4O7MA

Crystal structure of a trap periplasmic solute binding protein from shewanella loihica pv-4, target efi-510273, with bound l-malate
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
304
structure length
304
Chain Sequence
PTEIKFSHVVAENTPKGQMALKFKQLVEERLPGEYQVNVFPNSQLFGDNNELSALLLNDVQFVAPSLSKFERYTKKLQLFDLPFLFKDMDAVNRFQQSDAGQQLLNSMKRKGVVGLGYLHNGMKQFSASSPLVLPEDAQGKKFRIMASDVLAAQFQAVEAIPVKKPFSEVFTLLQTRAIDGQENTWSNIYSKKFYEVQSNITESNHGVLDYMVVTSNTFWKSLPADKRKVIKASLDEAIAYGNEIAAAKVNKDKQAIIDSKRSEVTYLTPEQRAAWVNAMKPVWAQFEDKIGKDLIDAAVASNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords TRAP dicarboxylate transporter, DctP subunit
publication title Experimental strategies for functional annotation and metabolism discovery: targeted screening of solute binding proteins and unbiased panning of metabolomes.
pubmed doi rcsb
source organism Shewanella loihica
total genus 106
structure length 304
sequence length 304
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-12-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4o7mA00
4PGPA 4XF5A 4OVTA 4PFRA 2VPOA 4YICA 2CEYA 4MCOA 4MMPA 3U65A 2XWIA 4NAPA 4NGUA 5I5PA 4PE3A 4MNPA 4NHBA 4UABA 4PF6A 4N6DA 4PCDA 2XXKA 4PFIA 4MIJA 4OVRA 2HPGA 3B50A 4XFEA 2HZLA 4NN3A 2V4CA 4N15A 4NQ8A 2ZZXA 4PBQA 2WX9A 5CM6A 4LN5A 4PGNA 4PFBA 4P3LA 4N6KA 2XA5A 4DI4B 4XEQA 2HZKA 4MNIA 4OVQA 5I7IA 4DI3D 4X04A 2PFYA 4PAFA 4MAGA 4O8MA 4P47A 5IZZA 2WYKA 4MNCA 4MHFA 4PBHA 4PAKA 4MX6A 2CEXA 4P8BA 4P9KA 4OA4A 4N17A 4PDDA 4PDHA 4NX1A 4O7MA 4O94A 5IM2A 2XWKA 4NF0A 4N4UA 2PFZA 2ZZVA 4N8GA 4NG7A 4PAIA 4P1EA 4PC9A 4PETA 5IGAA 2XWVA 3FXBA 4P1LA 2ZZWA 4P56A 2WYPA 5LTCA 4N91A 4YZZA 4N8YA 4OANA 2XWOA 4X8RA 4PF8A 4OVPA 2VPNA 4OVSA 3GYYA 4MEVA
chains in the Genus database with same CATH superfamily
1FPBA 4MLVA 3Q28A 1DCUA 1VDWA 4KI0E 3U65A 3T22A 4ZDMA 1URDA 1DK4A 1KZ8A 3MP8A 4NHBA 1A8FA 4L17A 4XKRA 1QGXA 3T1BA 3DLNA 4F1YA 4OYVA 1I6AA 4QFKA 3V5AA 4N15A 5DT6A 4F2OA 2R9JA 2OCUA 2RC7A 3MVZA 5CI5A 3DELB 1TFDA 1FJ6A 4AQ4A 3E9XA 4MBPA 3PUYE 2Y5KA 1FBHA 2Q89A 4O8MA 4U2RA 5HPQA 4GBWA 2I6EA 3HFUA 1B7ZA 1ZU0A 2PT2A 4O3AA 4F1UA 1R9QA 4AB5A 2D3IA 3C35A 3K1MA 5H8SA 3IK6B 4JVIA 2ONSA 1FPEA 4PDDA 5H8NB 3G7WA 4GWOA 4F2QA 4OERA 4OWDA 4ZEKA 2FVZA 3KOSA 4U1ZA 1Q1KA 2ZYMA 4ESWA 4YMAA 5EQ7A 1B1HA 4QF9A 5F1QA 4ZZAA 1RYXA 2GHAA 1IXHA 3TMGA 4IO3A 2F8DA 1N7WA 3VDFA 3H3GA 4EXKA 3AXFA 2WKYA 4ECFA 1QVSA 4OETA 4YICA 1DMBA 2XXHA 2CZKA 1R6ZA 1LFGA 3MP6A 4PE3A 1NV0A 2D5WA 1FTMA 3PMWA 4KCCA 3LSFB 1SW4A 4POXA 3KZGA 3Q27A 1FTAA 3I5OA 3KJTA 3IR1A 3LR1A 3LSLA 2V3TA 4PFYA 2GQ1A 5HM4B 2QJEA 4IO6A 5H8FA 4EUOA 1NH7A 3RQTA 1SDXA 4DE8A 2P1SA 5TP9A 3ILTB 3KBZA 2I4CA 4C0RA 2E1SA 3JZJA 3FXUA 2ANJA 2XHDA 3HHGA 1B40A 3TCHA 1NUXA 4MX6A 4QSEA 2OWTA 1P1OA 4M4GA 4H45A 4GWYA 1R9LA 2QMXA 4O94A 5IM2A 1LAFE 4JXIA 1JQFA 1JETA 1II5A 1MQGA 3GZGA 4N8GA 4NF5B 2F97A 2Q74A 3IO6A 1YCJA 2XWVA 1XC1A 1PB7A 1A54A 1HSLA 1FTJA 2DWJA 3MAMA 3N6UA 2WYPA 5AA2D 3IJXB 4OANA 3KOTA 4X1BA 3GYYA 1SD3A 3U93A 2QS4A 2PMSA 4DCXA 4FATA 1L5TA 2HCAA 4FAJA 2P3NA 4I1DA 4Q30B 1B52A 1FW0A 3FGSA 3VFJA 4NE4A 4PFWA 2B4MA 4TQUQ 1LBZA 4IB2A 4F22A 5JK4A 5EHSA 2VHAA 3K6WA 3CIJA 2O1LA 4OHNA 4PF6A 4N6DA 1PEBA 2Z23A 2AL4A 4JDFA 2KLFA 4IGRA 2DE3A 1JW4A 1US4A 1EH3A 3DP6A 2E0SA 3OOAA 4KYEA 5A5XA 2QVUA 1QUIA 1DPPA 1LGBC 1MY2A 4DI3D 3MZBA 4GL0A 1B3EA 2WBBA 1UIVA 1FQAA 3QUFA 1MY1A 3TAJA 3KSXA 3G3GA 3SEXA 4HS7A 1NV1A 4EXLA 3HSTA 4GRKA 3OSQA 1B58A 2BJIA 3QMFA 5F24A 1MH4A 3ILUB 4YKJA 4N4UA 4YKIA 3O6HA 2PFZA 3T9VA 3FVGA 3UN6A 5IGAA 4G68A 1FPDA 4Z0IA 1QKBA 2QFLA 1MS7A 4XKNA 5I3SA 5LTCA 2DWIA 3Q26A 3O6GA 2ZYKA 3H6VA 1FQBA 1QKAA 4IY5A 1Y1ZA 2JJKA 4OQOA 2H4IA 1S9TA 4GOTA 3N5LA 1NV5A 3T9XB 3EHTA 4ZEIA 2FIXA 1LAHE 4FEDA 1MG1A 3K01A 4C1UA 1GR2A 4KHZE 1Y9UA 2HXWA 1MXVA 2F3DA 5DVIA 3O97A 2YJPA 3MSTA 4ELOA 4F29A 4BDNA 4DLDA 3RT8A 4FJPA 4PGNA 2H5YA 2PYYA 1QUJA 3ZKKA 4RPNA 4F19A 4G4PA 3IB0A 5A5LA 2F34A 3G3KA 3PMXA 4KR5A 3M3KA 4AB6A 1J1NA 4PAFA 4OVJA 2QS2A 4F3SA 1USYH 2Z22A 3I6VA 1FTKA 4PBHA 1D9VA 4QBAA 3FV2A 1DPEA 5K2YA 4XKQA 5I57A 2QMWA 2H98A 2NXOA 3EKIA 4DCYA 4H46A 4IGTA 4QXDA 3TQWA 3PUWE 3FXBA 4P0GA 3BKIB 2QL3A 1MRPA 1P1WA 1Y3NA 4PFUA 3T0JA 4IY6A 1N3XA 4X8RA 3TEPA 3CFXA 3DP4A 2QVVA 4O7IA 4R9GA 4KFQA 4N07A 4XF5A 3RT6B 3BBRA 5EYGA 3TTNA 5TPAB 4MCOA 3Q29A 2FBPA 2DE4A 3TCGA 3NOHA 2F7AA 5I59B 2R71A 1ATGA 1FBDA 1OLCA 1IITA 3UIFA 4MNPA 4F18A 3USDA 1UIUA 1TXFA 3PPNA 3GBBA 3QXMA 2HEUA 2OJTA 2B3BA 2HAUA 2X26A 2QVRA 3KFMA 1B1XA 4DXUA 2OWZA 1SBPA 3C32A 3B8BA 4H65A 3CG3A 4FIMA 2THIA 4P3LA 2A5TB 1N04A 5CRYA 3K00A 3KGCA 2DVZA 4YU0A 1YXIA 4NWDA 2VT5A 1POTA 4KCDA 1NNPA 2DXYA 4UACA 5JTYB 1FPJA 3H6UA 4LATA 1H3DA 3QSLA 1NNTA 2HFBA 3PPPA 3TDJA 3IAZA 4YB6A 1B51A 4MJOA 4OMBA 1FTLA 1SW1A 3QAXA 1EYIA 2XXQA 4N17A 3HCQA 1FTOA 3JV9A 2ZMBA 3VVDA 4E0XA 4RXLA 4F39A 4NF0A 3CVGA 5F7VA 1TWYA 4GXAA 2DSFA 3IFCA 4ISUA 4O3CA 3C9HA 4XKPA 2O1MA 4YZZA 4H5FA 1DOTA 2Q9TA 2V84A 3N26A 3VVEA 1ANFA 1AIVA 4MEVA 1SW5A 4X1DA 1LCFA 2Q2CA 3C4MA 4NF6A 1JVYA 3MZ1A 3H03A 1YYZA 1OLAA 4H67A 4ELQA 3A3UA 3IL1B 4I3EA 4GIZA 1MDQA 2HHMA 2GHBA 4Z7EA 5BUUA 4K3FA 4NQ8A 2WEFA 3D4GA 2WX9A 3SERA 2R8TA 3O2AA 5DVJA 1MXYA 2Q88A 1LSTA 4LZ5A 1AOVA 4N6KA 4HTGA 4XEQA 1CB6A 1GTKA 2HQ0A 2REGA 3RPLA 3SETA 5I58A 4X04A 2I3WA 4GWUA 4LP2B 2Y5LA 3E4RA 4MAGA 3CHGA 2OBGA 4NF4A 4RK2A 2XXXA 5AE4A 3D4CA 5IZZA 3FBPA 4P8BA 1LBYA 5IZ3B 3THIA 3MWBA 5J16A 1FQEA 3FD3A 2V25A 4OA4A 4UA8A 5EHMA 3OEKA 4NX1A 1B46A 1MY3A 2RC8A 1LB9A 3A3CA 4RNSA 2ZZVA 4YMBA 5CMMA 1SQYA 4NMYA 3N6TA 5H8QB 1SVXB 2NOOA 2ZZWA 2UVHA 1LFIA 1O7TA 1WODA 3BFTA 4PFTA 5EYFA 3SEVA 4OEVA 4Q5TA 4F31B 3M3LA 1KWHA 3TZAA 3T96B 4OVTA 1IXIA 3CSBA 3KN8A 4TLLB 5KCJA 2PBWA 5ICQA 4NGUA 1QW0A 1XT8A 4BDLA 3MW0A 4WKMA 4R74A 5KDTB 4OEUA 1B3FA 1B3HA 3ODBA 4ZS9A 5JEIA 3EN3A 1M5CA 4WXJA 4XFEA 3K6UA 1XOCA 2Q8JA 5AA2A 3FVNA 2P3VA 3FXRA 5ET5A 3PPQA 4NTLA 3K2DA 2WBDA 5EYHA 3S9MC 3CG1A 1TFAA 4Q0CA 1UTHB 5I7IA 4GWZA 2DP8A 4R6YA 1AWBA 5TU0A 4LVQA 5I2NB 3PPOA 2P0SA 3FJ7A 1B4HA 1FPIA 3OENA 4P47A 1P1UA 2ZXTA 4MNCA 1SYHA 1RDXA 4ZZEA 1B7HA 1P1NA 3MUQA 1GGGA 4BDOA 3SDFA 3PTYA 3IOTA 5KZTA 2XXRA 3MBPA 4I3YA 4P1EA 4DDDA 3L6HA 4IR8A 3RTFB 3OXNA 4G8NA 1NUWA 2FHYA 4I8CA 3OO9A 3G3IA 2W7YA 4LONB 2XX7A 4PF8A 4LZ7A 4OVPA 3W15C 1I69A 1XHYA 2Y7WA 3A09A 1PC3A 5LDZA 1JEVA 3KBRA 3EQ1A 4PGPA 4GXSB 2VPOA 2CEYA 3EHSA 1Y4TA 2Z8DA 3U8QA 4OFJA 2ESNA 2DVCA 3O9PA 1IXCA 3H4ZA 3GXAA 2ZNUA 4KYDA 1FPKA 3FVOA 2XXPA 3FXQA 4R6HA 5H8NA 3C33A 4QFPA 4C1TA 3M8UA 2OK2A 5CMCA 5CM6A 4MF3A 1LBWA 1UTBB 3FIRA 4POWA 1SPIA 4H8IA 4NEDA 4DI4B 3HN0A 2CZHA 3I3VA 2UYFA 4EQ7A 5I56B 2AL5A 4GWSA 5ESYA 1N76A 4BDRA 1MXZA 3VLWA 3S9NC 3HPIA 3IB2A 3KC1A 3U94A 2GRVA 3OO8A 4YB7A 1EZOA 2B65A 4WEDA 4O7MA 1SW2A 3SZPA 3TCFA 3TELA 1B3LA 1US5A 2ZYNA 4JB7A 3R26A 1NV6A 4IO4A 3OSRA 2D21A 4PC9A 4R72A 1QUKA 4ZEBA 4RYAA 1NL5A 4P1LA 3PU5A 4R73A 4XIGQ 1IZ1A 3B7DA 2GFEA 2X7QA 1B5IA 3TFLA 4FECA 4N8YA 3EPEA 1Y3QA 1VE4A 4NF8B 1IMDA 4I62A 1LEVA 5AA4B 1BIYA 2O68A 2NUVA 3FVKA 4R2BA 2NVUB 1R1NA 2O7UA 4AS5A 2F6GA 4ELRA 3T66A 2QS3A 2UVGA 4ND9A 4NF5A 2Y7IA 5CBRA 2Y7PA 2ONRA 4TLMB 3MQ9A 2XA5A 4FEBA 3F11A 3OO6A 1B3GA 2PX1A 2XXUA 3OO7A 3R7XA 4G77A 1NMUA 1Y3PA 5I2KB 4MHFA 5CMBA 2AYSA 1TT1A 4F3BA 4O3BA 1N7XA 3DP8A 3EF7A 1IMCA 1A7LA 3MVYA 5H8HB 1B32A 2ABHA 1IQ7A 4G61A 4PETA 3TTRA 2I0CA 2VD3A 2I49A 3LSWA 3VXCA 1SYIA 3PMVA 2H25A 5IAIA 2XX9A 3PV0E 3OMBA 4N91A 3LUYA 4X9TA 4F1VA 3FV1A 2QS1A 4QRZA 3SEUA 2O84X 4GWXA 4H0WA 1MQIA 5ET6A 1JEUA 5EQ8A 5T3JA 1XI6A 1URGA 1N3WA 5FHOA 3QYTA 1JVXA 4MMPA 2XWIA 4LQ2A 4NAPA 3MZ9A 3MYUA 4MFIA 3IOUA 4R2FA 2VD2A 4ZE9A 4PTKA 3VLUA 3JYRA 1FBEA 3O28A 4GL8A 4RA1A 4PCDA 2ZNSA 1MPCA 1MQDA 3G3HA 4DZ1A 4KXPA 3V89B 4PP0A 2RC9A 1A55A 4PE5B 2PVUA 3QK6A 5CMKA 4R9FA 1NV7A 2NWJA 5DVFA 1H76A 1N0TA 3TQLA 2F78A 1Y1MA 5L8DA 1Y4CA 1NH8A 3HV1A 2ONKE 5AA1A 1B6HA 1MM6A 3HHFA 1DTGA 4OTEA 2ZYOA 3RTWB 2FNCA 4IO2A 2GH9A 5FTHA 4OFLA 4H5GA 2QSXA 5ITPA 2OWSA 2PCRA 5J1DA 4GX3A 1M5BA 3RLFE 1MY0A 1B2HA 3FASA 2DDKA 5HBCA 2F35A 2REJA 2VOZA 4JSOA 1QULA 1LCTA 5LOMA 1PB9A 3K6XA 4X48A 3UA8A 2XWOA 3ECRA 4JWYA 1ZJLA 3MJNA 1DTZA 3MPKA 4G68C 2Y7RA 5FHMA 3ZKLA 1FQDA 2HXRA 1O64A 2RF1A 3K02A 3MPLA 2DWAA 3VXBA 4U22A 4G8HA 1XS5A 2XD3A 3G3FA 1ZKBA 5EQAA 3UGWA 4YAHX 2RCAA 4OESA 3S9EA 1FJ9A 3RY3A 4MIJA 1P1QA 3H6WA 5CC2A 2H99A 1LBCA 1B05A 3CFLA 2G93A 3TTLA 1LBBA 4PFBA 3K1PA 1ZTYA 3OD7A 1FPFA 3IFAA 2PFYA 4FORA 4YB5A 1OVTA 4RPOA 3PPRA 4LA9A 1JW1A 5TPAA 1G0HA 1IMAA 5I59A 3S9LC 4ESXA 1EYKA 4JVCA 2UVIA 1MXXA 3LBSA 2XWKA 3IOWA 3TUSA 2I3VA 2M8CA 2F5XA 2PT1A 4OXVA 3VE1B 1ZLQA 3FJMA 4U1OA 1I6QA 4F3GA 3ONMA 1LBXA 2VGQA 1EU8A 1BK4A 1ZIUA 5H8FB 4YKKA 3BIGA 3C31A 2A5TA 3TODA 4HE1A 1KA1A 5TP9B 2KR0A 5EQ9A 3CI8A 4QFOA 2UYEA 5ISUA 4ZE8A 5JTYA 3KC0A 3PD9A 5ET8A 4QSCA 2H9BA 3PD8A 3B6QA 3ROJA 4RY1A 4BLAA 1AH5A 2FIEA 4GWWA 1WDNA 1FCKA 3QUJA 4F3PA 4U4XA 1N84A 3D1RA 1POY1 5DW8A 2DS9A 1BLFA 1FQCA 1FPGA 3QIMA 1YZ0A 5M2VA 2V3QA 5IZ1A 1A8EA 1FBGA 2I4BA 5IKBA 4HE0A 1H45A 4PBQA 4GFRA 3PUXE 2G29A 2HZKA 4HCYA 3WAEA 4DXCA 4OVQA 3O6IA 4GD5A 4TOZA 3O29A 3RNNA 2F36A 1LBVA 3KN3A 1MPBA 2ZNTA 2CEXA 4ZECA 1IXGA 1BTJA 4EQ9A 1M5FA 3W9WA 4GX4A 2UVJA 4Q8RA 1RKMA 1JP4A 3LUZA 3S2VA 1OMPA 3VVFA 5FTIA 3CSGA 4OENA 2XXTA 3T9HB 3T93B 1ZBMA 2XXWA 5A5XB 4GQOA 2O51A 2YPNA 1MH3A 2B4LA 2Z8EA 4OFOA 4BDMA 1T0KA 1RYOA 4HW8A 5BWJA 2DXRA 1FBFA 4PFRA 1A40A 3ZSFA 1GV8A 1H44A 2F7CA 4IO5A 1PBPA 5I5PA 5IZ3A 1VSOA 4EF1A 1D9QA 4HCWA 1JNFA 4QHQA 5L9MA 1OVBA 3ISPA 4PQJA 2HZLA 3IX1A 2O6AA 4NN3A 4OZ9A 3A29A 1WVJA 2I48A 3WAFA 2ZZXA 2OX3A 4G68B 1ELJA 4LN5A 2UXAA 5H8QA 3TTKA 5ET7A 2LAOA 1SI1A 3KSJA 1FBPA 3P7IA 3FZVA 3FUZA 5FBPA 3LC8A 3LV0A 1URSA 1G0IA 2DOJA 5B7DA 4ZEFA 1B4ZA 1LFHA 1Z7NE 5AA3A 5KDTA 3RUMA 2QRYA 4U21A 3U92A 1M5EA 3CRBA 2CZIA 3O66A 4N81A 3CR9A 1B5HA 1RDZA 2DYXA 3H06B 2V3UA 3PUZE 4M1VA 3KJ7A 1NUYA 1GVCA 4NG7A 4HXVA 5K2XA 2Q2AA 1INPA 3SKPA 3RYDA 3MVWA 1PDAA 3KN7A 1IMFA 1MXUA 4THIA 1NFTA 4G2ZA 4JWOA 1OQHA 2L5VA 1UTHA 4QFNA 5I2NA 1MQJA 2V93A 5ELVA 3K1NA 1IMBA 1Y20A 4GX6A 4DXBA 4U4SA 3OEMA 2IEEA 4EDPA 3CFZA 1FQFA 2FYIA 2R6GE 3VLVA 1H43A 3BIHA 3L6GA 2XX8A 5I57B 2HAVA 4RK9A 1DSNA 1MPDA 4KQPA 2MKZA 1D4NA 1XVXA 4OVRA 2HPGA 4G8MA 1NUZA 3B50A 4N6PA 1NNFA 3RGYA 1D3KA 3W9VA 2XXVA 1FBCA 2P2AA 3TYHA 1VFEA 4MNIA 4MH5A 2FA7A 5DEXB 1YTVA 5DTBA 4EF2A 2AIXA 4E0WA 1IIWA 2O7IA 4HE2A 2BJJX 1NI9A 4PAKA 1FPLA 3N94A 4P9KA 2X7PA 4R6KA 3FATA 5L9OA 2Q8MA 1PBQA 2B3FA 1BP5A 4GVOA 3TPAA 1F9BA 4MLQA 5CBSA 1KA0A 2RKMA 1LB8A 4XTCQ 4EQBA 3UK4A 1BKAA 1AL3A 1UTBA 4NWCA 3B6TA 3M3FA 1B7UA 2Y84A 4OVSA 5I56A 4GLIA 5I84A 2XD2A 3R6UA 3E79A 2OLBA 1A99A 1VR5A 1YAEA 2OZZA 4AS4A 4LZ8A 1OIBA 1EYJA 1IMEA 2DE2A 3S4UA 1LLSA 4ELPA 4ZEDA 2A5SA 3IO4A 3MP1A 4U23A 1AMFA 1D9YA 4H1XA 4XXUA 5ITOA 4UABA 3FJGA 3VV5A 2XXKA 4PFIA 3TKDA 4QFLA 1MDP1 4FE8A 3K4UA 3V8XB 3SESA 4DIGA 2Y7KA 4R75A 1NKXA 1OQGA 2DQVA 3IB1A 4KPTA 3KG2A 1VFDA 1NV3A 3E13X 1LAGE 1MY4A 4JBZA 4IO7A 5ICTA 1XVYA 2ALUA 2F6PA 3MC2A 2YLNA 4H6DA 3PGFA 2F3BA 1IEJA 3EHUA 4NF8A 1B0HA 4KYSA 1DBZA 3C36A 4NF6B 4I40A 5AA4A 1HSEA 3GLBA 1Q9DA 1EZPA 5B70A 2XXIA 4YKPA 5FHNA 4I9DA 3TTMA 3RPWA 3DM0A 1HSJA 1JW5A 1M5DA 1YPNA 4GF8A 5DEXA 1K9ZA 3RN8A 3GBAA 4JSDA 4JWXA 1MM7A 4JVDA 3B6WA 5DYHA 3E3KA 2QPQA 3UP9A 3U1OA 3H7MA 3BFUA 3RPLB 3HO7A 1Z7ME 5I58B 3LSXA 1LAXA 1B5JA 2VP1A 1NV2A 4WEPA 3SEYA 4NF4B 3G3JA 1CNQA 3UORA 1P99A 1QJMA 2XXYA 5I2KA 1FSAA 3T9UA 2Z8FA 3PUVE 1EZ9A 4LQ5A 3Q25A 3MVXA 1NV4A 3OELA 5H8HA 2CMOA 4P0IA 2V4CA 1UQWA 1K9YA 3SEWA 2I58A 5L9SA 2RCBA 1PB8A 4N13A 3ZS6A 4KD5A 1CE2A 1O63A 1IUDA 1MXWA 3IORA 3KEIA 2WYKA 2KQZA 2I0BA 2RINA 5KCJB 3K0VA 4P11A 2IA4A 4BDQA 3U72A 3IJOB 4ONYA 4H8JA 3C34A 4PDHA 4QSDA 3V83A 2F7BA 1FRPA 3IOVA 1RDYA 5AA2B 1S50A 4PAIA 2O69A 3H6TA 3K6VA 1NNKA 1B9JA 1SI0A 3E78A 4FBPA 1ZMGA 4GBVA 4LUBA 4P56A 1B0LA 4RJZA 2DWHA 2CZLA 1MQHA 2VPNA 1USYE 1S7YA 1I6BA 1Q35A
chains in the Genus database with same CATH topology
1FPBA 4XF5A 1FBFA 1IMDA 4PFRA 5EYGA 1DCUA 4MCOA 1LEVA 1VDWA 3U65A 2FBPA 2DE4A 3NOHA 1FBDA 5I5PA 1DK4A 5IZ3A 1KZ8A 4MNPA 1D9QA 4HCWA 4NHBA 4F18A 4AS5A 1QGXA 3T1BA 3ISPA 2HZLA 4NN3A 2QVRA 3A29A 4N15A 2ZZXA 2OX3A 4LN5A 2OWZA 5ET7A 3B8BA 4P3LA 1FBPA 1FJ6A 2XA5A 2DVZA 1YXIA 5FBPA 2VT5A 2Y5KA 3LV0A 1G0IA 1FBHA 1FPJA 4O8MA 4GBWA 3HFUA 4F1UA 4MHFA 4MJOA 4JVIA 1EYIA 1FPEA 2CZIA 4N17A 4N81A 4PDDA 1IMCA 1RDZA 2FVZA 4M1VA 4NF0A 1NUYA 5EQ7A 4G61A 4NG7A 4PETA 4HXVA 3IFCA 1INPA 3RYDA 1IMFA 4N91A 4YZZA 4X9TA 4F1VA 2Q9TA 2L5VA 4GWXA 4MEVA 5ET6A 5EQ8A 5T3JA 1IMBA 1XI6A 4YICA 4GX6A 2CZKA 4MMPA 2XWIA 4NAPA 1YYZA 3MYUA 4PTKA 4PE3A 3BIHA 1FBEA 1NV0A 4PCDA 2MKZA 1FTAA 4I3EA 4OVRA 2HPGA 4KXPA 1NUZA 3B50A 2HHMA 4NQ8A 3W9VA 2WEFA 1NV7A 2WX9A 1FBCA 2R8TA 2GQ1A 4N6KA 4XEQA 3RPLA 4MNIA 4X04A 3KBZA 4GWUA 2Y5LA 4MAGA 3CHGA 5IZZA 4HE2A 1NI9A 1NUXA 3FBPA 4PAKA 4MX6A 4P8BA 1LBYA 4H45A 5IZ3B 5J16A 4GWYA 1FPLA 4P9KA 4OA4A 2PCRA 5J1DA 4NX1A 4O94A 5IM2A 4GX3A 2Q8MA 2ZZVA 4N8GA 1KA0A 2DDKA 2Q74A 2XWVA 2ZZWA 2WYPA 4OANA 2XWOA 4OVSA 3GYYA 3E79A 4AS4A 4OVTA 2HXRA 1EYJA 1IMEA 2DE2A 2P3NA 4NGUA 2B4MA 1LBZA 5JK4A 4UABA 5EQAA 4PF6A 4N6DA 1FJ9A 2XXKA 4PFIA 4MIJA 2DE3A 4XFEA 2P3VA 5ET5A 2WBDA 5EYHA 4PFBA 1NV3A 1FPFA 2QVUA 3IFAA 5I7IA 4DI3D 4GWZA 2PFYA 1AWBA 1FPIA 2F3BA 2WBBA 4P47A 1DBZA 1G0HA 4I40A 1IMAA 4MNCA 1RDXA 1Q9DA 1NV1A 1EYKA 4JVCA 2BJIA 3QMFA 2XWKA 5F24A 3PTYA 4N4UA 1K9ZA 2PFZA 2F5XA 4I3YA 4P1EA 5IGAA 4IR8A 1LBXA 1FPDA 2QFLA 4JVDA 1BK4A 1NUWA 2FHYA 5I3SA 2QPQA 3BIGA 4HE1A 5LTCA 1KA1A 3RPLB 2KR0A 4PF8A 5EQ9A 4OVPA 2JJKA 3KC0A 1NV2A 5LDZA 5ET8A 4PGPA 3ROJA 2VPOA 1CNQA 2CEYA 1FSAA 2FIEA 1NV5A 4GWWA 2FIXA 1FPKA 3D1RA 1NV4A 5DW8A 1FPGA 1YZ0A 2V3QA 2F3DA 5IZ1A 2V4CA 1FBGA 3MSTA 1K9YA 4HE0A 4PBQA 5CM6A 4PGNA 1LBWA 1SPIA 4DI4B 2HZKA 2CZHA 4HCYA 4F19A 4OVQA 5A5LA 4GWSA 5ESYA 4PAFA 1LBVA 2WYKA 2KQZA 4PBHA 4QBAA 3KC1A 2CEXA 3EKIA 4PDHA 4O7MA 3SZPA 3W9WA 1FRPA 4H46A 1RDYA 4GX4A 1NV6A 4PAIA 1JP4A 3LUZA 4PC9A 4QXDA 3FXBA 3E78A 4FBPA 4P1LA 4GBVA 4P56A 3T0JA 4N8YA 4X8RA 2VPNA 2B4LA 2QVVA 4O7IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PGP A;  4XF5 A;  4OVT A;  4PFR A;  2VPO A;  4YIC A;  2CEY A;  4MCO A;  4MMP A;  3U65 A;  2XWI A;  4NAP A;  4NGU A;  5I5P A;  4PE3 A;  4MNP A;  4NHB A;  4UAB A;  4PF6 A;  4N6D A;  4PCD A;  2XXK A;  4PFI A;  4MIJ A;  4OVR A;  2HPG A;  3B50 A;  4XFE A;  2HZL A;  4NN3 A;  2V4C A;  4N15 A;  4NQ8 A;  2ZZX A;  4PBQ A;  2WX9 A;  5CM6 A;  4LN5 A;  4PGN A;  4PFB A;  4P3L A;  4N6K A;  2XA5 A;  4DI4 B;  4XEQ A;  2HZK A;  4MNI A;  4OVQ A;  5I7I A;  4DI3 D;  4X04 A;  2PFY A;  4PAF A;  4MAG A;  4O8M A;  4P47 A;  5IZZ A;  2WYK A;  4MNC A;  4MHF A;  4PBH A;  4PAK A;  4MX6 A;  2CEX A;  4P8B A;  4P9K A;  4OA4 A;  4N17 A;  4PDD A;  4PDH A;  4NX1 A;  4O7M A;  4O94 A;  5IM2 A;  2XWK A;  4NF0 A;  4N4U A;  2PFZ A;  2ZZV A;  4N8G A;  4NG7 A;  4PAI A;  4P1E A;  4PC9 A;  4PET A;  5IGA A;  2XWV A;  3FXB A;  4P1L A;  2ZZW A;  4P56 A;  2WYP A;  5LTC A;  4N91 A;  4YZZ A;  4N8Y A;  4OAN A;  2XWO A;  4X8R A;  4PF8 A;  4OVP A;  2VPN A;  4OVS A;  3GYY A;  4MEV A; 
#chains in the Genus database with same CATH topology
 1FPB A;  4MLV A;  3Q28 A;  1DCU A;  1VDW A;  4KI0 E;  3U65 A;  3T22 A;  4ZDM A;  1URD A;  1DK4 A;  1KZ8 A;  3MP8 A;  4NHB A;  1A8F A;  4L17 A;  4XKR A;  1QGX A;  3T1B A;  3DLN A;  4F1Y A;  4OYV A;  1I6A A;  4QFK A;  3V5A A;  4N15 A;  5DT6 A;  4F2O A;  2R9J A;  2OCU A;  2RC7 A;  3MVZ A;  5CI5 A;  3DEL B;  1TFD A;  1FJ6 A;  4AQ4 A;  3E9X A;  4MBP A;  3PUY E;  2Y5K A;  1FBH A;  2Q89 A;  4O8M A;  4U2R A;  5HPQ A;  4GBW A;  2I6E A;  3HFU A;  1B7Z A;  1ZU0 A;  2PT2 A;  4O3A A;  4F1U A;  1R9Q A;  4AB5 A;  2D3I A;  3C35 A;  3K1M A;  5H8S A;  3IK6 B;  4JVI A;  2ONS A;  1FPE A;  4PDD A;  5H8N B;  3G7W A;  4GWO A;  4F2Q A;  4OER A;  4OWD A;  4ZEK A;  2FVZ A;  3KOS A;  4U1Z A;  1Q1K A;  2ZYM A;  4ESW A;  4YMA A;  5EQ7 A;  1B1H A;  4QF9 A;  5F1Q A;  4ZZA A;  1RYX A;  2GHA A;  1IXH A;  3TMG A;  4IO3 A;  2F8D A;  1N7W A;  3VDF A;  3H3G A;  4EXK A;  3AXF A;  2WKY A;  4ECF A;  1QVS A;  4OET A;  4YIC A;  1DMB A;  2XXH A;  2CZK A;  1R6Z A;  1LFG A;  3MP6 A;  4PE3 A;  1NV0 A;  2D5W A;  1FTM A;  3PMW A;  4KCC A;  3LSF B;  1SW4 A;  4POX A;  3KZG A;  3Q27 A;  1FTA A;  3I5O A;  3KJT A;  3IR1 A;  3LR1 A;  3LSL A;  2V3T A;  4PFY A;  2GQ1 A;  5HM4 B;  2QJE A;  4IO6 A;  5H8F A;  4EUO A;  1NH7 A;  3RQT A;  1SDX A;  4DE8 A;  2P1S A;  5TP9 A;  3ILT B;  3KBZ A;  2I4C A;  4C0R A;  2E1S A;  3JZJ A;  3FXU A;  2ANJ A;  2XHD A;  3HHG A;  1B40 A;  3TCH A;  1NUX A;  4MX6 A;  4QSE A;  2OWT A;  1P1O A;  4M4G A;  4H45 A;  4GWY A;  1R9L A;  2QMX A;  4O94 A;  5IM2 A;  1LAF E;  4JXI A;  1JQF A;  1JET A;  1II5 A;  1MQG A;  3GZG A;  4N8G A;  4NF5 B;  2F97 A;  2Q74 A;  3IO6 A;  1YCJ A;  2XWV A;  1XC1 A;  1PB7 A;  1A54 A;  1HSL A;  1FTJ A;  2DWJ A;  3MAM A;  3N6U A;  2WYP A;  5AA2 D;  3IJX B;  4OAN A;  3KOT A;  4X1B A;  3GYY A;  1SD3 A;  3U93 A;  2QS4 A;  2PMS A;  4DCX A;  4FAT A;  1L5T A;  2HCA A;  4FAJ A;  2P3N A;  4I1D A;  4Q30 B;  1B52 A;  1FW0 A;  3FGS A;  3VFJ A;  4NE4 A;  4PFW A;  2B4M A;  4TQU Q;  1LBZ A;  4IB2 A;  4F22 A;  5JK4 A;  5EHS A;  2VHA A;  3K6W A;  3CIJ A;  2O1L A;  4OHN A;  4PF6 A;  4N6D A;  1PEB A;  2Z23 A;  2AL4 A;  4JDF A;  2KLF A;  4IGR A;  2DE3 A;  1JW4 A;  1US4 A;  1EH3 A;  3DP6 A;  2E0S A;  3OOA A;  4KYE A;  5A5X A;  2QVU A;  1QUI A;  1DPP A;  1LGB C;  1MY2 A;  4DI3 D;  3MZB A;  4GL0 A;  1B3E A;  2WBB A;  1UIV A;  1FQA A;  3QUF A;  1MY1 A;  3TAJ A;  3KSX A;  3G3G A;  3SEX A;  4HS7 A;  1NV1 A;  4EXL A;  3HST A;  4GRK A;  3OSQ A;  1B58 A;  2BJI A;  3QMF A;  5F24 A;  1MH4 A;  3ILU B;  4YKJ A;  4N4U A;  4YKI A;  3O6H A;  2PFZ A;  3T9V A;  3FVG A;  3UN6 A;  5IGA A;  4G68 A;  1FPD A;  4Z0I A;  1QKB A;  2QFL A;  1MS7 A;  4XKN A;  5I3S A;  5LTC A;  2DWI A;  3Q26 A;  3O6G A;  2ZYK A;  3H6V A;  1FQB A;  1QKA A;  4IY5 A;  1Y1Z A;  2JJK A;  4OQO A;  2H4I A;  1S9T A;  4GOT A;  3N5L A;  1NV5 A;  3T9X B;  3EHT A;  4ZEI A;  2FIX A;  1LAH E;  4FED A;  1MG1 A;  3K01 A;  4C1U A;  1GR2 A;  4KHZ E;  1Y9U A;  2HXW A;  1MXV A;  2F3D A;  5DVI A;  3O97 A;  2YJP A;  3MST A;  4ELO A;  4F29 A;  4BDN A;  4DLD A;  3RT8 A;  4FJP A;  4PGN A;  2H5Y A;  2PYY A;  1QUJ A;  3ZKK A;  4RPN A;  4F19 A;  4G4P A;  3IB0 A;  5A5L A;  2F34 A;  3G3K A;  3PMX A;  4KR5 A;  3M3K A;  4AB6 A;  1J1N A;  4PAF A;  4OVJ A;  2QS2 A;  4F3S A;  1USY H;  2Z22 A;  3I6V A;  1FTK A;  4PBH A;  1D9V A;  4QBA A;  3FV2 A;  1DPE A;  5K2Y A;  4XKQ A;  5I57 A;  2QMW A;  2H98 A;  2NXO A;  3EKI A;  4DCY A;  4H46 A;  4IGT A;  4QXD A;  3TQW A;  3PUW E;  3FXB A;  4P0G A;  3BKI B;  2QL3 A;  1MRP A;  1P1W A;  1Y3N A;  4PFU A;  3T0J A;  4IY6 A;  1N3X A;  4X8R A;  3TEP A;  3CFX A;  3DP4 A;  2QVV A;  4O7I A;  4R9G A;  4KFQ A;  4N07 A;  4XF5 A;  3RT6 B;  3BBR A;  5EYG A;  3TTN A;  5TPA B;  4MCO A;  3Q29 A;  2FBP A;  2DE4 A;  3TCG A;  3NOH A;  2F7A A;  5I59 B;  2R71 A;  1ATG A;  1FBD A;  1OLC A;  1IIT A;  3UIF A;  4MNP A;  4F18 A;  3USD A;  1UIU A;  1TXF A;  3PPN A;  3GBB A;  3QXM A;  2HEU A;  2OJT A;  2B3B A;  2HAU A;  2X26 A;  2QVR A;  3KFM A;  1B1X A;  4DXU A;  2OWZ A;  1SBP A;  3C32 A;  3B8B A;  4H65 A;  3CG3 A;  4FIM A;  2THI A;  4P3L A;  2A5T B;  1N04 A;  5CRY A;  3K00 A;  3KGC A;  2DVZ A;  4YU0 A;  1YXI A;  4NWD A;  2VT5 A;  1POT A;  4KCD A;  1NNP A;  2DXY A;  4UAC A;  5JTY B;  1FPJ A;  3H6U A;  4LAT A;  1H3D A;  3QSL A;  1NNT A;  2HFB A;  3PPP A;  3TDJ A;  3IAZ A;  4YB6 A;  1B51 A;  4MJO A;  4OMB A;  1FTL A;  1SW1 A;  3QAX A;  1EYI A;  2XXQ A;  4N17 A;  3HCQ A;  1FTO A;  3JV9 A;  2ZMB A;  3VVD A;  4E0X A;  4RXL A;  4F39 A;  4NF0 A;  3CVG A;  5F7V A;  1TWY A;  4GXA A;  2DSF A;  3IFC A;  4ISU A;  4O3C A;  3C9H A;  4XKP A;  2O1M A;  4YZZ A;  4H5F A;  1DOT A;  2Q9T A;  2V84 A;  3N26 A;  3VVE A;  1ANF A;  1AIV A;  4MEV A;  1SW5 A;  4X1D A;  1LCF A;  2Q2C A;  3C4M A;  4NF6 A;  1JVY A;  3MZ1 A;  3H03 A;  1YYZ A;  1OLA A;  4H67 A;  4ELQ A;  3A3U A;  3IL1 B;  4I3E A;  4GIZ A;  1MDQ A;  2HHM A;  2GHB A;  4Z7E A;  5BUU A;  4K3F A;  4NQ8 A;  2WEF A;  3D4G A;  2WX9 A;  3SER A;  2R8T A;  3O2A A;  5DVJ A;  1MXY A;  2Q88 A;  1LST A;  4LZ5 A;  1AOV A;  4N6K A;  4HTG A;  4XEQ A;  1CB6 A;  1GTK A;  2HQ0 A;  2REG A;  3RPL A;  3SET A;  5I58 A;  4X04 A;  2I3W A;  4GWU A;  4LP2 B;  2Y5L A;  3E4R A;  4MAG A;  3CHG A;  2OBG A;  4NF4 A;  4RK2 A;  2XXX A;  5AE4 A;  3D4C A;  5IZZ A;  3FBP A;  4P8B A;  1LBY A;  5IZ3 B;  3THI A;  3MWB A;  5J16 A;  1FQE A;  3FD3 A;  2V25 A;  4OA4 A;  4UA8 A;  5EHM A;  3OEK A;  4NX1 A;  1B46 A;  1MY3 A;  2RC8 A;  1LB9 A;  3A3C A;  4RNS A;  2ZZV A;  4YMB A;  5CMM A;  1SQY A;  4NMY A;  3N6T A;  5H8Q B;  1SVX B;  2NOO A;  2ZZW A;  2UVH A;  1LFI A;  1O7T A;  1WOD A;  3BFT A;  4PFT A;  5EYF A;  3SEV A;  4OEV A;  4Q5T A;  4F31 B;  3M3L A;  1KWH A;  3TZA A;  3T96 B;  4OVT A;  1IXI A;  3CSB A;  3KN8 A;  4TLL B;  5KCJ A;  2PBW A;  5ICQ A;  4NGU A;  1QW0 A;  1XT8 A;  4BDL A;  3MW0 A;  4WKM A;  4R74 A;  5KDT B;  4OEU A;  1B3F A;  1B3H A;  3ODB A;  4ZS9 A;  5JEI A;  3EN3 A;  1M5C A;  4WXJ A;  4XFE A;  3K6U A;  1XOC A;  2Q8J A;  5AA2 A;  3FVN A;  2P3V A;  3FXR A;  5ET5 A;  3PPQ A;  4NTL A;  3K2D A;  2WBD A;  5EYH A;  3S9M C;  3CG1 A;  1TFA A;  4Q0C A;  1UTH B;  5I7I A;  4GWZ A;  2DP8 A;  4R6Y A;  1AWB A;  5TU0 A;  4LVQ A;  5I2N B;  3PPO A;  2P0S A;  3FJ7 A;  1B4H A;  1FPI A;  3OEN A;  4P47 A;  1P1U A;  2ZXT A;  4MNC A;  1SYH A;  1RDX A;  4ZZE A;  1B7H A;  1P1N A;  3MUQ A;  1GGG A;  4BDO A;  3SDF A;  3PTY A;  3IOT A;  5KZT A;  2XXR A;  3MBP A;  4I3Y A;  4P1E A;  4DDD A;  3L6H A;  4IR8 A;  3RTF B;  3OXN A;  4G8N A;  1NUW A;  2FHY A;  4I8C A;  3OO9 A;  3G3I A;  2W7Y A;  4LON B;  2XX7 A;  4PF8 A;  4LZ7 A;  4OVP A;  3W15 C;  1I69 A;  1XHY A;  2Y7W A;  3A09 A;  1PC3 A;  5LDZ A;  1JEV A;  3KBR A;  3EQ1 A;  4PGP A;  4GXS B;  2VPO A;  2CEY A;  3EHS A;  1Y4T A;  2Z8D A;  3U8Q A;  4OFJ A;  2ESN A;  2DVC A;  3O9P A;  1IXC A;  3H4Z A;  3GXA A;  2ZNU A;  4KYD A;  1FPK A;  3FVO A;  2XXP A;  3FXQ A;  4R6H A;  5H8N A;  3C33 A;  4QFP A;  4C1T A;  3M8U A;  2OK2 A;  5CMC A;  5CM6 A;  4MF3 A;  1LBW A;  1UTB B;  3FIR A;  4POW A;  1SPI A;  4H8I A;  4NED A;  4DI4 B;  3HN0 A;  2CZH A;  3I3V A;  2UYF A;  4EQ7 A;  5I56 B;  2AL5 A;  4GWS A;  5ESY A;  1N76 A;  4BDR A;  1MXZ A;  3VLW A;  3S9N C;  3HPI A;  3IB2 A;  3KC1 A;  3U94 A;  2GRV A;  3OO8 A;  4YB7 A;  1EZO A;  2B65 A;  4WED A;  4O7M A;  1SW2 A;  3SZP A;  3TCF A;  3TEL A;  1B3L A;  1US5 A;  2ZYN A;  4JB7 A;  3R26 A;  1NV6 A;  4IO4 A;  3OSR A;  2D21 A;  4PC9 A;  4R72 A;  1QUK A;  4ZEB A;  4RYA A;  1NL5 A;  4P1L A;  3PU5 A;  4R73 A;  4XIG Q;  1IZ1 A;  3B7D A;  2GFE A;  2X7Q A;  1B5I A;  3TFL A;  4FEC A;  4N8Y A;  3EPE A;  1Y3Q A;  1VE4 A;  4NF8 B;  1IMD A;  4I62 A;  1LEV A;  5AA4 B;  1BIY A;  2O68 A;  2NUV A;  3FVK A;  4R2B A;  2NVU B;  1R1N A;  2O7U A;  4AS5 A;  2F6G A;  4ELR A;  3T66 A;  2QS3 A;  2UVG A;  4ND9 A;  4NF5 A;  2Y7I A;  5CBR A;  2Y7P A;  2ONR A;  4TLM B;  3MQ9 A;  2XA5 A;  4FEB A;  3F11 A;  3OO6 A;  1B3G A;  2PX1 A;  2XXU A;  3OO7 A;  3R7X A;  4G77 A;  1NMU A;  1Y3P A;  5I2K B;  4MHF A;  5CMB A;  2AYS A;  1TT1 A;  4F3B A;  4O3B A;  1N7X A;  3DP8 A;  3EF7 A;  1IMC A;  1A7L A;  3MVY A;  5H8H B;  1B32 A;  2ABH A;  1IQ7 A;  4G61 A;  4PET A;  3TTR A;  2I0C A;  2VD3 A;  2I49 A;  3LSW A;  3VXC A;  1SYI A;  3PMV A;  2H25 A;  5IAI A;  2XX9 A;  3PV0 E;  3OMB A;  4N91 A;  3LUY A;  4X9T A;  4F1V A;  3FV1 A;  2QS1 A;  4QRZ A;  3SEU A;  2O84 X;  4GWX A;  4H0W A;  1MQI A;  5ET6 A;  1JEU A;  5EQ8 A;  5T3J A;  1XI6 A;  1URG A;  1N3W A;  5FHO A;  3QYT A;  1JVX A;  4MMP A;  2XWI A;  4LQ2 A;  4NAP A;  3MZ9 A;  3MYU A;  4MFI A;  3IOU A;  4R2F A;  2VD2 A;  4ZE9 A;  4PTK A;  3VLU A;  3JYR A;  1FBE A;  3O28 A;  4GL8 A;  4RA1 A;  4PCD A;  2ZNS A;  1MPC A;  1MQD A;  3G3H A;  4DZ1 A;  4KXP A;  3V89 B;  4PP0 A;  2RC9 A;  1A55 A;  4PE5 B;  2PVU A;  3QK6 A;  5CMK A;  4R9F A;  1NV7 A;  2NWJ A;  5DVF A;  1H76 A;  1N0T A;  3TQL A;  2F78 A;  1Y1M A;  5L8D A;  1Y4C A;  1NH8 A;  3HV1 A;  2ONK E;  5AA1 A;  1B6H A;  1MM6 A;  3HHF A;  1DTG A;  4OTE A;  2ZYO A;  3RTW B;  2FNC A;  4IO2 A;  2GH9 A;  5FTH A;  4OFL A;  4H5G A;  2QSX A;  5ITP A;  2OWS A;  2PCR A;  5J1D A;  4GX3 A;  1M5B A;  3RLF E;  1MY0 A;  1B2H A;  3FAS A;  2DDK A;  5HBC A;  2F35 A;  2REJ A;  2VOZ A;  4JSO A;  1QUL A;  1LCT A;  5LOM A;  1PB9 A;  3K6X A;  4X48 A;  3UA8 A;  2XWO A;  3ECR A;  4JWY A;  1ZJL A;  3MJN A;  1DTZ A;  3MPK A;  4G68 C;  2Y7R A;  5FHM A;  3ZKL A;  1FQD A;  2HXR A;  1O64 A;  2RF1 A;  3K02 A;  3MPL A;  2DWA A;  3VXB A;  4U22 A;  4G8H A;  1XS5 A;  2XD3 A;  3G3F A;  1ZKB A;  5EQA A;  3UGW A;  4YAH X;  2RCA A;  4OES A;  3S9E A;  1FJ9 A;  3RY3 A;  4MIJ A;  1P1Q A;  3H6W A;  5CC2 A;  2H99 A;  1LBC A;  1B05 A;  3CFL A;  2G93 A;  3TTL A;  1LBB A;  4PFB A;  3K1P A;  1ZTY A;  3OD7 A;  1FPF A;  3IFA A;  2PFY A;  4FOR A;  4YB5 A;  1OVT A;  4RPO A;  3PPR A;  4LA9 A;  1JW1 A;  5TPA A;  1G0H A;  1IMA A;  5I59 A;  3S9L C;  4ESX A;  1EYK A;  4JVC A;  2UVI A;  1MXX A;  3LBS A;  2XWK A;  3IOW A;  3TUS A;  2I3V A;  2M8C A;  2F5X A;  2PT1 A;  4OXV A;  3VE1 B;  1ZLQ A;  3FJM A;  4U1O A;  1I6Q A;  4F3G A;  3ONM A;  1LBX A;  2VGQ A;  1EU8 A;  1BK4 A;  1ZIU A;  5H8F B;  4YKK A;  3BIG A;  3C31 A;  2A5T A;  3TOD A;  4HE1 A;  1KA1 A;  5TP9 B;  2KR0 A;  5EQ9 A;  3CI8 A;  4QFO A;  2UYE A;  5ISU A;  4ZE8 A;  5JTY A;  3KC0 A;  3PD9 A;  5ET8 A;  4QSC A;  2H9B A;  3PD8 A;  3B6Q A;  3ROJ A;  4RY1 A;  4BLA A;  1AH5 A;  2FIE A;  4GWW A;  1WDN A;  1FCK A;  3QUJ A;  4F3P A;  4U4X A;  1N84 A;  3D1R A;  1POY 1;  5DW8 A;  2DS9 A;  1BLF A;  1FQC A;  1FPG A;  3QIM A;  1YZ0 A;  5M2V A;  2V3Q A;  5IZ1 A;  1A8E A;  1FBG A;  2I4B A;  5IKB A;  4HE0 A;  1H45 A;  4PBQ A;  4GFR A;  3PUX E;  2G29 A;  2HZK A;  4HCY A;  3WAE A;  4DXC A;  4OVQ A;  3O6I A;  4GD5 A;  4TOZ A;  3O29 A;  3RNN A;  2F36 A;  1LBV A;  3KN3 A;  1MPB A;  2ZNT A;  2CEX A;  4ZEC A;  1IXG A;  1BTJ A;  4EQ9 A;  1M5F A;  3W9W A;  4GX4 A;  2UVJ A;  4Q8R A;  1RKM A;  1JP4 A;  3LUZ A;  3S2V A;  1OMP A;  3VVF A;  5FTI A;  3CSG A;  4OEN A;  2XXT A;  3T9H B;  3T93 B;  1ZBM A;  2XXW A;  5A5X B;  4GQO A;  2O51 A;  2YPN A;  1MH3 A;  2B4L A;  2Z8E A;  4OFO A;  4BDM A;  1T0K A;  1RYO A;  4HW8 A;  5BWJ A;  2DXR A;  1FBF A;  4PFR A;  1A40 A;  3ZSF A;  1GV8 A;  1H44 A;  2F7C A;  4IO5 A;  1PBP A;  5I5P A;  5IZ3 A;  1VSO A;  4EF1 A;  1D9Q A;  4HCW A;  1JNF A;  4QHQ A;  5L9M A;  1OVB A;  3ISP A;  4PQJ A;  2HZL A;  3IX1 A;  2O6A A;  4NN3 A;  4OZ9 A;  3A29 A;  1WVJ A;  2I48 A;  3WAF A;  2ZZX A;  2OX3 A;  4G68 B;  1ELJ A;  4LN5 A;  2UXA A;  5H8Q A;  3TTK A;  5ET7 A;  2LAO A;  1SI1 A;  3KSJ A;  1FBP A;  3P7I A;  3FZV A;  3FUZ A;  5FBP A;  3LC8 A;  3LV0 A;  1URS A;  1G0I A;  2DOJ A;  5B7D A;  4ZEF A;  1B4Z A;  1LFH A;  1Z7N E;  5AA3 A;  5KDT A;  3RUM A;  2QRY A;  4U21 A;  3U92 A;  1M5E A;  3CRB A;  2CZI A;  3O66 A;  4N81 A;  3CR9 A;  1B5H A;  1RDZ A;  2DYX A;  3H06 B;  2V3U A;  3PUZ E;  4M1V A;  3KJ7 A;  1NUY A;  1GVC A;  4NG7 A;  4HXV A;  5K2X A;  2Q2A A;  1INP A;  3SKP A;  3RYD A;  3MVW A;  1PDA A;  3KN7 A;  1IMF A;  1MXU A;  4THI A;  1NFT A;  4G2Z A;  4JWO A;  1OQH A;  2L5V A;  1UTH A;  4QFN A;  5I2N A;  1MQJ A;  2V93 A;  5ELV A;  3K1N A;  1IMB A;  1Y20 A;  4GX6 A;  4DXB A;  4U4S A;  3OEM A;  2IEE A;  4EDP A;  3CFZ A;  1FQF A;  2FYI A;  2R6G E;  3VLV A;  1H43 A;  3BIH A;  3L6G A;  2XX8 A;  5I57 B;  2HAV A;  4RK9 A;  1DSN A;  1MPD A;  4KQP A;  2MKZ A;  1D4N A;  1XVX A;  4OVR A;  2HPG A;  4G8M A;  1NUZ A;  3B50 A;  4N6P A;  1NNF A;  3RGY A;  1D3K A;  3W9V A;  2XXV A;  1FBC A;  2P2A A;  3TYH A;  1VFE A;  4MNI A;  4MH5 A;  2FA7 A;  5DEX B;  1YTV A;  5DTB A;  4EF2 A;  2AIX A;  4E0W A;  1IIW A;  2O7I A;  4HE2 A;  2BJJ X;  1NI9 A;  4PAK A;  1FPL A;  3N94 A;  4P9K A;  2X7P A;  4R6K A;  3FAT A;  5L9O A;  2Q8M A;  1PBQ A;  2B3F A;  1BP5 A;  4GVO A;  3TPA A;  1F9B A;  4MLQ A;  5CBS A;  1KA0 A;  2RKM A;  1LB8 A;  4XTC Q;  4EQB A;  3UK4 A;  1BKA A;  1AL3 A;  1UTB A;  4NWC A;  3B6T A;  3M3F A;  1B7U A;  2Y84 A;  4OVS A;  5I56 A;  4GLI A;  5I84 A;  2XD2 A;  3R6U A;  3E79 A;  2OLB A;  1A99 A;  1VR5 A;  1YAE A;  2OZZ A;  4AS4 A;  4LZ8 A;  1OIB A;  1EYJ A;  1IME A;  2DE2 A;  3S4U A;  1LLS A;  4ELP A;  4ZED A;  2A5S A;  3IO4 A;  3MP1 A;  4U23 A;  1AMF A;  1D9Y A;  4H1X A;  4XXU A;  5ITO A;  4UAB A;  3FJG A;  3VV5 A;  2XXK A;  4PFI A;  3TKD A;  4QFL A;  1MDP 1;  4FE8 A;  3K4U A;  3V8X B;  3SES A;  4DIG A;  2Y7K A;  4R75 A;  1NKX A;  1OQG A;  2DQV A;  3IB1 A;  4KPT A;  3KG2 A;  1VFD A;  1NV3 A;  3E13 X;  1LAG E;  1MY4 A;  4JBZ A;  4IO7 A;  5ICT A;  1XVY A;  2ALU A;  2F6P A;  3MC2 A;  2YLN A;  4H6D A;  3PGF A;  2F3B A;  1IEJ A;  3EHU A;  4NF8 A;  1B0H A;  4KYS A;  1DBZ A;  3C36 A;  4NF6 B;  4I40 A;  5AA4 A;  1HSE A;  3GLB A;  1Q9D A;  1EZP A;  5B70 A;  2XXI A;  4YKP A;  5FHN A;  4I9D A;  3TTM A;  3RPW A;  3DM0 A;  1HSJ A;  1JW5 A;  1M5D A;  1YPN A;  4GF8 A;  5DEX A;  1K9Z A;  3RN8 A;  3GBA A;  4JSD A;  4JWX A;  1MM7 A;  4JVD A;  3B6W A;  5DYH A;  3E3K A;  2QPQ A;  3UP9 A;  3U1O A;  3H7M A;  3BFU A;  3RPL B;  3HO7 A;  1Z7M E;  5I58 B;  3LSX A;  1LAX A;  1B5J A;  2VP1 A;  1NV2 A;  4WEP A;  3SEY A;  4NF4 B;  3G3J A;  1CNQ A;  3UOR A;  1P99 A;  1QJM A;  2XXY A;  5I2K A;  1FSA A;  3T9U A;  2Z8F A;  3PUV E;  1EZ9 A;  4LQ5 A;  3Q25 A;  3MVX A;  1NV4 A;  3OEL A;  5H8H A;  2CMO A;  4P0I A;  2V4C A;  1UQW A;  1K9Y A;  3SEW A;  2I58 A;  5L9S A;  2RCB A;  1PB8 A;  4N13 A;  3ZS6 A;  4KD5 A;  1CE2 A;  1O63 A;  1IUD A;  1MXW A;  3IOR A;  3KEI A;  2WYK A;  2KQZ A;  2I0B A;  2RIN A;  5KCJ B;  3K0V A;  4P11 A;  2IA4 A;  4BDQ A;  3U72 A;  3IJO B;  4ONY A;  4H8J A;  3C34 A;  4PDH A;  4QSD A;  3V83 A;  2F7B A;  1FRP A;  3IOV A;  1RDY A;  5AA2 B;  1S50 A;  4PAI A;  2O69 A;  3H6T A;  3K6V A;  1NNK A;  1B9J A;  1SI0 A;  3E78 A;  4FBP A;  1ZMG A;  4GBV A;  4LUB A;  4P56 A;  1B0L A;  4RJZ A;  2DWH A;  2CZL A;  1MQH A;  2VPN A;  1USY E;  1S7Y A;  1I6B A;  1Q35 A; 
#chains in the Genus database with same CATH homology
 1FPB A;  4XF5 A;  1FBF A;  1IMD A;  4PFR A;  5EYG A;  1DCU A;  4MCO A;  1LEV A;  1VDW A;  3U65 A;  2FBP A;  2DE4 A;  3NOH A;  1FBD A;  5I5P A;  1DK4 A;  5IZ3 A;  1KZ8 A;  4MNP A;  1D9Q A;  4HCW A;  4NHB A;  4F18 A;  4AS5 A;  1QGX A;  3T1B A;  3ISP A;  2HZL A;  4NN3 A;  2QVR A;  3A29 A;  4N15 A;  2ZZX A;  2OX3 A;  4LN5 A;  2OWZ A;  5ET7 A;  3B8B A;  4P3L A;  1FBP A;  1FJ6 A;  2XA5 A;  2DVZ A;  1YXI A;  5FBP A;  2VT5 A;  2Y5K A;  3LV0 A;  1G0I A;  1FBH A;  1FPJ A;  4O8M A;  4GBW A;  3HFU A;  4F1U A;  4MHF A;  4MJO A;  4JVI A;  1EYI A;  1FPE A;  2CZI A;  4N17 A;  4N81 A;  4PDD A;  1IMC A;  1RDZ A;  2FVZ A;  4M1V A;  4NF0 A;  1NUY A;  5EQ7 A;  4G61 A;  4NG7 A;  4PET A;  4HXV A;  3IFC A;  1INP A;  3RYD A;  1IMF A;  4N91 A;  4YZZ A;  4X9T A;  4F1V A;  2Q9T A;  2L5V A;  4GWX A;  4MEV A;  5ET6 A;  5EQ8 A;  5T3J A;  1IMB A;  1XI6 A;  4YIC A;  4GX6 A;  2CZK A;  4MMP A;  2XWI A;  4NAP A;  1YYZ A;  3MYU A;  4PTK A;  4PE3 A;  3BIH A;  1FBE A;  1NV0 A;  4PCD A;  2MKZ A;  1FTA A;  4I3E A;  4OVR A;  2HPG A;  4KXP A;  1NUZ A;  3B50 A;  2HHM A;  4NQ8 A;  3W9V A;  2WEF A;  1NV7 A;  2WX9 A;  1FBC A;  2R8T A;  2GQ1 A;  4N6K A;  4XEQ A;  3RPL A;  4MNI A;  4X04 A;  3KBZ A;  4GWU A;  2Y5L A;  4MAG A;  3CHG A;  5IZZ A;  4HE2 A;  1NI9 A;  1NUX A;  3FBP A;  4PAK A;  4MX6 A;  4P8B A;  1LBY A;  4H45 A;  5IZ3 B;  5J16 A;  4GWY A;  1FPL A;  4P9K A;  4OA4 A;  2PCR A;  5J1D A;  4NX1 A;  4O94 A;  5IM2 A;  4GX3 A;  2Q8M A;  2ZZV A;  4N8G A;  1KA0 A;  2DDK A;  2Q74 A;  2XWV A;  2ZZW A;  2WYP A;  4OAN A;  2XWO A;  4OVS A;  3GYY A;  3E79 A;  4AS4 A;  4OVT A;  2HXR A;  1EYJ A;  1IME A;  2DE2 A;  2P3N A;  4NGU A;  2B4M A;  1LBZ A;  5JK4 A;  4UAB A;  5EQA A;  4PF6 A;  4N6D A;  1FJ9 A;  2XXK A;  4PFI A;  4MIJ A;  2DE3 A;  4XFE A;  2P3V A;  5ET5 A;  2WBD A;  5EYH A;  4PFB A;  1NV3 A;  1FPF A;  2QVU A;  3IFA A;  5I7I A;  4DI3 D;  4GWZ A;  2PFY A;  1AWB A;  1FPI A;  2F3B A;  2WBB A;  4P47 A;  1DBZ A;  1G0H A;  4I40 A;  1IMA A;  4MNC A;  1RDX A;  1Q9D A;  1NV1 A;  1EYK A;  4JVC A;  2BJI A;  3QMF A;  2XWK A;  5F24 A;  3PTY A;  4N4U A;  1K9Z A;  2PFZ A;  2F5X A;  4I3Y A;  4P1E A;  5IGA A;  4IR8 A;  1LBX A;  1FPD A;  2QFL A;  4JVD A;  1BK4 A;  1NUW A;  2FHY A;  5I3S A;  2QPQ A;  3BIG A;  4HE1 A;  5LTC A;  1KA1 A;  3RPL B;  2KR0 A;  4PF8 A;  5EQ9 A;  4OVP A;  2JJK A;  3KC0 A;  1NV2 A;  5LDZ A;  5ET8 A;  4PGP A;  3ROJ A;  2VPO A;  1CNQ A;  2CEY A;  1FSA A;  2FIE A;  1NV5 A;  4GWW A;  2FIX A;  1FPK A;  3D1R A;  1NV4 A;  5DW8 A;  1FPG A;  1YZ0 A;  2V3Q A;  2F3D A;  5IZ1 A;  2V4C A;  1FBG A;  3MST A;  1K9Y A;  4HE0 A;  4PBQ A;  5CM6 A;  4PGN A;  1LBW A;  1SPI A;  4DI4 B;  2HZK A;  2CZH A;  4HCY A;  4F19 A;  4OVQ A;  5A5L A;  4GWS A;  5ESY A;  4PAF A;  1LBV A;  2WYK A;  2KQZ A;  4PBH A;  4QBA A;  3KC1 A;  2CEX A;  3EKI A;  4PDH A;  4O7M A;  3SZP A;  3W9W A;  1FRP A;  4H46 A;  1RDY A;  4GX4 A;  1NV6 A;  4PAI A;  1JP4 A;  3LUZ A;  4PC9 A;  4QXD A;  3FXB A;  3E78 A;  4FBP A;  4P1L A;  4GBV A;  4P56 A;  3T0J A;  4N8Y A;  4X8R A;  2VPN A;  2B4L A;  2QVV A;  4O7I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...