;  4PF6 A;  1NV2 A;  1DBZ A;  4R9F A;  1NV0 A;  4KQP A;  1B51 A;  2V93 A;  5L9S A;  3ISP A;  5ET5 A;  1NMU A;  4TLM B;  1B3H A;  3O6G A;  2WYK A;  4FAT A;  4QFP A;  4N8G A;  2B4M A;  1IXG A;  1SW5 A;  4FOR A;  4PBH A;  4ISU A;  1VR5 A;  1ZU0 A;  5IAI A;  1IMF A;  3GLB A;  3IFA A;  5L8D A;  2XX9 A;  3H6U A;  3HFU A;  3MP8 A;  1S50 A;  4ZEK A;  2UVJ A;  3V89 B;  2DS9 A;  3TEP A;  4FED A;  4Q0C A;  3VLU A;  4FBP A;  1D9V A;  1Y20 A;  3D4G A;  1SW4 A;  1MRP A;  4KCC A;  2KQZ A;  2F3D A;  5JTY B;  4U21 A;  1UTB A;  4YMA A;  1WVJ A;  2HHM A;  4DLD A;  5IKB A;  1M5E A;  3U1O A;  3LR1 A;  2XHD A;  3CVG A;  4MX6 A;  3FZV A;  1NH7 A;  3QUF A;  2ZZW A;  2RC8 A;  3O29 A;  5F1Q A;  4UA8 A;  4OEV A;  3KOS A;  1NUW A;  1MQJ A;  3T66 A;  3EHU A;  4MNC A;  1EZ9 A;  2D3I A;  1IMA A;  2XXP A;  3KOT A;  4HE1 A;  3VFJ A;  4NED A;  4JVI A;  3CFL A;  2HQ0 A;  1Y3P A;  1B1X A;  3SEX A;  4IO3 A;  2DVC A;  2QVU A;  3TTR A;  3KN8 A;  2ZNS A;  5DVF A;  1EYJ A;  4QSD A;  1H76 A;  4L17 A;  1B32 A;  1SI1 A;  4H0W A;  4PTK A;  1J1N A;  3UIF A;  1A40 A;  4ZE9 A;  1XI6 A;  2DYX A;  1M5D A;  3UK4 A;  2XWO A;  1LST A;  3SEU A;  2ONS A;  3T9X B;  4PE5 B;  2OZZ A;  4NTL A;  1URS A;  3ZSF A;  4R2F A;  1BIY A;  2XXY A;  3ODB A;  3HHG A;  4MIJ A;  5LTC A;  1FQB A;  1FBH A;  4GBV A;  1FPJ A;  3B8B A;  4YB7 A;  5AA2 D;  3ILU B;  1MY3 A;  1KZ8 A;  1Y9U A;  1NNP A;  2W7Y A;  2BJI A;  2OWS A;  5TU0 A;  5I3S A;  4DCX A;  3FXQ A;  4XEQ A;  4O7I A;  3OD7 A;  3IR1 A;  5ESY A;  2L5V A;  2Q88 A;  3ILT B;  2A5T A;  1XOC A;  3IB0 A;  3RPL A;  2I3V A;  5J1D A;  3IB2 A;  4P1E A;  4ESW A;  3KJT A;  1GR2 A;  3IX1 A;  2O6A A;  4PF8 A;  1AMF A;  4UAC A;  3FVK A;  2Z8F A;  4JXI A;  4OVT A;  1K9Y A;  3K0V A;  1IMC A;  1MPC A;  1MS7 A;  2V25 A;  3SET A;  3VVD A;  4KD5 A;  3ZKL A;  5DEX B;  2WKY A;  2Q2A A;  1B05 A;  5EQ7 A;  1NNK A;  3TFL A;  5ET6 A;  4HW8 A;  1FRP A;  4ELR A;  5I59 A;  5TP9 A;  2XXT A;  4NE4 A;  4OES A;  3OSQ A;  4OVP A;  3Q27 A;  5J16 A;  2UVI A;  1YCJ A;  1D3K A;  3C34 A;  4PDD A;  4R75 A;  3FXU A;  3K2D A;  1NFT A;  4EQ9 A;  1I6B A;  4N07 A;  4HXV A;  3TTM A;  4OVS A;  3V5A A;  2ZYM A;  1N7X A;  2FIX A;  4M4G A;  4GWS A;  1IQ7 A;  5ISU A;  5CBR A;  4MJO A;  5H8N B;  4C1U A;  3O6H A;  4N6D A;  1NUY A;  1LBX A;  1MQH A;  4LUB A;  2I49 A;  4F3B A;  1SW2 A;  3KBZ A;  2I3W A;  3TUS A;  3RN8 A;  5DTB A;  4PET A;  1MM6 A;  3G3G A;  3FUZ A;  3N5L A;  5HPQ A;  5ICT A;  2YLN A;  4IGR A;  3N26 A;  3A09 A;  1JVY A;  4WED A;  4LA9 A;  4H45 A;  3ZKK A;  3C35 A;  1JVX A;  2XWI A;  4R9G A;  5CMB A;  4PFI A;  4XF5 A;  1IUD A;  1EZO A;  1MY1 A;  4X1D A;  4JBZ A;  1PB8 A;  4PP0 A;  3MVZ A;  4RK2 A;  3VE1 B;  2WX9 A;  3LSX A;  1DOT A;  2FYI A;  2XD3 A;  3S9M C;  2Z23 A;  2F35 A;  1LLS A;  1B4Z A;  3QIM A;  2ALU A;  4PFR A;  2QMX A;  4KR5 A;  3TTL A;  1B5H A;  3MP1 A;  4H67 A;  4OER A;  1P1Q A;  2I4B A;  2AL5 A;  2QFL A;  3QXM A;  5H8F B;  2H98 A;  1VE4 A;  4YMB A;  1LGB C;  4PFY A;  1AH5 A;  2THI A;  1Z7M E;  4P0G A;  1NNF A;  3BIG A;  1AOV A;  5EHM A;  1URG A;  1FQC A;  3K1M A;  1NUZ A;  3S2V A;  1LB8 A;  4FEC A;  2YPN A;  4EXK A;  4OFO A;  1DCU A;  3TZA A;  2Q8J A;  1KWH A;  3PD9 A;  4PFB A;  5F7V A;  1QUI A;  3CI8 A;  2O51 A;  4RYA A;  4I3E A;  2DXY A;  1UQW A;  4MEV A;  5KCJ A;  1UTH A;  1P99 A;  4IO5 A;  1YYZ A;  5CBS A;  2DDK A;  3TPA A;  4BDN A;  4X9T A;  5I56 B;  5AA4 B;  1A54 A;  4NWD A;  2JJK A;  4G68 B;  4GD5 A;  1QW0 A;  4OHN A;  4GOT A;  5IM2 A;  3O6I A;  3LC8 A;  3QK6 A;  3DP4 A;  4KFQ A;  3I3V A;  4RNS A;  1K9Z A;  4O3C A;  2Y7R A;  4YB6 A;  1UIU A;  1A8F A;  1YPN A;  3P7I A;  3OXN A;  2DWH A;  1PBQ A;  4MLV A;  4AS5 A;  2DWI A;  2R9J A;  3MP6 A;  4MNP A;  4NF8 A;  3MVX A;  1LBZ A;  4R74 A;  2I0C A;  4U2R A;  3SES A;  1P1O A;  2H25 A;  3OEM A;  2FNC A;  1FTO A;  3HN0 A;  3VV5 A;  2A5S A;  3CSB A;  4NF4 B;  1IXI A;  4PC9 A;  4H8I A;  1B5I A;  2F5X A;  3PD8 A;  3N94 A;  4XKR A;  2PT2 A;  4YU0 A;  4P11 A;  3KFM A;  4DZ1 A;  1QUJ A;  3TCH A;  1TFA A;  3K6U A;  5A5X A;  4IO6 A;  4JVC A;  3TEL A;  4BDM A;  2VPN A;  4BLA A;  1GVC A;  1ZIU A;  4KYS A;  5KDT B;  4ESX A;  4YIC A;  5ITP A;  2HXR A;  4EF2 A;  5I57 B;  4N6K A;  3FJM A;  5DVJ A;  4DXC A;  3FBP A;  2FHY A;  3OO9 A;  1KA1 A;  4N13 A;  1FPB A;  1A7L A;  3IOT A;  2V84 A;  4X48 A;  4GL0 A;  4TOZ A;  1RDZ A;  3T9H B;  4AB6 A;  4GL8 A;  3K02 A;  3FAS A;  1DPE A;  4I62 A;  3H06 B;  4TLL B;  4YKP A;  3SEV A;  2KLF A;  4GFR A;  1O7T A;  1JW1 A;  1LFG A;  3KC0 A;  2XXW A;  4DCY A;  2REJ A;  2GHB A;  1KA0 A;  3KN3 A;  4QFK A;  1G0I A;  4ZS9 A;  2E0S A;  2NXO A;  1MM7 A;  1NNT A;  4KHZ E;  5H8Q A;  1TXF A;  4YZZ A;  2RCB A;  5JK4 A;  2NWJ A;  3TYH A;  2CZH A;  4MCO A;  1VSO A;  2XXH A;  3VLV A;  1B7U A;  1VFD A;  4RK9 A;  2X26 A;  2F6P A;  1SPI A;  1FTJ A;  2PT1 A;  4ND9 A;  3HHF A;  3B50 A;  1OMP A;  2F3B A;  2RKM A;  3GBB A;  1NI9 A;  1YZ0 A;  3TOD A;  3RTF B;  3RQT A;  3PUW E;  4XIG Q;  3MAM A;  4R6K A;  4F2Q A;  3KC1 A;  3QAX A;  3CIJ A;  4NAP A;  3MC2 A;  4EXL A;  3VLW A;  3D1R A;  4JWX A;  5ELV A;  1MG1 A;  5EYH A;  1Q35 A;  2HXW A;  4EUO A;  4GF8 A;  3PU5 A;  2HFB A;  2Q9T A;  4P47 A;  3BBR A;  3AXF A;  1AWB A;  3T9V A;  1NUX A;  4EF1 A;  3H03 A;  2F8D A;  2O69 A;  4N81 A;  1HSL A;  3W9W A;  5AA2 A;  3E78 A;  1H45 A;  4I1D A;  4XFE A;  3MPL A;  1B52 A;  1QKB A;  1EH3 A;  4QFL A;  2PVU A;  1QKA A;  1RYO A;  4QXD A;  3JYR A;  4U4S A;  1NH8 A;  4GRK A;  3S9N C;  4OA4 A;  4MAG A;  3MWB A;  2RC9 A;  3C4M A;  4MHF A;  1FPK A;  2ANJ A;  4DIG A;  1FPG A;  3FJ7 A;  4IGT A;  1MQI A;  1A99 A;  3U92 A;  3PUX E;  1IMD A;  4GBW A;  3O66 A;  3USD A;  1BK4 A;  4U23 A;  3M3F A;  1SD3 A;  2O84 X;  1R1N A;  3UA8 A;  4BDR A;  2YJP A;  4U22 A;  4FIM A;  2XA5 A;  1H44 A;  1NL5 A;  1NKX A;  4OAN A;  2F6G A;  3K01 A;  2ZNU A;  2X7P A;  4GX4 A;  3OO8 A;  2XXX A;  3LUY A;  2A5T B;  2Q89 A;  1GTK A;  4LP2 B;  4EQB A;  4DE8 A;  2R71 A;  2VD2 A;  3DLN A;  5EQ8 A;  1RDY A;  2RCA A;  4THI A;  3I5O A;  4PAF A;  3VXC A;  5I5P A;  3S4U A;  2GRV A;  3U72 A;  4E0W A;  4P3L A;  4ECF A;  4LZ8 A;  1B3E A;  2O7U A;  3M8U A;  3D4C A;  4LZ5 A;  1UIV A;  3RUM A;  5I84 A;  3PMX A;  4F19 A;  5AA1 A;  3IO4 A;  5I59 B;  5TP9 B;  2P3V A;  5EYG A;  4ZDM A;  3U8Q A;  1LAH E;  2D21 A;  1HSE A;  1QVS A;  3G3H A;  2CEX A;  1IMB A;  3KN7 A;  1DTG A;  3PPP A;  4OTE A;  2QRY A;  5CRY A;  2ZYO A;  2XD2 A;  3TQW A;  2QS1 A;  2XXQ A;  1MH3 A;  3FJG A;  3O28 A;  2QS2 A;  3BKI B;  1N0T A;  3CHG A;  4PGN A;  1D9Y A;  5FTI A;  2UYF A;  3C32 A;  4Q5T A;  3R6U A;  3MJN A;  3CG1 A;  3GZG A;  2ZYK A;  5CMM A;  2WYP A;  5ICQ A;  3E4R A;  1QUL A;  4N91 A;  3TQL A;  3PPN A;  1ZBM A;  1LCT A;  1B9J A;  3IB1 A;  5JTY A;  1D9Q A;  2V3Q A;  5F24 A;  1B3G A;  5I58 A;  3C9H A;  5H8H A;  5IZ3 A;  4ZED A;  3JV9 A;  4O3A A;  2OLB A;  4MFI A;  2OWT A;  4UAB A;  2G93 A;  1VDW A;  4N4U A;  4PFT A;  2VHA A;  4NF6 A;  2UVH A;  2VD3 A;  4NF5 B;  4PDH A;  3O2A A;  3T93 B;  2XXU A;  1L5T A;  4F3S A;  5T3J A;  2ZNT A;  3FD3 A;  4GWX A;  4O8M A;  4F29 A;  1LAG E;  3H6V A;  3T1B A;  3FV1 A;  4H5G A;  5CC2 A;  5ET7 A;  1XVX A;  4OET A;  1JP4 A;  4PQJ A;  2DOJ A;  1FTM A;  3TTN A;  1Z7N E;  4LN5 A;  4I40 A;  4QHQ A;  5EHS A;  1LAF E;  1ZLQ A;  5KCJ B;  1QUK A;  3PV0 E;  4O94 A;  4FAJ A;  1PEB A;  1OQG A;  4HCY A;  4F31 B;  2H4I A;  1LBW A;  1NV4 A;  4QFN A;  4H6D A;  4LVQ A;  5IGA A;  3TKD A;  1SVX B;  4OVJ A;  2B65 A;  1P1U A;  2HZK A;  2QS4 A;  5DW8 A;  3BIH A;  3KG2 A;  3A3U A;  1MY0 A;  1M5B A;  2ZZX A;  4IY6 A;  4RPN A;  5I2K A;  4NF8 B;  4F2O A;  5FBP A;  2CEY A;  1H3D A;  3Q29 A;  1JEV A;  3WAE A;  1LFH A;  2GHA A;  2NVU B;  3EHS A;  1B6H A;  4XKN A;  4PAK A;  1B7H A;  4OVR A;  5A5X B;  3CFX A;  1FW0 A;  5FHN A;  1D4N A;  4P1L A;  5FHO A;  4IR8 A;  1BP5 A;  1R6Z A;  4ZEB A;  4IO4 A;  1Q1K A;  2B4L A;  3KBR A;  3U94 A;  4QFO A;  1NV5 A;  3VVF A;  1DSN A;  1GV8 A;  3T22 A;  1LBV A;  1ANF A;  2F7C A;  2O1M A;  1R9L A;  2Y7W A;  3FIR A;  1WOD A;  3FGS A;  4O7M A;  2IEE A;  3ROJ A;  2X7Q A;  1IXC A;  3OO7 A;  3K6W A;  2F7B A;  2KR0 A;  3N6U A;  3GYY A;  4DDD A;  5L9M A;  4NGU A;  3SER A;  3IOR A;  4GQO A;  2DWA A;  1MXW A;  2CZL A;  4GVO A;  3GXA A;  4JSO A;  3W15 C;  1I6A A;  4GWY A;  3MBP A;  4DI4 B;  1INP A;  2Y7K A;  2P3N A;  3B7D A;  3K4U A;  2Q8M A;  1ZKB A;  4F3G A;  1GGG A;  3TAJ A;  4XKQ A;  3OSR A;  4Q30 B;  1N84 A;  3RGY A;  1POY 1;  1FCK A;  3TTK A;  5H8Q B;  2DXR A;  5H8N A;  4Z0I A;  2VPO A;  2UVG A;  3IFC A;  2PBW A;  2AIX A;  3EQ1 A;  4G8N A;  4NF0 A;  5IZ1 A;  4LAT A;  2QL3 A;  2XXR A;  3MYU A;  4IO2 A;  3RT8 A;  4OEU A;  2QVR A;  4FE8 A;  1TWY A;  1SDX A;  1XT8 A;  1MPB A;  1USY E;  4DI3 D;  4KYD A;  4OYV A;  1ATG A;  2FVZ A;  4ZE8 A;  4MF3 A;  2OCU A;  2HPG A;  2WEF A;  3KSJ A;  3SDF A;  2Z8D A;  1M5F A;  2BJJ X;  1PC3 A;  1LCF A;  1B4H A;  3ONM A;  1FBD A;  2HAU A;  1FBF A;  1OLA A;  1YAE A;  1LBY A;  3H7M A;  5LOM A;  3L6G A;  5IZZ A;  5FHM A;  2CZI A;  2O1L A;  3TMG A;  1BLF A;  3EPE A;  1QJM A;  5I2N A;  4NHB A;  4G2Z A;  2AL4 A;  2Q74 A;  2VOZ A;  1MDQ A;  4R6Y A;  1AIV A;  4MMP A;  2O7I A;  3LV0 A;  5CI5 A;  3TCF A;  3PGF A;  4G77 A;  1IXH A;  4R6H A;  3MVY A;  4HE2 A;  4RXL A;  3N6T A;  4G8M A;  3T9U A;  3IAZ A;  3PTY A;  4KPT A;  2QMW A;  3IL1 B;  1Y3Q A;  1PB9 A;  3FXR A;  1ELJ A;  2ZXT A;  4HCW A;  1UTB B;  2FIE A;  1JNF A;  2ZZV A;  1DK4 A;  3CG3 A;  5DT6 A;  3HST A;  4PGP A;  1MXU A;  3E3K A;  2REG A;  5CMC A;  3A29 A;  1ZTY A;  2XXK A;  1NV7 A;  3PUY E;  4F1V A;  5L9O A;  4OWD A;  2VGQ A;  1ZMG A;  1DPP A;  4MBP A;  3FVO A;  4P8B A;  2HZL A;  2GH9 A;  1FSA A;  1MH4 A;  1JET A;  4BDO A;  5LDZ A;  1SQY A;  4NF4 A;  3V8X B;  1PB7 A;  3MQ9 A;  1B40 A;  4YKJ A;  1LBC A;  1R9Q A;  5HBC A;  4YB5 A;  3PUZ E;  2UXA A;  2OJT A;  5FTH A;  1DTZ A;  1ZJL A;  3G3J A;  3HV1 A;  1B0L A;  4H5F A;  1O64 A;  2D5W A;  3O97 A;  5ITO A;  4ZZE A;  1AL3 A;  5KDT A;  5TPA A;  3IJX B;  1B3F A;  4RPO A;  3IK6 B;  4ELP A;  4R73 A;  1BKA A;  1NV6 A;  3LUZ A;  1PDA A;  1XHY A;  3VXB A;  1OVT A;  2Y7I A;  2QJE A;  4DXB A;  1TFD A;  5I7I A;  3DEL B;  4PAI A; 
#chains in the Genus database with same CATH homology
 2WX9 A;  4MNI A;  3E79 A;  1FBP A;  4PFR A;  4GWZ A;  2WYP A;  4P56 A;  2QFL A;  4HE0 A;  4N91 A;  2QVV A;  1FPF A;  1D9Q A;  2V3Q A;  5F24 A;  3BIG A;  4JVD A;  4F1U A;  5IZ3 A;  2QPQ A;  2R8T A;  1NUZ A;  2DE3 A;  2MKZ A;  3MST A;  4UAB A;  1DCU A;  1VDW A;  4N4U A;  4NX1 A;  4PFB A;  4PDH A;  3RPL B;  5IZ3 B;  4NQ8 A;  5EQA A;  5T3J A;  1EYI A;  4I3E A;  4MEV A;  4GWW A;  1FPD A;  4GWX A;  4NN3 A;  4O8M A;  1FJ9 A;  3T1B A;  5ET7 A;  1YYZ A;  4PE3 A;  2DDK A;  3NOH A;  2OWZ A;  4X9T A;  1JP4 A;  1NV3 A;  4G61 A;  2JJK A;  4LN5 A;  2DE4 A;  2OX3 A;  4QBA A;  4I40 A;  4PCD A;  5IM2 A;  4GX3 A;  1K9Z A;  4O94 A;  4HCY A;  1QGX A;  1NV1 A;  1LBW A;  1NV4 A;  2WBD A;  3SZP A;  1FBG A;  4AS5 A;  4MNP A;  5IGA A;  1Q9D A;  1LBZ A;  2HZK A;  5DW8 A;  1FTA A;  3BIH A;  4PC9 A;  2F5X A;  2ZZX A;  4PF6 A;  1NV2 A;  1DBZ A;  4JVC A;  1NV0 A;  2VPN A;  5FBP A;  3ISP A;  5ET5 A;  2CEY A;  4F18 A;  2WYK A;  4YIC A;  4N8G A;  2B4M A;  2HXR A;  4N6K A;  4PAK A;  4PBH A;  4OVR A;  3RYD A;  3FBP A;  2FHY A;  1IMF A;  3IFA A;  1KA1 A;  4N8Y A;  1FPB A;  4P1L A;  3HFU A;  4IR8 A;  1RDZ A;  2B4L A;  2PFZ A;  1NV5 A;  4FBP A;  1LBV A;  2PFY A;  1G0H A;  2V4C A;  2XWV A;  2KQZ A;  2F3D A;  4O7M A;  3ROJ A;  3KC0 A;  2HHM A;  4I3Y A;  1YXI A;  1KA0 A;  2KR0 A;  3GYY A;  1G0I A;  4NGU A;  2Y5K A;  4MX6 A;  2DE2 A;  2ZZW A;  4YZZ A;  5ET8 A;  5JK4 A;  1FPI A;  2CZH A;  3QMF A;  4MCO A;  4GWY A;  4DI4 B;  1INP A;  2P3N A;  2Q8M A;  1NUW A;  5A5L A;  1SPI A;  4MNC A;  1IMA A;  4HE1 A;  4GX6 A;  3B50 A;  4JVI A;  2F3B A;  1FPE A;  2VPO A;  1NI9 A;  3IFC A;  1YZ0 A;  4NF0 A;  5IZ1 A;  2QVU A;  4X04 A;  1EYJ A;  3KC1 A;  4PTK A;  3MYU A;  4NAP A;  2QVR A;  3W9V A;  1XI6 A;  4P9K A;  4H46 A;  3D1R A;  2XWO A;  2WBB A;  2Y5L A;  4DI3 D;  5EYH A;  2FVZ A;  4OVQ A;  2HPG A;  1LEV A;  2WEF A;  2Q9T A;  4P47 A;  4AS4 A;  1AWB A;  4MIJ A;  4N15 A;  1NUX A;  5LTC A;  4N81 A;  1FBE A;  4PBQ A;  3W9W A;  1FBD A;  3FXB A;  2PCR A;  3E78 A;  1FBF A;  4XFE A;  1FBH A;  4GBV A;  1FPJ A;  3B8B A;  1LBY A;  4GWU A;  1KZ8 A;  1FJ6 A;  5IZZ A;  2BJI A;  4QXD A;  2CZI A;  5I3S A;  2GQ1 A;  4OA4 A;  4MAG A;  1IME A;  4MHF A;  1FPK A;  1FPG A;  4NHB A;  2Q74 A;  4XEQ A;  1IMD A;  4GBW A;  4MMP A;  2VT5 A;  4O7I A;  3LV0 A;  1BK4 A;  5ESY A;  2L5V A;  1FBC A;  3EKI A;  3RPL A;  4HE2 A;  5J1D A;  4KXP A;  4P1E A;  2XA5 A;  3PTY A;  4OAN A;  4PF8 A;  4GX4 A;  4OVT A;  1FPL A;  4HCW A;  1K9Y A;  2FIE A;  1IMC A;  2ZZV A;  1DK4 A;  5EQ8 A;  1RDY A;  4M1V A;  4PGP A;  5EQ7 A;  5ET6 A;  3A29 A;  2XXK A;  1FRP A;  5EQ9 A;  4PAF A;  1NV7 A;  4N17 A;  2FBP A;  4OVP A;  4F1V A;  5I5P A;  5J16 A;  4P3L A;  3U65 A;  4PDD A;  4P8B A;  2HZL A;  1FSA A;  4HXV A;  4OVS A;  5LDZ A;  4X8R A;  4F19 A;  2FIX A;  4GWS A;  4MJO A;  2P3V A;  5EYG A;  4N6D A;  1NUY A;  1LBX A;  1EYK A;  3T0J A;  2CEX A;  1IMB A;  3KBZ A;  1RDX A;  1CNQ A;  4PET A;  2DVZ A;  4H45 A;  5CM6 A;  4NG7 A;  1NV6 A;  3LUZ A;  2XWI A;  2XWK A;  4PFI A;  4XF5 A;  3CHG A;  4PGN A;  5I7I A;  4PAI A;  2CZK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...