4LONB

Crystal structure of monomeric sulphate free form of ligand binding domain of cysb,an lttr from salmonella typhimurium lt2
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
239
structure length
239
Chain Sequence
EHTWPDKGSLYIATTHTQARYALPGVIKGFIERYPRVSLHMHQGSPTQIAEAVSKGNADFAIATEALHLYDDLVMLPCYHWNRSIVVTPDHPLAATSSVTIEALAQYPLVTYTFGFTGRSELDTAFNRAGLTPRIVFTATDADVIKTYVRLGLGVGVIASMAVDPLADPDLVRIDAHDIFSHSTTKIGFRRSTFLRSYMYDFIQRFAPHLTRDVVDTAVALRSNEEIEAMFQDIKLPEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator CysB
publication title Crystal structure of monomeric sulphate free form of ligand binding domain of CysB,an LTTR from Salmonella typhimurium LT2
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Gene regulation
total genus 68
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2013-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4lonB01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4lonB02
1N84A 2XXWA 3O6HA 1DMBA 3EHTA 1XVXA 3C34A 1FQAA 2QRYA 3PMVA 1ZJLA 4ELRA 2DWAA 2QPQA 3GLBA 4LVQA 3IOUA 4GL0A 3VLVA 1B3LA 2VD3A 4EF1A 3SEVA 2XX8A 2XXTA 5CBSA 1EZ9A 1PB8A 1S7YA 2D21A 4QSCA 4FEBA 1QKAA 2PVUA 3M3LA 3QK6A 3T9XB 3TCHA 3FATA 2Y84A 2ZXTA 3K1MA 1Q1KA 2AIXA 4GQOA 3BKIB 3PPRA 4XKNA 1H43A 3E3KA 4F39A 3MVYA 2ANJA 1MY1A 1SI0A 5L9OA 4RPOA 5H8SA 2VP1A 5H8FA 4OYVA 4YKPA 3SEXA 1A40A 3TTLA 3GXAA 1A8EA 1PEBA 1P1NA 3R6UA 4X9TA 1NH7A 1PDAA 4QF9A 3N6UA 2REJA 4FIMA 2R71A 3CI8A 5AA1A 1YAEA 4G8NA 4YKIA 4OERA 1FQDA 1MXZA 3C32A 1VR5A 2Z8DA 3I5OA 4KQPA 1N7WA 3TQWA 3H7MA 4GD5A 4F29A 2F5XA 5J1DA 3TAJA 1MXYA 1SW2A 1B5IA 3KEIA 3VFJA 2GFEA 5I57B 4ZZEA 3O97A 2VOZA 2DP8A 1JVXA 2DVCA 1MPBA 4F3GA 1R6ZA 2GH9A 4KHZE 1KWHA 2WKYA 4X1BA 2E0SA 2V93A 1D4NA 2ESNA 4GXAA 4H1XA 1XVYA 2I4CA 2FA7A 2I6EA 1VE4A 2Z22A 3DP4A 3I6VA 4O3AA 5I2NB 3T66A 4UA8A 3IOWA 2HAUA 3CSBA 3VLUA 5FHMA 3KSJA 4LQ2A 3RNNA 2Q9TA 3PD8A 3TMGA 1D3KA 1BLFA 1LB8A 1VFEA 4JDFA 1GV8A 3S9EA 2QSXA 2XHDA 1B32A 1XOCA 4DXCA 1B0HA 4F2QA 5IKBA 1H3DA 1USYH 4POWA 4OFLA 5TP9B 1Y3NA 2NVUB 2F8DA 3H6UA 4PFTA 4AB5A 1JW1A 4RNSA 3B6WA 1P1WA 4PETA 2Y7KA 5I59A 1DPEA 5AA4A 2XD2A 3MQ9A 1I6QA 1MG1A 1XHYA 5I57A 4YMAA 4YB5A 5M2VA 1MDQA 4IGRA 3JZJA 5DEXB 4KR5A 3Q25A 4ZE9A 3IB2A 2ONRA 3ZKKA 3HSTA 1D9VA 3THIA 3IB1A 1ZLQA 4BLAA 3K6WA 3C9HA 3U94A 2F78A 2CMOA 2HCAA 1P1OA 3OENA 4ZECA 1ZTYA 4X48A 3OD7A 3MZBA 3U8QA 1Y9UA 4OWDA 4LONB 3SEUA 4OQOA 3HPIA 1TFDA 3OOAA 1OQHA 3JYRA 1EU8A 1ZMGA 4I9DA 2IA4A 1IXGA 3HHFA 2I49A 4F1YA 4C0RA 4G8MA 5TP9A 5FTHA 1B4HA 2ONKE 4LZ7A 1PC3A 2M8CA 3EHUA 3OO7A 3PUYE 3RUMA 1SYHA 2QS1A 3C4MA 5F1QA 2O1LA 1FTOA 1M5BA 2DWIA 3M8UA 1MY3A 1ZBMA 4NMYA 4KYDA 1PB9A 2A5TB 1UIVA 4ELPA 3HN0A 3FJMA 1OMPA 4POXA 3G3GA 5DEXA 1LCFA 2VGQA 3FXUA 4F1UA 4GFRA 2B3BA 3H03A 4GRKA 4YAHX 2O51A 1FQFA 3AXFA 4OENA 3VE1B 3D4CA 1Y1ZA 5KCJA 4ISUA 4ZZAA 1IXCA 1MM7A 3A3CA 4Q5TA 2P0SA 1IUDA 1SW1A 2I3VA 4C1TA 1B0LA 3RGYA 3K01A 1O64A 2V84A 5ITOA 4NF5B 3CG1A 3TTMA 4YKJA 2HZLA 4QRZA 3UK4A 2F97A 4P0IA 4OVJA 3C33A 5HBCA 5EHSA 1N3WA 1WODA 3MW0A 4G68B 4WEDA 4BDNA 2ZNSA 3A09A 3W9VA 1FQEA 4BDLA 4U4XA 4BDMA 3H3GA 4N13A 2DXYA 3G3FA 4K3FA 2YPNA 2AL4A 3C31A 4RK2A 3OO6A 4U2RA 3OEMA 3WAEA 3QUJA 4RYAA 5HPQA 3D4GA 4O3CA 2E1SA 1B51A 1AL3A 3HCQA 2A5TA 4P11A 3MUQA 1M5CA 2X7PA 1A99A 1NNFA 4NF4B 4Z0IA 5F7VA 1IZ1A 5AA2B 2PT2A 1B7UA 1JW4A 3EN3A 1B3GA 3TTNA 4R75A 3KBRA 4RPNA 4YMBA 3K4UA 4EXKA 2O7IA 2XD3A 5BUUA 1MRPA 2HXWA 3KOSA 2X7QA 4AQ4A 2DE4A 5I84A 3CR9A 1B5JA 2NWJA 1B05A 3S9NC 4RXLA 3TQLA 1FQCA 3LUYA 1LAFE 2F6GA 1LLSA 5ICTA 3TZAA 4NF8B 3Q27A 5ICQA 3K1PA 1MS7A 1WDNA 1LGBC 2H25A 1IEJA 3K1NA 4RA1A 1NNKA 1XT8A 4EUOA 1MPDA 2I48A 4FAJA 4XKQA 3W15C 3RQTA 4G68A 3DP6A 4QFKA 3LSXA 1ZIUA 2P1SA 1MXVA 4ZEBA 4I8CA 1SVXB 4DLDA 4OETA 3K6VA 4Q30B 1JW5A 1SYIA 4OTEA 5B70A 2I58A 3MZ1A 4G77A 4YICA 3O66A 4QFOA 4PFUA 4ZE8A 3HV1A 3ZS6A 2NOOA 1IIWA 4IO5A 3L6HA 4OMBA 1MXXA 4OXVA 4YU0A 4FATA 4ND9A 2PX1A 2F7CA 4TLMB 5ELVA 1B2HA 3TEPA 3PV0E 4QFLA 3PUXE 3RLFE 4F18A 4ZEIA 3ZSFA 4FEDA 3ODBA 4QFNA 4H0WA 2BJJX 3E9XA 1N0TA 1D9YA 2A5SA 2RC7A 2NUVA 4Z7EA 1A55A 3DELB 4F1VA 2QS3A 2B3FA 3O6IA 4NF8A 4IO4A 3PMWA 1URSA 1ELJA 3C36A 3FZVA 2ZMBA 2DS9A 2QMXA 2Z8FA 1B6HA 1EH3A 3MZ9A 4XXUA 1M5DA 3U92A 2OLBA 1L5TA 2B65A 1AOVA 2I3WA 4R6YA 3FVNA 3PUVE 5BWJA 3GBBA 3Q29A 3IK6B 3RN8A 2XX9A 2XXIA 3OO8A 4LATA 1RYXA 1A7LA 1JQFA 4ESXA 2D3IA 5KDTB 1YCJA 3KJ7A 1SQYA 4GOTA 2PMSA 3U93A 4HS7A 1Y1MA 4H8IA 2QS4A 4F2OA 3K6UA 4WKMA 3FVOA 3VVEA 1Y4CA 3MP8A 4R2FA 3TODA 3TPAA 4F31B 5JK4A 3LR1A 5AE4A 3RT6B 4M4GA 4FE8A 1N3XA 3QAXA 4BDOA 4YKKA 4IY6A 3E4RA 4KYSA 1BKAA 3KG2A 3KN3A 3V5AA 3PUWE 1IXIA 2OBGA 2REGA 4OHNA 3V89B 3CSGA 3OSQA 4IGTA 4BDRA 1MQGA 1QJMA 1TXFA 3N5LA 3IB0A 1MH4A 2QL3A 2Q8JA 1YPNA 4TLLB 1B46A 3BFTA 3IAZA 5L9SA 1F9BA 3SDFA 1B52A 4X1DA 3OELA 3MJNA 1R9QA 3S9LC 1TWYA 4HTGA 4PFWA 1I6BA 2LAOA 1JEUA 1AIVA 4I62A 5KDTA 1XC1A 2ONSA 4BDQA 2X26A 1QUIA 1LAXA 1CB6A 5EHMA 3Q28A 4EQ7A 4PFYA 1MQIA 1H45A 4EQ9A 5K2XA 3PD9A 3QIMA 5CRYA 4F22A 5IAIA 1I69A 2XXQA 1ANFA 4R9GA 1GVCA 3UIFA 5CMCA 3MVWA 3PMXA 3CFXA 3IJXB 2G29A 3PU5A 5I2NA 3RT8A 2OWTA 2O6AA 1H76A 4R6HA 1LFHA 1EZPA 2ZNTA 3PPNA 4NWDA 3U1OA 4H8JA 4KCCA 1IXHA 1MXUA 4H65A 2F6PA 4OEUA 1DSNA 4JSDA 4R73A 2D5WA 2XXXA 4ZS9A 5DYHA 4OEVA 4IO6A 3CRBA 2UVHA 4LQ5A 2NXOA 3BBRA 1SW4A 2V25A 4C1UA 1HSEA 3OXNA 1US4A 3UA8A 1LB9A 5TU0A 3TKDA 5DVFA 2ZNUA 3WAFA 5I56B 4FORA 4GF8A 1MH3A 3UORA 4ZDMA 4OFJA 1RKMA 4F3PA 5CMMA 2F36A 1JEVA 2DE2A 3T9UA 2VD2A 3IOVA 1DOTA 4KYEA 3L6GA 3TCGA 1POTA 2XX7A 1B5HA 4THIA 1LBBA 3EHSA 3QUFA 3FD3A 4RK9A 1SW5A 2PT1A 4EDPA 3MC2A 3PPOA 3PUZE 4TQUQ 2RCBA 3FGSA 3CVGA 3UP9A 4F19A 4NF6B 3LSLA 2RC8A 3VLWA 2UVGA 4JSOA 1H44A 4G4PA 2VHAA 3LSFB 3FIRA 1FW0A 4P0GA 2FYIA 1M5EA 3V8XB 2RF1A 1XS5A 1QUJA 3K00A 4KPTA 2Q89A 1P1QA 3RTFB 1Q35A 4U1OA 1QW0A 1NL5A 1II5A 4MH5A 1LAGE 4KFQA 3I3VA 5L8DA 2RCAA 4IO7A 3K6XA 2ABHA 2HAVA 1ZKBA 3PPQA 3SEWA 1S9TA 3T96B 2F7AA 3DP8A 1B7ZA 1NH8A 3ZKLA 4Q8RA 3K02A 3LC8A 1B3HA 2O84X 4RY1A 1FQBA 3FXRA 1QULA 1J1NA 3DLNA 3FJ7A 2F35A 3MBPA 3B7DA 2XXHA 1MPCA 3UN6A 2HQ0A 1CE2A 2OZZA 4NF6A 1BP5A 4LP2B 1BIYA 4YZZA 3TYHA 1ATGA 2R9JA 2O7UA 2UVJA 2DSFA 2H9BA 1B4ZA 3H4ZA 2XXRA 3MP6A 4NF5A 1DTZA 3FJGA 3SERA 2YJPA 4JWXA 4R72A 3KGCA 3LBSA 2V3TA 4PP0A 4F3SA 1NFTA 3IJOB 5H8FB 3TUSA 3A3UA 1SDXA 1OVBA 2I0CA 4OZ9A 1N7XA 4WXJA 4IB2A 1GGGA 1Y4TA 3ECRA 2QJEA 2UVIA 3EPEA 5CC2A 3T22A 3MPKA 3N94A 4KI0E 3KSXA 5CM6A 2HEUA 1MQDA 3IOTA 3R26A 3KZGA 3C35A 1MDP1 2F7BA 4R6KA 4NF4A 2KLFA 4MF3A 1YTVA 5K2YA 5AA2A 1USYE 3W9WA 4ECFA 1RYOA 2IEEA 4I1DA 1MM6A 3KJTA 2Z8EA 2Y7WA 2H5YA 2UYEA 1MQHA 1P99A 1OVTA 5CMKA 1UTBB 3PPPA 3CIJA 1AH5A 1FCKA 4GL8A 1US5A 3FXQA 2Y7PA 2H4IA 4N6PA 4N07A 1T0KA 3N6TA 5HM4B 5A5XB 5CMBA 1B40A 3FVKA 2Y7IA 3O9PA 3PGFA 3VDFA 3VV5A 3S2VA 1B3FA 2ZYMA 4JB7A 3U72A 3QXMA 2Q2CA 3FUZA 2P2AA 1PBQA 3SEYA 2ALUA 1IQ7A 4EQBA 5H8NB 3TELA 2RKMA 4PQJA 5I59B 4QSEA 1MXWA 3HO7A 1ZU0A 4DE8A 2THIA 4YB7A 4U23A 5AA4B 1NKXA 4EF2A 2PBWA 4MBPA 5JEIA 3FASA 1JVYA 3QSLA 1QVSA 1UTHB 3V83A 4NE4A 3SKPA 3EQ1A 2OWSA 3OMBA 2I4BA 5AA3A 3G3KA 5I58B 5L9MA 4WEPA 1UTBA 4HCWA 3G3IA 5H8HB 3VVDA 4GWOA 4IY5A 4U22A 4H5GA 4M1VA 4H6DA 1N76A 1Y3PA 1HSLA 3TTKA 1M5FA 1O7TA 2R6GE 3OSRA 4IO3A 1LBCA 2OK2A 1VFDA 2DWJA 4MFIA 1MY2A 4YB6A 5A5XA 2DQVA 3T9VA 4NTLA 5EYFA 3S9MC 5AA2D 3DM0A 3H6VA 3MPLA 3O29A 3R7XA 3H6TA 1AMFA 3M3FA 3IL1B 3IORA 1FTMA 2F34A 2DE3A 2XXUA 1URGA 2HZKA 4XTCQ 5H8NA 4ELQA 3GZGA 3JV9A 2Q2AA 4QSDA 2ZYKA 3M3KA 3FVGA 1MY0A 4G2ZA 4QFPA 2W7YA 2V3UA 4XKRA 3TFLA 1QUKA 4OFOA 1A54A 4LZ5A 4LA9A 3RPWA 1HSJA 1UTHA 3IO6A 3G3JA 3H6WA 4EXLA 4DIGA 1B9JA 4DCYA 4L17A 4JWYA 5I58A 2XXVA 4HCYA 4Q0CA 2GHAA 3MVZA 3VXBA 5H8HA 1LFGA 2OJTA 2PYYA 2CZLA 1LCTA 3QYTA 5CBRA 4FJPA 4NWCA 1MQJA 4G8HA 5KCJB 1DTGA 2OCUA 3F11A 2XXPA 1FTLA 2AL5A 1O63A 3IR1A 4UACA 2Z23A 2H98A 4R74A 3O6GA 1P1UA 1TT1A 5DTBA 5B7DA 2O68A 3N26A 1UQWA 4AB6A 3KN8A 3FV2A 4NEDA 3CFLA 1SI1A 3UGWA 1R1NA 4LUBA 2DXRA 2AYSA 1SBPA 5JTYB 3SETA 3RY3A 2ZYOA 3HHGA 2DVZA 2O69A 3USDA 3GBAA 4ZEFA 5I2KB 4RJZA 3MWBA 1I6AA 4R9FA 4IO2A 5DVIA 4U1ZA 1IITA 5ITPA 4ZEDA 4F3BA 3ONMA 4ONYA 4H5FA 5FHNA 2DYXA 1GTKA 1EZOA 3B6TA 2GHBA 3P7IA 4GLIA 4DXBA 3OEKA 3G7WA 5KZTA 1NNPA 4DCXA 2DWHA 4DZ1A 3CG3A 2UYFA 4FECA 1JNFA 1UIUA 3K0VA 1SD3A 3O28A 2RC9A 1OIBA 4U21A 2UXAA 5H8QB 4LZ8A 1OQGA 5CI5A 1WVJA 4O3BA 4JXIA 2RINA 3BFUA 3TDJA 1NMUA 4DDDA 4H67A 4GXSB 4XIGQ 3EF7A 4TOZA 1PB7A 3T93B 2HFBA 1R9LA 3IO4A 3MAMA 2GRVA 2Y7RA 5TPAB 3E13X 1FTKA 1LAHE 4U4SA 3H06B 5FTIA 5JTYA 1Y3QA 3FV1A 2V3QA 2O1MA 1B3EA 5I2KA 2ZYNA 1N04A 2XXYA 4ELOA 1POY1 5I56A 4E0XA 1LFIA 1A8FA 1BTJA 3IX1A 1VSOA 2I0BA 4OESA 1MY4A 4E0WA 3KFMA 3S4UA 3TCFA 3O2AA 3KN7A 5LOMA 3G3HA 1JETA 3MVXA 4GVOA 1PBPA 1Y20A 1FTJA 1B1HA 3Q26A 3VXCA 3ILTB 4MLVA 1OLCA 2QS2A 2DOJA 1NNTA 1QKBA 3TTRA 4ZEKA 1DPPA 4HW8A 5FHOA 4JWOA 1B1XA 4R2BA 2Q88A 2FNCA 3ILUB 4DXUA 4KCDA 5H8QA 1TFAA 4G68C 1B7HA 3KOTA 5DVJA 1B58A 3SESA 4GIZA 4KD5A 2QMWA 1Z7NE 3RTWB 2G93A 3MP1A 3OO9A 3T9HB 1S50A 2H99A 1Z7ME 5DT6A 3LSWA 1URDA 4MLQA 3VVFA 4JBZA 3CFZA 1OLAA 5TPAA 4QHQA 5ISUA 4PE5B 1LSTA 4ESWA 3K2DA 3B6QA 4XKPA 1GR2A 2YLNA
chains in the Genus database with same CATH superfamily
5IZ1A 4MHFA 1N84A 2XXWA 4PF6A 3O6HA 1DMBA 3EHTA 1XVXA 3C34A 1FQAA 2QRYA 3PMVA 1ZJLA 4ELRA 2DWAA 2QPQA 4O7IA 3GLBA 4FBPA 4LVQA 3IOUA 4GL0A 4GBWA 3VLVA 1B3LA 2VD3A 4EF1A 3SEVA 2XX8A 3BIHA 2XXTA 5CBSA 1EZ9A 1PB8A 1S7YA 2D21A 4PBHA 4QSCA 4FEBA 1QKAA 2PVUA 3M3LA 3QK6A 3T9XB 1YYZA 4AS5A 5IZZA 3TCHA 3FATA 1NUXA 2Y84A 2ZXTA 3K1MA 1Q1KA 2AIXA 4GQOA 4MNCA 3BKIB 3PPRA 4XKNA 1H43A 2WYKA 3E3KA 4F39A 3MVYA 1LBZA 1FJ9A 2ANJA 1MY1A 1SI0A 5L9OA 1FSAA 4RPOA 5H8SA 2XWKA 2VP1A 5H8FA 4OYVA 4YKPA 1FPFA 1SPIA 3SEXA 1A40A 3TTLA 3GXAA 1A8EA 1PEBA 1P1NA 3R6UA 4X9TA 1NH7A 4N91A 1PDAA 4QF9A 3N6UA 2REJA 4FIMA 4MNIA 2R71A 3CI8A 5AA1A 3KBZA 2CZIA 1YAEA 4G8NA 4YKIA 4OERA 1FQDA 4NAPA 1MXZA 3C32A 1VR5A 2Z8DA 3I5OA 4KQPA 1N7WA 3TQWA 1QGXA 3H7MA 4GD5A 4F29A 2F5XA 5J1DA 3TAJA 1MXYA 1SW2A 1B5IA 3KEIA 3VFJA 2WYPA 2GFEA 5I57B 4ZZEA 3O97A 3LV0A 2VOZA 2DP8A 1JVXA 2DVCA 1MPBA 1NV4A 4F3GA 1R6ZA 2GH9A 4P47A 4KHZE 1KWHA 2WKYA 4X1BA 2E0SA 1FPLA 2V93A 3CHGA 1D4NA 2ESNA 4GXAA 4H1XA 1XVYA 3ISPA 2I4CA 2FA7A 2I6EA 1VE4A 2Z22A 3DP4A 3I6VA 4O3AA 2KQZA 5I2NB 2FHYA 3T66A 4UA8A 3IOWA 2HAUA 3CSBA 3VLUA 5FHMA 3KSJA 4LQ2A 3RNNA 2Q9TA 3PD8A 3TMGA 1D3KA 1BLFA 1LB8A 1VFEA 2F3BA 4HE1A 4JDFA 1GV8A 3S9EA 2QSXA 2P3VA 2XHDA 4GBVA 1B32A 1XOCA 1LBYA 4DXCA 1B0HA 4F2QA 5IKBA 1H3DA 4N8YA 1USYH 4POWA 4OFLA 5TP9B 1Y3NA 4MAGA 2NVUB 2F8DA 3H6UA 4PFTA 4AB5A 1JW1A 4RNSA 1RDYA 3B6WA 1P1WA 3EKIA 4PETA 2Y7KA 5I59A 1DPEA 5AA4A 2XD2A 4OVQA 3MQ9A 1I6QA 1MG1A 1XHYA 5I57A 4N17A 4YMAA 5I7IA 4YB5A 1KZ8A 5M2VA 1EYIA 1MDQA 4IGRA 3JZJA 5DEXB 4KR5A 3Q25A 4ZE9A 3IB2A 2ONRA 2OWZA 3ZKKA 2CEXA 3HSTA 1D9VA 3THIA 3IB1A 1ZLQA 4BLAA 3K6WA 3C9HA 5ET6A 3U94A 4H45A 2F78A 2CMOA 2HCAA 1P1OA 3OENA 4ZECA 1ZTYA 4X48A 2HXRA 3OD7A 3MZBA 3U8QA 1Y9UA 4OWDA 4N6KA 4LONB 3SEUA 4OQOA 3HPIA 1TFDA 3OOAA 4DI3D 1OQHA 1FTAA 3JYRA 1EU8A 1ZMGA 4I9DA 2IA4A 1IXGA 3HHFA 2I49A 1IMBA 4F1YA 4C0RA 4NF0A 3MSTA 4G8MA 1IMDA 4I40A 5TP9A 5FTHA 1B4HA 2ONKE 4LZ7A 1PC3A 2M8CA 3EHUA 3RYDA 3OO7A 3PUYE 3RUMA 1SYHA 2QS1A 3C4MA 5F1QA 2O1LA 1FTOA 1M5BA 2DWIA 3M8UA 1MY3A 1ZBMA 3E79A 4NMYA 4KYDA 1PB9A 2A5TB 1UIVA 4ELPA 3HN0A 3FJMA 1OMPA 2PFYA 4POXA 3G3GA 5DEXA 1LCFA 2VGQA 3FXUA 4F1UA 4PDHA 4GFRA 4JVIA 2B3BA 3H03A 4GRKA 4YAHX 2O51A 1FQFA 3AXFA 4DI4B 4OENA 2XWIA 3VE1B 4PGPA 3D4CA 1Y1ZA 1VDWA 5KCJA 4ISUA 4ZZAA 1D9QA 1IXCA 1MM7A 3A3CA 4Q5TA 2P0SA 1IUDA 1SW1A 2I3VA 2ZZVA 4C1TA 1B0LA 4MCOA 4NN3A 3RGYA 3K01A 1O64A 2V84A 5ITOA 4NF5B 3CG1A 3TTMA 4YKJA 2HZLA 4QRZA 3UK4A 2F97A 4P0IA 4OVJA 3C33A 5HBCA 5IM2A 4PFRA 5EHSA 1N3WA 4AS4A 1WODA 3MW0A 4G68B 4WEDA 2Y5LA 4BDNA 2ZNSA 3A09A 3W9VA 5LDZA 1IMCA 1FQEA 4BDLA 4U4XA 4BDMA 4O8MA 3H3GA 4N13A 2DXYA 3G3FA 4K3FA 2YPNA 2AL4A 3C31A 1NUZA 4RK2A 2XWOA 2FBPA 3OO6A 4O7MA 4U2RA 3OEMA 3WAEA 3QUJA 4RYAA 5HPQA 4IR8A 5IGAA 3D4GA 4O3CA 2E1SA 3HFUA 1B51A 1AL3A 3HCQA 2A5TA 4P11A 3MUQA 1M5CA 2X7PA 1A99A 1DCUA 1NNFA 4NF4B 4XEQA 5F7VA 4Z0IA 1IZ1A 5AA2B 2PT2A 1B7UA 1JW4A 3EN3A 3SZPA 1B3GA 5F24A 3TTNA 4R75A 3BIGA 3KBRA 4RPNA 4YMBA 3K4UA 4EXKA 2O7IA 4LN5A 2XD3A 4P9KA 4QXDA 1MRPA 2HXWA 3KOSA 5BUUA 2X7QA 1LEVA 4AQ4A 2DE4A 1K9ZA 5I84A 3CR9A 5ESYA 1B5JA 2NWJA 1B05A 3S9NC 4RXLA 3TQLA 1FQCA 2P3NA 2VPOA 3LUYA 1LAFE 4PAKA 2F6GA 1LLSA 5ICTA 3TZAA 4NF8B 3Q27A 5ICQA 3K1PA 1MS7A 1WDNA 1LGBC 2H25A 1IEJA 3K1NA 4RA1A 1NNKA 1XT8A 2VT5A 4EUOA 1MPDA 2I48A 4FAJA 2B4LA 4XKQA 3W15C 3NOHA 3RQTA 4G68A 3DP6A 4QFKA 3LSXA 1ZIUA 2P1SA 1MXVA 4ZEBA 4I8CA 1SVXB 4DLDA 4OETA 3K6VA 4Q30B 1JW5A 5EQ7A 4H46A 1SYIA 4OTEA 5B70A 2I58A 3MZ1A 4G77A 4YICA 1RDZA 3O66A 4QFOA 4PFUA 4GWUA 4ZE8A 3HV1A 3ZS6A 2NOOA 1IIWA 4IO5A 3L6HA 1BK4A 4OMBA 1MXXA 4OXVA 4YU0A 4FATA 4ND9A 2PX1A 2F7CA 4TLMB 5ELVA 1B2HA 3TEPA 3PV0E 5EYGA 4QFLA 3PUXE 5A5LA 3RLFE 4F18A 4ZEIA 1JP4A 3ZSFA 3IFCA 4FEDA 3ODBA 4QFNA 4H0WA 2BJJX 3E9XA 1N0TA 1D9YA 2A5SA 2RC7A 2NUVA 4Z7EA 1A55A 4OVTA 3DELB 4F1VA 2QS3A 2B3FA 3O6IA 4NF8A 4IO4A 4OVPA 1NUWA 3PMWA 4N81A 4MJOA 1URSA 4NG7A 1ELJA 3C36A 1IMAA 3FZVA 2ZMBA 2DS9A 2QMXA 2Z8FA 1B6HA 1EH3A 4GWWA 3MZ9A 4XXUA 1M5DA 3U92A 2OLBA 1L5TA 2B65A 2XXKA 1AOVA 2I3WA 4R6YA 3FVNA 4X8RA 3PUVE 5BWJA 3GBBA 3Q29A 3IK6B 3RN8A 2XX9A 2XXIA 3OO8A 4LATA 1RYXA 1A7LA 1JQFA 2Q8MA 4ESXA 2D3IA 5KDTB 1YCJA 3KJ7A 1LBXA 1SQYA 4GOTA 2PMSA 3U93A 4GX6A 2MKZA 4HS7A 1Y1MA 4H8IA 4PFIA 2QS4A 4F2OA 3K6UA 4WKMA 1Q9DA 3FVOA 3VVEA 1Y4CA 3MP8A 4R2FA 3TODA 3TPAA 4F31B 5JK4A 3LR1A 4P8BA 5AE4A 3RT6B 4M4GA 1FRPA 2CZHA 4FE8A 1N3XA 1FBHA 3QAXA 4BDOA 4YKKA 4N6DA 4IY6A 4PAIA 3E4RA 4HXVA 4KYSA 1BKAA 3MYUA 3KG2A 3KN3A 3V5AA 3PUWE 1IXIA 2OBGA 2REGA 4X04A 4OHNA 1EYKA 3V89B 2R8TA 3CSGA 3OSQA 4IGTA 4BDRA 1MQGA 1QJMA 1TXFA 4GX3A 3N5LA 3IB0A 1NV5A 1MH4A 2QL3A 3B8BA 2Q8JA 1YPNA 4TLLB 1B46A 3BFTA 2ZZWA 3IAZA 5L9SA 1F9BA 2ZZXA 3LUZA 3SDFA 1B52A 4X1DA 3OELA 3MJNA 1R9QA 3S9LC 1FBDA 1TWYA 4HTGA 4PFWA 1I6BA 2LAOA 1JEUA 4MIJA 1AIVA 4I62A 5KDTA 1FBGA 1XC1A 2ONSA 1FBPA 4BDQA 2X26A 1QUIA 1LAXA 1CB6A 5EHMA 3Q28A 4EQ7A 4PFYA 1MQIA 1H45A 4EQ9A 5K2XA 3PD9A 3QIMA 5CRYA 4F22A 5IAIA 1I69A 1FPJA 2XXQA 2WBBA 1ANFA 4R9GA 1GVCA 3UIFA 5CMCA 3MVWA 3PMXA 3CFXA 4PBQA 3IJXB 2G29A 3PU5A 5I2NA 3RT8A 2OWTA 2L5VA 2O6AA 1H76A 4R6HA 1LFHA 1EZPA 2ZNTA 3PPNA 4NWDA 1NV3A 1FPKA 3U1OA 4H8JA 4KCCA 1IXHA 2XWVA 1MXUA 1G0HA 4H65A 2DDKA 2F6PA 4OEUA 1DSNA 1KA1A 4JSDA 4R73A 2D5WA 1YZ0A 2XXXA 4ZS9A 5DYHA 4OEVA 4IO6A 3CRBA 2UVHA 4LQ5A 5ET7A 2NXOA 3BBRA 1SW4A 2V25A 4C1UA 1HSEA 3OXNA 1US4A 3UA8A 1LB9A 5TU0A 3TKDA 5DVFA 2ZNUA 3WAFA 2QVUA 5DW8A 3KC0A 5I56B 1NV2A 1FPEA 3RPLB 4FORA 4GF8A 1MH3A 3UORA 4ZDMA 4OFJA 1RKMA 4F3PA 5CMMA 2F36A 1JEVA 2DE2A 3T9UA 2VD2A 3IOVA 1DOTA 3FBPA 4KYEA 3L6GA 3TCGA 1POTA 2XX7A 1B5HA 4THIA 1LBBA 3EHSA 3QUFA 4HE0A 3FD3A 4RK9A 3GYYA 1SW5A 2PT1A 4EDPA 3MC2A 3PPOA 3PUZE 4TQUQ 1CNQA 2RCBA 3FGSA 3CVGA 4MX6A 3UP9A 4F19A 4NF6B 3LSLA 2RC8A 3VLWA 1FBCA 2UVGA 4JSOA 1H44A 4G4PA 2QVVA 2VHAA 3LSFB 3FIRA 3T1BA 1FW0A 4P0GA 2FYIA 1M5EA 3V8XB 4N15A 1INPA 2RF1A 1XS5A 4P1EA 1QUJA 3K00A 4KPTA 2Q89A 1K9YA 1P1QA 3RTFB 1Q35A 4U1OA 1QW0A 1NL5A 1II5A 4MH5A 2VPNA 1LAGE 4KFQA 3I3VA 5L8DA 2RCAA 4IO7A 3K6XA 4NQ8A 2ABHA 4MNPA 2HAVA 1ZKBA 3PPQA 3SEWA 1S9TA 3T96B 2F7AA 3DP8A 1B7ZA 5EQAA 3T0JA 2F3DA 1IMEA 1NH8A 3ZKLA 4Q8RA 3K02A 3LC8A 1B3HA 2O84X 2OX3A 4RY1A 1FQBA 3FXRA 4GWXA 1QULA 1J1NA 3DLNA 1YXIA 3FJ7A 4MEVA 2F35A 1NV1A 3PTYA 3D1RA 3MBPA 3B7DA 2XXHA 1MPCA 3UN6A 2HQ0A 1CE2A 2OZZA 4NF6A 1BP5A 4LP2B 1BIYA 4YZZA 3TYHA 1ATGA 4OVRA 2R9JA 2O7UA 2UVJA 2DSFA 2H9BA 1B4ZA 3H4ZA 1AWBA 2XXRA 3MP6A 4NF5A 1DTZA 4PGNA 3FJGA 3SERA 2YJPA 4JWXA 4R72A 3KGCA 3LBSA 2V3TA 4PP0A 4F3SA 1NFTA 3IJOB 5H8FB 3TUSA 3A3UA 1SDXA 1OVBA 2I0CA 4OZ9A 1N7XA 4WXJA 5FBPA 4IB2A 1GGGA 1Y4TA 3ECRA 2QJEA 2UVIA 3EPEA 1FBEA 5CC2A 3T22A 3MPKA 3N94A 4KI0E 3KSXA 5ET8A 5CM6A 2HEUA 2V4CA 1MQDA 3IOTA 3R26A 4PE3A 1FBFA 2PFZA 4OVSA 3KZGA 2JJKA 3C35A 1MDP1 4GWZA 5IZ3B 2F7BA 2WX9A 4R6KA 2HHMA 4NF4A 3QMFA 2KLFA 4MF3A 1YTVA 5K2YA 5AA2A 1USYE 3W9WA 2Q74A 4ECFA 1RYOA 2IEEA 4I1DA 1MM6A 3KJTA 4KXPA 2Z8EA 2Y7WA 2BJIA 2H5YA 2UYEA 1MQHA 1P99A 1OVTA 5CMKA 1UTBB 3PPPA 1NI9A 4XFEA 1LBWA 3CIJA 1AH5A 1FCKA 4XF5A 4GL8A 1US5A 3FXQA 2Y7PA 2H4IA 4N6PA 4N07A 1T0KA 3N6TA 4P3LA 5HM4B 5A5XB 5CMBA 1B40A 3FVKA 2Y7IA 3O9PA 3E78A 2CZKA 3PGFA 3VDFA 3VV5A 2QVRA 3S2VA 1B3FA 2ZYMA 4JB7A 3U72A 3QXMA 2Q2CA 1NV0A 3FUZA 2XA5A 2P2AA 1PBQA 3SEYA 2KR0A 1DBZA 2ALUA 1IQ7A 4EQBA 5H8NB 3TELA 2RKMA 4PDDA 4PQJA 5I59B 4QSEA 4OANA 1MXWA 5IZ3A 3HO7A 1ZU0A 4DE8A 2THIA 4YB7A 4NHBA 4U23A 5AA4B 1NKXA 4EF2A 2PBWA 4MBPA 5JEIA 3FASA 1JVYA 3QSLA 1QVSA 1UTHB 1EYJA 4P56A 3V83A 4NE4A 4PF8A 3SKPA 1RDXA 2OWSA 3EQ1A 4GX4A 5LTCA 3OMBA 2I4BA 5AA3A 3G3KA 5I58B 5L9MA 4I3EA 4WEPA 1UTBA 4HCWA 1NV6A 3G3IA 5H8HB 3VVDA 4GWOA 4IY5A 4U22A 4H5GA 4M1VA 4H6DA 1N76A 1Y3PA 1HSLA 3TTKA 1M5FA 4PC9A 1O7TA 2R6GE 3OSRA 4IO3A 2FVZA 1LBCA 2OK2A 1VFDA 2DWJA 4MFIA 4JVDA 1MY2A 4YB6A 5A5XA 2DQVA 3T9VA 4NTLA 5EYFA 3S9MC 5AA2D 2B4MA 4NGUA 3DM0A 3H6VA 3A29A 3MPLA 3O29A 3R7XA 3H6TA 1AMFA 3M3FA 3IL1B 1FPGA 3IORA 1FTMA 5I3SA 2F34A 2DE3A 2XXUA 1URGA 2HZKA 4XTCQ 5H8NA 4ELQA 4P1LA 3GZGA 3JV9A 2Q2AA 4QSDA 2ZYKA 5EYHA 2Y5KA 1NV7A 2GQ1A 3M3KA 3FVGA 1MY0A 4G2ZA 4QFPA 2W7YA 2V3UA 4XKRA 3TFLA 1QUKA 4OFOA 1A54A 4LZ5A 4LA9A 3RPWA 1HSJA 1UTHA 3IO6A 3G3JA 3H6WA 4EXLA 4DIGA 1B9JA 4DCYA 1G0IA 4JVCA 4L17A 4JWYA 5I58A 2XXVA 4HCYA 4Q0CA 2GHAA 3MVZA 4N4UA 3VXBA 5H8HA 1LFGA 2OJTA 2PYYA 2CZLA 1LCTA 3QYTA 4PCDA 5CBRA 4FJPA 4NWCA 1MQJA 1IMFA 1DK4A 4G8HA 5KCJB 3ROJA 1DTGA 2OCUA 1FPDA 3F11A 1NUYA 2XXPA 1FTLA 2AL5A 1O63A 3IR1A 4UACA 2Z23A 2H98A 4R74A 3O6GA 1XI6A 1P1UA 4PTKA 1TT1A 5DTBA 5B7DA 2O68A 3N26A 1UQWA 4AB6A 3KN8A 3FV2A 4NEDA 3CFLA 1SI1A 3UGWA 1R1NA 4LUBA 2DXRA 1FPIA 2AYSA 1SBPA 5JTYB 3SETA 3RY3A 2HPGA 2ZYOA 3HHGA 2DVZA 2O69A 3USDA 3GBAA 4ZEFA 4O94A 5I2KB 4RJZA 3MWBA 1I6AA 4R9FA 4IO2A 5DVIA 2FIEA 4U1ZA 1IITA 3KC1A 5ITPA 4ZEDA 4F3BA 4GWYA 3ONMA 4ONYA 4QBAA 4H5FA 5FHNA 4MMPA 2DYXA 1GTKA 1EZOA 3B6TA 2GHBA 3P7IA 4GLIA 4DXBA 3OEKA 3G7WA 5I5PA 5KZTA 1NNPA 4DCXA 2WEFA 1FPBA 4G61A 2DWHA 4DZ1A 4UABA 3CG3A 2UYFA 4FECA 1JNFA 1UIUA 3K0VA 1SD3A 3O28A 2RC9A 1OIBA 4U21A 2UXAA 4PFBA 5H8QB 4LZ8A 1OQGA 5CI5A 1WVJA 4O3BA 4JXIA 2RINA 3BFUA 3TDJA 1NMUA 4DDDA 4H67A 4GXSB 4XIGQ 3EF7A 4TOZA 5ET5A 1PB7A 3T93B 4NX1A 2HFBA 1R9LA 3IO4A 3MAMA 2GRVA 2Y7RA 5TPAB 3E13X 1FTKA 1LAHE 4U4SA 3H06B 5FTIA 4N8GA 2QFLA 4HE2A 5JTYA 1Y3QA 3FV1A 2V3QA 2O1MA 1B3EA 4GWSA 5I2KA 2ZYNA 1N04A 2XXYA 4ELOA 1POY1 5I56A 3U65A 4E0XA 1LFIA 1FJ6A 1A8FA 3RPLA 1BTJA 3IX1A 1VSOA 2I0BA 4OESA 1MY4A 4E0WA 3KFMA 3S4UA 5J16A 3TCFA 3O2AA 3KN7A 5LOMA 2CEYA 5EQ9A 4I3YA 3G3HA 1JETA 3MVXA 4OA4A 4GVOA 1PBPA 1Y20A 1FTJA 1B1HA 3Q26A 3VXCA 3ILTB 4MLVA 1OLCA 2QS2A 2DOJA 1NNTA 1QKBA 5T3JA 3TTRA 4ZEKA 1DPPA 4HW8A 5FHOA 4JWOA 1B1XA 4R2BA 2Q88A 2FNCA 3ILUB 4KCDA 5EQ8A 4DXUA 2PCRA 5H8QA 1TFAA 4G68C 1B7HA 3KOTA 5DVJA 1B58A 3SESA 4GIZA 4KD5A 2QMWA 2FIXA 1Z7NE 1KA0A 3RTWB 2G93A 3MP1A 3OO9A 3T9HB 1S50A 2H99A 1Z7ME 5DT6A 3LSWA 1URDA 4MLQA 3VVFA 4JBZA 3CFZA 1OLAA 1LBVA 5TPAA 3B50A 4QHQA 5ISUA 4PE5B 2WBDA 1LSTA 4ESWA 3K2DA 3B6QA 3FXBA 3IFAA 4XKPA 1GR2A 2YLNA 4PAFA
chains in the Genus database with same CATH topology
1N84A 2XXWA 3O6HA 1DMBA 3EHTA 1XVXA 3C34A 1FQAA 2QRYA 3PMVA 1ZJLA 4ELRA 2DWAA 2QPQA 3GLBA 4LVQA 3IOUA 4GL0A 3VLVA 1B3LA 2VD3A 4EF1A 3SEVA 2XX8A 2XXTA 5CBSA 1EZ9A 1PB8A 1S7YA 2D21A 4QSCA 4FEBA 1QKAA 2PVUA 3M3LA 3QK6A 3T9XB 3TCHA 3FATA 2Y84A 2ZXTA 3K1MA 1Q1KA 2AIXA 4GQOA 3BKIB 3PPRA 4XKNA 1H43A 3E3KA 4F39A 3MVYA 2ANJA 1MY1A 1SI0A 5L9OA 4RPOA 5H8SA 2VP1A 5H8FA 4OYVA 4YKPA 3SEXA 1A40A 3TTLA 3GXAA 1A8EA 1PEBA 1P1NA 3R6UA 4X9TA 1NH7A 1PDAA 4QF9A 3N6UA 2REJA 4FIMA 2R71A 3CI8A 5AA1A 1YAEA 4G8NA 4YKIA 4OERA 1FQDA 1MXZA 3C32A 1VR5A 2Z8DA 3I5OA 4KQPA 1N7WA 3TQWA 3H7MA 4GD5A 4F29A 2F5XA 5J1DA 3TAJA 1MXYA 1SW2A 1B5IA 3KEIA 3VFJA 2GFEA 5I57B 4ZZEA 3O97A 2VOZA 2DP8A 1JVXA 2DVCA 1MPBA 4F3GA 1R6ZA 2GH9A 4KHZE 1KWHA 2WKYA 4X1BA 2E0SA 2V93A 1D4NA 2ESNA 4GXAA 4H1XA 1XVYA 2I4CA 2FA7A 2I6EA 1VE4A 2Z22A 3DP4A 3I6VA 4O3AA 5I2NB 3T66A 4UA8A 3IOWA 2HAUA 3CSBA 3VLUA 5FHMA 3KSJA 4LQ2A 3RNNA 2Q9TA 3PD8A 3TMGA 1D3KA 1BLFA 1LB8A 1VFEA 4JDFA 1GV8A 3S9EA 2QSXA 2XHDA 1B32A 1XOCA 4DXCA 1B0HA 4F2QA 5IKBA 1H3DA 1USYH 4POWA 4OFLA 5TP9B 1Y3NA 2NVUB 2F8DA 3H6UA 4PFTA 4AB5A 1JW1A 4RNSA 3B6WA 1P1WA 4PETA 2Y7KA 5I59A 1DPEA 5AA4A 2XD2A 3MQ9A 1I6QA 1MG1A 1XHYA 5I57A 4YMAA 4YB5A 5M2VA 1MDQA 4IGRA 3JZJA 5DEXB 4KR5A 3Q25A 4ZE9A 3IB2A 2ONRA 3ZKKA 3HSTA 1D9VA 3THIA 3IB1A 1ZLQA 4BLAA 3K6WA 3C9HA 3U94A 2F78A 2CMOA 2HCAA 1P1OA 3OENA 4ZECA 1ZTYA 4X48A 3OD7A 3MZBA 3U8QA 1Y9UA 4OWDA 4LONB 3SEUA 4OQOA 3HPIA 1TFDA 3OOAA 1OQHA 3JYRA 1EU8A 1ZMGA 4I9DA 2IA4A 1IXGA 3HHFA 2I49A 4F1YA 4C0RA 4G8MA 5TP9A 5FTHA 1B4HA 2ONKE 4LZ7A 1PC3A 2M8CA 3EHUA 3OO7A 3PUYE 3RUMA 1SYHA 2QS1A 3C4MA 5F1QA 2O1LA 1FTOA 1M5BA 2DWIA 3M8UA 1MY3A 1ZBMA 4NMYA 4KYDA 1PB9A 2A5TB 1UIVA 4ELPA 3HN0A 3FJMA 1OMPA 4POXA 3G3GA 5DEXA 1LCFA 2VGQA 3FXUA 4F1UA 4GFRA 2B3BA 3H03A 4GRKA 4YAHX 2O51A 1FQFA 3AXFA 4OENA 3VE1B 3D4CA 1Y1ZA 5KCJA 4ISUA 4ZZAA 1IXCA 1MM7A 3A3CA 4Q5TA 2P0SA 1IUDA 1SW1A 2I3VA 4C1TA 1B0LA 3RGYA 3K01A 1O64A 2V84A 5ITOA 4NF5B 3CG1A 3TTMA 4YKJA 2HZLA 4QRZA 3UK4A 2F97A 4P0IA 4OVJA 3C33A 5HBCA 5EHSA 1N3WA 1WODA 3MW0A 4G68B 4WEDA 4BDNA 2ZNSA 3A09A 3W9VA 1FQEA 4BDLA 4U4XA 4BDMA 3H3GA 4N13A 2DXYA 3G3FA 4K3FA 2YPNA 2AL4A 3C31A 4RK2A 3OO6A 4U2RA 3OEMA 3WAEA 3QUJA 4RYAA 5HPQA 3D4GA 4O3CA 2E1SA 1B51A 1AL3A 3HCQA 2A5TA 4P11A 3MUQA 1M5CA 2X7PA 1A99A 1NNFA 4NF4B 4Z0IA 5F7VA 1IZ1A 5AA2B 2PT2A 1B7UA 1JW4A 3EN3A 1B3GA 3TTNA 4R75A 3KBRA 4RPNA 4YMBA 3K4UA 4EXKA 2O7IA 2XD3A 5BUUA 1MRPA 2HXWA 3KOSA 2X7QA 4AQ4A 2DE4A 5I84A 3CR9A 1B5JA 2NWJA 1B05A 3S9NC 4RXLA 3TQLA 1FQCA 3LUYA 1LAFE 2F6GA 1LLSA 5ICTA 3TZAA 4NF8B 3Q27A 5ICQA 3K1PA 1MS7A 1WDNA 1LGBC 2H25A 1IEJA 3K1NA 4RA1A 1NNKA 1XT8A 4EUOA 1MPDA 2I48A 4FAJA 4XKQA 3W15C 3RQTA 4G68A 3DP6A 4QFKA 3LSXA 1ZIUA 2P1SA 1MXVA 4ZEBA 4I8CA 1SVXB 4DLDA 4OETA 3K6VA 4Q30B 1JW5A 1SYIA 4OTEA 5B70A 2I58A 3MZ1A 4G77A 4YICA 3O66A 4QFOA 4PFUA 4ZE8A 3HV1A 3ZS6A 2NOOA 1IIWA 4IO5A 3L6HA 4OMBA 1MXXA 4OXVA 4YU0A 4FATA 4ND9A 2PX1A 2F7CA 4TLMB 5ELVA 1B2HA 3TEPA 3PV0E 4QFLA 3PUXE 3RLFE 4F18A 4ZEIA 3ZSFA 4FEDA 3ODBA 4QFNA 4H0WA 2BJJX 3E9XA 1N0TA 1D9YA 2A5SA 2RC7A 2NUVA 4Z7EA 1A55A 3DELB 4F1VA 2QS3A 2B3FA 3O6IA 4NF8A 4IO4A 3PMWA 1URSA 1ELJA 3C36A 3FZVA 2ZMBA 2DS9A 2QMXA 2Z8FA 1B6HA 1EH3A 3MZ9A 4XXUA 1M5DA 3U92A 2OLBA 1L5TA 2B65A 1AOVA 2I3WA 4R6YA 3FVNA 3PUVE 5BWJA 3GBBA 3Q29A 3IK6B 3RN8A 2XX9A 2XXIA 3OO8A 4LATA 1RYXA 1A7LA 1JQFA 4ESXA 2D3IA 5KDTB 1YCJA 3KJ7A 1SQYA 4GOTA 2PMSA 3U93A 4HS7A 1Y1MA 4H8IA 2QS4A 4F2OA 3K6UA 4WKMA 3FVOA 3VVEA 1Y4CA 3MP8A 4R2FA 3TODA 3TPAA 4F31B 5JK4A 3LR1A 5AE4A 3RT6B 4M4GA 4FE8A 1N3XA 3QAXA 4BDOA 4YKKA 4IY6A 3E4RA 4KYSA 1BKAA 3KG2A 3KN3A 3V5AA 3PUWE 1IXIA 2OBGA 2REGA 4OHNA 3V89B 3CSGA 3OSQA 4IGTA 4BDRA 1MQGA 1QJMA 1TXFA 3N5LA 3IB0A 1MH4A 2QL3A 2Q8JA 1YPNA 4TLLB 1B46A 3BFTA 3IAZA 5L9SA 1F9BA 3SDFA 1B52A 4X1DA 3OELA 3MJNA 1R9QA 3S9LC 1TWYA 4HTGA 4PFWA 1I6BA 2LAOA 1JEUA 1AIVA 4I62A 5KDTA 1XC1A 2ONSA 4BDQA 2X26A 1QUIA 1LAXA 1CB6A 5EHMA 3Q28A 4EQ7A 4PFYA 1MQIA 1H45A 4EQ9A 5K2XA 3PD9A 3QIMA 5CRYA 4F22A 5IAIA 1I69A 2XXQA 1ANFA 4R9GA 1GVCA 3UIFA 5CMCA 3MVWA 3PMXA 3CFXA 3IJXB 2G29A 3PU5A 5I2NA 3RT8A 2OWTA 2O6AA 1H76A 4R6HA 1LFHA 1EZPA 2ZNTA 3PPNA 4NWDA 3U1OA 4H8JA 4KCCA 1IXHA 1MXUA 4H65A 2F6PA 4OEUA 1DSNA 4JSDA 4R73A 2D5WA 2XXXA 4ZS9A 5DYHA 4OEVA 4IO6A 3CRBA 2UVHA 4LQ5A 2NXOA 3BBRA 1SW4A 2V25A 4C1UA 1HSEA 3OXNA 1US4A 3UA8A 1LB9A 5TU0A 3TKDA 5DVFA 2ZNUA 3WAFA 5I56B 4FORA 4GF8A 1MH3A 3UORA 4ZDMA 4OFJA 1RKMA 4F3PA 5CMMA 2F36A 1JEVA 2DE2A 3T9UA 2VD2A 3IOVA 1DOTA 4KYEA 3L6GA 3TCGA 1POTA 2XX7A 1B5HA 4THIA 1LBBA 3EHSA 3QUFA 3FD3A 4RK9A 1SW5A 2PT1A 4EDPA 3MC2A 3PPOA 3PUZE 4TQUQ 2RCBA 3FGSA 3CVGA 3UP9A 4F19A 4NF6B 3LSLA 2RC8A 3VLWA 2UVGA 4JSOA 1H44A 4G4PA 2VHAA 3LSFB 3FIRA 1FW0A 4P0GA 2FYIA 1M5EA 3V8XB 2RF1A 1XS5A 1QUJA 3K00A 4KPTA 2Q89A 1P1QA 3RTFB 1Q35A 4U1OA 1QW0A 1NL5A 1II5A 4MH5A 1LAGE 4KFQA 3I3VA 5L8DA 2RCAA 4IO7A 3K6XA 2ABHA 2HAVA 1ZKBA 3PPQA 3SEWA 1S9TA 3T96B 2F7AA 3DP8A 1B7ZA 1NH8A 3ZKLA 4Q8RA 3K02A 3LC8A 1B3HA 2O84X 4RY1A 1FQBA 3FXRA 1QULA 1J1NA 3DLNA 3FJ7A 2F35A 3MBPA 3B7DA 2XXHA 1MPCA 3UN6A 2HQ0A 1CE2A 2OZZA 4NF6A 1BP5A 4LP2B 1BIYA 4YZZA 3TYHA 1ATGA 2R9JA 2O7UA 2UVJA 2DSFA 2H9BA 1B4ZA 3H4ZA 2XXRA 3MP6A 4NF5A 1DTZA 3FJGA 3SERA 2YJPA 4JWXA 4R72A 3KGCA 3LBSA 2V3TA 4PP0A 4F3SA 1NFTA 3IJOB 5H8FB 3TUSA 3A3UA 1SDXA 1OVBA 2I0CA 4OZ9A 1N7XA 4WXJA 4IB2A 1GGGA 1Y4TA 3ECRA 2QJEA 2UVIA 3EPEA 5CC2A 3T22A 3MPKA 3N94A 4KI0E 3KSXA 5CM6A 2HEUA 1MQDA 3IOTA 3R26A 3KZGA 3C35A 1MDP1 2F7BA 4R6KA 4NF4A 2KLFA 4MF3A 1YTVA 5K2YA 5AA2A 1USYE 3W9WA 4ECFA 1RYOA 2IEEA 4I1DA 1MM6A 3KJTA 2Z8EA 2Y7WA 2H5YA 2UYEA 1MQHA 1P99A 1OVTA 5CMKA 1UTBB 3PPPA 3CIJA 1AH5A 1FCKA 4GL8A 1US5A 3FXQA 2Y7PA 2H4IA 4N6PA 4N07A 1T0KA 3N6TA 5HM4B 5A5XB 5CMBA 1B40A 3FVKA 2Y7IA 3O9PA 3PGFA 3VDFA 3VV5A 3S2VA 1B3FA 2ZYMA 4JB7A 3U72A 3QXMA 2Q2CA 3FUZA 2P2AA 1PBQA 3SEYA 2ALUA 1IQ7A 4EQBA 5H8NB 3TELA 2RKMA 4PQJA 5I59B 4QSEA 1MXWA 3HO7A 1ZU0A 4DE8A 2THIA 4YB7A 4U23A 5AA4B 1NKXA 4EF2A 2PBWA 4MBPA 5JEIA 3FASA 1JVYA 3QSLA 1QVSA 1UTHB 3V83A 4NE4A 3SKPA 3EQ1A 2OWSA 3OMBA 2I4BA 5AA3A 3G3KA 5I58B 5L9MA 4WEPA 1UTBA 4HCWA 3G3IA 5H8HB 3VVDA 4GWOA 4IY5A 4U22A 4H5GA 4M1VA 4H6DA 1N76A 1Y3PA 1HSLA 3TTKA 1M5FA 1O7TA 2R6GE 3OSRA 4IO3A 1LBCA 2OK2A 1VFDA 2DWJA 4MFIA 1MY2A 4YB6A 5A5XA 2DQVA 3T9VA 4NTLA 5EYFA 3S9MC 5AA2D 3DM0A 3H6VA 3MPLA 3O29A 3R7XA 3H6TA 1AMFA 3M3FA 3IL1B 3IORA 1FTMA 2F34A 2DE3A 2XXUA 1URGA 2HZKA 4XTCQ 5H8NA 4ELQA 3GZGA 3JV9A 2Q2AA 4QSDA 2ZYKA 3M3KA 3FVGA 1MY0A 4G2ZA 4QFPA 2W7YA 2V3UA 4XKRA 3TFLA 1QUKA 4OFOA 1A54A 4LZ5A 4LA9A 3RPWA 1HSJA 1UTHA 3IO6A 3G3JA 3H6WA 4EXLA 4DIGA 1B9JA 4DCYA 4L17A 4JWYA 5I58A 2XXVA 4HCYA 4Q0CA 2GHAA 3MVZA 3VXBA 5H8HA 1LFGA 2OJTA 2PYYA 2CZLA 1LCTA 3QYTA 5CBRA 4FJPA 4NWCA 1MQJA 4G8HA 5KCJB 1DTGA 2OCUA 3F11A 2XXPA 1FTLA 2AL5A 1O63A 3IR1A 4UACA 2Z23A 2H98A 4R74A 3O6GA 1P1UA 1TT1A 5DTBA 5B7DA 2O68A 3N26A 1UQWA 4AB6A 3KN8A 3FV2A 4NEDA 3CFLA 1SI1A 3UGWA 1R1NA 4LUBA 2DXRA 2AYSA 1SBPA 5JTYB 3SETA 3RY3A 2ZYOA 3HHGA 2DVZA 2O69A 3USDA 3GBAA 4ZEFA 5I2KB 4RJZA 3MWBA 1I6AA 4R9FA 4IO2A 5DVIA 4U1ZA 1IITA 5ITPA 4ZEDA 4F3BA 3ONMA 4ONYA 4H5FA 5FHNA 2DYXA 1GTKA 1EZOA 3B6TA 2GHBA 3P7IA 4GLIA 4DXBA 3OEKA 3G7WA 5KZTA 1NNPA 4DCXA 2DWHA 4DZ1A 3CG3A 2UYFA 4FECA 1JNFA 1UIUA 3K0VA 1SD3A 3O28A 2RC9A 1OIBA 4U21A 2UXAA 5H8QB 4LZ8A 1OQGA 5CI5A 1WVJA 4O3BA 4JXIA 2RINA 3BFUA 3TDJA 1NMUA 4DDDA 4H67A 4GXSB 4XIGQ 3EF7A 4TOZA 1PB7A 3T93B 2HFBA 1R9LA 3IO4A 3MAMA 2GRVA 2Y7RA 5TPAB 3E13X 1FTKA 1LAHE 4U4SA 3H06B 5FTIA 5JTYA 1Y3QA 3FV1A 2V3QA 2O1MA 1B3EA 5I2KA 2ZYNA 1N04A 2XXYA 4ELOA 1POY1 5I56A 4E0XA 1LFIA 1A8FA 1BTJA 3IX1A 1VSOA 2I0BA 4OESA 1MY4A 4E0WA 3KFMA 3S4UA 3TCFA 3O2AA 3KN7A 5LOMA 3G3HA 1JETA 3MVXA 4GVOA 1PBPA 1Y20A 1FTJA 1B1HA 3Q26A 3VXCA 3ILTB 4MLVA 1OLCA 2QS2A 2DOJA 1NNTA 1QKBA 3TTRA 4ZEKA 1DPPA 4HW8A 5FHOA 4JWOA 1B1XA 4R2BA 2Q88A 2FNCA 3ILUB 4DXUA 4KCDA 5H8QA 1TFAA 4G68C 1B7HA 3KOTA 5DVJA 1B58A 3SESA 4GIZA 4KD5A 2QMWA 1Z7NE 3RTWB 2G93A 3MP1A 3OO9A 3T9HB 1S50A 2H99A 1Z7ME 5DT6A 3LSWA 1URDA 4MLQA 3VVFA 4JBZA 3CFZA 1OLAA 5TPAA 4QHQA 5ISUA 4PE5B 1LSTA 4ESWA 3K2DA 3B6QA 4XKPA 1GR2A 2YLNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N84 A;  2XXW A;  3O6H A;  1DMB A;  3EHT A;  1XVX A;  3C34 A;  1FQA A;  2QRY A;  3PMV A;  1ZJL A;  4ELR A;  2DWA A;  2QPQ A;  3GLB A;  4LVQ A;  3IOU A;  4GL0 A;  3VLV A;  1B3L A;  2VD3 A;  4EF1 A;  3SEV A;  2XX8 A;  2XXT A;  5CBS A;  1EZ9 A;  1PB8 A;  1S7Y A;  2D21 A;  4QSC A;  4FEB A;  1QKA A;  2PVU A;  3M3L A;  3QK6 A;  3T9X B;  3TCH A;  3FAT A;  2Y84 A;  2ZXT A;  3K1M A;  1Q1K A;  2AIX A;  4GQO A;  3BKI B;  3PPR A;  4XKN A;  1H43 A;  3E3K A;  4F39 A;  3MVY A;  2ANJ A;  1MY1 A;  1SI0 A;  5L9O A;  4RPO A;  5H8S A;  2VP1 A;  5H8F A;  4OYV A;  4YKP A;  3SEX A;  1A40 A;  3TTL A;  3GXA A;  1A8E A;  1PEB A;  1P1N A;  3R6U A;  4X9T A;  1NH7 A;  1PDA A;  4QF9 A;  3N6U A;  2REJ A;  4FIM A;  2R71 A;  3CI8 A;  5AA1 A;  1YAE A;  4G8N A;  4YKI A;  4OER A;  1FQD A;  1MXZ A;  3C32 A;  1VR5 A;  2Z8D A;  3I5O A;  4KQP A;  1N7W A;  3TQW A;  3H7M A;  4GD5 A;  4F29 A;  2F5X A;  5J1D A;  3TAJ A;  1MXY A;  1SW2 A;  1B5I A;  3KEI A;  3VFJ A;  2GFE A;  5I57 B;  4ZZE A;  3O97 A;  2VOZ A;  2DP8 A;  1JVX A;  2DVC A;  1MPB A;  4F3G A;  1R6Z A;  2GH9 A;  4KHZ E;  1KWH A;  2WKY A;  4X1B A;  2E0S A;  2V93 A;  1D4N A;  2ESN A;  4GXA A;  4H1X A;  1XVY A;  2I4C A;  2FA7 A;  2I6E A;  1VE4 A;  2Z22 A;  3DP4 A;  3I6V A;  4O3A A;  5I2N B;  3T66 A;  4UA8 A;  3IOW A;  2HAU A;  3CSB A;  3VLU A;  5FHM A;  3KSJ A;  4LQ2 A;  3RNN A;  2Q9T A;  3PD8 A;  3TMG A;  1D3K A;  1BLF A;  1LB8 A;  1VFE A;  4JDF A;  1GV8 A;  3S9E A;  2QSX A;  2XHD A;  1B32 A;  1XOC A;  4DXC A;  1B0H A;  4F2Q A;  5IKB A;  1H3D A;  1USY H;  4POW A;  4OFL A;  5TP9 B;  1Y3N A;  2NVU B;  2F8D A;  3H6U A;  4PFT A;  4AB5 A;  1JW1 A;  4RNS A;  3B6W A;  1P1W A;  4PET A;  2Y7K A;  5I59 A;  1DPE A;  5AA4 A;  2XD2 A;  3MQ9 A;  1I6Q A;  1MG1 A;  1XHY A;  5I57 A;  4YMA A;  4YB5 A;  5M2V A;  1MDQ A;  4IGR A;  3JZJ A;  5DEX B;  4KR5 A;  3Q25 A;  4ZE9 A;  3IB2 A;  2ONR A;  3ZKK A;  3HST A;  1D9V A;  3THI A;  3IB1 A;  1ZLQ A;  4BLA A;  3K6W A;  3C9H A;  3U94 A;  2F78 A;  2CMO A;  2HCA A;  1P1O A;  3OEN A;  4ZEC A;  1ZTY A;  4X48 A;  3OD7 A;  3MZB A;  3U8Q A;  1Y9U A;  4OWD A;  4LON B;  3SEU A;  4OQO A;  3HPI A;  1TFD A;  3OOA A;  1OQH A;  3JYR A;  1EU8 A;  1ZMG A;  4I9D A;  2IA4 A;  1IXG A;  3HHF A;  2I49 A;  4F1Y A;  4C0R A;  4G8M A;  5TP9 A;  5FTH A;  1B4H A;  2ONK E;  4LZ7 A;  1PC3 A;  2M8C A;  3EHU A;  3OO7 A;  3PUY E;  3RUM A;  1SYH A;  2QS1 A;  3C4M A;  5F1Q A;  2O1L A;  1FTO A;  1M5B A;  2DWI A;  3M8U A;  1MY3 A;  1ZBM A;  4NMY A;  4KYD A;  1PB9 A;  2A5T B;  1UIV A;  4ELP A;  3HN0 A;  3FJM A;  1OMP A;  4POX A;  3G3G A;  5DEX A;  1LCF A;  2VGQ A;  3FXU A;  4F1U A;  4GFR A;  2B3B A;  3H03 A;  4GRK A;  4YAH X;  2O51 A;  1FQF A;  3AXF A;  4OEN A;  3VE1 B;  3D4C A;  1Y1Z A;  5KCJ A;  4ISU A;  4ZZA A;  1IXC A;  1MM7 A;  3A3C A;  4Q5T A;  2P0S A;  1IUD A;  1SW1 A;  2I3V A;  4C1T A;  1B0L A;  3RGY A;  3K01 A;  1O64 A;  2V84 A;  5ITO A;  4NF5 B;  3CG1 A;  3TTM A;  4YKJ A;  2HZL A;  4QRZ A;  3UK4 A;  2F97 A;  4P0I A;  4OVJ A;  3C33 A;  5HBC A;  5EHS A;  1N3W A;  1WOD A;  3MW0 A;  4G68 B;  4WED A;  4BDN A;  2ZNS A;  3A09 A;  3W9V A;  1FQE A;  4BDL A;  4U4X A;  4BDM A;  3H3G A;  4N13 A;  2DXY A;  3G3F A;  4K3F A;  2YPN A;  2AL4 A;  3C31 A;  4RK2 A;  3OO6 A;  4U2R A;  3OEM A;  3WAE A;  3QUJ A;  4RYA A;  5HPQ A;  3D4G A;  4O3C A;  2E1S A;  1B51 A;  1AL3 A;  3HCQ A;  2A5T A;  4P11 A;  3MUQ A;  1M5C A;  2X7P A;  1A99 A;  1NNF A;  4NF4 B;  4Z0I A;  5F7V A;  1IZ1 A;  5AA2 B;  2PT2 A;  1B7U A;  1JW4 A;  3EN3 A;  1B3G A;  3TTN A;  4R75 A;  3KBR A;  4RPN A;  4YMB A;  3K4U A;  4EXK A;  2O7I A;  2XD3 A;  5BUU A;  1MRP A;  2HXW A;  3KOS A;  2X7Q A;  4AQ4 A;  2DE4 A;  5I84 A;  3CR9 A;  1B5J A;  2NWJ A;  1B05 A;  3S9N C;  4RXL A;  3TQL A;  1FQC A;  3LUY A;  1LAF E;  2F6G A;  1LLS A;  5ICT A;  3TZA A;  4NF8 B;  3Q27 A;  5ICQ A;  3K1P A;  1MS7 A;  1WDN A;  1LGB C;  2H25 A;  1IEJ A;  3K1N A;  4RA1 A;  1NNK A;  1XT8 A;  4EUO A;  1MPD A;  2I48 A;  4FAJ A;  4XKQ A;  3W15 C;  3RQT A;  4G68 A;  3DP6 A;  4QFK A;  3LSX A;  1ZIU A;  2P1S A;  1MXV A;  4ZEB A;  4I8C A;  1SVX B;  4DLD A;  4OET A;  3K6V A;  4Q30 B;  1JW5 A;  1SYI A;  4OTE A;  5B70 A;  2I58 A;  3MZ1 A;  4G77 A;  4YIC A;  3O66 A;  4QFO A;  4PFU A;  4ZE8 A;  3HV1 A;  3ZS6 A;  2NOO A;  1IIW A;  4IO5 A;  3L6H A;  4OMB A;  1MXX A;  4OXV A;  4YU0 A;  4FAT A;  4ND9 A;  2PX1 A;  2F7C A;  4TLM B;  5ELV A;  1B2H A;  3TEP A;  3PV0 E;  4QFL A;  3PUX E;  3RLF E;  4F18 A;  4ZEI A;  3ZSF A;  4FED A;  3ODB A;  4QFN A;  4H0W A;  2BJJ X;  3E9X A;  1N0T A;  1D9Y A;  2A5S A;  2RC7 A;  2NUV A;  4Z7E A;  1A55 A;  3DEL B;  4F1V A;  2QS3 A;  2B3F A;  3O6I A;  4NF8 A;  4IO4 A;  3PMW A;  1URS A;  1ELJ A;  3C36 A;  3FZV A;  2ZMB A;  2DS9 A;  2QMX A;  2Z8F A;  1B6H A;  1EH3 A;  3MZ9 A;  4XXU A;  1M5D A;  3U92 A;  2OLB A;  1L5T A;  2B65 A;  1AOV A;  2I3W A;  4R6Y A;  3FVN A;  3PUV E;  5BWJ A;  3GBB A;  3Q29 A;  3IK6 B;  3RN8 A;  2XX9 A;  2XXI A;  3OO8 A;  4LAT A;  1RYX A;  1A7L A;  1JQF A;  4ESX A;  2D3I A;  5KDT B;  1YCJ A;  3KJ7 A;  1SQY A;  4GOT A;  2PMS A;  3U93 A;  4HS7 A;  1Y1M A;  4H8I A;  2QS4 A;  4F2O A;  3K6U A;  4WKM A;  3FVO A;  3VVE A;  1Y4C A;  3MP8 A;  4R2F A;  3TOD A;  3TPA A;  4F31 B;  5JK4 A;  3LR1 A;  5AE4 A;  3RT6 B;  4M4G A;  4FE8 A;  1N3X A;  3QAX A;  4BDO A;  4YKK A;  4IY6 A;  3E4R A;  4KYS A;  1BKA A;  3KG2 A;  3KN3 A;  3V5A A;  3PUW E;  1IXI A;  2OBG A;  2REG A;  4OHN A;  3V89 B;  3CSG A;  3OSQ A;  4IGT A;  4BDR A;  1MQG A;  1QJM A;  1TXF A;  3N5L A;  3IB0 A;  1MH4 A;  2QL3 A;  2Q8J A;  1YPN A;  4TLL B;  1B46 A;  3BFT A;  3IAZ A;  5L9S A;  1F9B A;  3SDF A;  1B52 A;  4X1D A;  3OEL A;  3MJN A;  1R9Q A;  3S9L C;  1TWY A;  4HTG A;  4PFW A;  1I6B A;  2LAO A;  1JEU A;  1AIV A;  4I62 A;  5KDT A;  1XC1 A;  2ONS A;  4BDQ A;  2X26 A;  1QUI A;  1LAX A;  1CB6 A;  5EHM A;  3Q28 A;  4EQ7 A;  4PFY A;  1MQI A;  1H45 A;  4EQ9 A;  5K2X A;  3PD9 A;  3QIM A;  5CRY A;  4F22 A;  5IAI A;  1I69 A;  2XXQ A;  1ANF A;  4R9G A;  1GVC A;  3UIF A;  5CMC A;  3MVW A;  3PMX A;  3CFX A;  3IJX B;  2G29 A;  3PU5 A;  5I2N A;  3RT8 A;  2OWT A;  2O6A A;  1H76 A;  4R6H A;  1LFH A;  1EZP A;  2ZNT A;  3PPN A;  4NWD A;  3U1O A;  4H8J A;  4KCC A;  1IXH A;  1MXU A;  4H65 A;  2F6P A;  4OEU A;  1DSN A;  4JSD A;  4R73 A;  2D5W A;  2XXX A;  4ZS9 A;  5DYH A;  4OEV A;  4IO6 A;  3CRB A;  2UVH A;  4LQ5 A;  2NXO A;  3BBR A;  1SW4 A;  2V25 A;  4C1U A;  1HSE A;  3OXN A;  1US4 A;  3UA8 A;  1LB9 A;  5TU0 A;  3TKD A;  5DVF A;  2ZNU A;  3WAF A;  5I56 B;  4FOR A;  4GF8 A;  1MH3 A;  3UOR A;  4ZDM A;  4OFJ A;  1RKM A;  4F3P A;  5CMM A;  2F36 A;  1JEV A;  2DE2 A;  3T9U A;  2VD2 A;  3IOV A;  1DOT A;  4KYE A;  3L6G A;  3TCG A;  1POT A;  2XX7 A;  1B5H A;  4THI A;  1LBB A;  3EHS A;  3QUF A;  3FD3 A;  4RK9 A;  1SW5 A;  2PT1 A;  4EDP A;  3MC2 A;  3PPO A;  3PUZ E;  4TQU Q;  2RCB A;  3FGS A;  3CVG A;  3UP9 A;  4F19 A;  4NF6 B;  3LSL A;  2RC8 A;  3VLW A;  2UVG A;  4JSO A;  1H44 A;  4G4P A;  2VHA A;  3LSF B;  3FIR A;  1FW0 A;  4P0G A;  2FYI A;  1M5E A;  3V8X B;  2RF1 A;  1XS5 A;  1QUJ A;  3K00 A;  4KPT A;  2Q89 A;  1P1Q A;  3RTF B;  1Q35 A;  4U1O A;  1QW0 A;  1NL5 A;  1II5 A;  4MH5 A;  1LAG E;  4KFQ A;  3I3V A;  5L8D A;  2RCA A;  4IO7 A;  3K6X A;  2ABH A;  2HAV A;  1ZKB A;  3PPQ A;  3SEW A;  1S9T A;  3T96 B;  2F7A A;  3DP8 A;  1B7Z A;  1NH8 A;  3ZKL A;  4Q8R A;  3K02 A;  3LC8 A;  1B3H A;  2O84 X;  4RY1 A;  1FQB A;  3FXR A;  1QUL A;  1J1N A;  3DLN A;  3FJ7 A;  2F35 A;  3MBP A;  3B7D A;  2XXH A;  1MPC A;  3UN6 A;  2HQ0 A;  1CE2 A;  2OZZ A;  4NF6 A;  1BP5 A;  4LP2 B;  1BIY A;  4YZZ A;  3TYH A;  1ATG A;  2R9J A;  2O7U A;  2UVJ A;  2DSF A;  2H9B A;  1B4Z A;  3H4Z A;  2XXR A;  3MP6 A;  4NF5 A;  1DTZ A;  3FJG A;  3SER A;  2YJP A;  4JWX A;  4R72 A;  3KGC A;  3LBS A;  2V3T A;  4PP0 A;  4F3S A;  1NFT A;  3IJO B;  5H8F B;  3TUS A;  3A3U A;  1SDX A;  1OVB A;  2I0C A;  4OZ9 A;  1N7X A;  4WXJ A;  4IB2 A;  1GGG A;  1Y4T A;  3ECR A;  2QJE A;  2UVI A;  3EPE A;  5CC2 A;  3T22 A;  3MPK A;  3N94 A;  4KI0 E;  3KSX A;  5CM6 A;  2HEU A;  1MQD A;  3IOT A;  3R26 A;  3KZG A;  3C35 A;  1MDP 1;  2F7B A;  4R6K A;  4NF4 A;  2KLF A;  4MF3 A;  1YTV A;  5K2Y A;  5AA2 A;  1USY E;  3W9W A;  4ECF A;  1RYO A;  2IEE A;  4I1D A;  1MM6 A;  3KJT A;  2Z8E A;  2Y7W A;  2H5Y A;  2UYE A;  1MQH A;  1P99 A;  1OVT A;  5CMK A;  1UTB B;  3PPP A;  3CIJ A;  1AH5 A;  1FCK A;  4GL8 A;  1US5 A;  3FXQ A;  2Y7P A;  2H4I A;  4N6P A;  4N07 A;  1T0K A;  3N6T A;  5HM4 B;  5A5X B;  5CMB A;  1B40 A;  3FVK A;  2Y7I A;  3O9P A;  3PGF A;  3VDF A;  3VV5 A;  3S2V A;  1B3F A;  2ZYM A;  4JB7 A;  3U72 A;  3QXM A;  2Q2C A;  3FUZ A;  2P2A A;  1PBQ A;  3SEY A;  2ALU A;  1IQ7 A;  4EQB A;  5H8N B;  3TEL A;  2RKM A;  4PQJ A;  5I59 B;  4QSE A;  1MXW A;  3HO7 A;  1ZU0 A;  4DE8 A;  2THI A;  4YB7 A;  4U23 A;  5AA4 B;  1NKX A;  4EF2 A;  2PBW A;  4MBP A;  5JEI A;  3FAS A;  1JVY A;  3QSL A;  1QVS A;  1UTH B;  3V83 A;  4NE4 A;  3SKP A;  3EQ1 A;  2OWS A;  3OMB A;  2I4B A;  5AA3 A;  3G3K A;  5I58 B;  5L9M A;  4WEP A;  1UTB A;  4HCW A;  3G3I A;  5H8H B;  3VVD A;  4GWO A;  4IY5 A;  4U22 A;  4H5G A;  4M1V A;  4H6D A;  1N76 A;  1Y3P A;  1HSL A;  3TTK A;  1M5F A;  1O7T A;  2R6G E;  3OSR A;  4IO3 A;  1LBC A;  2OK2 A;  1VFD A;  2DWJ A;  4MFI A;  1MY2 A;  4YB6 A;  5A5X A;  2DQV A;  3T9V A;  4NTL A;  5EYF A;  3S9M C;  5AA2 D;  3DM0 A;  3H6V A;  3MPL A;  3O29 A;  3R7X A;  3H6T A;  1AMF A;  3M3F A;  3IL1 B;  3IOR A;  1FTM A;  2F34 A;  2DE3 A;  2XXU A;  1URG A;  2HZK A;  4XTC Q;  5H8N A;  4ELQ A;  3GZG A;  3JV9 A;  2Q2A A;  4QSD A;  2ZYK A;  3M3K A;  3FVG A;  1MY0 A;  4G2Z A;  4QFP A;  2W7Y A;  2V3U A;  4XKR A;  3TFL A;  1QUK A;  4OFO A;  1A54 A;  4LZ5 A;  4LA9 A;  3RPW A;  1HSJ A;  1UTH A;  3IO6 A;  3G3J A;  3H6W A;  4EXL A;  4DIG A;  1B9J A;  4DCY A;  4L17 A;  4JWY A;  5I58 A;  2XXV A;  4HCY A;  4Q0C A;  2GHA A;  3MVZ A;  3VXB A;  5H8H A;  1LFG A;  2OJT A;  2PYY A;  2CZL A;  1LCT A;  3QYT A;  5CBR A;  4FJP A;  4NWC A;  1MQJ A;  4G8H A;  5KCJ B;  1DTG A;  2OCU A;  3F11 A;  2XXP A;  1FTL A;  2AL5 A;  1O63 A;  3IR1 A;  4UAC A;  2Z23 A;  2H98 A;  4R74 A;  3O6G A;  1P1U A;  1TT1 A;  5DTB A;  5B7D A;  2O68 A;  3N26 A;  1UQW A;  4AB6 A;  3KN8 A;  3FV2 A;  4NED A;  3CFL A;  1SI1 A;  3UGW A;  1R1N A;  4LUB A;  2DXR A;  2AYS A;  1SBP A;  5JTY B;  3SET A;  3RY3 A;  2ZYO A;  3HHG A;  2DVZ A;  2O69 A;  3USD A;  3GBA A;  4ZEF A;  5I2K B;  4RJZ A;  3MWB A;  1I6A A;  4R9F A;  4IO2 A;  5DVI A;  4U1Z A;  1IIT A;  5ITP A;  4ZED A;  4F3B A;  3ONM A;  4ONY A;  4H5F A;  5FHN A;  2DYX A;  1GTK A;  1EZO A;  3B6T A;  2GHB A;  3P7I A;  4GLI A;  4DXB A;  3OEK A;  3G7W A;  5KZT A;  1NNP A;  4DCX A;  2DWH A;  4DZ1 A;  3CG3 A;  2UYF A;  4FEC A;  1JNF A;  1UIU A;  3K0V A;  1SD3 A;  3O28 A;  2RC9 A;  1OIB A;  4U21 A;  2UXA A;  5H8Q B;  4LZ8 A;  1OQG A;  5CI5 A;  1WVJ A;  4O3B A;  4JXI A;  2RIN A;  3BFU A;  3TDJ A;  1NMU A;  4DDD A;  4H67 A;  4GXS B;  4XIG Q;  3EF7 A;  4TOZ A;  1PB7 A;  3T93 B;  2HFB A;  1R9L A;  3IO4 A;  3MAM A;  2GRV A;  2Y7R A;  5TPA B;  3E13 X;  1FTK A;  1LAH E;  4U4S A;  3H06 B;  5FTI A;  5JTY A;  1Y3Q A;  3FV1 A;  2V3Q A;  2O1M A;  1B3E A;  5I2K A;  2ZYN A;  1N04 A;  2XXY A;  4ELO A;  1POY 1;  5I56 A;  4E0X A;  1LFI A;  1A8F A;  1BTJ A;  3IX1 A;  1VSO A;  2I0B A;  4OES A;  1MY4 A;  4E0W A;  3KFM A;  3S4U A;  3TCF A;  3O2A A;  3KN7 A;  5LOM A;  3G3H A;  1JET A;  3MVX A;  4GVO A;  1PBP A;  1Y20 A;  1FTJ A;  1B1H A;  3Q26 A;  3VXC A;  3ILT B;  4MLV A;  1OLC A;  2QS2 A;  2DOJ A;  1NNT A;  1QKB A;  3TTR A;  4ZEK A;  1DPP A;  4HW8 A;  5FHO A;  4JWO A;  1B1X A;  4R2B A;  2Q88 A;  2FNC A;  3ILU B;  4DXU A;  4KCD A;  5H8Q A;  1TFA A;  4G68 C;  1B7H A;  3KOT A;  5DVJ A;  1B58 A;  3SES A;  4GIZ A;  4KD5 A;  2QMW A;  1Z7N E;  3RTW B;  2G93 A;  3MP1 A;  3OO9 A;  3T9H B;  1S50 A;  2H99 A;  1Z7M E;  5DT6 A;  3LSW A;  1URD A;  4MLQ A;  3VVF A;  4JBZ A;  3CFZ A;  1OLA A;  5TPA A;  4QHQ A;  5ISU A;  4PE5 B;  1LST A;  4ESW A;  3K2D A;  3B6Q A;  4XKP A;  1GR2 A;  2YLN A; 
#chains in the Genus database with same CATH topology
 5IZ1 A;  4MHF A;  1N84 A;  2XXW A;  4PF6 A;  3O6H A;  1DMB A;  3EHT A;  1XVX A;  3C34 A;  1FQA A;  2QRY A;  3PMV A;  1ZJL A;  4ELR A;  2DWA A;  2QPQ A;  4O7I A;  3GLB A;  4FBP A;  4LVQ A;  3IOU A;  4GL0 A;  4GBW A;  3VLV A;  1B3L A;  2VD3 A;  4EF1 A;  3SEV A;  2XX8 A;  3BIH A;  2XXT A;  5CBS A;  1EZ9 A;  1PB8 A;  1S7Y A;  2D21 A;  4PBH A;  4QSC A;  4FEB A;  1QKA A;  2PVU A;  3M3L A;  3QK6 A;  3T9X B;  1YYZ A;  4AS5 A;  5IZZ A;  3TCH A;  3FAT A;  1NUX A;  2Y84 A;  2ZXT A;  3K1M A;  1Q1K A;  2AIX A;  4GQO A;  4MNC A;  3BKI B;  3PPR A;  4XKN A;  1H43 A;  2WYK A;  3E3K A;  4F39 A;  3MVY A;  1LBZ A;  1FJ9 A;  2ANJ A;  1MY1 A;  1SI0 A;  5L9O A;  1FSA A;  4RPO A;  5H8S A;  2XWK A;  2VP1 A;  5H8F A;  4OYV A;  4YKP A;  1FPF A;  1SPI A;  3SEX A;  1A40 A;  3TTL A;  3GXA A;  1A8E A;  1PEB A;  1P1N A;  3R6U A;  4X9T A;  1NH7 A;  4N91 A;  1PDA A;  4QF9 A;  3N6U A;  2REJ A;  4FIM A;  4MNI A;  2R71 A;  3CI8 A;  5AA1 A;  3KBZ A;  2CZI A;  1YAE A;  4G8N A;  4YKI A;  4OER A;  1FQD A;  4NAP A;  1MXZ A;  3C32 A;  1VR5 A;  2Z8D A;  3I5O A;  4KQP A;  1N7W A;  3TQW A;  1QGX A;  3H7M A;  4GD5 A;  4F29 A;  2F5X A;  5J1D A;  3TAJ A;  1MXY A;  1SW2 A;  1B5I A;  3KEI A;  3VFJ A;  2WYP A;  2GFE A;  5I57 B;  4ZZE A;  3O97 A;  3LV0 A;  2VOZ A;  2DP8 A;  1JVX A;  2DVC A;  1MPB A;  1NV4 A;  4F3G A;  1R6Z A;  2GH9 A;  4P47 A;  4KHZ E;  1KWH A;  2WKY A;  4X1B A;  2E0S A;  1FPL A;  2V93 A;  3CHG A;  1D4N A;  2ESN A;  4GXA A;  4H1X A;  1XVY A;  3ISP A;  2I4C A;  2FA7 A;  2I6E A;  1VE4 A;  2Z22 A;  3DP4 A;  3I6V A;  4O3A A;  2KQZ A;  5I2N B;  2FHY A;  3T66 A;  4UA8 A;  3IOW A;  2HAU A;  3CSB A;  3VLU A;  5FHM A;  3KSJ A;  4LQ2 A;  3RNN A;  2Q9T A;  3PD8 A;  3TMG A;  1D3K A;  1BLF A;  1LB8 A;  1VFE A;  2F3B A;  4HE1 A;  4JDF A;  1GV8 A;  3S9E A;  2QSX A;  2P3V A;  2XHD A;  4GBV A;  1B32 A;  1XOC A;  1LBY A;  4DXC A;  1B0H A;  4F2Q A;  5IKB A;  1H3D A;  4N8Y A;  1USY H;  4POW A;  4OFL A;  5TP9 B;  1Y3N A;  4MAG A;  2NVU B;  2F8D A;  3H6U A;  4PFT A;  4AB5 A;  1JW1 A;  4RNS A;  1RDY A;  3B6W A;  1P1W A;  3EKI A;  4PET A;  2Y7K A;  5I59 A;  1DPE A;  5AA4 A;  2XD2 A;  4OVQ A;  3MQ9 A;  1I6Q A;  1MG1 A;  1XHY A;  5I57 A;  4N17 A;  4YMA A;  5I7I A;  4YB5 A;  1KZ8 A;  5M2V A;  1EYI A;  1MDQ A;  4IGR A;  3JZJ A;  5DEX B;  4KR5 A;  3Q25 A;  4ZE9 A;  3IB2 A;  2ONR A;  2OWZ A;  3ZKK A;  2CEX A;  3HST A;  1D9V A;  3THI A;  3IB1 A;  1ZLQ A;  4BLA A;  3K6W A;  3C9H A;  5ET6 A;  3U94 A;  4H45 A;  2F78 A;  2CMO A;  2HCA A;  1P1O A;  3OEN A;  4ZEC A;  1ZTY A;  4X48 A;  2HXR A;  3OD7 A;  3MZB A;  3U8Q A;  1Y9U A;  4OWD A;  4N6K A;  4LON B;  3SEU A;  4OQO A;  3HPI A;  1TFD A;  3OOA A;  4DI3 D;  1OQH A;  1FTA A;  3JYR A;  1EU8 A;  1ZMG A;  4I9D A;  2IA4 A;  1IXG A;  3HHF A;  2I49 A;  1IMB A;  4F1Y A;  4C0R A;  4NF0 A;  3MST A;  4G8M A;  1IMD A;  4I40 A;  5TP9 A;  5FTH A;  1B4H A;  2ONK E;  4LZ7 A;  1PC3 A;  2M8C A;  3EHU A;  3RYD A;  3OO7 A;  3PUY E;  3RUM A;  1SYH A;  2QS1 A;  3C4M A;  5F1Q A;  2O1L A;  1FTO A;  1M5B A;  2DWI A;  3M8U A;  1MY3 A;  1ZBM A;  3E79 A;  4NMY A;  4KYD A;  1PB9 A;  2A5T B;  1UIV A;  4ELP A;  3HN0 A;  3FJM A;  1OMP A;  2PFY A;  4POX A;  3G3G A;  5DEX A;  1LCF A;  2VGQ A;  3FXU A;  4F1U A;  4PDH A;  4GFR A;  4JVI A;  2B3B A;  3H03 A;  4GRK A;  4YAH X;  2O51 A;  1FQF A;  3AXF A;  4DI4 B;  4OEN A;  2XWI A;  3VE1 B;  4PGP A;  3D4C A;  1Y1Z A;  1VDW A;  5KCJ A;  4ISU A;  4ZZA A;  1D9Q A;  1IXC A;  1MM7 A;  3A3C A;  4Q5T A;  2P0S A;  1IUD A;  1SW1 A;  2I3V A;  2ZZV A;  4C1T A;  1B0L A;  4MCO A;  4NN3 A;  3RGY A;  3K01 A;  1O64 A;  2V84 A;  5ITO A;  4NF5 B;  3CG1 A;  3TTM A;  4YKJ A;  2HZL A;  4QRZ A;  3UK4 A;  2F97 A;  4P0I A;  4OVJ A;  3C33 A;  5HBC A;  5IM2 A;  4PFR A;  5EHS A;  1N3W A;  4AS4 A;  1WOD A;  3MW0 A;  4G68 B;  4WED A;  2Y5L A;  4BDN A;  2ZNS A;  3A09 A;  3W9V A;  5LDZ A;  1IMC A;  1FQE A;  4BDL A;  4U4X A;  4BDM A;  4O8M A;  3H3G A;  4N13 A;  2DXY A;  3G3F A;  4K3F A;  2YPN A;  2AL4 A;  3C31 A;  1NUZ A;  4RK2 A;  2XWO A;  2FBP A;  3OO6 A;  4O7M A;  4U2R A;  3OEM A;  3WAE A;  3QUJ A;  4RYA A;  5HPQ A;  4IR8 A;  5IGA A;  3D4G A;  4O3C A;  2E1S A;  3HFU A;  1B51 A;  1AL3 A;  3HCQ A;  2A5T A;  4P11 A;  3MUQ A;  1M5C A;  2X7P A;  1A99 A;  1DCU A;  1NNF A;  4NF4 B;  4XEQ A;  5F7V A;  4Z0I A;  1IZ1 A;  5AA2 B;  2PT2 A;  1B7U A;  1JW4 A;  3EN3 A;  3SZP A;  1B3G A;  5F24 A;  3TTN A;  4R75 A;  3BIG A;  3KBR A;  4RPN A;  4YMB A;  3K4U A;  4EXK A;  2O7I A;  4LN5 A;  2XD3 A;  4P9K A;  4QXD A;  1MRP A;  2HXW A;  3KOS A;  5BUU A;  2X7Q A;  1LEV A;  4AQ4 A;  2DE4 A;  1K9Z A;  5I84 A;  3CR9 A;  5ESY A;  1B5J A;  2NWJ A;  1B05 A;  3S9N C;  4RXL A;  3TQL A;  1FQC A;  2P3N A;  2VPO A;  3LUY A;  1LAF E;  4PAK A;  2F6G A;  1LLS A;  5ICT A;  3TZA A;  4NF8 B;  3Q27 A;  5ICQ A;  3K1P A;  1MS7 A;  1WDN A;  1LGB C;  2H25 A;  1IEJ A;  3K1N A;  4RA1 A;  1NNK A;  1XT8 A;  2VT5 A;  4EUO A;  1MPD A;  2I48 A;  4FAJ A;  2B4L A;  4XKQ A;  3W15 C;  3NOH A;  3RQT A;  4G68 A;  3DP6 A;  4QFK A;  3LSX A;  1ZIU A;  2P1S A;  1MXV A;  4ZEB A;  4I8C A;  1SVX B;  4DLD A;  4OET A;  3K6V A;  4Q30 B;  1JW5 A;  5EQ7 A;  4H46 A;  1SYI A;  4OTE A;  5B70 A;  2I58 A;  3MZ1 A;  4G77 A;  4YIC A;  1RDZ A;  3O66 A;  4QFO A;  4PFU A;  4GWU A;  4ZE8 A;  3HV1 A;  3ZS6 A;  2NOO A;  1IIW A;  4IO5 A;  3L6H A;  1BK4 A;  4OMB A;  1MXX A;  4OXV A;  4YU0 A;  4FAT A;  4ND9 A;  2PX1 A;  2F7C A;  4TLM B;  5ELV A;  1B2H A;  3TEP A;  3PV0 E;  5EYG A;  4QFL A;  3PUX E;  5A5L A;  3RLF E;  4F18 A;  4ZEI A;  1JP4 A;  3ZSF A;  3IFC A;  4FED A;  3ODB A;  4QFN A;  4H0W A;  2BJJ X;  3E9X A;  1N0T A;  1D9Y A;  2A5S A;  2RC7 A;  2NUV A;  4Z7E A;  1A55 A;  4OVT A;  3DEL B;  4F1V A;  2QS3 A;  2B3F A;  3O6I A;  4NF8 A;  4IO4 A;  4OVP A;  1NUW A;  3PMW A;  4N81 A;  4MJO A;  1URS A;  4NG7 A;  1ELJ A;  3C36 A;  1IMA A;  3FZV A;  2ZMB A;  2DS9 A;  2QMX A;  2Z8F A;  1B6H A;  1EH3 A;  4GWW A;  3MZ9 A;  4XXU A;  1M5D A;  3U92 A;  2OLB A;  1L5T A;  2B65 A;  2XXK A;  1AOV A;  2I3W A;  4R6Y A;  3FVN A;  4X8R A;  3PUV E;  5BWJ A;  3GBB A;  3Q29 A;  3IK6 B;  3RN8 A;  2XX9 A;  2XXI A;  3OO8 A;  4LAT A;  1RYX A;  1A7L A;  1JQF A;  2Q8M A;  4ESX A;  2D3I A;  5KDT B;  1YCJ A;  3KJ7 A;  1LBX A;  1SQY A;  4GOT A;  2PMS A;  3U93 A;  4GX6 A;  2MKZ A;  4HS7 A;  1Y1M A;  4H8I A;  4PFI A;  2QS4 A;  4F2O A;  3K6U A;  4WKM A;  1Q9D A;  3FVO A;  3VVE A;  1Y4C A;  3MP8 A;  4R2F A;  3TOD A;  3TPA A;  4F31 B;  5JK4 A;  3LR1 A;  4P8B A;  5AE4 A;  3RT6 B;  4M4G A;  1FRP A;  2CZH A;  4FE8 A;  1N3X A;  1FBH A;  3QAX A;  4BDO A;  4YKK A;  4N6D A;  4IY6 A;  4PAI A;  3E4R A;  4HXV A;  4KYS A;  1BKA A;  3MYU A;  3KG2 A;  3KN3 A;  3V5A A;  3PUW E;  1IXI A;  2OBG A;  2REG A;  4X04 A;  4OHN A;  1EYK A;  3V89 B;  2R8T A;  3CSG A;  3OSQ A;  4IGT A;  4BDR A;  1MQG A;  1QJM A;  1TXF A;  4GX3 A;  3N5L A;  3IB0 A;  1NV5 A;  1MH4 A;  2QL3 A;  3B8B A;  2Q8J A;  1YPN A;  4TLL B;  1B46 A;  3BFT A;  2ZZW A;  3IAZ A;  5L9S A;  1F9B A;  2ZZX A;  3LUZ A;  3SDF A;  1B52 A;  4X1D A;  3OEL A;  3MJN A;  1R9Q A;  3S9L C;  1FBD A;  1TWY A;  4HTG A;  4PFW A;  1I6B A;  2LAO A;  1JEU A;  4MIJ A;  1AIV A;  4I62 A;  5KDT A;  1FBG A;  1XC1 A;  2ONS A;  1FBP A;  4BDQ A;  2X26 A;  1QUI A;  1LAX A;  1CB6 A;  5EHM A;  3Q28 A;  4EQ7 A;  4PFY A;  1MQI A;  1H45 A;  4EQ9 A;  5K2X A;  3PD9 A;  3QIM A;  5CRY A;  4F22 A;  5IAI A;  1I69 A;  1FPJ A;  2XXQ A;  2WBB A;  1ANF A;  4R9G A;  1GVC A;  3UIF A;  5CMC A;  3MVW A;  3PMX A;  3CFX A;  4PBQ A;  3IJX B;  2G29 A;  3PU5 A;  5I2N A;  3RT8 A;  2OWT A;  2L5V A;  2O6A A;  1H76 A;  4R6H A;  1LFH A;  1EZP A;  2ZNT A;  3PPN A;  4NWD A;  1NV3 A;  1FPK A;  3U1O A;  4H8J A;  4KCC A;  1IXH A;  2XWV A;  1MXU A;  1G0H A;  4H65 A;  2DDK A;  2F6P A;  4OEU A;  1DSN A;  1KA1 A;  4JSD A;  4R73 A;  2D5W A;  1YZ0 A;  2XXX A;  4ZS9 A;  5DYH A;  4OEV A;  4IO6 A;  3CRB A;  2UVH A;  4LQ5 A;  5ET7 A;  2NXO A;  3BBR A;  1SW4 A;  2V25 A;  4C1U A;  1HSE A;  3OXN A;  1US4 A;  3UA8 A;  1LB9 A;  5TU0 A;  3TKD A;  5DVF A;  2ZNU A;  3WAF A;  2QVU A;  5DW8 A;  3KC0 A;  5I56 B;  1NV2 A;  1FPE A;  3RPL B;  4FOR A;  4GF8 A;  1MH3 A;  3UOR A;  4ZDM A;  4OFJ A;  1RKM A;  4F3P A;  5CMM A;  2F36 A;  1JEV A;  2DE2 A;  3T9U A;  2VD2 A;  3IOV A;  1DOT A;  3FBP A;  4KYE A;  3L6G A;  3TCG A;  1POT A;  2XX7 A;  1B5H A;  4THI A;  1LBB A;  3EHS A;  3QUF A;  4HE0 A;  3FD3 A;  4RK9 A;  3GYY A;  1SW5 A;  2PT1 A;  4EDP A;  3MC2 A;  3PPO A;  3PUZ E;  4TQU Q;  1CNQ A;  2RCB A;  3FGS A;  3CVG A;  4MX6 A;  3UP9 A;  4F19 A;  4NF6 B;  3LSL A;  2RC8 A;  3VLW A;  1FBC A;  2UVG A;  4JSO A;  1H44 A;  4G4P A;  2QVV A;  2VHA A;  3LSF B;  3FIR A;  3T1B A;  1FW0 A;  4P0G A;  2FYI A;  1M5E A;  3V8X B;  4N15 A;  1INP A;  2RF1 A;  1XS5 A;  4P1E A;  1QUJ A;  3K00 A;  4KPT A;  2Q89 A;  1K9Y A;  1P1Q A;  3RTF B;  1Q35 A;  4U1O A;  1QW0 A;  1NL5 A;  1II5 A;  4MH5 A;  2VPN A;  1LAG E;  4KFQ A;  3I3V A;  5L8D A;  2RCA A;  4IO7 A;  3K6X A;  4NQ8 A;  2ABH A;  4MNP A;  2HAV A;  1ZKB A;  3PPQ A;  3SEW A;  1S9T A;  3T96 B;  2F7A A;  3DP8 A;  1B7Z A;  5EQA A;  3T0J A;  2F3D A;  1IME A;  1NH8 A;  3ZKL A;  4Q8R A;  3K02 A;  3LC8 A;  1B3H A;  2O84 X;  2OX3 A;  4RY1 A;  1FQB A;  3FXR A;  4GWX A;  1QUL A;  1J1N A;  3DLN A;  1YXI A;  3FJ7 A;  4MEV A;  2F35 A;  1NV1 A;  3PTY A;  3D1R A;  3MBP A;  3B7D A;  2XXH A;  1MPC A;  3UN6 A;  2HQ0 A;  1CE2 A;  2OZZ A;  4NF6 A;  1BP5 A;  4LP2 B;  1BIY A;  4YZZ A;  3TYH A;  1ATG A;  4OVR A;  2R9J A;  2O7U A;  2UVJ A;  2DSF A;  2H9B A;  1B4Z A;  3H4Z A;  1AWB A;  2XXR A;  3MP6 A;  4NF5 A;  1DTZ A;  4PGN A;  3FJG A;  3SER A;  2YJP A;  4JWX A;  4R72 A;  3KGC A;  3LBS A;  2V3T A;  4PP0 A;  4F3S A;  1NFT A;  3IJO B;  5H8F B;  3TUS A;  3A3U A;  1SDX A;  1OVB A;  2I0C A;  4OZ9 A;  1N7X A;  4WXJ A;  5FBP A;  4IB2 A;  1GGG A;  1Y4T A;  3ECR A;  2QJE A;  2UVI A;  3EPE A;  1FBE A;  5CC2 A;  3T22 A;  3MPK A;  3N94 A;  4KI0 E;  3KSX A;  5ET8 A;  5CM6 A;  2HEU A;  2V4C A;  1MQD A;  3IOT A;  3R26 A;  4PE3 A;  1FBF A;  2PFZ A;  4OVS A;  3KZG A;  2JJK A;  3C35 A;  1MDP 1;  4GWZ A;  5IZ3 B;  2F7B A;  2WX9 A;  4R6K A;  2HHM A;  4NF4 A;  3QMF A;  2KLF A;  4MF3 A;  1YTV A;  5K2Y A;  5AA2 A;  1USY E;  3W9W A;  2Q74 A;  4ECF A;  1RYO A;  2IEE A;  4I1D A;  1MM6 A;  3KJT A;  4KXP A;  2Z8E A;  2Y7W A;  2BJI A;  2H5Y A;  2UYE A;  1MQH A;  1P99 A;  1OVT A;  5CMK A;  1UTB B;  3PPP A;  1NI9 A;  4XFE A;  1LBW A;  3CIJ A;  1AH5 A;  1FCK A;  4XF5 A;  4GL8 A;  1US5 A;  3FXQ A;  2Y7P A;  2H4I A;  4N6P A;  4N07 A;  1T0K A;  3N6T A;  4P3L A;  5HM4 B;  5A5X B;  5CMB A;  1B40 A;  3FVK A;  2Y7I A;  3O9P A;  3E78 A;  2CZK A;  3PGF A;  3VDF A;  3VV5 A;  2QVR A;  3S2V A;  1B3F A;  2ZYM A;  4JB7 A;  3U72 A;  3QXM A;  2Q2C A;  1NV0 A;  3FUZ A;  2XA5 A;  2P2A A;  1PBQ A;  3SEY A;  2KR0 A;  1DBZ A;  2ALU A;  1IQ7 A;  4EQB A;  5H8N B;  3TEL A;  2RKM A;  4PDD A;  4PQJ A;  5I59 B;  4QSE A;  4OAN A;  1MXW A;  5IZ3 A;  3HO7 A;  1ZU0 A;  4DE8 A;  2THI A;  4YB7 A;  4NHB A;  4U23 A;  5AA4 B;  1NKX A;  4EF2 A;  2PBW A;  4MBP A;  5JEI A;  3FAS A;  1JVY A;  3QSL A;  1QVS A;  1UTH B;  1EYJ A;  4P56 A;  3V83 A;  4NE4 A;  4PF8 A;  3SKP A;  1RDX A;  2OWS A;  3EQ1 A;  4GX4 A;  5LTC A;  3OMB A;  2I4B A;  5AA3 A;  3G3K A;  5I58 B;  5L9M A;  4I3E A;  4WEP A;  1UTB A;  4HCW A;  1NV6 A;  3G3I A;  5H8H B;  3VVD A;  4GWO A;  4IY5 A;  4U22 A;  4H5G A;  4M1V A;  4H6D A;  1N76 A;  1Y3P A;  1HSL A;  3TTK A;  1M5F A;  4PC9 A;  1O7T A;  2R6G E;  3OSR A;  4IO3 A;  2FVZ A;  1LBC A;  2OK2 A;  1VFD A;  2DWJ A;  4MFI A;  4JVD A;  1MY2 A;  4YB6 A;  5A5X A;  2DQV A;  3T9V A;  4NTL A;  5EYF A;  3S9M C;  5AA2 D;  2B4M A;  4NGU A;  3DM0 A;  3H6V A;  3A29 A;  3MPL A;  3O29 A;  3R7X A;  3H6T A;  1AMF A;  3M3F A;  3IL1 B;  1FPG A;  3IOR A;  1FTM A;  5I3S A;  2F34 A;  2DE3 A;  2XXU A;  1URG A;  2HZK A;  4XTC Q;  5H8N A;  4ELQ A;  4P1L A;  3GZG A;  3JV9 A;  2Q2A A;  4QSD A;  2ZYK A;  5EYH A;  2Y5K A;  1NV7 A;  2GQ1 A;  3M3K A;  3FVG A;  1MY0 A;  4G2Z A;  4QFP A;  2W7Y A;  2V3U A;  4XKR A;  3TFL A;  1QUK A;  4OFO A;  1A54 A;  4LZ5 A;  4LA9 A;  3RPW A;  1HSJ A;  1UTH A;  3IO6 A;  3G3J A;  3H6W A;  4EXL A;  4DIG A;  1B9J A;  4DCY A;  1G0I A;  4JVC A;  4L17 A;  4JWY A;  5I58 A;  2XXV A;  4HCY A;  4Q0C A;  2GHA A;  3MVZ A;  4N4U A;  3VXB A;  5H8H A;  1LFG A;  2OJT A;  2PYY A;  2CZL A;  1LCT A;  3QYT A;  4PCD A;  5CBR A;  4FJP A;  4NWC A;  1MQJ A;  1IMF A;  1DK4 A;  4G8H A;  5KCJ B;  3ROJ A;  1DTG A;  2OCU A;  1FPD A;  3F11 A;  1NUY A;  2XXP A;  1FTL A;  2AL5 A;  1O63 A;  3IR1 A;  4UAC A;  2Z23 A;  2H98 A;  4R74 A;  3O6G A;  1XI6 A;  1P1U A;  4PTK A;  1TT1 A;  5DTB A;  5B7D A;  2O68 A;  3N26 A;  1UQW A;  4AB6 A;  3KN8 A;  3FV2 A;  4NED A;  3CFL A;  1SI1 A;  3UGW A;  1R1N A;  4LUB A;  2DXR A;  1FPI A;  2AYS A;  1SBP A;  5JTY B;  3SET A;  3RY3 A;  2HPG A;  2ZYO A;  3HHG A;  2DVZ A;  2O69 A;  3USD A;  3GBA A;  4ZEF A;  4O94 A;  5I2K B;  4RJZ A;  3MWB A;  1I6A A;  4R9F A;  4IO2 A;  5DVI A;  2FIE A;  4U1Z A;  1IIT A;  3KC1 A;  5ITP A;  4ZED A;  4F3B A;  4GWY A;  3ONM A;  4ONY A;  4QBA A;  4H5F A;  5FHN A;  4MMP A;  2DYX A;  1GTK A;  1EZO A;  3B6T A;  2GHB A;  3P7I A;  4GLI A;  4DXB A;  3OEK A;  3G7W A;  5I5P A;  5KZT A;  1NNP A;  4DCX A;  2WEF A;  1FPB A;  4G61 A;  2DWH A;  4DZ1 A;  4UAB A;  3CG3 A;  2UYF A;  4FEC A;  1JNF A;  1UIU A;  3K0V A;  1SD3 A;  3O28 A;  2RC9 A;  1OIB A;  4U21 A;  2UXA A;  4PFB A;  5H8Q B;  4LZ8 A;  1OQG A;  5CI5 A;  1WVJ A;  4O3B A;  4JXI A;  2RIN A;  3BFU A;  3TDJ A;  1NMU A;  4DDD A;  4H67 A;  4GXS B;  4XIG Q;  3EF7 A;  4TOZ A;  5ET5 A;  1PB7 A;  3T93 B;  4NX1 A;  2HFB A;  1R9L A;  3IO4 A;  3MAM A;  2GRV A;  2Y7R A;  5TPA B;  3E13 X;  1FTK A;  1LAH E;  4U4S A;  3H06 B;  5FTI A;  4N8G A;  2QFL A;  4HE2 A;  5JTY A;  1Y3Q A;  3FV1 A;  2V3Q A;  2O1M A;  1B3E A;  4GWS A;  5I2K A;  2ZYN A;  1N04 A;  2XXY A;  4ELO A;  1POY 1;  5I56 A;  3U65 A;  4E0X A;  1LFI A;  1FJ6 A;  1A8F A;  3RPL A;  1BTJ A;  3IX1 A;  1VSO A;  2I0B A;  4OES A;  1MY4 A;  4E0W A;  3KFM A;  3S4U A;  5J16 A;  3TCF A;  3O2A A;  3KN7 A;  5LOM A;  2CEY A;  5EQ9 A;  4I3Y A;  3G3H A;  1JET A;  3MVX A;  4OA4 A;  4GVO A;  1PBP A;  1Y20 A;  1FTJ A;  1B1H A;  3Q26 A;  3VXC A;  3ILT B;  4MLV A;  1OLC A;  2QS2 A;  2DOJ A;  1NNT A;  1QKB A;  5T3J A;  3TTR A;  4ZEK A;  1DPP A;  4HW8 A;  5FHO A;  4JWO A;  1B1X A;  4R2B A;  2Q88 A;  2FNC A;  3ILU B;  4KCD A;  5EQ8 A;  4DXU A;  2PCR A;  5H8Q A;  1TFA A;  4G68 C;  1B7H A;  3KOT A;  5DVJ A;  1B58 A;  3SES A;  4GIZ A;  4KD5 A;  2QMW A;  2FIX A;  1Z7N E;  1KA0 A;  3RTW B;  2G93 A;  3MP1 A;  3OO9 A;  3T9H B;  1S50 A;  2H99 A;  1Z7M E;  5DT6 A;  3LSW A;  1URD A;  4MLQ A;  3VVF A;  4JBZ A;  3CFZ A;  1OLA A;  1LBV A;  5TPA A;  3B50 A;  4QHQ A;  5ISU A;  4PE5 B;  2WBD A;  1LST A;  4ESW A;  3K2D A;  3B6Q A;  3FXB A;  3IFA A;  4XKP A;  1GR2 A;  2YLN A;  4PAF A; 
#chains in the Genus database with same CATH homology
 1N84 A;  2XXW A;  3O6H A;  1DMB A;  3EHT A;  1XVX A;  3C34 A;  1FQA A;  2QRY A;  3PMV A;  1ZJL A;  4ELR A;  2DWA A;  2QPQ A;  3GLB A;  4LVQ A;  3IOU A;  4GL0 A;  3VLV A;  1B3L A;  2VD3 A;  4EF1 A;  3SEV A;  2XX8 A;  2XXT A;  5CBS A;  1EZ9 A;  1PB8 A;  1S7Y A;  2D21 A;  4QSC A;  4FEB A;  1QKA A;  2PVU A;  3M3L A;  3QK6 A;  3T9X B;  3TCH A;  3FAT A;  2Y84 A;  2ZXT A;  3K1M A;  1Q1K A;  2AIX A;  4GQO A;  3BKI B;  3PPR A;  4XKN A;  1H43 A;  3E3K A;  4F39 A;  3MVY A;  2ANJ A;  1MY1 A;  1SI0 A;  5L9O A;  4RPO A;  5H8S A;  2VP1 A;  5H8F A;  4OYV A;  4YKP A;  3SEX A;  1A40 A;  3TTL A;  3GXA A;  1A8E A;  1PEB A;  1P1N A;  3R6U A;  4X9T A;  1NH7 A;  1PDA A;  4QF9 A;  3N6U A;  2REJ A;  4FIM A;  2R71 A;  3CI8 A;  5AA1 A;  1YAE A;  4G8N A;  4YKI A;  4OER A;  1FQD A;  1MXZ A;  3C32 A;  1VR5 A;  2Z8D A;  3I5O A;  4KQP A;  1N7W A;  3TQW A;  3H7M A;  4GD5 A;  4F29 A;  2F5X A;  5J1D A;  3TAJ A;  1MXY A;  1SW2 A;  1B5I A;  3KEI A;  3VFJ A;  2GFE A;  5I57 B;  4ZZE A;  3O97 A;  2VOZ A;  2DP8 A;  1JVX A;  2DVC A;  1MPB A;  4F3G A;  1R6Z A;  2GH9 A;  4KHZ E;  1KWH A;  2WKY A;  4X1B A;  2E0S A;  2V93 A;  1D4N A;  2ESN A;  4GXA A;  4H1X A;  1XVY A;  2I4C A;  2FA7 A;  2I6E A;  1VE4 A;  2Z22 A;  3DP4 A;  3I6V A;  4O3A A;  5I2N B;  3T66 A;  4UA8 A;  3IOW A;  2HAU A;  3CSB A;  3VLU A;  5FHM A;  3KSJ A;  4LQ2 A;  3RNN A;  2Q9T A;  3PD8 A;  3TMG A;  1D3K A;  1BLF A;  1LB8 A;  1VFE A;  4JDF A;  1GV8 A;  3S9E A;  2QSX A;  2XHD A;  1B32 A;  1XOC A;  4DXC A;  1B0H A;  4F2Q A;  5IKB A;  1H3D A;  1USY H;  4POW A;  4OFL A;  5TP9 B;  1Y3N A;  2NVU B;  2F8D A;  3H6U A;  4PFT A;  4AB5 A;  1JW1 A;  4RNS A;  3B6W A;  1P1W A;  4PET A;  2Y7K A;  5I59 A;  1DPE A;  5AA4 A;  2XD2 A;  3MQ9 A;  1I6Q A;  1MG1 A;  1XHY A;  5I57 A;  4YMA A;  4YB5 A;  5M2V A;  1MDQ A;  4IGR A;  3JZJ A;  5DEX B;  4KR5 A;  3Q25 A;  4ZE9 A;  3IB2 A;  2ONR A;  3ZKK A;  3HST A;  1D9V A;  3THI A;  3IB1 A;  1ZLQ A;  4BLA A;  3K6W A;  3C9H A;  3U94 A;  2F78 A;  2CMO A;  2HCA A;  1P1O A;  3OEN A;  4ZEC A;  1ZTY A;  4X48 A;  3OD7 A;  3MZB A;  3U8Q A;  1Y9U A;  4OWD A;  4LON B;  3SEU A;  4OQO A;  3HPI A;  1TFD A;  3OOA A;  1OQH A;  3JYR A;  1EU8 A;  1ZMG A;  4I9D A;  2IA4 A;  1IXG A;  3HHF A;  2I49 A;  4F1Y A;  4C0R A;  4G8M A;  5TP9 A;  5FTH A;  1B4H A;  2ONK E;  4LZ7 A;  1PC3 A;  2M8C A;  3EHU A;  3OO7 A;  3PUY E;  3RUM A;  1SYH A;  2QS1 A;  3C4M A;  5F1Q A;  2O1L A;  1FTO A;  1M5B A;  2DWI A;  3M8U A;  1MY3 A;  1ZBM A;  4NMY A;  4KYD A;  1PB9 A;  2A5T B;  1UIV A;  4ELP A;  3HN0 A;  3FJM A;  1OMP A;  4POX A;  3G3G A;  5DEX A;  1LCF A;  2VGQ A;  3FXU A;  4F1U A;  4GFR A;  2B3B A;  3H03 A;  4GRK A;  4YAH X;  2O51 A;  1FQF A;  3AXF A;  4OEN A;  3VE1 B;  3D4C A;  1Y1Z A;  5KCJ A;  4ISU A;  4ZZA A;  1IXC A;  1MM7 A;  3A3C A;  4Q5T A;  2P0S A;  1IUD A;  1SW1 A;  2I3V A;  4C1T A;  1B0L A;  3RGY A;  3K01 A;  1O64 A;  2V84 A;  5ITO A;  4NF5 B;  3CG1 A;  3TTM A;  4YKJ A;  2HZL A;  4QRZ A;  3UK4 A;  2F97 A;  4P0I A;  4OVJ A;  3C33 A;  5HBC A;  5EHS A;  1N3W A;  1WOD A;  3MW0 A;  4G68 B;  4WED A;  4BDN A;  2ZNS A;  3A09 A;  3W9V A;  1FQE A;  4BDL A;  4U4X A;  4BDM A;  3H3G A;  4N13 A;  2DXY A;  3G3F A;  4K3F A;  2YPN A;  2AL4 A;  3C31 A;  4RK2 A;  3OO6 A;  4U2R A;  3OEM A;  3WAE A;  3QUJ A;  4RYA A;  5HPQ A;  3D4G A;  4O3C A;  2E1S A;  1B51 A;  1AL3 A;  3HCQ A;  2A5T A;  4P11 A;  3MUQ A;  1M5C A;  2X7P A;  1A99 A;  1NNF A;  4NF4 B;  4Z0I A;  5F7V A;  1IZ1 A;  5AA2 B;  2PT2 A;  1B7U A;  1JW4 A;  3EN3 A;  1B3G A;  3TTN A;  4R75 A;  3KBR A;  4RPN A;  4YMB A;  3K4U A;  4EXK A;  2O7I A;  2XD3 A;  5BUU A;  1MRP A;  2HXW A;  3KOS A;  2X7Q A;  4AQ4 A;  2DE4 A;  5I84 A;  3CR9 A;  1B5J A;  2NWJ A;  1B05 A;  3S9N C;  4RXL A;  3TQL A;  1FQC A;  3LUY A;  1LAF E;  2F6G A;  1LLS A;  5ICT A;  3TZA A;  4NF8 B;  3Q27 A;  5ICQ A;  3K1P A;  1MS7 A;  1WDN A;  1LGB C;  2H25 A;  1IEJ A;  3K1N A;  4RA1 A;  1NNK A;  1XT8 A;  4EUO A;  1MPD A;  2I48 A;  4FAJ A;  4XKQ A;  3W15 C;  3RQT A;  4G68 A;  3DP6 A;  4QFK A;  3LSX A;  1ZIU A;  2P1S A;  1MXV A;  4ZEB A;  4I8C A;  1SVX B;  4DLD A;  4OET A;  3K6V A;  4Q30 B;  1JW5 A;  1SYI A;  4OTE A;  5B70 A;  2I58 A;  3MZ1 A;  4G77 A;  4YIC A;  3O66 A;  4QFO A;  4PFU A;  4ZE8 A;  3HV1 A;  3ZS6 A;  2NOO A;  1IIW A;  4IO5 A;  3L6H A;  4OMB A;  1MXX A;  4OXV A;  4YU0 A;  4FAT A;  4ND9 A;  2PX1 A;  2F7C A;  4TLM B;  5ELV A;  1B2H A;  3TEP A;  3PV0 E;  4QFL A;  3PUX E;  3RLF E;  4F18 A;  4ZEI A;  3ZSF A;  4FED A;  3ODB A;  4QFN A;  4H0W A;  2BJJ X;  3E9X A;  1N0T A;  1D9Y A;  2A5S A;  2RC7 A;  2NUV A;  4Z7E A;  1A55 A;  3DEL B;  4F1V A;  2QS3 A;  2B3F A;  3O6I A;  4NF8 A;  4IO4 A;  3PMW A;  1URS A;  1ELJ A;  3C36 A;  3FZV A;  2ZMB A;  2DS9 A;  2QMX A;  2Z8F A;  1B6H A;  1EH3 A;  3MZ9 A;  4XXU A;  1M5D A;  3U92 A;  2OLB A;  1L5T A;  2B65 A;  1AOV A;  2I3W A;  4R6Y A;  3FVN A;  3PUV E;  5BWJ A;  3GBB A;  3Q29 A;  3IK6 B;  3RN8 A;  2XX9 A;  2XXI A;  3OO8 A;  4LAT A;  1RYX A;  1A7L A;  1JQF A;  4ESX A;  2D3I A;  5KDT B;  1YCJ A;  3KJ7 A;  1SQY A;  4GOT A;  2PMS A;  3U93 A;  4HS7 A;  1Y1M A;  4H8I A;  2QS4 A;  4F2O A;  3K6U A;  4WKM A;  3FVO A;  3VVE A;  1Y4C A;  3MP8 A;  4R2F A;  3TOD A;  3TPA A;  4F31 B;  5JK4 A;  3LR1 A;  5AE4 A;  3RT6 B;  4M4G A;  4FE8 A;  1N3X A;  3QAX A;  4BDO A;  4YKK A;  4IY6 A;  3E4R A;  4KYS A;  1BKA A;  3KG2 A;  3KN3 A;  3V5A A;  3PUW E;  1IXI A;  2OBG A;  2REG A;  4OHN A;  3V89 B;  3CSG A;  3OSQ A;  4IGT A;  4BDR A;  1MQG A;  1QJM A;  1TXF A;  3N5L A;  3IB0 A;  1MH4 A;  2QL3 A;  2Q8J A;  1YPN A;  4TLL B;  1B46 A;  3BFT A;  3IAZ A;  5L9S A;  1F9B A;  3SDF A;  1B52 A;  4X1D A;  3OEL A;  3MJN A;  1R9Q A;  3S9L C;  1TWY A;  4HTG A;  4PFW A;  1I6B A;  2LAO A;  1JEU A;  1AIV A;  4I62 A;  5KDT A;  1XC1 A;  2ONS A;  4BDQ A;  2X26 A;  1QUI A;  1LAX A;  1CB6 A;  5EHM A;  3Q28 A;  4EQ7 A;  4PFY A;  1MQI A;  1H45 A;  4EQ9 A;  5K2X A;  3PD9 A;  3QIM A;  5CRY A;  4F22 A;  5IAI A;  1I69 A;  2XXQ A;  1ANF A;  4R9G A;  1GVC A;  3UIF A;  5CMC A;  3MVW A;  3PMX A;  3CFX A;  3IJX B;  2G29 A;  3PU5 A;  5I2N A;  3RT8 A;  2OWT A;  2O6A A;  1H76 A;  4R6H A;  1LFH A;  1EZP A;  2ZNT A;  3PPN A;  4NWD A;  3U1O A;  4H8J A;  4KCC A;  1IXH A;  1MXU A;  4H65 A;  2F6P A;  4OEU A;  1DSN A;  4JSD A;  4R73 A;  2D5W A;  2XXX A;  4ZS9 A;  5DYH A;  4OEV A;  4IO6 A;  3CRB A;  2UVH A;  4LQ5 A;  2NXO A;  3BBR A;  1SW4 A;  2V25 A;  4C1U A;  1HSE A;  3OXN A;  1US4 A;  3UA8 A;  1LB9 A;  5TU0 A;  3TKD A;  5DVF A;  2ZNU A;  3WAF A;  5I56 B;  4FOR A;  4GF8 A;  1MH3 A;  3UOR A;  4ZDM A;  4OFJ A;  1RKM A;  4F3P A;  5CMM A;  2F36 A;  1JEV A;  2DE2 A;  3T9U A;  2VD2 A;  3IOV A;  1DOT A;  4KYE A;  3L6G A;  3TCG A;  1POT A;  2XX7 A;  1B5H A;  4THI A;  1LBB A;  3EHS A;  3QUF A;  3FD3 A;  4RK9 A;  1SW5 A;  2PT1 A;  4EDP A;  3MC2 A;  3PPO A;  3PUZ E;  4TQU Q;  2RCB A;  3FGS A;  3CVG A;  3UP9 A;  4F19 A;  4NF6 B;  3LSL A;  2RC8 A;  3VLW A;  2UVG A;  4JSO A;  1H44 A;  4G4P A;  2VHA A;  3LSF B;  3FIR A;  1FW0 A;  4P0G A;  2FYI A;  1M5E A;  3V8X B;  2RF1 A;  1XS5 A;  1QUJ A;  3K00 A;  4KPT A;  2Q89 A;  1P1Q A;  3RTF B;  1Q35 A;  4U1O A;  1QW0 A;  1NL5 A;  1II5 A;  4MH5 A;  1LAG E;  4KFQ A;  3I3V A;  5L8D A;  2RCA A;  4IO7 A;  3K6X A;  2ABH A;  2HAV A;  1ZKB A;  3PPQ A;  3SEW A;  1S9T A;  3T96 B;  2F7A A;  3DP8 A;  1B7Z A;  1NH8 A;  3ZKL A;  4Q8R A;  3K02 A;  3LC8 A;  1B3H A;  2O84 X;  4RY1 A;  1FQB A;  3FXR A;  1QUL A;  1J1N A;  3DLN A;  3FJ7 A;  2F35 A;  3MBP A;  3B7D A;  2XXH A;  1MPC A;  3UN6 A;  2HQ0 A;  1CE2 A;  2OZZ A;  4NF6 A;  1BP5 A;  4LP2 B;  1BIY A;  4YZZ A;  3TYH A;  1ATG A;  2R9J A;  2O7U A;  2UVJ A;  2DSF A;  2H9B A;  1B4Z A;  3H4Z A;  2XXR A;  3MP6 A;  4NF5 A;  1DTZ A;  3FJG A;  3SER A;  2YJP A;  4JWX A;  4R72 A;  3KGC A;  3LBS A;  2V3T A;  4PP0 A;  4F3S A;  1NFT A;  3IJO B;  5H8F B;  3TUS A;  3A3U A;  1SDX A;  1OVB A;  2I0C A;  4OZ9 A;  1N7X A;  4WXJ A;  4IB2 A;  1GGG A;  1Y4T A;  3ECR A;  2QJE A;  2UVI A;  3EPE A;  5CC2 A;  3T22 A;  3MPK A;  3N94 A;  4KI0 E;  3KSX A;  5CM6 A;  2HEU A;  1MQD A;  3IOT A;  3R26 A;  3KZG A;  3C35 A;  1MDP 1;  2F7B A;  4R6K A;  4NF4 A;  2KLF A;  4MF3 A;  1YTV A;  5K2Y A;  5AA2 A;  1USY E;  3W9W A;  4ECF A;  1RYO A;  2IEE A;  4I1D A;  1MM6 A;  3KJT A;  2Z8E A;  2Y7W A;  2H5Y A;  2UYE A;  1MQH A;  1P99 A;  1OVT A;  5CMK A;  1UTB B;  3PPP A;  3CIJ A;  1AH5 A;  1FCK A;  4GL8 A;  1US5 A;  3FXQ A;  2Y7P A;  2H4I A;  4N6P A;  4N07 A;  1T0K A;  3N6T A;  5HM4 B;  5A5X B;  5CMB A;  1B40 A;  3FVK A;  2Y7I A;  3O9P A;  3PGF A;  3VDF A;  3VV5 A;  3S2V A;  1B3F A;  2ZYM A;  4JB7 A;  3U72 A;  3QXM A;  2Q2C A;  3FUZ A;  2P2A A;  1PBQ A;  3SEY A;  2ALU A;  1IQ7 A;  4EQB A;  5H8N B;  3TEL A;  2RKM A;  4PQJ A;  5I59 B;  4QSE A;  1MXW A;  3HO7 A;  1ZU0 A;  4DE8 A;  2THI A;  4YB7 A;  4U23 A;  5AA4 B;  1NKX A;  4EF2 A;  2PBW A;  4MBP A;  5JEI A;  3FAS A;  1JVY A;  3QSL A;  1QVS A;  1UTH B;  3V83 A;  4NE4 A;  3SKP A;  3EQ1 A;  2OWS A;  3OMB A;  2I4B A;  5AA3 A;  3G3K A;  5I58 B;  5L9M A;  4WEP A;  1UTB A;  4HCW A;  3G3I A;  5H8H B;  3VVD A;  4GWO A;  4IY5 A;  4U22 A;  4H5G A;  4M1V A;  4H6D A;  1N76 A;  1Y3P A;  1HSL A;  3TTK A;  1M5F A;  1O7T A;  2R6G E;  3OSR A;  4IO3 A;  1LBC A;  2OK2 A;  1VFD A;  2DWJ A;  4MFI A;  1MY2 A;  4YB6 A;  5A5X A;  2DQV A;  3T9V A;  4NTL A;  5EYF A;  3S9M C;  5AA2 D;  3DM0 A;  3H6V A;  3MPL A;  3O29 A;  3R7X A;  3H6T A;  1AMF A;  3M3F A;  3IL1 B;  3IOR A;  1FTM A;  2F34 A;  2DE3 A;  2XXU A;  1URG A;  2HZK A;  4XTC Q;  5H8N A;  4ELQ A;  3GZG A;  3JV9 A;  2Q2A A;  4QSD A;  2ZYK A;  3M3K A;  3FVG A;  1MY0 A;  4G2Z A;  4QFP A;  2W7Y A;  2V3U A;  4XKR A;  3TFL A;  1QUK A;  4OFO A;  1A54 A;  4LZ5 A;  4LA9 A;  3RPW A;  1HSJ A;  1UTH A;  3IO6 A;  3G3J A;  3H6W A;  4EXL A;  4DIG A;  1B9J A;  4DCY A;  4L17 A;  4JWY A;  5I58 A;  2XXV A;  4HCY A;  4Q0C A;  2GHA A;  3MVZ A;  3VXB A;  5H8H A;  1LFG A;  2OJT A;  2PYY A;  2CZL A;  1LCT A;  3QYT A;  5CBR A;  4FJP A;  4NWC A;  1MQJ A;  4G8H A;  5KCJ B;  1DTG A;  2OCU A;  3F11 A;  2XXP A;  1FTL A;  2AL5 A;  1O63 A;  3IR1 A;  4UAC A;  2Z23 A;  2H98 A;  4R74 A;  3O6G A;  1P1U A;  1TT1 A;  5DTB A;  5B7D A;  2O68 A;  3N26 A;  1UQW A;  4AB6 A;  3KN8 A;  3FV2 A;  4NED A;  3CFL A;  1SI1 A;  3UGW A;  1R1N A;  4LUB A;  2DXR A;  2AYS A;  1SBP A;  5JTY B;  3SET A;  3RY3 A;  2ZYO A;  3HHG A;  2DVZ A;  2O69 A;  3USD A;  3GBA A;  4ZEF A;  5I2K B;  4RJZ A;  3MWB A;  1I6A A;  4R9F A;  4IO2 A;  5DVI A;  4U1Z A;  1IIT A;  5ITP A;  4ZED A;  4F3B A;  3ONM A;  4ONY A;  4H5F A;  5FHN A;  2DYX A;  1GTK A;  1EZO A;  3B6T A;  2GHB A;  3P7I A;  4GLI A;  4DXB A;  3OEK A;  3G7W A;  5KZT A;  1NNP A;  4DCX A;  2DWH A;  4DZ1 A;  3CG3 A;  2UYF A;  4FEC A;  1JNF A;  1UIU A;  3K0V A;  1SD3 A;  3O28 A;  2RC9 A;  1OIB A;  4U21 A;  2UXA A;  5H8Q B;  4LZ8 A;  1OQG A;  5CI5 A;  1WVJ A;  4O3B A;  4JXI A;  2RIN A;  3BFU A;  3TDJ A;  1NMU A;  4DDD A;  4H67 A;  4GXS B;  4XIG Q;  3EF7 A;  4TOZ A;  1PB7 A;  3T93 B;  2HFB A;  1R9L A;  3IO4 A;  3MAM A;  2GRV A;  2Y7R A;  5TPA B;  3E13 X;  1FTK A;  1LAH E;  4U4S A;  3H06 B;  5FTI A;  5JTY A;  1Y3Q A;  3FV1 A;  2V3Q A;  2O1M A;  1B3E A;  5I2K A;  2ZYN A;  1N04 A;  2XXY A;  4ELO A;  1POY 1;  5I56 A;  4E0X A;  1LFI A;  1A8F A;  1BTJ A;  3IX1 A;  1VSO A;  2I0B A;  4OES A;  1MY4 A;  4E0W A;  3KFM A;  3S4U A;  3TCF A;  3O2A A;  3KN7 A;  5LOM A;  3G3H A;  1JET A;  3MVX A;  4GVO A;  1PBP A;  1Y20 A;  1FTJ A;  1B1H A;  3Q26 A;  3VXC A;  3ILT B;  4MLV A;  1OLC A;  2QS2 A;  2DOJ A;  1NNT A;  1QKB A;  3TTR A;  4ZEK A;  1DPP A;  4HW8 A;  5FHO A;  4JWO A;  1B1X A;  4R2B A;  2Q88 A;  2FNC A;  3ILU B;  4DXU A;  4KCD A;  5H8Q A;  1TFA A;  4G68 C;  1B7H A;  3KOT A;  5DVJ A;  1B58 A;  3SES A;  4GIZ A;  4KD5 A;  2QMW A;  1Z7N E;  3RTW B;  2G93 A;  3MP1 A;  3OO9 A;  3T9H B;  1S50 A;  2H99 A;  1Z7M E;  5DT6 A;  3LSW A;  1URD A;  4MLQ A;  3VVF A;  4JBZ A;  3CFZ A;  1OLA A;  5TPA A;  4QHQ A;  5ISU A;  4PE5 B;  1LST A;  4ESW A;  3K2D A;  3B6Q A;  4XKP A;  1GR2 A;  2YLN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...