1GV8A

18 kda fragment of n-ii domain of duck ovotransferrin
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
159
structure length
159
Chain Sequence
SYYAVAVVKKGTDFMIKDLRGKTSCHTGLGRSAGWNIPIGTLIHRGDIEWEGIESGSVEQAVAKFFSASCVPGATTEQKLCRQCKGDAKTKCLRNAPYSGYSGAFQCLKDGKGDVAFVKHTTVQENAPEEKDEYELLCLDGTRQPVDSYKTCNWARVAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Iron transport
molecule keywords OVOTRANSFERRIN
publication title The Mechanism of Iron Uptake by Transferrins: The X-Ray Structures of the 18 kDa Nii Domain Fragment of Duck Ovotransferrin and its Nitrilotriacetate Complex
pubmed doi rcsb
total genus 45
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2002-02-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1gv8A00
3E4RA 3O29A 1JNFA 3TTLA 2F35A 4NF5B 2F8DA 2WKYA 1XHYA 1N84A 2D3IA 2ZYMA 4Z7EA 2F6PA 3PU5A 5DVFA 1M5FA 1N7WA 5FHMA 4YKPA 5AE4A 4LA9A 4U23A 4GXAA 2QL3A 4PETA 2QMXA 1LAGE 1UIUA 3H6WA 3OSRA 2M8CA 2DWJA 2HCAA 3FXRA 3BBRA 3TCGA 1OMPA 3O97A 5I2KA 2XXHA 3ILTB 3TTKA 5I58A 1MY2A 2VGQA 1QW0A 4U22A 1B52A 3MZ9A 1P1WA 3PD8A 4BDNA 4OMBA 1LLSA 4U21A 1B7ZA 3VLVA 1OLCA 3KEIA 1B51A 3LUYA 3M8UA 4YB7A 5KCJA 3HPIA 3G3JA 5EHSA 2GRVA 4FORA 1T0KA 2P0SA 1IEJA 3TCFA 2A5SA 5CC2A 4XKPA 2V3UA 3OO8A 3H7MA 4R72A 2YLNA 5HM4B 4JSOA 4XKNA 4P0IA 1MXXA 3OOAA 5AA2D 4GL8A 3LSXA 3AXFA 2O7UA 3O2AA 4LZ7A 4F1VA 4ZECA 3Q25A 1HSEA 1I6AA 1HSLA 1QULA 3OO7A 4PFUA 3A3CA 1IQ7A 2XXQA 3K6UA 1D9YA 3QAXA 3Q29A 2Q88A 2V93A 3OD7A 4DCXA 1SW1A 3U92A 1FQDA 2OLBA 5CBRA 1Y1ZA 4QFLA 4FIMA 4P11A 3K0VA 2REJA 5DT6A 2V3QA 4N6PA 3F11A 3HHGA 1OQHA 3K1MA 2UVGA 1UTBA 3GZGA 1XOCA 1WDNA 3UP9A 1MQGA 3H3GA 4DE8A 5CMKA 2H99A 1R1NA 2ALUA 3IORA 4FJPA 2PVUA 1IITA 3RNNA 4JB7A 4R9GA 2F7AA 3ZKKA 5J1DA 5L9MA 1EZ9A 4K3FA 1N7XA 4IB2A 1I6QA 3MP6A 4NWCA 4OENA 1LAFE 3L6HA 3WAFA 4OFOA 4JWYA 2H98A 2QJEA 3FGSA 3CFZA 3G3GA 4Z0IA 3EF7A 5CBSA 3S4UA 3THIA 3FUZA 2DVCA 1B6HA 3MAMA 3G3KA 1H43A 4NF4A 4EXKA 4HCWA 1UTHA 3MVWA 4MBPA 4NEDA 1LB9A 3GBBA 4Q0CA 4KI0E 4X1DA 2DXYA 5I56A 2DE2A 2OBGA 1B40A 2I6EA 1PBQA 4RK2A 5IAIA 3PPOA 5H8FB 1SI0A 4GFRA 1GGGA 4DZ1A 4GVOA 1I69A 4YICA 3IJXB 1SW4A 3PPPA 3N6TA 5HPQA 5DVIA 3C34A 1IIWA 5JTYA 4AB5A 1A7LA 5DEXA 3SETA 5H8QA 4DIGA 1MDQA 3DP6A 3TTMA 3TELA 5L9OA 3HO7A 4OYVA 4XKQA 4F3BA 2ZYOA 3C36A 2XX9A 1B1HA 2Z8EA 2PYYA 2I4BA 2QS1A 4HW8A 4TLMB 1H45A 1FTJA 3USDA 4IO7A 4RXLA 1EZPA 3VV5A 4OXVA 2ONKE 3W15C 4ZE8A 1ZTYA 2HFBA 3KSXA 4AQ4A 5DVJA 3MP8A 2THIA 2H25A 3I6VA 3VXBA 1NH7A 2HXWA 4ECFA 4QSDA 4ZDMA 4F3PA 1J1NA 2O1LA 2R9JA 2XHDA 4IO4A 4U4XA 2DOJA 1LCFA 5B7DA 3CG3A 1MPCA 1A8FA 2OWTA 3JYRA 3VFJA 4ONYA 3FIRA 4KFQA 4PFYA 4LQ5A 1LB8A 1FTMA 2XXTA 1JETA 2B3FA 4OZ9A 1AIVA 5TP9B 1OLAA 4KPTA 4EQ9A 2AYSA 1LSTA 2DE3A 4LATA 1B5HA 1M5EA 1MQJA 4QFOA 3K6VA 1B7HA 2H5YA 5H8HA 5I57B 5I2NA 1ZU0A 3IB0A 1MM6A 3CI8A 4QFNA 1M5CA 5I84A 4GL0A 1JVYA 2ZYKA 3FVNA 4F31B 5H8NB 2B65A 4JSDA 1QJMA 1SW5A 4H5FA 3VVDA 2OCUA 4H65A 2XXPA 3RLFE 1Q35A 4O3BA 4IY6A 3OENA 5ISUA 2AL4A 3VLWA 2F36A 4UA8A 2UVIA 1FCKA 4QRZA 4OERA 3W9WA 1JW4A 4ELQA 4F29A 5AA2B 4H5GA 2O7IA 1B05A 3QYTA 5KDTB 3EHTA 4IO6A 4NF8A 3CSGA 3C31A 2DXRA 1USYE 3Q26A 2Q89A 1Q1KA 4PFTA 3IX1A 1TFAA 3EQ1A 5A5XB 1B32A 2A5TB 1S50A 3MQ9A 3K6XA 4H8IA 2O1MA 3KN7A 1MXUA 1XVYA 3QUFA 4OFLA 1TFDA 4C1UA 3DM0A 4YKKA 3IOWA 1MG1A 2Y7RA 3IAZA 1II5A 3KBRA 4OVJA 3VVEA 1D9VA 2DWHA 5DTBA 2DVZA 1POY1 1MRPA 2CMOA 3ECRA 2GHBA 1AL3A 5CMBA 1M5DA 5FHNA 1KWHA 1QUIA 4I1DA 3SESA 4YMBA 4YU0A 2DWAA 3T9XB 2I49A 4H6DA 4XIGQ 4C0RA 3A09A 2I0BA 3OELA 1B3LA 3TQLA 3SKPA 4EUOA 2PMSA 2P1SA 1N04A 5CRYA 1Z7ME 3LBSA 1EH3A 2DQVA 4QFPA 4RJZA 1O64A 3CR9A 3U93A 3O28A 1NKXA 2UYEA 4LP2B 1R9QA 3H4ZA 3B7DA 3T9HB 4OFJA 1TWYA 4F1YA 3T9VA 1IXCA 5KDTA 1SYHA 3JV9A 2Y7IA 3E9XA 4O3CA 3B6WA 3SERA 1F9BA 4BDQA 3IO4A 3T96B 4E0WA 1LBBA 2I0CA 4M4GA 3S9MC 5CMMA 1ZJLA 1S7YA 1MXWA 4EQ7A 3RT6B 3MC2A 2PBWA 3OXNA 3SEWA 4IY5A 3JZJA 3RGYA 4E0XA 3TDJA 2QRYA 2VP1A 5I59A 4NTLA 3R7XA 2VHAA 3K1NA 3VLUA 2IA4A 3MZBA 1B9JA 2H4IA 3ZKLA 4F3GA 2QPQA 4WEPA 4EDPA 2XD3A 1MQIA 3KJ7A 1Y3PA 5JK4A 4NF6B 4O3AA 4LUBA 1JEVA 4TQUQ 1CE2A 2NXOA 5IKBA 3IR1A 4ZZEA 4GIZA 1BTJA 5AA3A 1GV8A 2YJPA 3OSQA 1NNPA 3N5LA 3HSTA 2IEEA 3R26A 1B5IA 3OMBA 4NF5A 3B6QA 1Y3QA 3KSJA 4OHNA 5CMCA 1A8EA 4ZEFA 4H8JA 3LC8A 3S9LC 1WVJA 1DOTA 3KOSA 3P7IA 1DPPA 3HV1A 1DSNA 3FVOA 2ZNTA 1NH8A 1FQBA 4RK9A 4OEUA 3WAEA 4GXSB 2X7QA 3LSLA 2QMWA 2FNCA 3M3KA 1ELJA 3IO6A 5AA4B 1P1QA 3PMVA 2RKMA 5H8SA 3MZ1A 3SDFA 2DWIA 4RPOA 3VXCA 3FJMA 4H1XA 4KCCA 4HCYA 1AH5A 3FV1A 1O7TA 3G3IA 1B58A 2LAOA 2UYFA 3ILUB 2F5XA 1JQFA 1VFEA 5CM6A 3DELB 3TKDA 3C35A 3E3KA 4OTEA 4EXLA 1D3KA 2NUVA 3RTFB 3O6IA 1SVXB 3KZGA 1QKBA 3LSWA 2Y7WA 3TAJA 3FXQA 4F3SA 3FJ7A 2OJTA 5BWJA 1A40A 2H9BA 2Y84A 1HSJA 1PB9A 3TFLA 2HEUA 2BJJX 4I62A 1XT8A 4X48A 1PB7A 2G29A 1B5JA 4GRKA 3MWBA 2XXXA 1MY3A 2QS3A 3K6WA 4G77A 3RUMA 1NL5A 2XX7A 2R71A 2I48A 1ATGA 2UVHA 3BKIB 3V89B 3Q27A 5M2VA 3MP1A 2Y7PA 1BP5A 4F1UA 3LR1A 2UVJA 2Z23A 2NWJA 1FTKA 1MXZA 4ZS9A 4IO5A 1MPDA 3TODA 3SEVA 3LSFB 3TMGA 4YZZA 4U2RA 3IOVA 2VD2A 1M5BA 4KYDA 2O68A 1LFGA 4IGRA 4ESXA 1AOVA 3T66A 1URSA 4F39A 1US4A 4PE5B 3PUZE 3U1OA 4JWOA 1MY4A 3KGCA 4LVQA 4GLIA 1PDAA 1N0TA 3UIFA 3UK4A 4OWDA 4G68B 3U94A 1OVBA 2F7CA 1DMBA 1CB6A 1UIVA 1RYOA 3OEKA 4F19A 3U72A 2DE4A 4PFWA 5LOMA 1URDA 1PB8A 3CRBA 1O63A 4WEDA 4BDMA 2QS4A 4EF1A 4QSCA 2XXUA 4FATA 2GHAA 1US5A 1FQAA 4RYAA 1IXIA 2HAVA 3HHFA 2HQ0A 2Q2AA 3VE1B 4U1OA 4HS7A 3G3HA 4OETA 5FTHA 4KCDA 1QUJA 4QHQA 3M3LA 3U8QA 5H8FA 4FEBA 1SD3A 4IO2A 2XXVA 3FATA 3K01A 1VSOA 1LGBC 4YB5A 3TYHA 1FQFA 1MY0A 3O66A 3RY3A 2F34A 1VR5A 1B0HA 4F2OA 1B4HA 3T9UA 2O51A 1FW0A 2RC9A 1B3HA 5CI5A 1IXGA 1EU8A 1TT1A 3EHSA 3PPRA 1B2HA 4G8NA 3TCHA 3ONMA 2XXIA 3BFTA 3IOTA 4JDFA 2OWSA 3MW0A 2YPNA 3FVKA 2F78A 1Y9UA 1MPBA 5I58B 3K4UA 3KJTA 3O6GA 3I3VA 3UORA 3T93B 1R6ZA 2DSFA 1NFTA 4OEVA 3CFXA 1BKAA 1Y20A 4KR5A 2ONRA 1N3WA 3MPLA 1FQCA 1I6BA 3OEMA 1SDXA 1MXYA 3KFMA 3H03A 4F22A 3C32A 4YKIA 2V3TA 4ELOA 1YCJA 1H3DA 4GQOA 5TP9A 5FTIA 4KYEA 1PC3A 4KYSA 3TZAA 2REGA 5I57A 3H6TA 4I9DA 4MLQA 1FQEA 3G3FA 3HN0A 1SI1A 3S9EA 1MM7A 3FV2A 4WXJA 5H8NA 3GLBA 5TPAB 5TU0A 3Q28A 4JWXA 2F97A 1LBCA 3DP4A 4R73A 4DCYA 1Y4CA 1B3FA 1QKAA 4THIA 3RQTA 4I8CA 1LCTA 3TQWA 5ITPA 3V8XB 2VD3A 2G93A 1IUDA 2ANJA 2Y7KA 4KQPA 4RA1A 5AA2A 1BIYA 4N13A 5FHOA 4MFIA 4FE8A 4PQJA 3H6UA 2HZLA 1TXFA 1UTBB 2RC8A 1ANFA 3DLNA 1DPEA 3CSBA 5AA1A 3R6UA 1BLFA 4R9FA 3K1PA 5A5XA 2P2AA 1GVCA 2E0SA 2A5TA 3CIJA 5ICQA 2I3VA 4QSEA 5K2YA 1P99A 4L17A 4MF3A 4H67A 5BUUA 1P1UA 4F2QA 4UACA 2AIXA 5KZTA 1L5TA 1DTZA 4LQ2A 1XS5A 1RYXA 5DYHA 3L6GA 2RC7A 3IJOB 3DP8A 4X1BA 3IL1B 4KHZE 4R2BA 5HBCA 2OZZA 4Q5TA 4NWDA 1JW5A 4NF4B 1N3XA 2O69A 4HTGA 2GFEA 1UTHB 3TTNA 3UA8A 5TPAA 1LFHA 5L9SA 3VDFA 4KD5A 1A54A 1XVXA 5I56B 1SW2A 1OIBA 4ZEKA 3TPAA 2O84X 4U4SA 3E13X 3H06B 3EPEA 3K00A 1AMFA 4MLVA 3PUYE 4PP0A 3PGFA 1LAXA 2V25A 2QSXA 4POXA 3KN3A 3O9PA 1MQHA 4ELRA 1MQDA 3D4GA 4XXUA 4QFKA 4GWOA 1MS7A 5JTYB 4YMAA 2X26A 5DEXB 2ZXTA 4YKJA 5H8QB 3S2VA 2HAUA 3ZS6A 2QS2A 3PD9A 4X9TA 4IGTA 4RPNA 3GXAA 1PBPA 2NVUB 4OQOA 3EN3A 5K2XA 1H44A 4JBZA 4R6YA 1NNKA 1A99A 5ELVA 4Q30B 1JVXA 3CG1A 3FXUA 4ZEIA 1FTLA 2VOZA 2Z8FA 1URGA 4MH5A 2B3BA 2XXWA 2X7PA 3BFUA 1VFDA 4TLLB 1B7UA 4ESWA 3OO9A 1POTA 3N6UA 2ONSA 5ICTA 4DDDA 1SQYA 3B6TA 4GF8A 1YAEA 3D4CA 1Y3NA 2ABHA 4M1VA 1FTOA 2F7BA 4NF6A 2OK2A 5EHMA 4G68C 2ESNA 3W9VA 2FA7A 2D21A 4ZEDA 3PMXA 3EHUA 3C9HA 1ZBMA 1OQGA 5F1QA 3MVYA 2ZMBA 5H8HB 1LFIA 5I2NB 1MH4A 3PUVE 4LZ8A 1ZMGA 1LAHE 2XX8A 4JXIA 3M3FA 1YTVA 3S9NC 3TEPA 4EQBA 4GOTA 3TTRA 1B0LA 5F7VA 3PPQA 3FD3A 1B4ZA 2XXRA 1NMUA 1OVTA 2CZLA 4XKRA 1SYIA 1ZIUA 4ZE9A 5AA4A 4Q8RA 3QK6A 3MUQA 1WODA 3MPKA 2XD2A 2GH9A 3KG2A 4RY1A 4YB6A 2AL5A 4ELPA 4NMYA 3GBAA 3QUJA 1PEBA 1Z7NE 4C1TA 1P1OA 3H6VA 4NF8B 5ITOA 4QF9A 1GR2A 1XC1A 4ISUA 4FEDA 1GTKA 3V5AA 1USYH 3ODBA 4POWA 2XXYA 3PV0E 3PUXE 4YAHX 2DP8A 1NNTA 1QVSA 1N76A 2I4CA 4G2ZA 4DXCA 2DS9A 4RNSA 3K2DA 1DTGA 3A3UA 1YPNA 4NE4A 2UXAA 3IB1A 1JEUA 1Y1MA 3QIMA 3N26A 3MBPA 4BDOA 2PX1A 1IXHA 4OESA 4DLDA 3SEXA 4BDRA 2Z8DA 1H76A 4N07A 4G8HA 4LZ5A 3IK6B 4F18A 3O6HA 3IB2A 2Q8JA 1SBPA 3PPNA 3QSLA 2D5WA 4BLAA 4ND9A 3K02A 1B1XA 1MH3A 2RF1A 1Y4TA 4P0GA 2I58A 3PUWE 3OO6A 1EZOA 3I5OA 3QXMA 3FASA 3C33A 2PT1A 2PT2A 4FAJA 1B46A 3CFLA 3MJNA 1P1NA 2W7YA 4XTCQ 3SEUA 1B3GA 3RT8A 4R74A 3KOTA 4BDLA 1ZLQA 4R2FA 1JW1A 3MVZA 1MDP1 1IZ1A 4EF2A 2F6GA 3HCQA 1QUKA 3V83A 2RCBA 5L8DA 5B70A 1VE4A 2I3WA 4G68A 4WKMA 5I2KB 3IOUA 3G7WA 3TUSA 2R6GE 1A55A 4G8MA 1ZKBA 4AB6A 3RTWB 4U1ZA 1B3EA 4R6KA 3RPWA 3ZSFA 2KLFA 4FECA 4ZZAA 3VVFA 2FYIA 4TOZA 2V84A 4H0WA 2RCAA 5KCJB 2E1SA 2HZKA 2Q9TA 3FVGA 1MY1A 1UQWA 4G4PA 5JEIA 3CVGA 5I59B 3RN8A 2Q2CA 3UGWA 4R6HA 1RKMA 3SEYA 2ZNSA 5EYFA 3PMWA 4R75A 2ZNUA 4IO3A 1NNFA 2O6AA 1MXVA 2DYXA 3T22A 1R9LA 4ZEBA 4DXBA 3KN8A 4DXUA 2NOOA 2RINA 3C4MA 4GD5A 1S9TA 2Z22A 4LONB 3UN6A 3MVXA 3FJGA 3N94A 2ZYNA 1D4NA 3FZVA
chains in the Genus database with same CATH superfamily
3E4RA 3O29A 1JNFA 3TTLA 2F35A 4NF5B 2F8DA 2WKYA 1XHYA 1N84A 3LV0A 2D3IA 2ZYMA 3FXBA 4Z7EA 2CZKA 2F6PA 3PU5A 5DVFA 1M5FA 1N7WA 5FHMA 4YKPA 5AE4A 4LA9A 4U23A 2WBBA 4G61A 4GXAA 2QL3A 4PETA 2QMXA 1FPJA 1LAGE 1UIUA 2PCRA 3H6WA 3OSRA 2M8CA 2DWJA 2HCAA 3FXRA 3BBRA 3TCGA 1OMPA 3O97A 5I2KA 4PE3A 2XXHA 3ILTB 4PTKA 3TTKA 5I58A 1MY2A 4PGPA 2VGQA 1QW0A 4U22A 1B52A 3MZ9A 1P1WA 4P47A 3PD8A 4BDNA 4OMBA 1LLSA 2DDKA 4U21A 1B7ZA 3VLVA 1OLCA 4NX1A 3KEIA 1B51A 3LUYA 3M8UA 4GBVA 4YB7A 5KCJA 3HPIA 3G3JA 5EHSA 2R8TA 4FBPA 4GWSA 4GX3A 2GRVA 4FORA 1T0KA 2P0SA 1IEJA 3TCFA 2A5SA 5CC2A 4XKPA 2V3UA 3OO8A 1FBDA 2P3VA 1NV7A 5T3JA 3H7MA 4R72A 2YLNA 5HM4B 4JSOA 4XKNA 4P0IA 2GQ1A 2HPGA 1MXXA 3OOAA 5AA2D 4GL8A 3LSXA 3AXFA 2O7UA 3O2AA 4LZ7A 4F1VA 4ZECA 4NHBA 2ZZVA 4H46A 3Q25A 2ZZWA 1HSEA 3RPLA 1I6AA 1HSLA 1QULA 4P1EA 3OO7A 4PFUA 3A3CA 1IQ7A 2XXQA 3K6UA 1D9YA 4PDHA 3QAXA 2KQZA 3Q29A 2Q88A 2V93A 3OD7A 4DCXA 1SW1A 3U92A 1FQDA 2OLBA 5CBRA 1Y1ZA 4QFLA 4FIMA 4P11A 3K0VA 2CEXA 1YXIA 2REJA 5DT6A 2V3QA 4N6PA 3F11A 5I7IA 3HHGA 1OQHA 3K1MA 2UVGA 1UTBA 3GZGA 1XOCA 1WDNA 3UP9A 1MQGA 3H3GA 4DE8A 5CMKA 2H99A 1FBGA 4MMPA 1R1NA 2ALUA 3IORA 4FJPA 2PVUA 1IITA 3RNNA 4JB7A 4R9GA 2F7AA 4OANA 3ZKKA 5J1DA 5L9MA 1NV5A 1EZ9A 4K3FA 1N7XA 4IB2A 1I6QA 3MP6A 4NWCA 4OENA 1LAFE 3L6HA 3E79A 3WAFA 2B4LA 4OFOA 4JWYA 2H98A 2QJEA 3FGSA 1RDYA 3CFZA 3G3GA 4Z0IA 3EF7A 5CBSA 3S4UA 3THIA 5ET5A 3FUZA 2DVCA 1B6HA 3MAMA 3G3KA 1H43A 4NF4A 4EXKA 2FHYA 2OX3A 4HCWA 4N15A 1UTHA 3MVWA 4MBPA 4PFRA 4NEDA 4X8RA 1IMAA 1LB9A 3GBBA 4Q0CA 4KI0E 4X1DA 2DXYA 5I56A 2DE2A 2OBGA 1B40A 2I6EA 1PBQA 3ROJA 4RK2A 5IAIA 3PPOA 5H8FB 1SI0A 1AWBA 4GFRA 1GGGA 4DZ1A 4GVOA 1I69A 4HE0A 4YICA 1LBXA 3IJXB 1SW4A 3PPPA 3N6TA 1DCUA 5HPQA 5DVIA 3C34A 1IIWA 5JTYA 4AB5A 1A7LA 5DEXA 4P9KA 3SETA 5H8QA 4N6KA 4DIGA 1MDQA 3DP6A 3TTMA 3TELA 5L9OA 3HO7A 4OYVA 4XKQA 4F3BA 2ZYOA 3C36A 2XX9A 1B1HA 2Z8EA 2PYYA 2I4BA 1FPDA 2QS1A 1EYKA 4HW8A 4TLMB 1H45A 1FTJA 1QGXA 5EYHA 3USDA 4IO7A 4RXLA 1EZPA 3VV5A 4OXVA 2ONKE 5EQ9A 3W15C 4ZE8A 1ZTYA 2HFBA 1FSAA 4N8YA 3KSXA 4AQ4A 4DI4B 5DVJA 3MP8A 2THIA 2H25A 3I6VA 3VXBA 1NH7A 2HXWA 4ECFA 4QSDA 4ZDMA 4F3PA 1FBEA 1J1NA 2O1LA 2R9JA 2XHDA 4IO4A 4GWUA 4U4XA 2DOJA 1LCFA 5B7DA 3CG3A 1MPCA 1A8FA 2OWTA 3JYRA 3VFJA 4ONYA 3FIRA 4GBWA 4KFQA 4PFYA 4LQ5A 1LB8A 1FTMA 5EYGA 3SZPA 2XXTA 1JETA 2B3FA 4OZ9A 1AIVA 5TP9B 1OLAA 4KPTA 4EQ9A 2AYSA 1LBVA 1LSTA 2DE3A 4LATA 1B5HA 1M5EA 1MQJA 4QFOA 3K6VA 1B7HA 2H5YA 5H8HA 5I57B 5I2NA 1ZU0A 1FTAA 3IB0A 1MM6A 3CI8A 4QFNA 1M5CA 1LBYA 5I84A 4GL0A 1JVYA 2ZYKA 3FVNA 4F31B 5H8NB 2B65A 4JSDA 1NV3A 1QJMA 1SW5A 4I3EA 4H5FA 3VVDA 2OCUA 4H65A 2XXPA 3RLFE 1Q35A 4O3BA 4IY6A 3OENA 5ISUA 1LEVA 2AL4A 5I5PA 3VLWA 2F36A 4UA8A 2UVIA 1FCKA 4OVTA 4QRZA 4IR8A 4OERA 3W9WA 1JW4A 4ELQA 4PBHA 4F29A 5AA2B 4H5GA 2O7IA 1B05A 3QYTA 5KDTB 3EHTA 4IO6A 2B4MA 4NF8A 4AS4A 3CSGA 3C31A 2DXRA 1USYE 4I3YA 5ESYA 3Q26A 2Q89A 1Q1KA 4XF5A 4PFTA 3IX1A 1TFAA 2QVRA 3EQ1A 5A5XB 1B32A 2A5TB 1S50A 1INPA 3MQ9A 3K6XA 4H8IA 2O1MA 2XXKA 3KN7A 1MXUA 1XVYA 3QUFA 4OFLA 1TFDA 4C1UA 3DM0A 4YKKA 3IOWA 1FJ9A 1MG1A 2VPNA 2Y7RA 3IAZA 1II5A 3KBRA 4OVJA 4GX6A 3VVEA 1D9VA 2DWHA 5DTBA 2DVZA 1POY1 1MRPA 2CMOA 1XI6A 4UABA 3ECRA 1NV0A 2GHBA 1IMCA 1AL3A 5CMBA 1M5DA 5FHNA 1KWHA 4JVCA 1QUIA 4I1DA 3SESA 4YMBA 4YU0A 2DWAA 3T9XB 4NGUA 1NV6A 2I49A 4H6DA 4XIGQ 1CNQA 4JVIA 4C0RA 3A09A 2I0BA 3OELA 1B3LA 1K9ZA 3TQLA 3SKPA 1EYJA 4EUOA 2PMSA 2VT5A 2P1SA 1N04A 5CRYA 1Z7ME 4PGNA 3LBSA 1EH3A 2DQVA 4N4UA 4QFPA 4RJZA 1O64A 3CR9A 3U93A 3O28A 1NKXA 2UYEA 4LP2B 1R9QA 2WYPA 3H4ZA 3B7DA 1DK4A 4OFJA 3T9HB 1TWYA 3T9VA 4F1YA 1IXCA 5KDTA 1SYHA 3JV9A 2Y7IA 3E9XA 4O3CA 5IZ3B 3B6WA 5LTCA 3SERA 2JJKA 1F9BA 4BDQA 4MHFA 4GWYA 3IO4A 2HHMA 3T96B 1LBBA 4E0WA 2I0CA 4M4GA 3S9MC 5CMMA 4P56A 1ZJLA 1S7YA 1MXWA 4EQ7A 3RT6B 3MC2A 2PBWA 3OXNA 3SEWA 4IY5A 4PCDA 3JZJA 4MIJA 4NF0A 4GWZA 3RGYA 4E0XA 3TDJA 2QRYA 2VP1A 4NN3A 4X04A 5I59A 4NTLA 3R7XA 2VHAA 3K1NA 3VLUA 1NUZA 2IA4A 3MZBA 1B9JA 2H4IA 3HFUA 3ZKLA 3BIHA 4F3GA 2CEYA 2QPQA 4WEPA 4EDPA 2XD3A 1MQIA 3KJ7A 4MNCA 1Y3PA 5JK4A 4NF6B 4O3AA 4LUBA 1JEVA 4TQUQ 2Q8MA 1CE2A 2NXOA 5IKBA 5IM2A 3IR1A 4ZZEA 4GIZA 1BTJA 1D9QA 5AA3A 3CHGA 4OVQA 1GV8A 2YJPA 3OSQA 1NNPA 3N5LA 3HSTA 2IEEA 3R26A 1B5IA 3OMBA 4NF5A 2FVZA 3FBPA 3B6QA 4NG7A 1Y3QA 3KSJA 4OHNA 3ISPA 4MEVA 5CMCA 1A8EA 4LN5A 4ZEFA 4H8JA 3LC8A 3RYDA 3S9LC 1WVJA 1DOTA 2ZZXA 3KOSA 3P7IA 1DPPA 3HV1A 1DSNA 3FVOA 2ZNTA 1NH8A 1FQBA 4RK9A 1FBHA 4JVDA 4OEUA 3WAEA 4GXSB 2X7QA 3LSLA 2QMWA 2FNCA 3M3KA 1ELJA 3IO6A 5AA4B 1P1QA 3PMVA 2RKMA 5H8SA 3MZ1A 3SDFA 2DWIA 4RPOA 3VXCA 3FJMA 4GWWA 4H1XA 4KCCA 3QMFA 4HCYA 1AH5A 3FV1A 1O7TA 2L5VA 3G3IA 1B58A 2LAOA 1JP4A 2UYFA 3ILUB 2F5XA 1JQFA 1VFEA 5CM6A 3DELB 4NQ8A 3TKDA 3C35A 3E3KA 2VPOA 4OTEA 1D3KA 4EXLA 2NUVA 3RTFB 3O6IA 2PFYA 1SVXB 3KZGA 1QKBA 3LSWA 2Y7WA 3TAJA 3FXQA 4F3SA 1FRPA 3FJ7A 2OJTA 5BWJA 1A40A 2H9BA 2Y84A 1HSJA 1PB9A 3KC1A 3TFLA 2HEUA 2BJJX 4I62A 1KA0A 3E78A 1XT8A 4X48A 1PB7A 2G29A 1B5JA 4GRKA 1IMEA 3MWBA 2XXXA 1MY3A 2QS3A 1KA1A 3K6WA 4G77A 5IZ1A 3RUMA 4PFIA 2WEFA 1NL5A 2XWIA 2XX7A 2R71A 2I48A 1ATGA 2UVHA 3LUZA 3BKIB 4N81A 3V89B 3Q27A 5M2VA 3MP1A 2Y7PA 1BP5A 4F1UA 3LR1A 2UVJA 2Z23A 2NWJA 1FTKA 1MXZA 4ZS9A 2Y5LA 4IO5A 1MPDA 3TODA 4O8MA 4KXPA 3SEVA 3LSFB 3TMGA 4YZZA 4U2RA 4XFEA 3IOVA 2VD2A 1M5BA 2QVVA 4KYDA 2O68A 1LFGA 4IGRA 4HE1A 4ESXA 1LBZA 1AOVA 3KC0A 3T66A 1URSA 4DI3D 1SPIA 4F39A 2V4CA 1US4A 4PE5B 3PUZE 3U1OA 4JWOA 1MY4A 3KGCA 1FPGA 4LVQA 4GLIA 1PDAA 4PC9A 1N0TA 3UIFA 3UK4A 4OWDA 4OVRA 4G68B 3U94A 4OA4A 1OVBA 1NV4A 2F7CA 1DMBA 1CB6A 1UIVA 1RYOA 3OEKA 4F19A 4OVSA 2FIEA 3U72A 2DE4A 4PFWA 5LOMA 2QFLA 1URDA 1PB8A 3CRBA 1O63A 4WEDA 4BDMA 2QS4A 2OWZA 4EF1A 3GYYA 4QSCA 2XXUA 4FATA 2GHAA 1US5A 5IZZA 1FQAA 4RYAA 1IXIA 2HAVA 3HHFA 1FJ6A 2HQ0A 2Q2AA 3VE1B 4U1OA 4HS7A 3G3HA 4OETA 5FTHA 4KCDA 1QUJA 4QHQA 3M3LA 1DBZA 1LBWA 3U8QA 5H8FA 4FEBA 1SD3A 4IO2A 2BJIA 2XXVA 3FATA 3K01A 4MX6A 1VSOA 1LGBC 4YB5A 1MY0A 1FQFA 3TYHA 3O66A 3RY3A 2F34A 1VR5A 4GX4A 1B0HA 4F2OA 2Q74A 1B4HA 3T9UA 2O51A 1FW0A 2RC9A 1B3HA 5CI5A 1IXGA 1EU8A 1NV1A 2XWOA 1TT1A 3EHSA 3PPRA 1B2HA 4G8NA 3TCHA 3ONMA 2XXIA 3BFTA 3IOTA 4JDFA 2OWSA 3MW0A 2YPNA 3FVKA 1NUXA 2F78A 2CZIA 1Y9UA 1MPBA 5I58B 3K4UA 3KJTA 3O6GA 4AS5A 1RDXA 3I3VA 3UORA 3T93B 1YZ0A 1R6ZA 2DSFA 1NFTA 4OEVA 5EQ8A 3CFXA 1BKAA 1Y20A 4KR5A 2ONRA 1N3WA 3MPLA 2P3NA 1FQCA 1I6BA 3OEMA 1SDXA 1MXYA 1BK4A 3KFMA 3H03A 5DW8A 4F22A 3C32A 4YKIA 2V3TA 4ELOA 1FBFA 1IMFA 1YCJA 1RDZA 1H3DA 4GQOA 5TP9A 5FTIA 4KYEA 3BIGA 1PC3A 4KYSA 3IFCA 2WYKA 3TZAA 1FPEA 2REGA 3U65A 1NI9A 5I57A 3H6TA 4I9DA 4MLQA 1FQEA 3G3FA 3HN0A 1FPLA 1SI1A 3S9EA 1MM7A 3FV2A 4WXJA 5H8NA 3GLBA 5TPAB 5TU0A 3Q28A 4JWXA 5IGAA 2F97A 2WX9A 1LBCA 1G0HA 3DP4A 4N91A 4R73A 3MSTA 3RPLB 4DCYA 4PAKA 1Y4CA 1B3FA 1QKAA 4THIA 3RQTA 4I8CA 1LCTA 3TQWA 5ITPA 3V8XB 2VD3A 2G93A 1IUDA 2ANJA 2Y7KA 4KQPA 2XA5A 2FIXA 4RA1A 5AA2A 1BIYA 2HXRA 3A29A 4N13A 5FHOA 4MFIA 4FE8A 4PQJA 3H6UA 2HZLA 1TXFA 4PAIA 1UTBB 2RC8A 1ANFA 3DLNA 1DPEA 3CSBA 1FBPA 3T0JA 5AA1A 3R6UA 1BLFA 4R9FA 4P8BA 3K1PA 5A5XA 2P2AA 1GVCA 2E0SA 2A5TA 3CIJA 3PTYA 5EQAA 5ICQA 2I3VA 4PAFA 4QSEA 5K2YA 4OVPA 3EKIA 1P99A 4L17A 4MF3A 4XEQA 4H67A 1EYIA 4N6DA 5BUUA 1P1UA 5I3SA 4F2QA 4UACA 2AIXA 5KZTA 1L5TA 1DTZA 4LQ2A 1XS5A 1RYXA 5DYHA 3L6GA 2RC7A 3IJOB 3DP8A 4X1BA 3IL1B 4KHZE 4R2BA 5HBCA 4MJOA 2OZZA 4Q5TA 1YYZA 4NWDA 4PDDA 1JW5A 4NF4B 1N3XA 2O69A 4HTGA 2GFEA 1UTHB 3TTNA 3UA8A 5TPAA 1LFHA 5L9SA 3VDFA 4KD5A 1K9YA 1A54A 1XVXA 5I56B 1SW2A 1OIBA 4ZEKA 3TPAA 2O84X 4U4SA 3E13X 3H06B 3EPEA 1IMDA 2PFZA 3K00A 1AMFA 4MLVA 4O7IA 3PUYE 4PP0A 3PGFA 4P1LA 1LAXA 2V25A 2QSXA 4POXA 3KN3A 3O9PA 1MQHA 4ELRA 1MQDA 3D4GA 4XXUA 4QFKA 4GWOA 5IZ3A 4MNPA 1MS7A 5JTYB 4O94A 4YMAA 2X26A 5DEXB 2ZXTA 4YKJA 5H8QB 3S2VA 2HAUA 3ZS6A 2QS2A 3PD9A 4X9TA 4IGTA 4P3LA 4QBAA 4RPNA 2WBDA 3GXAA 1PBPA 2NVUB 4OQOA 3EN3A 5K2XA 1H44A 3KBZA 4JBZA 4R6YA 1NNKA 1A99A 5ELVA 4Q30B 1JVXA 2XWVA 3CG1A 3FXUA 4ZEIA 1FTLA 2VOZA 2Z8FA 1URGA 4MH5A 2B3BA 2XXWA 2X7PA 3BFUA 1VFDA 4TLLB 1B7UA 4ESWA 3OO9A 1POTA 3N6UA 2ONSA 5ICTA 4O7MA 4DDDA 3MYUA 1FPFA 1SQYA 3B6TA 4GF8A 1YAEA 3D4CA 4N17A 1Y3NA 2ABHA 4M1VA 1FTOA 2F7BA 4HE2A 2OK2A 4NF6A 5ET7A 5EHMA 4G68C 2ESNA 3W9VA 2FA7A 2CZHA 2D21A 1G0IA 4ZEDA 3PMXA 3EHUA 3C9HA 1ZBMA 2F3DA 1OQGA 5F1QA 3MVYA 2ZMBA 5H8HB 1LFIA 5I2NB 1MH4A 3PUVE 4LZ8A 4PF8A 1ZMGA 1LAHE 4GWXA 2XX8A 3B8BA 4JXIA 5A5LA 3M3FA 1YTVA 3S9NC 3TEPA 4EQBA 4GOTA 3TTRA 2F3BA 1B0LA 5F7VA 3PPQA 3FD3A 1B4ZA 2XXRA 1NMUA 1OVTA 2QVUA 2CZLA 4XKRA 3T1BA 1SYIA 1ZIUA 4ZE9A 5AA4A 4Q8RA 3QK6A 3MUQA 1WODA 3MPKA 2XD2A 2GH9A 3KG2A 4RY1A 4YB6A 2AL5A 4ELPA 4NMYA 3GBAA 3QUJA 5EQ7A 1PEBA 1Z7NE 4C1TA 1Q9DA 1P1OA 3H6VA 4NF8B 5ITOA 3D1RA 4I40A 4QF9A 1GR2A 1XC1A 4ISUA 4FEDA 5FBPA 4MAGA 1GTKA 3V5AA 1USYH 3ODBA 4POWA 2XXYA 3PV0E 3PUXE 4YAHX 2DP8A 1NNTA 1FPIA 1QVSA 1N76A 2I4CA 4G2ZA 4DXCA 2DS9A 4RNSA 3K2DA 1FPKA 1DTGA 3A3UA 1YPNA 4NE4A 2UXAA 3IB1A 1JEUA 1Y1MA 3QIMA 3N26A 3MBPA 5ET8A 4BDOA 2PX1A 1IXHA 3NOHA 4OESA 4DLDA 2KR0A 3SEXA 4BDRA 2Z8DA 1H76A 4N07A 2MKZA 4G8HA 4MCOA 4LZ5A 3IK6B 4MNIA 4F18A 3O6HA 3IB2A 5ET6A 2Q8JA 1SBPA 3PPNA 3QSLA 2D5WA 4BLAA 4ND9A 3K02A 1B1XA 1MH3A 2RF1A 5LDZA 1Y4TA 4P0GA 2I58A 2FBPA 4H45A 4QXDA 3PUWE 3OO6A 1EZOA 3I5OA 1NUWA 3QXMA 1KZ8A 3FASA 3C33A 3IFAA 2PT1A 2PT2A 4FAJA 1B46A 3CFLA 3MJNA 1P1NA 1FPBA 2W7YA 4XTCQ 3SEUA 1B3GA 3RT8A 5F24A 4R74A 3KOTA 4BDLA 1ZLQA 4PFBA 4R2FA 1JW1A 3MVZA 1MDP1 1IZ1A 2Y5KA 4EF2A 2F6GA 3HCQA 1QUKA 3V83A 2RCBA 4PF6A 5L8DA 5B70A 1NV2A 1VE4A 1NUYA 2I3WA 4G68A 2XWKA 4WKMA 5I2KB 3IOUA 3G7WA 3TUSA 2R6GE 1A55A 4G8MA 1ZKBA 4AB6A 3RTWB 4U1ZA 1B3EA 4R6KA 3RPWA 3ZSFA 2KLFA 4FECA 4ZZAA 3VVFA 2FYIA 4TOZA 2V84A 4H0WA 2RCAA 5KCJB 2E1SA 2HZKA 2Q9TA 3FVGA 1MY1A 1UQWA 4G4PA 1VDWA 5JEIA 3CVGA 5I59B 4PBQA 3RN8A 2Q2CA 3UGWA 4R6HA 4N8GA 1RKMA 3SEYA 2ZNSA 5EYFA 3PMWA 1FBCA 4R75A 2ZNUA 4IO3A 1NNFA 2O6AA 1MXVA 3B50A 2DYXA 3T22A 1R9LA 4ZEBA 4DXBA 3KN8A 4DXUA 2NOOA 2RINA 5J16A 3C4MA 4GD5A 1S9TA 4LONB 2Z22A 3UN6A 3MVXA 3FJGA 1IMBA 3N94A 4NAPA 2ZYNA 1D4NA 3FZVA 4HXVA
chains in the Genus database with same CATH topology
3E4RA 3O29A 1JNFA 3TTLA 2F35A 4NF5B 2F8DA 2WKYA 1XHYA 1N84A 2D3IA 2ZYMA 4Z7EA 2F6PA 3PU5A 5DVFA 1M5FA 1N7WA 5FHMA 4YKPA 5AE4A 4LA9A 4U23A 4GXAA 2QL3A 4PETA 2QMXA 1LAGE 1UIUA 3H6WA 3OSRA 2M8CA 2DWJA 2HCAA 3FXRA 3BBRA 3TCGA 1OMPA 3O97A 5I2KA 2XXHA 3ILTB 3TTKA 5I58A 1MY2A 2VGQA 1QW0A 4U22A 1B52A 3MZ9A 1P1WA 3PD8A 4BDNA 4OMBA 1LLSA 4U21A 1B7ZA 3VLVA 1OLCA 3KEIA 1B51A 3LUYA 3M8UA 4YB7A 5KCJA 3HPIA 3G3JA 5EHSA 2GRVA 4FORA 1T0KA 2P0SA 1IEJA 3TCFA 2A5SA 5CC2A 4XKPA 2V3UA 3OO8A 3H7MA 4R72A 2YLNA 5HM4B 4JSOA 4XKNA 4P0IA 1MXXA 3OOAA 5AA2D 4GL8A 3LSXA 3AXFA 2O7UA 3O2AA 4LZ7A 4F1VA 4ZECA 3Q25A 1HSEA 1I6AA 1HSLA 1QULA 3OO7A 4PFUA 3A3CA 1IQ7A 2XXQA 3K6UA 1D9YA 3QAXA 3Q29A 2Q88A 2V93A 3OD7A 4DCXA 1SW1A 3U92A 1FQDA 2OLBA 5CBRA 1Y1ZA 4QFLA 4FIMA 4P11A 3K0VA 2REJA 5DT6A 2V3QA 4N6PA 3F11A 3HHGA 1OQHA 3K1MA 2UVGA 1UTBA 3GZGA 1XOCA 1WDNA 3UP9A 1MQGA 3H3GA 4DE8A 5CMKA 2H99A 1R1NA 2ALUA 3IORA 4FJPA 2PVUA 1IITA 3RNNA 4JB7A 4R9GA 2F7AA 3ZKKA 5J1DA 5L9MA 1EZ9A 4K3FA 1N7XA 4IB2A 1I6QA 3MP6A 4NWCA 4OENA 1LAFE 3L6HA 3WAFA 4OFOA 4JWYA 2H98A 2QJEA 3FGSA 3CFZA 3G3GA 4Z0IA 3EF7A 5CBSA 3S4UA 3THIA 3FUZA 2DVCA 1B6HA 3MAMA 3G3KA 1H43A 4NF4A 4EXKA 4HCWA 1UTHA 3MVWA 4MBPA 4NEDA 1LB9A 3GBBA 4Q0CA 4KI0E 4X1DA 2DXYA 5I56A 2DE2A 2OBGA 1B40A 2I6EA 1PBQA 4RK2A 5IAIA 3PPOA 5H8FB 1SI0A 4GFRA 1GGGA 4DZ1A 4GVOA 1I69A 4YICA 3IJXB 1SW4A 3PPPA 3N6TA 5HPQA 5DVIA 3C34A 1IIWA 5JTYA 4AB5A 1A7LA 5DEXA 3SETA 5H8QA 4DIGA 1MDQA 3DP6A 3TTMA 3TELA 5L9OA 3HO7A 4OYVA 4XKQA 4F3BA 2ZYOA 3C36A 2XX9A 1B1HA 2Z8EA 2PYYA 2I4BA 2QS1A 4HW8A 4TLMB 1H45A 1FTJA 3USDA 4IO7A 4RXLA 1EZPA 3VV5A 4OXVA 2ONKE 3W15C 4ZE8A 1ZTYA 2HFBA 3KSXA 4AQ4A 5DVJA 3MP8A 2THIA 2H25A 3I6VA 3VXBA 1NH7A 2HXWA 4ECFA 4QSDA 4ZDMA 4F3PA 1J1NA 2O1LA 2R9JA 2XHDA 4IO4A 4U4XA 2DOJA 1LCFA 5B7DA 3CG3A 1MPCA 1A8FA 2OWTA 3JYRA 3VFJA 4ONYA 3FIRA 4KFQA 4PFYA 4LQ5A 1LB8A 1FTMA 2XXTA 1JETA 2B3FA 4OZ9A 1AIVA 5TP9B 1OLAA 4KPTA 4EQ9A 2AYSA 1LSTA 2DE3A 4LATA 1B5HA 1M5EA 1MQJA 4QFOA 3K6VA 1B7HA 2H5YA 5H8HA 5I57B 5I2NA 1ZU0A 3IB0A 1MM6A 3CI8A 4QFNA 1M5CA 5I84A 4GL0A 1JVYA 2ZYKA 3FVNA 4F31B 5H8NB 2B65A 4JSDA 1QJMA 1SW5A 4H5FA 3VVDA 2OCUA 4H65A 2XXPA 3RLFE 1Q35A 4O3BA 4IY6A 3OENA 5ISUA 2AL4A 3VLWA 2F36A 4UA8A 2UVIA 1FCKA 4QRZA 4OERA 3W9WA 1JW4A 4ELQA 4F29A 5AA2B 4H5GA 2O7IA 1B05A 3QYTA 5KDTB 3EHTA 4IO6A 4NF8A 3CSGA 3C31A 2DXRA 1USYE 3Q26A 2Q89A 1Q1KA 4PFTA 3IX1A 1TFAA 3EQ1A 5A5XB 1B32A 2A5TB 1S50A 3MQ9A 3K6XA 4H8IA 2O1MA 3KN7A 1MXUA 1XVYA 3QUFA 4OFLA 1TFDA 4C1UA 3DM0A 4YKKA 3IOWA 1MG1A 2Y7RA 3IAZA 1II5A 3KBRA 4OVJA 3VVEA 1D9VA 2DWHA 5DTBA 2DVZA 1POY1 1MRPA 2CMOA 3ECRA 2GHBA 1AL3A 5CMBA 1M5DA 5FHNA 1KWHA 1QUIA 4I1DA 3SESA 4YMBA 4YU0A 2DWAA 3T9XB 2I49A 4H6DA 4XIGQ 4C0RA 3A09A 2I0BA 3OELA 1B3LA 3TQLA 3SKPA 4EUOA 2PMSA 2P1SA 1N04A 5CRYA 1Z7ME 3LBSA 1EH3A 2DQVA 4QFPA 4RJZA 1O64A 3CR9A 3U93A 3O28A 1NKXA 2UYEA 4LP2B 1R9QA 3H4ZA 3B7DA 3T9HB 4OFJA 1TWYA 4F1YA 3T9VA 1IXCA 5KDTA 1SYHA 3JV9A 2Y7IA 3E9XA 4O3CA 3B6WA 3SERA 1F9BA 4BDQA 3IO4A 3T96B 4E0WA 1LBBA 2I0CA 4M4GA 3S9MC 5CMMA 1ZJLA 1S7YA 1MXWA 4EQ7A 3RT6B 3MC2A 2PBWA 3OXNA 3SEWA 4IY5A 3JZJA 3RGYA 4E0XA 3TDJA 2QRYA 2VP1A 5I59A 4NTLA 3R7XA 2VHAA 3K1NA 3VLUA 2IA4A 3MZBA 1B9JA 2H4IA 3ZKLA 4F3GA 2QPQA 4WEPA 4EDPA 2XD3A 1MQIA 3KJ7A 1Y3PA 5JK4A 4NF6B 4O3AA 4LUBA 1JEVA 4TQUQ 1CE2A 2NXOA 5IKBA 3IR1A 4ZZEA 4GIZA 1BTJA 5AA3A 1GV8A 2YJPA 3OSQA 1NNPA 3N5LA 3HSTA 2IEEA 3R26A 1B5IA 3OMBA 4NF5A 3B6QA 1Y3QA 3KSJA 4OHNA 5CMCA 1A8EA 4ZEFA 4H8JA 3LC8A 3S9LC 1WVJA 1DOTA 3KOSA 3P7IA 1DPPA 3HV1A 1DSNA 3FVOA 2ZNTA 1NH8A 1FQBA 4RK9A 4OEUA 3WAEA 4GXSB 2X7QA 3LSLA 2QMWA 2FNCA 3M3KA 1ELJA 3IO6A 5AA4B 1P1QA 3PMVA 2RKMA 5H8SA 3MZ1A 3SDFA 2DWIA 4RPOA 3VXCA 3FJMA 4H1XA 4KCCA 4HCYA 1AH5A 3FV1A 1O7TA 3G3IA 1B58A 2LAOA 2UYFA 3ILUB 2F5XA 1JQFA 1VFEA 5CM6A 3DELB 3TKDA 3C35A 3E3KA 4OTEA 4EXLA 1D3KA 2NUVA 3RTFB 3O6IA 1SVXB 3KZGA 1QKBA 3LSWA 2Y7WA 3TAJA 3FXQA 4F3SA 3FJ7A 2OJTA 5BWJA 1A40A 2H9BA 2Y84A 1HSJA 1PB9A 3TFLA 2HEUA 2BJJX 4I62A 1XT8A 4X48A 1PB7A 2G29A 1B5JA 4GRKA 3MWBA 2XXXA 1MY3A 2QS3A 3K6WA 4G77A 3RUMA 1NL5A 2XX7A 2R71A 2I48A 1ATGA 2UVHA 3BKIB 3V89B 3Q27A 5M2VA 3MP1A 2Y7PA 1BP5A 4F1UA 3LR1A 2UVJA 2Z23A 2NWJA 1FTKA 1MXZA 4ZS9A 4IO5A 1MPDA 3TODA 3SEVA 3LSFB 3TMGA 4YZZA 4U2RA 3IOVA 2VD2A 1M5BA 4KYDA 2O68A 1LFGA 4IGRA 4ESXA 1AOVA 3T66A 1URSA 4F39A 1US4A 4PE5B 3PUZE 3U1OA 4JWOA 1MY4A 3KGCA 4LVQA 4GLIA 1PDAA 1N0TA 3UIFA 3UK4A 4OWDA 4G68B 3U94A 1OVBA 2F7CA 1DMBA 1CB6A 1UIVA 1RYOA 3OEKA 4F19A 3U72A 2DE4A 4PFWA 5LOMA 1URDA 1PB8A 3CRBA 1O63A 4WEDA 4BDMA 2QS4A 4EF1A 4QSCA 2XXUA 4FATA 2GHAA 1US5A 1FQAA 4RYAA 1IXIA 2HAVA 3HHFA 2HQ0A 2Q2AA 3VE1B 4U1OA 4HS7A 3G3HA 4OETA 5FTHA 4KCDA 1QUJA 4QHQA 3M3LA 3U8QA 5H8FA 4FEBA 1SD3A 4IO2A 2XXVA 3FATA 3K01A 1VSOA 1LGBC 4YB5A 3TYHA 1FQFA 1MY0A 3O66A 3RY3A 2F34A 1VR5A 1B0HA 4F2OA 1B4HA 3T9UA 2O51A 1FW0A 2RC9A 1B3HA 5CI5A 1IXGA 1EU8A 1TT1A 3EHSA 3PPRA 1B2HA 4G8NA 3TCHA 3ONMA 2XXIA 3BFTA 3IOTA 4JDFA 2OWSA 3MW0A 2YPNA 3FVKA 2F78A 1Y9UA 1MPBA 5I58B 3K4UA 3KJTA 3O6GA 3I3VA 3UORA 3T93B 1R6ZA 2DSFA 1NFTA 4OEVA 3CFXA 1BKAA 1Y20A 4KR5A 2ONRA 1N3WA 3MPLA 1FQCA 1I6BA 3OEMA 1SDXA 1MXYA 3KFMA 3H03A 4F22A 3C32A 4YKIA 2V3TA 4ELOA 1YCJA 1H3DA 4GQOA 5TP9A 5FTIA 4KYEA 1PC3A 4KYSA 3TZAA 2REGA 5I57A 3H6TA 4I9DA 4MLQA 1FQEA 3G3FA 3HN0A 1SI1A 3S9EA 1MM7A 3FV2A 4WXJA 5H8NA 3GLBA 5TPAB 5TU0A 3Q28A 4JWXA 2F97A 1LBCA 3DP4A 4R73A 4DCYA 1Y4CA 1B3FA 1QKAA 4THIA 3RQTA 4I8CA 1LCTA 3TQWA 5ITPA 3V8XB 2VD3A 2G93A 1IUDA 2ANJA 2Y7KA 4KQPA 4RA1A 5AA2A 1BIYA 4N13A 5FHOA 4MFIA 4FE8A 4PQJA 3H6UA 2HZLA 1TXFA 1UTBB 2RC8A 1ANFA 3DLNA 1DPEA 3CSBA 5AA1A 3R6UA 1BLFA 4R9FA 3K1PA 5A5XA 2P2AA 1GVCA 2E0SA 2A5TA 3CIJA 5ICQA 2I3VA 4QSEA 5K2YA 1P99A 4L17A 4MF3A 4H67A 5BUUA 1P1UA 4F2QA 4UACA 2AIXA 5KZTA 1L5TA 1DTZA 4LQ2A 1XS5A 1RYXA 5DYHA 3L6GA 2RC7A 3IJOB 3DP8A 4X1BA 3IL1B 4KHZE 4R2BA 5HBCA 2OZZA 4Q5TA 4NWDA 1JW5A 4NF4B 1N3XA 2O69A 4HTGA 2GFEA 1UTHB 3TTNA 3UA8A 5TPAA 1LFHA 5L9SA 3VDFA 4KD5A 1A54A 1XVXA 5I56B 1SW2A 1OIBA 4ZEKA 3TPAA 2O84X 4U4SA 3E13X 3H06B 3EPEA 3K00A 1AMFA 4MLVA 3PUYE 4PP0A 3PGFA 1LAXA 2V25A 2QSXA 4POXA 3KN3A 3O9PA 1MQHA 4ELRA 1MQDA 3D4GA 4XXUA 4QFKA 4GWOA 1MS7A 5JTYB 4YMAA 2X26A 5DEXB 2ZXTA 4YKJA 5H8QB 3S2VA 2HAUA 3ZS6A 2QS2A 3PD9A 4X9TA 4IGTA 4RPNA 3GXAA 1PBPA 2NVUB 4OQOA 3EN3A 5K2XA 1H44A 4JBZA 4R6YA 1NNKA 1A99A 5ELVA 4Q30B 1JVXA 3CG1A 3FXUA 4ZEIA 1FTLA 2VOZA 2Z8FA 1URGA 4MH5A 2B3BA 2XXWA 2X7PA 3BFUA 1VFDA 4TLLB 1B7UA 4ESWA 3OO9A 1POTA 3N6UA 2ONSA 5ICTA 4DDDA 1SQYA 3B6TA 4GF8A 1YAEA 3D4CA 1Y3NA 2ABHA 4M1VA 1FTOA 2F7BA 4NF6A 2OK2A 5EHMA 4G68C 2ESNA 3W9VA 2FA7A 2D21A 4ZEDA 3PMXA 3EHUA 3C9HA 1ZBMA 1OQGA 5F1QA 3MVYA 2ZMBA 5H8HB 1LFIA 5I2NB 1MH4A 3PUVE 4LZ8A 1ZMGA 1LAHE 2XX8A 4JXIA 3M3FA 1YTVA 3S9NC 3TEPA 4EQBA 4GOTA 3TTRA 1B0LA 5F7VA 3PPQA 3FD3A 1B4ZA 2XXRA 1NMUA 1OVTA 2CZLA 4XKRA 1SYIA 1ZIUA 4ZE9A 5AA4A 4Q8RA 3QK6A 3MUQA 1WODA 3MPKA 2XD2A 2GH9A 3KG2A 4RY1A 4YB6A 2AL5A 4ELPA 4NMYA 3GBAA 3QUJA 1PEBA 1Z7NE 4C1TA 1P1OA 3H6VA 4NF8B 5ITOA 4QF9A 1GR2A 1XC1A 4ISUA 4FEDA 1GTKA 3V5AA 1USYH 3ODBA 4POWA 2XXYA 3PV0E 3PUXE 4YAHX 2DP8A 1NNTA 1QVSA 1N76A 2I4CA 4G2ZA 4DXCA 2DS9A 4RNSA 3K2DA 1DTGA 3A3UA 1YPNA 4NE4A 2UXAA 3IB1A 1JEUA 1Y1MA 3QIMA 3N26A 3MBPA 4BDOA 2PX1A 1IXHA 4OESA 4DLDA 3SEXA 4BDRA 2Z8DA 1H76A 4N07A 4G8HA 4LZ5A 3IK6B 4F18A 3O6HA 3IB2A 2Q8JA 1SBPA 3PPNA 3QSLA 2D5WA 4BLAA 4ND9A 3K02A 1B1XA 1MH3A 2RF1A 1Y4TA 4P0GA 2I58A 3PUWE 3OO6A 1EZOA 3I5OA 3QXMA 3FASA 3C33A 2PT1A 2PT2A 4FAJA 1B46A 3CFLA 3MJNA 1P1NA 2W7YA 4XTCQ 3SEUA 1B3GA 3RT8A 4R74A 3KOTA 4BDLA 1ZLQA 4R2FA 1JW1A 3MVZA 1MDP1 1IZ1A 4EF2A 2F6GA 3HCQA 1QUKA 3V83A 2RCBA 5L8DA 5B70A 1VE4A 2I3WA 4G68A 4WKMA 5I2KB 3IOUA 3G7WA 3TUSA 2R6GE 1A55A 4G8MA 1ZKBA 4AB6A 3RTWB 4U1ZA 1B3EA 4R6KA 3RPWA 3ZSFA 2KLFA 4FECA 4ZZAA 3VVFA 2FYIA 4TOZA 2V84A 4H0WA 2RCAA 5KCJB 2E1SA 2HZKA 2Q9TA 3FVGA 1MY1A 1UQWA 4G4PA 5JEIA 3CVGA 5I59B 3RN8A 2Q2CA 3UGWA 4R6HA 1RKMA 3SEYA 2ZNSA 5EYFA 3PMWA 4R75A 2ZNUA 4IO3A 1NNFA 2O6AA 1MXVA 2DYXA 3T22A 1R9LA 4ZEBA 4DXBA 3KN8A 4DXUA 2NOOA 2RINA 3C4MA 4GD5A 1S9TA 2Z22A 4LONB 3UN6A 3MVXA 3FJGA 3N94A 2ZYNA 1D4NA 3FZVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E4R A;  3O29 A;  1JNF A;  3TTL A;  2F35 A;  4NF5 B;  2F8D A;  2WKY A;  1XHY A;  1N84 A;  2D3I A;  2ZYM A;  4Z7E A;  2F6P A;  3PU5 A;  5DVF A;  1M5F A;  1N7W A;  5FHM A;  4YKP A;  5AE4 A;  4LA9 A;  4U23 A;  4GXA A;  2QL3 A;  4PET A;  2QMX A;  1LAG E;  1UIU A;  3H6W A;  3OSR A;  2M8C A;  2DWJ A;  2HCA A;  3FXR A;  3BBR A;  3TCG A;  1OMP A;  3O97 A;  5I2K A;  2XXH A;  3ILT B;  3TTK A;  5I58 A;  1MY2 A;  2VGQ A;  1QW0 A;  4U22 A;  1B52 A;  3MZ9 A;  1P1W A;  3PD8 A;  4BDN A;  4OMB A;  1LLS A;  4U21 A;  1B7Z A;  3VLV A;  1OLC A;  3KEI A;  1B51 A;  3LUY A;  3M8U A;  4YB7 A;  5KCJ A;  3HPI A;  3G3J A;  5EHS A;  2GRV A;  4FOR A;  1T0K A;  2P0S A;  1IEJ A;  3TCF A;  2A5S A;  5CC2 A;  4XKP A;  2V3U A;  3OO8 A;  3H7M A;  4R72 A;  2YLN A;  5HM4 B;  4JSO A;  4XKN A;  4P0I A;  1MXX A;  3OOA A;  5AA2 D;  4GL8 A;  3LSX A;  3AXF A;  2O7U A;  3O2A A;  4LZ7 A;  4F1V A;  4ZEC A;  3Q25 A;  1HSE A;  1I6A A;  1HSL A;  1QUL A;  3OO7 A;  4PFU A;  3A3C A;  1IQ7 A;  2XXQ A;  3K6U A;  1D9Y A;  3QAX A;  3Q29 A;  2Q88 A;  2V93 A;  3OD7 A;  4DCX A;  1SW1 A;  3U92 A;  1FQD A;  2OLB A;  5CBR A;  1Y1Z A;  4QFL A;  4FIM A;  4P11 A;  3K0V A;  2REJ A;  5DT6 A;  2V3Q A;  4N6P A;  3F11 A;  3HHG A;  1OQH A;  3K1M A;  2UVG A;  1UTB A;  3GZG A;  1XOC A;  1WDN A;  3UP9 A;  1MQG A;  3H3G A;  4DE8 A;  5CMK A;  2H99 A;  1R1N A;  2ALU A;  3IOR A;  4FJP A;  2PVU A;  1IIT A;  3RNN A;  4JB7 A;  4R9G A;  2F7A A;  3ZKK A;  5J1D A;  5L9M A;  1EZ9 A;  4K3F A;  1N7X A;  4IB2 A;  1I6Q A;  3MP6 A;  4NWC A;  4OEN A;  1LAF E;  3L6H A;  3WAF A;  4OFO A;  4JWY A;  2H98 A;  2QJE A;  3FGS A;  3CFZ A;  3G3G A;  4Z0I A;  3EF7 A;  5CBS A;  3S4U A;  3THI A;  3FUZ A;  2DVC A;  1B6H A;  3MAM A;  3G3K A;  1H43 A;  4NF4 A;  4EXK A;  4HCW A;  1UTH A;  3MVW A;  4MBP A;  4NED A;  1LB9 A;  3GBB A;  4Q0C A;  4KI0 E;  4X1D A;  2DXY A;  5I56 A;  2DE2 A;  2OBG A;  1B40 A;  2I6E A;  1PBQ A;  4RK2 A;  5IAI A;  3PPO A;  5H8F B;  1SI0 A;  4GFR A;  1GGG A;  4DZ1 A;  4GVO A;  1I69 A;  4YIC A;  3IJX B;  1SW4 A;  3PPP A;  3N6T A;  5HPQ A;  5DVI A;  3C34 A;  1IIW A;  5JTY A;  4AB5 A;  1A7L A;  5DEX A;  3SET A;  5H8Q A;  4DIG A;  1MDQ A;  3DP6 A;  3TTM A;  3TEL A;  5L9O A;  3HO7 A;  4OYV A;  4XKQ A;  4F3B A;  2ZYO A;  3C36 A;  2XX9 A;  1B1H A;  2Z8E A;  2PYY A;  2I4B A;  2QS1 A;  4HW8 A;  4TLM B;  1H45 A;  1FTJ A;  3USD A;  4IO7 A;  4RXL A;  1EZP A;  3VV5 A;  4OXV A;  2ONK E;  3W15 C;  4ZE8 A;  1ZTY A;  2HFB A;  3KSX A;  4AQ4 A;  5DVJ A;  3MP8 A;  2THI A;  2H25 A;  3I6V A;  3VXB A;  1NH7 A;  2HXW A;  4ECF A;  4QSD A;  4ZDM A;  4F3P A;  1J1N A;  2O1L A;  2R9J A;  2XHD A;  4IO4 A;  4U4X A;  2DOJ A;  1LCF A;  5B7D A;  3CG3 A;  1MPC A;  1A8F A;  2OWT A;  3JYR A;  3VFJ A;  4ONY A;  3FIR A;  4KFQ A;  4PFY A;  4LQ5 A;  1LB8 A;  1FTM A;  2XXT A;  1JET A;  2B3F A;  4OZ9 A;  1AIV A;  5TP9 B;  1OLA A;  4KPT A;  4EQ9 A;  2AYS A;  1LST A;  2DE3 A;  4LAT A;  1B5H A;  1M5E A;  1MQJ A;  4QFO A;  3K6V A;  1B7H A;  2H5Y A;  5H8H A;  5I57 B;  5I2N A;  1ZU0 A;  3IB0 A;  1MM6 A;  3CI8 A;  4QFN A;  1M5C A;  5I84 A;  4GL0 A;  1JVY A;  2ZYK A;  3FVN A;  4F31 B;  5H8N B;  2B65 A;  4JSD A;  1QJM A;  1SW5 A;  4H5F A;  3VVD A;  2OCU A;  4H65 A;  2XXP A;  3RLF E;  1Q35 A;  4O3B A;  4IY6 A;  3OEN A;  5ISU A;  2AL4 A;  3VLW A;  2F36 A;  4UA8 A;  2UVI A;  1FCK A;  4QRZ A;  4OER A;  3W9W A;  1JW4 A;  4ELQ A;  4F29 A;  5AA2 B;  4H5G A;  2O7I A;  1B05 A;  3QYT A;  5KDT B;  3EHT A;  4IO6 A;  4NF8 A;  3CSG A;  3C31 A;  2DXR A;  1USY E;  3Q26 A;  2Q89 A;  1Q1K A;  4PFT A;  3IX1 A;  1TFA A;  3EQ1 A;  5A5X B;  1B32 A;  2A5T B;  1S50 A;  3MQ9 A;  3K6X A;  4H8I A;  2O1M A;  3KN7 A;  1MXU A;  1XVY A;  3QUF A;  4OFL A;  1TFD A;  4C1U A;  3DM0 A;  4YKK A;  3IOW A;  1MG1 A;  2Y7R A;  3IAZ A;  1II5 A;  3KBR A;  4OVJ A;  3VVE A;  1D9V A;  2DWH A;  5DTB A;  2DVZ A;  1POY 1;  1MRP A;  2CMO A;  3ECR A;  2GHB A;  1AL3 A;  5CMB A;  1M5D A;  5FHN A;  1KWH A;  1QUI A;  4I1D A;  3SES A;  4YMB A;  4YU0 A;  2DWA A;  3T9X B;  2I49 A;  4H6D A;  4XIG Q;  4C0R A;  3A09 A;  2I0B A;  3OEL A;  1B3L A;  3TQL A;  3SKP A;  4EUO A;  2PMS A;  2P1S A;  1N04 A;  5CRY A;  1Z7M E;  3LBS A;  1EH3 A;  2DQV A;  4QFP A;  4RJZ A;  1O64 A;  3CR9 A;  3U93 A;  3O28 A;  1NKX A;  2UYE A;  4LP2 B;  1R9Q A;  3H4Z A;  3B7D A;  3T9H B;  4OFJ A;  1TWY A;  4F1Y A;  3T9V A;  1IXC A;  5KDT A;  1SYH A;  3JV9 A;  2Y7I A;  3E9X A;  4O3C A;  3B6W A;  3SER A;  1F9B A;  4BDQ A;  3IO4 A;  3T96 B;  4E0W A;  1LBB A;  2I0C A;  4M4G A;  3S9M C;  5CMM A;  1ZJL A;  1S7Y A;  1MXW A;  4EQ7 A;  3RT6 B;  3MC2 A;  2PBW A;  3OXN A;  3SEW A;  4IY5 A;  3JZJ A;  3RGY A;  4E0X A;  3TDJ A;  2QRY A;  2VP1 A;  5I59 A;  4NTL A;  3R7X A;  2VHA A;  3K1N A;  3VLU A;  2IA4 A;  3MZB A;  1B9J A;  2H4I A;  3ZKL A;  4F3G A;  2QPQ A;  4WEP A;  4EDP A;  2XD3 A;  1MQI A;  3KJ7 A;  1Y3P A;  5JK4 A;  4NF6 B;  4O3A A;  4LUB A;  1JEV A;  4TQU Q;  1CE2 A;  2NXO A;  5IKB A;  3IR1 A;  4ZZE A;  4GIZ A;  1BTJ A;  5AA3 A;  1GV8 A;  2YJP A;  3OSQ A;  1NNP A;  3N5L A;  3HST A;  2IEE A;  3R26 A;  1B5I A;  3OMB A;  4NF5 A;  3B6Q A;  1Y3Q A;  3KSJ A;  4OHN A;  5CMC A;  1A8E A;  4ZEF A;  4H8J A;  3LC8 A;  3S9L C;  1WVJ A;  1DOT A;  3KOS A;  3P7I A;  1DPP A;  3HV1 A;  1DSN A;  3FVO A;  2ZNT A;  1NH8 A;  1FQB A;  4RK9 A;  4OEU A;  3WAE A;  4GXS B;  2X7Q A;  3LSL A;  2QMW A;  2FNC A;  3M3K A;  1ELJ A;  3IO6 A;  5AA4 B;  1P1Q A;  3PMV A;  2RKM A;  5H8S A;  3MZ1 A;  3SDF A;  2DWI A;  4RPO A;  3VXC A;  3FJM A;  4H1X A;  4KCC A;  4HCY A;  1AH5 A;  3FV1 A;  1O7T A;  3G3I A;  1B58 A;  2LAO A;  2UYF A;  3ILU B;  2F5X A;  1JQF A;  1VFE A;  5CM6 A;  3DEL B;  3TKD A;  3C35 A;  3E3K A;  4OTE A;  4EXL A;  1D3K A;  2NUV A;  3RTF B;  3O6I A;  1SVX B;  3KZG A;  1QKB A;  3LSW A;  2Y7W A;  3TAJ A;  3FXQ A;  4F3S A;  3FJ7 A;  2OJT A;  5BWJ A;  1A40 A;  2H9B A;  2Y84 A;  1HSJ A;  1PB9 A;  3TFL A;  2HEU A;  2BJJ X;  4I62 A;  1XT8 A;  4X48 A;  1PB7 A;  2G29 A;  1B5J A;  4GRK A;  3MWB A;  2XXX A;  1MY3 A;  2QS3 A;  3K6W A;  4G77 A;  3RUM A;  1NL5 A;  2XX7 A;  2R71 A;  2I48 A;  1ATG A;  2UVH A;  3BKI B;  3V89 B;  3Q27 A;  5M2V A;  3MP1 A;  2Y7P A;  1BP5 A;  4F1U A;  3LR1 A;  2UVJ A;  2Z23 A;  2NWJ A;  1FTK A;  1MXZ A;  4ZS9 A;  4IO5 A;  1MPD A;  3TOD A;  3SEV A;  3LSF B;  3TMG A;  4YZZ A;  4U2R A;  3IOV A;  2VD2 A;  1M5B A;  4KYD A;  2O68 A;  1LFG A;  4IGR A;  4ESX A;  1AOV A;  3T66 A;  1URS A;  4F39 A;  1US4 A;  4PE5 B;  3PUZ E;  3U1O A;  4JWO A;  1MY4 A;  3KGC A;  4LVQ A;  4GLI A;  1PDA A;  1N0T A;  3UIF A;  3UK4 A;  4OWD A;  4G68 B;  3U94 A;  1OVB A;  2F7C A;  1DMB A;  1CB6 A;  1UIV A;  1RYO A;  3OEK A;  4F19 A;  3U72 A;  2DE4 A;  4PFW A;  5LOM A;  1URD A;  1PB8 A;  3CRB A;  1O63 A;  4WED A;  4BDM A;  2QS4 A;  4EF1 A;  4QSC A;  2XXU A;  4FAT A;  2GHA A;  1US5 A;  1FQA A;  4RYA A;  1IXI A;  2HAV A;  3HHF A;  2HQ0 A;  2Q2A A;  3VE1 B;  4U1O A;  4HS7 A;  3G3H A;  4OET A;  5FTH A;  4KCD A;  1QUJ A;  4QHQ A;  3M3L A;  3U8Q A;  5H8F A;  4FEB A;  1SD3 A;  4IO2 A;  2XXV A;  3FAT A;  3K01 A;  1VSO A;  1LGB C;  4YB5 A;  3TYH A;  1FQF A;  1MY0 A;  3O66 A;  3RY3 A;  2F34 A;  1VR5 A;  1B0H A;  4F2O A;  1B4H A;  3T9U A;  2O51 A;  1FW0 A;  2RC9 A;  1B3H A;  5CI5 A;  1IXG A;  1EU8 A;  1TT1 A;  3EHS A;  3PPR A;  1B2H A;  4G8N A;  3TCH A;  3ONM A;  2XXI A;  3BFT A;  3IOT A;  4JDF A;  2OWS A;  3MW0 A;  2YPN A;  3FVK A;  2F78 A;  1Y9U A;  1MPB A;  5I58 B;  3K4U A;  3KJT A;  3O6G A;  3I3V A;  3UOR A;  3T93 B;  1R6Z A;  2DSF A;  1NFT A;  4OEV A;  3CFX A;  1BKA A;  1Y20 A;  4KR5 A;  2ONR A;  1N3W A;  3MPL A;  1FQC A;  1I6B A;  3OEM A;  1SDX A;  1MXY A;  3KFM A;  3H03 A;  4F22 A;  3C32 A;  4YKI A;  2V3T A;  4ELO A;  1YCJ A;  1H3D A;  4GQO A;  5TP9 A;  5FTI A;  4KYE A;  1PC3 A;  4KYS A;  3TZA A;  2REG A;  5I57 A;  3H6T A;  4I9D A;  4MLQ A;  1FQE A;  3G3F A;  3HN0 A;  1SI1 A;  3S9E A;  1MM7 A;  3FV2 A;  4WXJ A;  5H8N A;  3GLB A;  5TPA B;  5TU0 A;  3Q28 A;  4JWX A;  2F97 A;  1LBC A;  3DP4 A;  4R73 A;  4DCY A;  1Y4C A;  1B3F A;  1QKA A;  4THI A;  3RQT A;  4I8C A;  1LCT A;  3TQW A;  5ITP A;  3V8X B;  2VD3 A;  2G93 A;  1IUD A;  2ANJ A;  2Y7K A;  4KQP A;  4RA1 A;  5AA2 A;  1BIY A;  4N13 A;  5FHO A;  4MFI A;  4FE8 A;  4PQJ A;  3H6U A;  2HZL A;  1TXF A;  1UTB B;  2RC8 A;  1ANF A;  3DLN A;  1DPE A;  3CSB A;  5AA1 A;  3R6U A;  1BLF A;  4R9F A;  3K1P A;  5A5X A;  2P2A A;  1GVC A;  2E0S A;  2A5T A;  3CIJ A;  5ICQ A;  2I3V A;  4QSE A;  5K2Y A;  1P99 A;  4L17 A;  4MF3 A;  4H67 A;  5BUU A;  1P1U A;  4F2Q A;  4UAC A;  2AIX A;  5KZT A;  1L5T A;  1DTZ A;  4LQ2 A;  1XS5 A;  1RYX A;  5DYH A;  3L6G A;  2RC7 A;  3IJO B;  3DP8 A;  4X1B A;  3IL1 B;  4KHZ E;  4R2B A;  5HBC A;  2OZZ A;  4Q5T A;  4NWD A;  1JW5 A;  4NF4 B;  1N3X A;  2O69 A;  4HTG A;  2GFE A;  1UTH B;  3TTN A;  3UA8 A;  5TPA A;  1LFH A;  5L9S A;  3VDF A;  4KD5 A;  1A54 A;  1XVX A;  5I56 B;  1SW2 A;  1OIB A;  4ZEK A;  3TPA A;  2O84 X;  4U4S A;  3E13 X;  3H06 B;  3EPE A;  3K00 A;  1AMF A;  4MLV A;  3PUY E;  4PP0 A;  3PGF A;  1LAX A;  2V25 A;  2QSX A;  4POX A;  3KN3 A;  3O9P A;  1MQH A;  4ELR A;  1MQD A;  3D4G A;  4XXU A;  4QFK A;  4GWO A;  1MS7 A;  5JTY B;  4YMA A;  2X26 A;  5DEX B;  2ZXT A;  4YKJ A;  5H8Q B;  3S2V A;  2HAU A;  3ZS6 A;  2QS2 A;  3PD9 A;  4X9T A;  4IGT A;  4RPN A;  3GXA A;  1PBP A;  2NVU B;  4OQO A;  3EN3 A;  5K2X A;  1H44 A;  4JBZ A;  4R6Y A;  1NNK A;  1A99 A;  5ELV A;  4Q30 B;  1JVX A;  3CG1 A;  3FXU A;  4ZEI A;  1FTL A;  2VOZ A;  2Z8F A;  1URG A;  4MH5 A;  2B3B A;  2XXW A;  2X7P A;  3BFU A;  1VFD A;  4TLL B;  1B7U A;  4ESW A;  3OO9 A;  1POT A;  3N6U A;  2ONS A;  5ICT A;  4DDD A;  1SQY A;  3B6T A;  4GF8 A;  1YAE A;  3D4C A;  1Y3N A;  2ABH A;  4M1V A;  1FTO A;  2F7B A;  4NF6 A;  2OK2 A;  5EHM A;  4G68 C;  2ESN A;  3W9V A;  2FA7 A;  2D21 A;  4ZED A;  3PMX A;  3EHU A;  3C9H A;  1ZBM A;  1OQG A;  5F1Q A;  3MVY A;  2ZMB A;  5H8H B;  1LFI A;  5I2N B;  1MH4 A;  3PUV E;  4LZ8 A;  1ZMG A;  1LAH E;  2XX8 A;  4JXI A;  3M3F A;  1YTV A;  3S9N C;  3TEP A;  4EQB A;  4GOT A;  3TTR A;  1B0L A;  5F7V A;  3PPQ A;  3FD3 A;  1B4Z A;  2XXR A;  1NMU A;  1OVT A;  2CZL A;  4XKR A;  1SYI A;  1ZIU A;  4ZE9 A;  5AA4 A;  4Q8R A;  3QK6 A;  3MUQ A;  1WOD A;  3MPK A;  2XD2 A;  2GH9 A;  3KG2 A;  4RY1 A;  4YB6 A;  2AL5 A;  4ELP A;  4NMY A;  3GBA A;  3QUJ A;  1PEB A;  1Z7N E;  4C1T A;  1P1O A;  3H6V A;  4NF8 B;  5ITO A;  4QF9 A;  1GR2 A;  1XC1 A;  4ISU A;  4FED A;  1GTK A;  3V5A A;  1USY H;  3ODB A;  4POW A;  2XXY A;  3PV0 E;  3PUX E;  4YAH X;  2DP8 A;  1NNT A;  1QVS A;  1N76 A;  2I4C A;  4G2Z A;  4DXC A;  2DS9 A;  4RNS A;  3K2D A;  1DTG A;  3A3U A;  1YPN A;  4NE4 A;  2UXA A;  3IB1 A;  1JEU A;  1Y1M A;  3QIM A;  3N26 A;  3MBP A;  4BDO A;  2PX1 A;  1IXH A;  4OES A;  4DLD A;  3SEX A;  4BDR A;  2Z8D A;  1H76 A;  4N07 A;  4G8H A;  4LZ5 A;  3IK6 B;  4F18 A;  3O6H A;  3IB2 A;  2Q8J A;  1SBP A;  3PPN A;  3QSL A;  2D5W A;  4BLA A;  4ND9 A;  3K02 A;  1B1X A;  1MH3 A;  2RF1 A;  1Y4T A;  4P0G A;  2I58 A;  3PUW E;  3OO6 A;  1EZO A;  3I5O A;  3QXM A;  3FAS A;  3C33 A;  2PT1 A;  2PT2 A;  4FAJ A;  1B46 A;  3CFL A;  3MJN A;  1P1N A;  2W7Y A;  4XTC Q;  3SEU A;  1B3G A;  3RT8 A;  4R74 A;  3KOT A;  4BDL A;  1ZLQ A;  4R2F A;  1JW1 A;  3MVZ A;  1MDP 1;  1IZ1 A;  4EF2 A;  2F6G A;  3HCQ A;  1QUK A;  3V83 A;  2RCB A;  5L8D A;  5B70 A;  1VE4 A;  2I3W A;  4G68 A;  4WKM A;  5I2K B;  3IOU A;  3G7W A;  3TUS A;  2R6G E;  1A55 A;  4G8M A;  1ZKB A;  4AB6 A;  3RTW B;  4U1Z A;  1B3E A;  4R6K A;  3RPW A;  3ZSF A;  2KLF A;  4FEC A;  4ZZA A;  3VVF A;  2FYI A;  4TOZ A;  2V84 A;  4H0W A;  2RCA A;  5KCJ B;  2E1S A;  2HZK A;  2Q9T A;  3FVG A;  1MY1 A;  1UQW A;  4G4P A;  5JEI A;  3CVG A;  5I59 B;  3RN8 A;  2Q2C A;  3UGW A;  4R6H A;  1RKM A;  3SEY A;  2ZNS A;  5EYF A;  3PMW A;  4R75 A;  2ZNU A;  4IO3 A;  1NNF A;  2O6A A;  1MXV A;  2DYX A;  3T22 A;  1R9L A;  4ZEB A;  4DXB A;  3KN8 A;  4DXU A;  2NOO A;  2RIN A;  3C4M A;  4GD5 A;  1S9T A;  2Z22 A;  4LON B;  3UN6 A;  3MVX A;  3FJG A;  3N94 A;  2ZYN A;  1D4N A;  3FZV A; 
#chains in the Genus database with same CATH topology
 3E4R A;  3O29 A;  1JNF A;  3TTL A;  2F35 A;  4NF5 B;  2F8D A;  2WKY A;  1XHY A;  1N84 A;  3LV0 A;  2D3I A;  2ZYM A;  3FXB A;  4Z7E A;  2CZK A;  2F6P A;  3PU5 A;  5DVF A;  1M5F A;  1N7W A;  5FHM A;  4YKP A;  5AE4 A;  4LA9 A;  4U23 A;  2WBB A;  4G61 A;  4GXA A;  2QL3 A;  4PET A;  2QMX A;  1FPJ A;  1LAG E;  1UIU A;  2PCR A;  3H6W A;  3OSR A;  2M8C A;  2DWJ A;  2HCA A;  3FXR A;  3BBR A;  3TCG A;  1OMP A;  3O97 A;  5I2K A;  4PE3 A;  2XXH A;  3ILT B;  4PTK A;  3TTK A;  5I58 A;  1MY2 A;  4PGP A;  2VGQ A;  1QW0 A;  4U22 A;  1B52 A;  3MZ9 A;  1P1W A;  4P47 A;  3PD8 A;  4BDN A;  4OMB A;  1LLS A;  2DDK A;  4U21 A;  1B7Z A;  3VLV A;  1OLC A;  4NX1 A;  3KEI A;  1B51 A;  3LUY A;  3M8U A;  4GBV A;  4YB7 A;  5KCJ A;  3HPI A;  3G3J A;  5EHS A;  2R8T A;  4FBP A;  4GWS A;  4GX3 A;  2GRV A;  4FOR A;  1T0K A;  2P0S A;  1IEJ A;  3TCF A;  2A5S A;  5CC2 A;  4XKP A;  2V3U A;  3OO8 A;  1FBD A;  2P3V A;  1NV7 A;  5T3J A;  3H7M A;  4R72 A;  2YLN A;  5HM4 B;  4JSO A;  4XKN A;  4P0I A;  2GQ1 A;  2HPG A;  1MXX A;  3OOA A;  5AA2 D;  4GL8 A;  3LSX A;  3AXF A;  2O7U A;  3O2A A;  4LZ7 A;  4F1V A;  4ZEC A;  4NHB A;  2ZZV A;  4H46 A;  3Q25 A;  2ZZW A;  1HSE A;  3RPL A;  1I6A A;  1HSL A;  1QUL A;  4P1E A;  3OO7 A;  4PFU A;  3A3C A;  1IQ7 A;  2XXQ A;  3K6U A;  1D9Y A;  4PDH A;  3QAX A;  2KQZ A;  3Q29 A;  2Q88 A;  2V93 A;  3OD7 A;  4DCX A;  1SW1 A;  3U92 A;  1FQD A;  2OLB A;  5CBR A;  1Y1Z A;  4QFL A;  4FIM A;  4P11 A;  3K0V A;  2CEX A;  1YXI A;  2REJ A;  5DT6 A;  2V3Q A;  4N6P A;  3F11 A;  5I7I A;  3HHG A;  1OQH A;  3K1M A;  2UVG A;  1UTB A;  3GZG A;  1XOC A;  1WDN A;  3UP9 A;  1MQG A;  3H3G A;  4DE8 A;  5CMK A;  2H99 A;  1FBG A;  4MMP A;  1R1N A;  2ALU A;  3IOR A;  4FJP A;  2PVU A;  1IIT A;  3RNN A;  4JB7 A;  4R9G A;  2F7A A;  4OAN A;  3ZKK A;  5J1D A;  5L9M A;  1NV5 A;  1EZ9 A;  4K3F A;  1N7X A;  4IB2 A;  1I6Q A;  3MP6 A;  4NWC A;  4OEN A;  1LAF E;  3L6H A;  3E79 A;  3WAF A;  2B4L A;  4OFO A;  4JWY A;  2H98 A;  2QJE A;  3FGS A;  1RDY A;  3CFZ A;  3G3G A;  4Z0I A;  3EF7 A;  5CBS A;  3S4U A;  3THI A;  5ET5 A;  3FUZ A;  2DVC A;  1B6H A;  3MAM A;  3G3K A;  1H43 A;  4NF4 A;  4EXK A;  2FHY A;  2OX3 A;  4HCW A;  4N15 A;  1UTH A;  3MVW A;  4MBP A;  4PFR A;  4NED A;  4X8R A;  1IMA A;  1LB9 A;  3GBB A;  4Q0C A;  4KI0 E;  4X1D A;  2DXY A;  5I56 A;  2DE2 A;  2OBG A;  1B40 A;  2I6E A;  1PBQ A;  3ROJ A;  4RK2 A;  5IAI A;  3PPO A;  5H8F B;  1SI0 A;  1AWB A;  4GFR A;  1GGG A;  4DZ1 A;  4GVO A;  1I69 A;  4HE0 A;  4YIC A;  1LBX A;  3IJX B;  1SW4 A;  3PPP A;  3N6T A;  1DCU A;  5HPQ A;  5DVI A;  3C34 A;  1IIW A;  5JTY A;  4AB5 A;  1A7L A;  5DEX A;  4P9K A;  3SET A;  5H8Q A;  4N6K A;  4DIG A;  1MDQ A;  3DP6 A;  3TTM A;  3TEL A;  5L9O A;  3HO7 A;  4OYV A;  4XKQ A;  4F3B A;  2ZYO A;  3C36 A;  2XX9 A;  1B1H A;  2Z8E A;  2PYY A;  2I4B A;  1FPD A;  2QS1 A;  1EYK A;  4HW8 A;  4TLM B;  1H45 A;  1FTJ A;  1QGX A;  5EYH A;  3USD A;  4IO7 A;  4RXL A;  1EZP A;  3VV5 A;  4OXV A;  2ONK E;  5EQ9 A;  3W15 C;  4ZE8 A;  1ZTY A;  2HFB A;  1FSA A;  4N8Y A;  3KSX A;  4AQ4 A;  4DI4 B;  5DVJ A;  3MP8 A;  2THI A;  2H25 A;  3I6V A;  3VXB A;  1NH7 A;  2HXW A;  4ECF A;  4QSD A;  4ZDM A;  4F3P A;  1FBE A;  1J1N A;  2O1L A;  2R9J A;  2XHD A;  4IO4 A;  4GWU A;  4U4X A;  2DOJ A;  1LCF A;  5B7D A;  3CG3 A;  1MPC A;  1A8F A;  2OWT A;  3JYR A;  3VFJ A;  4ONY A;  3FIR A;  4GBW A;  4KFQ A;  4PFY A;  4LQ5 A;  1LB8 A;  1FTM A;  5EYG A;  3SZP A;  2XXT A;  1JET A;  2B3F A;  4OZ9 A;  1AIV A;  5TP9 B;  1OLA A;  4KPT A;  4EQ9 A;  2AYS A;  1LBV A;  1LST A;  2DE3 A;  4LAT A;  1B5H A;  1M5E A;  1MQJ A;  4QFO A;  3K6V A;  1B7H A;  2H5Y A;  5H8H A;  5I57 B;  5I2N A;  1ZU0 A;  1FTA A;  3IB0 A;  1MM6 A;  3CI8 A;  4QFN A;  1M5C A;  1LBY A;  5I84 A;  4GL0 A;  1JVY A;  2ZYK A;  3FVN A;  4F31 B;  5H8N B;  2B65 A;  4JSD A;  1NV3 A;  1QJM A;  1SW5 A;  4I3E A;  4H5F A;  3VVD A;  2OCU A;  4H65 A;  2XXP A;  3RLF E;  1Q35 A;  4O3B A;  4IY6 A;  3OEN A;  5ISU A;  1LEV A;  2AL4 A;  5I5P A;  3VLW A;  2F36 A;  4UA8 A;  2UVI A;  1FCK A;  4OVT A;  4QRZ A;  4IR8 A;  4OER A;  3W9W A;  1JW4 A;  4ELQ A;  4PBH A;  4F29 A;  5AA2 B;  4H5G A;  2O7I A;  1B05 A;  3QYT A;  5KDT B;  3EHT A;  4IO6 A;  2B4M A;  4NF8 A;  4AS4 A;  3CSG A;  3C31 A;  2DXR A;  1USY E;  4I3Y A;  5ESY A;  3Q26 A;  2Q89 A;  1Q1K A;  4XF5 A;  4PFT A;  3IX1 A;  1TFA A;  2QVR A;  3EQ1 A;  5A5X B;  1B32 A;  2A5T B;  1S50 A;  1INP A;  3MQ9 A;  3K6X A;  4H8I A;  2O1M A;  2XXK A;  3KN7 A;  1MXU A;  1XVY A;  3QUF A;  4OFL A;  1TFD A;  4C1U A;  3DM0 A;  4YKK A;  3IOW A;  1FJ9 A;  1MG1 A;  2VPN A;  2Y7R A;  3IAZ A;  1II5 A;  3KBR A;  4OVJ A;  4GX6 A;  3VVE A;  1D9V A;  2DWH A;  5DTB A;  2DVZ A;  1POY 1;  1MRP A;  2CMO A;  1XI6 A;  4UAB A;  3ECR A;  1NV0 A;  2GHB A;  1IMC A;  1AL3 A;  5CMB A;  1M5D A;  5FHN A;  1KWH A;  4JVC A;  1QUI A;  4I1D A;  3SES A;  4YMB A;  4YU0 A;  2DWA A;  3T9X B;  4NGU A;  1NV6 A;  2I49 A;  4H6D A;  4XIG Q;  1CNQ A;  4JVI A;  4C0R A;  3A09 A;  2I0B A;  3OEL A;  1B3L A;  1K9Z A;  3TQL A;  3SKP A;  1EYJ A;  4EUO A;  2PMS A;  2VT5 A;  2P1S A;  1N04 A;  5CRY A;  1Z7M E;  4PGN A;  3LBS A;  1EH3 A;  2DQV A;  4N4U A;  4QFP A;  4RJZ A;  1O64 A;  3CR9 A;  3U93 A;  3O28 A;  1NKX A;  2UYE A;  4LP2 B;  1R9Q A;  2WYP A;  3H4Z A;  3B7D A;  1DK4 A;  4OFJ A;  3T9H B;  1TWY A;  3T9V A;  4F1Y A;  1IXC A;  5KDT A;  1SYH A;  3JV9 A;  2Y7I A;  3E9X A;  4O3C A;  5IZ3 B;  3B6W A;  5LTC A;  3SER A;  2JJK A;  1F9B A;  4BDQ A;  4MHF A;  4GWY A;  3IO4 A;  2HHM A;  3T96 B;  1LBB A;  4E0W A;  2I0C A;  4M4G A;  3S9M C;  5CMM A;  4P56 A;  1ZJL A;  1S7Y A;  1MXW A;  4EQ7 A;  3RT6 B;  3MC2 A;  2PBW A;  3OXN A;  3SEW A;  4IY5 A;  4PCD A;  3JZJ A;  4MIJ A;  4NF0 A;  4GWZ A;  3RGY A;  4E0X A;  3TDJ A;  2QRY A;  2VP1 A;  4NN3 A;  4X04 A;  5I59 A;  4NTL A;  3R7X A;  2VHA A;  3K1N A;  3VLU A;  1NUZ A;  2IA4 A;  3MZB A;  1B9J A;  2H4I A;  3HFU A;  3ZKL A;  3BIH A;  4F3G A;  2CEY A;  2QPQ A;  4WEP A;  4EDP A;  2XD3 A;  1MQI A;  3KJ7 A;  4MNC A;  1Y3P A;  5JK4 A;  4NF6 B;  4O3A A;  4LUB A;  1JEV A;  4TQU Q;  2Q8M A;  1CE2 A;  2NXO A;  5IKB A;  5IM2 A;  3IR1 A;  4ZZE A;  4GIZ A;  1BTJ A;  1D9Q A;  5AA3 A;  3CHG A;  4OVQ A;  1GV8 A;  2YJP A;  3OSQ A;  1NNP A;  3N5L A;  3HST A;  2IEE A;  3R26 A;  1B5I A;  3OMB A;  4NF5 A;  2FVZ A;  3FBP A;  3B6Q A;  4NG7 A;  1Y3Q A;  3KSJ A;  4OHN A;  3ISP A;  4MEV A;  5CMC A;  1A8E A;  4LN5 A;  4ZEF A;  4H8J A;  3LC8 A;  3RYD A;  3S9L C;  1WVJ A;  1DOT A;  2ZZX A;  3KOS A;  3P7I A;  1DPP A;  3HV1 A;  1DSN A;  3FVO A;  2ZNT A;  1NH8 A;  1FQB A;  4RK9 A;  1FBH A;  4JVD A;  4OEU A;  3WAE A;  4GXS B;  2X7Q A;  3LSL A;  2QMW A;  2FNC A;  3M3K A;  1ELJ A;  3IO6 A;  5AA4 B;  1P1Q A;  3PMV A;  2RKM A;  5H8S A;  3MZ1 A;  3SDF A;  2DWI A;  4RPO A;  3VXC A;  3FJM A;  4GWW A;  4H1X A;  4KCC A;  3QMF A;  4HCY A;  1AH5 A;  3FV1 A;  1O7T A;  2L5V A;  3G3I A;  1B58 A;  2LAO A;  1JP4 A;  2UYF A;  3ILU B;  2F5X A;  1JQF A;  1VFE A;  5CM6 A;  3DEL B;  4NQ8 A;  3TKD A;  3C35 A;  3E3K A;  2VPO A;  4OTE A;  1D3K A;  4EXL A;  2NUV A;  3RTF B;  3O6I A;  2PFY A;  1SVX B;  3KZG A;  1QKB A;  3LSW A;  2Y7W A;  3TAJ A;  3FXQ A;  4F3S A;  1FRP A;  3FJ7 A;  2OJT A;  5BWJ A;  1A40 A;  2H9B A;  2Y84 A;  1HSJ A;  1PB9 A;  3KC1 A;  3TFL A;  2HEU A;  2BJJ X;  4I62 A;  1KA0 A;  3E78 A;  1XT8 A;  4X48 A;  1PB7 A;  2G29 A;  1B5J A;  4GRK A;  1IME A;  3MWB A;  2XXX A;  1MY3 A;  2QS3 A;  1KA1 A;  3K6W A;  4G77 A;  5IZ1 A;  3RUM A;  4PFI A;  2WEF A;  1NL5 A;  2XWI A;  2XX7 A;  2R71 A;  2I48 A;  1ATG A;  2UVH A;  3LUZ A;  3BKI B;  4N81 A;  3V89 B;  3Q27 A;  5M2V A;  3MP1 A;  2Y7P A;  1BP5 A;  4F1U A;  3LR1 A;  2UVJ A;  2Z23 A;  2NWJ A;  1FTK A;  1MXZ A;  4ZS9 A;  2Y5L A;  4IO5 A;  1MPD A;  3TOD A;  4O8M A;  4KXP A;  3SEV A;  3LSF B;  3TMG A;  4YZZ A;  4U2R A;  4XFE A;  3IOV A;  2VD2 A;  1M5B A;  2QVV A;  4KYD A;  2O68 A;  1LFG A;  4IGR A;  4HE1 A;  4ESX A;  1LBZ A;  1AOV A;  3KC0 A;  3T66 A;  1URS A;  4DI3 D;  1SPI A;  4F39 A;  2V4C A;  1US4 A;  4PE5 B;  3PUZ E;  3U1O A;  4JWO A;  1MY4 A;  3KGC A;  1FPG A;  4LVQ A;  4GLI A;  1PDA A;  4PC9 A;  1N0T A;  3UIF A;  3UK4 A;  4OWD A;  4OVR A;  4G68 B;  3U94 A;  4OA4 A;  1OVB A;  1NV4 A;  2F7C A;  1DMB A;  1CB6 A;  1UIV A;  1RYO A;  3OEK A;  4F19 A;  4OVS A;  2FIE A;  3U72 A;  2DE4 A;  4PFW A;  5LOM A;  2QFL A;  1URD A;  1PB8 A;  3CRB A;  1O63 A;  4WED A;  4BDM A;  2QS4 A;  2OWZ A;  4EF1 A;  3GYY A;  4QSC A;  2XXU A;  4FAT A;  2GHA A;  1US5 A;  5IZZ A;  1FQA A;  4RYA A;  1IXI A;  2HAV A;  3HHF A;  1FJ6 A;  2HQ0 A;  2Q2A A;  3VE1 B;  4U1O A;  4HS7 A;  3G3H A;  4OET A;  5FTH A;  4KCD A;  1QUJ A;  4QHQ A;  3M3L A;  1DBZ A;  1LBW A;  3U8Q A;  5H8F A;  4FEB A;  1SD3 A;  4IO2 A;  2BJI A;  2XXV A;  3FAT A;  3K01 A;  4MX6 A;  1VSO A;  1LGB C;  4YB5 A;  1MY0 A;  1FQF A;  3TYH A;  3O66 A;  3RY3 A;  2F34 A;  1VR5 A;  4GX4 A;  1B0H A;  4F2O A;  2Q74 A;  1B4H A;  3T9U A;  2O51 A;  1FW0 A;  2RC9 A;  1B3H A;  5CI5 A;  1IXG A;  1EU8 A;  1NV1 A;  2XWO A;  1TT1 A;  3EHS A;  3PPR A;  1B2H A;  4G8N A;  3TCH A;  3ONM A;  2XXI A;  3BFT A;  3IOT A;  4JDF A;  2OWS A;  3MW0 A;  2YPN A;  3FVK A;  1NUX A;  2F78 A;  2CZI A;  1Y9U A;  1MPB A;  5I58 B;  3K4U A;  3KJT A;  3O6G A;  4AS5 A;  1RDX A;  3I3V A;  3UOR A;  3T93 B;  1YZ0 A;  1R6Z A;  2DSF A;  1NFT A;  4OEV A;  5EQ8 A;  3CFX A;  1BKA A;  1Y20 A;  4KR5 A;  2ONR A;  1N3W A;  3MPL A;  2P3N A;  1FQC A;  1I6B A;  3OEM A;  1SDX A;  1MXY A;  1BK4 A;  3KFM A;  3H03 A;  5DW8 A;  4F22 A;  3C32 A;  4YKI A;  2V3T A;  4ELO A;  1FBF A;  1IMF A;  1YCJ A;  1RDZ A;  1H3D A;  4GQO A;  5TP9 A;  5FTI A;  4KYE A;  3BIG A;  1PC3 A;  4KYS A;  3IFC A;  2WYK A;  3TZA A;  1FPE A;  2REG A;  3U65 A;  1NI9 A;  5I57 A;  3H6T A;  4I9D A;  4MLQ A;  1FQE A;  3G3F A;  3HN0 A;  1FPL A;  1SI1 A;  3S9E A;  1MM7 A;  3FV2 A;  4WXJ A;  5H8N A;  3GLB A;  5TPA B;  5TU0 A;  3Q28 A;  4JWX A;  5IGA A;  2F97 A;  2WX9 A;  1LBC A;  1G0H A;  3DP4 A;  4N91 A;  4R73 A;  3MST A;  3RPL B;  4DCY A;  4PAK A;  1Y4C A;  1B3F A;  1QKA A;  4THI A;  3RQT A;  4I8C A;  1LCT A;  3TQW A;  5ITP A;  3V8X B;  2VD3 A;  2G93 A;  1IUD A;  2ANJ A;  2Y7K A;  4KQP A;  2XA5 A;  2FIX A;  4RA1 A;  5AA2 A;  1BIY A;  2HXR A;  3A29 A;  4N13 A;  5FHO A;  4MFI A;  4FE8 A;  4PQJ A;  3H6U A;  2HZL A;  1TXF A;  4PAI A;  1UTB B;  2RC8 A;  1ANF A;  3DLN A;  1DPE A;  3CSB A;  1FBP A;  3T0J A;  5AA1 A;  3R6U A;  1BLF A;  4R9F A;  4P8B A;  3K1P A;  5A5X A;  2P2A A;  1GVC A;  2E0S A;  2A5T A;  3CIJ A;  3PTY A;  5EQA A;  5ICQ A;  2I3V A;  4PAF A;  4QSE A;  5K2Y A;  4OVP A;  3EKI A;  1P99 A;  4L17 A;  4MF3 A;  4XEQ A;  4H67 A;  1EYI A;  4N6D A;  5BUU A;  1P1U A;  5I3S A;  4F2Q A;  4UAC A;  2AIX A;  5KZT A;  1L5T A;  1DTZ A;  4LQ2 A;  1XS5 A;  1RYX A;  5DYH A;  3L6G A;  2RC7 A;  3IJO B;  3DP8 A;  4X1B A;  3IL1 B;  4KHZ E;  4R2B A;  5HBC A;  4MJO A;  2OZZ A;  4Q5T A;  1YYZ A;  4NWD A;  4PDD A;  1JW5 A;  4NF4 B;  1N3X A;  2O69 A;  4HTG A;  2GFE A;  1UTH B;  3TTN A;  3UA8 A;  5TPA A;  1LFH A;  5L9S A;  3VDF A;  4KD5 A;  1K9Y A;  1A54 A;  1XVX A;  5I56 B;  1SW2 A;  1OIB A;  4ZEK A;  3TPA A;  2O84 X;  4U4S A;  3E13 X;  3H06 B;  3EPE A;  1IMD A;  2PFZ A;  3K00 A;  1AMF A;  4MLV A;  4O7I A;  3PUY E;  4PP0 A;  3PGF A;  4P1L A;  1LAX A;  2V25 A;  2QSX A;  4POX A;  3KN3 A;  3O9P A;  1MQH A;  4ELR A;  1MQD A;  3D4G A;  4XXU A;  4QFK A;  4GWO A;  5IZ3 A;  4MNP A;  1MS7 A;  5JTY B;  4O94 A;  4YMA A;  2X26 A;  5DEX B;  2ZXT A;  4YKJ A;  5H8Q B;  3S2V A;  2HAU A;  3ZS6 A;  2QS2 A;  3PD9 A;  4X9T A;  4IGT A;  4P3L A;  4QBA A;  4RPN A;  2WBD A;  3GXA A;  1PBP A;  2NVU B;  4OQO A;  3EN3 A;  5K2X A;  1H44 A;  3KBZ A;  4JBZ A;  4R6Y A;  1NNK A;  1A99 A;  5ELV A;  4Q30 B;  1JVX A;  2XWV A;  3CG1 A;  3FXU A;  4ZEI A;  1FTL A;  2VOZ A;  2Z8F A;  1URG A;  4MH5 A;  2B3B A;  2XXW A;  2X7P A;  3BFU A;  1VFD A;  4TLL B;  1B7U A;  4ESW A;  3OO9 A;  1POT A;  3N6U A;  2ONS A;  5ICT A;  4O7M A;  4DDD A;  3MYU A;  1FPF A;  1SQY A;  3B6T A;  4GF8 A;  1YAE A;  3D4C A;  4N17 A;  1Y3N A;  2ABH A;  4M1V A;  1FTO A;  2F7B A;  4HE2 A;  2OK2 A;  4NF6 A;  5ET7 A;  5EHM A;  4G68 C;  2ESN A;  3W9V A;  2FA7 A;  2CZH A;  2D21 A;  1G0I A;  4ZED A;  3PMX A;  3EHU A;  3C9H A;  1ZBM A;  2F3D A;  1OQG A;  5F1Q A;  3MVY A;  2ZMB A;  5H8H B;  1LFI A;  5I2N B;  1MH4 A;  3PUV E;  4LZ8 A;  4PF8 A;  1ZMG A;  1LAH E;  4GWX A;  2XX8 A;  3B8B A;  4JXI A;  5A5L A;  3M3F A;  1YTV A;  3S9N C;  3TEP A;  4EQB A;  4GOT A;  3TTR A;  2F3B A;  1B0L A;  5F7V A;  3PPQ A;  3FD3 A;  1B4Z A;  2XXR A;  1NMU A;  1OVT A;  2QVU A;  2CZL A;  4XKR A;  3T1B A;  1SYI A;  1ZIU A;  4ZE9 A;  5AA4 A;  4Q8R A;  3QK6 A;  3MUQ A;  1WOD A;  3MPK A;  2XD2 A;  2GH9 A;  3KG2 A;  4RY1 A;  4YB6 A;  2AL5 A;  4ELP A;  4NMY A;  3GBA A;  3QUJ A;  5EQ7 A;  1PEB A;  1Z7N E;  4C1T A;  1Q9D A;  1P1O A;  3H6V A;  4NF8 B;  5ITO A;  3D1R A;  4I40 A;  4QF9 A;  1GR2 A;  1XC1 A;  4ISU A;  4FED A;  5FBP A;  4MAG A;  1GTK A;  3V5A A;  1USY H;  3ODB A;  4POW A;  2XXY A;  3PV0 E;  3PUX E;  4YAH X;  2DP8 A;  1NNT A;  1FPI A;  1QVS A;  1N76 A;  2I4C A;  4G2Z A;  4DXC A;  2DS9 A;  4RNS A;  3K2D A;  1FPK A;  1DTG A;  3A3U A;  1YPN A;  4NE4 A;  2UXA A;  3IB1 A;  1JEU A;  1Y1M A;  3QIM A;  3N26 A;  3MBP A;  5ET8 A;  4BDO A;  2PX1 A;  1IXH A;  3NOH A;  4OES A;  4DLD A;  2KR0 A;  3SEX A;  4BDR A;  2Z8D A;  1H76 A;  4N07 A;  2MKZ A;  4G8H A;  4MCO A;  4LZ5 A;  3IK6 B;  4MNI A;  4F18 A;  3O6H A;  3IB2 A;  5ET6 A;  2Q8J A;  1SBP A;  3PPN A;  3QSL A;  2D5W A;  4BLA A;  4ND9 A;  3K02 A;  1B1X A;  1MH3 A;  2RF1 A;  5LDZ A;  1Y4T A;  4P0G A;  2I58 A;  2FBP A;  4H45 A;  4QXD A;  3PUW E;  3OO6 A;  1EZO A;  3I5O A;  1NUW A;  3QXM A;  1KZ8 A;  3FAS A;  3C33 A;  3IFA A;  2PT1 A;  2PT2 A;  4FAJ A;  1B46 A;  3CFL A;  3MJN A;  1P1N A;  1FPB A;  2W7Y A;  4XTC Q;  3SEU A;  1B3G A;  3RT8 A;  5F24 A;  4R74 A;  3KOT A;  4BDL A;  1ZLQ A;  4PFB A;  4R2F A;  1JW1 A;  3MVZ A;  1MDP 1;  1IZ1 A;  2Y5K A;  4EF2 A;  2F6G A;  3HCQ A;  1QUK A;  3V83 A;  2RCB A;  4PF6 A;  5L8D A;  5B70 A;  1NV2 A;  1VE4 A;  1NUY A;  2I3W A;  4G68 A;  2XWK A;  4WKM A;  5I2K B;  3IOU A;  3G7W A;  3TUS A;  2R6G E;  1A55 A;  4G8M A;  1ZKB A;  4AB6 A;  3RTW B;  4U1Z A;  1B3E A;  4R6K A;  3RPW A;  3ZSF A;  2KLF A;  4FEC A;  4ZZA A;  3VVF A;  2FYI A;  4TOZ A;  2V84 A;  4H0W A;  2RCA A;  5KCJ B;  2E1S A;  2HZK A;  2Q9T A;  3FVG A;  1MY1 A;  1UQW A;  4G4P A;  1VDW A;  5JEI A;  3CVG A;  5I59 B;  4PBQ A;  3RN8 A;  2Q2C A;  3UGW A;  4R6H A;  4N8G A;  1RKM A;  3SEY A;  2ZNS A;  5EYF A;  3PMW A;  1FBC A;  4R75 A;  2ZNU A;  4IO3 A;  1NNF A;  2O6A A;  1MXV A;  3B50 A;  2DYX A;  3T22 A;  1R9L A;  4ZEB A;  4DXB A;  3KN8 A;  4DXU A;  2NOO A;  2RIN A;  5J16 A;  3C4M A;  4GD5 A;  1S9T A;  4LON B;  2Z22 A;  3UN6 A;  3MVX A;  3FJG A;  1IMB A;  3N94 A;  4NAP A;  2ZYN A;  1D4N A;  3FZV A;  4HXV A; 
#chains in the Genus database with same CATH homology
 3E4R A;  3O29 A;  1JNF A;  3TTL A;  2F35 A;  4NF5 B;  2F8D A;  2WKY A;  1XHY A;  1N84 A;  2D3I A;  2ZYM A;  4Z7E A;  2F6P A;  3PU5 A;  5DVF A;  1M5F A;  1N7W A;  5FHM A;  4YKP A;  5AE4 A;  4LA9 A;  4U23 A;  4GXA A;  2QL3 A;  4PET A;  2QMX A;  1LAG E;  1UIU A;  3H6W A;  3OSR A;  2M8C A;  2DWJ A;  2HCA A;  3FXR A;  3BBR A;  3TCG A;  1OMP A;  3O97 A;  5I2K A;  2XXH A;  3ILT B;  3TTK A;  5I58 A;  1MY2 A;  2VGQ A;  1QW0 A;  4U22 A;  1B52 A;  3MZ9 A;  1P1W A;  3PD8 A;  4BDN A;  4OMB A;  1LLS A;  4U21 A;  1B7Z A;  3VLV A;  1OLC A;  3KEI A;  1B51 A;  3LUY A;  3M8U A;  4YB7 A;  5KCJ A;  3HPI A;  3G3J A;  5EHS A;  2GRV A;  4FOR A;  1T0K A;  2P0S A;  1IEJ A;  3TCF A;  2A5S A;  5CC2 A;  4XKP A;  2V3U A;  3OO8 A;  3H7M A;  4R72 A;  2YLN A;  5HM4 B;  4JSO A;  4XKN A;  4P0I A;  1MXX A;  3OOA A;  5AA2 D;  4GL8 A;  3LSX A;  3AXF A;  2O7U A;  3O2A A;  4LZ7 A;  4F1V A;  4ZEC A;  3Q25 A;  1HSE A;  1I6A A;  1HSL A;  1QUL A;  3OO7 A;  4PFU A;  3A3C A;  1IQ7 A;  2XXQ A;  3K6U A;  1D9Y A;  3QAX A;  3Q29 A;  2Q88 A;  2V93 A;  3OD7 A;  4DCX A;  1SW1 A;  3U92 A;  1FQD A;  2OLB A;  5CBR A;  1Y1Z A;  4QFL A;  4FIM A;  4P11 A;  3K0V A;  2REJ A;  5DT6 A;  2V3Q A;  4N6P A;  3F11 A;  3HHG A;  1OQH A;  3K1M A;  2UVG A;  1UTB A;  3GZG A;  1XOC A;  1WDN A;  3UP9 A;  1MQG A;  3H3G A;  4DE8 A;  5CMK A;  2H99 A;  1R1N A;  2ALU A;  3IOR A;  4FJP A;  2PVU A;  1IIT A;  3RNN A;  4JB7 A;  4R9G A;  2F7A A;  3ZKK A;  5J1D A;  5L9M A;  1EZ9 A;  4K3F A;  1N7X A;  4IB2 A;  1I6Q A;  3MP6 A;  4NWC A;  4OEN A;  1LAF E;  3L6H A;  3WAF A;  4OFO A;  4JWY A;  2H98 A;  2QJE A;  3FGS A;  3CFZ A;  3G3G A;  4Z0I A;  3EF7 A;  5CBS A;  3S4U A;  3THI A;  3FUZ A;  2DVC A;  1B6H A;  3MAM A;  3G3K A;  1H43 A;  4NF4 A;  4EXK A;  4HCW A;  1UTH A;  3MVW A;  4MBP A;  4NED A;  1LB9 A;  3GBB A;  4Q0C A;  4KI0 E;  4X1D A;  2DXY A;  5I56 A;  2DE2 A;  2OBG A;  1B40 A;  2I6E A;  1PBQ A;  4RK2 A;  5IAI A;  3PPO A;  5H8F B;  1SI0 A;  4GFR A;  1GGG A;  4DZ1 A;  4GVO A;  1I69 A;  4YIC A;  3IJX B;  1SW4 A;  3PPP A;  3N6T A;  5HPQ A;  5DVI A;  3C34 A;  1IIW A;  5JTY A;  4AB5 A;  1A7L A;  5DEX A;  3SET A;  5H8Q A;  4DIG A;  1MDQ A;  3DP6 A;  3TTM A;  3TEL A;  5L9O A;  3HO7 A;  4OYV A;  4XKQ A;  4F3B A;  2ZYO A;  3C36 A;  2XX9 A;  1B1H A;  2Z8E A;  2PYY A;  2I4B A;  2QS1 A;  4HW8 A;  4TLM B;  1H45 A;  1FTJ A;  3USD A;  4IO7 A;  4RXL A;  1EZP A;  3VV5 A;  4OXV A;  2ONK E;  3W15 C;  4ZE8 A;  1ZTY A;  2HFB A;  3KSX A;  4AQ4 A;  5DVJ A;  3MP8 A;  2THI A;  2H25 A;  3I6V A;  3VXB A;  1NH7 A;  2HXW A;  4ECF A;  4QSD A;  4ZDM A;  4F3P A;  1J1N A;  2O1L A;  2R9J A;  2XHD A;  4IO4 A;  4U4X A;  2DOJ A;  1LCF A;  5B7D A;  3CG3 A;  1MPC A;  1A8F A;  2OWT A;  3JYR A;  3VFJ A;  4ONY A;  3FIR A;  4KFQ A;  4PFY A;  4LQ5 A;  1LB8 A;  1FTM A;  2XXT A;  1JET A;  2B3F A;  4OZ9 A;  1AIV A;  5TP9 B;  1OLA A;  4KPT A;  4EQ9 A;  2AYS A;  1LST A;  2DE3 A;  4LAT A;  1B5H A;  1M5E A;  1MQJ A;  4QFO A;  3K6V A;  1B7H A;  2H5Y A;  5H8H A;  5I57 B;  5I2N A;  1ZU0 A;  3IB0 A;  1MM6 A;  3CI8 A;  4QFN A;  1M5C A;  5I84 A;  4GL0 A;  1JVY A;  2ZYK A;  3FVN A;  4F31 B;  5H8N B;  2B65 A;  4JSD A;  1QJM A;  1SW5 A;  4H5F A;  3VVD A;  2OCU A;  4H65 A;  2XXP A;  3RLF E;  1Q35 A;  4O3B A;  4IY6 A;  3OEN A;  5ISU A;  2AL4 A;  3VLW A;  2F36 A;  4UA8 A;  2UVI A;  1FCK A;  4QRZ A;  4OER A;  3W9W A;  1JW4 A;  4ELQ A;  4F29 A;  5AA2 B;  4H5G A;  2O7I A;  1B05 A;  3QYT A;  5KDT B;  3EHT A;  4IO6 A;  4NF8 A;  3CSG A;  3C31 A;  2DXR A;  1USY E;  3Q26 A;  2Q89 A;  1Q1K A;  4PFT A;  3IX1 A;  1TFA A;  3EQ1 A;  5A5X B;  1B32 A;  2A5T B;  1S50 A;  3MQ9 A;  3K6X A;  4H8I A;  2O1M A;  3KN7 A;  1MXU A;  1XVY A;  3QUF A;  4OFL A;  1TFD A;  4C1U A;  3DM0 A;  4YKK A;  3IOW A;  1MG1 A;  2Y7R A;  3IAZ A;  1II5 A;  3KBR A;  4OVJ A;  3VVE A;  1D9V A;  2DWH A;  5DTB A;  2DVZ A;  1POY 1;  1MRP A;  2CMO A;  3ECR A;  2GHB A;  1AL3 A;  5CMB A;  1M5D A;  5FHN A;  1KWH A;  1QUI A;  4I1D A;  3SES A;  4YMB A;  4YU0 A;  2DWA A;  3T9X B;  2I49 A;  4H6D A;  4XIG Q;  4C0R A;  3A09 A;  2I0B A;  3OEL A;  1B3L A;  3TQL A;  3SKP A;  4EUO A;  2PMS A;  2P1S A;  1N04 A;  5CRY A;  1Z7M E;  3LBS A;  1EH3 A;  2DQV A;  4QFP A;  4RJZ A;  1O64 A;  3CR9 A;  3U93 A;  3O28 A;  1NKX A;  2UYE A;  4LP2 B;  1R9Q A;  3H4Z A;  3B7D A;  3T9H B;  4OFJ A;  1TWY A;  4F1Y A;  3T9V A;  1IXC A;  5KDT A;  1SYH A;  3JV9 A;  2Y7I A;  3E9X A;  4O3C A;  3B6W A;  3SER A;  1F9B A;  4BDQ A;  3IO4 A;  3T96 B;  4E0W A;  1LBB A;  2I0C A;  4M4G A;  3S9M C;  5CMM A;  1ZJL A;  1S7Y A;  1MXW A;  4EQ7 A;  3RT6 B;  3MC2 A;  2PBW A;  3OXN A;  3SEW A;  4IY5 A;  3JZJ A;  3RGY A;  4E0X A;  3TDJ A;  2QRY A;  2VP1 A;  5I59 A;  4NTL A;  3R7X A;  2VHA A;  3K1N A;  3VLU A;  2IA4 A;  3MZB A;  1B9J A;  2H4I A;  3ZKL A;  4F3G A;  2QPQ A;  4WEP A;  4EDP A;  2XD3 A;  1MQI A;  3KJ7 A;  1Y3P A;  5JK4 A;  4NF6 B;  4O3A A;  4LUB A;  1JEV A;  4TQU Q;  1CE2 A;  2NXO A;  5IKB A;  3IR1 A;  4ZZE A;  4GIZ A;  1BTJ A;  5AA3 A;  1GV8 A;  2YJP A;  3OSQ A;  1NNP A;  3N5L A;  3HST A;  2IEE A;  3R26 A;  1B5I A;  3OMB A;  4NF5 A;  3B6Q A;  1Y3Q A;  3KSJ A;  4OHN A;  5CMC A;  1A8E A;  4ZEF A;  4H8J A;  3LC8 A;  3S9L C;  1WVJ A;  1DOT A;  3KOS A;  3P7I A;  1DPP A;  3HV1 A;  1DSN A;  3FVO A;  2ZNT A;  1NH8 A;  1FQB A;  4RK9 A;  4OEU A;  3WAE A;  4GXS B;  2X7Q A;  3LSL A;  2QMW A;  2FNC A;  3M3K A;  1ELJ A;  3IO6 A;  5AA4 B;  1P1Q A;  3PMV A;  2RKM A;  5H8S A;  3MZ1 A;  3SDF A;  2DWI A;  4RPO A;  3VXC A;  3FJM A;  4H1X A;  4KCC A;  4HCY A;  1AH5 A;  3FV1 A;  1O7T A;  3G3I A;  1B58 A;  2LAO A;  2UYF A;  3ILU B;  2F5X A;  1JQF A;  1VFE A;  5CM6 A;  3DEL B;  3TKD A;  3C35 A;  3E3K A;  4OTE A;  4EXL A;  1D3K A;  2NUV A;  3RTF B;  3O6I A;  1SVX B;  3KZG A;  1QKB A;  3LSW A;  2Y7W A;  3TAJ A;  3FXQ A;  4F3S A;  3FJ7 A;  2OJT A;  5BWJ A;  1A40 A;  2H9B A;  2Y84 A;  1HSJ A;  1PB9 A;  3TFL A;  2HEU A;  2BJJ X;  4I62 A;  1XT8 A;  4X48 A;  1PB7 A;  2G29 A;  1B5J A;  4GRK A;  3MWB A;  2XXX A;  1MY3 A;  2QS3 A;  3K6W A;  4G77 A;  3RUM A;  1NL5 A;  2XX7 A;  2R71 A;  2I48 A;  1ATG A;  2UVH A;  3BKI B;  3V89 B;  3Q27 A;  5M2V A;  3MP1 A;  2Y7P A;  1BP5 A;  4F1U A;  3LR1 A;  2UVJ A;  2Z23 A;  2NWJ A;  1FTK A;  1MXZ A;  4ZS9 A;  4IO5 A;  1MPD A;  3TOD A;  3SEV A;  3LSF B;  3TMG A;  4YZZ A;  4U2R A;  3IOV A;  2VD2 A;  1M5B A;  4KYD A;  2O68 A;  1LFG A;  4IGR A;  4ESX A;  1AOV A;  3T66 A;  1URS A;  4F39 A;  1US4 A;  4PE5 B;  3PUZ E;  3U1O A;  4JWO A;  1MY4 A;  3KGC A;  4LVQ A;  4GLI A;  1PDA A;  1N0T A;  3UIF A;  3UK4 A;  4OWD A;  4G68 B;  3U94 A;  1OVB A;  2F7C A;  1DMB A;  1CB6 A;  1UIV A;  1RYO A;  3OEK A;  4F19 A;  3U72 A;  2DE4 A;  4PFW A;  5LOM A;  1URD A;  1PB8 A;  3CRB A;  1O63 A;  4WED A;  4BDM A;  2QS4 A;  4EF1 A;  4QSC A;  2XXU A;  4FAT A;  2GHA A;  1US5 A;  1FQA A;  4RYA A;  1IXI A;  2HAV A;  3HHF A;  2HQ0 A;  2Q2A A;  3VE1 B;  4U1O A;  4HS7 A;  3G3H A;  4OET A;  5FTH A;  4KCD A;  1QUJ A;  4QHQ A;  3M3L A;  3U8Q A;  5H8F A;  4FEB A;  1SD3 A;  4IO2 A;  2XXV A;  3FAT A;  3K01 A;  1VSO A;  1LGB C;  4YB5 A;  3TYH A;  1FQF A;  1MY0 A;  3O66 A;  3RY3 A;  2F34 A;  1VR5 A;  1B0H A;  4F2O A;  1B4H A;  3T9U A;  2O51 A;  1FW0 A;  2RC9 A;  1B3H A;  5CI5 A;  1IXG A;  1EU8 A;  1TT1 A;  3EHS A;  3PPR A;  1B2H A;  4G8N A;  3TCH A;  3ONM A;  2XXI A;  3BFT A;  3IOT A;  4JDF A;  2OWS A;  3MW0 A;  2YPN A;  3FVK A;  2F78 A;  1Y9U A;  1MPB A;  5I58 B;  3K4U A;  3KJT A;  3O6G A;  3I3V A;  3UOR A;  3T93 B;  1R6Z A;  2DSF A;  1NFT A;  4OEV A;  3CFX A;  1BKA A;  1Y20 A;  4KR5 A;  2ONR A;  1N3W A;  3MPL A;  1FQC A;  1I6B A;  3OEM A;  1SDX A;  1MXY A;  3KFM A;  3H03 A;  4F22 A;  3C32 A;  4YKI A;  2V3T A;  4ELO A;  1YCJ A;  1H3D A;  4GQO A;  5TP9 A;  5FTI A;  4KYE A;  1PC3 A;  4KYS A;  3TZA A;  2REG A;  5I57 A;  3H6T A;  4I9D A;  4MLQ A;  1FQE A;  3G3F A;  3HN0 A;  1SI1 A;  3S9E A;  1MM7 A;  3FV2 A;  4WXJ A;  5H8N A;  3GLB A;  5TPA B;  5TU0 A;  3Q28 A;  4JWX A;  2F97 A;  1LBC A;  3DP4 A;  4R73 A;  4DCY A;  1Y4C A;  1B3F A;  1QKA A;  4THI A;  3RQT A;  4I8C A;  1LCT A;  3TQW A;  5ITP A;  3V8X B;  2VD3 A;  2G93 A;  1IUD A;  2ANJ A;  2Y7K A;  4KQP A;  4RA1 A;  5AA2 A;  1BIY A;  4N13 A;  5FHO A;  4MFI A;  4FE8 A;  4PQJ A;  3H6U A;  2HZL A;  1TXF A;  1UTB B;  2RC8 A;  1ANF A;  3DLN A;  1DPE A;  3CSB A;  5AA1 A;  3R6U A;  1BLF A;  4R9F A;  3K1P A;  5A5X A;  2P2A A;  1GVC A;  2E0S A;  2A5T A;  3CIJ A;  5ICQ A;  2I3V A;  4QSE A;  5K2Y A;  1P99 A;  4L17 A;  4MF3 A;  4H67 A;  5BUU A;  1P1U A;  4F2Q A;  4UAC A;  2AIX A;  5KZT A;  1L5T A;  1DTZ A;  4LQ2 A;  1XS5 A;  1RYX A;  5DYH A;  3L6G A;  2RC7 A;  3IJO B;  3DP8 A;  4X1B A;  3IL1 B;  4KHZ E;  4R2B A;  5HBC A;  2OZZ A;  4Q5T A;  4NWD A;  1JW5 A;  4NF4 B;  1N3X A;  2O69 A;  4HTG A;  2GFE A;  1UTH B;  3TTN A;  3UA8 A;  5TPA A;  1LFH A;  5L9S A;  3VDF A;  4KD5 A;  1A54 A;  1XVX A;  5I56 B;  1SW2 A;  1OIB A;  4ZEK A;  3TPA A;  2O84 X;  4U4S A;  3E13 X;  3H06 B;  3EPE A;  3K00 A;  1AMF A;  4MLV A;  3PUY E;  4PP0 A;  3PGF A;  1LAX A;  2V25 A;  2QSX A;  4POX A;  3KN3 A;  3O9P A;  1MQH A;  4ELR A;  1MQD A;  3D4G A;  4XXU A;  4QFK A;  4GWO A;  1MS7 A;  5JTY B;  4YMA A;  2X26 A;  5DEX B;  2ZXT A;  4YKJ A;  5H8Q B;  3S2V A;  2HAU A;  3ZS6 A;  2QS2 A;  3PD9 A;  4X9T A;  4IGT A;  4RPN A;  3GXA A;  1PBP A;  2NVU B;  4OQO A;  3EN3 A;  5K2X A;  1H44 A;  4JBZ A;  4R6Y A;  1NNK A;  1A99 A;  5ELV A;  4Q30 B;  1JVX A;  3CG1 A;  3FXU A;  4ZEI A;  1FTL A;  2VOZ A;  2Z8F A;  1URG A;  4MH5 A;  2B3B A;  2XXW A;  2X7P A;  3BFU A;  1VFD A;  4TLL B;  1B7U A;  4ESW A;  3OO9 A;  1POT A;  3N6U A;  2ONS A;  5ICT A;  4DDD A;  1SQY A;  3B6T A;  4GF8 A;  1YAE A;  3D4C A;  1Y3N A;  2ABH A;  4M1V A;  1FTO A;  2F7B A;  4NF6 A;  2OK2 A;  5EHM A;  4G68 C;  2ESN A;  3W9V A;  2FA7 A;  2D21 A;  4ZED A;  3PMX A;  3EHU A;  3C9H A;  1ZBM A;  1OQG A;  5F1Q A;  3MVY A;  2ZMB A;  5H8H B;  1LFI A;  5I2N B;  1MH4 A;  3PUV E;  4LZ8 A;  1ZMG A;  1LAH E;  2XX8 A;  4JXI A;  3M3F A;  1YTV A;  3S9N C;  3TEP A;  4EQB A;  4GOT A;  3TTR A;  1B0L A;  5F7V A;  3PPQ A;  3FD3 A;  1B4Z A;  2XXR A;  1NMU A;  1OVT A;  2CZL A;  4XKR A;  1SYI A;  1ZIU A;  4ZE9 A;  5AA4 A;  4Q8R A;  3QK6 A;  3MUQ A;  1WOD A;  3MPK A;  2XD2 A;  2GH9 A;  3KG2 A;  4RY1 A;  4YB6 A;  2AL5 A;  4ELP A;  4NMY A;  3GBA A;  3QUJ A;  1PEB A;  1Z7N E;  4C1T A;  1P1O A;  3H6V A;  4NF8 B;  5ITO A;  4QF9 A;  1GR2 A;  1XC1 A;  4ISU A;  4FED A;  1GTK A;  3V5A A;  1USY H;  3ODB A;  4POW A;  2XXY A;  3PV0 E;  3PUX E;  4YAH X;  2DP8 A;  1NNT A;  1QVS A;  1N76 A;  2I4C A;  4G2Z A;  4DXC A;  2DS9 A;  4RNS A;  3K2D A;  1DTG A;  3A3U A;  1YPN A;  4NE4 A;  2UXA A;  3IB1 A;  1JEU A;  1Y1M A;  3QIM A;  3N26 A;  3MBP A;  4BDO A;  2PX1 A;  1IXH A;  4OES A;  4DLD A;  3SEX A;  4BDR A;  2Z8D A;  1H76 A;  4N07 A;  4G8H A;  4LZ5 A;  3IK6 B;  4F18 A;  3O6H A;  3IB2 A;  2Q8J A;  1SBP A;  3PPN A;  3QSL A;  2D5W A;  4BLA A;  4ND9 A;  3K02 A;  1B1X A;  1MH3 A;  2RF1 A;  1Y4T A;  4P0G A;  2I58 A;  3PUW E;  3OO6 A;  1EZO A;  3I5O A;  3QXM A;  3FAS A;  3C33 A;  2PT1 A;  2PT2 A;  4FAJ A;  1B46 A;  3CFL A;  3MJN A;  1P1N A;  2W7Y A;  4XTC Q;  3SEU A;  1B3G A;  3RT8 A;  4R74 A;  3KOT A;  4BDL A;  1ZLQ A;  4R2F A;  1JW1 A;  3MVZ A;  1MDP 1;  1IZ1 A;  4EF2 A;  2F6G A;  3HCQ A;  1QUK A;  3V83 A;  2RCB A;  5L8D A;  5B70 A;  1VE4 A;  2I3W A;  4G68 A;  4WKM A;  5I2K B;  3IOU A;  3G7W A;  3TUS A;  2R6G E;  1A55 A;  4G8M A;  1ZKB A;  4AB6 A;  3RTW B;  4U1Z A;  1B3E A;  4R6K A;  3RPW A;  3ZSF A;  2KLF A;  4FEC A;  4ZZA A;  3VVF A;  2FYI A;  4TOZ A;  2V84 A;  4H0W A;  2RCA A;  5KCJ B;  2E1S A;  2HZK A;  2Q9T A;  3FVG A;  1MY1 A;  1UQW A;  4G4P A;  5JEI A;  3CVG A;  5I59 B;  3RN8 A;  2Q2C A;  3UGW A;  4R6H A;  1RKM A;  3SEY A;  2ZNS A;  5EYF A;  3PMW A;  4R75 A;  2ZNU A;  4IO3 A;  1NNF A;  2O6A A;  1MXV A;  2DYX A;  3T22 A;  1R9L A;  4ZEB A;  4DXB A;  3KN8 A;  4DXU A;  2NOO A;  2RIN A;  3C4M A;  4GD5 A;  1S9T A;  2Z22 A;  4LON B;  3UN6 A;  3MVX A;  3FJG A;  3N94 A;  2ZYN A;  1D4N A;  3FZV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...