3ODBA

Haemophilus influenzae ferric binding protein a -iron loaded -open conformation
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
308
structure length
308
Chain Sequence
DITVYNGQHKEAATAVAKAFEQETGIKVTLNSGKSEQLAGQLKEEGDKTPADVFYTEQTATFADLSEAGLLAPISEQTIQQTAQKGVPLAPKKDWIALSGRSRVVVYDHTKLSEKDMEKSVLDYATPKWKGKIGYVSTSGAFLEQVVALSKMKGDKVALNWLKGLKENGKLYAKNSVALQAVENGEVPAALINNYYWYNLAKEKGVENLKSRLYFVRHQDPGALVSYSGAAVLKASKNQAEAQKFVDFLASKKGQEALVAARAEYPLRADVVSPFNLEPYEKLEAPVVSATTAQDKEHAIKLIEEAGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Iron-utilization periplasmic protein
publication title The role of vicinal tyrosine residues in the function of Haemophilus influenzae ferric binding protein A.
pubmed doi rcsb
source organism Haemophilus influenzae
total genus 113
structure length 308
sequence length 308
ec nomenclature
pdb deposition date 2010-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3odbA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3odbA02
3SEWA 1MY3A 3RPWA 5I59A 2HQ0A 1US5A 1ZKBA 4MH5A 1URDA 3RN8A 4G68B 3OENA 1LCFA 1DPPA 4G68A 3TPAA 4IB2A 2O51A 1PB9A 1LB9A 3TEPA 3ODBA 2DWAA 4F1YA 3E9XA 3TELA 4LA9A 3Q25A 3DP4A 3PPRA 3PUXE 2AIXA 1D9VA 1AIVA 3O28A 2FYIA 2X7PA 3HCQA 3MQ9A 4YKPA 1MDQA 4ZEKA 2UVJA 5CMMA 4IO3A 4Z7EA 5DT6A 5FHOA 4OESA 1Y4TA 2Q2AA 1LAFE 4H1XA 4U1ZA 1R6ZA 1IQ7A 3USDA 3K6XA 5DTBA 2ZYKA 2NXOA 4XTCQ 3A3CA 3FGSA 1JEUA 1FTMA 3GXAA 4N07A 3KJ7A 1N04A 2PYYA 2D3IA 1JW1A 3QYTA 3H4ZA 4RK2A 3UN6A 4PQJA 1KWHA 1R9QA 5HBCA 2YPNA 3K1NA 1M5CA 3WAFA 2P0SA 3OELA 4YMAA 4GD5A 3JYRA 1JW5A 3FUZA 2DE4A 5DEXB 2ABHA 4K3FA 4H67A 3T93B 3R6UA 4OXVA 4GF8A 3S4UA 3SKPA 5L9MA 4OFJA 1N7WA 3AXFA 1VFEA 4JSDA 4OMBA 4DXBA 4ELOA 4N13A 1Z7ME 1Y1ZA 2H9BA 1YTVA 1A54A 3MW0A 3FJ7A 3M3FA 1B2HA 1I69A 4OENA 2Z22A 4RYAA 4BDRA 1P1UA 3PUYE 3VV5A 4Z0IA 4L17A 1OLCA 2ZNSA 4U23A 3UK4A 2PX1A 3CFZA 2QJEA 3MUQA 5IKBA 5DYHA 4THIA 4MLVA 2OWTA 3MBPA 1IZ1A 2QMXA 1MPBA 4MBPA 4R6HA 1FTLA 4GIZA 1JQFA 2F36A 2B65A 4QFKA 1B40A 1OVTA 3QUJA 3FATA 4FAJA 3K01A 5TPAB 1MXWA 2WKYA 3Q29A 2I3VA 3TCGA 4POXA 1O64A 4KHZE 4DZ1A 3CI8A 4F18A 2DWHA 2OZZA 3OD7A 4LQ2A 3MPLA 4EQ9A 3KN3A 1XC1A 4WEPA 1OMPA 4EUOA 1DTZA 2IEEA 1XHYA 3OO9A 2DQVA 5JEIA 3ZSFA 1GV8A 5H8QB 4IO4A 4R9FA 4R72A 2AYSA 3B6WA 4XKRA 2GFEA 4F3GA 1GGGA 1URGA 3IX1A 4GOTA 4YKKA 2UVIA 2RKMA 2H99A 4JWXA 1B3GA 3TTMA 3T22A 2HAVA 2Y7WA 2V3QA 1P1NA 2Y7PA 3G3JA 1FTJA 2A5TB 4ZZAA 2DWJA 1UTBB 4IY5A 2A5TA 5CMKA 4RPOA 1ZBMA 1UTBA 2PBWA 1P1OA 1P1WA 2Z8DA 3C31A 5L9SA 4OHNA 3OO6A 2G93A 2FA7A 3DP8A 1QVSA 1B58A 4F2OA 1A7LA 3QUFA 4X1BA 5FHMA 4GL0A 4F2QA 5AA3A 3OSQA 2YJPA 2DXRA 2F6PA 4I1DA 4KCCA 2ONRA 4HTGA 4RJZA 2Z23A 3VXBA 4RXLA 4FIMA 4Q8RA 1A40A 1NL5A 5CMBA 3DLNA 4YAHX 4RNSA 1B1XA 4DCYA 1Q35A 4H5GA 4DLDA 2ALUA 2V84A 2RCBA 4M4GA 1Y4CA 3SDFA 3T66A 3ILTB 3OOAA 3SETA 2B3BA 3O29A 5L9OA 1OQGA 1MQIA 4NMYA 4R2BA 1B3FA 4KR5A 4H8JA 1B9JA 3UA8A 4YKIA 5CBRA 1PBQA 2XXWA 1FCKA 3QAXA 3IOVA 3IOTA 2THIA 4ND9A 2QL3A 2M8CA 2QPQA 3DELB 3U8QA 3O66A 4LUBA 3SEXA 2XXHA 4FORA 2OWSA 3KFMA 5JTYA 4AB6A 2YLNA 1IEJA 1B3EA 4R6KA 1SYHA 2QS2A 4G77A 2F35A 3BFTA 4GFRA 3THIA 2Y7RA 4DXCA 1QJMA 2I48A 2RINA 1IUDA 4YZZA 3EHTA 1F9BA 3TQLA 3RQTA 5KCJA 3RNNA 3O97A 1SBPA 5ITPA 2ZXTA 1B32A 1TT1A 5TP9A 3QSLA 2VD2A 4RPNA 1MRPA 3I3VA 3B6QA 3OO8A 4MFIA 1DTGA 4QF9A 2G29A 2O1LA 5IAIA 1NH8A 5KZTA 4U4XA 4DDDA 4G4PA 3PD8A 4ESXA 2R71A 4ZECA 1PDAA 2X26A 3KOSA 3VDFA 1M5DA 2F7CA 1XVYA 2GHAA 1GR2A 1ZIUA 2Q2CA 5BWJA 5I58B 5I58A 3QK6A 2ZYNA 4H65A 3SERA 3LSXA 1H3DA 3HSTA 1AMFA 4Q5TA 2HCAA 3ECRA 3VLWA 3KOTA 1M5BA 3CFXA 3MC2A 3TFLA 4GLIA 4O3AA 3K6VA 4KYDA 3T9VA 3UP9A 2H5YA 2IA4A 2PT2A 3T9HB 4XKQA 1QUJA 3FJMA 4FE8A 3EHUA 2Q8JA 2PMSA 3HN0A 3G3HA 3G3IA 4LZ7A 4IO6A 4ZDMA 2RCAA 1AOVA 2HFBA 4LVQA 4RK9A 4IY6A 2I3WA 3S9NC 4TLLB 1XT8A 1R1NA 5KDTB 2F97A 5KDTA 3PUZE 3MP1A 2O7UA 2I4BA 2UYFA 5AA2D 5CC2A 1MQDA 3BKIB 1B5IA 5I59B 1LSTA 4QSDA 1SW1A 1MPDA 3CSGA 4QSEA 3H06B 5A5XA 4R6YA 3MVWA 4ZE8A 3CSBA 3ILUB 3K6WA 1NMUA 1LFGA 4JB7A 4F31B 2DVCA 1O63A 3K00A 3G3GA 5TU0A 4G8HA 5EHMA 1MXUA 1H43A 1QKBA 4WKMA 1LAGE 1CB6A 3LSFB 1O7TA 1WVJA 3KN7A 4KD5A 4F22A 2XXXA 1PEBA 4XXUA 3MVZA 5I2NA 4IGRA 2FNCA 2D5WA 1UTHA 2XXRA 5M2VA 3D4CA 2XXVA 1H45A 3I5OA 1NNFA 3FVNA 2AL5A 5ICTA 3WAEA 5ISUA 3IJOB 1QKAA 4GWOA 4OYVA 1MS7A 3SEYA 1L5TA 2D21A 1LAXA 4NTLA 5ELVA 1POTA 4NWDA 2ANJA 1IXCA 3MWBA 2ZNTA 1HSJA 1JETA 3O2AA 3KG2A 3PPOA 3P7IA 1SDXA 4HS7A 4KCDA 2H25A 2ZNUA 3IAZA 3V5AA 3MP6A 1R9LA 2DYXA 3LUYA 3TUSA 4JSOA 4LZ8A 4OVJA 1WODA 5H8FB 2Z8FA 3VVEA 5H8FA 3RUMA 1B7ZA 3K1PA 1A55A 3ONMA 4XKPA 3K0VA 4F39A 3IB1A 3MZ9A 3H3GA 1RYXA 4GXSB 4I8CA 2RC8A 2UYEA 3G3KA 3GZGA 1N0TA 3U72A 1JEVA 1ZTYA 2OJTA 3H6UA 3TQWA 1PBPA 4IO5A 3G3FA 1USYH 3Q26A 1I6BA 1BKAA 1N3XA 1TFDA 3T9UA 3L6GA 4QFPA 3S9MC 3E3KA 1M5EA 3IO6A 1URSA 1SYIA 3U92A 3LBSA 2I0BA 1OLAA 1N7XA 3Q27A 3FJGA 4NF6A 4P0GA 4OFLA 2CMOA 3DP6A 2UVHA 1H44A 1AL3A 4ZE9A 3ZKKA 2O68A 5F1QA 1IXIA 3QIMA 4OERA 3C35A 3DM0A 4ZEFA 4G68C 1B3LA 1Y1MA 1HSLA 3FV2A 2HAUA 1SI0A 2B3FA 1NNKA 3CG3A 1MM7A 1FTKA 4ELQA 2NWJA 3VVDA 3BFUA 3FV1A 1P1QA 2REGA 3SEUA 1QUKA 3RTFB 2I49A 3RGYA 1B4ZA 2OCUA 4R74A 1PB7A 4E0XA 5DVIA 1MXVA 5B70A 1LFIA 4LONB 1B5JA 2H4IA 4TLMB 3IB2A 3W9VA 1B46A 3LSLA 4BDNA 4NF8B 4JWYA 2Q9TA 1AH5A 4NF8A 2QS4A 2DXYA 4NE4A 2UVGA 1NNPA 1LBCA 5CBSA 1B7HA 3OSRA 4P11A 3KGCA 3LC8A 3M3LA 1J1NA 3FXUA 4OQOA 3FVOA 2A5SA 5ICQA 3F11A 4EF2A 4BDOA 2RF1A 1P99A 4R75A 1DSNA 2ZMBA 3VLVA 4EDPA 3MJNA 4F3PA 1FQCA 1B1HA 2DWIA 3IR1A 1EZOA 4NF4A 1FQDA 2XXYA 2QSXA 3EN3A 4P0IA 4EQ7A 2F5XA 1UIVA 3TMGA 1RKMA 5JTYB 1MY1A 5J1DA 4NF5B 4NF5A 3B7DA 5K2YA 2Y84A 4PP0A 3VFJA 4UACA 4PFWA 3G7WA 2H98A 4ELPA 1DOTA 2DS9A 4Q30B 4AB5A 3FXRA 1YCJA 4LATA 4ELRA 2PT1A 5FTIA 1MQHA 2HZLA 2NVUB 2O84X 5KCJB 3KSXA 2V3TA 1OIBA 1JW4A 4BDQA 4F3BA 3H7MA 3SESA 3N6TA 3UIFA 4FATA 5EYFA 4ZEDA 5TP9B 3O6GA 1XOCA 3D4GA 1OVBA 2DSFA 3HHGA 4OTEA 4IO7A 1MQGA 1SW2A 3PU5A 3O6HA 5I57B 4ONYA 3N6UA 4DCXA 2XD3A 1NKXA 5I57A 1SD3A 1HSEA 2XXUA 3L6HA 3TZAA 3HHFA 3KSJA 1ANFA 2HEUA 3CG1A 1B52A 1FQAA 4QHQA 4C1UA 4MF3A 1TXFA 3M8UA 4UA8A 2R6GE 3UGWA 3CRBA 3T96B 1S50A 1LBBA 4X9TA 4IO2A 1MPCA 1LB8A 2DE2A 3C9HA 2QS3A 4I9DA 1EU8A 2AL4A 1S7YA 2I4CA 4RA1A 1B0HA 2Q88A 3A09A 3IOUA 2OK2A 1SVXB 3PMXA 3HO7A 3LR1A 1SW5A 3MP8A 3KZGA 4HW8A 5I84A 1MY4A 3LSWA 4ZEIA 3TTRA 2P2AA 3I6VA 1NH7A 2RC7A 3FIRA 4NWCA 4PE5B 1MH3A 4MLQA 4JDFA 2DP8A 1Y3PA 3FVKA 4PETA 2O1MA 3EF7A 3MVXA 1ZMGA 1UQWA 2BJJX 3OMBA 3RY3A 3TTKA 3K6UA 4PFTA 4GRKA 3RT8A 5L8DA 4BDLA 5AA1A 4C0RA 3VVFA 1MM6A 3C4MA 2HZKA 4G8NA 4EQBA 1D3KA 4DXUA 5A5XB 4AQ4A 4U21A 4GQOA 3UORA 2XXQA 4F29A 3VLUA 5HM4B 4YKJA 4OFOA 3T9XB 1OQHA 4G8MA 3U1OA 1QUIA 1MH4A 5H8NB 5H8SA 3OXNA 5I2NB 1QULA 5H8NA 3TTNA 1BLFA 1FQBA 4TQUQ 1BIYA 1ZLQA 1UTHB 1POY1 2F78A 3H6WA 3KEIA 1Y3NA 4LQ5A 3GBBA 4H6DA 2F7BA 1N76A 2ZYOA 1B51A 5FTHA 4FJPA 3IOWA 1XS5A 3E4RA 1A8FA 3V89B 3OO7A 3N26A 2F7AA 4YB6A 2GRVA 2E0SA 2REJA 3JZJA 4R73A 2OBGA 4H5FA 4YB7A 4BLAA 1FTOA 3IL1B 5DVJA 2PVUA 2P1SA 3R7XA 4PFYA 2RC9A 1LAHE 4YICA 1UIUA 1ELJA 3K4UA 3K1MA 3U93A 4EXKA 3PPQA 4WXJA 2F8DA 5CMCA 5DEXA 4OZ9A 4KYSA 1YAEA 3W9WA 4KPTA 1S9TA 2QS1A 4JBZA 3N5LA 1CE2A 1NFTA 4ZS9A 2KLFA 1ZJLA 1ATGA 4JXIA 3N94A 4GL8A 3JV9A 1EZPA 3PD9A 2DVZA 4KI0E 3PGFA 3HV1A 1ZU0A 1MY2A 2I6EA 1GVCA 4LP2B 1MDP1 2O7IA 1B05A 3TAJA 4F1VA 3C32A 2VOZA 4YU0A 2XHDA 2Z8EA 4NF6B 5TPAA 3TYHA 4LZ5A 3B6TA 2VHAA 3PUVE 3CFLA 3C36A 1MQJA 1NNTA 1MY0A 2V3UA 2W7YA 4JWOA 3K02A 5JK4A 3SEVA 3CVGA 3Q28A 2LAOA 2I58A 1Y20A 2DOJA 3IJXB 3ZS6A 3W15C 4NEDA 1SW4A 5BUUA 1EZ9A 4R9GA 5H8QA 1Y9UA 3TODA 3FVGA 5AA2B 3KN8A 4ISUA 3BBRA 5AA2A 4ZEBA 2CZLA 4QSCA 4BDMA 2DE3A 3MZ1A 3PPPA 2XX8A 4EF1A 1DMBA 4FEBA 1B0LA 1A8EA 4HCWA 4F19A 1VSOA 1Y3QA 1IXHA 2UXAA 1MXYA 3FZVA 1BP5A 3VXCA 3C33A 3TTLA 3TDJA 5CI5A 5AE4A 4C1TA 1II5A 2ESNA 3PMWA 2Y7KA 3O9PA 4M1VA 2R9JA 1IXGA 4IGTA 3M3KA 3IK6B 2E1SA 2VP1A 1MXXA 1BTJA 3O6IA 1Q1KA 1XVXA 4KFQA 1IIWA 2ZYMA 4DIGA 2GHBA 3U94A 1N3WA 3V83A 2NOOA 4NF4B 4Q0CA 1US4A 3MVYA 1VR5A 4XIGQ 4N6PA 1PB8A 3PPNA 4U4SA 1QW0A 3CR9A 5FHNA 4QFLA 2VD3A 1Z7NE 4PFUA 1D4NA 1JVYA 3PV0E 1LCTA 4KQPA 4O3CA 5CM6A 2O6AA 2ONSA 2V93A 2O69A 4FECA 1VFDA 3FXQA 4YMBA 2QRYA 2HXWA 4H8IA 1B5HA 4GVOA 3MZBA 1N84A 1USYE 4WEDA 3VE1B 3H6VA 3IO4A 4TOZA 3OEMA 2XXIA 4YB5A 3RLFE 2OLBA 1LFHA 3CIJA 2GH9A 5AA4B 1LLSA 2ONKE 1SI1A 3A3UA 5ITOA 4GXAA 5AA4A 3R26A 3PMVA 3HPIA 1H76A 5DVFA 3FASA 3QXMA 5CRYA 3TCHA 4OEUA 2X7QA 5H8HB 4XKNA 2VGQA 3KJTA 3S9EA 5EHSA 5H8HA 2I0CA 4U1OA 1EH3A 1IITA 2V25A 4O3BA 4U22A 1TWYA 3EHSA 4HCYA 3ZKLA 3PUWE 1I6AA 3GBAA 2XD2A 1SQYA 4F3SA 3RT6B 1MXZA 3H03A 3GLBA 4OEVA 4E0WA 2XX9A 1B6HA 5K2XA 3IB0A 1DPEA 3TKDA 1D9YA 1LGBC 2XXTA 4ESWA 4F1UA 3IORA 3S2VA 1JVXA 4U2RA 5LOMA 1JNFA 5I56B 4POWA 1B3HA 1PC3A 4ECFA 1FQFA 5I56A 2F6GA 1I6QA 2XXPA 3RTWB 5HPQA 3C34A 4QFOA 5B7DA 4G2ZA 4X1DA 1B7UA 1MG1A 3OEKA 1YPNA 1FW0A 3TCFA 1T0KA 5I2KB 4KYEA 4X48A 3MPKA 5I2KA 4I62A 2NUVA 4OWDA 3MAMA 4R2FA 1VE4A 3E13X 1TFAA 4DE8A 1RYOA 4OETA 1B4HA 3V8XB 3EQ1A 4H0WA 3S9LC 5F7VA 2Y7IA 4RY1A 3K2DA 3H6TA 1M5FA 4QFNA 2QMWA 2F34A 1FQEA 2XX7A 4EXLA 1WDNA 3KBRA 4ZZEA 4FEDA 4QRZA 1GTKA 3EPEA 3FD3A 1A99A 2Q89A
chains in the Genus database with same CATH superfamily
3SEWA 1MY3A 3RPWA 5I59A 2HQ0A 1US5A 1ZKBA 4MH5A 1URDA 3RN8A 4G68B 3OENA 1LCFA 1DPPA 4G68A 3TPAA 4IB2A 2O51A 4N91A 1PB9A 1LB9A 3TEPA 3ODBA 2DWAA 4F1YA 3E9XA 3TELA 4PE3A 4LA9A 3Q25A 3DP4A 3PPRA 3PUXE 2AIXA 4OVQA 1D9VA 1AIVA 3O28A 2FYIA 2X7PA 3HCQA 2FBPA 3MQ9A 4I40A 4YKPA 1MDQA 4ZEKA 1FBEA 2UVJA 5CMMA 4IO3A 4Z7EA 5DT6A 5FHOA 4OESA 1Y4TA 2MKZA 2Q2AA 1LAFE 4H1XA 4U1ZA 1R6ZA 1IQ7A 4N4UA 3USDA 3K6XA 5DTBA 2ZYKA 5A5LA 2NXOA 2P3VA 4MAGA 4XTCQ 3A3CA 3FGSA 2Q8MA 1YYZA 1JEUA 1FTMA 3GXAA 2Q74A 4N07A 3KJ7A 2CZKA 1N04A 2PYYA 2D3IA 1JW1A 3QYTA 3H4ZA 4RK2A 3UN6A 4PQJA 1NV6A 1KWHA 1R9QA 2L5VA 5HBCA 2YPNA 3K1NA 1M5CA 3WAFA 2P0SA 3OELA 4YMAA 4GD5A 3JYRA 1JW5A 3CHGA 3FUZA 2DE4A 5DEXB 2ABHA 4K3FA 4H67A 3T93B 3R6UA 4OXVA 4GF8A 1KA0A 3S4UA 3SKPA 5L9MA 4OFJA 2VT5A 1N7WA 3AXFA 1VFEA 4P9KA 4JSDA 4OMBA 4DXBA 4ELOA 4N13A 1Z7ME 1Y1ZA 2H9BA 1JP4A 1A54A 1YTVA 3MW0A 3FJ7A 3M3FA 1IMDA 1B2HA 1I69A 4OENA 2Z22A 4JVCA 4RYAA 4BDRA 1P1UA 3PUYE 3VV5A 4Z0IA 4L17A 1OLCA 1LBWA 2ZNSA 4U23A 3UK4A 2PX1A 3CFZA 2QJEA 3MUQA 5IKBA 2FVZA 5DYHA 4THIA 4MLVA 2OWTA 3MBPA 1IZ1A 2QMXA 1MPBA 4MBPA 4R6HA 1FTLA 4GIZA 5EYHA 2FHYA 4GWWA 1JQFA 2F36A 2B65A 4QFKA 1B40A 1OVTA 3QUJA 3FATA 4FAJA 3K01A 4X04A 5TPAB 1MXWA 1NUZA 2PFZA 2WKYA 3Q29A 2I3VA 3TCGA 4POXA 1O64A 4KHZE 4DZ1A 3CI8A 2DWHA 4F18A 2OZZA 3OD7A 4LQ2A 3MPLA 4EQ9A 3KN3A 4MMPA 1XC1A 4WEPA 1OMPA 5ET7A 4EUOA 2R8TA 1DTZA 4NG7A 2IEEA 1XHYA 3OO9A 2DDKA 2DQVA 2ZZWA 5JEIA 3ZSFA 1GV8A 3BIHA 4GWYA 5H8QB 5IZZA 4IO4A 4R9FA 4R72A 2AYSA 3B6WA 4XKRA 2GFEA 4F3GA 1GGGA 1URGA 5IGAA 3IX1A 4GOTA 4YKKA 2UVIA 2RKMA 2H99A 4JWXA 1B3GA 3TTMA 2F3BA 3T22A 2VPOA 2QVVA 2HAVA 2Y7WA 2V3QA 1P1NA 2Y7PA 3G3JA 1FTJA 2A5TB 4ZZAA 2DWJA 1UTBB 4IY5A 2A5TA 4QBAA 5CMKA 2F3DA 4RPOA 1ZBMA 1UTBA 2PBWA 1P1OA 1P1WA 3IFCA 2Z8DA 4H46A 3C31A 5L9SA 3RYDA 4P1LA 5J16A 4O7MA 4OHNA 3OO6A 4XFEA 2G93A 2FA7A 3DP8A 1QVSA 1B58A 4F2OA 1A7LA 3QUFA 4X1BA 5FHMA 4GL0A 4F2QA 5AA3A 3OSQA 3RPLB 2YJPA 4PAIA 2DXRA 2F6PA 4I1DA 1IMCA 4KCCA 2ONRA 4P47A 4HTGA 4RJZA 1FPIA 2Z23A 3VXBA 1SPIA 4RXLA 2CZIA 4FIMA 4Q8RA 1A40A 4H45A 1NL5A 5CMBA 3DLNA 4YAHX 4RNSA 1B1XA 4DCYA 1Q35A 4H5GA 4DLDA 2ALUA 2V84A 2RCBA 4M4GA 1Y4CA 3SDFA 5F24A 3T66A 3ILTB 3OOAA 3SETA 2B3BA 3O29A 5L9OA 1OQGA 1MQIA 4NMYA 4R2BA 1B3FA 4PAFA 4KR5A 4H8JA 1B9JA 1NV2A 4O94A 3UA8A 4YKIA 5CBRA 1PBQA 2XXWA 1FCKA 3QAXA 3IOVA 3IOTA 2THIA 4ND9A 3E78A 2QL3A 2M8CA 2QPQA 3DELB 3O66A 4LUBA 3SEXA 3U8QA 2XXHA 4FORA 2OWSA 3KFMA 5JTYA 4AB6A 2YLNA 1IEJA 1B3EA 4R6KA 5T3JA 1SYHA 2QS2A 4G77A 2F35A 3BFTA 4GFRA 3THIA 4PAKA 2Y7RA 4DXCA 1QJMA 5IZ1A 5IM2A 2I48A 2RINA 1IUDA 4YZZA 3EHTA 4PFIA 1F9BA 3TQLA 3RQTA 5KCJA 3RNNA 2FIXA 2GQ1A 1SBPA 3O97A 5ITPA 2ZXTA 1NI9A 1B32A 1TT1A 5TP9A 3QSLA 2VD2A 4RPNA 1MRPA 3I3VA 3B6QA 3OO8A 1RDYA 4MFIA 4N6DA 1DTGA 4QF9A 2G29A 2O1LA 5IAIA 1NH8A 5KZTA 4U4XA 4NN3A 4DDDA 4N8GA 4G4PA 3PD8A 4ESXA 2R71A 4ZECA 1PDAA 2X26A 3KOSA 3VDFA 1M5DA 2F7CA 1XVYA 1NUYA 2GHAA 1GR2A 1ZIUA 2Q2CA 5BWJA 5I58B 5I58A 1FBDA 3QK6A 1YXIA 2ZYNA 4H65A 3SERA 3LSXA 1H3DA 3HSTA 1AMFA 4Q5TA 4P3LA 2HCAA 3ECRA 3VLWA 3KOTA 2WX9A 1M5BA 3CFXA 3MC2A 4N6KA 3TFLA 4GLIA 2QVUA 4O3AA 3K6VA 4KYDA 3T9VA 3UP9A 2H5YA 2IA4A 2PT2A 3T9HB 4MHFA 4XKQA 1QUJA 3FJMA 4FE8A 3EHUA 2Q8JA 2PMSA 3HN0A 3G3HA 3G3IA 4LZ7A 4IO6A 4ZDMA 2RCAA 4LN5A 1AOVA 2HFBA 4LVQA 4RK9A 4IY6A 2I3WA 3S9NC 4TLLB 1XT8A 1LBYA 1R1NA 5KDTB 2F97A 4NX1A 5KDTA 3PUZE 3MP1A 2O7UA 2I4BA 2UYFA 5AA2D 5CC2A 1MQDA 4JVDA 3BKIB 1B5IA 5I59B 1LSTA 4QSDA 1SW1A 1MPDA 1NUXA 3CSGA 1EYIA 4QSEA 3H06B 5A5XA 4R6YA 3MVWA 4ZE8A 1FPJA 4GX3A 3CSBA 1FBGA 4PGNA 3ILUB 2OX3A 3K6WA 1NMUA 1FPGA 1LFGA 4JB7A 4PTKA 4F31B 2DVCA 1O63A 3K00A 3G3GA 3ISPA 5TU0A 1FBFA 4HXVA 4G8HA 5EHMA 1MXUA 1H43A 1QKBA 4PF6A 4WKMA 1LAGE 1CB6A 5EQ9A 3LSFB 1O7TA 1WVJA 3KN7A 4KD5A 4F22A 2XXXA 1PEBA 4XXUA 3MVZA 5I2NA 1BK4A 1FSAA 4IGRA 2FNCA 2D5WA 1UTHA 2XXRA 5M2VA 3D4CA 2XXVA 1KZ8A 1H45A 3I5OA 2OWZA 1NNFA 3FVNA 2AL5A 2PCRA 5ICTA 3MYUA 3WAEA 5ISUA 3IJOB 5IZ3B 1QKAA 4GWOA 4OYVA 1MS7A 3SEYA 5IZ3A 1L5TA 2D21A 1LAXA 4NTLA 5ELVA 1POTA 4NWDA 2ANJA 1IXCA 2CEXA 3MWBA 2ZNTA 1HSJA 1JETA 3O2AA 1DK4A 3KG2A 3PPOA 3P7IA 5FBPA 1SDXA 4HS7A 4O7IA 4KCDA 2H25A 2ZNUA 3IAZA 4PDHA 3V5AA 3MP6A 2VPNA 1R9LA 1LBXA 1FPEA 2DYXA 3LUYA 3TUSA 4JSOA 4LZ8A 2XA5A 3FXBA 4OVJA 1WODA 5H8FB 2Z8FA 3VVEA 5H8FA 3RUMA 1B7ZA 3K1PA 1A55A 3ONMA 4XKPA 3K0VA 4F39A 3IB1A 3MZ9A 3H3GA 1RYXA 4GXSB 4I8CA 2RC8A 2UYEA 3G3KA 3GZGA 1N0TA 4P56A 4HE2A 3U72A 1JEVA 1ZTYA 2OJTA 3H6UA 5I5PA 3TQWA 1PBPA 4IO5A 2B4MA 3G3FA 1USYH 4HE1A 3Q26A 1I6BA 1BKAA 1N3XA 1TFDA 2WYPA 3T9UA 3L6GA 4QFPA 3S9MC 3E3KA 4XF5A 3U65A 1M5EA 3FBPA 1FBCA 3IO6A 1URSA 1SYIA 3U92A 3LBSA 2I0BA 4G61A 4MEVA 1OLAA 1N7XA 3Q27A 3FJGA 4NF6A 4P0GA 1DBZA 4OFLA 1XI6A 2CMOA 4GBWA 3DP6A 3KC1A 2UVHA 1H44A 1AL3A 4ZE9A 3ZKKA 2O68A 5F1QA 1IXIA 3QIMA 5ET6A 4OERA 3C35A 3DM0A 4ZEFA 4G68C 1B3LA 1Y1MA 1HSLA 3FV2A 2HAUA 1SI0A 1NV3A 2B3FA 1NNKA 2JJKA 2FIEA 3CG3A 1MM7A 1FJ9A 1FTKA 4ELQA 2NWJA 3VVDA 3BFUA 3FV1A 1P1QA 2REGA 3SEUA 1QUKA 3RTFB 1IMEA 2I49A 3RGYA 1B4ZA 2OCUA 4R74A 1PB7A 4E0XA 5DVIA 1MXVA 5B70A 1LFIA 4LONB 1B5JA 2H4IA 4TLMB 5LDZA 3IB2A 3W9VA 2CZHA 1B46A 2CEYA 3LSLA 4BDNA 4MNCA 4NF8B 1K9ZA 4JWYA 2Q9TA 1FPFA 1AH5A 4NF8A 2QS4A 2DXYA 4NE4A 1NV0A 2UVGA 3SZPA 1NNPA 1LBCA 5CBSA 1B7HA 3OSRA 4P11A 3KGCA 3LC8A 3M3LA 1J1NA 3FXUA 4OQOA 1YZ0A 3FVOA 2A5SA 5ICQA 3F11A 4EF2A 4BDOA 2RF1A 1P99A 4R75A 1DSNA 4MCOA 2ZMBA 3VLVA 4EDPA 2XWVA 3MJNA 3EKIA 4F3PA 1FQCA 1B1HA 2HXRA 3A29A 2DWIA 4GBVA 3IR1A 1EZOA 4NF4A 1FQDA 2XXYA 4PFRA 2QSXA 3EN3A 4P0IA 4EQ7A 2WBBA 5ET5A 4MJOA 2F5XA 3LV0A 1UIVA 3TMGA 1RKMA 5JTYB 1MY1A 5J1DA 4NF5B 2WYKA 4NF5A 4GWSA 3B7DA 4MX6A 5K2YA 2Y84A 4PP0A 3VFJA 4UACA 4PFWA 3G7WA 2H98A 4ELPA 1DOTA 2DS9A 4Q30B 4AB5A 3FXRA 1YCJA 4LATA 4ELRA 2PT1A 5FTIA 1IMAA 1MQHA 2HZLA 3QMFA 2NVUB 2O84X 4GWXA 5KCJB 3KSXA 2V3TA 1OIBA 1JW4A 4BDQA 4F3BA 3H7MA 3SESA 3N6TA 3UIFA 4FATA 5EYFA 4ZEDA 5TP9B 3O6GA 1XOCA 2ZZXA 3D4GA 1OVBA 2DSFA 3HHGA 4OTEA 4IO7A 1MQGA 1SW2A 3PU5A 3O6HA 5I57B 4ONYA 3N6UA 4DCXA 4P1EA 2XD3A 1NKXA 5I57A 1SD3A 1HSEA 2XXUA 3L6HA 3TZAA 3HHFA 3KSJA 1ANFA 2WBDA 2HEUA 3CG1A 1B52A 1FQAA 4QHQA 4C1UA 1IMBA 4MF3A 1TXFA 3M8UA 4UA8A 4GWUA 2R6GE 3UGWA 3CRBA 3T96B 1LEVA 1S50A 1LBBA 4NAPA 4X9TA 4IO2A 1MPCA 2BJIA 1LB8A 2DE2A 3C9HA 2QS3A 1AWBA 4I9DA 1EU8A 2AL4A 4PBHA 1S7YA 2I4CA 4RA1A 1B0HA 2Q88A 1INPA 3A09A 3IOUA 2OK2A 1SVXB 3PMXA 3HO7A 3LR1A 1SW5A 3MP8A 3KZGA 4OANA 4HW8A 5I84A 1MY4A 3LSWA 2V4CA 4ZEIA 3IFAA 4I3EA 3TTRA 2P2AA 3I6VA 1NH7A 2RC7A 3FIRA 4NWCA 4PE5B 1MH3A 4MLQA 4JDFA 2DP8A 4OVSA 1Y3PA 3FVKA 1G0HA 5DW8A 4PETA 2O1MA 3EF7A 3MVXA 1ZMGA 1UQWA 1D9QA 2BJJX 4N81A 3OMBA 3RY3A 2Y5LA 3TTKA 3T0JA 4N17A 3K6UA 4PFTA 4GRKA 3RT8A 5L8DA 4BDLA 5AA1A 4C0RA 3VVFA 5LTCA 5EQ8A 1MM6A 3C4MA 2HZKA 4G8NA 4EQBA 1D3KA 4DXUA 4AQ4A 5A5XB 4U21A 4GQOA 3UORA 1RDXA 1FBHA 2XXQA 4F29A 3VLUA 4NGUA 1RDZA 1FRPA 1FPDA 4PBQA 5HM4B 4YKJA 4OFOA 3T9XB 1OQHA 4G8MA 3U1OA 1QUIA 1MH4A 4MIJA 5H8NB 5H8SA 4DI4B 3OXNA 5I2NB 1QULA 5H8NA 3TTNA 1BLFA 1FQBA 4TQUQ 1FBPA 1FPLA 1BIYA 1ZLQA 1UTHB 1POY1 2F78A 4O8MA 3H6WA 3D1RA 1Y3NA 3KEIA 3GBBA 4H6DA 4LQ5A 2F7BA 1N76A 4IR8A 4PFBA 2ZYOA 1B51A 5FTHA 4FJPA 3IOWA 1XS5A 3E4RA 3B8BA 1A8FA 1K9YA 4PC9A 3V89B 3OO7A 3N26A 2F7AA 4YB6A 2GRVA 2E0SA 2REJA 3JZJA 5EQAA 4QXDA 4R73A 2OBGA 4H5FA 4YB7A 4BLAA 4JVIA 1FTOA 3IL1B 5DVJA 2PVUA 2HPGA 2P1SA 3R7XA 4PFYA 1IMFA 2RC9A 1G0IA 1LAHE 4YICA 1UIUA 4GX6A 1ELJA 3K4UA 3K1MA 1NUWA 3U93A 4EXKA 3PPQA 4WXJA 2F8DA 5CMCA 5DEXA 4OZ9A 4KYSA 1YAEA 3W9WA 4KPTA 1EYJA 1S9TA 2QS1A 4JBZA 3N5LA 1CE2A 1NFTA 4ZS9A 2KLFA 4PDDA 1ZJLA 1ATGA 4JXIA 3N94A 4GL8A 3JV9A 1EZPA 3PD9A 2DVZA 2QFLA 4KI0E 3PGFA 3HV1A 1ZU0A 1DCUA 1MY2A 2I6EA 1GVCA 1Q9DA 4LP2B 1MDP1 2O7IA 1B05A 3TAJA 5EQ7A 4F1VA 3C32A 1LBVA 2VOZA 4YU0A 2XHDA 4PCDA 2Z8EA 4NF6B 5TPAA 3TYHA 4LZ5A 3B6TA 2VHAA 3PUVE 3CFLA 3C36A 1MQJA 5I7IA 1NV4A 1NNTA 4GX4A 4HE0A 3BIGA 1MY0A 2V3UA 2W7YA 4JWOA 3K02A 5JK4A 3SEVA 3CVGA 4OVRA 3Q28A 2LAOA 3MSTA 2I58A 1Y20A 2DOJA 3IJXB 3ZS6A 3W15C 4NEDA 3NOHA 1SW4A 2KQZA 5EYGA 5BUUA 1EZ9A 4R9GA 4KXPA 5H8QA 4AS5A 1Y9UA 3TODA 3FVGA 5AA2B 3KN8A 4ISUA 3BBRA 5AA2A 4ZEBA 2CZLA 4QSCA 4BDMA 2DE3A 3MZ1A 4OVTA 3PPPA 2XX8A 4EF1A 1DMBA 4XEQA 4FEBA 1B0LA 1A8EA 4HCWA 2ZZVA 4F19A 1VSOA 1Y3QA 1QGXA 1LBZA 2WEFA 1IXHA 2UXAA 1MXYA 3FZVA 1BP5A 3HFUA 3VXCA 3KBZA 3C33A 3TTLA 2XWIA 3TDJA 5CI5A 5AE4A 4C1TA 1II5A 2ESNA 3PMWA 4OVPA 5ET8A 2Y7KA 3E79A 3O9PA 4M1VA 2R9JA 3GYYA 1IXGA 4IGTA 3M3KA 3IK6B 2E1SA 2VP1A 1MXXA 1BTJA 3O6IA 1Q1KA 1XVXA 3RPLA 4KFQA 1IIWA 2ZYMA 4DIGA 5ESYA 1FPKA 2GHBA 1FPBA 1FJ6A 3U94A 2XWOA 4MNPA 1N3WA 3V83A 2NOOA 4NF4B 4Q0CA 1US4A 3MVYA 1VR5A 4XIGQ 4N6PA 1PB8A 3PPNA 4U4SA 1QW0A 4DI3D 3CR9A 5FHNA 4QFLA 2VD3A 1Z7NE 4PFUA 1D4NA 1JVYA 3PV0E 1LCTA 1NV1A 4KQPA 4O3CA 1NV5A 5CM6A 2O6AA 2ONSA 2V93A 2O69A 4FECA 1VFDA 3FXQA 4YMBA 2QRYA 2HXWA 1NV7A 4H8IA 1B5HA 4GVOA 3MZBA 1N84A 1USYE 4WEDA 3VE1B 3B50A 3H6VA 3IO4A 4TOZA 3OEMA 4NF0A 2B4LA 2XXIA 4YB5A 3RLFE 4X8RA 3ROJA 2OLBA 1LFHA 3CIJA 2GH9A 5AA4B 1LLSA 2ONKE 1SI1A 3A3UA 5ITOA 4GXAA 5AA4A 3R26A 3PMVA 3HPIA 1H76A 4NHBA 5DVFA 4PF8A 3FASA 3QXMA 5CRYA 2PFYA 3TCHA 4OEUA 4P8BA 2X7QA 5H8HB 4XKNA 2VGQA 3KJTA 3S9EA 5EHSA 5H8HA 2I0CA 4U1OA 1EH3A 2QVRA 1IITA 2V25A 4O3BA 4U22A 4PGPA 1TWYA 3EHSA 4N8YA 4HCYA 3ZKLA 3PUWE 1I6AA 1KA1A 3GBAA 2XD2A 1SQYA 4F3SA 3RT6B 1MXZA 3H03A 3GLBA 4N15A 4OEVA 4E0WA 2XX9A 2HHMA 4NQ8A 1B6HA 5K2XA 3IB0A 2XXKA 1DPEA 3TKDA 1D9YA 1LGBC 2XXTA 4ESWA 4F1UA 3IORA 3S2VA 1JVXA 4U2RA 5LOMA 1JNFA 5I56B 4POWA 1B3HA 3PTYA 2P3NA 4FBPA 1PC3A 3LUZA 4ECFA 1FQFA 5I56A 2F6GA 1I6QA 2XXPA 3RTWB 5HPQA 3KC0A 3C34A 4QFOA 5I3SA 5B7DA 4G2ZA 4X1DA 1B7UA 1FTAA 1MG1A 3OEKA 1YPNA 1FW0A 3TCFA 1T0KA 5I2KB 4KYEA 4AS4A 4X48A 3MPKA 5I2KA 4I62A 2NUVA 4OWDA 3MAMA 4R2FA 4MNIA 1VE4A 4OA4A 3E13X 1TFAA 4DE8A 1RYOA 4OETA 1B4HA 3V8XB 1EYKA 1VDWA 3EQ1A 4H0WA 3S9LC 5F7VA 2Y7IA 2XWKA 4RY1A 3K2DA 1CNQA 3H6TA 1M5FA 4GWZA 4QFNA 2QMWA 3T1BA 2F34A 4I3YA 1FQEA 2XX7A 4EXLA 1WDNA 3KBRA 4ZZEA 4FEDA 4QRZA 1GTKA 2KR0A 3EPEA 3FD3A 4UABA 1A99A 2Y5KA 2Q89A
chains in the Genus database with same CATH topology
3SEWA 1MY3A 3RPWA 5I59A 2HQ0A 1US5A 1ZKBA 4MH5A 1URDA 3RN8A 4G68B 3OENA 1LCFA 1DPPA 4G68A 3TPAA 4IB2A 2O51A 1PB9A 1LB9A 3TEPA 3ODBA 2DWAA 4F1YA 3E9XA 3TELA 4LA9A 3Q25A 3DP4A 3PPRA 3PUXE 2AIXA 1D9VA 1AIVA 3O28A 2FYIA 2X7PA 3HCQA 3MQ9A 4YKPA 1MDQA 4ZEKA 2UVJA 5CMMA 4IO3A 4Z7EA 5DT6A 5FHOA 4OESA 1Y4TA 2Q2AA 1LAFE 4H1XA 4U1ZA 1R6ZA 1IQ7A 3USDA 3K6XA 5DTBA 2ZYKA 2NXOA 4XTCQ 3A3CA 3FGSA 1JEUA 1FTMA 3GXAA 4N07A 3KJ7A 1N04A 2PYYA 2D3IA 1JW1A 3QYTA 3H4ZA 4RK2A 3UN6A 4PQJA 1KWHA 1R9QA 5HBCA 2YPNA 3K1NA 1M5CA 3WAFA 2P0SA 3OELA 4YMAA 4GD5A 3JYRA 1JW5A 3FUZA 2DE4A 5DEXB 2ABHA 4K3FA 4H67A 3T93B 3R6UA 4OXVA 4GF8A 3S4UA 3SKPA 5L9MA 4OFJA 1N7WA 3AXFA 1VFEA 4JSDA 4OMBA 4DXBA 4ELOA 4N13A 1Z7ME 1Y1ZA 2H9BA 1YTVA 1A54A 3MW0A 3FJ7A 3M3FA 1B2HA 1I69A 4OENA 2Z22A 4RYAA 4BDRA 1P1UA 3PUYE 3VV5A 4Z0IA 4L17A 1OLCA 2ZNSA 4U23A 3UK4A 2PX1A 3CFZA 2QJEA 3MUQA 5IKBA 5DYHA 4THIA 4MLVA 2OWTA 3MBPA 1IZ1A 2QMXA 1MPBA 4MBPA 4R6HA 1FTLA 4GIZA 1JQFA 2F36A 2B65A 4QFKA 1B40A 1OVTA 3QUJA 3FATA 4FAJA 3K01A 5TPAB 1MXWA 2WKYA 3Q29A 2I3VA 3TCGA 4POXA 1O64A 4KHZE 4DZ1A 3CI8A 4F18A 2DWHA 2OZZA 3OD7A 4LQ2A 3MPLA 4EQ9A 3KN3A 1XC1A 4WEPA 1OMPA 4EUOA 1DTZA 2IEEA 1XHYA 3OO9A 2DQVA 5JEIA 3ZSFA 1GV8A 5H8QB 4IO4A 4R9FA 4R72A 2AYSA 3B6WA 4XKRA 2GFEA 4F3GA 1GGGA 1URGA 3IX1A 4GOTA 4YKKA 2UVIA 2RKMA 2H99A 4JWXA 1B3GA 3TTMA 3T22A 2HAVA 2Y7WA 2V3QA 1P1NA 2Y7PA 3G3JA 1FTJA 2A5TB 4ZZAA 2DWJA 1UTBB 4IY5A 2A5TA 5CMKA 4RPOA 1ZBMA 1UTBA 2PBWA 1P1OA 1P1WA 2Z8DA 3C31A 5L9SA 4OHNA 3OO6A 2G93A 2FA7A 3DP8A 1QVSA 1B58A 4F2OA 1A7LA 3QUFA 4X1BA 5FHMA 4GL0A 4F2QA 5AA3A 3OSQA 2YJPA 2DXRA 2F6PA 4I1DA 4KCCA 2ONRA 4HTGA 4RJZA 2Z23A 3VXBA 4RXLA 4FIMA 4Q8RA 1A40A 1NL5A 5CMBA 3DLNA 4YAHX 4RNSA 1B1XA 4DCYA 1Q35A 4H5GA 4DLDA 2ALUA 2V84A 2RCBA 4M4GA 1Y4CA 3SDFA 3T66A 3ILTB 3OOAA 3SETA 2B3BA 3O29A 5L9OA 1OQGA 1MQIA 4NMYA 4R2BA 1B3FA 4KR5A 4H8JA 1B9JA 3UA8A 4YKIA 5CBRA 1PBQA 2XXWA 1FCKA 3QAXA 3IOVA 3IOTA 2THIA 4ND9A 2QL3A 2M8CA 2QPQA 3DELB 3U8QA 3O66A 4LUBA 3SEXA 2XXHA 4FORA 2OWSA 3KFMA 5JTYA 4AB6A 2YLNA 1IEJA 1B3EA 4R6KA 1SYHA 2QS2A 4G77A 2F35A 3BFTA 4GFRA 3THIA 2Y7RA 4DXCA 1QJMA 2I48A 2RINA 1IUDA 4YZZA 3EHTA 1F9BA 3TQLA 3RQTA 5KCJA 3RNNA 3O97A 1SBPA 5ITPA 2ZXTA 1B32A 1TT1A 5TP9A 3QSLA 2VD2A 4RPNA 1MRPA 3I3VA 3B6QA 3OO8A 4MFIA 1DTGA 4QF9A 2G29A 2O1LA 5IAIA 1NH8A 5KZTA 4U4XA 4DDDA 4G4PA 3PD8A 4ESXA 2R71A 4ZECA 1PDAA 2X26A 3KOSA 3VDFA 1M5DA 2F7CA 1XVYA 2GHAA 1GR2A 1ZIUA 2Q2CA 5BWJA 5I58B 5I58A 3QK6A 2ZYNA 4H65A 3SERA 3LSXA 1H3DA 3HSTA 1AMFA 4Q5TA 2HCAA 3ECRA 3VLWA 3KOTA 1M5BA 3CFXA 3MC2A 3TFLA 4GLIA 4O3AA 3K6VA 4KYDA 3T9VA 3UP9A 2H5YA 2IA4A 2PT2A 3T9HB 4XKQA 1QUJA 3FJMA 4FE8A 3EHUA 2Q8JA 2PMSA 3HN0A 3G3HA 3G3IA 4LZ7A 4IO6A 4ZDMA 2RCAA 1AOVA 2HFBA 4LVQA 4RK9A 4IY6A 2I3WA 3S9NC 4TLLB 1XT8A 1R1NA 5KDTB 2F97A 5KDTA 3PUZE 3MP1A 2O7UA 2I4BA 2UYFA 5AA2D 5CC2A 1MQDA 3BKIB 1B5IA 5I59B 1LSTA 4QSDA 1SW1A 1MPDA 3CSGA 4QSEA 3H06B 5A5XA 4R6YA 3MVWA 4ZE8A 3CSBA 3ILUB 3K6WA 1NMUA 1LFGA 4JB7A 4F31B 2DVCA 1O63A 3K00A 3G3GA 5TU0A 4G8HA 5EHMA 1MXUA 1H43A 1QKBA 4WKMA 1LAGE 1CB6A 3LSFB 1O7TA 1WVJA 3KN7A 4KD5A 4F22A 2XXXA 1PEBA 4XXUA 3MVZA 5I2NA 4IGRA 2FNCA 2D5WA 1UTHA 2XXRA 5M2VA 3D4CA 2XXVA 1H45A 3I5OA 1NNFA 3FVNA 2AL5A 5ICTA 3WAEA 5ISUA 3IJOB 1QKAA 4GWOA 4OYVA 1MS7A 3SEYA 1L5TA 2D21A 1LAXA 4NTLA 5ELVA 1POTA 4NWDA 2ANJA 1IXCA 3MWBA 2ZNTA 1HSJA 1JETA 3O2AA 3KG2A 3PPOA 3P7IA 1SDXA 4HS7A 4KCDA 2H25A 2ZNUA 3IAZA 3V5AA 3MP6A 1R9LA 2DYXA 3LUYA 3TUSA 4JSOA 4LZ8A 4OVJA 1WODA 5H8FB 2Z8FA 3VVEA 5H8FA 3RUMA 1B7ZA 3K1PA 1A55A 3ONMA 4XKPA 3K0VA 4F39A 3IB1A 3MZ9A 3H3GA 1RYXA 4GXSB 4I8CA 2RC8A 2UYEA 3G3KA 3GZGA 1N0TA 3U72A 1JEVA 1ZTYA 2OJTA 3H6UA 3TQWA 1PBPA 4IO5A 3G3FA 1USYH 3Q26A 1I6BA 1BKAA 1N3XA 1TFDA 3T9UA 3L6GA 4QFPA 3S9MC 3E3KA 1M5EA 3IO6A 1URSA 1SYIA 3U92A 3LBSA 2I0BA 1OLAA 1N7XA 3Q27A 3FJGA 4NF6A 4P0GA 4OFLA 2CMOA 3DP6A 2UVHA 1H44A 1AL3A 4ZE9A 3ZKKA 2O68A 5F1QA 1IXIA 3QIMA 4OERA 3C35A 3DM0A 4ZEFA 4G68C 1B3LA 1Y1MA 1HSLA 3FV2A 2HAUA 1SI0A 2B3FA 1NNKA 3CG3A 1MM7A 1FTKA 4ELQA 2NWJA 3VVDA 3BFUA 3FV1A 1P1QA 2REGA 3SEUA 1QUKA 3RTFB 2I49A 3RGYA 1B4ZA 2OCUA 4R74A 1PB7A 4E0XA 5DVIA 1MXVA 5B70A 1LFIA 4LONB 1B5JA 2H4IA 4TLMB 3IB2A 3W9VA 1B46A 3LSLA 4BDNA 4NF8B 4JWYA 2Q9TA 1AH5A 4NF8A 2QS4A 2DXYA 4NE4A 2UVGA 1NNPA 1LBCA 5CBSA 1B7HA 3OSRA 4P11A 3KGCA 3LC8A 3M3LA 1J1NA 3FXUA 4OQOA 3FVOA 2A5SA 5ICQA 3F11A 4EF2A 4BDOA 2RF1A 1P99A 4R75A 1DSNA 2ZMBA 3VLVA 4EDPA 3MJNA 4F3PA 1FQCA 1B1HA 2DWIA 3IR1A 1EZOA 4NF4A 1FQDA 2XXYA 2QSXA 3EN3A 4P0IA 4EQ7A 2F5XA 1UIVA 3TMGA 1RKMA 5JTYB 1MY1A 5J1DA 4NF5B 4NF5A 3B7DA 5K2YA 2Y84A 4PP0A 3VFJA 4UACA 4PFWA 3G7WA 2H98A 4ELPA 1DOTA 2DS9A 4Q30B 4AB5A 3FXRA 1YCJA 4LATA 4ELRA 2PT1A 5FTIA 1MQHA 2HZLA 2NVUB 2O84X 5KCJB 3KSXA 2V3TA 1OIBA 1JW4A 4BDQA 4F3BA 3H7MA 3SESA 3N6TA 3UIFA 4FATA 5EYFA 4ZEDA 5TP9B 3O6GA 1XOCA 3D4GA 1OVBA 2DSFA 3HHGA 4OTEA 4IO7A 1MQGA 1SW2A 3PU5A 3O6HA 5I57B 4ONYA 3N6UA 4DCXA 2XD3A 1NKXA 5I57A 1SD3A 1HSEA 2XXUA 3L6HA 3TZAA 3HHFA 3KSJA 1ANFA 2HEUA 3CG1A 1B52A 1FQAA 4QHQA 4C1UA 4MF3A 1TXFA 3M8UA 4UA8A 2R6GE 3UGWA 3CRBA 3T96B 1S50A 1LBBA 4X9TA 4IO2A 1MPCA 1LB8A 2DE2A 3C9HA 2QS3A 4I9DA 1EU8A 2AL4A 1S7YA 2I4CA 4RA1A 1B0HA 2Q88A 3A09A 3IOUA 2OK2A 1SVXB 3PMXA 3HO7A 3LR1A 1SW5A 3MP8A 3KZGA 4HW8A 5I84A 1MY4A 3LSWA 4ZEIA 3TTRA 2P2AA 3I6VA 1NH7A 2RC7A 3FIRA 4NWCA 4PE5B 1MH3A 4MLQA 4JDFA 2DP8A 1Y3PA 3FVKA 4PETA 2O1MA 3EF7A 3MVXA 1ZMGA 1UQWA 2BJJX 3OMBA 3RY3A 3TTKA 3K6UA 4PFTA 4GRKA 3RT8A 5L8DA 4BDLA 5AA1A 4C0RA 3VVFA 1MM6A 3C4MA 2HZKA 4G8NA 4EQBA 1D3KA 4DXUA 5A5XB 4AQ4A 4U21A 4GQOA 3UORA 2XXQA 4F29A 3VLUA 5HM4B 4YKJA 4OFOA 3T9XB 1OQHA 4G8MA 3U1OA 1QUIA 1MH4A 5H8NB 5H8SA 3OXNA 5I2NB 1QULA 5H8NA 3TTNA 1BLFA 1FQBA 4TQUQ 1BIYA 1ZLQA 1UTHB 1POY1 2F78A 3H6WA 3KEIA 1Y3NA 4LQ5A 3GBBA 4H6DA 2F7BA 1N76A 2ZYOA 1B51A 5FTHA 4FJPA 3IOWA 1XS5A 3E4RA 1A8FA 3V89B 3OO7A 3N26A 2F7AA 4YB6A 2GRVA 2E0SA 2REJA 3JZJA 4R73A 2OBGA 4H5FA 4YB7A 4BLAA 1FTOA 3IL1B 5DVJA 2PVUA 2P1SA 3R7XA 4PFYA 2RC9A 1LAHE 4YICA 1UIUA 1ELJA 3K4UA 3K1MA 3U93A 4EXKA 3PPQA 4WXJA 2F8DA 5CMCA 5DEXA 4OZ9A 4KYSA 1YAEA 3W9WA 4KPTA 1S9TA 2QS1A 4JBZA 3N5LA 1CE2A 1NFTA 4ZS9A 2KLFA 1ZJLA 1ATGA 4JXIA 3N94A 4GL8A 3JV9A 1EZPA 3PD9A 2DVZA 4KI0E 3PGFA 3HV1A 1ZU0A 1MY2A 2I6EA 1GVCA 4LP2B 1MDP1 2O7IA 1B05A 3TAJA 4F1VA 3C32A 2VOZA 4YU0A 2XHDA 2Z8EA 4NF6B 5TPAA 3TYHA 4LZ5A 3B6TA 2VHAA 3PUVE 3CFLA 3C36A 1MQJA 1NNTA 1MY0A 2V3UA 2W7YA 4JWOA 3K02A 5JK4A 3SEVA 3CVGA 3Q28A 2LAOA 2I58A 1Y20A 2DOJA 3IJXB 3ZS6A 3W15C 4NEDA 1SW4A 5BUUA 1EZ9A 4R9GA 5H8QA 1Y9UA 3TODA 3FVGA 5AA2B 3KN8A 4ISUA 3BBRA 5AA2A 4ZEBA 2CZLA 4QSCA 4BDMA 2DE3A 3MZ1A 3PPPA 2XX8A 4EF1A 1DMBA 4FEBA 1B0LA 1A8EA 4HCWA 4F19A 1VSOA 1Y3QA 1IXHA 2UXAA 1MXYA 3FZVA 1BP5A 3VXCA 3C33A 3TTLA 3TDJA 5CI5A 5AE4A 4C1TA 1II5A 2ESNA 3PMWA 2Y7KA 3O9PA 4M1VA 2R9JA 1IXGA 4IGTA 3M3KA 3IK6B 2E1SA 2VP1A 1MXXA 1BTJA 3O6IA 1Q1KA 1XVXA 4KFQA 1IIWA 2ZYMA 4DIGA 2GHBA 3U94A 1N3WA 3V83A 2NOOA 4NF4B 4Q0CA 1US4A 3MVYA 1VR5A 4XIGQ 4N6PA 1PB8A 3PPNA 4U4SA 1QW0A 3CR9A 5FHNA 4QFLA 2VD3A 1Z7NE 4PFUA 1D4NA 1JVYA 3PV0E 1LCTA 4KQPA 4O3CA 5CM6A 2O6AA 2ONSA 2V93A 2O69A 4FECA 1VFDA 3FXQA 4YMBA 2QRYA 2HXWA 4H8IA 1B5HA 4GVOA 3MZBA 1N84A 1USYE 4WEDA 3VE1B 3H6VA 3IO4A 4TOZA 3OEMA 2XXIA 4YB5A 3RLFE 2OLBA 1LFHA 3CIJA 2GH9A 5AA4B 1LLSA 2ONKE 1SI1A 3A3UA 5ITOA 4GXAA 5AA4A 3R26A 3PMVA 3HPIA 1H76A 5DVFA 3FASA 3QXMA 5CRYA 3TCHA 4OEUA 2X7QA 5H8HB 4XKNA 2VGQA 3KJTA 3S9EA 5EHSA 5H8HA 2I0CA 4U1OA 1EH3A 1IITA 2V25A 4O3BA 4U22A 1TWYA 3EHSA 4HCYA 3ZKLA 3PUWE 1I6AA 3GBAA 2XD2A 1SQYA 4F3SA 3RT6B 1MXZA 3H03A 3GLBA 4OEVA 4E0WA 2XX9A 1B6HA 5K2XA 3IB0A 1DPEA 3TKDA 1D9YA 1LGBC 2XXTA 4ESWA 4F1UA 3IORA 3S2VA 1JVXA 4U2RA 5LOMA 1JNFA 5I56B 4POWA 1B3HA 1PC3A 4ECFA 1FQFA 5I56A 2F6GA 1I6QA 2XXPA 3RTWB 5HPQA 3C34A 4QFOA 5B7DA 4G2ZA 4X1DA 1B7UA 1MG1A 3OEKA 1YPNA 1FW0A 3TCFA 1T0KA 5I2KB 4KYEA 4X48A 3MPKA 5I2KA 4I62A 2NUVA 4OWDA 3MAMA 4R2FA 1VE4A 3E13X 1TFAA 4DE8A 1RYOA 4OETA 1B4HA 3V8XB 3EQ1A 4H0WA 3S9LC 5F7VA 2Y7IA 4RY1A 3K2DA 3H6TA 1M5FA 4QFNA 2QMWA 2F34A 1FQEA 2XX7A 4EXLA 1WDNA 3KBRA 4ZZEA 4FEDA 4QRZA 1GTKA 3EPEA 3FD3A 1A99A 2Q89A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SEW A;  1MY3 A;  3RPW A;  5I59 A;  2HQ0 A;  1US5 A;  1ZKB A;  4MH5 A;  1URD A;  3RN8 A;  4G68 B;  3OEN A;  1LCF A;  1DPP A;  4G68 A;  3TPA A;  4IB2 A;  2O51 A;  1PB9 A;  1LB9 A;  3TEP A;  3ODB A;  2DWA A;  4F1Y A;  3E9X A;  3TEL A;  4LA9 A;  3Q25 A;  3DP4 A;  3PPR A;  3PUX E;  2AIX A;  1D9V A;  1AIV A;  3O28 A;  2FYI A;  2X7P A;  3HCQ A;  3MQ9 A;  4YKP A;  1MDQ A;  4ZEK A;  2UVJ A;  5CMM A;  4IO3 A;  4Z7E A;  5DT6 A;  5FHO A;  4OES A;  1Y4T A;  2Q2A A;  1LAF E;  4H1X A;  4U1Z A;  1R6Z A;  1IQ7 A;  3USD A;  3K6X A;  5DTB A;  2ZYK A;  2NXO A;  4XTC Q;  3A3C A;  3FGS A;  1JEU A;  1FTM A;  3GXA A;  4N07 A;  3KJ7 A;  1N04 A;  2PYY A;  2D3I A;  1JW1 A;  3QYT A;  3H4Z A;  4RK2 A;  3UN6 A;  4PQJ A;  1KWH A;  1R9Q A;  5HBC A;  2YPN A;  3K1N A;  1M5C A;  3WAF A;  2P0S A;  3OEL A;  4YMA A;  4GD5 A;  3JYR A;  1JW5 A;  3FUZ A;  2DE4 A;  5DEX B;  2ABH A;  4K3F A;  4H67 A;  3T93 B;  3R6U A;  4OXV A;  4GF8 A;  3S4U A;  3SKP A;  5L9M A;  4OFJ A;  1N7W A;  3AXF A;  1VFE A;  4JSD A;  4OMB A;  4DXB A;  4ELO A;  4N13 A;  1Z7M E;  1Y1Z A;  2H9B A;  1YTV A;  1A54 A;  3MW0 A;  3FJ7 A;  3M3F A;  1B2H A;  1I69 A;  4OEN A;  2Z22 A;  4RYA A;  4BDR A;  1P1U A;  3PUY E;  3VV5 A;  4Z0I A;  4L17 A;  1OLC A;  2ZNS A;  4U23 A;  3UK4 A;  2PX1 A;  3CFZ A;  2QJE A;  3MUQ A;  5IKB A;  5DYH A;  4THI A;  4MLV A;  2OWT A;  3MBP A;  1IZ1 A;  2QMX A;  1MPB A;  4MBP A;  4R6H A;  1FTL A;  4GIZ A;  1JQF A;  2F36 A;  2B65 A;  4QFK A;  1B40 A;  1OVT A;  3QUJ A;  3FAT A;  4FAJ A;  3K01 A;  5TPA B;  1MXW A;  2WKY A;  3Q29 A;  2I3V A;  3TCG A;  4POX A;  1O64 A;  4KHZ E;  4DZ1 A;  3CI8 A;  4F18 A;  2DWH A;  2OZZ A;  3OD7 A;  4LQ2 A;  3MPL A;  4EQ9 A;  3KN3 A;  1XC1 A;  4WEP A;  1OMP A;  4EUO A;  1DTZ A;  2IEE A;  1XHY A;  3OO9 A;  2DQV A;  5JEI A;  3ZSF A;  1GV8 A;  5H8Q B;  4IO4 A;  4R9F A;  4R72 A;  2AYS A;  3B6W A;  4XKR A;  2GFE A;  4F3G A;  1GGG A;  1URG A;  3IX1 A;  4GOT A;  4YKK A;  2UVI A;  2RKM A;  2H99 A;  4JWX A;  1B3G A;  3TTM A;  3T22 A;  2HAV A;  2Y7W A;  2V3Q A;  1P1N A;  2Y7P A;  3G3J A;  1FTJ A;  2A5T B;  4ZZA A;  2DWJ A;  1UTB B;  4IY5 A;  2A5T A;  5CMK A;  4RPO A;  1ZBM A;  1UTB A;  2PBW A;  1P1O A;  1P1W A;  2Z8D A;  3C31 A;  5L9S A;  4OHN A;  3OO6 A;  2G93 A;  2FA7 A;  3DP8 A;  1QVS A;  1B58 A;  4F2O A;  1A7L A;  3QUF A;  4X1B A;  5FHM A;  4GL0 A;  4F2Q A;  5AA3 A;  3OSQ A;  2YJP A;  2DXR A;  2F6P A;  4I1D A;  4KCC A;  2ONR A;  4HTG A;  4RJZ A;  2Z23 A;  3VXB A;  4RXL A;  4FIM A;  4Q8R A;  1A40 A;  1NL5 A;  5CMB A;  3DLN A;  4YAH X;  4RNS A;  1B1X A;  4DCY A;  1Q35 A;  4H5G A;  4DLD A;  2ALU A;  2V84 A;  2RCB A;  4M4G A;  1Y4C A;  3SDF A;  3T66 A;  3ILT B;  3OOA A;  3SET A;  2B3B A;  3O29 A;  5L9O A;  1OQG A;  1MQI A;  4NMY A;  4R2B A;  1B3F A;  4KR5 A;  4H8J A;  1B9J A;  3UA8 A;  4YKI A;  5CBR A;  1PBQ A;  2XXW A;  1FCK A;  3QAX A;  3IOV A;  3IOT A;  2THI A;  4ND9 A;  2QL3 A;  2M8C A;  2QPQ A;  3DEL B;  3U8Q A;  3O66 A;  4LUB A;  3SEX A;  2XXH A;  4FOR A;  2OWS A;  3KFM A;  5JTY A;  4AB6 A;  2YLN A;  1IEJ A;  1B3E A;  4R6K A;  1SYH A;  2QS2 A;  4G77 A;  2F35 A;  3BFT A;  4GFR A;  3THI A;  2Y7R A;  4DXC A;  1QJM A;  2I48 A;  2RIN A;  1IUD A;  4YZZ A;  3EHT A;  1F9B A;  3TQL A;  3RQT A;  5KCJ A;  3RNN A;  3O97 A;  1SBP A;  5ITP A;  2ZXT A;  1B32 A;  1TT1 A;  5TP9 A;  3QSL A;  2VD2 A;  4RPN A;  1MRP A;  3I3V A;  3B6Q A;  3OO8 A;  4MFI A;  1DTG A;  4QF9 A;  2G29 A;  2O1L A;  5IAI A;  1NH8 A;  5KZT A;  4U4X A;  4DDD A;  4G4P A;  3PD8 A;  4ESX A;  2R71 A;  4ZEC A;  1PDA A;  2X26 A;  3KOS A;  3VDF A;  1M5D A;  2F7C A;  1XVY A;  2GHA A;  1GR2 A;  1ZIU A;  2Q2C A;  5BWJ A;  5I58 B;  5I58 A;  3QK6 A;  2ZYN A;  4H65 A;  3SER A;  3LSX A;  1H3D A;  3HST A;  1AMF A;  4Q5T A;  2HCA A;  3ECR A;  3VLW A;  3KOT A;  1M5B A;  3CFX A;  3MC2 A;  3TFL A;  4GLI A;  4O3A A;  3K6V A;  4KYD A;  3T9V A;  3UP9 A;  2H5Y A;  2IA4 A;  2PT2 A;  3T9H B;  4XKQ A;  1QUJ A;  3FJM A;  4FE8 A;  3EHU A;  2Q8J A;  2PMS A;  3HN0 A;  3G3H A;  3G3I A;  4LZ7 A;  4IO6 A;  4ZDM A;  2RCA A;  1AOV A;  2HFB A;  4LVQ A;  4RK9 A;  4IY6 A;  2I3W A;  3S9N C;  4TLL B;  1XT8 A;  1R1N A;  5KDT B;  2F97 A;  5KDT A;  3PUZ E;  3MP1 A;  2O7U A;  2I4B A;  2UYF A;  5AA2 D;  5CC2 A;  1MQD A;  3BKI B;  1B5I A;  5I59 B;  1LST A;  4QSD A;  1SW1 A;  1MPD A;  3CSG A;  4QSE A;  3H06 B;  5A5X A;  4R6Y A;  3MVW A;  4ZE8 A;  3CSB A;  3ILU B;  3K6W A;  1NMU A;  1LFG A;  4JB7 A;  4F31 B;  2DVC A;  1O63 A;  3K00 A;  3G3G A;  5TU0 A;  4G8H A;  5EHM A;  1MXU A;  1H43 A;  1QKB A;  4WKM A;  1LAG E;  1CB6 A;  3LSF B;  1O7T A;  1WVJ A;  3KN7 A;  4KD5 A;  4F22 A;  2XXX A;  1PEB A;  4XXU A;  3MVZ A;  5I2N A;  4IGR A;  2FNC A;  2D5W A;  1UTH A;  2XXR A;  5M2V A;  3D4C A;  2XXV A;  1H45 A;  3I5O A;  1NNF A;  3FVN A;  2AL5 A;  5ICT A;  3WAE A;  5ISU A;  3IJO B;  1QKA A;  4GWO A;  4OYV A;  1MS7 A;  3SEY A;  1L5T A;  2D21 A;  1LAX A;  4NTL A;  5ELV A;  1POT A;  4NWD A;  2ANJ A;  1IXC A;  3MWB A;  2ZNT A;  1HSJ A;  1JET A;  3O2A A;  3KG2 A;  3PPO A;  3P7I A;  1SDX A;  4HS7 A;  4KCD A;  2H25 A;  2ZNU A;  3IAZ A;  3V5A A;  3MP6 A;  1R9L A;  2DYX A;  3LUY A;  3TUS A;  4JSO A;  4LZ8 A;  4OVJ A;  1WOD A;  5H8F B;  2Z8F A;  3VVE A;  5H8F A;  3RUM A;  1B7Z A;  3K1P A;  1A55 A;  3ONM A;  4XKP A;  3K0V A;  4F39 A;  3IB1 A;  3MZ9 A;  3H3G A;  1RYX A;  4GXS B;  4I8C A;  2RC8 A;  2UYE A;  3G3K A;  3GZG A;  1N0T A;  3U72 A;  1JEV A;  1ZTY A;  2OJT A;  3H6U A;  3TQW A;  1PBP A;  4IO5 A;  3G3F A;  1USY H;  3Q26 A;  1I6B A;  1BKA A;  1N3X A;  1TFD A;  3T9U A;  3L6G A;  4QFP A;  3S9M C;  3E3K A;  1M5E A;  3IO6 A;  1URS A;  1SYI A;  3U92 A;  3LBS A;  2I0B A;  1OLA A;  1N7X A;  3Q27 A;  3FJG A;  4NF6 A;  4P0G A;  4OFL A;  2CMO A;  3DP6 A;  2UVH A;  1H44 A;  1AL3 A;  4ZE9 A;  3ZKK A;  2O68 A;  5F1Q A;  1IXI A;  3QIM A;  4OER A;  3C35 A;  3DM0 A;  4ZEF A;  4G68 C;  1B3L A;  1Y1M A;  1HSL A;  3FV2 A;  2HAU A;  1SI0 A;  2B3F A;  1NNK A;  3CG3 A;  1MM7 A;  1FTK A;  4ELQ A;  2NWJ A;  3VVD A;  3BFU A;  3FV1 A;  1P1Q A;  2REG A;  3SEU A;  1QUK A;  3RTF B;  2I49 A;  3RGY A;  1B4Z A;  2OCU A;  4R74 A;  1PB7 A;  4E0X A;  5DVI A;  1MXV A;  5B70 A;  1LFI A;  4LON B;  1B5J A;  2H4I A;  4TLM B;  3IB2 A;  3W9V A;  1B46 A;  3LSL A;  4BDN A;  4NF8 B;  4JWY A;  2Q9T A;  1AH5 A;  4NF8 A;  2QS4 A;  2DXY A;  4NE4 A;  2UVG A;  1NNP A;  1LBC A;  5CBS A;  1B7H A;  3OSR A;  4P11 A;  3KGC A;  3LC8 A;  3M3L A;  1J1N A;  3FXU A;  4OQO A;  3FVO A;  2A5S A;  5ICQ A;  3F11 A;  4EF2 A;  4BDO A;  2RF1 A;  1P99 A;  4R75 A;  1DSN A;  2ZMB A;  3VLV A;  4EDP A;  3MJN A;  4F3P A;  1FQC A;  1B1H A;  2DWI A;  3IR1 A;  1EZO A;  4NF4 A;  1FQD A;  2XXY A;  2QSX A;  3EN3 A;  4P0I A;  4EQ7 A;  2F5X A;  1UIV A;  3TMG A;  1RKM A;  5JTY B;  1MY1 A;  5J1D A;  4NF5 B;  4NF5 A;  3B7D A;  5K2Y A;  2Y84 A;  4PP0 A;  3VFJ A;  4UAC A;  4PFW A;  3G7W A;  2H98 A;  4ELP A;  1DOT A;  2DS9 A;  4Q30 B;  4AB5 A;  3FXR A;  1YCJ A;  4LAT A;  4ELR A;  2PT1 A;  5FTI A;  1MQH A;  2HZL A;  2NVU B;  2O84 X;  5KCJ B;  3KSX A;  2V3T A;  1OIB A;  1JW4 A;  4BDQ A;  4F3B A;  3H7M A;  3SES A;  3N6T A;  3UIF A;  4FAT A;  5EYF A;  4ZED A;  5TP9 B;  3O6G A;  1XOC A;  3D4G A;  1OVB A;  2DSF A;  3HHG A;  4OTE A;  4IO7 A;  1MQG A;  1SW2 A;  3PU5 A;  3O6H A;  5I57 B;  4ONY A;  3N6U A;  4DCX A;  2XD3 A;  1NKX A;  5I57 A;  1SD3 A;  1HSE A;  2XXU A;  3L6H A;  3TZA A;  3HHF A;  3KSJ A;  1ANF A;  2HEU A;  3CG1 A;  1B52 A;  1FQA A;  4QHQ A;  4C1U A;  4MF3 A;  1TXF A;  3M8U A;  4UA8 A;  2R6G E;  3UGW A;  3CRB A;  3T96 B;  1S50 A;  1LBB A;  4X9T A;  4IO2 A;  1MPC A;  1LB8 A;  2DE2 A;  3C9H A;  2QS3 A;  4I9D A;  1EU8 A;  2AL4 A;  1S7Y A;  2I4C A;  4RA1 A;  1B0H A;  2Q88 A;  3A09 A;  3IOU A;  2OK2 A;  1SVX B;  3PMX A;  3HO7 A;  3LR1 A;  1SW5 A;  3MP8 A;  3KZG A;  4HW8 A;  5I84 A;  1MY4 A;  3LSW A;  4ZEI A;  3TTR A;  2P2A A;  3I6V A;  1NH7 A;  2RC7 A;  3FIR A;  4NWC A;  4PE5 B;  1MH3 A;  4MLQ A;  4JDF A;  2DP8 A;  1Y3P A;  3FVK A;  4PET A;  2O1M A;  3EF7 A;  3MVX A;  1ZMG A;  1UQW A;  2BJJ X;  3OMB A;  3RY3 A;  3TTK A;  3K6U A;  4PFT A;  4GRK A;  3RT8 A;  5L8D A;  4BDL A;  5AA1 A;  4C0R A;  3VVF A;  1MM6 A;  3C4M A;  2HZK A;  4G8N A;  4EQB A;  1D3K A;  4DXU A;  5A5X B;  4AQ4 A;  4U21 A;  4GQO A;  3UOR A;  2XXQ A;  4F29 A;  3VLU A;  5HM4 B;  4YKJ A;  4OFO A;  3T9X B;  1OQH A;  4G8M A;  3U1O A;  1QUI A;  1MH4 A;  5H8N B;  5H8S A;  3OXN A;  5I2N B;  1QUL A;  5H8N A;  3TTN A;  1BLF A;  1FQB A;  4TQU Q;  1BIY A;  1ZLQ A;  1UTH B;  1POY 1;  2F78 A;  3H6W A;  3KEI A;  1Y3N A;  4LQ5 A;  3GBB A;  4H6D A;  2F7B A;  1N76 A;  2ZYO A;  1B51 A;  5FTH A;  4FJP A;  3IOW A;  1XS5 A;  3E4R A;  1A8F A;  3V89 B;  3OO7 A;  3N26 A;  2F7A A;  4YB6 A;  2GRV A;  2E0S A;  2REJ A;  3JZJ A;  4R73 A;  2OBG A;  4H5F A;  4YB7 A;  4BLA A;  1FTO A;  3IL1 B;  5DVJ A;  2PVU A;  2P1S A;  3R7X A;  4PFY A;  2RC9 A;  1LAH E;  4YIC A;  1UIU A;  1ELJ A;  3K4U A;  3K1M A;  3U93 A;  4EXK A;  3PPQ A;  4WXJ A;  2F8D A;  5CMC A;  5DEX A;  4OZ9 A;  4KYS A;  1YAE A;  3W9W A;  4KPT A;  1S9T A;  2QS1 A;  4JBZ A;  3N5L A;  1CE2 A;  1NFT A;  4ZS9 A;  2KLF A;  1ZJL A;  1ATG A;  4JXI A;  3N94 A;  4GL8 A;  3JV9 A;  1EZP A;  3PD9 A;  2DVZ A;  4KI0 E;  3PGF A;  3HV1 A;  1ZU0 A;  1MY2 A;  2I6E A;  1GVC A;  4LP2 B;  1MDP 1;  2O7I A;  1B05 A;  3TAJ A;  4F1V A;  3C32 A;  2VOZ A;  4YU0 A;  2XHD A;  2Z8E A;  4NF6 B;  5TPA A;  3TYH A;  4LZ5 A;  3B6T A;  2VHA A;  3PUV E;  3CFL A;  3C36 A;  1MQJ A;  1NNT A;  1MY0 A;  2V3U A;  2W7Y A;  4JWO A;  3K02 A;  5JK4 A;  3SEV A;  3CVG A;  3Q28 A;  2LAO A;  2I58 A;  1Y20 A;  2DOJ A;  3IJX B;  3ZS6 A;  3W15 C;  4NED A;  1SW4 A;  5BUU A;  1EZ9 A;  4R9G A;  5H8Q A;  1Y9U A;  3TOD A;  3FVG A;  5AA2 B;  3KN8 A;  4ISU A;  3BBR A;  5AA2 A;  4ZEB A;  2CZL A;  4QSC A;  4BDM A;  2DE3 A;  3MZ1 A;  3PPP A;  2XX8 A;  4EF1 A;  1DMB A;  4FEB A;  1B0L A;  1A8E A;  4HCW A;  4F19 A;  1VSO A;  1Y3Q A;  1IXH A;  2UXA A;  1MXY A;  3FZV A;  1BP5 A;  3VXC A;  3C33 A;  3TTL A;  3TDJ A;  5CI5 A;  5AE4 A;  4C1T A;  1II5 A;  2ESN A;  3PMW A;  2Y7K A;  3O9P A;  4M1V A;  2R9J A;  1IXG A;  4IGT A;  3M3K A;  3IK6 B;  2E1S A;  2VP1 A;  1MXX A;  1BTJ A;  3O6I A;  1Q1K A;  1XVX A;  4KFQ A;  1IIW A;  2ZYM A;  4DIG A;  2GHB A;  3U94 A;  1N3W A;  3V83 A;  2NOO A;  4NF4 B;  4Q0C A;  1US4 A;  3MVY A;  1VR5 A;  4XIG Q;  4N6P A;  1PB8 A;  3PPN A;  4U4S A;  1QW0 A;  3CR9 A;  5FHN A;  4QFL A;  2VD3 A;  1Z7N E;  4PFU A;  1D4N A;  1JVY A;  3PV0 E;  1LCT A;  4KQP A;  4O3C A;  5CM6 A;  2O6A A;  2ONS A;  2V93 A;  2O69 A;  4FEC A;  1VFD A;  3FXQ A;  4YMB A;  2QRY A;  2HXW A;  4H8I A;  1B5H A;  4GVO A;  3MZB A;  1N84 A;  1USY E;  4WED A;  3VE1 B;  3H6V A;  3IO4 A;  4TOZ A;  3OEM A;  2XXI A;  4YB5 A;  3RLF E;  2OLB A;  1LFH A;  3CIJ A;  2GH9 A;  5AA4 B;  1LLS A;  2ONK E;  1SI1 A;  3A3U A;  5ITO A;  4GXA A;  5AA4 A;  3R26 A;  3PMV A;  3HPI A;  1H76 A;  5DVF A;  3FAS A;  3QXM A;  5CRY A;  3TCH A;  4OEU A;  2X7Q A;  5H8H B;  4XKN A;  2VGQ A;  3KJT A;  3S9E A;  5EHS A;  5H8H A;  2I0C A;  4U1O A;  1EH3 A;  1IIT A;  2V25 A;  4O3B A;  4U22 A;  1TWY A;  3EHS A;  4HCY A;  3ZKL A;  3PUW E;  1I6A A;  3GBA A;  2XD2 A;  1SQY A;  4F3S A;  3RT6 B;  1MXZ A;  3H03 A;  3GLB A;  4OEV A;  4E0W A;  2XX9 A;  1B6H A;  5K2X A;  3IB0 A;  1DPE A;  3TKD A;  1D9Y A;  1LGB C;  2XXT A;  4ESW A;  4F1U A;  3IOR A;  3S2V A;  1JVX A;  4U2R A;  5LOM A;  1JNF A;  5I56 B;  4POW A;  1B3H A;  1PC3 A;  4ECF A;  1FQF A;  5I56 A;  2F6G A;  1I6Q A;  2XXP A;  3RTW B;  5HPQ A;  3C34 A;  4QFO A;  5B7D A;  4G2Z A;  4X1D A;  1B7U A;  1MG1 A;  3OEK A;  1YPN A;  1FW0 A;  3TCF A;  1T0K A;  5I2K B;  4KYE A;  4X48 A;  3MPK A;  5I2K A;  4I62 A;  2NUV A;  4OWD A;  3MAM A;  4R2F A;  1VE4 A;  3E13 X;  1TFA A;  4DE8 A;  1RYO A;  4OET A;  1B4H A;  3V8X B;  3EQ1 A;  4H0W A;  3S9L C;  5F7V A;  2Y7I A;  4RY1 A;  3K2D A;  3H6T A;  1M5F A;  4QFN A;  2QMW A;  2F34 A;  1FQE A;  2XX7 A;  4EXL A;  1WDN A;  3KBR A;  4ZZE A;  4FED A;  4QRZ A;  1GTK A;  3EPE A;  3FD3 A;  1A99 A;  2Q89 A; 
#chains in the Genus database with same CATH topology
 3SEW A;  1MY3 A;  3RPW A;  5I59 A;  2HQ0 A;  1US5 A;  1ZKB A;  4MH5 A;  1URD A;  3RN8 A;  4G68 B;  3OEN A;  1LCF A;  1DPP A;  4G68 A;  3TPA A;  4IB2 A;  2O51 A;  4N91 A;  1PB9 A;  1LB9 A;  3TEP A;  3ODB A;  2DWA A;  4F1Y A;  3E9X A;  3TEL A;  4PE3 A;  4LA9 A;  3Q25 A;  3DP4 A;  3PPR A;  3PUX E;  2AIX A;  4OVQ A;  1D9V A;  1AIV A;  3O28 A;  2FYI A;  2X7P A;  3HCQ A;  2FBP A;  3MQ9 A;  4I40 A;  4YKP A;  1MDQ A;  4ZEK A;  1FBE A;  2UVJ A;  5CMM A;  4IO3 A;  4Z7E A;  5DT6 A;  5FHO A;  4OES A;  1Y4T A;  2MKZ A;  2Q2A A;  1LAF E;  4H1X A;  4U1Z A;  1R6Z A;  1IQ7 A;  4N4U A;  3USD A;  3K6X A;  5DTB A;  2ZYK A;  5A5L A;  2NXO A;  2P3V A;  4MAG A;  4XTC Q;  3A3C A;  3FGS A;  2Q8M A;  1YYZ A;  1JEU A;  1FTM A;  3GXA A;  2Q74 A;  4N07 A;  3KJ7 A;  2CZK A;  1N04 A;  2PYY A;  2D3I A;  1JW1 A;  3QYT A;  3H4Z A;  4RK2 A;  3UN6 A;  4PQJ A;  1NV6 A;  1KWH A;  1R9Q A;  2L5V A;  5HBC A;  2YPN A;  3K1N A;  1M5C A;  3WAF A;  2P0S A;  3OEL A;  4YMA A;  4GD5 A;  3JYR A;  1JW5 A;  3CHG A;  3FUZ A;  2DE4 A;  5DEX B;  2ABH A;  4K3F A;  4H67 A;  3T93 B;  3R6U A;  4OXV A;  4GF8 A;  1KA0 A;  3S4U A;  3SKP A;  5L9M A;  4OFJ A;  2VT5 A;  1N7W A;  3AXF A;  1VFE A;  4P9K A;  4JSD A;  4OMB A;  4DXB A;  4ELO A;  4N13 A;  1Z7M E;  1Y1Z A;  2H9B A;  1JP4 A;  1A54 A;  1YTV A;  3MW0 A;  3FJ7 A;  3M3F A;  1IMD A;  1B2H A;  1I69 A;  4OEN A;  2Z22 A;  4JVC A;  4RYA A;  4BDR A;  1P1U A;  3PUY E;  3VV5 A;  4Z0I A;  4L17 A;  1OLC A;  1LBW A;  2ZNS A;  4U23 A;  3UK4 A;  2PX1 A;  3CFZ A;  2QJE A;  3MUQ A;  5IKB A;  2FVZ A;  5DYH A;  4THI A;  4MLV A;  2OWT A;  3MBP A;  1IZ1 A;  2QMX A;  1MPB A;  4MBP A;  4R6H A;  1FTL A;  4GIZ A;  5EYH A;  2FHY A;  4GWW A;  1JQF A;  2F36 A;  2B65 A;  4QFK A;  1B40 A;  1OVT A;  3QUJ A;  3FAT A;  4FAJ A;  3K01 A;  4X04 A;  5TPA B;  1MXW A;  1NUZ A;  2PFZ A;  2WKY A;  3Q29 A;  2I3V A;  3TCG A;  4POX A;  1O64 A;  4KHZ E;  4DZ1 A;  3CI8 A;  2DWH A;  4F18 A;  2OZZ A;  3OD7 A;  4LQ2 A;  3MPL A;  4EQ9 A;  3KN3 A;  4MMP A;  1XC1 A;  4WEP A;  1OMP A;  5ET7 A;  4EUO A;  2R8T A;  1DTZ A;  4NG7 A;  2IEE A;  1XHY A;  3OO9 A;  2DDK A;  2DQV A;  2ZZW A;  5JEI A;  3ZSF A;  1GV8 A;  3BIH A;  4GWY A;  5H8Q B;  5IZZ A;  4IO4 A;  4R9F A;  4R72 A;  2AYS A;  3B6W A;  4XKR A;  2GFE A;  4F3G A;  1GGG A;  1URG A;  5IGA A;  3IX1 A;  4GOT A;  4YKK A;  2UVI A;  2RKM A;  2H99 A;  4JWX A;  1B3G A;  3TTM A;  2F3B A;  3T22 A;  2VPO A;  2QVV A;  2HAV A;  2Y7W A;  2V3Q A;  1P1N A;  2Y7P A;  3G3J A;  1FTJ A;  2A5T B;  4ZZA A;  2DWJ A;  1UTB B;  4IY5 A;  2A5T A;  4QBA A;  5CMK A;  2F3D A;  4RPO A;  1ZBM A;  1UTB A;  2PBW A;  1P1O A;  1P1W A;  3IFC A;  2Z8D A;  4H46 A;  3C31 A;  5L9S A;  3RYD A;  4P1L A;  5J16 A;  4O7M A;  4OHN A;  3OO6 A;  4XFE A;  2G93 A;  2FA7 A;  3DP8 A;  1QVS A;  1B58 A;  4F2O A;  1A7L A;  3QUF A;  4X1B A;  5FHM A;  4GL0 A;  4F2Q A;  5AA3 A;  3OSQ A;  3RPL B;  2YJP A;  4PAI A;  2DXR A;  2F6P A;  4I1D A;  1IMC A;  4KCC A;  2ONR A;  4P47 A;  4HTG A;  4RJZ A;  1FPI A;  2Z23 A;  3VXB A;  1SPI A;  4RXL A;  2CZI A;  4FIM A;  4Q8R A;  1A40 A;  4H45 A;  1NL5 A;  5CMB A;  3DLN A;  4YAH X;  4RNS A;  1B1X A;  4DCY A;  1Q35 A;  4H5G A;  4DLD A;  2ALU A;  2V84 A;  2RCB A;  4M4G A;  1Y4C A;  3SDF A;  5F24 A;  3T66 A;  3ILT B;  3OOA A;  3SET A;  2B3B A;  3O29 A;  5L9O A;  1OQG A;  1MQI A;  4NMY A;  4R2B A;  1B3F A;  4PAF A;  4KR5 A;  4H8J A;  1B9J A;  1NV2 A;  4O94 A;  3UA8 A;  4YKI A;  5CBR A;  1PBQ A;  2XXW A;  1FCK A;  3QAX A;  3IOV A;  3IOT A;  2THI A;  4ND9 A;  3E78 A;  2QL3 A;  2M8C A;  2QPQ A;  3DEL B;  3O66 A;  4LUB A;  3SEX A;  3U8Q A;  2XXH A;  4FOR A;  2OWS A;  3KFM A;  5JTY A;  4AB6 A;  2YLN A;  1IEJ A;  1B3E A;  4R6K A;  5T3J A;  1SYH A;  2QS2 A;  4G77 A;  2F35 A;  3BFT A;  4GFR A;  3THI A;  4PAK A;  2Y7R A;  4DXC A;  1QJM A;  5IZ1 A;  5IM2 A;  2I48 A;  2RIN A;  1IUD A;  4YZZ A;  3EHT A;  4PFI A;  1F9B A;  3TQL A;  3RQT A;  5KCJ A;  3RNN A;  2FIX A;  2GQ1 A;  1SBP A;  3O97 A;  5ITP A;  2ZXT A;  1NI9 A;  1B32 A;  1TT1 A;  5TP9 A;  3QSL A;  2VD2 A;  4RPN A;  1MRP A;  3I3V A;  3B6Q A;  3OO8 A;  1RDY A;  4MFI A;  4N6D A;  1DTG A;  4QF9 A;  2G29 A;  2O1L A;  5IAI A;  1NH8 A;  5KZT A;  4U4X A;  4NN3 A;  4DDD A;  4N8G A;  4G4P A;  3PD8 A;  4ESX A;  2R71 A;  4ZEC A;  1PDA A;  2X26 A;  3KOS A;  3VDF A;  1M5D A;  2F7C A;  1XVY A;  1NUY A;  2GHA A;  1GR2 A;  1ZIU A;  2Q2C A;  5BWJ A;  5I58 B;  5I58 A;  1FBD A;  3QK6 A;  1YXI A;  2ZYN A;  4H65 A;  3SER A;  3LSX A;  1H3D A;  3HST A;  1AMF A;  4Q5T A;  4P3L A;  2HCA A;  3ECR A;  3VLW A;  3KOT A;  2WX9 A;  1M5B A;  3CFX A;  3MC2 A;  4N6K A;  3TFL A;  4GLI A;  2QVU A;  4O3A A;  3K6V A;  4KYD A;  3T9V A;  3UP9 A;  2H5Y A;  2IA4 A;  2PT2 A;  3T9H B;  4MHF A;  4XKQ A;  1QUJ A;  3FJM A;  4FE8 A;  3EHU A;  2Q8J A;  2PMS A;  3HN0 A;  3G3H A;  3G3I A;  4LZ7 A;  4IO6 A;  4ZDM A;  2RCA A;  4LN5 A;  1AOV A;  2HFB A;  4LVQ A;  4RK9 A;  4IY6 A;  2I3W A;  3S9N C;  4TLL B;  1XT8 A;  1LBY A;  1R1N A;  5KDT B;  2F97 A;  4NX1 A;  5KDT A;  3PUZ E;  3MP1 A;  2O7U A;  2I4B A;  2UYF A;  5AA2 D;  5CC2 A;  1MQD A;  4JVD A;  3BKI B;  1B5I A;  5I59 B;  1LST A;  4QSD A;  1SW1 A;  1MPD A;  1NUX A;  3CSG A;  1EYI A;  4QSE A;  3H06 B;  5A5X A;  4R6Y A;  3MVW A;  4ZE8 A;  1FPJ A;  4GX3 A;  3CSB A;  1FBG A;  4PGN A;  3ILU B;  2OX3 A;  3K6W A;  1NMU A;  1FPG A;  1LFG A;  4JB7 A;  4PTK A;  4F31 B;  2DVC A;  1O63 A;  3K00 A;  3G3G A;  3ISP A;  5TU0 A;  1FBF A;  4HXV A;  4G8H A;  5EHM A;  1MXU A;  1H43 A;  1QKB A;  4PF6 A;  4WKM A;  1LAG E;  1CB6 A;  5EQ9 A;  3LSF B;  1O7T A;  1WVJ A;  3KN7 A;  4KD5 A;  4F22 A;  2XXX A;  1PEB A;  4XXU A;  3MVZ A;  5I2N A;  1BK4 A;  1FSA A;  4IGR A;  2FNC A;  2D5W A;  1UTH A;  2XXR A;  5M2V A;  3D4C A;  2XXV A;  1KZ8 A;  1H45 A;  3I5O A;  2OWZ A;  1NNF A;  3FVN A;  2AL5 A;  2PCR A;  5ICT A;  3MYU A;  3WAE A;  5ISU A;  3IJO B;  5IZ3 B;  1QKA A;  4GWO A;  4OYV A;  1MS7 A;  3SEY A;  5IZ3 A;  1L5T A;  2D21 A;  1LAX A;  4NTL A;  5ELV A;  1POT A;  4NWD A;  2ANJ A;  1IXC A;  2CEX A;  3MWB A;  2ZNT A;  1HSJ A;  1JET A;  3O2A A;  1DK4 A;  3KG2 A;  3PPO A;  3P7I A;  5FBP A;  1SDX A;  4HS7 A;  4O7I A;  4KCD A;  2H25 A;  2ZNU A;  3IAZ A;  4PDH A;  3V5A A;  3MP6 A;  2VPN A;  1R9L A;  1LBX A;  1FPE A;  2DYX A;  3LUY A;  3TUS A;  4JSO A;  4LZ8 A;  2XA5 A;  3FXB A;  4OVJ A;  1WOD A;  5H8F B;  2Z8F A;  3VVE A;  5H8F A;  3RUM A;  1B7Z A;  3K1P A;  1A55 A;  3ONM A;  4XKP A;  3K0V A;  4F39 A;  3IB1 A;  3MZ9 A;  3H3G A;  1RYX A;  4GXS B;  4I8C A;  2RC8 A;  2UYE A;  3G3K A;  3GZG A;  1N0T A;  4P56 A;  4HE2 A;  3U72 A;  1JEV A;  1ZTY A;  2OJT A;  3H6U A;  5I5P A;  3TQW A;  1PBP A;  4IO5 A;  2B4M A;  3G3F A;  1USY H;  4HE1 A;  3Q26 A;  1I6B A;  1BKA A;  1N3X A;  1TFD A;  2WYP A;  3T9U A;  3L6G A;  4QFP A;  3S9M C;  3E3K A;  4XF5 A;  3U65 A;  1M5E A;  3FBP A;  1FBC A;  3IO6 A;  1URS A;  1SYI A;  3U92 A;  3LBS A;  2I0B A;  4G61 A;  4MEV A;  1OLA A;  1N7X A;  3Q27 A;  3FJG A;  4NF6 A;  4P0G A;  1DBZ A;  4OFL A;  1XI6 A;  2CMO A;  4GBW A;  3DP6 A;  3KC1 A;  2UVH A;  1H44 A;  1AL3 A;  4ZE9 A;  3ZKK A;  2O68 A;  5F1Q A;  1IXI A;  3QIM A;  5ET6 A;  4OER A;  3C35 A;  3DM0 A;  4ZEF A;  4G68 C;  1B3L A;  1Y1M A;  1HSL A;  3FV2 A;  2HAU A;  1SI0 A;  1NV3 A;  2B3F A;  1NNK A;  2JJK A;  2FIE A;  3CG3 A;  1MM7 A;  1FJ9 A;  1FTK A;  4ELQ A;  2NWJ A;  3VVD A;  3BFU A;  3FV1 A;  1P1Q A;  2REG A;  3SEU A;  1QUK A;  3RTF B;  1IME A;  2I49 A;  3RGY A;  1B4Z A;  2OCU A;  4R74 A;  1PB7 A;  4E0X A;  5DVI A;  1MXV A;  5B70 A;  1LFI A;  4LON B;  1B5J A;  2H4I A;  4TLM B;  5LDZ A;  3IB2 A;  3W9V A;  2CZH A;  1B46 A;  2CEY A;  3LSL A;  4BDN A;  4MNC A;  4NF8 B;  1K9Z A;  4JWY A;  2Q9T A;  1FPF A;  1AH5 A;  4NF8 A;  2QS4 A;  2DXY A;  4NE4 A;  1NV0 A;  2UVG A;  3SZP A;  1NNP A;  1LBC A;  5CBS A;  1B7H A;  3OSR A;  4P11 A;  3KGC A;  3LC8 A;  3M3L A;  1J1N A;  3FXU A;  4OQO A;  1YZ0 A;  3FVO A;  2A5S A;  5ICQ A;  3F11 A;  4EF2 A;  4BDO A;  2RF1 A;  1P99 A;  4R75 A;  1DSN A;  4MCO A;  2ZMB A;  3VLV A;  4EDP A;  2XWV A;  3MJN A;  3EKI A;  4F3P A;  1FQC A;  1B1H A;  2HXR A;  3A29 A;  2DWI A;  4GBV A;  3IR1 A;  1EZO A;  4NF4 A;  1FQD A;  2XXY A;  4PFR A;  2QSX A;  3EN3 A;  4P0I A;  4EQ7 A;  2WBB A;  5ET5 A;  4MJO A;  2F5X A;  3LV0 A;  1UIV A;  3TMG A;  1RKM A;  5JTY B;  1MY1 A;  5J1D A;  4NF5 B;  2WYK A;  4NF5 A;  4GWS A;  3B7D A;  4MX6 A;  5K2Y A;  2Y84 A;  4PP0 A;  3VFJ A;  4UAC A;  4PFW A;  3G7W A;  2H98 A;  4ELP A;  1DOT A;  2DS9 A;  4Q30 B;  4AB5 A;  3FXR A;  1YCJ A;  4LAT A;  4ELR A;  2PT1 A;  5FTI A;  1IMA A;  1MQH A;  2HZL A;  3QMF A;  2NVU B;  2O84 X;  4GWX A;  5KCJ B;  3KSX A;  2V3T A;  1OIB A;  1JW4 A;  4BDQ A;  4F3B A;  3H7M A;  3SES A;  3N6T A;  3UIF A;  4FAT A;  5EYF A;  4ZED A;  5TP9 B;  3O6G A;  1XOC A;  2ZZX A;  3D4G A;  1OVB A;  2DSF A;  3HHG A;  4OTE A;  4IO7 A;  1MQG A;  1SW2 A;  3PU5 A;  3O6H A;  5I57 B;  4ONY A;  3N6U A;  4DCX A;  4P1E A;  2XD3 A;  1NKX A;  5I57 A;  1SD3 A;  1HSE A;  2XXU A;  3L6H A;  3TZA A;  3HHF A;  3KSJ A;  1ANF A;  2WBD A;  2HEU A;  3CG1 A;  1B52 A;  1FQA A;  4QHQ A;  4C1U A;  1IMB A;  4MF3 A;  1TXF A;  3M8U A;  4UA8 A;  4GWU A;  2R6G E;  3UGW A;  3CRB A;  3T96 B;  1LEV A;  1S50 A;  1LBB A;  4NAP A;  4X9T A;  4IO2 A;  1MPC A;  2BJI A;  1LB8 A;  2DE2 A;  3C9H A;  2QS3 A;  1AWB A;  4I9D A;  1EU8 A;  2AL4 A;  4PBH A;  1S7Y A;  2I4C A;  4RA1 A;  1B0H A;  2Q88 A;  1INP A;  3A09 A;  3IOU A;  2OK2 A;  1SVX B;  3PMX A;  3HO7 A;  3LR1 A;  1SW5 A;  3MP8 A;  3KZG A;  4OAN A;  4HW8 A;  5I84 A;  1MY4 A;  3LSW A;  2V4C A;  4ZEI A;  3IFA A;  4I3E A;  3TTR A;  2P2A A;  3I6V A;  1NH7 A;  2RC7 A;  3FIR A;  4NWC A;  4PE5 B;  1MH3 A;  4MLQ A;  4JDF A;  2DP8 A;  4OVS A;  1Y3P A;  3FVK A;  1G0H A;  5DW8 A;  4PET A;  2O1M A;  3EF7 A;  3MVX A;  1ZMG A;  1UQW A;  1D9Q A;  2BJJ X;  4N81 A;  3OMB A;  3RY3 A;  2Y5L A;  3TTK A;  3T0J A;  4N17 A;  3K6U A;  4PFT A;  4GRK A;  3RT8 A;  5L8D A;  4BDL A;  5AA1 A;  4C0R A;  3VVF A;  5LTC A;  5EQ8 A;  1MM6 A;  3C4M A;  2HZK A;  4G8N A;  4EQB A;  1D3K A;  4DXU A;  4AQ4 A;  5A5X B;  4U21 A;  4GQO A;  3UOR A;  1RDX A;  1FBH A;  2XXQ A;  4F29 A;  3VLU A;  4NGU A;  1RDZ A;  1FRP A;  1FPD A;  4PBQ A;  5HM4 B;  4YKJ A;  4OFO A;  3T9X B;  1OQH A;  4G8M A;  3U1O A;  1QUI A;  1MH4 A;  4MIJ A;  5H8N B;  5H8S A;  4DI4 B;  3OXN A;  5I2N B;  1QUL A;  5H8N A;  3TTN A;  1BLF A;  1FQB A;  4TQU Q;  1FBP A;  1FPL A;  1BIY A;  1ZLQ A;  1UTH B;  1POY 1;  2F78 A;  4O8M A;  3H6W A;  3D1R A;  1Y3N A;  3KEI A;  3GBB A;  4H6D A;  4LQ5 A;  2F7B A;  1N76 A;  4IR8 A;  4PFB A;  2ZYO A;  1B51 A;  5FTH A;  4FJP A;  3IOW A;  1XS5 A;  3E4R A;  3B8B A;  1A8F A;  1K9Y A;  4PC9 A;  3V89 B;  3OO7 A;  3N26 A;  2F7A A;  4YB6 A;  2GRV A;  2E0S A;  2REJ A;  3JZJ A;  5EQA A;  4QXD A;  4R73 A;  2OBG A;  4H5F A;  4YB7 A;  4BLA A;  4JVI A;  1FTO A;  3IL1 B;  5DVJ A;  2PVU A;  2HPG A;  2P1S A;  3R7X A;  4PFY A;  1IMF A;  2RC9 A;  1G0I A;  1LAH E;  4YIC A;  1UIU A;  4GX6 A;  1ELJ A;  3K4U A;  3K1M A;  1NUW A;  3U93 A;  4EXK A;  3PPQ A;  4WXJ A;  2F8D A;  5CMC A;  5DEX A;  4OZ9 A;  4KYS A;  1YAE A;  3W9W A;  4KPT A;  1EYJ A;  1S9T A;  2QS1 A;  4JBZ A;  3N5L A;  1CE2 A;  1NFT A;  4ZS9 A;  2KLF A;  4PDD A;  1ZJL A;  1ATG A;  4JXI A;  3N94 A;  4GL8 A;  3JV9 A;  1EZP A;  3PD9 A;  2DVZ A;  2QFL A;  4KI0 E;  3PGF A;  3HV1 A;  1ZU0 A;  1DCU A;  1MY2 A;  2I6E A;  1GVC A;  1Q9D A;  4LP2 B;  1MDP 1;  2O7I A;  1B05 A;  3TAJ A;  5EQ7 A;  4F1V A;  3C32 A;  1LBV A;  2VOZ A;  4YU0 A;  2XHD A;  4PCD A;  2Z8E A;  4NF6 B;  5TPA A;  3TYH A;  4LZ5 A;  3B6T A;  2VHA A;  3PUV E;  3CFL A;  3C36 A;  1MQJ A;  5I7I A;  1NV4 A;  1NNT A;  4GX4 A;  4HE0 A;  3BIG A;  1MY0 A;  2V3U A;  2W7Y A;  4JWO A;  3K02 A;  5JK4 A;  3SEV A;  3CVG A;  4OVR A;  3Q28 A;  2LAO A;  3MST A;  2I58 A;  1Y20 A;  2DOJ A;  3IJX B;  3ZS6 A;  3W15 C;  4NED A;  3NOH A;  1SW4 A;  2KQZ A;  5EYG A;  5BUU A;  1EZ9 A;  4R9G A;  4KXP A;  5H8Q A;  4AS5 A;  1Y9U A;  3TOD A;  3FVG A;  5AA2 B;  3KN8 A;  4ISU A;  3BBR A;  5AA2 A;  4ZEB A;  2CZL A;  4QSC A;  4BDM A;  2DE3 A;  3MZ1 A;  4OVT A;  3PPP A;  2XX8 A;  4EF1 A;  1DMB A;  4XEQ A;  4FEB A;  1B0L A;  1A8E A;  4HCW A;  2ZZV A;  4F19 A;  1VSO A;  1Y3Q A;  1QGX A;  1LBZ A;  2WEF A;  1IXH A;  2UXA A;  1MXY A;  3FZV A;  1BP5 A;  3HFU A;  3VXC A;  3KBZ A;  3C33 A;  3TTL A;  2XWI A;  3TDJ A;  5CI5 A;  5AE4 A;  4C1T A;  1II5 A;  2ESN A;  3PMW A;  4OVP A;  5ET8 A;  2Y7K A;  3E79 A;  3O9P A;  4M1V A;  2R9J A;  3GYY A;  1IXG A;  4IGT A;  3M3K A;  3IK6 B;  2E1S A;  2VP1 A;  1MXX A;  1BTJ A;  3O6I A;  1Q1K A;  1XVX A;  3RPL A;  4KFQ A;  1IIW A;  2ZYM A;  4DIG A;  5ESY A;  1FPK A;  2GHB A;  1FPB A;  1FJ6 A;  3U94 A;  2XWO A;  4MNP A;  1N3W A;  3V83 A;  2NOO A;  4NF4 B;  4Q0C A;  1US4 A;  3MVY A;  1VR5 A;  4XIG Q;  4N6P A;  1PB8 A;  3PPN A;  4U4S A;  1QW0 A;  4DI3 D;  3CR9 A;  5FHN A;  4QFL A;  2VD3 A;  1Z7N E;  4PFU A;  1D4N A;  1JVY A;  3PV0 E;  1LCT A;  1NV1 A;  4KQP A;  4O3C A;  1NV5 A;  5CM6 A;  2O6A A;  2ONS A;  2V93 A;  2O69 A;  4FEC A;  1VFD A;  3FXQ A;  4YMB A;  2QRY A;  2HXW A;  1NV7 A;  4H8I A;  1B5H A;  4GVO A;  3MZB A;  1N84 A;  1USY E;  4WED A;  3VE1 B;  3B50 A;  3H6V A;  3IO4 A;  4TOZ A;  3OEM A;  4NF0 A;  2B4L A;  2XXI A;  4YB5 A;  3RLF E;  4X8R A;  3ROJ A;  2OLB A;  1LFH A;  3CIJ A;  2GH9 A;  5AA4 B;  1LLS A;  2ONK E;  1SI1 A;  3A3U A;  5ITO A;  4GXA A;  5AA4 A;  3R26 A;  3PMV A;  3HPI A;  1H76 A;  4NHB A;  5DVF A;  4PF8 A;  3FAS A;  3QXM A;  5CRY A;  2PFY A;  3TCH A;  4OEU A;  4P8B A;  2X7Q A;  5H8H B;  4XKN A;  2VGQ A;  3KJT A;  3S9E A;  5EHS A;  5H8H A;  2I0C A;  4U1O A;  1EH3 A;  2QVR A;  1IIT A;  2V25 A;  4O3B A;  4U22 A;  4PGP A;  1TWY A;  3EHS A;  4N8Y A;  4HCY A;  3ZKL A;  3PUW E;  1I6A A;  1KA1 A;  3GBA A;  2XD2 A;  1SQY A;  4F3S A;  3RT6 B;  1MXZ A;  3H03 A;  3GLB A;  4N15 A;  4OEV A;  4E0W A;  2XX9 A;  2HHM A;  4NQ8 A;  1B6H A;  5K2X A;  3IB0 A;  2XXK A;  1DPE A;  3TKD A;  1D9Y A;  1LGB C;  2XXT A;  4ESW A;  4F1U A;  3IOR A;  3S2V A;  1JVX A;  4U2R A;  5LOM A;  1JNF A;  5I56 B;  4POW A;  1B3H A;  3PTY A;  2P3N A;  4FBP A;  1PC3 A;  3LUZ A;  4ECF A;  1FQF A;  5I56 A;  2F6G A;  1I6Q A;  2XXP A;  3RTW B;  5HPQ A;  3KC0 A;  3C34 A;  4QFO A;  5I3S A;  5B7D A;  4G2Z A;  4X1D A;  1B7U A;  1FTA A;  1MG1 A;  3OEK A;  1YPN A;  1FW0 A;  3TCF A;  1T0K A;  5I2K B;  4KYE A;  4AS4 A;  4X48 A;  3MPK A;  5I2K A;  4I62 A;  2NUV A;  4OWD A;  3MAM A;  4R2F A;  4MNI A;  1VE4 A;  4OA4 A;  3E13 X;  1TFA A;  4DE8 A;  1RYO A;  4OET A;  1B4H A;  3V8X B;  1EYK A;  1VDW A;  3EQ1 A;  4H0W A;  3S9L C;  5F7V A;  2Y7I A;  2XWK A;  4RY1 A;  3K2D A;  1CNQ A;  3H6T A;  1M5F A;  4GWZ A;  4QFN A;  2QMW A;  3T1B A;  2F34 A;  4I3Y A;  1FQE A;  2XX7 A;  4EXL A;  1WDN A;  3KBR A;  4ZZE A;  4FED A;  4QRZ A;  1GTK A;  2KR0 A;  3EPE A;  3FD3 A;  4UAB A;  1A99 A;  2Y5K A;  2Q89 A; 
#chains in the Genus database with same CATH homology
 3SEW A;  1MY3 A;  3RPW A;  5I59 A;  2HQ0 A;  1US5 A;  1ZKB A;  4MH5 A;  1URD A;  3RN8 A;  4G68 B;  3OEN A;  1LCF A;  1DPP A;  4G68 A;  3TPA A;  4IB2 A;  2O51 A;  1PB9 A;  1LB9 A;  3TEP A;  3ODB A;  2DWA A;  4F1Y A;  3E9X A;  3TEL A;  4LA9 A;  3Q25 A;  3DP4 A;  3PPR A;  3PUX E;  2AIX A;  1D9V A;  1AIV A;  3O28 A;  2FYI A;  2X7P A;  3HCQ A;  3MQ9 A;  4YKP A;  1MDQ A;  4ZEK A;  2UVJ A;  5CMM A;  4IO3 A;  4Z7E A;  5DT6 A;  5FHO A;  4OES A;  1Y4T A;  2Q2A A;  1LAF E;  4H1X A;  4U1Z A;  1R6Z A;  1IQ7 A;  3USD A;  3K6X A;  5DTB A;  2ZYK A;  2NXO A;  4XTC Q;  3A3C A;  3FGS A;  1JEU A;  1FTM A;  3GXA A;  4N07 A;  3KJ7 A;  1N04 A;  2PYY A;  2D3I A;  1JW1 A;  3QYT A;  3H4Z A;  4RK2 A;  3UN6 A;  4PQJ A;  1KWH A;  1R9Q A;  5HBC A;  2YPN A;  3K1N A;  1M5C A;  3WAF A;  2P0S A;  3OEL A;  4YMA A;  4GD5 A;  3JYR A;  1JW5 A;  3FUZ A;  2DE4 A;  5DEX B;  2ABH A;  4K3F A;  4H67 A;  3T93 B;  3R6U A;  4OXV A;  4GF8 A;  3S4U A;  3SKP A;  5L9M A;  4OFJ A;  1N7W A;  3AXF A;  1VFE A;  4JSD A;  4OMB A;  4DXB A;  4ELO A;  4N13 A;  1Z7M E;  1Y1Z A;  2H9B A;  1YTV A;  1A54 A;  3MW0 A;  3FJ7 A;  3M3F A;  1B2H A;  1I69 A;  4OEN A;  2Z22 A;  4RYA A;  4BDR A;  1P1U A;  3PUY E;  3VV5 A;  4Z0I A;  4L17 A;  1OLC A;  2ZNS A;  4U23 A;  3UK4 A;  2PX1 A;  3CFZ A;  2QJE A;  3MUQ A;  5IKB A;  5DYH A;  4THI A;  4MLV A;  2OWT A;  3MBP A;  1IZ1 A;  2QMX A;  1MPB A;  4MBP A;  4R6H A;  1FTL A;  4GIZ A;  1JQF A;  2F36 A;  2B65 A;  4QFK A;  1B40 A;  1OVT A;  3QUJ A;  3FAT A;  4FAJ A;  3K01 A;  5TPA B;  1MXW A;  2WKY A;  3Q29 A;  2I3V A;  3TCG A;  4POX A;  1O64 A;  4KHZ E;  4DZ1 A;  3CI8 A;  4F18 A;  2DWH A;  2OZZ A;  3OD7 A;  4LQ2 A;  3MPL A;  4EQ9 A;  3KN3 A;  1XC1 A;  4WEP A;  1OMP A;  4EUO A;  1DTZ A;  2IEE A;  1XHY A;  3OO9 A;  2DQV A;  5JEI A;  3ZSF A;  1GV8 A;  5H8Q B;  4IO4 A;  4R9F A;  4R72 A;  2AYS A;  3B6W A;  4XKR A;  2GFE A;  4F3G A;  1GGG A;  1URG A;  3IX1 A;  4GOT A;  4YKK A;  2UVI A;  2RKM A;  2H99 A;  4JWX A;  1B3G A;  3TTM A;  3T22 A;  2HAV A;  2Y7W A;  2V3Q A;  1P1N A;  2Y7P A;  3G3J A;  1FTJ A;  2A5T B;  4ZZA A;  2DWJ A;  1UTB B;  4IY5 A;  2A5T A;  5CMK A;  4RPO A;  1ZBM A;  1UTB A;  2PBW A;  1P1O A;  1P1W A;  2Z8D A;  3C31 A;  5L9S A;  4OHN A;  3OO6 A;  2G93 A;  2FA7 A;  3DP8 A;  1QVS A;  1B58 A;  4F2O A;  1A7L A;  3QUF A;  4X1B A;  5FHM A;  4GL0 A;  4F2Q A;  5AA3 A;  3OSQ A;  2YJP A;  2DXR A;  2F6P A;  4I1D A;  4KCC A;  2ONR A;  4HTG A;  4RJZ A;  2Z23 A;  3VXB A;  4RXL A;  4FIM A;  4Q8R A;  1A40 A;  1NL5 A;  5CMB A;  3DLN A;  4YAH X;  4RNS A;  1B1X A;  4DCY A;  1Q35 A;  4H5G A;  4DLD A;  2ALU A;  2V84 A;  2RCB A;  4M4G A;  1Y4C A;  3SDF A;  3T66 A;  3ILT B;  3OOA A;  3SET A;  2B3B A;  3O29 A;  5L9O A;  1OQG A;  1MQI A;  4NMY A;  4R2B A;  1B3F A;  4KR5 A;  4H8J A;  1B9J A;  3UA8 A;  4YKI A;  5CBR A;  1PBQ A;  2XXW A;  1FCK A;  3QAX A;  3IOV A;  3IOT A;  2THI A;  4ND9 A;  2QL3 A;  2M8C A;  2QPQ A;  3DEL B;  3U8Q A;  3O66 A;  4LUB A;  3SEX A;  2XXH A;  4FOR A;  2OWS A;  3KFM A;  5JTY A;  4AB6 A;  2YLN A;  1IEJ A;  1B3E A;  4R6K A;  1SYH A;  2QS2 A;  4G77 A;  2F35 A;  3BFT A;  4GFR A;  3THI A;  2Y7R A;  4DXC A;  1QJM A;  2I48 A;  2RIN A;  1IUD A;  4YZZ A;  3EHT A;  1F9B A;  3TQL A;  3RQT A;  5KCJ A;  3RNN A;  3O97 A;  1SBP A;  5ITP A;  2ZXT A;  1B32 A;  1TT1 A;  5TP9 A;  3QSL A;  2VD2 A;  4RPN A;  1MRP A;  3I3V A;  3B6Q A;  3OO8 A;  4MFI A;  1DTG A;  4QF9 A;  2G29 A;  2O1L A;  5IAI A;  1NH8 A;  5KZT A;  4U4X A;  4DDD A;  4G4P A;  3PD8 A;  4ESX A;  2R71 A;  4ZEC A;  1PDA A;  2X26 A;  3KOS A;  3VDF A;  1M5D A;  2F7C A;  1XVY A;  2GHA A;  1GR2 A;  1ZIU A;  2Q2C A;  5BWJ A;  5I58 B;  5I58 A;  3QK6 A;  2ZYN A;  4H65 A;  3SER A;  3LSX A;  1H3D A;  3HST A;  1AMF A;  4Q5T A;  2HCA A;  3ECR A;  3VLW A;  3KOT A;  1M5B A;  3CFX A;  3MC2 A;  3TFL A;  4GLI A;  4O3A A;  3K6V A;  4KYD A;  3T9V A;  3UP9 A;  2H5Y A;  2IA4 A;  2PT2 A;  3T9H B;  4XKQ A;  1QUJ A;  3FJM A;  4FE8 A;  3EHU A;  2Q8J A;  2PMS A;  3HN0 A;  3G3H A;  3G3I A;  4LZ7 A;  4IO6 A;  4ZDM A;  2RCA A;  1AOV A;  2HFB A;  4LVQ A;  4RK9 A;  4IY6 A;  2I3W A;  3S9N C;  4TLL B;  1XT8 A;  1R1N A;  5KDT B;  2F97 A;  5KDT A;  3PUZ E;  3MP1 A;  2O7U A;  2I4B A;  2UYF A;  5AA2 D;  5CC2 A;  1MQD A;  3BKI B;  1B5I A;  5I59 B;  1LST A;  4QSD A;  1SW1 A;  1MPD A;  3CSG A;  4QSE A;  3H06 B;  5A5X A;  4R6Y A;  3MVW A;  4ZE8 A;  3CSB A;  3ILU B;  3K6W A;  1NMU A;  1LFG A;  4JB7 A;  4F31 B;  2DVC A;  1O63 A;  3K00 A;  3G3G A;  5TU0 A;  4G8H A;  5EHM A;  1MXU A;  1H43 A;  1QKB A;  4WKM A;  1LAG E;  1CB6 A;  3LSF B;  1O7T A;  1WVJ A;  3KN7 A;  4KD5 A;  4F22 A;  2XXX A;  1PEB A;  4XXU A;  3MVZ A;  5I2N A;  4IGR A;  2FNC A;  2D5W A;  1UTH A;  2XXR A;  5M2V A;  3D4C A;  2XXV A;  1H45 A;  3I5O A;  1NNF A;  3FVN A;  2AL5 A;  5ICT A;  3WAE A;  5ISU A;  3IJO B;  1QKA A;  4GWO A;  4OYV A;  1MS7 A;  3SEY A;  1L5T A;  2D21 A;  1LAX A;  4NTL A;  5ELV A;  1POT A;  4NWD A;  2ANJ A;  1IXC A;  3MWB A;  2ZNT A;  1HSJ A;  1JET A;  3O2A A;  3KG2 A;  3PPO A;  3P7I A;  1SDX A;  4HS7 A;  4KCD A;  2H25 A;  2ZNU A;  3IAZ A;  3V5A A;  3MP6 A;  1R9L A;  2DYX A;  3LUY A;  3TUS A;  4JSO A;  4LZ8 A;  4OVJ A;  1WOD A;  5H8F B;  2Z8F A;  3VVE A;  5H8F A;  3RUM A;  1B7Z A;  3K1P A;  1A55 A;  3ONM A;  4XKP A;  3K0V A;  4F39 A;  3IB1 A;  3MZ9 A;  3H3G A;  1RYX A;  4GXS B;  4I8C A;  2RC8 A;  2UYE A;  3G3K A;  3GZG A;  1N0T A;  3U72 A;  1JEV A;  1ZTY A;  2OJT A;  3H6U A;  3TQW A;  1PBP A;  4IO5 A;  3G3F A;  1USY H;  3Q26 A;  1I6B A;  1BKA A;  1N3X A;  1TFD A;  3T9U A;  3L6G A;  4QFP A;  3S9M C;  3E3K A;  1M5E A;  3IO6 A;  1URS A;  1SYI A;  3U92 A;  3LBS A;  2I0B A;  1OLA A;  1N7X A;  3Q27 A;  3FJG A;  4NF6 A;  4P0G A;  4OFL A;  2CMO A;  3DP6 A;  2UVH A;  1H44 A;  1AL3 A;  4ZE9 A;  3ZKK A;  2O68 A;  5F1Q A;  1IXI A;  3QIM A;  4OER A;  3C35 A;  3DM0 A;  4ZEF A;  4G68 C;  1B3L A;  1Y1M A;  1HSL A;  3FV2 A;  2HAU A;  1SI0 A;  2B3F A;  1NNK A;  3CG3 A;  1MM7 A;  1FTK A;  4ELQ A;  2NWJ A;  3VVD A;  3BFU A;  3FV1 A;  1P1Q A;  2REG A;  3SEU A;  1QUK A;  3RTF B;  2I49 A;  3RGY A;  1B4Z A;  2OCU A;  4R74 A;  1PB7 A;  4E0X A;  5DVI A;  1MXV A;  5B70 A;  1LFI A;  4LON B;  1B5J A;  2H4I A;  4TLM B;  3IB2 A;  3W9V A;  1B46 A;  3LSL A;  4BDN A;  4NF8 B;  4JWY A;  2Q9T A;  1AH5 A;  4NF8 A;  2QS4 A;  2DXY A;  4NE4 A;  2UVG A;  1NNP A;  1LBC A;  5CBS A;  1B7H A;  3OSR A;  4P11 A;  3KGC A;  3LC8 A;  3M3L A;  1J1N A;  3FXU A;  4OQO A;  3FVO A;  2A5S A;  5ICQ A;  3F11 A;  4EF2 A;  4BDO A;  2RF1 A;  1P99 A;  4R75 A;  1DSN A;  2ZMB A;  3VLV A;  4EDP A;  3MJN A;  4F3P A;  1FQC A;  1B1H A;  2DWI A;  3IR1 A;  1EZO A;  4NF4 A;  1FQD A;  2XXY A;  2QSX A;  3EN3 A;  4P0I A;  4EQ7 A;  2F5X A;  1UIV A;  3TMG A;  1RKM A;  5JTY B;  1MY1 A;  5J1D A;  4NF5 B;  4NF5 A;  3B7D A;  5K2Y A;  2Y84 A;  4PP0 A;  3VFJ A;  4UAC A;  4PFW A;  3G7W A;  2H98 A;  4ELP A;  1DOT A;  2DS9 A;  4Q30 B;  4AB5 A;  3FXR A;  1YCJ A;  4LAT A;  4ELR A;  2PT1 A;  5FTI A;  1MQH A;  2HZL A;  2NVU B;  2O84 X;  5KCJ B;  3KSX A;  2V3T A;  1OIB A;  1JW4 A;  4BDQ A;  4F3B A;  3H7M A;  3SES A;  3N6T A;  3UIF A;  4FAT A;  5EYF A;  4ZED A;  5TP9 B;  3O6G A;  1XOC A;  3D4G A;  1OVB A;  2DSF A;  3HHG A;  4OTE A;  4IO7 A;  1MQG A;  1SW2 A;  3PU5 A;  3O6H A;  5I57 B;  4ONY A;  3N6U A;  4DCX A;  2XD3 A;  1NKX A;  5I57 A;  1SD3 A;  1HSE A;  2XXU A;  3L6H A;  3TZA A;  3HHF A;  3KSJ A;  1ANF A;  2HEU A;  3CG1 A;  1B52 A;  1FQA A;  4QHQ A;  4C1U A;  4MF3 A;  1TXF A;  3M8U A;  4UA8 A;  2R6G E;  3UGW A;  3CRB A;  3T96 B;  1S50 A;  1LBB A;  4X9T A;  4IO2 A;  1MPC A;  1LB8 A;  2DE2 A;  3C9H A;  2QS3 A;  4I9D A;  1EU8 A;  2AL4 A;  1S7Y A;  2I4C A;  4RA1 A;  1B0H A;  2Q88 A;  3A09 A;  3IOU A;  2OK2 A;  1SVX B;  3PMX A;  3HO7 A;  3LR1 A;  1SW5 A;  3MP8 A;  3KZG A;  4HW8 A;  5I84 A;  1MY4 A;  3LSW A;  4ZEI A;  3TTR A;  2P2A A;  3I6V A;  1NH7 A;  2RC7 A;  3FIR A;  4NWC A;  4PE5 B;  1MH3 A;  4MLQ A;  4JDF A;  2DP8 A;  1Y3P A;  3FVK A;  4PET A;  2O1M A;  3EF7 A;  3MVX A;  1ZMG A;  1UQW A;  2BJJ X;  3OMB A;  3RY3 A;  3TTK A;  3K6U A;  4PFT A;  4GRK A;  3RT8 A;  5L8D A;  4BDL A;  5AA1 A;  4C0R A;  3VVF A;  1MM6 A;  3C4M A;  2HZK A;  4G8N A;  4EQB A;  1D3K A;  4DXU A;  5A5X B;  4AQ4 A;  4U21 A;  4GQO A;  3UOR A;  2XXQ A;  4F29 A;  3VLU A;  5HM4 B;  4YKJ A;  4OFO A;  3T9X B;  1OQH A;  4G8M A;  3U1O A;  1QUI A;  1MH4 A;  5H8N B;  5H8S A;  3OXN A;  5I2N B;  1QUL A;  5H8N A;  3TTN A;  1BLF A;  1FQB A;  4TQU Q;  1BIY A;  1ZLQ A;  1UTH B;  1POY 1;  2F78 A;  3H6W A;  3KEI A;  1Y3N A;  4LQ5 A;  3GBB A;  4H6D A;  2F7B A;  1N76 A;  2ZYO A;  1B51 A;  5FTH A;  4FJP A;  3IOW A;  1XS5 A;  3E4R A;  1A8F A;  3V89 B;  3OO7 A;  3N26 A;  2F7A A;  4YB6 A;  2GRV A;  2E0S A;  2REJ A;  3JZJ A;  4R73 A;  2OBG A;  4H5F A;  4YB7 A;  4BLA A;  1FTO A;  3IL1 B;  5DVJ A;  2PVU A;  2P1S A;  3R7X A;  4PFY A;  2RC9 A;  1LAH E;  4YIC A;  1UIU A;  1ELJ A;  3K4U A;  3K1M A;  3U93 A;  4EXK A;  3PPQ A;  4WXJ A;  2F8D A;  5CMC A;  5DEX A;  4OZ9 A;  4KYS A;  1YAE A;  3W9W A;  4KPT A;  1S9T A;  2QS1 A;  4JBZ A;  3N5L A;  1CE2 A;  1NFT A;  4ZS9 A;  2KLF A;  1ZJL A;  1ATG A;  4JXI A;  3N94 A;  4GL8 A;  3JV9 A;  1EZP A;  3PD9 A;  2DVZ A;  4KI0 E;  3PGF A;  3HV1 A;  1ZU0 A;  1MY2 A;  2I6E A;  1GVC A;  4LP2 B;  1MDP 1;  2O7I A;  1B05 A;  3TAJ A;  4F1V A;  3C32 A;  2VOZ A;  4YU0 A;  2XHD A;  2Z8E A;  4NF6 B;  5TPA A;  3TYH A;  4LZ5 A;  3B6T A;  2VHA A;  3PUV E;  3CFL A;  3C36 A;  1MQJ A;  1NNT A;  1MY0 A;  2V3U A;  2W7Y A;  4JWO A;  3K02 A;  5JK4 A;  3SEV A;  3CVG A;  3Q28 A;  2LAO A;  2I58 A;  1Y20 A;  2DOJ A;  3IJX B;  3ZS6 A;  3W15 C;  4NED A;  1SW4 A;  5BUU A;  1EZ9 A;  4R9G A;  5H8Q A;  1Y9U A;  3TOD A;  3FVG A;  5AA2 B;  3KN8 A;  4ISU A;  3BBR A;  5AA2 A;  4ZEB A;  2CZL A;  4QSC A;  4BDM A;  2DE3 A;  3MZ1 A;  3PPP A;  2XX8 A;  4EF1 A;  1DMB A;  4FEB A;  1B0L A;  1A8E A;  4HCW A;  4F19 A;  1VSO A;  1Y3Q A;  1IXH A;  2UXA A;  1MXY A;  3FZV A;  1BP5 A;  3VXC A;  3C33 A;  3TTL A;  3TDJ A;  5CI5 A;  5AE4 A;  4C1T A;  1II5 A;  2ESN A;  3PMW A;  2Y7K A;  3O9P A;  4M1V A;  2R9J A;  1IXG A;  4IGT A;  3M3K A;  3IK6 B;  2E1S A;  2VP1 A;  1MXX A;  1BTJ A;  3O6I A;  1Q1K A;  1XVX A;  4KFQ A;  1IIW A;  2ZYM A;  4DIG A;  2GHB A;  3U94 A;  1N3W A;  3V83 A;  2NOO A;  4NF4 B;  4Q0C A;  1US4 A;  3MVY A;  1VR5 A;  4XIG Q;  4N6P A;  1PB8 A;  3PPN A;  4U4S A;  1QW0 A;  3CR9 A;  5FHN A;  4QFL A;  2VD3 A;  1Z7N E;  4PFU A;  1D4N A;  1JVY A;  3PV0 E;  1LCT A;  4KQP A;  4O3C A;  5CM6 A;  2O6A A;  2ONS A;  2V93 A;  2O69 A;  4FEC A;  1VFD A;  3FXQ A;  4YMB A;  2QRY A;  2HXW A;  4H8I A;  1B5H A;  4GVO A;  3MZB A;  1N84 A;  1USY E;  4WED A;  3VE1 B;  3H6V A;  3IO4 A;  4TOZ A;  3OEM A;  2XXI A;  4YB5 A;  3RLF E;  2OLB A;  1LFH A;  3CIJ A;  2GH9 A;  5AA4 B;  1LLS A;  2ONK E;  1SI1 A;  3A3U A;  5ITO A;  4GXA A;  5AA4 A;  3R26 A;  3PMV A;  3HPI A;  1H76 A;  5DVF A;  3FAS A;  3QXM A;  5CRY A;  3TCH A;  4OEU A;  2X7Q A;  5H8H B;  4XKN A;  2VGQ A;  3KJT A;  3S9E A;  5EHS A;  5H8H A;  2I0C A;  4U1O A;  1EH3 A;  1IIT A;  2V25 A;  4O3B A;  4U22 A;  1TWY A;  3EHS A;  4HCY A;  3ZKL A;  3PUW E;  1I6A A;  3GBA A;  2XD2 A;  1SQY A;  4F3S A;  3RT6 B;  1MXZ A;  3H03 A;  3GLB A;  4OEV A;  4E0W A;  2XX9 A;  1B6H A;  5K2X A;  3IB0 A;  1DPE A;  3TKD A;  1D9Y A;  1LGB C;  2XXT A;  4ESW A;  4F1U A;  3IOR A;  3S2V A;  1JVX A;  4U2R A;  5LOM A;  1JNF A;  5I56 B;  4POW A;  1B3H A;  1PC3 A;  4ECF A;  1FQF A;  5I56 A;  2F6G A;  1I6Q A;  2XXP A;  3RTW B;  5HPQ A;  3C34 A;  4QFO A;  5B7D A;  4G2Z A;  4X1D A;  1B7U A;  1MG1 A;  3OEK A;  1YPN A;  1FW0 A;  3TCF A;  1T0K A;  5I2K B;  4KYE A;  4X48 A;  3MPK A;  5I2K A;  4I62 A;  2NUV A;  4OWD A;  3MAM A;  4R2F A;  1VE4 A;  3E13 X;  1TFA A;  4DE8 A;  1RYO A;  4OET A;  1B4H A;  3V8X B;  3EQ1 A;  4H0W A;  3S9L C;  5F7V A;  2Y7I A;  4RY1 A;  3K2D A;  3H6T A;  1M5F A;  4QFN A;  2QMW A;  2F34 A;  1FQE A;  2XX7 A;  4EXL A;  1WDN A;  3KBR A;  4ZZE A;  4FED A;  4QRZ A;  1GTK A;  3EPE A;  3FD3 A;  1A99 A;  2Q89 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...