4O7MA

Crystal structure of a trap periplasmic solute binding protein from shewanella loihica pv-4, target efi-510273, with bound l-malate
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
304
structure length
304
Chain Sequence
PTEIKFSHVVAENTPKGQMALKFKQLVEERLPGEYQVNVFPNSQLFGDNNELSALLLNDVQFVAPSLSKFERYTKKLQLFDLPFLFKDMDAVNRFQQSDAGQQLLNSMKRKGVVGLGYLHNGMKQFSASSPLVLPEDAQGKKFRIMASDVLAAQFQAVEAIPVKKPFSEVFTLLQTRAIDGQENTWSNIYSKKFYEVQSNITESNHGVLDYMVVTSNTFWKSLPADKRKVIKASLDEAIAYGNEIAAAKVNKDKQAIIDSKRSEVTYLTPEQRAAWVNAMKPVWAQFEDKIGKDLIDAAVASNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Experimental strategies for functional annotation and metabolism discovery: targeted screening of solute binding proteins and unbiased panning of metabolomes.
pubmed doi rcsb
source organism Shewanella loihica
molecule tags Transport protein
molecule keywords TRAP dicarboxylate transporter, DctP subunit
total genus 106
structure length 304
sequence length 304
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-12-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4o7mA00
3GYYA 4OVTA 4X8RA 4P1EA 2XXKA 4PE3A 2HZLA 4MNIA 4PGPA 5IZZA 4P3LA 4N91A 4PETA 4MAGA 5IGAA 4P47A 5I5PA 4MEVA 4MX6A 4MIJA 4N6DA 4LN5A 2VPOA 4PFIA 4NGUA 4DI3D 4PAIA 4OVPA 4N8YA 4PBQA 2ZZVA 4XFEA 4YICA 4XF5A 4NAPA 2PFYA 2XWKA 4NX1A 4NN3A 2ZZWA 2V4CA 4DI4B 2CEYA 2ZZXA 4NQ8A 4PGNA 2WYPA 4PC9A 4N4UA 4N6KA 4PAKA 4MHFA 4YZZA 4PCDA 4P8BA 5I7IA 4OANA 4N15A 4N8GA 4PF6A 5CM6A 4XEQA 4MNCA 2WX9A 4PF8A 5IM2A 2XWVA 3B50A 4PAFA 4P9KA 2VPNA 4OVRA 2HPGA 4O7MA 2WYKA 4P1LA 4MNPA 4OVQA 4PFRA 4MCOA 4N17A 2PFZA 4PFBA 4MMPA 4OA4A 4PBHA 4PDHA 4OVSA 4PDDA 4O94A 2HZKA 4NG7A 5LTCA 3FXBA 4NF0A 2XWOA 4P56A 2XWIA 2XA5A 4X04A 3U65A 4NHBA 2CEXA 4UABA 4O8MA
chains in the Genus database with same CATH superfamily
1Y4CA 5JEIA 1MXZA 3CFLA 3PTYA 3EHUA 4TOZA 5AA4B 3FXQA 4NF8A 1QKAA 4C1UA 1B1XA 2UXAA 4H8IA 4ONYA 1FPDA 3OO9A 1FBFA 4PQJA 4ISUA 1FTKA 4MX6A 4IO6A 1FTOA 4ZEBA 4F22A 2L5VA 3CI8A 1SW5A 3G3JA 4GVOA 1MQHA 4PBQA 2Q9TA 5ISUA 3VVEA 1H44A 3MQ9A 5I59A 4R2BA 3U93A 3PMXA 2CZKA 3U72A 1UTBB 4FIMA 2QPQA 1EYIA 3D4GA 2CEYA 1D9VA 2GFEA 2I49A 2QFLA 1PBPA 3G3IA 3OD7A 4QFOA 2O69A 4NE4A 5ICQA 2PCRA 3DLNA 1H45A 3BFUA 1MQGA 4LA9A 4AB6A 2V3QA 3O66A 3QIMA 5EQ7A 2FBPA 4N17A 3IL1B 3ODBA 4PP0A 3IB0A 5JK4A 3DM0A 4IY5A 5JTYA 2OBGA 1Y3QA 2PT2A 1QUIA 5I58B 1QKBA 4IR8A 3K1PA 3IO4A 2I4CA 1YAEA 3MZBA 3K02A 1URSA 1INPA 1D9YA 1NV0A 3FBPA 2ZNTA 3PU5A 3TDJA 4EQ7A 5AE4A 5I5PA 1RYOA 1Y4TA 4GX4A 3OO6A 4GX3A 2QL3A 4OVPA 4N8YA 5AA2A 1LBBA 4F1YA 1B0HA 1YZ0A 3PMVA 5I2NA 1B7HA 1URGA 4X1DA 3D4CA 2H5YA 3MP8A 1FQBA 1P1OA 2QVVA 4U21A 3K0VA 4DDDA 2Y84A 3QMFA 4EUOA 3H3GA 1FPJA 4POWA 4F31B 4F3SA 3SEYA 1M5EA 4YKKA 3MZ9A 4P8BA 1KWHA 3ECRA 3KC0A 2DQVA 3TEPA 4JDFA 4N15A 3HPIA 1MY2A 2O7IA 4JSOA 3Q28A 1CNQA 3PPNA 3A3UA 3N26A 2XWVA 2DE2A 1IZ1A 3USDA 1FW0A 4QRZA 4IY6A 2ANJA 1FPIA 2WKYA 4NWCA 1BK4A 4OVQA 4YKIA 4MCOA 3E79A 3FJ7A 3GBAA 5DVFA 4OA4A 2Y7IA 2GRVA 1BP5A 2FYIA 2HQ0A 4GBWA 4F3GA 5LOMA 1FBPA 4L17A 3K6WA 3E78A 4PE3A 3RN8A 3FIRA 4GIZA 4P3LA 3PGFA 1OLCA 3FVOA 2CZLA 3IFAA 1SI1A 4BDRA 5L9SA 2DS9A 1MM7A 4G8HA 3FV2A 3B6QA 2CZHA 1YPNA 4F3BA 3KSXA 4LZ7A 2UVGA 3H4ZA 2F35A 1QJMA 1L5TA 1N76A 4EQ9A 1QULA 2XXVA 4KCCA 4XIGQ 1UTBA 4RYAA 1USYE 4FJPA 2QJEA 2OK2A 4NMYA 1KA1A 3MPKA 1JEVA 2Z22A 2A5TB 3ZKLA 4KYDA 5ET5A 1B32A 1BLFA 4XKQA 2H25A 3SDFA 1A54A 2I0BA 4HS7A 3Q25A 1N0TA 2XD3A 2UYEA 1B5IA 4FE8A 1FTMA 1AWBA 3O2AA 1QUJA 1B2HA 2OWSA 4IO5A 5CM6A 2Z23A 4NF6A 2REJA 3U92A 3IX1A 3IB2A 1NV7A 3B50A 1A7LA 3QUFA 4IGRA 2XXPA 2R9JA 4GF8A 3IB1A 4KD5A 2Q2CA 1SDXA 4ZECA 2DWIA 5CMBA 1IQ7A 1SBPA 2THIA 2PT1A 1LFGA 3E13X 2ABHA 3QSLA 3FXBA 3VXBA 2I0CA 1WDNA 3PUYE 4P1EA 4R73A 2I6EA 3H7MA 1R1NA 5DEXA 2XX8A 4XKPA 1B46A 1LAFE 4Q8RA 4MEVA 1I6BA 5H8QA 4PFIA 1XI6A 3C32A 4DI3D 5HPQA 4BLAA 4U4SA 5I2KB 4OEUA 1B6HA 1HSEA 4GX6A 4F1VA 4U1ZA 3IORA 4LQ5A 3SKPA 4NF6B 2O7UA 2RKMA 3SEXA 3TYHA 2HXWA 2OZZA 2V3TA 2DE4A 1MXWA 5KDTA 4QXDA 3FVKA 4NN3A 4IO3A 5I3SA 4F2OA 1JP4A 1LBXA 3T9UA 1RDXA 4HW8A 2V3UA 2KQZA 5FTIA 3TUSA 2ZZXA 3PUXE 3R7XA 2QVRA 5EQAA 3OMBA 1BTJA 5EYHA 4AS5A 3SZPA 3EF7A 1B0LA 3ILUB 3H6UA 4I40A 2Z8EA 2OCUA 1Y3NA 1AL3A 4OFJA 1MM6A 4JB7A 3IJXB 4O7IA 1TWYA 1FTAA 3M3FA 1WVJA 1I6AA 1PB9A 3O6IA 2V25A 1LBYA 1II5A 3IOVA 1SVXB 4PDHA 2DVZA 4HCYA 5JTYB 2XXRA 4OEVA 1PC3A 2XXTA 2P3NA 4NHBA 4OESA 3U1OA 4EDPA 2BJIA 2F7AA 2A5SA 1MDQA 4R9FA 3GYYA 5EHMA 3FVGA 4YMBA 5F7VA 3K00A 3HO7A 2HZLA 4MNIA 1RDZA 2XXHA 5CRYA 1MQDA 1ZMGA 2NVUB 3JV9A 3KOTA 3HHFA 3TODA 4BDQA 1AH5A 3W9WA 5TP9B 3O6HA 3W15C 3OEMA 1B3HA 5M2VA 3Q27A 4KI0E 2OWZA 2ONRA 4TLMB 4YICA 3PPPA 1I6QA 5L9OA 2F78A 5ITPA 1SD3A 3G7WA 3VLWA 1Z7NE 1PDAA 1MRPA 4MLQA 3KSJA 2ZNSA 2HFBA 2Y5LA 3RNNA 1D9QA 2Y7WA 1DPEA 1NKXA 4N6KA 5I57B 1IMFA 4OXVA 2GHBA 4XEQA 1JVYA 5DYHA 3B8BA 5EYGA 5H8NA 4IO2A 1NV6A 5I56B 1EYKA 5K2XA 4HE2A 1PB8A 4F39A 1LCFA 1ATGA 2VPNA 3T9VA 4OVRA 3EKIA 1OVTA 1A8FA 1IMAA 4GWWA 1NV2A 3V83A 1Q35A 3K1NA 4FATA 1B5HA 2VD2A 2DXYA 3SESA 3O28A 2QS4A 4HXVA 4AS4A 4QFNA 2DXRA 3RTFB 5L8DA 3BKIB 2HEUA 3S4UA 1NMUA 3THIA 2QMXA 4PGPA 2AL5A 3DELB 4EF2A 3IAZA 4PETA 3S9LC 3SETA 3IOTA 1B05A 5A5XB 2AIXA 4ESWA 2UVJA 2BJJX 2DSFA 4DXUA 3CVGA 1LB9A 1QVSA 3KEIA 1FTLA 3VXCA 4ESXA 4P0GA 2DDKA 1MY4A 4G2ZA 1R9QA 3FXRA 4THIA 5B70A 4NAPA 3FASA 3R26A 2F6GA 3V8XB 3KZGA 4BDNA 1LLSA 4KFQA 3T0JA 4OZ9A 1NNFA 3E3KA 3OSRA 4XXUA 5I2NB 1IXIA 2V4CA 4DE8A 1Y1MA 3K01A 3SEWA 3RTWB 4YZZA 3M8UA 3O9PA 3JZJA 1SW4A 4I8CA 2ONKE 4KYEA 5KCJB 4QHQA 1D3KA 4PF6A 5A5XA 3KG2A 3C9HA 1FBHA 4WEPA 3C33A 1LBVA 1LFHA 4PAFA 1QW0A 3UIFA 2HPGA 4R75A 2I48A 3VLVA 3MZ1A 2GH9A 3PPRA 3B6TA 5CBRA 2ZNUA 2HZKA 4F2QA 1DBZA 4MFIA 1LFIA 1N84A 1HSJA 2XWOA 3OO7A 2LAOA 3T22A 1G0IA 1P1NA 1FBGA 4G61A 4GWUA 3N5LA 1URDA 2F6PA 4JVCA 4KR5A 2YPNA 3IK6B 4NWDA 1HSLA 1OIBA 5H8SA 4RA1A 2Z8DA 4PE5B 1NV3A 4JBZA 4ELOA 4NF4B 2VPOA 4QSEA 2I3VA 2QMWA 4H46A 4NGUA 5I2KA 3LUZA 5L9MA 3TKDA 3C34A 5TPAB 2QS2A 3PUWE 1RDYA 1XS5A 3QXMA 3OEKA 3VV5A 1O63A 1ZIUA 1UQWA 2VOZA 1N3WA 3EQ1A 3PD9A 3T9XB 2RC9A 5ITOA 4DI4B 2AYSA 2O1MA 3BIGA 1M5CA 2GQ1A 5BUUA 4PFTA 2B3BA 3ONMA 2PBWA 2P2AA 2VT5A 4YAHX 1JETA 4OETA 1ELJA 1TXFA 1TT1A 4NF5A 3GZGA 5EQ8A 2ZYKA 4P9KA 1UIVA 4KHZE 1IMEA 1NUZA 5CC2A 1SW1A 3TFLA 4RXLA 1B3LA 3CG3A 4ZE9A 4EXKA 3QUJA 4GWXA 4LATA 1N3XA 4R74A 3KGCA 4OMBA 1DMBA 1MPBA 3WAFA 4LQ2A 1MPCA 1MXUA 5DVJA 4O8MA 4H8JA 4GWYA 2RF1A 4FBPA 2FIEA 4PFUA 5K2YA 1GV8A 5KZTA 1Z7ME 3G3KA 4Z0IA 1ANFA 4BDMA 3LV0A 2F34A 2DWHA 3OENA 1VR5A 2PMSA 4FECA 3SEVA 1BKAA 4H5GA 3PUZE 1NH7A 4NEDA 4QF9A 3RGYA 1FRPA 1PB7A 3QAXA 4GXAA 4PAIA 2Y7KA 5ICTA 4QBAA 3L6HA 3B6WA 3MBPA 4H6DA 3KN7A 3N6TA 1NUWA 3O6GA 2YLNA 4DZ1A 3FJGA 5IZ3B 1FPEA 1MQIA 3CRBA 3IFCA 5CMCA 2UVHA 1NUXA 1B7ZA 2B65A 4YKPA 4HCWA 5ESYA 1H3DA 1PBQA 2ALUA 2I4BA 5TPAA 1S7YA 3QK6A 2H9BA 2KLFA 1XOCA 2XXWA 2I58A 3VVFA 3V5AA 5I7IA 5H8NB 4OANA 4QFKA 1LBZA 1P1WA 2WX9A 2F3BA 1D4NA 4OWDA 5HM4B 1MQJA 1XT8A 3I3VA 3TZAA 4GWZA 4ZDMA 3LC8A 3KN8A 2QVUA 3O97A 4PTKA 1MXYA 4JVDA 1NFTA 3TMGA 4ZEFA 3RYDA 4GXSB 3MW0A 1FCKA 2FHYA 3SEUA 1A8EA 1DOTA 1LBWA 4GOTA 1SYHA 1TFDA 1IMDA 3K1MA 5I56A 2O51A 1B58A 4U1OA 3KJ7A 3LBSA 2VHAA 4LN5A 2FIXA 3CIJA 5I57A 4N13A 3B7DA 3RPWA 1B3FA 5FHNA 2OX3A 4JVIA 3FD3A 5BWJA 3HCQA 4K3FA 5DVIA 5I59B 1DSNA 3LSWA 4RPOA 2P1SA 3VFJA 3IOWA 4NQ8A 1NH8A 1K9YA 1XC1A 3EHSA 5J1DA 2XX7A 2RC8A 3EHTA 2F3DA 3CSGA 4Q5TA 2NOOA 4JXIA 1FPFA 5ET8A 4OENA 1AOVA 1OQGA 4JWYA 1FQCA 2D3IA 4KXPA 4F29A 3PV0E 4XKNA 2V84A 2ZYNA 4G68A 4BDLA 4MNPA 3D1RA 4QFPA 2HHMA 1FTJA 1POTA 4I9DA 4MMPA 4H45A 1MS7A 4FAJA 2E1SA 4NG7A 1K9ZA 4QSDA 4P56A 4UABA 3G3GA 4M4GA 1EZ9A 5FBPA 1IITA 4H67A 4P11A 2WBBA 4OVTA 4X8RA 4E0XA 4O3BA 1Q1KA 1B3GA 2F5XA 1UTHA 4H0WA 2OJTA 4X9TA 4GFRA 4P47A 4GQOA 4POXA 4ZS9A 4BDOA 2RCAA 4RK9A 4EF1A 4G68B 3H6VA 4WXJA 1IXCA 1EZPA 4WKMA 1S9TA 5H8QB 2WBDA 2PFYA 3T9HB 3T96B 4G8MA 5AA1A 2UYFA 1FPKA 2B4LA 2RCBA 2Q8JA 3H6TA 2D5WA 5I58A 4YU0A 3MJNA 2XD2A 4N4UA 4KYSA 4PCDA 1FBEA 4NF4A 1LAXA 2F7CA 3C35A 5H8FA 1VFDA 1NV1A 3BBRA 3GLBA 4O7MA 4ZZEA 4XKRA 1VSOA 2XXIA 3HSTA 2R8TA 5EQ9A 4IO7A 2Y7RA 5FHMA 1AMFA 1H43A 3TTLA 1IMCA 3N6UA 2QSXA 4YKJA 4OQOA 1ZJLA 4WEDA 3NOHA 2B3FA 3EPEA 3TPAA 1N7XA 2OWTA 1IUDA 3K6XA 5IGAA 3F11A 2FVZA 4LUBA 4OERA 5HBCA 2W7YA 3KJTA 3LSLA 2PX1A 3Q29A 5H8FB 5J16A 4MIJA 4N6DA 5H8HB 2ESNA 3PMWA 3I5OA 2H99A 5A5LA 3QYTA 2ZZVA 2Q89A 3M3LA 3K6UA 4YB5A 5CI5A 1FPBA 4QSCA 2IA4A 2IEEA 1SYIA 4H5FA 1F9BA 1YTVA 2FNCA 2G29A 4GRKA 1LEVA 2VGQA 3E9XA 4R6KA 5AA4A 4F18A 1XVXA 1GVCA 2O84X 3BIHA 1RYXA 2ZZWA 1CB6A 3S9NC 1B4HA 4GL0A 2NUVA 4R6YA 5FTHA 1R9LA 4PAKA 4C1TA 3FXUA 3TQLA 1QGXA 1YXIA 1KZ8A 2H4IA 1JNFA 1FSAA 2PYYA 4KPTA 3C31A 3IJOB 4JSDA 3MSTA 1MH4A 2RC7A 1USYH 5DW8A 3RT8A 4P1LA 1FPLA 3L6GA 1OQHA 4OFLA 1ZKBA 3MVYA 3TCHA 1IXGA 3IR1A 4IB2A 2DWJA 4TLLB 3DP4A 3R6UA 3VDFA 4YMAA 2REGA 4H65A 2DWAA 3MVZA 5ELVA 2XXQA 5AA2B 4C0RA 4DXBA 2XXXA 3H6WA 2ZYMA 1POY1 3GXAA 3RLFE 4I3YA 1N04A 3G3HA 3S9MC 2DP8A 4FEDA 1M5FA 4DCYA 2XXYA 1LB8A 2DE3A 2X7PA 1B7UA 2ONSA 3IOUA 1JQFA 4FEBA 3LUYA 4RJZA 1LCTA 2GHAA 3MVXA 4XFEA 1B40A 3OOAA 4JWXA 2Z8FA 2X26A 1VDWA 5TU0A 3U94A 4YB7A 4ZEKA 3HV1A 3T1BA 1Y1ZA 3K6VA 1IMBA 2ZYOA 3T93B 4G68C 4U2RA 3CG1A 3UORA 3G3FA 3TTRA 3AXFA 4EQBA 1XHYA 4MLVA 1Y9UA 1NNTA 2ZMBA 1NNPA 3FJMA 4RY1A 4X1BA 4ND9A 2P3VA 3LSXA 1GGGA 3P7IA 4I3EA 2Q8MA 4OVJA 2FA7A 2Y5KA 2CZIA 3U8QA 3UGWA 4FORA 4Z7EA 3FGSA 2QS3A 3CFXA 2VP1A 3PPOA 2PFZA 1GR2A 3C4MA 4PDDA 4U4XA 1AIVA 4R9GA 3TELA 1B51A 5IAIA 5LTCA 1UTHB 5ET6A 2VD3A 1GTKA 4IO4A 3KN3A 4F19A 1XVYA 3W9VA 3WAEA 2XXKA 3RQTA 3HHGA 1YCJA 3TCGA 3FUZA 3HN0A 4HE1A 5IZ1A 1FBDA 1P1QA 1TFAA 4HE0A 1FQFA 2V93A 3CR9A 4LZ5A 4F3PA 4NF5B 4U22A 1MXVA 1DCUA 3FATA 1EYJA 4ELQA 4O3AA 1I69A 3O29A 1FQDA 2F7BA 1SPIA 4N6PA 2HCAA 1ZLQA 1FJ9A 3KC1A 4DCXA 4PGNA 4OYVA 3H03A 2PVUA 3A29A 2DYXA 4P0IA 3S9EA 1NUYA 5FHOA 1A40A 3TQWA 4I1DA 3RUMA 2JJKA 5F1QA 2XX9A 3I6VA 3TTNA 4JWOA 5AA3A 4NTLA 1B9JA 1QUKA 1MXXA 1MG1A 1VE4A 1PEBA 3LSFB 3ZSFA 1O7TA 1MY0A 4R2FA 4PFBA 1EH3A 1R6ZA 5KDTB 1G0HA 4ECFA 4HTGA 1US4A 4NF0A 1FQEA 4KCDA 2XA5A 5B7DA 5DEXB 2Q2AA 3Q26A 2NWJA 1J1NA 4UACA 3KOSA 2Q74A 2Y7PA 3PD8A 1OLAA 4LONB 1MH3A 2O6AA 4MAGA 1O64A 4OHNA 3K4UA 1IXHA 1IEJA 4KQPA 3ZS6A 3OSQA 1OMPA 5KCJA 3KBZA 2DVCA 3A3CA 3K2DA 3MVWA 4X48A 2P0SA 4IGTA 4GL8A 3ROJA 1IIWA 1SW2A 4G8NA 2G93A 4YB6A 2O1LA 1LAGE 3M3KA 1Q9DA 4H1XA 2R6GE 2XWKA 4NX1A 1P99A 4GBVA 3UK4A 4DXCA 2AL4A 4LVQA 1US5A 3BFTA 1NI9A 1EU8A 2NXOA 1OVBA 1DTZA 1N7WA 3RY3A 2XHDA 3KBRA 4RNSA 3MAMA 4ZEIA 4MHFA 3MUQA 1H76A 1DTGA 1Y3PA 4MNCA 4G4PA 4O3CA 4M1VA 4QFLA 3VVDA 2XXUA 3IO6A 3RT6B 2HXRA 2Q88A 1KA0A 2HAVA 1MY3A 5I84A 4G77A 5EYFA 4PBHA 1RKMA 3MP1A 1NL5A 4XTCQ 4F1UA 4OTEA 4GLIA 1ZBMA 4U23A 5IZ3A 4X04A 5LDZA 4PFYA 1EZOA 3TTMA 3KFMA 1JW4A 4R6HA 5IZZA 3T66A 1FJ6A 1UIUA 5TP9A 3GBBA 1SI0A 3TTKA 4ELPA 3PPQA 1MDP1 2D21A 3MYUA 2O68A 2E0SA 1DPPA 2DOJA 5IKBA 3VLUA 1MPDA 1ZU0A 5T3JA 2F8DA 3EN3A 1JW1A 4XF5A 3MP6A 4GWOA 4UA8A 1FPGA 3DP6A 4MBPA 4MJOA 4Q0CA 2X7QA 3UN6A 4ELRA 1ZTYA 4TQUQ 3FV1A 1A99A 3MWBA 5H8HA 1BIYA 5CMMA 2B4MA 4I62A 4PF8A 5IM2A 1T0KA 3OXNA 4AQ4A 4ZZAA 5DT6A 4DIGA 4MF3A 1JEUA 3RPLB 3UP9A 2WYKA 3CFZA 5ET7A 4PFRA 3S2VA 1A55A 5CMKA 4LP2B 1LBCA 2HAUA 3MC2A 3E4RA 2I3WA 1B3EA 4Q30B 4O94A 4R72A 1MY1A 4RK2A 3U65A 1CE2A 3UA8A 2CEXA 4EXLA 3A09A 1B1HA 2QS1A 1FBCA 1JVXA 1M5DA 3OO8A 1FQAA 1B5JA 4AB5A 1SQYA 4RPNA 4N91A 1NNKA 2ZXTA 3ZKKA 1VFEA 4PFWA 2F36A 5DTBA 5F24A 2YJPA 1NV5A 1YYZA 1B4ZA 2R71A 3RPLA 1S50A 1LGBC 4NF8B 1P1UA 2WEFA 4DLDA 3JYRA 4ZE8A 4LZ8A 2RINA 1WODA 2KR0A 3V89B 3H06B 4N07A 4N81A 3ILTB 3FVNA 4ZEDA 3MPLA 4E0WA 3TAJA 1JW5A 3LR1A 4MH5A 2OLBA 5CBSA 4GWSA 1LAHE 3CHGA 3N94A 5AA2D 2WYPA 2QRYA 4PC9A 1NV4A 2F97A 2UVIA 3C36A 2MKZA 2M8CA 3CSBA 4N8GA 1LSTA 1B52A 1M5BA 3PUVE 3TCFA 3SERA 3DP8A 3HFUA 2A5TA 1Y20A 4OVSA 2CMOA 3FZVA 5EHSA 2H98A 3OELA 4OFOA 2XWIA 3VE1B 3ISPA 4GD5A 1DK4A
chains in the Genus database with same CATH topology
1FBCA 4FBPA 3GYYA 4GWUA 2WBBA 3E78A 2FIEA 4OVTA 3PTYA 2Q74A 4P1EA 2FHYA 2XXKA 4IR8A 4X8RA 4PE3A 4JVCA 2HZLA 4MNIA 4PGPA 3NOHA 1LBWA 1RDZA 5IZZA 2F5XA 4P3LA 4N91A 1INPA 4I3YA 3LV0A 4MAGA 4PETA 3IFAA 1FJ6A 4X9TA 4HE1A 1NV0A 3FBPA 5IGAA 5FBPA 1IMDA 2FVZA 1FPDA 1FBFA 5IZ1A 4P47A 5I5PA 4MEVA 5F24A 1NV3A 1FBDA 5J16A 2DE3A 4MX6A 4MIJA 4N6DA 1NV5A 3W9WA 1YYZA 2CZHA 2FIXA 4GX4A 4LN5A 2VPOA 3KBZA 4HE0A 4PFIA 1XI6A 4H46A 4NGUA 3MYUA 4DI3D 1FRPA 5DW8A 2L5VA 3RPLA 3LUZA 4GX3A 4PAIA 4OVPA 4QBAA 5A5LA 2OWZA 5T3JA 4N8YA 2OX3A 4PBQA 2Q9TA 2ZZVA 2WEFA 2DDKA 4GX6A 4XFEA 4F1VA 3ROJA 1NUWA 2WBDA 1FPBA 4YICA 1YZ0A 4XF5A 2KR0A 4JVIA 2PFYA 4NAPA 1RDYA 1VDWA 5IZ3B 1FPEA 1Q9DA 2XWKA 4NX1A 1DCUA 1FPGA 4N81A 1EYJA 2CZKA 4GBVA 3IFCA 3T0JA 1LEVA 3T1BA 1KA1A 2DE4A 1IMBA 1SPIA 2B4LA 1FPKA 1NUXA 2QVVA 4NN3A 4QXDA 3QMFA 1NI9A 4F18A 5I3SA 2QPQA 4MJOA 3BIHA 4HCWA 2ZZWA 1JP4A 2V4CA 1LBXA 5ESYA 1RDXA 4GWSA 1FPJA 1FJ9A 5ET5A 1EYIA 2Y5LA 3CHGA 2KQZA 3KC1A 4DI4B 2CEYA 1D9QA 2ZZXA 4NQ8A 2QVRA 4PGNA 4AS5A 2WYPA 1K9YA 2QFLA 5EQAA 5J1DA 3BIGA 2F3DA 4PC9A 4N4UA 4N6KA 4PAKA 4MHFA 4YZZA 1IMFA 1NV4A 3A29A 5EYHA 3SZPA 2GQ1A 4PCDA 4P8BA 1NUYA 2MKZA 1FBEA 1AWBA 1QGXA 1YXIA 3KC0A 5I7IA 1KZ8A 2VT5A 4OANA 1FSAA 1FPFA 4N15A 1LBZA 5ET8A 4N8GA 4PF6A 4I40A 5CM6A 4XEQA 2B4MA 4MNCA 2PCRA 2WX9A 3B8BA 2F3BA 4PF8A 2JJKA 5EYGA 4KXPA 3MSTA 5IM2A 1CNQA 2P3VA 1NV6A 1FBHA 1EYKA 4I3EA 1NV7A 1LBVA 2XWVA 2Q8MA 2DE2A 4HE2A 3B50A 4M1VA 4PAFA 5EQ8A 1NV1A 2VPNA 4O7IA 4P9KA 4OVRA 1FTAA 2HPGA 2HXRA 4O7MA 3RPLB 3EKIA 2Y5KA 1KA0A 2CZIA 2V3QA 1IMEA 1FPIA 1NUZA 2WYKA 1FPLA 4MNPA 1IMAA 1BK4A 4OVQA 4GWZA 4P1LA 4PFRA 4MCOA 5EQ7A 3D1RA 5ET7A 1LBYA 4GWWA 2FBPA 2HHMA 3E79A 4N17A 1NV2A 3HFUA 2PFZA 2R8TA 4PFBA 2QVUA 4MMPA 4PTKA 5EQ9A 4OA4A 4PBHA 4PDHA 4OVSA 4H45A 4O94A 2DVZA 4PDDA 5JK4A 1G0HA 4HCYA 2HZKA 4F1UA 1DBZA 4GWXA 4GBWA 1K9ZA 4NG7A 5LTCA 3FXBA 4NF0A 2XWOA 5ET6A 4P56A 2XWIA 4JVDA 4HXVA 2XA5A 5IZ3A 3ISPA 4X04A 3U65A 4AS4A 1IMCA 1G0IA 2P3NA 2CEXA 1FBPA 4NHBA 2BJIA 4UABA 1DK4A 1FBGA 4O8MA 3RYDA 4F19A 5LDZA 3W9VA 4G61A 4GWYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GYY A;  4OVT A;  4X8R A;  4P1E A;  2XXK A;  4PE3 A;  2HZL A;  4MNI A;  4PGP A;  5IZZ A;  4P3L A;  4N91 A;  4PET A;  4MAG A;  5IGA A;  4P47 A;  5I5P A;  4MEV A;  4MX6 A;  4MIJ A;  4N6D A;  4LN5 A;  2VPO A;  4PFI A;  4NGU A;  4DI3 D;  4PAI A;  4OVP A;  4N8Y A;  4PBQ A;  2ZZV A;  4XFE A;  4YIC A;  4XF5 A;  4NAP A;  2PFY A;  2XWK A;  4NX1 A;  4NN3 A;  2ZZW A;  2V4C A;  4DI4 B;  2CEY A;  2ZZX A;  4NQ8 A;  4PGN A;  2WYP A;  4PC9 A;  4N4U A;  4N6K A;  4PAK A;  4MHF A;  4YZZ A;  4PCD A;  4P8B A;  5I7I A;  4OAN A;  4N15 A;  4N8G A;  4PF6 A;  5CM6 A;  4XEQ A;  4MNC A;  2WX9 A;  4PF8 A;  5IM2 A;  2XWV A;  3B50 A;  4PAF A;  4P9K A;  2VPN A;  4OVR A;  2HPG A;  4O7M A;  2WYK A;  4P1L A;  4MNP A;  4OVQ A;  4PFR A;  4MCO A;  4N17 A;  2PFZ A;  4PFB A;  4MMP A;  4OA4 A;  4PBH A;  4PDH A;  4OVS A;  4PDD A;  4O94 A;  2HZK A;  4NG7 A;  5LTC A;  3FXB A;  4NF0 A;  2XWO A;  4P56 A;  2XWI A;  2XA5 A;  4X04 A;  3U65 A;  4NHB A;  2CEX A;  4UAB A;  4O8M A; 
#chains in the Genus database with same CATH topology
 1Y4C A;  5JEI A;  1MXZ A;  3CFL A;  3PTY A;  3EHU A;  4TOZ A;  5AA4 B;  3FXQ A;  4NF8 A;  1QKA A;  4C1U A;  1B1X A;  2UXA A;  4H8I A;  4ONY A;  1FPD A;  3OO9 A;  1FBF A;  4PQJ A;  4ISU A;  1FTK A;  4MX6 A;  4IO6 A;  1FTO A;  4ZEB A;  4F22 A;  2L5V A;  3CI8 A;  1SW5 A;  3G3J A;  4GVO A;  1MQH A;  4PBQ A;  2Q9T A;  5ISU A;  3VVE A;  1H44 A;  3MQ9 A;  5I59 A;  4R2B A;  3U93 A;  3PMX A;  2CZK A;  3U72 A;  1UTB B;  4FIM A;  2QPQ A;  1EYI A;  3D4G A;  2CEY A;  1D9V A;  2GFE A;  2I49 A;  2QFL A;  1PBP A;  3G3I A;  3OD7 A;  4QFO A;  2O69 A;  4NE4 A;  5ICQ A;  2PCR A;  3DLN A;  1H45 A;  3BFU A;  1MQG A;  4LA9 A;  4AB6 A;  2V3Q A;  3O66 A;  3QIM A;  5EQ7 A;  2FBP A;  4N17 A;  3IL1 B;  3ODB A;  4PP0 A;  3IB0 A;  5JK4 A;  3DM0 A;  4IY5 A;  5JTY A;  2OBG A;  1Y3Q A;  2PT2 A;  1QUI A;  5I58 B;  1QKB A;  4IR8 A;  3K1P A;  3IO4 A;  2I4C A;  1YAE A;  3MZB A;  3K02 A;  1URS A;  1INP A;  1D9Y A;  1NV0 A;  3FBP A;  2ZNT A;  3PU5 A;  3TDJ A;  4EQ7 A;  5AE4 A;  5I5P A;  1RYO A;  1Y4T A;  4GX4 A;  3OO6 A;  4GX3 A;  2QL3 A;  4OVP A;  4N8Y A;  5AA2 A;  1LBB A;  4F1Y A;  1B0H A;  1YZ0 A;  3PMV A;  5I2N A;  1B7H A;  1URG A;  4X1D A;  3D4C A;  2H5Y A;  3MP8 A;  1FQB A;  1P1O A;  2QVV A;  4U21 A;  3K0V A;  4DDD A;  2Y84 A;  3QMF A;  4EUO A;  3H3G A;  1FPJ A;  4POW A;  4F31 B;  4F3S A;  3SEY A;  1M5E A;  4YKK A;  3MZ9 A;  4P8B A;  1KWH A;  3ECR A;  3KC0 A;  2DQV A;  3TEP A;  4JDF A;  4N15 A;  3HPI A;  1MY2 A;  2O7I A;  4JSO A;  3Q28 A;  1CNQ A;  3PPN A;  3A3U A;  3N26 A;  2XWV A;  2DE2 A;  1IZ1 A;  3USD A;  1FW0 A;  4QRZ A;  4IY6 A;  2ANJ A;  1FPI A;  2WKY A;  4NWC A;  1BK4 A;  4OVQ A;  4YKI A;  4MCO A;  3E79 A;  3FJ7 A;  3GBA A;  5DVF A;  4OA4 A;  2Y7I A;  2GRV A;  1BP5 A;  2FYI A;  2HQ0 A;  4GBW A;  4F3G A;  5LOM A;  1FBP A;  4L17 A;  3K6W A;  3E78 A;  4PE3 A;  3RN8 A;  3FIR A;  4GIZ A;  4P3L A;  3PGF A;  1OLC A;  3FVO A;  2CZL A;  3IFA A;  1SI1 A;  4BDR A;  5L9S A;  2DS9 A;  1MM7 A;  4G8H A;  3FV2 A;  3B6Q A;  2CZH A;  1YPN A;  4F3B A;  3KSX A;  4LZ7 A;  2UVG A;  3H4Z A;  2F35 A;  1QJM A;  1L5T A;  1N76 A;  4EQ9 A;  1QUL A;  2XXV A;  4KCC A;  4XIG Q;  1UTB A;  4RYA A;  1USY E;  4FJP A;  2QJE A;  2OK2 A;  4NMY A;  1KA1 A;  3MPK A;  1JEV A;  2Z22 A;  2A5T B;  3ZKL A;  4KYD A;  5ET5 A;  1B32 A;  1BLF A;  4XKQ A;  2H25 A;  3SDF A;  1A54 A;  2I0B A;  4HS7 A;  3Q25 A;  1N0T A;  2XD3 A;  2UYE A;  1B5I A;  4FE8 A;  1FTM A;  1AWB A;  3O2A A;  1QUJ A;  1B2H A;  2OWS A;  4IO5 A;  5CM6 A;  2Z23 A;  4NF6 A;  2REJ A;  3U92 A;  3IX1 A;  3IB2 A;  1NV7 A;  3B50 A;  1A7L A;  3QUF A;  4IGR A;  2XXP A;  2R9J A;  4GF8 A;  3IB1 A;  4KD5 A;  2Q2C A;  1SDX A;  4ZEC A;  2DWI A;  5CMB A;  1IQ7 A;  1SBP A;  2THI A;  2PT1 A;  1LFG A;  3E13 X;  2ABH A;  3QSL A;  3FXB A;  3VXB A;  2I0C A;  1WDN A;  3PUY E;  4P1E A;  4R73 A;  2I6E A;  3H7M A;  1R1N A;  5DEX A;  2XX8 A;  4XKP A;  1B46 A;  1LAF E;  4Q8R A;  4MEV A;  1I6B A;  5H8Q A;  4PFI A;  1XI6 A;  3C32 A;  4DI3 D;  5HPQ A;  4BLA A;  4U4S A;  5I2K B;  4OEU A;  1B6H A;  1HSE A;  4GX6 A;  4F1V A;  4U1Z A;  3IOR A;  4LQ5 A;  3SKP A;  4NF6 B;  2O7U A;  2RKM A;  3SEX A;  3TYH A;  2HXW A;  2OZZ A;  2V3T A;  2DE4 A;  1MXW A;  5KDT A;  4QXD A;  3FVK A;  4NN3 A;  4IO3 A;  5I3S A;  4F2O A;  1JP4 A;  1LBX A;  3T9U A;  1RDX A;  4HW8 A;  2V3U A;  2KQZ A;  5FTI A;  3TUS A;  2ZZX A;  3PUX E;  3R7X A;  2QVR A;  5EQA A;  3OMB A;  1BTJ A;  5EYH A;  4AS5 A;  3SZP A;  3EF7 A;  1B0L A;  3ILU B;  3H6U A;  4I40 A;  2Z8E A;  2OCU A;  1Y3N A;  1AL3 A;  4OFJ A;  1MM6 A;  4JB7 A;  3IJX B;  4O7I A;  1TWY A;  1FTA A;  3M3F A;  1WVJ A;  1I6A A;  1PB9 A;  3O6I A;  2V25 A;  1LBY A;  1II5 A;  3IOV A;  1SVX B;  4PDH A;  2DVZ A;  4HCY A;  5JTY B;  2XXR A;  4OEV A;  1PC3 A;  2XXT A;  2P3N A;  4NHB A;  4OES A;  3U1O A;  4EDP A;  2BJI A;  2F7A A;  2A5S A;  1MDQ A;  4R9F A;  3GYY A;  5EHM A;  3FVG A;  4YMB A;  5F7V A;  3K00 A;  3HO7 A;  2HZL A;  4MNI A;  1RDZ A;  2XXH A;  5CRY A;  1MQD A;  1ZMG A;  2NVU B;  3JV9 A;  3KOT A;  3HHF A;  3TOD A;  4BDQ A;  1AH5 A;  3W9W A;  5TP9 B;  3O6H A;  3W15 C;  3OEM A;  1B3H A;  5M2V A;  3Q27 A;  4KI0 E;  2OWZ A;  2ONR A;  4TLM B;  4YIC A;  3PPP A;  1I6Q A;  5L9O A;  2F78 A;  5ITP A;  1SD3 A;  3G7W A;  3VLW A;  1Z7N E;  1PDA A;  1MRP A;  4MLQ A;  3KSJ A;  2ZNS A;  2HFB A;  2Y5L A;  3RNN A;  1D9Q A;  2Y7W A;  1DPE A;  1NKX A;  4N6K A;  5I57 B;  1IMF A;  4OXV A;  2GHB A;  4XEQ A;  1JVY A;  5DYH A;  3B8B A;  5EYG A;  5H8N A;  4IO2 A;  1NV6 A;  5I56 B;  1EYK A;  5K2X A;  4HE2 A;  1PB8 A;  4F39 A;  1LCF A;  1ATG A;  2VPN A;  3T9V A;  4OVR A;  3EKI A;  1OVT A;  1A8F A;  1IMA A;  4GWW A;  1NV2 A;  3V83 A;  1Q35 A;  3K1N A;  4FAT A;  1B5H A;  2VD2 A;  2DXY A;  3SES A;  3O28 A;  2QS4 A;  4HXV A;  4AS4 A;  4QFN A;  2DXR A;  3RTF B;  5L8D A;  3BKI B;  2HEU A;  3S4U A;  1NMU A;  3THI A;  2QMX A;  4PGP A;  2AL5 A;  3DEL B;  4EF2 A;  3IAZ A;  4PET A;  3S9L C;  3SET A;  3IOT A;  1B05 A;  5A5X B;  2AIX A;  4ESW A;  2UVJ A;  2BJJ X;  2DSF A;  4DXU A;  3CVG A;  1LB9 A;  1QVS A;  3KEI A;  1FTL A;  3VXC A;  4ESX A;  4P0G A;  2DDK A;  1MY4 A;  4G2Z A;  1R9Q A;  3FXR A;  4THI A;  5B70 A;  4NAP A;  3FAS A;  3R26 A;  2F6G A;  3V8X B;  3KZG A;  4BDN A;  1LLS A;  4KFQ A;  3T0J A;  4OZ9 A;  1NNF A;  3E3K A;  3OSR A;  4XXU A;  5I2N B;  1IXI A;  2V4C A;  4DE8 A;  1Y1M A;  3K01 A;  3SEW A;  3RTW B;  4YZZ A;  3M8U A;  3O9P A;  3JZJ A;  1SW4 A;  4I8C A;  2ONK E;  4KYE A;  5KCJ B;  4QHQ A;  1D3K A;  4PF6 A;  5A5X A;  3KG2 A;  3C9H A;  1FBH A;  4WEP A;  3C33 A;  1LBV A;  1LFH A;  4PAF A;  1QW0 A;  3UIF A;  2HPG A;  4R75 A;  2I48 A;  3VLV A;  3MZ1 A;  2GH9 A;  3PPR A;  3B6T A;  5CBR A;  2ZNU A;  2HZK A;  4F2Q A;  1DBZ A;  4MFI A;  1LFI A;  1N84 A;  1HSJ A;  2XWO A;  3OO7 A;  2LAO A;  3T22 A;  1G0I A;  1P1N A;  1FBG A;  4G61 A;  4GWU A;  3N5L A;  1URD A;  2F6P A;  4JVC A;  4KR5 A;  2YPN A;  3IK6 B;  4NWD A;  1HSL A;  1OIB A;  5H8S A;  4RA1 A;  2Z8D A;  4PE5 B;  1NV3 A;  4JBZ A;  4ELO A;  4NF4 B;  2VPO A;  4QSE A;  2I3V A;  2QMW A;  4H46 A;  4NGU A;  5I2K A;  3LUZ A;  5L9M A;  3TKD A;  3C34 A;  5TPA B;  2QS2 A;  3PUW E;  1RDY A;  1XS5 A;  3QXM A;  3OEK A;  3VV5 A;  1O63 A;  1ZIU A;  1UQW A;  2VOZ A;  1N3W A;  3EQ1 A;  3PD9 A;  3T9X B;  2RC9 A;  5ITO A;  4DI4 B;  2AYS A;  2O1M A;  3BIG A;  1M5C A;  2GQ1 A;  5BUU A;  4PFT A;  2B3B A;  3ONM A;  2PBW A;  2P2A A;  2VT5 A;  4YAH X;  1JET A;  4OET A;  1ELJ A;  1TXF A;  1TT1 A;  4NF5 A;  3GZG A;  5EQ8 A;  2ZYK A;  4P9K A;  1UIV A;  4KHZ E;  1IME A;  1NUZ A;  5CC2 A;  1SW1 A;  3TFL A;  4RXL A;  1B3L A;  3CG3 A;  4ZE9 A;  4EXK A;  3QUJ A;  4GWX A;  4LAT A;  1N3X A;  4R74 A;  3KGC A;  4OMB A;  1DMB A;  1MPB A;  3WAF A;  4LQ2 A;  1MPC A;  1MXU A;  5DVJ A;  4O8M A;  4H8J A;  4GWY A;  2RF1 A;  4FBP A;  2FIE A;  4PFU A;  5K2Y A;  1GV8 A;  5KZT A;  1Z7M E;  3G3K A;  4Z0I A;  1ANF A;  4BDM A;  3LV0 A;  2F34 A;  2DWH A;  3OEN A;  1VR5 A;  2PMS A;  4FEC A;  3SEV A;  1BKA A;  4H5G A;  3PUZ E;  1NH7 A;  4NED A;  4QF9 A;  3RGY A;  1FRP A;  1PB7 A;  3QAX A;  4GXA A;  4PAI A;  2Y7K A;  5ICT A;  4QBA A;  3L6H A;  3B6W A;  3MBP A;  4H6D A;  3KN7 A;  3N6T A;  1NUW A;  3O6G A;  2YLN A;  4DZ1 A;  3FJG A;  5IZ3 B;  1FPE A;  1MQI A;  3CRB A;  3IFC A;  5CMC A;  2UVH A;  1NUX A;  1B7Z A;  2B65 A;  4YKP A;  4HCW A;  5ESY A;  1H3D A;  1PBQ A;  2ALU A;  2I4B A;  5TPA A;  1S7Y A;  3QK6 A;  2H9B A;  2KLF A;  1XOC A;  2XXW A;  2I58 A;  3VVF A;  3V5A A;  5I7I A;  5H8N B;  4OAN A;  4QFK A;  1LBZ A;  1P1W A;  2WX9 A;  2F3B A;  1D4N A;  4OWD A;  5HM4 B;  1MQJ A;  1XT8 A;  3I3V A;  3TZA A;  4GWZ A;  4ZDM A;  3LC8 A;  3KN8 A;  2QVU A;  3O97 A;  4PTK A;  1MXY A;  4JVD A;  1NFT A;  3TMG A;  4ZEF A;  3RYD A;  4GXS B;  3MW0 A;  1FCK A;  2FHY A;  3SEU A;  1A8E A;  1DOT A;  1LBW A;  4GOT A;  1SYH A;  1TFD A;  1IMD A;  3K1M A;  5I56 A;  2O51 A;  1B58 A;  4U1O A;  3KJ7 A;  3LBS A;  2VHA A;  4LN5 A;  2FIX A;  3CIJ A;  5I57 A;  4N13 A;  3B7D A;  3RPW A;  1B3F A;  5FHN A;  2OX3 A;  4JVI A;  3FD3 A;  5BWJ A;  3HCQ A;  4K3F A;  5DVI A;  5I59 B;  1DSN A;  3LSW A;  4RPO A;  2P1S A;  3VFJ A;  3IOW A;  4NQ8 A;  1NH8 A;  1K9Y A;  1XC1 A;  3EHS A;  5J1D A;  2XX7 A;  2RC8 A;  3EHT A;  2F3D A;  3CSG A;  4Q5T A;  2NOO A;  4JXI A;  1FPF A;  5ET8 A;  4OEN A;  1AOV A;  1OQG A;  4JWY A;  1FQC A;  2D3I A;  4KXP A;  4F29 A;  3PV0 E;  4XKN A;  2V84 A;  2ZYN A;  4G68 A;  4BDL A;  4MNP A;  3D1R A;  4QFP A;  2HHM A;  1FTJ A;  1POT A;  4I9D A;  4MMP A;  4H45 A;  1MS7 A;  4FAJ A;  2E1S A;  4NG7 A;  1K9Z A;  4QSD A;  4P56 A;  4UAB A;  3G3G A;  4M4G A;  1EZ9 A;  5FBP A;  1IIT A;  4H67 A;  4P11 A;  2WBB A;  4OVT A;  4X8R A;  4E0X A;  4O3B A;  1Q1K A;  1B3G A;  2F5X A;  1UTH A;  4H0W A;  2OJT A;  4X9T A;  4GFR A;  4P47 A;  4GQO A;  4POX A;  4ZS9 A;  4BDO A;  2RCA A;  4RK9 A;  4EF1 A;  4G68 B;  3H6V A;  4WXJ A;  1IXC A;  1EZP A;  4WKM A;  1S9T A;  5H8Q B;  2WBD A;  2PFY A;  3T9H B;  3T96 B;  4G8M A;  5AA1 A;  2UYF A;  1FPK A;  2B4L A;  2RCB A;  2Q8J A;  3H6T A;  2D5W A;  5I58 A;  4YU0 A;  3MJN A;  2XD2 A;  4N4U A;  4KYS A;  4PCD A;  1FBE A;  4NF4 A;  1LAX A;  2F7C A;  3C35 A;  5H8F A;  1VFD A;  1NV1 A;  3BBR A;  3GLB A;  4O7M A;  4ZZE A;  4XKR A;  1VSO A;  2XXI A;  3HST A;  2R8T A;  5EQ9 A;  4IO7 A;  2Y7R A;  5FHM A;  1AMF A;  1H43 A;  3TTL A;  1IMC A;  3N6U A;  2QSX A;  4YKJ A;  4OQO A;  1ZJL A;  4WED A;  3NOH A;  2B3F A;  3EPE A;  3TPA A;  1N7X A;  2OWT A;  1IUD A;  3K6X A;  5IGA A;  3F11 A;  2FVZ A;  4LUB A;  4OER A;  5HBC A;  2W7Y A;  3KJT A;  3LSL A;  2PX1 A;  3Q29 A;  5H8F B;  5J16 A;  4MIJ A;  4N6D A;  5H8H B;  2ESN A;  3PMW A;  3I5O A;  2H99 A;  5A5L A;  3QYT A;  2ZZV A;  2Q89 A;  3M3L A;  3K6U A;  4YB5 A;  5CI5 A;  1FPB A;  4QSC A;  2IA4 A;  2IEE A;  1SYI A;  4H5F A;  1F9B A;  1YTV A;  2FNC A;  2G29 A;  4GRK A;  1LEV A;  2VGQ A;  3E9X A;  4R6K A;  5AA4 A;  4F18 A;  1XVX A;  1GVC A;  2O84 X;  3BIH A;  1RYX A;  2ZZW A;  1CB6 A;  3S9N C;  1B4H A;  4GL0 A;  2NUV A;  4R6Y A;  5FTH A;  1R9L A;  4PAK A;  4C1T A;  3FXU A;  3TQL A;  1QGX A;  1YXI A;  1KZ8 A;  2H4I A;  1JNF A;  1FSA A;  2PYY A;  4KPT A;  3C31 A;  3IJO B;  4JSD A;  3MST A;  1MH4 A;  2RC7 A;  1USY H;  5DW8 A;  3RT8 A;  4P1L A;  1FPL A;  3L6G A;  1OQH A;  4OFL A;  1ZKB A;  3MVY A;  3TCH A;  1IXG A;  3IR1 A;  4IB2 A;  2DWJ A;  4TLL B;  3DP4 A;  3R6U A;  3VDF A;  4YMA A;  2REG A;  4H65 A;  2DWA A;  3MVZ A;  5ELV A;  2XXQ A;  5AA2 B;  4C0R A;  4DXB A;  2XXX A;  3H6W A;  2ZYM A;  1POY 1;  3GXA A;  3RLF E;  4I3Y A;  1N04 A;  3G3H A;  3S9M C;  2DP8 A;  4FED A;  1M5F A;  4DCY A;  2XXY A;  1LB8 A;  2DE3 A;  2X7P A;  1B7U A;  2ONS A;  3IOU A;  1JQF A;  4FEB A;  3LUY A;  4RJZ A;  1LCT A;  2GHA A;  3MVX A;  4XFE A;  1B40 A;  3OOA A;  4JWX A;  2Z8F A;  2X26 A;  1VDW A;  5TU0 A;  3U94 A;  4YB7 A;  4ZEK A;  3HV1 A;  3T1B A;  1Y1Z A;  3K6V A;  1IMB A;  2ZYO A;  3T93 B;  4G68 C;  4U2R A;  3CG1 A;  3UOR A;  3G3F A;  3TTR A;  3AXF A;  4EQB A;  1XHY A;  4MLV A;  1Y9U A;  1NNT A;  2ZMB A;  1NNP A;  3FJM A;  4RY1 A;  4X1B A;  4ND9 A;  2P3V A;  3LSX A;  1GGG A;  3P7I A;  4I3E A;  2Q8M A;  4OVJ A;  2FA7 A;  2Y5K A;  2CZI A;  3U8Q A;  3UGW A;  4FOR A;  4Z7E A;  3FGS A;  2QS3 A;  3CFX A;  2VP1 A;  3PPO A;  2PFZ A;  1GR2 A;  3C4M A;  4PDD A;  4U4X A;  1AIV A;  4R9G A;  3TEL A;  1B51 A;  5IAI A;  5LTC A;  1UTH B;  5ET6 A;  2VD3 A;  1GTK A;  4IO4 A;  3KN3 A;  4F19 A;  1XVY A;  3W9V A;  3WAE A;  2XXK A;  3RQT A;  3HHG A;  1YCJ A;  3TCG A;  3FUZ A;  3HN0 A;  4HE1 A;  5IZ1 A;  1FBD A;  1P1Q A;  1TFA A;  4HE0 A;  1FQF A;  2V93 A;  3CR9 A;  4LZ5 A;  4F3P A;  4NF5 B;  4U22 A;  1MXV A;  1DCU A;  3FAT A;  1EYJ A;  4ELQ A;  4O3A A;  1I69 A;  3O29 A;  1FQD A;  2F7B A;  1SPI A;  4N6P A;  2HCA A;  1ZLQ A;  1FJ9 A;  3KC1 A;  4DCX A;  4PGN A;  4OYV A;  3H03 A;  2PVU A;  3A29 A;  2DYX A;  4P0I A;  3S9E A;  1NUY A;  5FHO A;  1A40 A;  3TQW A;  4I1D A;  3RUM A;  2JJK A;  5F1Q A;  2XX9 A;  3I6V A;  3TTN A;  4JWO A;  5AA3 A;  4NTL A;  1B9J A;  1QUK A;  1MXX A;  1MG1 A;  1VE4 A;  1PEB A;  3LSF B;  3ZSF A;  1O7T A;  1MY0 A;  4R2F A;  4PFB A;  1EH3 A;  1R6Z A;  5KDT B;  1G0H A;  4ECF A;  4HTG A;  1US4 A;  4NF0 A;  1FQE A;  4KCD A;  2XA5 A;  5B7D A;  5DEX B;  2Q2A A;  3Q26 A;  2NWJ A;  1J1N A;  4UAC A;  3KOS A;  2Q74 A;  2Y7P A;  3PD8 A;  1OLA A;  4LON B;  1MH3 A;  2O6A A;  4MAG A;  1O64 A;  4OHN A;  3K4U A;  1IXH A;  1IEJ A;  4KQP A;  3ZS6 A;  3OSQ A;  1OMP A;  5KCJ A;  3KBZ A;  2DVC A;  3A3C A;  3K2D A;  3MVW A;  4X48 A;  2P0S A;  4IGT A;  4GL8 A;  3ROJ A;  1IIW A;  1SW2 A;  4G8N A;  2G93 A;  4YB6 A;  2O1L A;  1LAG E;  3M3K A;  1Q9D A;  4H1X A;  2R6G E;  2XWK A;  4NX1 A;  1P99 A;  4GBV A;  3UK4 A;  4DXC A;  2AL4 A;  4LVQ A;  1US5 A;  3BFT A;  1NI9 A;  1EU8 A;  2NXO A;  1OVB A;  1DTZ A;  1N7W A;  3RY3 A;  2XHD A;  3KBR A;  4RNS A;  3MAM A;  4ZEI A;  4MHF A;  3MUQ A;  1H76 A;  1DTG A;  1Y3P A;  4MNC A;  4G4P A;  4O3C A;  4M1V A;  4QFL A;  3VVD A;  2XXU A;  3IO6 A;  3RT6 B;  2HXR A;  2Q88 A;  1KA0 A;  2HAV A;  1MY3 A;  5I84 A;  4G77 A;  5EYF A;  4PBH A;  1RKM A;  3MP1 A;  1NL5 A;  4XTC Q;  4F1U A;  4OTE A;  4GLI A;  1ZBM A;  4U23 A;  5IZ3 A;  4X04 A;  5LDZ A;  4PFY A;  1EZO A;  3TTM A;  3KFM A;  1JW4 A;  4R6H A;  5IZZ A;  3T66 A;  1FJ6 A;  1UIU A;  5TP9 A;  3GBB A;  1SI0 A;  3TTK A;  4ELP A;  3PPQ A;  1MDP 1;  2D21 A;  3MYU A;  2O68 A;  2E0S A;  1DPP A;  2DOJ A;  5IKB A;  3VLU A;  1MPD A;  1ZU0 A;  5T3J A;  2F8D A;  3EN3 A;  1JW1 A;  4XF5 A;  3MP6 A;  4GWO A;  4UA8 A;  1FPG A;  3DP6 A;  4MBP A;  4MJO A;  4Q0C A;  2X7Q A;  3UN6 A;  4ELR A;  1ZTY A;  4TQU Q;  3FV1 A;  1A99 A;  3MWB A;  5H8H A;  1BIY A;  5CMM A;  2B4M A;  4I62 A;  4PF8 A;  5IM2 A;  1T0K A;  3OXN A;  4AQ4 A;  4ZZA A;  5DT6 A;  4DIG A;  4MF3 A;  1JEU A;  3RPL B;  3UP9 A;  2WYK A;  3CFZ A;  5ET7 A;  4PFR A;  3S2V A;  1A55 A;  5CMK A;  4LP2 B;  1LBC A;  2HAU A;  3MC2 A;  3E4R A;  2I3W A;  1B3E A;  4Q30 B;  4O94 A;  4R72 A;  1MY1 A;  4RK2 A;  3U65 A;  1CE2 A;  3UA8 A;  2CEX A;  4EXL A;  3A09 A;  1B1H A;  2QS1 A;  1FBC A;  1JVX A;  1M5D A;  3OO8 A;  1FQA A;  1B5J A;  4AB5 A;  1SQY A;  4RPN A;  4N91 A;  1NNK A;  2ZXT A;  3ZKK A;  1VFE A;  4PFW A;  2F36 A;  5DTB A;  5F24 A;  2YJP A;  1NV5 A;  1YYZ A;  1B4Z A;  2R71 A;  3RPL A;  1S50 A;  1LGB C;  4NF8 B;  1P1U A;  2WEF A;  4DLD A;  3JYR A;  4ZE8 A;  4LZ8 A;  2RIN A;  1WOD A;  2KR0 A;  3V89 B;  3H06 B;  4N07 A;  4N81 A;  3ILT B;  3FVN A;  4ZED A;  3MPL A;  4E0W A;  3TAJ A;  1JW5 A;  3LR1 A;  4MH5 A;  2OLB A;  5CBS A;  4GWS A;  1LAH E;  3CHG A;  3N94 A;  5AA2 D;  2WYP A;  2QRY A;  4PC9 A;  1NV4 A;  2F97 A;  2UVI A;  3C36 A;  2MKZ A;  2M8C A;  3CSB A;  4N8G A;  1LST A;  1B52 A;  1M5B A;  3PUV E;  3TCF A;  3SER A;  3DP8 A;  3HFU A;  2A5T A;  1Y20 A;  4OVS A;  2CMO A;  3FZV A;  5EHS A;  2H98 A;  3OEL A;  4OFO A;  2XWI A;  3VE1 B;  3ISP A;  4GD5 A;  1DK4 A; 
#chains in the Genus database with same CATH homology
 1FBC A;  4FBP A;  3GYY A;  4GWU A;  2WBB A;  3E78 A;  2FIE A;  4OVT A;  3PTY A;  2Q74 A;  4P1E A;  2FHY A;  2XXK A;  4IR8 A;  4X8R A;  4PE3 A;  4JVC A;  2HZL A;  4MNI A;  4PGP A;  3NOH A;  1LBW A;  1RDZ A;  5IZZ A;  2F5X A;  4P3L A;  4N91 A;  1INP A;  4I3Y A;  3LV0 A;  4MAG A;  4PET A;  3IFA A;  1FJ6 A;  4X9T A;  4HE1 A;  1NV0 A;  3FBP A;  5IGA A;  5FBP A;  1IMD A;  2FVZ A;  1FPD A;  1FBF A;  5IZ1 A;  4P47 A;  5I5P A;  4MEV A;  5F24 A;  1NV3 A;  1FBD A;  5J16 A;  2DE3 A;  4MX6 A;  4MIJ A;  4N6D A;  1NV5 A;  3W9W A;  1YYZ A;  2CZH A;  2FIX A;  4GX4 A;  4LN5 A;  2VPO A;  3KBZ A;  4HE0 A;  4PFI A;  1XI6 A;  4H46 A;  4NGU A;  3MYU A;  4DI3 D;  1FRP A;  5DW8 A;  2L5V A;  3RPL A;  3LUZ A;  4GX3 A;  4PAI A;  4OVP A;  4QBA A;  5A5L A;  2OWZ A;  5T3J A;  4N8Y A;  2OX3 A;  4PBQ A;  2Q9T A;  2ZZV A;  2WEF A;  2DDK A;  4GX6 A;  4XFE A;  4F1V A;  3ROJ A;  1NUW A;  2WBD A;  1FPB A;  4YIC A;  1YZ0 A;  4XF5 A;  2KR0 A;  4JVI A;  2PFY A;  4NAP A;  1RDY A;  1VDW A;  5IZ3 B;  1FPE A;  1Q9D A;  2XWK A;  4NX1 A;  1DCU A;  1FPG A;  4N81 A;  1EYJ A;  2CZK A;  4GBV A;  3IFC A;  3T0J A;  1LEV A;  3T1B A;  1KA1 A;  2DE4 A;  1IMB A;  1SPI A;  2B4L A;  1FPK A;  1NUX A;  2QVV A;  4NN3 A;  4QXD A;  3QMF A;  1NI9 A;  4F18 A;  5I3S A;  2QPQ A;  4MJO A;  3BIH A;  4HCW A;  2ZZW A;  1JP4 A;  2V4C A;  1LBX A;  5ESY A;  1RDX A;  4GWS A;  1FPJ A;  1FJ9 A;  5ET5 A;  1EYI A;  2Y5L A;  3CHG A;  2KQZ A;  3KC1 A;  4DI4 B;  2CEY A;  1D9Q A;  2ZZX A;  4NQ8 A;  2QVR A;  4PGN A;  4AS5 A;  2WYP A;  1K9Y A;  2QFL A;  5EQA A;  5J1D A;  3BIG A;  2F3D A;  4PC9 A;  4N4U A;  4N6K A;  4PAK A;  4MHF A;  4YZZ A;  1IMF A;  1NV4 A;  3A29 A;  5EYH A;  3SZP A;  2GQ1 A;  4PCD A;  4P8B A;  1NUY A;  2MKZ A;  1FBE A;  1AWB A;  1QGX A;  1YXI A;  3KC0 A;  5I7I A;  1KZ8 A;  2VT5 A;  4OAN A;  1FSA A;  1FPF A;  4N15 A;  1LBZ A;  5ET8 A;  4N8G A;  4PF6 A;  4I40 A;  5CM6 A;  4XEQ A;  2B4M A;  4MNC A;  2PCR A;  2WX9 A;  3B8B A;  2F3B A;  4PF8 A;  2JJK A;  5EYG A;  4KXP A;  3MST A;  5IM2 A;  1CNQ A;  2P3V A;  1NV6 A;  1FBH A;  1EYK A;  4I3E A;  1NV7 A;  1LBV A;  2XWV A;  2Q8M A;  2DE2 A;  4HE2 A;  3B50 A;  4M1V A;  4PAF A;  5EQ8 A;  1NV1 A;  2VPN A;  4O7I A;  4P9K A;  4OVR A;  1FTA A;  2HPG A;  2HXR A;  4O7M A;  3RPL B;  3EKI A;  2Y5K A;  1KA0 A;  2CZI A;  2V3Q A;  1IME A;  1FPI A;  1NUZ A;  2WYK A;  1FPL A;  4MNP A;  1IMA A;  1BK4 A;  4OVQ A;  4GWZ A;  4P1L A;  4PFR A;  4MCO A;  5EQ7 A;  3D1R A;  5ET7 A;  1LBY A;  4GWW A;  2FBP A;  2HHM A;  3E79 A;  4N17 A;  1NV2 A;  3HFU A;  2PFZ A;  2R8T A;  4PFB A;  2QVU A;  4MMP A;  4PTK A;  5EQ9 A;  4OA4 A;  4PBH A;  4PDH A;  4OVS A;  4H45 A;  4O94 A;  2DVZ A;  4PDD A;  5JK4 A;  1G0H A;  4HCY A;  2HZK A;  4F1U A;  1DBZ A;  4GWX A;  4GBW A;  1K9Z A;  4NG7 A;  5LTC A;  3FXB A;  4NF0 A;  2XWO A;  5ET6 A;  4P56 A;  2XWI A;  4JVD A;  4HXV A;  2XA5 A;  5IZ3 A;  3ISP A;  4X04 A;  3U65 A;  4AS4 A;  1IMC A;  1G0I A;  2P3N A;  2CEX A;  1FBP A;  4NHB A;  2BJI A;  4UAB A;  1DK4 A;  1FBG A;  4O8M A;  3RYD A;  4F19 A;  5LDZ A;  3W9V A;  4G61 A;  4GWY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...