3ODBA

Haemophilus influenzae ferric binding protein a -iron loaded -open conformation
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
308
structure length
308
Chain Sequence
DITVYNGQHKEAATAVAKAFEQETGIKVTLNSGKSEQLAGQLKEEGDKTPADVFYTEQTATFADLSEAGLLAPISEQTIQQTAQKGVPLAPKKDWIALSGRSRVVVYDHTKLSEKDMEKSVLDYATPKWKGKIGYVSTSGAFLEQVVALSKMKGDKVALNWLKGLKENGKLYAKNSVALQAVENGEVPAALINNYYWYNLAKEKGVENLKSRLYFVRHQDPGALVSYSGAAVLKASKNQAEAQKFVDFLASKKGQEALVAARAEYPLRADVVSPFNLEPYEKLEAPVVSATTAQDKEHAIKLIEEAGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The role of vicinal tyrosine residues in the function of Haemophilus influenzae ferric binding protein A.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Metal binding protein
molecule keywords Iron-utilization periplasmic protein
total genus 113
structure length 308
sequence length 308
ec nomenclature
pdb deposition date 2010-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3odbA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3odbA02
4GF8A 3G3KA 2OWSA 4PQJA 2DS9A 3N5LA 4QSEA 4OWDA 2Q9TA 3PPOA 4KYEA 3UP9A 2I48A 2AYSA 3SEVA 1VE4A 1A8EA 1BTJA 2QL3A 4OEUA 1PB7A 4YB7A 1LAXA 3I5OA 1LFIA 2DOJA 4ONYA 3OEKA 3V83A 2DE4A 1USYE 4LONB 3TYHA 4DCXA 3IORA 1IITA 4OXVA 3Q29A 2H4IA 2HZKA 4FEBA 3K1PA 3FZVA 3SESA 4H5GA 4TQUQ 2NOOA 1JW4A 1FTMA 1B3HA 1NNTA 2PVUA 2O68A 2XXHA 3FVGA 3IB0A 3LC8A 2Q88A 3LSWA 4OQOA 4QFKA 4RY1A 4NF6B 3G3HA 4F3SA 3SEXA 4QHQA 4JWYA 5I58A 1FTKA 2VD3A 1WODA 1O63A 3U72A 4OFOA 4GVOA 4R73A 1FQCA 1Y4CA 3C33A 1Y3PA 4H67A 5DT6A 3THIA 3VVFA 1LFHA 1TFAA 2W7YA 3KN3A 1AMFA 2O7UA 3MP1A 4XKRA 1TWYA 3IAZA 3PUZE 4DXUA 1SVXB 2REJA 1QKBA 2RCBA 1SQYA 4OERA 3S9NC 4FEDA 1B2HA 2XHDA 3K1NA 2QS2A 4N07A 4OTEA 4YB6A 1VR5A 4TLLB 3ZS6A 5ICQA 1GGGA 4XIGQ 1MY1A 3UORA 2X7QA 1PEBA 3PMXA 4BDLA 2QMWA 4R72A 1UIVA 5CBSA 5AA2A 5L9OA 1B4HA 2V3TA 4X48A 1H44A 5J1DA 1MXXA 3T9UA 3Q26A 3C4MA 2V3UA 4F3PA 3H6VA 2B3BA 3K6UA 3F11A 5TPAA 1MQHA 3H4ZA 3MWBA 2OK2A 3KOSA 2H9BA 2HXWA 1B3GA 4UA8A 4F22A 3H7MA 1QUKA 2DWAA 2R6GE 3M3LA 1QKAA 4JBZA 5I57B 4KCCA 4PFUA 1OLCA 2P0SA 3GBBA 1UIUA 3IL1B 3MZBA 3QK6A 1M5BA 3T9VA 1VSOA 1Z7ME 4FECA 1NFTA 1LCFA 1BIYA 4F2QA 1SYIA 2F6GA 3FJGA 4DXBA 1IXIA 2XXQA 2XXUA 2RKMA 3MPKA 4EXLA 3KOTA 1POY1 1QJMA 3C9HA 1MH4A 4IO3A 1NNFA 3ZKKA 3S9LC 2ONSA 4IGRA 1NH7A 3H6UA 3FD3A 5KDTB 3IK6B 3MQ9A 5FHMA 3ILUB 2E0SA 3T9XB 4BDMA 1HSEA 2F7BA 3FGSA 5I58B 2IA4A 2GHAA 1R1NA 2KLFA 3Q28A 1RYOA 1SW1A 4LA9A 3RNNA 1Y4TA 4N6PA 1MXZA 4PFYA 2DVZA 4DCYA 2QS3A 4DXCA 4R75A 1MXUA 1MQGA 1MQIA 4QSDA 3S4UA 5H8HB 1DTGA 3R26A 4G8HA 1GV8A 3ZSFA 2PBWA 3OOAA 3QXMA 4GRKA 4RK9A 3RGYA 2I6EA 3K6XA 2ESNA 4LP2B 4U4XA 3W9WA 4EF1A 1DOTA 3EHTA 5ICTA 3KEIA 2DQVA 1UTBB 4THIA 1L5TA 2DXRA 1ZJLA 5CMKA 4OENA 2THIA 1I6AA 3PPQA 1MDP1 3O97A 2D3IA 4QFNA 3S9EA 1JEVA 2NUVA 4G4PA 4KI0E 1LBCA 3UIFA 1Y3QA 4C1UA 4ND9A 3Q25A 3IJOB 4EQ9A 3G3FA 3MVWA 4EUOA 2ONRA 1QULA 5KDTA 1B5HA 3M8UA 1FQDA 1SDXA 3H06B 3FASA 1Y9UA 5L9MA 3IOUA 4YMAA 4NF8B 3FV1A 5F7VA 3KSJA 5I2NA 4O3AA 4GLIA 4IY6A 3TTLA 4UACA 1QW0A 3E9XA 1TXFA 3ONMA 3EPEA 4XTCQ 4AQ4A 4BDQA 2O7IA 1MXVA 5F1QA 4JXIA 1JEUA 2Z8EA 4HCYA 2Z8FA 4JWXA 4Q30B 2GFEA 1M5CA 3UA8A 4GQOA 3MW0A 3KJ7A 3B6TA 4GIZA 1BKAA 1XC1A 3IOVA 4F19A 3KGCA 5DVJA 1CE2A 2XX9A 1MG1A 1XT8A 2VP1A 2O84X 1US4A 2ZYMA 5CMCA 2HFBA 1USYH 3A3CA 3LR1A 4ZDMA 5H8FA 2DWHA 2I0BA 5JK4A 4G8NA 4H0WA 3FV2A 1MM7A 1B52A 1B05A 2UYFA 4YKJA 1KWHA 5HBCA 5K2YA 1R9LA 2AL5A 1FQFA 4PFWA 5L9SA 2O1LA 4G68A 4QFLA 4XXUA 5I57A 3RN8A 3CG3A 4MFIA 1PBPA 3BKIB 2PT1A 4Q5TA 4WEDA 5H8HA 2YPNA 3RT6B 5I2KA 2Z8DA 3TAJA 4JSOA 4OYVA 2Z22A 5I59B 1DMBA 5IAIA 3GBAA 2GHBA 1LGBC 3C31A 4O3CA 1H76A 3V89B 2PYYA 2UXAA 2Y7IA 4OFLA 3K02A 4JDFA 5H8QB 1I6QA 3SETA 4AB5A 2VGQA 3H3GA 3IJXB 5AA2B 4FAJA 1NMUA 3K1MA 1Y20A 1HSJA 3K0VA 1NNPA 3IOTA 4R9FA 3VDFA 3WAEA 2Y7RA 2UVHA 1I6BA 1D3KA 4YKPA 2M8CA 3U1OA 1Y1ZA 1MRPA 1SW4A 1NNKA 3VXCA 3FXQA 2PT2A 4F31B 4XKQA 4EDPA 1IIWA 1MQDA 2I3WA 4HTGA 4ISUA 3TELA 1MH3A 3D4CA 1MPCA 1UQWA 1ZIUA 4Z0IA 1N0TA 2AL4A 4NF4B 3LSXA 3FXUA 1A99A 5AA4B 3TUSA 4GXAA 4KPTA 3A09A 3HPIA 4Q0CA 3RTWB 1MQJA 2P1SA 2Q2CA 2ZYOA 5A5XA 2F6PA 1N04A 5I59A 5TP9A 3MVXA 3K00A 1AOVA 2F35A 3TODA 3EHSA 1LBBA 1ZU0A 3FUZA 2I4BA 3MP8A 3OO6A 2B65A 3DELB 4LZ5A 4OETA 5K2XA 3RLFE 3R6UA 4FATA 3G3JA 4G68C 1ZTYA 4PP0A 1P1WA 3PPNA 2A5TB 4POXA 3K01A 2QJEA 4YICA 3K6WA 4TLMB 1FQBA 2F97A 4IO6A 1EZ9A 4LUBA 1P1QA 3N94A 2Z23A 4NF5B 3MC2A 1B5IA 5I2NB 4HCWA 4ESXA 2E1SA 1O7TA 1N3XA 5FTHA 4F3GA 3TKDA 1FQAA 4QFPA 1MXYA 3SERA 3CIJA 1B5JA 4PFTA 2O6AA 1GR2A 3D4GA 3E4RA 3U8QA 1EU8A 2PX1A 5I56A 1T0KA 1LAGE 2DWJA 5CI5A 1MY3A 1SYHA 4LZ7A 4OVJA 1B32A 1R6ZA 3H6WA 4TOZA 3TTMA 1B9JA 3FVOA 1RKMA 1EZOA 1BLFA 3CI8A 2O69A 3PD8A 3U93A 3CSGA 1LFGA 1JW5A 1B0LA 1YPNA 3PPPA 4AB6A 1PBQA 2FNCA 2I0CA 5JEIA 1PB9A 2WKYA 2ANJA 3N6UA 5DEXA 1S9TA 3T22A 3TCHA 5CMBA 1B40A 2ZYNA 2A5TA 3CRBA 3ILTB 3PPRA 3GLBA 4OZ9A 5FHOA 1XHYA 2Q2AA 3RY3A 4DLDA 3FVNA 1OQHA 3B7DA 3RPWA 4G2ZA 3DP4A 2VOZA 4RNSA 2G93A 3HHGA 4G68B 4WEPA 3SEUA 4IO4A 3T93B 2DSFA 2XXXA 2RC7A 1MY4A 1D4NA 3K4UA 2ZNTA 4FIMA 4H6DA 4I62A 4XKNA 5DVFA 1VFDA 3LSLA 1MY0A 2OWTA 4KYSA 3TMGA 4BDNA 4XKPA 4F1VA 5DVIA 3BBRA 1YTVA 4M4GA 1QUIA 1IXGA 4EXKA 1SD3A 5A5XB 2B3FA 3RQTA 3CFLA 3ZKLA 3PD9A 2I3VA 3TQLA 1QVSA 3O28A 2UVIA 4GD5A 2A5SA 3PV0E 5HPQA 4ZS9A 3TTRA 2RC9A 1UTHB 1B3FA 2O1MA 4P0IA 2RINA 1JQFA 3FATA 4PE5B 4RA1A 3IO6A 2VD2A 2ALUA 3G3IA 5DEXB 5JTYA 5CC2A 1A40A 4O3BA 5CMMA 3TEPA 4U4SA 4NF5A 4LVQA 3HO7A 2F7CA 4OEVA 3VLUA 4DIGA 2I4CA 5M2VA 1II5A 4GL0A 3M3FA 4I9DA 3I6VA 4G8MA 3FVKA 4NF4A 4EF2A 1J1NA 1B58A 1OLAA 2UVGA 3Q27A 4ZZEA 3LUYA 5AA4A 4ZECA 2H5YA 2R9JA 4NWCA 4HS7A 3TPAA 2H99A 1LCTA 4U23A 3T66A 5TP9B 5BWJA 3O6IA 3CFZA 3W9VA 1P1NA 1B46A 2XXIA 2XD2A 4Q8RA 3CFXA 4JSDA 1UTBA 3TTKA 2HQ0A 2LAOA 2G29A 4ELQA 2D5WA 5TU0A 1LB8A 1SBPA 3MVZA 4YZZA 1ZMGA 2UYEA 3OENA 1ZLQA 2DVCA 4NEDA 1M5EA 3KBRA 1OIBA 2QS1A 5BUUA 1AH5A 1URGA 1R9QA 2DXYA 1ZBMA 3KSXA 4ZEDA 2AIXA 4R6YA 1O64A 1FQEA 2IEEA 4JWOA 4C0RA 3PMWA 3DM0A 1SI1A 2HAVA 4NF8A 3VFJA 2XX8A 2Y7WA 3QYTA 4LZ8A 2PMSA 1US5A 1N76A 2DE3A 5DYHA 4LATA 1Q1KA 3A3UA 5B7DA 2O51A 3EHUA 3V5AA 3UK4A 5I56B 1NL5A 4X9TA 4GXSB 5L8DA 2FYIA 3OSQA 3VXBA 1ATGA 4F29A 3LSFB 3OEMA 2ZYKA 4MH5A 2X7PA 3PU5A 1N84A 3DLNA 3O66A 3T9HB 4IY5A 1FTOA 2V93A 1P1OA 2XXTA 3IX1A 1ZKBA 3CVGA 1FTJA 4NE4A 3MAMA 4P11A 3LBSA 4MBPA 1OMPA 4BDOA 1LAFE 3VLVA 1P1UA 4JB7A 5H8NA 1Z7NE 3BFUA 4R2FA 4YAHX 3KN7A 5H8FB 3SEWA 4F2OA 1A8FA 2VHAA 3MJNA 2XXVA 3V8XB 3VE1B 2YLNA 1GVCA 4U22A 1B7ZA 3TFLA 2V84A 3S2VA 1S7YA 2F34A 3K2DA 1OQGA 1TT1A 4R2BA 1JNFA 3SDFA 4U21A 5I2KB 4KYDA 3P7IA 4EQBA 4F18A 4F1UA 4MLQA 5I84A 1D9VA 3VLWA 5CM6A 1A7LA 1B51A 3W15C 3DP6A 3FJMA 3O29A 1B7UA 3DP8A 4R74A 1B6HA 3C34A 5ITPA 4H1XA 4OFJA 1OVTA 3OO8A 3KFMA 5EYFA 5ISUA 1MY2A 5HM4B 1UTHA 4MF3A 1LAHE 2XXYA 3EF7A 4KR5A 3S9MC 3PUXE 3VVEA 2F8DA 4GOTA 4FJPA 1F9BA 2DWIA 1XOCA 2CMOA 4BLAA 1JVYA 3MBPA 2GRVA 5ELVA 1LLSA 3O6HA 1PC3A 4I8CA 4DZ1A 3OSRA 5FHNA 4U2RA 4KQPA 3E13X 3UGWA 5AE4A 4BDRA 2XXPA 3PGFA 4F3BA 3E3KA 3FXRA 1B4ZA 1URSA 3CR9A 1N7XA 1N3WA 1MXWA 1I69A 1DPPA 1IXCA 2ONKE 4ZEKA 3RUMA 2OBGA 3TQWA 3C35A 2Y84A 1B1HA 3C32A 3OXNA 1M5FA 4ZZAA 3VV5A 1DPEA 3BFTA 1IXHA 3H6TA 2D21A 3FIRA 4RJZA 3TTNA 3VVDA 5IKBA 3U92A 2H98A 4QF9A 4H5FA 2FA7A 2DP8A 2HZLA 3MPLA 3EN3A 3O6GA 2Y7KA 1URDA 5H8NB 4RPNA 2OCUA 2XXRA 1QUJA 1CB6A 3AXFA 1LSTA 3QAXA 4LQ5A 1XVYA 1Y1MA 5AA1A 1ANFA 4HW8A 2F5XA 1B3LA 1SW2A 2Q8JA 3MZ9A 1SW5A 4ZEFA 3UN6A 1MPDA 3JV9A 1IUDA 2UVJA 2Q89A 2CZLA 3O2AA 4RXLA 1JETA 2DE2A 3L6HA 4QRZA 2RC8A 1B1XA 1MS7A 3MVYA 1B0HA 4YKKA 1POTA 5B70A 4ELPA 1EH3A 4GL8A 4WXJA 1FCKA 4H8IA 2Y7PA 1NKXA 5AA2D 1MPBA 1IZ1A 3IOWA 3C36A 2XX7A 3L6GA 1SI0A 4I1DA 4ECFA 3SEYA 3OO7A 4GWOA 3B6WA 4IO7A 3WAFA 1FTLA 1MDQA 1YAEA 3IB2A 1TFDA 4NMYA 3H03A 4DDDA 2GH9A 2OJTA 1OVBA 1BP5A 2RF1A 3HN0A 3QUFA 4P0GA 5EHMA 4Z7EA 3KJTA 2XXWA 1A55A 3TCGA 1LB9A 4F39A 1MM6A 2NXOA 5LOMA 3RTFB 1EZPA 3KN8A 1FW0A 3M3KA 5FTIA 4E0XA 4MLVA 2QSXA 1A54A 1Y3NA 4LQ2A 4KHZE 2F7AA 1B7HA 1S50A 1Q35A 4L17A 2BJJX 2P2AA 3QUJA 4YB5A 2QS4A 5CRYA 4ZEIA 2REGA 4DE8A 3PUWE 3IB1A 5KZTA 1B3EA 3OO9A 2H25A 4FE8A 1H3DA 4IO2A 1YCJA 2R71A 3MP6A 4R9GA 2ZNUA 3JYRA 2YJPA 3SKPA 4IO5A 3IR1A 4U1ZA 4RPOA 4OHNA 2OZZA 4X1BA 3GXAA 5EHSA 3IO4A 4POWA 1AIVA 1HSLA 5KCJA 1WDNA 1PDAA 4NTLA 3R7XA 2V25A 3I3VA 3B6QA 4M1VA 4R6KA 4YU0A 4C1TA 1ELJA 4R6HA 3OMBA 1PB8A 2I58A 1DTZA 3ECRA 4ZE9A 5JTYB 2I49A 3HHFA 2ABHA 4IGTA 3GZGA 1H43A 4G77A 4H8JA 4KCDA 3TZAA 1IQ7A 1RYXA 2DYXA 3CG1A 3CSBA 3K6VA 3PMVA 3G3GA 4IB2A 4X1DA 3MUQA 5TPAB 1JW1A 2NWJA 5AA3A 4U1OA 2ZXTA 4OESA 4K3FA 3OD7A 3MZ1A 3QIMA 1XVXA 2QRYA 4N13A 5KCJB 4RYAA 4ZEBA 1AL3A 2X26A 4OMBA 4PETA 5ITOA 4FORA 4EQ7A 4GFRA 1H45A 5H8SA 4H65A 3T96B 3ODBA 3HSTA 4NWDA 1N7WA 3TDJA 2F36A 4KD5A 3HV1A 2V3QA 3PUVE 4ZE8A 4E0WA 1GTKA 2OLBA 2HAUA 1WVJA 1JVXA 1XS5A 3PUYE 5H8QA 2HCAA 3FJ7A 2NVUB 5CBRA 1VFEA 3N6TA 4QSCA 4QFOA 4WKMA 3EQ1A 4ELOA 2HEUA 2RCAA 1P99A 1DSNA 1NH8A 4NF6A 1D9YA 3KZGA 2ZMBA 2XD3A 3JZJA 4KFQA 4YMBA 4F1YA 1IEJA 2QPQA 1M5DA 3HCQA 3QSLA 4YKIA 3TCFA 3N26A 2ZNSA 3KG2A 4RK2A 4ELRA 2QMXA 3OELA 3USDA 5DTBA 3G7WA 2F78A 4ESWA 3RT8A 3O9PA 3U94A
chains in the Genus database with same CATH superfamily
3G3KA 3E79A 4QSEA 4OWDA 1PB7A 4YB7A 1LAXA 4ONYA 1USYE 3TYHA 3SESA 2HZKA 4PE3A 4TQUQ 4OVPA 1JW4A 1FTMA 1B3HA 2PVUA 2XXHA 4RY1A 3IB0A 3FVGA 3LSWA 1FTKA 2VD3A 4OFOA 1LFHA 3THIA 5DT6A 3MP1A 4OERA 2RCBA 4N07A 2ZZWA 3ZS6A 2XA5A 3UORA 4R72A 5CBSA 2V3TA 4F3PA 2B3BA 1MQHA 2HXWA 2FIEA 4F22A 3H7MA 3M3LA 1QKAA 2V4CA 4KCCA 5I7IA 2CEXA 1KA1A 3FXBA 1M5BA 1VSOA 1LCFA 1SYIA 1IXIA 2XXQA 3KOTA 4IO3A 3S9LC 4IGRA 2VPNA 1LBWA 1FJ9A 3T9XB 3FGSA 2GHAA 3FBPA 4LA9A 4MX6A 4QXDA 1GV8A 2PBWA 3RGYA 4OVRA 1NV2A 2ESNA 4LP2B 4U4XA 1DOTA 3EHTA 5ICTA 2DQVA 3T1BA 2THIA 1I6AA 1MDP1 2D3IA 4QFNA 4ND9A 3G3FA 1B5HA 3M8UA 5IGAA 3FASA 5L9MA 5F7VA 1TXFA 5IZZA 3EPEA 2O7IA 1MXVA 4JXIA 1JEUA 2Z8EA 4HCYA 4JWXA 1M5CA 3MW0A 4N15A 1BKAA 3IOVA 1CE2A 1XT8A 2ZYMA 1FBPA 2HFBA 3A3CA 3FV2A 4YKJA 5K2YA 1FQFA 5L9SA 4QFLA 5I57A 4WEDA 3RT6B 5IAIA 2GHBA 4LN5A 1LGBC 3V89B 2JJKA 2PYYA 4JDFA 3IJXB 4OVSA 1NNPA 3IOTA 3VDFA 3WAEA 2UVHA 1NNKA 1IIWA 1MQDA 2I3WA 4HTGA 1N0TA 2AL4A 1A99A 4HE0A 3A09A 1MQJA 3GYYA 2F35A 1LBBA 1ZU0A 2I4BA 1NUYA 3DELB 1JP4A 5K2XA 4OVTA 3G3JA 1ZTYA 4PP0A 4POXA 3K01A 3N94A 2Z23A 3KC0A 3MC2A 1O7TA 1N3XA 4F3GA 3E4RA 1EU8A 1B32A 4GWSA 3FVOA 1RKMA 1BLFA 3PD8A 5ESYA 1KZ8A 1JW5A 1B0LA 1YPNA 4AB6A 1PB9A 3T22A 1S9TA 3CRBA 2A5TA 3PPRA 3GLBA 2Q2AA 1OQHA 4RNSA 5T3JA 2DSFA 4XKNA 2OWTA 4KYSA 3RPLB 4BDNA 3BBRA 1YTVA 2B3FA 3PD9A 1Q9DA 4ZS9A 2O1MA 2RINA 3FATA 4MHFA 5DEXB 5CC2A 3HO7A 4OEVA 3VLUA 5M2VA 1J1NA 1B58A 4ZECA 2R9JA 3TPAA 2H99A 3T66A 4Q8RA 3MVZA 4YZZA 4KXPA 4NEDA 1R9QA 3KSXA 2AIXA 1FQEA 2IEEA 4JWOA 3PMWA 4N8GA 2XX8A 5EYGA 2PMSA 1N76A 4LATA 1Q1KA 3A3UA 3EHUA 1NI9A 3UK4A 5I56B 3OEMA 2X7PA 1G0HA 4P11A 3MAMA 3LBSA 1LAFE 4JB7A 5H8NA 2L5VA 4R2FA 4X04A 1A8FA 3MJNA 3V8XB 2F34A 4F18A 1D9VA 3VLWA 5CM6A 4N17A 3FJMA 3O29A 3DP8A 5ITPA 4HXVA 2XXYA 4FJPA 1F9BA 3MBPA 5ELVA 2WEFA 4BDRA 2HXRA 2XXPA 1URSA 1I69A 4H45A 1IXCA 2ONKE 3RUMA 2F3BA 3OXNA 3H6TA 3FIRA 3LV0A 3U92A 4H5FA 4I3EA 3EN3A 1FPLA 1D9QA 1CB6A 3AXFA 3QAXA 1XVYA 1ANFA 4ZEFA 4XFEA 2UVJA 4JVDA 3L6HA 1B0HA 2QFLA 5B70A 4ELPA 1EYJA 5AA2D 1IMDA 4ECFA 3L6GA 4HE2A 1SI0A 1RDZA 4NMYA 1TFDA 2GH9A 5EHMA 3TCGA 1A55A 5LOMA 3RTFB 1EZPA 4E0XA 1A54A 4LQ2A 5ET7A 1Q35A 3IB1A 1B3EA 2H25A 1LBVA 3IR1A 1AIVA 3I3VA 1ELJA 5ET8A 3ECRA 4IGTA 3HHFA 4KCDA 1H43A 1IQ7A 2DYXA 4H46A 3CSBA 4X1DA 3G3GA 1G0IA 2NWJA 4U1OA 2ZXTA 4OESA 3OD7A 4ZEBA 3T96B 4HW8A 1N7WA 4P47A 1GTKA 3SERA 2HAUA 1JVXA 1XS5A 3PUYE 1LBZA 1VFEA 4QSCA 1P99A 3PTYA 3KZGA 2ZMBA 4F1YA 1QGXA 3SZPA 4PAIA 3TCFA 2ZNSA 2PFZA 4RK2A 3O9PA 3U94A 4GF8A 2DS9A 1VE4A 1BTJA 2QL3A 1IMAA 2WBBA 3V83A 2DE4A 3BIHA 3IORA 4OXVA 2H4IA 3K1PA 3FZVA 4H5GA 4GWZA 2NOOA 2HHMA 4XF5A 1NV7A 4NF6B 3G3HA 4QHQA 4N6KA 4R73A 4MMPA 4H67A 1Y3PA 1AMFA 4C1TA 2XHDA 1VR5A 2X7QA 1UIVA 1H44A 2VT5A 5IZ1A 3KOSA 4UA8A 1B3GA 4X8RA 4PF6A 4PFUA 4MNPA 3QK6A 1NFTA 4NF0A 4F2QA 3FJGA 2RKMA 3ZKKA 1QJMA 1NH7A 5KDTB 1YYZA 2E0SA 2F7BA 2IA4A 1R1NA 3Q28A 1RYOA 1Y4TA 4N6PA 4DXCA 4R75A 1MQGA 1MQIA 1DTGA 4G8HA 4GRKA 4RK9A 2CZHA 3K6XA 4EF1A 3KEIA 1UTBB 4THIA 2DXRA 1ZJLA 1Y3QA 4C1UA 4EUOA 3MVWA 1K9ZA 1QULA 3IOUA 4YMAA 3KSJA 1QW0A 3ONMA 4BDQA 5F1QA 2Z8FA 4GIZA 2PCRA 1RDYA 2O84X 5CMCA 1NUWA 1USYH 4MCOA 5H8FA 4ZDMA 4NAPA 4G8NA 4H0WA 1MM7A 1B52A 2UYFA 1R9LA 1FPGA 4XXUA 4Q5TA 5H8HA 3QMFA 3TAJA 4OYVA 1DMBA 2Y7IA 4AB5A 1I6QA 3CHGA 4MAGA 2QVRA 3A29A 2M8CA 2PT2A 1UQWA 3HPIA 4Q0CA 3RTWB 1N04A 5I59A 3MVXA 3EHSA 4OETA 3FUZA 3MP8A 3OO6A 4LZ5A 5DW8A 3R6UA 4FATA 4O8MA 4PGNA 2A5TB 3K6WA 1VDWA 1FQBA 5EQ7A 1FQAA 2XXKA 4PFTA 1GR2A 2PX1A 1LAGE 1MY3A 4TOZA 3H6WA 1B9JA 1EZOA 3CI8A 2O69A 4PBQA 3PPPA 1PBQA 3TCHA 5DEXA 1B40A 4DLDA 2Y5LA 4G2ZA 2VOZA 3HHGA 4G68B 4WEPA 3S9EA 3T93B 5FHNA 4I62A 5DVFA 3LSLA 1MY0A 5DVIA 4EXKA 3EKIA 3RQTA 3CFLA 3ZKLA 2UVIA 1UTHB 4PE5B 4P0IA 4DI4B 1JQFA 3IO6A 2OWZA 4GWWA 4NF5A 1II5A 4GL0A 3M3FA 4I9DA 3I6VA 3FVKA 2Q74A 2H5YA 4NWCA 4HS7A 1LCTA 4MNCA 2XXIA 1UTBA 3TTKA 5EQ8A 4JVIA 1LB8A 3OENA 3KBRA 5BUUA 1AH5A 1ZBMA 4C0RA 3DM0A 1SI1A 3VFJA 2HPGA 3QYTA 4LZ8A 5DYHA 2WYPA 3V5AA 1NL5A 4X9TA 2FYIA 2V93A 4XKPA 2F3DA 3CVGA 4MBPA 4PDDA 1P1UA 3BFUA 4GWUA 4F2OA 2VHAA 2YLNA 1GVCA 4U22A 1B7ZA 3TFLA 2V84A 2BJIA 3KBZA 1AWBA 5I2KB 4MLQA 5I84A 5ET6A 1A7LA 1B51A 4O94A 4H1XA 1MY2A 4OA4A 4KR5A 3VVEA 2Q8MA 2CMOA 1LEVA 3OSRA 4KQPA 2FVZA 3E13X 5AE4A 4N6DA 2XWVA 4P9KA 1N7XA 1MXWA 4ZZAA 3VV5A 1FBCA 1IMCA 3MPLA 4GBVA 3O6GA 2Y7KA 2OCUA 1QUJA 1LSTA 1MPDA 4RXLA 2Q89A 3O2AA 1JETA 2RC8A 3MVYA 1MS7A 4YKKA 1POTA 1EH3A 2Y7PA 1NKXA 2XX7A 3B6WA 3IB2A 3H03A 3T0JA 3HN0A 4P0GA 3QUFA 4F39A 2NXOA 3KN8A 1FW0A 3M3KA 1IMBA 4MLVA 2F7AA 1S50A 4PFRA 4ZEIA 4L17A 4F3BA 2P2AA 2QS4A 2REGA 3PUWE 3OO9A 1IMFA 4IO2A 4R9GA 3IFAA 2YJPA 4RPOA 4OHNA 3GXAA 2P3NA 1HSLA 1FTAA 5IZ3A 4M1VA 4R6KA 4R6HA 3OMBA 1PB8A 2I49A 3TZAA 2ABHA 4H8JA 4NX1A 4IB2A 1JW1A 2FHYA 5I5PA 1XVXA 2QRYA 1LBYA 3B50A 4OMBA 5ITOA 4FORA 1FPKA 5H8SA 3ODBA 4NWDA 2F36A 4KD5A 4E0WA 5AA2A 5H8QA 2NVUB 1FPEA 3N6TA 4QFOA 5EQAA 4WKMA 4HE1A 2HEUA 2RCAA 4KFQA 4YMBA 1IEJA 2PFYA 1M5DA 2QMXA 3USDA 3G7WA 3RT8A 3MSTA 4P8BA 2Q9TA 3PPOA 3UP9A 2I48A 2AYSA 4OEUA 2DOJA 1FBDA 4DCXA 4LONB 4PFIA 1BK4A 1NV3A 1NNTA 2O68A 4OQOA 4F3SA 3SEXA 4JWYA 3MYUA 1WODA 4GVOA 1FQCA 2FBPA 3VVFA 1TFAA 2W7YA 4XKRA 2O7UA 3PUZE 2REJA 1QKBA 3S9NC 1SQYA 1B2HA 4OTEA 5KCJB 4YB6A 1GGGA 1MY1A 4BDLA 1PEBA 2QMWA 4X48A 5J1DA 5TPAA 3MWBA 2OK2A 2H9BA 1SPIA 2R6GE 1FPJA 1OLCA 2P0SA 3GBBA 3MZBA 4FECA 1BIYA 2F6GA 4DXBA 3MPKA 1POY1 1IMEA 3FD3A 3IK6B 3MQ9A 5FHMA 5I58B 1SW1A 1DBZA 1MXZA 4PFYA 2DVZA 4DCYA 2QS3A 1MXUA 4N81A 5H8HB 3ZSFA 3OOAA 3QXMA 2I6EA 5CMKA 3PPQA 3O97A 4G61A 1JEVA 2GQ1A 4G4PA 4KI0E 3UIFA 3Q25A 4EQ9A 4GWXA 5KDTA 1SDXA 5I2NA 4O3AA 4GLIA 4IY6A 3TTLA 4UACA 3E9XA 4AQ4A 4XTCQ 4P3LA 2GFEA 3UA8A 4GQOA 3KJ7A 3B6TA 5DVJA 1MG1A 1US4A 2I0BA 4IR8A 1B05A 1KWHA 5HBCA 2AL5A 2O1LA 4G68A 3RN8A 4MFIA 1PBPA 2PT1A 3RPLA 2YPNA 4MNIA 2Z8DA 4JSOA 2Z22A 4O3CA 1NV4A 2UXAA 3K02A 2VGQA 3K0VA 1HSJA 4GWYA 4YKPA 3U1OA 1Y1ZA 1MRPA 3VXCA 1INPA 4XKQA 3TELA 1MH3A 3D4CA 5JK4A 4NF4B 5AA4B 3FXUA 3TUSA 4OANA 5A5XA 2Q2CA 3K00A 3TODA 3RLFE 2B65A 1P1WA 4YICA 2QJEA 4TLMB 1EZ9A 1P1QA 4NF5B 3TKDA 4QFPA 1MXYA 3CIJA 1B5JA 2CEYA 2O6AA 3U8QA 1SYHA 4GX6A 1CNQA 2FNCA 2WKYA 3N6UA 2ANJA 1XHYA 4I40A 3B7DA 1NV1A 1NUZA 3DP4A 2G93A 4IO4A 4U1ZA 2XXXA 1MY4A 3K4UA 2ZNTA 4F19A 1VFDA 4AS4A 1QUIA 1SD3A 2I3VA 3TQLA 2A5SA 3TTRA 4RA1A 4PDHA 2VD2A 3G3IA 1A40A 5CMMA 2VPOA 2WBDA 4ZZEA 3Q27A 3LUYA 4O7IA 3KC1A 5TP9B 3O6IA 3W9VA 2XD2A 3CFXA 4PBHA 2HQ0A 2LAOA 4I3YA 2G29A 5TU0A 1SBPA 1ZMGA 2UYEA 1ZLQA 2DVCA 1M5EA 1OIBA 4ZEDA 4R6YA 1O64A 4NF8A 4AS5A 1KA0A 3U65A 1US5A 5B7DA 3VXBA 1ATGA 4F29A 3PU5A 1N84A 4OVQA 3T9HB 4IY5A 1FTOA 1P1OA 2XXTA 1ZKBA 4NE4A 4BDOA 4UABA 2XWIA 3S2VA 1S7YA 1DK4A 3K2DA 1NV6A 1OQGA 5I3SA 1JNFA 3SDFA 4N91A 3BIGA 5A5LA 1B7UA 1B6HA 1OVTA 4QBAA 1FBHA 3KFMA 5ISUA 4MF3A 1LAHE 3EF7A 4GOTA 1JVYA 2GRVA 3O6HA 3PGFA 3E3KA 3FXRA 1N3WA 2OBGA 2Y5KA 1B1HA 3C32A 1DPEA 4PFBA 4RJZA 2D21A 3TTNA 2DP8A 2HZLA 5J16A 1URDA 5H8NB 1Y1MA 2F5XA 1B3LA 1SW2A 2Q8JA 3MZ9A 1SW5A 3UN6A 2MKZA 4QRZA 1B1XA 4GL8A 4WXJA 4H8IA 1MPBA 3OO7A 4GWOA 4IO7A 4DDDA 2OJTA 1OVBA 4Z7EA 1FBFA 1MM6A 3HFUA 2QSXA 1Y3NA 1B7HA 5CRYA 5HPQA 3QUJA 2P3VA 4DE8A 4JVCA 3MP6A 2ZNUA 3JYRA 2ZZVA 2OX3A 5EHSA 2OZZA 4X1BA 2B4LA 3IFCA 5KCJA 1PDAA 3B6QA 4YU0A 2I58A 5JTYB 4N4UA 1RYXA 5TPAB 4N13A 4RYAA 1AL3A 2FIXA 1DCUA 4GFRA 3HV1A 2V3QA 3PUVE 5CBRA 2CZIA 3EQ1A 4ELOA 1DSNA 1NH8A 1D9YA 3JZJA 2QPQA 3HCQA 3N26A 3KG2A 3OELA 2F78A 4PCDA 2OWSA 4PQJA 3N5LA 3D1RA 4KYEA 3SEVA 1A8EA 4PAFA 3I5OA 1LFIA 3OEKA 1IITA 3Q29A 4FEBA 3LC8A 1NV0A 2Q88A 4QFKA 5I58A 1O63A 3U72A 3C33A 1Y4CA 3KN3A 1TWYA 3IAZA 4DXUA 4P56A 1SVXB 4FEDA 2KR0A 3K1NA 5ICQA 2QS2A 4TLLB 4XIGQ 5EQ9A 3PMXA 5L9OA 1B4HA 1MXXA 3T9UA 3Q26A 3C4MA 2V3UA 3H6VA 3K6UA 3F11A 3H4ZA 1QUKA 2DWAA 4JBZA 4O7MA 5I57B 1UIUA 3IL1B 3T9VA 1Z7ME 2XXUA 4EXLA 3C9HA 1MH4A 1NNFA 2ONSA 3H6UA 3ILUB 4MJOA 4BDMA 1HSEA 2KLFA 4QSDA 3S4UA 3R26A 2ZZXA 3W9WA 1YZ0A 1L5TA 4OENA 2NUVA 1LBCA 3IJOB 2ONRA 1FRPA 1FQDA 3H06B 1Y9UA 4NF8B 3FV1A 4Q30B 4PC9A 1XC1A 3KGCA 2XX9A 5LDZA 2VP1A 3LR1A 2DWHA 2WX9A 4NQ8A 4PFWA 3ISPA 3CG3A 3BKIB 5I2KA 1NV5A 5I59B 3GBAA 4NGUA 3C31A 1H76A 3SETA 4OFLA 5AA2B 5H8QB 3H3GA 4FAJA 1NMUA 3K1MA 1Y20A 4R9FA 2Y7RA 1I6BA 1D3KA 1SW4A 2R8TA 5LTCA 3FXQA 4F31B 4EDPA 4ISUA 4Z0IA 1MPCA 1ZIUA 3LSXA 1RDXA 4GXAA 4KPTA 3ROJA 2P1SA 2ZYOA 2F6PA 5TP9A 1AOVA 4G68C 3PPNA 2DDKA 2F97A 4IO6A 4LUBA 1B5IA 5I2NB 4HCWA 4ESXA 2E1SA 5FTHA 3D4GA 5I56A 1T0KA 2DWJA 5CI5A 1FBGA 4LZ7A 4OVJA 1R6ZA 1LBXA 3TTMA 3U93A 3CSGA 1LFGA 2I0CA 5JEIA 5CMBA 2ZYNA 3ILTB 5FHOA 4OZ9A 3RY3A 2QVUA 3FVNA 3RPWA 3SEUA 4P1EA 2RC7A 4GX3A 1D4NA 3RNNA 4FIMA 4H6DA 4EQBA 3TMGA 4F1VA 4M4GA 1IXGA 5A5XB 1YXIA 1QVSA 2XWOA 3O28A 4GD5A 3PV0E 2QVVA 2RC9A 1B3FA 2ALUA 5JTYA 3TEPA 4O3BA 4U4SA 4LVQA 2F7CA 4DIGA 2I4CA 4G8MA 4NF4A 4EF2A 1OLAA 2UVGA 5F24A 5AA4A 4U23A 5BWJA 3CFZA 1P1NA 1B46A 4JSDA 4ELQA 2D5WA 4PAKA 4NG7A 2QS1A 1URGA 2DXYA 2HAVA 2Y7WA 4DI3D 2DE3A 2O51A 1EYIA 5L8DA 2XWKA 4GXSB 3OSQA 4XEQA 3LSFB 2ZYKA 4MH5A 3DLNA 3O66A 4NN3A 3IX1A 1FTJA 4P1LA 1OMPA 3VLVA 3SEWA 1Z7NE 4YAHX 3KN7A 5H8FB 2XXVA 3RYDA 3VE1B 1TT1A 4R2BA 3NOHA 4U21A 4KYDA 3P7IA 4F1UA 3W15C 3DP6A 4R74A 3C34A 4OFJA 3OO8A 5EYFA 5HM4B 1UTHA 3S9MC 3PUXE 1FPBA 2F8DA 2DWIA 1XOCA 4BLAA 4MIJA 1LLSA 4DZ1A 1PC3A 4I8CA 4U2RA 3UGWA 1B4ZA 4ZEKA 3CR9A 3TQWA 1FPFA 1DPPA 3C35A 2Y84A 4FBPA 1M5FA 3BFTA 1IXHA 3VVDA 2KQZA 5IKBA 2H98A 4QF9A 1XI6A 2FA7A 4RPNA 2XXRA 5AA1A 4LQ5A 1K9YA 3E78A 2B4MA 4MEVA 4PF8A 3JV9A 1IUDA 2CZKA 2CZLA 2DE2A 4GX4A 1FCKA 4NHBA 4I1DA 1IZ1A 3IOWA 3C36A 3SEYA 3WAFA 1FTLA 1MDQA 1YAEA 2RF1A 1BP5A 1FPIA 2XXWA 3KJTA 1LB9A 5FTIA 1FJ6A 4KHZE 4YB5A 2BJJX 2WYKA 5KZTA 1EYKA 4N8YA 4FE8A 1H3DA 1YCJA 2R71A 3SKPA 4PTKA 4IO5A 1NUXA 5FBPA 3IO4A 4POWA 1FBEA 1WDNA 4NTLA 3R7XA 2V25A 3LUZA 1DTZA 4ZE9A 4GBWA 3GZGA 4G77A 3PMVA 1FPDA 3CG1A 3K6VA 3MUQA 5EYHA 5AA3A 4K3FA 3MZ1A 1FSAA 3QIMA 5IM2A 2X26A 4PETA 4EQ7A 1H45A 3B8BA 4H65A 3HSTA 3TDJA 4ZE8A 5IZ3B 2OLBA 1WVJA 5ET5A 2HCAA 3FJ7A 4NF6A 2XD3A 3QSLA 4YKIA 4PGPA 4ELRA 5DTBA 4ESWA
chains in the Genus database with same CATH topology
4GF8A 3G3KA 2OWSA 4PQJA 2DS9A 3N5LA 4QSEA 4OWDA 2Q9TA 3PPOA 4KYEA 3UP9A 2I48A 2AYSA 3SEVA 1VE4A 1A8EA 1BTJA 2QL3A 4OEUA 1PB7A 4YB7A 1LAXA 3I5OA 1LFIA 2DOJA 4ONYA 3OEKA 3V83A 2DE4A 1USYE 4LONB 3TYHA 4DCXA 3IORA 1IITA 4OXVA 3Q29A 2H4IA 2HZKA 4FEBA 3K1PA 3FZVA 3SESA 4H5GA 4TQUQ 2NOOA 1JW4A 1FTMA 1B3HA 1NNTA 2PVUA 2O68A 2XXHA 3FVGA 3IB0A 3LC8A 2Q88A 3LSWA 4OQOA 4QFKA 4RY1A 4NF6B 3G3HA 4F3SA 3SEXA 4QHQA 4JWYA 5I58A 1FTKA 2VD3A 1WODA 1O63A 3U72A 4OFOA 4GVOA 4R73A 1FQCA 1Y4CA 3C33A 1Y3PA 4H67A 5DT6A 3THIA 3VVFA 1LFHA 1TFAA 2W7YA 3KN3A 1AMFA 2O7UA 3MP1A 4XKRA 1TWYA 3IAZA 3PUZE 4DXUA 1SVXB 2REJA 1QKBA 2RCBA 1SQYA 4OERA 3S9NC 4FEDA 1B2HA 2XHDA 3K1NA 2QS2A 4N07A 4OTEA 4YB6A 1VR5A 4TLLB 3ZS6A 5ICQA 1GGGA 4XIGQ 1MY1A 3UORA 2X7QA 1PEBA 3PMXA 4BDLA 2QMWA 4R72A 1UIVA 5CBSA 5AA2A 5L9OA 1B4HA 2V3TA 4X48A 1H44A 5J1DA 1MXXA 3T9UA 3Q26A 3C4MA 2V3UA 4F3PA 3H6VA 2B3BA 3K6UA 3F11A 5TPAA 1MQHA 3H4ZA 3MWBA 2OK2A 3KOSA 2H9BA 2HXWA 1B3GA 4UA8A 4F22A 3H7MA 1QUKA 2DWAA 2R6GE 3M3LA 1QKAA 4JBZA 5I57B 4KCCA 4PFUA 1OLCA 2P0SA 3GBBA 1UIUA 3IL1B 3MZBA 3QK6A 1M5BA 3T9VA 1VSOA 1Z7ME 4FECA 1NFTA 1LCFA 1BIYA 4F2QA 1SYIA 2F6GA 3FJGA 4DXBA 1IXIA 2XXQA 2XXUA 2RKMA 3MPKA 4EXLA 3KOTA 1POY1 1QJMA 3C9HA 1MH4A 4IO3A 1NNFA 3ZKKA 3S9LC 2ONSA 4IGRA 1NH7A 3H6UA 3FD3A 5KDTB 3IK6B 3MQ9A 5FHMA 3ILUB 2E0SA 3T9XB 4BDMA 1HSEA 2F7BA 3FGSA 5I58B 2IA4A 2GHAA 1R1NA 2KLFA 3Q28A 1RYOA 1SW1A 4LA9A 3RNNA 1Y4TA 4N6PA 1MXZA 4PFYA 2DVZA 4DCYA 2QS3A 4DXCA 4R75A 1MXUA 1MQGA 1MQIA 4QSDA 3S4UA 5H8HB 1DTGA 3R26A 4G8HA 1GV8A 3ZSFA 2PBWA 3OOAA 3QXMA 4GRKA 4RK9A 3RGYA 2I6EA 3K6XA 2ESNA 4LP2B 4U4XA 3W9WA 4EF1A 1DOTA 3EHTA 5ICTA 3KEIA 2DQVA 1UTBB 4THIA 1L5TA 2DXRA 1ZJLA 5CMKA 4OENA 2THIA 1I6AA 3PPQA 1MDP1 3O97A 2D3IA 4QFNA 3S9EA 1JEVA 2NUVA 4G4PA 4KI0E 1LBCA 3UIFA 1Y3QA 4C1UA 4ND9A 3Q25A 3IJOB 4EQ9A 3G3FA 3MVWA 4EUOA 2ONRA 1QULA 5KDTA 1B5HA 3M8UA 1FQDA 1SDXA 3H06B 3FASA 1Y9UA 5L9MA 3IOUA 4YMAA 4NF8B 3FV1A 5F7VA 3KSJA 5I2NA 4O3AA 4GLIA 4IY6A 3TTLA 4UACA 1QW0A 3E9XA 1TXFA 3ONMA 3EPEA 4XTCQ 4AQ4A 4BDQA 2O7IA 1MXVA 5F1QA 4JXIA 1JEUA 2Z8EA 4HCYA 2Z8FA 4JWXA 4Q30B 2GFEA 1M5CA 3UA8A 4GQOA 3MW0A 3KJ7A 3B6TA 4GIZA 1BKAA 1XC1A 3IOVA 4F19A 3KGCA 5DVJA 1CE2A 2XX9A 1MG1A 1XT8A 2VP1A 2O84X 1US4A 2ZYMA 5CMCA 2HFBA 1USYH 3A3CA 3LR1A 4ZDMA 5H8FA 2DWHA 2I0BA 5JK4A 4G8NA 4H0WA 3FV2A 1MM7A 1B52A 1B05A 2UYFA 4YKJA 1KWHA 5HBCA 5K2YA 1R9LA 2AL5A 1FQFA 4PFWA 5L9SA 2O1LA 4G68A 4QFLA 4XXUA 5I57A 3RN8A 3CG3A 4MFIA 1PBPA 3BKIB 2PT1A 4Q5TA 4WEDA 5H8HA 2YPNA 3RT6B 5I2KA 2Z8DA 3TAJA 4JSOA 4OYVA 2Z22A 5I59B 1DMBA 5IAIA 3GBAA 2GHBA 1LGBC 3C31A 4O3CA 1H76A 3V89B 2PYYA 2UXAA 2Y7IA 4OFLA 3K02A 4JDFA 5H8QB 1I6QA 3SETA 4AB5A 2VGQA 3H3GA 3IJXB 5AA2B 4FAJA 1NMUA 3K1MA 1Y20A 1HSJA 3K0VA 1NNPA 3IOTA 4R9FA 3VDFA 3WAEA 2Y7RA 2UVHA 1I6BA 1D3KA 4YKPA 2M8CA 3U1OA 1Y1ZA 1MRPA 1SW4A 1NNKA 3VXCA 3FXQA 2PT2A 4F31B 4XKQA 4EDPA 1IIWA 1MQDA 2I3WA 4HTGA 4ISUA 3TELA 1MH3A 3D4CA 1MPCA 1UQWA 1ZIUA 4Z0IA 1N0TA 2AL4A 4NF4B 3LSXA 3FXUA 1A99A 5AA4B 3TUSA 4GXAA 4KPTA 3A09A 3HPIA 4Q0CA 3RTWB 1MQJA 2P1SA 2Q2CA 2ZYOA 5A5XA 2F6PA 1N04A 5I59A 5TP9A 3MVXA 3K00A 1AOVA 2F35A 3TODA 3EHSA 1LBBA 1ZU0A 3FUZA 2I4BA 3MP8A 3OO6A 2B65A 3DELB 4LZ5A 4OETA 5K2XA 3RLFE 3R6UA 4FATA 3G3JA 4G68C 1ZTYA 4PP0A 1P1WA 3PPNA 2A5TB 4POXA 3K01A 2QJEA 4YICA 3K6WA 4TLMB 1FQBA 2F97A 4IO6A 1EZ9A 4LUBA 1P1QA 3N94A 2Z23A 4NF5B 3MC2A 1B5IA 5I2NB 4HCWA 4ESXA 2E1SA 1O7TA 1N3XA 5FTHA 4F3GA 3TKDA 1FQAA 4QFPA 1MXYA 3SERA 3CIJA 1B5JA 4PFTA 2O6AA 1GR2A 3D4GA 3E4RA 3U8QA 1EU8A 2PX1A 5I56A 1T0KA 1LAGE 2DWJA 5CI5A 1MY3A 1SYHA 4LZ7A 4OVJA 1B32A 1R6ZA 3H6WA 4TOZA 3TTMA 1B9JA 3FVOA 1RKMA 1EZOA 1BLFA 3CI8A 2O69A 3PD8A 3U93A 3CSGA 1LFGA 1JW5A 1B0LA 1YPNA 3PPPA 4AB6A 1PBQA 2FNCA 2I0CA 5JEIA 1PB9A 2WKYA 2ANJA 3N6UA 5DEXA 1S9TA 3T22A 3TCHA 5CMBA 1B40A 2ZYNA 2A5TA 3CRBA 3ILTB 3PPRA 3GLBA 4OZ9A 5FHOA 1XHYA 2Q2AA 3RY3A 4DLDA 3FVNA 1OQHA 3B7DA 3RPWA 4G2ZA 3DP4A 2VOZA 4RNSA 2G93A 3HHGA 4G68B 4WEPA 3SEUA 4IO4A 3T93B 2DSFA 2XXXA 2RC7A 1MY4A 1D4NA 3K4UA 2ZNTA 4FIMA 4H6DA 4I62A 4XKNA 5DVFA 1VFDA 3LSLA 1MY0A 2OWTA 4KYSA 3TMGA 4BDNA 4XKPA 4F1VA 5DVIA 3BBRA 1YTVA 4M4GA 1QUIA 1IXGA 4EXKA 1SD3A 5A5XB 2B3FA 3RQTA 3CFLA 3ZKLA 3PD9A 2I3VA 3TQLA 1QVSA 3O28A 2UVIA 4GD5A 2A5SA 3PV0E 5HPQA 4ZS9A 3TTRA 2RC9A 1UTHB 1B3FA 2O1MA 4P0IA 2RINA 1JQFA 3FATA 4PE5B 4RA1A 3IO6A 2VD2A 2ALUA 3G3IA 5DEXB 5JTYA 5CC2A 1A40A 4O3BA 5CMMA 3TEPA 4U4SA 4NF5A 4LVQA 3HO7A 2F7CA 4OEVA 3VLUA 4DIGA 2I4CA 5M2VA 1II5A 4GL0A 3M3FA 4I9DA 3I6VA 4G8MA 3FVKA 4NF4A 4EF2A 1J1NA 1B58A 1OLAA 2UVGA 3Q27A 4ZZEA 3LUYA 5AA4A 4ZECA 2H5YA 2R9JA 4NWCA 4HS7A 3TPAA 2H99A 1LCTA 4U23A 3T66A 5TP9B 5BWJA 3O6IA 3CFZA 3W9VA 1P1NA 1B46A 2XXIA 2XD2A 4Q8RA 3CFXA 4JSDA 1UTBA 3TTKA 2HQ0A 2LAOA 2G29A 4ELQA 2D5WA 5TU0A 1LB8A 1SBPA 3MVZA 4YZZA 1ZMGA 2UYEA 3OENA 1ZLQA 2DVCA 4NEDA 1M5EA 3KBRA 1OIBA 2QS1A 5BUUA 1AH5A 1URGA 1R9QA 2DXYA 1ZBMA 3KSXA 4ZEDA 2AIXA 4R6YA 1O64A 1FQEA 2IEEA 4JWOA 4C0RA 3PMWA 3DM0A 1SI1A 2HAVA 4NF8A 3VFJA 2XX8A 2Y7WA 3QYTA 4LZ8A 2PMSA 1US5A 1N76A 2DE3A 5DYHA 4LATA 1Q1KA 3A3UA 5B7DA 2O51A 3EHUA 3V5AA 3UK4A 5I56B 1NL5A 4X9TA 4GXSB 5L8DA 2FYIA 3OSQA 3VXBA 1ATGA 4F29A 3LSFB 3OEMA 2ZYKA 4MH5A 2X7PA 3PU5A 1N84A 3DLNA 3O66A 3T9HB 4IY5A 1FTOA 2V93A 1P1OA 2XXTA 3IX1A 1ZKBA 3CVGA 1FTJA 4NE4A 3MAMA 4P11A 3LBSA 4MBPA 1OMPA 4BDOA 1LAFE 3VLVA 1P1UA 4JB7A 5H8NA 1Z7NE 3BFUA 4R2FA 4YAHX 3KN7A 5H8FB 3SEWA 4F2OA 1A8FA 2VHAA 3MJNA 2XXVA 3V8XB 3VE1B 2YLNA 1GVCA 4U22A 1B7ZA 3TFLA 2V84A 3S2VA 1S7YA 2F34A 3K2DA 1OQGA 1TT1A 4R2BA 1JNFA 3SDFA 4U21A 5I2KB 4KYDA 3P7IA 4EQBA 4F18A 4F1UA 4MLQA 5I84A 1D9VA 3VLWA 5CM6A 1A7LA 1B51A 3W15C 3DP6A 3FJMA 3O29A 1B7UA 3DP8A 4R74A 1B6HA 3C34A 5ITPA 4H1XA 4OFJA 1OVTA 3OO8A 3KFMA 5EYFA 5ISUA 1MY2A 5HM4B 1UTHA 4MF3A 1LAHE 2XXYA 3EF7A 4KR5A 3S9MC 3PUXE 3VVEA 2F8DA 4GOTA 4FJPA 1F9BA 2DWIA 1XOCA 2CMOA 4BLAA 1JVYA 3MBPA 2GRVA 5ELVA 1LLSA 3O6HA 1PC3A 4I8CA 4DZ1A 3OSRA 5FHNA 4U2RA 4KQPA 3E13X 3UGWA 5AE4A 4BDRA 2XXPA 3PGFA 4F3BA 3E3KA 3FXRA 1B4ZA 1URSA 3CR9A 1N7XA 1N3WA 1MXWA 1I69A 1DPPA 1IXCA 2ONKE 4ZEKA 3RUMA 2OBGA 3TQWA 3C35A 2Y84A 1B1HA 3C32A 3OXNA 1M5FA 4ZZAA 3VV5A 1DPEA 3BFTA 1IXHA 3H6TA 2D21A 3FIRA 4RJZA 3TTNA 3VVDA 5IKBA 3U92A 2H98A 4QF9A 4H5FA 2FA7A 2DP8A 2HZLA 3MPLA 3EN3A 3O6GA 2Y7KA 1URDA 5H8NB 4RPNA 2OCUA 2XXRA 1QUJA 1CB6A 3AXFA 1LSTA 3QAXA 4LQ5A 1XVYA 1Y1MA 5AA1A 1ANFA 4HW8A 2F5XA 1B3LA 1SW2A 2Q8JA 3MZ9A 1SW5A 4ZEFA 3UN6A 1MPDA 3JV9A 1IUDA 2UVJA 2Q89A 2CZLA 3O2AA 4RXLA 1JETA 2DE2A 3L6HA 4QRZA 2RC8A 1B1XA 1MS7A 3MVYA 1B0HA 4YKKA 1POTA 5B70A 4ELPA 1EH3A 4GL8A 4WXJA 1FCKA 4H8IA 2Y7PA 1NKXA 5AA2D 1MPBA 1IZ1A 3IOWA 3C36A 2XX7A 3L6GA 1SI0A 4I1DA 4ECFA 3SEYA 3OO7A 4GWOA 3B6WA 4IO7A 3WAFA 1FTLA 1MDQA 1YAEA 3IB2A 1TFDA 4NMYA 3H03A 4DDDA 2GH9A 2OJTA 1OVBA 1BP5A 2RF1A 3HN0A 3QUFA 4P0GA 5EHMA 4Z7EA 3KJTA 2XXWA 1A55A 3TCGA 1LB9A 4F39A 1MM6A 2NXOA 5LOMA 3RTFB 1EZPA 3KN8A 1FW0A 3M3KA 5FTIA 4E0XA 4MLVA 2QSXA 1A54A 1Y3NA 4LQ2A 4KHZE 2F7AA 1B7HA 1S50A 1Q35A 4L17A 2BJJX 2P2AA 3QUJA 4YB5A 2QS4A 5CRYA 4ZEIA 2REGA 4DE8A 3PUWE 3IB1A 5KZTA 1B3EA 3OO9A 2H25A 4FE8A 1H3DA 4IO2A 1YCJA 2R71A 3MP6A 4R9GA 2ZNUA 3JYRA 2YJPA 3SKPA 4IO5A 3IR1A 4U1ZA 4RPOA 4OHNA 2OZZA 4X1BA 3GXAA 5EHSA 3IO4A 4POWA 1AIVA 1HSLA 5KCJA 1WDNA 1PDAA 4NTLA 3R7XA 2V25A 3I3VA 3B6QA 4M1VA 4R6KA 4YU0A 4C1TA 1ELJA 4R6HA 3OMBA 1PB8A 2I58A 1DTZA 3ECRA 4ZE9A 5JTYB 2I49A 3HHFA 2ABHA 4IGTA 3GZGA 1H43A 4G77A 4H8JA 4KCDA 3TZAA 1IQ7A 1RYXA 2DYXA 3CG1A 3CSBA 3K6VA 3PMVA 3G3GA 4IB2A 4X1DA 3MUQA 5TPAB 1JW1A 2NWJA 5AA3A 4U1OA 2ZXTA 4OESA 4K3FA 3OD7A 3MZ1A 3QIMA 1XVXA 2QRYA 4N13A 5KCJB 4RYAA 4ZEBA 1AL3A 2X26A 4OMBA 4PETA 5ITOA 4FORA 4EQ7A 4GFRA 1H45A 5H8SA 4H65A 3T96B 3ODBA 3HSTA 4NWDA 1N7WA 3TDJA 2F36A 4KD5A 3HV1A 2V3QA 3PUVE 4ZE8A 4E0WA 1GTKA 2OLBA 2HAUA 1WVJA 1JVXA 1XS5A 3PUYE 5H8QA 2HCAA 3FJ7A 2NVUB 5CBRA 1VFEA 3N6TA 4QSCA 4QFOA 4WKMA 3EQ1A 4ELOA 2HEUA 2RCAA 1P99A 1DSNA 1NH8A 4NF6A 1D9YA 3KZGA 2ZMBA 2XD3A 3JZJA 4KFQA 4YMBA 4F1YA 1IEJA 2QPQA 1M5DA 3HCQA 3QSLA 4YKIA 3TCFA 3N26A 2ZNSA 3KG2A 4RK2A 4ELRA 2QMXA 3OELA 3USDA 5DTBA 3G7WA 2F78A 4ESWA 3RT8A 3O9PA 3U94A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GF8 A;  3G3K A;  2OWS A;  4PQJ A;  2DS9 A;  3N5L A;  4QSE A;  4OWD A;  2Q9T A;  3PPO A;  4KYE A;  3UP9 A;  2I48 A;  2AYS A;  3SEV A;  1VE4 A;  1A8E A;  1BTJ A;  2QL3 A;  4OEU A;  1PB7 A;  4YB7 A;  1LAX A;  3I5O A;  1LFI A;  2DOJ A;  4ONY A;  3OEK A;  3V83 A;  2DE4 A;  1USY E;  4LON B;  3TYH A;  4DCX A;  3IOR A;  1IIT A;  4OXV A;  3Q29 A;  2H4I A;  2HZK A;  4FEB A;  3K1P A;  3FZV A;  3SES A;  4H5G A;  4TQU Q;  2NOO A;  1JW4 A;  1FTM A;  1B3H A;  1NNT A;  2PVU A;  2O68 A;  2XXH A;  3FVG A;  3IB0 A;  3LC8 A;  2Q88 A;  3LSW A;  4OQO A;  4QFK A;  4RY1 A;  4NF6 B;  3G3H A;  4F3S A;  3SEX A;  4QHQ A;  4JWY A;  5I58 A;  1FTK A;  2VD3 A;  1WOD A;  1O63 A;  3U72 A;  4OFO A;  4GVO A;  4R73 A;  1FQC A;  1Y4C A;  3C33 A;  1Y3P A;  4H67 A;  5DT6 A;  3THI A;  3VVF A;  1LFH A;  1TFA A;  2W7Y A;  3KN3 A;  1AMF A;  2O7U A;  3MP1 A;  4XKR A;  1TWY A;  3IAZ A;  3PUZ E;  4DXU A;  1SVX B;  2REJ A;  1QKB A;  2RCB A;  1SQY A;  4OER A;  3S9N C;  4FED A;  1B2H A;  2XHD A;  3K1N A;  2QS2 A;  4N07 A;  4OTE A;  4YB6 A;  1VR5 A;  4TLL B;  3ZS6 A;  5ICQ A;  1GGG A;  4XIG Q;  1MY1 A;  3UOR A;  2X7Q A;  1PEB A;  3PMX A;  4BDL A;  2QMW A;  4R72 A;  1UIV A;  5CBS A;  5AA2 A;  5L9O A;  1B4H A;  2V3T A;  4X48 A;  1H44 A;  5J1D A;  1MXX A;  3T9U A;  3Q26 A;  3C4M A;  2V3U A;  4F3P A;  3H6V A;  2B3B A;  3K6U A;  3F11 A;  5TPA A;  1MQH A;  3H4Z A;  3MWB A;  2OK2 A;  3KOS A;  2H9B A;  2HXW A;  1B3G A;  4UA8 A;  4F22 A;  3H7M A;  1QUK A;  2DWA A;  2R6G E;  3M3L A;  1QKA A;  4JBZ A;  5I57 B;  4KCC A;  4PFU A;  1OLC A;  2P0S A;  3GBB A;  1UIU A;  3IL1 B;  3MZB A;  3QK6 A;  1M5B A;  3T9V A;  1VSO A;  1Z7M E;  4FEC A;  1NFT A;  1LCF A;  1BIY A;  4F2Q A;  1SYI A;  2F6G A;  3FJG A;  4DXB A;  1IXI A;  2XXQ A;  2XXU A;  2RKM A;  3MPK A;  4EXL A;  3KOT A;  1POY 1;  1QJM A;  3C9H A;  1MH4 A;  4IO3 A;  1NNF A;  3ZKK A;  3S9L C;  2ONS A;  4IGR A;  1NH7 A;  3H6U A;  3FD3 A;  5KDT B;  3IK6 B;  3MQ9 A;  5FHM A;  3ILU B;  2E0S A;  3T9X B;  4BDM A;  1HSE A;  2F7B A;  3FGS A;  5I58 B;  2IA4 A;  2GHA A;  1R1N A;  2KLF A;  3Q28 A;  1RYO A;  1SW1 A;  4LA9 A;  3RNN A;  1Y4T A;  4N6P A;  1MXZ A;  4PFY A;  2DVZ A;  4DCY A;  2QS3 A;  4DXC A;  4R75 A;  1MXU A;  1MQG A;  1MQI A;  4QSD A;  3S4U A;  5H8H B;  1DTG A;  3R26 A;  4G8H A;  1GV8 A;  3ZSF A;  2PBW A;  3OOA A;  3QXM A;  4GRK A;  4RK9 A;  3RGY A;  2I6E A;  3K6X A;  2ESN A;  4LP2 B;  4U4X A;  3W9W A;  4EF1 A;  1DOT A;  3EHT A;  5ICT A;  3KEI A;  2DQV A;  1UTB B;  4THI A;  1L5T A;  2DXR A;  1ZJL A;  5CMK A;  4OEN A;  2THI A;  1I6A A;  3PPQ A;  1MDP 1;  3O97 A;  2D3I A;  4QFN A;  3S9E A;  1JEV A;  2NUV A;  4G4P A;  4KI0 E;  1LBC A;  3UIF A;  1Y3Q A;  4C1U A;  4ND9 A;  3Q25 A;  3IJO B;  4EQ9 A;  3G3F A;  3MVW A;  4EUO A;  2ONR A;  1QUL A;  5KDT A;  1B5H A;  3M8U A;  1FQD A;  1SDX A;  3H06 B;  3FAS A;  1Y9U A;  5L9M A;  3IOU A;  4YMA A;  4NF8 B;  3FV1 A;  5F7V A;  3KSJ A;  5I2N A;  4O3A A;  4GLI A;  4IY6 A;  3TTL A;  4UAC A;  1QW0 A;  3E9X A;  1TXF A;  3ONM A;  3EPE A;  4XTC Q;  4AQ4 A;  4BDQ A;  2O7I A;  1MXV A;  5F1Q A;  4JXI A;  1JEU A;  2Z8E A;  4HCY A;  2Z8F A;  4JWX A;  4Q30 B;  2GFE A;  1M5C A;  3UA8 A;  4GQO A;  3MW0 A;  3KJ7 A;  3B6T A;  4GIZ A;  1BKA A;  1XC1 A;  3IOV A;  4F19 A;  3KGC A;  5DVJ A;  1CE2 A;  2XX9 A;  1MG1 A;  1XT8 A;  2VP1 A;  2O84 X;  1US4 A;  2ZYM A;  5CMC A;  2HFB A;  1USY H;  3A3C A;  3LR1 A;  4ZDM A;  5H8F A;  2DWH A;  2I0B A;  5JK4 A;  4G8N A;  4H0W A;  3FV2 A;  1MM7 A;  1B52 A;  1B05 A;  2UYF A;  4YKJ A;  1KWH A;  5HBC A;  5K2Y A;  1R9L A;  2AL5 A;  1FQF A;  4PFW A;  5L9S A;  2O1L A;  4G68 A;  4QFL A;  4XXU A;  5I57 A;  3RN8 A;  3CG3 A;  4MFI A;  1PBP A;  3BKI B;  2PT1 A;  4Q5T A;  4WED A;  5H8H A;  2YPN A;  3RT6 B;  5I2K A;  2Z8D A;  3TAJ A;  4JSO A;  4OYV A;  2Z22 A;  5I59 B;  1DMB A;  5IAI A;  3GBA A;  2GHB A;  1LGB C;  3C31 A;  4O3C A;  1H76 A;  3V89 B;  2PYY A;  2UXA A;  2Y7I A;  4OFL A;  3K02 A;  4JDF A;  5H8Q B;  1I6Q A;  3SET A;  4AB5 A;  2VGQ A;  3H3G A;  3IJX B;  5AA2 B;  4FAJ A;  1NMU A;  3K1M A;  1Y20 A;  1HSJ A;  3K0V A;  1NNP A;  3IOT A;  4R9F A;  3VDF A;  3WAE A;  2Y7R A;  2UVH A;  1I6B A;  1D3K A;  4YKP A;  2M8C A;  3U1O A;  1Y1Z A;  1MRP A;  1SW4 A;  1NNK A;  3VXC A;  3FXQ A;  2PT2 A;  4F31 B;  4XKQ A;  4EDP A;  1IIW A;  1MQD A;  2I3W A;  4HTG A;  4ISU A;  3TEL A;  1MH3 A;  3D4C A;  1MPC A;  1UQW A;  1ZIU A;  4Z0I A;  1N0T A;  2AL4 A;  4NF4 B;  3LSX A;  3FXU A;  1A99 A;  5AA4 B;  3TUS A;  4GXA A;  4KPT A;  3A09 A;  3HPI A;  4Q0C A;  3RTW B;  1MQJ A;  2P1S A;  2Q2C A;  2ZYO A;  5A5X A;  2F6P A;  1N04 A;  5I59 A;  5TP9 A;  3MVX A;  3K00 A;  1AOV A;  2F35 A;  3TOD A;  3EHS A;  1LBB A;  1ZU0 A;  3FUZ A;  2I4B A;  3MP8 A;  3OO6 A;  2B65 A;  3DEL B;  4LZ5 A;  4OET A;  5K2X A;  3RLF E;  3R6U A;  4FAT A;  3G3J A;  4G68 C;  1ZTY A;  4PP0 A;  1P1W A;  3PPN A;  2A5T B;  4POX A;  3K01 A;  2QJE A;  4YIC A;  3K6W A;  4TLM B;  1FQB A;  2F97 A;  4IO6 A;  1EZ9 A;  4LUB A;  1P1Q A;  3N94 A;  2Z23 A;  4NF5 B;  3MC2 A;  1B5I A;  5I2N B;  4HCW A;  4ESX A;  2E1S A;  1O7T A;  1N3X A;  5FTH A;  4F3G A;  3TKD A;  1FQA A;  4QFP A;  1MXY A;  3SER A;  3CIJ A;  1B5J A;  4PFT A;  2O6A A;  1GR2 A;  3D4G A;  3E4R A;  3U8Q A;  1EU8 A;  2PX1 A;  5I56 A;  1T0K A;  1LAG E;  2DWJ A;  5CI5 A;  1MY3 A;  1SYH A;  4LZ7 A;  4OVJ A;  1B32 A;  1R6Z A;  3H6W A;  4TOZ A;  3TTM A;  1B9J A;  3FVO A;  1RKM A;  1EZO A;  1BLF A;  3CI8 A;  2O69 A;  3PD8 A;  3U93 A;  3CSG A;  1LFG A;  1JW5 A;  1B0L A;  1YPN A;  3PPP A;  4AB6 A;  1PBQ A;  2FNC A;  2I0C A;  5JEI A;  1PB9 A;  2WKY A;  2ANJ A;  3N6U A;  5DEX A;  1S9T A;  3T22 A;  3TCH A;  5CMB A;  1B40 A;  2ZYN A;  2A5T A;  3CRB A;  3ILT B;  3PPR A;  3GLB A;  4OZ9 A;  5FHO A;  1XHY A;  2Q2A A;  3RY3 A;  4DLD A;  3FVN A;  1OQH A;  3B7D A;  3RPW A;  4G2Z A;  3DP4 A;  2VOZ A;  4RNS A;  2G93 A;  3HHG A;  4G68 B;  4WEP A;  3SEU A;  4IO4 A;  3T93 B;  2DSF A;  2XXX A;  2RC7 A;  1MY4 A;  1D4N A;  3K4U A;  2ZNT A;  4FIM A;  4H6D A;  4I62 A;  4XKN A;  5DVF A;  1VFD A;  3LSL A;  1MY0 A;  2OWT A;  4KYS A;  3TMG A;  4BDN A;  4XKP A;  4F1V A;  5DVI A;  3BBR A;  1YTV A;  4M4G A;  1QUI A;  1IXG A;  4EXK A;  1SD3 A;  5A5X B;  2B3F A;  3RQT A;  3CFL A;  3ZKL A;  3PD9 A;  2I3V A;  3TQL A;  1QVS A;  3O28 A;  2UVI A;  4GD5 A;  2A5S A;  3PV0 E;  5HPQ A;  4ZS9 A;  3TTR A;  2RC9 A;  1UTH B;  1B3F A;  2O1M A;  4P0I A;  2RIN A;  1JQF A;  3FAT A;  4PE5 B;  4RA1 A;  3IO6 A;  2VD2 A;  2ALU A;  3G3I A;  5DEX B;  5JTY A;  5CC2 A;  1A40 A;  4O3B A;  5CMM A;  3TEP A;  4U4S A;  4NF5 A;  4LVQ A;  3HO7 A;  2F7C A;  4OEV A;  3VLU A;  4DIG A;  2I4C A;  5M2V A;  1II5 A;  4GL0 A;  3M3F A;  4I9D A;  3I6V A;  4G8M A;  3FVK A;  4NF4 A;  4EF2 A;  1J1N A;  1B58 A;  1OLA A;  2UVG A;  3Q27 A;  4ZZE A;  3LUY A;  5AA4 A;  4ZEC A;  2H5Y A;  2R9J A;  4NWC A;  4HS7 A;  3TPA A;  2H99 A;  1LCT A;  4U23 A;  3T66 A;  5TP9 B;  5BWJ A;  3O6I A;  3CFZ A;  3W9V A;  1P1N A;  1B46 A;  2XXI A;  2XD2 A;  4Q8R A;  3CFX A;  4JSD A;  1UTB A;  3TTK A;  2HQ0 A;  2LAO A;  2G29 A;  4ELQ A;  2D5W A;  5TU0 A;  1LB8 A;  1SBP A;  3MVZ A;  4YZZ A;  1ZMG A;  2UYE A;  3OEN A;  1ZLQ A;  2DVC A;  4NED A;  1M5E A;  3KBR A;  1OIB A;  2QS1 A;  5BUU A;  1AH5 A;  1URG A;  1R9Q A;  2DXY A;  1ZBM A;  3KSX A;  4ZED A;  2AIX A;  4R6Y A;  1O64 A;  1FQE A;  2IEE A;  4JWO A;  4C0R A;  3PMW A;  3DM0 A;  1SI1 A;  2HAV A;  4NF8 A;  3VFJ A;  2XX8 A;  2Y7W A;  3QYT A;  4LZ8 A;  2PMS A;  1US5 A;  1N76 A;  2DE3 A;  5DYH A;  4LAT A;  1Q1K A;  3A3U A;  5B7D A;  2O51 A;  3EHU A;  3V5A A;  3UK4 A;  5I56 B;  1NL5 A;  4X9T A;  4GXS B;  5L8D A;  2FYI A;  3OSQ A;  3VXB A;  1ATG A;  4F29 A;  3LSF B;  3OEM A;  2ZYK A;  4MH5 A;  2X7P A;  3PU5 A;  1N84 A;  3DLN A;  3O66 A;  3T9H B;  4IY5 A;  1FTO A;  2V93 A;  1P1O A;  2XXT A;  3IX1 A;  1ZKB A;  3CVG A;  1FTJ A;  4NE4 A;  3MAM A;  4P11 A;  3LBS A;  4MBP A;  1OMP A;  4BDO A;  1LAF E;  3VLV A;  1P1U A;  4JB7 A;  5H8N A;  1Z7N E;  3BFU A;  4R2F A;  4YAH X;  3KN7 A;  5H8F B;  3SEW A;  4F2O A;  1A8F A;  2VHA A;  3MJN A;  2XXV A;  3V8X B;  3VE1 B;  2YLN A;  1GVC A;  4U22 A;  1B7Z A;  3TFL A;  2V84 A;  3S2V A;  1S7Y A;  2F34 A;  3K2D A;  1OQG A;  1TT1 A;  4R2B A;  1JNF A;  3SDF A;  4U21 A;  5I2K B;  4KYD A;  3P7I A;  4EQB A;  4F18 A;  4F1U A;  4MLQ A;  5I84 A;  1D9V A;  3VLW A;  5CM6 A;  1A7L A;  1B51 A;  3W15 C;  3DP6 A;  3FJM A;  3O29 A;  1B7U A;  3DP8 A;  4R74 A;  1B6H A;  3C34 A;  5ITP A;  4H1X A;  4OFJ A;  1OVT A;  3OO8 A;  3KFM A;  5EYF A;  5ISU A;  1MY2 A;  5HM4 B;  1UTH A;  4MF3 A;  1LAH E;  2XXY A;  3EF7 A;  4KR5 A;  3S9M C;  3PUX E;  3VVE A;  2F8D A;  4GOT A;  4FJP A;  1F9B A;  2DWI A;  1XOC A;  2CMO A;  4BLA A;  1JVY A;  3MBP A;  2GRV A;  5ELV A;  1LLS A;  3O6H A;  1PC3 A;  4I8C A;  4DZ1 A;  3OSR A;  5FHN A;  4U2R A;  4KQP A;  3E13 X;  3UGW A;  5AE4 A;  4BDR A;  2XXP A;  3PGF A;  4F3B A;  3E3K A;  3FXR A;  1B4Z A;  1URS A;  3CR9 A;  1N7X A;  1N3W A;  1MXW A;  1I69 A;  1DPP A;  1IXC A;  2ONK E;  4ZEK A;  3RUM A;  2OBG A;  3TQW A;  3C35 A;  2Y84 A;  1B1H A;  3C32 A;  3OXN A;  1M5F A;  4ZZA A;  3VV5 A;  1DPE A;  3BFT A;  1IXH A;  3H6T A;  2D21 A;  3FIR A;  4RJZ A;  3TTN A;  3VVD A;  5IKB A;  3U92 A;  2H98 A;  4QF9 A;  4H5F A;  2FA7 A;  2DP8 A;  2HZL A;  3MPL A;  3EN3 A;  3O6G A;  2Y7K A;  1URD A;  5H8N B;  4RPN A;  2OCU A;  2XXR A;  1QUJ A;  1CB6 A;  3AXF A;  1LST A;  3QAX A;  4LQ5 A;  1XVY A;  1Y1M A;  5AA1 A;  1ANF A;  4HW8 A;  2F5X A;  1B3L A;  1SW2 A;  2Q8J A;  3MZ9 A;  1SW5 A;  4ZEF A;  3UN6 A;  1MPD A;  3JV9 A;  1IUD A;  2UVJ A;  2Q89 A;  2CZL A;  3O2A A;  4RXL A;  1JET A;  2DE2 A;  3L6H A;  4QRZ A;  2RC8 A;  1B1X A;  1MS7 A;  3MVY A;  1B0H A;  4YKK A;  1POT A;  5B70 A;  4ELP A;  1EH3 A;  4GL8 A;  4WXJ A;  1FCK A;  4H8I A;  2Y7P A;  1NKX A;  5AA2 D;  1MPB A;  1IZ1 A;  3IOW A;  3C36 A;  2XX7 A;  3L6G A;  1SI0 A;  4I1D A;  4ECF A;  3SEY A;  3OO7 A;  4GWO A;  3B6W A;  4IO7 A;  3WAF A;  1FTL A;  1MDQ A;  1YAE A;  3IB2 A;  1TFD A;  4NMY A;  3H03 A;  4DDD A;  2GH9 A;  2OJT A;  1OVB A;  1BP5 A;  2RF1 A;  3HN0 A;  3QUF A;  4P0G A;  5EHM A;  4Z7E A;  3KJT A;  2XXW A;  1A55 A;  3TCG A;  1LB9 A;  4F39 A;  1MM6 A;  2NXO A;  5LOM A;  3RTF B;  1EZP A;  3KN8 A;  1FW0 A;  3M3K A;  5FTI A;  4E0X A;  4MLV A;  2QSX A;  1A54 A;  1Y3N A;  4LQ2 A;  4KHZ E;  2F7A A;  1B7H A;  1S50 A;  1Q35 A;  4L17 A;  2BJJ X;  2P2A A;  3QUJ A;  4YB5 A;  2QS4 A;  5CRY A;  4ZEI A;  2REG A;  4DE8 A;  3PUW E;  3IB1 A;  5KZT A;  1B3E A;  3OO9 A;  2H25 A;  4FE8 A;  1H3D A;  4IO2 A;  1YCJ A;  2R71 A;  3MP6 A;  4R9G A;  2ZNU A;  3JYR A;  2YJP A;  3SKP A;  4IO5 A;  3IR1 A;  4U1Z A;  4RPO A;  4OHN A;  2OZZ A;  4X1B A;  3GXA A;  5EHS A;  3IO4 A;  4POW A;  1AIV A;  1HSL A;  5KCJ A;  1WDN A;  1PDA A;  4NTL A;  3R7X A;  2V25 A;  3I3V A;  3B6Q A;  4M1V A;  4R6K A;  4YU0 A;  4C1T A;  1ELJ A;  4R6H A;  3OMB A;  1PB8 A;  2I58 A;  1DTZ A;  3ECR A;  4ZE9 A;  5JTY B;  2I49 A;  3HHF A;  2ABH A;  4IGT A;  3GZG A;  1H43 A;  4G77 A;  4H8J A;  4KCD A;  3TZA A;  1IQ7 A;  1RYX A;  2DYX A;  3CG1 A;  3CSB A;  3K6V A;  3PMV A;  3G3G A;  4IB2 A;  4X1D A;  3MUQ A;  5TPA B;  1JW1 A;  2NWJ A;  5AA3 A;  4U1O A;  2ZXT A;  4OES A;  4K3F A;  3OD7 A;  3MZ1 A;  3QIM A;  1XVX A;  2QRY A;  4N13 A;  5KCJ B;  4RYA A;  4ZEB A;  1AL3 A;  2X26 A;  4OMB A;  4PET A;  5ITO A;  4FOR A;  4EQ7 A;  4GFR A;  1H45 A;  5H8S A;  4H65 A;  3T96 B;  3ODB A;  3HST A;  4NWD A;  1N7W A;  3TDJ A;  2F36 A;  4KD5 A;  3HV1 A;  2V3Q A;  3PUV E;  4ZE8 A;  4E0W A;  1GTK A;  2OLB A;  2HAU A;  1WVJ A;  1JVX A;  1XS5 A;  3PUY E;  5H8Q A;  2HCA A;  3FJ7 A;  2NVU B;  5CBR A;  1VFE A;  3N6T A;  4QSC A;  4QFO A;  4WKM A;  3EQ1 A;  4ELO A;  2HEU A;  2RCA A;  1P99 A;  1DSN A;  1NH8 A;  4NF6 A;  1D9Y A;  3KZG A;  2ZMB A;  2XD3 A;  3JZJ A;  4KFQ A;  4YMB A;  4F1Y A;  1IEJ A;  2QPQ A;  1M5D A;  3HCQ A;  3QSL A;  4YKI A;  3TCF A;  3N26 A;  2ZNS A;  3KG2 A;  4RK2 A;  4ELR A;  2QMX A;  3OEL A;  3USD A;  5DTB A;  3G7W A;  2F78 A;  4ESW A;  3RT8 A;  3O9P A;  3U94 A; 
#chains in the Genus database with same CATH topology
 3G3K A;  3E79 A;  4QSE A;  4OWD A;  1PB7 A;  4YB7 A;  1LAX A;  4ONY A;  1USY E;  3TYH A;  3SES A;  2HZK A;  4PE3 A;  4TQU Q;  4OVP A;  1JW4 A;  1FTM A;  1B3H A;  2PVU A;  2XXH A;  4RY1 A;  3IB0 A;  3FVG A;  3LSW A;  1FTK A;  2VD3 A;  4OFO A;  1LFH A;  3THI A;  5DT6 A;  3MP1 A;  4OER A;  2RCB A;  4N07 A;  2ZZW A;  3ZS6 A;  2XA5 A;  3UOR A;  4R72 A;  5CBS A;  2V3T A;  4F3P A;  2B3B A;  1MQH A;  2HXW A;  2FIE A;  4F22 A;  3H7M A;  3M3L A;  1QKA A;  2V4C A;  4KCC A;  5I7I A;  2CEX A;  1KA1 A;  3FXB A;  1M5B A;  1VSO A;  1LCF A;  1SYI A;  1IXI A;  2XXQ A;  3KOT A;  4IO3 A;  3S9L C;  4IGR A;  2VPN A;  1LBW A;  1FJ9 A;  3T9X B;  3FGS A;  2GHA A;  3FBP A;  4LA9 A;  4MX6 A;  4QXD A;  1GV8 A;  2PBW A;  3RGY A;  4OVR A;  1NV2 A;  2ESN A;  4LP2 B;  4U4X A;  1DOT A;  3EHT A;  5ICT A;  2DQV A;  3T1B A;  2THI A;  1I6A A;  1MDP 1;  2D3I A;  4QFN A;  4ND9 A;  3G3F A;  1B5H A;  3M8U A;  5IGA A;  3FAS A;  5L9M A;  5F7V A;  1TXF A;  5IZZ A;  3EPE A;  2O7I A;  1MXV A;  4JXI A;  1JEU A;  2Z8E A;  4HCY A;  4JWX A;  1M5C A;  3MW0 A;  4N15 A;  1BKA A;  3IOV A;  1CE2 A;  1XT8 A;  2ZYM A;  1FBP A;  2HFB A;  3A3C A;  3FV2 A;  4YKJ A;  5K2Y A;  1FQF A;  5L9S A;  4QFL A;  5I57 A;  4WED A;  3RT6 B;  5IAI A;  2GHB A;  4LN5 A;  1LGB C;  3V89 B;  2JJK A;  2PYY A;  4JDF A;  3IJX B;  4OVS A;  1NNP A;  3IOT A;  3VDF A;  3WAE A;  2UVH A;  1NNK A;  1IIW A;  1MQD A;  2I3W A;  4HTG A;  1N0T A;  2AL4 A;  1A99 A;  4HE0 A;  3A09 A;  1MQJ A;  3GYY A;  2F35 A;  1LBB A;  1ZU0 A;  2I4B A;  1NUY A;  3DEL B;  1JP4 A;  5K2X A;  4OVT A;  3G3J A;  1ZTY A;  4PP0 A;  4POX A;  3K01 A;  3N94 A;  2Z23 A;  3KC0 A;  3MC2 A;  1O7T A;  1N3X A;  4F3G A;  3E4R A;  1EU8 A;  1B32 A;  4GWS A;  3FVO A;  1RKM A;  1BLF A;  3PD8 A;  5ESY A;  1KZ8 A;  1JW5 A;  1B0L A;  1YPN A;  4AB6 A;  1PB9 A;  3T22 A;  1S9T A;  3CRB A;  2A5T A;  3PPR A;  3GLB A;  2Q2A A;  1OQH A;  4RNS A;  5T3J A;  2DSF A;  4XKN A;  2OWT A;  4KYS A;  3RPL B;  4BDN A;  3BBR A;  1YTV A;  2B3F A;  3PD9 A;  1Q9D A;  4ZS9 A;  2O1M A;  2RIN A;  3FAT A;  4MHF A;  5DEX B;  5CC2 A;  3HO7 A;  4OEV A;  3VLU A;  5M2V A;  1J1N A;  1B58 A;  4ZEC A;  2R9J A;  3TPA A;  2H99 A;  3T66 A;  4Q8R A;  3MVZ A;  4YZZ A;  4KXP A;  4NED A;  1R9Q A;  3KSX A;  2AIX A;  1FQE A;  2IEE A;  4JWO A;  3PMW A;  4N8G A;  2XX8 A;  5EYG A;  2PMS A;  1N76 A;  4LAT A;  1Q1K A;  3A3U A;  3EHU A;  1NI9 A;  3UK4 A;  5I56 B;  3OEM A;  2X7P A;  1G0H A;  4P11 A;  3MAM A;  3LBS A;  1LAF E;  4JB7 A;  5H8N A;  2L5V A;  4R2F A;  4X04 A;  1A8F A;  3MJN A;  3V8X B;  2F34 A;  4F18 A;  1D9V A;  3VLW A;  5CM6 A;  4N17 A;  3FJM A;  3O29 A;  3DP8 A;  5ITP A;  4HXV A;  2XXY A;  4FJP A;  1F9B A;  3MBP A;  5ELV A;  2WEF A;  4BDR A;  2HXR A;  2XXP A;  1URS A;  1I69 A;  4H45 A;  1IXC A;  2ONK E;  3RUM A;  2F3B A;  3OXN A;  3H6T A;  3FIR A;  3LV0 A;  3U92 A;  4H5F A;  4I3E A;  3EN3 A;  1FPL A;  1D9Q A;  1CB6 A;  3AXF A;  3QAX A;  1XVY A;  1ANF A;  4ZEF A;  4XFE A;  2UVJ A;  4JVD A;  3L6H A;  1B0H A;  2QFL A;  5B70 A;  4ELP A;  1EYJ A;  5AA2 D;  1IMD A;  4ECF A;  3L6G A;  4HE2 A;  1SI0 A;  1RDZ A;  4NMY A;  1TFD A;  2GH9 A;  5EHM A;  3TCG A;  1A55 A;  5LOM A;  3RTF B;  1EZP A;  4E0X A;  1A54 A;  4LQ2 A;  5ET7 A;  1Q35 A;  3IB1 A;  1B3E A;  2H25 A;  1LBV A;  3IR1 A;  1AIV A;  3I3V A;  1ELJ A;  5ET8 A;  3ECR A;  4IGT A;  3HHF A;  4KCD A;  1H43 A;  1IQ7 A;  2DYX A;  4H46 A;  3CSB A;  4X1D A;  3G3G A;  1G0I A;  2NWJ A;  4U1O A;  2ZXT A;  4OES A;  3OD7 A;  4ZEB A;  3T96 B;  4HW8 A;  1N7W A;  4P47 A;  1GTK A;  3SER A;  2HAU A;  1JVX A;  1XS5 A;  3PUY E;  1LBZ A;  1VFE A;  4QSC A;  1P99 A;  3PTY A;  3KZG A;  2ZMB A;  4F1Y A;  1QGX A;  3SZP A;  4PAI A;  3TCF A;  2ZNS A;  2PFZ A;  4RK2 A;  3O9P A;  3U94 A;  4GF8 A;  2DS9 A;  1VE4 A;  1BTJ A;  2QL3 A;  1IMA A;  2WBB A;  3V83 A;  2DE4 A;  3BIH A;  3IOR A;  4OXV A;  2H4I A;  3K1P A;  3FZV A;  4H5G A;  4GWZ A;  2NOO A;  2HHM A;  4XF5 A;  1NV7 A;  4NF6 B;  3G3H A;  4QHQ A;  4N6K A;  4R73 A;  4MMP A;  4H67 A;  1Y3P A;  1AMF A;  4C1T A;  2XHD A;  1VR5 A;  2X7Q A;  1UIV A;  1H44 A;  2VT5 A;  5IZ1 A;  3KOS A;  4UA8 A;  1B3G A;  4X8R A;  4PF6 A;  4PFU A;  4MNP A;  3QK6 A;  1NFT A;  4NF0 A;  4F2Q A;  3FJG A;  2RKM A;  3ZKK A;  1QJM A;  1NH7 A;  5KDT B;  1YYZ A;  2E0S A;  2F7B A;  2IA4 A;  1R1N A;  3Q28 A;  1RYO A;  1Y4T A;  4N6P A;  4DXC A;  4R75 A;  1MQG A;  1MQI A;  1DTG A;  4G8H A;  4GRK A;  4RK9 A;  2CZH A;  3K6X A;  4EF1 A;  3KEI A;  1UTB B;  4THI A;  2DXR A;  1ZJL A;  1Y3Q A;  4C1U A;  4EUO A;  3MVW A;  1K9Z A;  1QUL A;  3IOU A;  4YMA A;  3KSJ A;  1QW0 A;  3ONM A;  4BDQ A;  5F1Q A;  2Z8F A;  4GIZ A;  2PCR A;  1RDY A;  2O84 X;  5CMC A;  1NUW A;  1USY H;  4MCO A;  5H8F A;  4ZDM A;  4NAP A;  4G8N A;  4H0W A;  1MM7 A;  1B52 A;  2UYF A;  1R9L A;  1FPG A;  4XXU A;  4Q5T A;  5H8H A;  3QMF A;  3TAJ A;  4OYV A;  1DMB A;  2Y7I A;  4AB5 A;  1I6Q A;  3CHG A;  4MAG A;  2QVR A;  3A29 A;  2M8C A;  2PT2 A;  1UQW A;  3HPI A;  4Q0C A;  3RTW B;  1N04 A;  5I59 A;  3MVX A;  3EHS A;  4OET A;  3FUZ A;  3MP8 A;  3OO6 A;  4LZ5 A;  5DW8 A;  3R6U A;  4FAT A;  4O8M A;  4PGN A;  2A5T B;  3K6W A;  1VDW A;  1FQB A;  5EQ7 A;  1FQA A;  2XXK A;  4PFT A;  1GR2 A;  2PX1 A;  1LAG E;  1MY3 A;  4TOZ A;  3H6W A;  1B9J A;  1EZO A;  3CI8 A;  2O69 A;  4PBQ A;  3PPP A;  1PBQ A;  3TCH A;  5DEX A;  1B40 A;  4DLD A;  2Y5L A;  4G2Z A;  2VOZ A;  3HHG A;  4G68 B;  4WEP A;  3S9E A;  3T93 B;  5FHN A;  4I62 A;  5DVF A;  3LSL A;  1MY0 A;  5DVI A;  4EXK A;  3EKI A;  3RQT A;  3CFL A;  3ZKL A;  2UVI A;  1UTH B;  4PE5 B;  4P0I A;  4DI4 B;  1JQF A;  3IO6 A;  2OWZ A;  4GWW A;  4NF5 A;  1II5 A;  4GL0 A;  3M3F A;  4I9D A;  3I6V A;  3FVK A;  2Q74 A;  2H5Y A;  4NWC A;  4HS7 A;  1LCT A;  4MNC A;  2XXI A;  1UTB A;  3TTK A;  5EQ8 A;  4JVI A;  1LB8 A;  3OEN A;  3KBR A;  5BUU A;  1AH5 A;  1ZBM A;  4C0R A;  3DM0 A;  1SI1 A;  3VFJ A;  2HPG A;  3QYT A;  4LZ8 A;  5DYH A;  2WYP A;  3V5A A;  1NL5 A;  4X9T A;  2FYI A;  2V93 A;  4XKP A;  2F3D A;  3CVG A;  4MBP A;  4PDD A;  1P1U A;  3BFU A;  4GWU A;  4F2O A;  2VHA A;  2YLN A;  1GVC A;  4U22 A;  1B7Z A;  3TFL A;  2V84 A;  2BJI A;  3KBZ A;  1AWB A;  5I2K B;  4MLQ A;  5I84 A;  5ET6 A;  1A7L A;  1B51 A;  4O94 A;  4H1X A;  1MY2 A;  4OA4 A;  4KR5 A;  3VVE A;  2Q8M A;  2CMO A;  1LEV A;  3OSR A;  4KQP A;  2FVZ A;  3E13 X;  5AE4 A;  4N6D A;  2XWV A;  4P9K A;  1N7X A;  1MXW A;  4ZZA A;  3VV5 A;  1FBC A;  1IMC A;  3MPL A;  4GBV A;  3O6G A;  2Y7K A;  2OCU A;  1QUJ A;  1LST A;  1MPD A;  4RXL A;  2Q89 A;  3O2A A;  1JET A;  2RC8 A;  3MVY A;  1MS7 A;  4YKK A;  1POT A;  1EH3 A;  2Y7P A;  1NKX A;  2XX7 A;  3B6W A;  3IB2 A;  3H03 A;  3T0J A;  3HN0 A;  4P0G A;  3QUF A;  4F39 A;  2NXO A;  3KN8 A;  1FW0 A;  3M3K A;  1IMB A;  4MLV A;  2F7A A;  1S50 A;  4PFR A;  4ZEI A;  4L17 A;  4F3B A;  2P2A A;  2QS4 A;  2REG A;  3PUW E;  3OO9 A;  1IMF A;  4IO2 A;  4R9G A;  3IFA A;  2YJP A;  4RPO A;  4OHN A;  3GXA A;  2P3N A;  1HSL A;  1FTA A;  5IZ3 A;  4M1V A;  4R6K A;  4R6H A;  3OMB A;  1PB8 A;  2I49 A;  3TZA A;  2ABH A;  4H8J A;  4NX1 A;  4IB2 A;  1JW1 A;  2FHY A;  5I5P A;  1XVX A;  2QRY A;  1LBY A;  3B50 A;  4OMB A;  5ITO A;  4FOR A;  1FPK A;  5H8S A;  3ODB A;  4NWD A;  2F36 A;  4KD5 A;  4E0W A;  5AA2 A;  5H8Q A;  2NVU B;  1FPE A;  3N6T A;  4QFO A;  5EQA A;  4WKM A;  4HE1 A;  2HEU A;  2RCA A;  4KFQ A;  4YMB A;  1IEJ A;  2PFY A;  1M5D A;  2QMX A;  3USD A;  3G7W A;  3RT8 A;  3MST A;  4P8B A;  2Q9T A;  3PPO A;  3UP9 A;  2I48 A;  2AYS A;  4OEU A;  2DOJ A;  1FBD A;  4DCX A;  4LON B;  4PFI A;  1BK4 A;  1NV3 A;  1NNT A;  2O68 A;  4OQO A;  4F3S A;  3SEX A;  4JWY A;  3MYU A;  1WOD A;  4GVO A;  1FQC A;  2FBP A;  3VVF A;  1TFA A;  2W7Y A;  4XKR A;  2O7U A;  3PUZ E;  2REJ A;  1QKB A;  3S9N C;  1SQY A;  1B2H A;  4OTE A;  5KCJ B;  4YB6 A;  1GGG A;  1MY1 A;  4BDL A;  1PEB A;  2QMW A;  4X48 A;  5J1D A;  5TPA A;  3MWB A;  2OK2 A;  2H9B A;  1SPI A;  2R6G E;  1FPJ A;  1OLC A;  2P0S A;  3GBB A;  3MZB A;  4FEC A;  1BIY A;  2F6G A;  4DXB A;  3MPK A;  1POY 1;  1IME A;  3FD3 A;  3IK6 B;  3MQ9 A;  5FHM A;  5I58 B;  1SW1 A;  1DBZ A;  1MXZ A;  4PFY A;  2DVZ A;  4DCY A;  2QS3 A;  1MXU A;  4N81 A;  5H8H B;  3ZSF A;  3OOA A;  3QXM A;  2I6E A;  5CMK A;  3PPQ A;  3O97 A;  4G61 A;  1JEV A;  2GQ1 A;  4G4P A;  4KI0 E;  3UIF A;  3Q25 A;  4EQ9 A;  4GWX A;  5KDT A;  1SDX A;  5I2N A;  4O3A A;  4GLI A;  4IY6 A;  3TTL A;  4UAC A;  3E9X A;  4AQ4 A;  4XTC Q;  4P3L A;  2GFE A;  3UA8 A;  4GQO A;  3KJ7 A;  3B6T A;  5DVJ A;  1MG1 A;  1US4 A;  2I0B A;  4IR8 A;  1B05 A;  1KWH A;  5HBC A;  2AL5 A;  2O1L A;  4G68 A;  3RN8 A;  4MFI A;  1PBP A;  2PT1 A;  3RPL A;  2YPN A;  4MNI A;  2Z8D A;  4JSO A;  2Z22 A;  4O3C A;  1NV4 A;  2UXA A;  3K02 A;  2VGQ A;  3K0V A;  1HSJ A;  4GWY A;  4YKP A;  3U1O A;  1Y1Z A;  1MRP A;  3VXC A;  1INP A;  4XKQ A;  3TEL A;  1MH3 A;  3D4C A;  5JK4 A;  4NF4 B;  5AA4 B;  3FXU A;  3TUS A;  4OAN A;  5A5X A;  2Q2C A;  3K00 A;  3TOD A;  3RLF E;  2B65 A;  1P1W A;  4YIC A;  2QJE A;  4TLM B;  1EZ9 A;  1P1Q A;  4NF5 B;  3TKD A;  4QFP A;  1MXY A;  3CIJ A;  1B5J A;  2CEY A;  2O6A A;  3U8Q A;  1SYH A;  4GX6 A;  1CNQ A;  2FNC A;  2WKY A;  3N6U A;  2ANJ A;  1XHY A;  4I40 A;  3B7D A;  1NV1 A;  1NUZ A;  3DP4 A;  2G93 A;  4IO4 A;  4U1Z A;  2XXX A;  1MY4 A;  3K4U A;  2ZNT A;  4F19 A;  1VFD A;  4AS4 A;  1QUI A;  1SD3 A;  2I3V A;  3TQL A;  2A5S A;  3TTR A;  4RA1 A;  4PDH A;  2VD2 A;  3G3I A;  1A40 A;  5CMM A;  2VPO A;  2WBD A;  4ZZE A;  3Q27 A;  3LUY A;  4O7I A;  3KC1 A;  5TP9 B;  3O6I A;  3W9V A;  2XD2 A;  3CFX A;  4PBH A;  2HQ0 A;  2LAO A;  4I3Y A;  2G29 A;  5TU0 A;  1SBP A;  1ZMG A;  2UYE A;  1ZLQ A;  2DVC A;  1M5E A;  1OIB A;  4ZED A;  4R6Y A;  1O64 A;  4NF8 A;  4AS5 A;  1KA0 A;  3U65 A;  1US5 A;  5B7D A;  3VXB A;  1ATG A;  4F29 A;  3PU5 A;  1N84 A;  4OVQ A;  3T9H B;  4IY5 A;  1FTO A;  1P1O A;  2XXT A;  1ZKB A;  4NE4 A;  4BDO A;  4UAB A;  2XWI A;  3S2V A;  1S7Y A;  1DK4 A;  3K2D A;  1NV6 A;  1OQG A;  5I3S A;  1JNF A;  3SDF A;  4N91 A;  3BIG A;  5A5L A;  1B7U A;  1B6H A;  1OVT A;  4QBA A;  1FBH A;  3KFM A;  5ISU A;  4MF3 A;  1LAH E;  3EF7 A;  4GOT A;  1JVY A;  2GRV A;  3O6H A;  3PGF A;  3E3K A;  3FXR A;  1N3W A;  2OBG A;  2Y5K A;  1B1H A;  3C32 A;  1DPE A;  4PFB A;  4RJZ A;  2D21 A;  3TTN A;  2DP8 A;  2HZL A;  5J16 A;  1URD A;  5H8N B;  1Y1M A;  2F5X A;  1B3L A;  1SW2 A;  2Q8J A;  3MZ9 A;  1SW5 A;  3UN6 A;  2MKZ A;  4QRZ A;  1B1X A;  4GL8 A;  4WXJ A;  4H8I A;  1MPB A;  3OO7 A;  4GWO A;  4IO7 A;  4DDD A;  2OJT A;  1OVB A;  4Z7E A;  1FBF A;  1MM6 A;  3HFU A;  2QSX A;  1Y3N A;  1B7H A;  5CRY A;  5HPQ A;  3QUJ A;  2P3V A;  4DE8 A;  4JVC A;  3MP6 A;  2ZNU A;  3JYR A;  2ZZV A;  2OX3 A;  5EHS A;  2OZZ A;  4X1B A;  2B4L A;  3IFC A;  5KCJ A;  1PDA A;  3B6Q A;  4YU0 A;  2I58 A;  5JTY B;  4N4U A;  1RYX A;  5TPA B;  4N13 A;  4RYA A;  1AL3 A;  2FIX A;  1DCU A;  4GFR A;  3HV1 A;  2V3Q A;  3PUV E;  5CBR A;  2CZI A;  3EQ1 A;  4ELO A;  1DSN A;  1NH8 A;  1D9Y A;  3JZJ A;  2QPQ A;  3HCQ A;  3N26 A;  3KG2 A;  3OEL A;  2F78 A;  4PCD A;  2OWS A;  4PQJ A;  3N5L A;  3D1R A;  4KYE A;  3SEV A;  1A8E A;  4PAF A;  3I5O A;  1LFI A;  3OEK A;  1IIT A;  3Q29 A;  4FEB A;  3LC8 A;  1NV0 A;  2Q88 A;  4QFK A;  5I58 A;  1O63 A;  3U72 A;  3C33 A;  1Y4C A;  3KN3 A;  1TWY A;  3IAZ A;  4DXU A;  4P56 A;  1SVX B;  4FED A;  2KR0 A;  3K1N A;  5ICQ A;  2QS2 A;  4TLL B;  4XIG Q;  5EQ9 A;  3PMX A;  5L9O A;  1B4H A;  1MXX A;  3T9U A;  3Q26 A;  3C4M A;  2V3U A;  3H6V A;  3K6U A;  3F11 A;  3H4Z A;  1QUK A;  2DWA A;  4JBZ A;  4O7M A;  5I57 B;  1UIU A;  3IL1 B;  3T9V A;  1Z7M E;  2XXU A;  4EXL A;  3C9H A;  1MH4 A;  1NNF A;  2ONS A;  3H6U A;  3ILU B;  4MJO A;  4BDM A;  1HSE A;  2KLF A;  4QSD A;  3S4U A;  3R26 A;  2ZZX A;  3W9W A;  1YZ0 A;  1L5T A;  4OEN A;  2NUV A;  1LBC A;  3IJO B;  2ONR A;  1FRP A;  1FQD A;  3H06 B;  1Y9U A;  4NF8 B;  3FV1 A;  4Q30 B;  4PC9 A;  1XC1 A;  3KGC A;  2XX9 A;  5LDZ A;  2VP1 A;  3LR1 A;  2DWH A;  2WX9 A;  4NQ8 A;  4PFW A;  3ISP A;  3CG3 A;  3BKI B;  5I2K A;  1NV5 A;  5I59 B;  3GBA A;  4NGU A;  3C31 A;  1H76 A;  3SET A;  4OFL A;  5AA2 B;  5H8Q B;  3H3G A;  4FAJ A;  1NMU A;  3K1M A;  1Y20 A;  4R9F A;  2Y7R A;  1I6B A;  1D3K A;  1SW4 A;  2R8T A;  5LTC A;  3FXQ A;  4F31 B;  4EDP A;  4ISU A;  4Z0I A;  1MPC A;  1ZIU A;  3LSX A;  1RDX A;  4GXA A;  4KPT A;  3ROJ A;  2P1S A;  2ZYO A;  2F6P A;  5TP9 A;  1AOV A;  4G68 C;  3PPN A;  2DDK A;  2F97 A;  4IO6 A;  4LUB A;  1B5I A;  5I2N B;  4HCW A;  4ESX A;  2E1S A;  5FTH A;  3D4G A;  5I56 A;  1T0K A;  2DWJ A;  5CI5 A;  1FBG A;  4LZ7 A;  4OVJ A;  1R6Z A;  1LBX A;  3TTM A;  3U93 A;  3CSG A;  1LFG A;  2I0C A;  5JEI A;  5CMB A;  2ZYN A;  3ILT B;  5FHO A;  4OZ9 A;  3RY3 A;  2QVU A;  3FVN A;  3RPW A;  3SEU A;  4P1E A;  2RC7 A;  4GX3 A;  1D4N A;  3RNN A;  4FIM A;  4H6D A;  4EQB A;  3TMG A;  4F1V A;  4M4G A;  1IXG A;  5A5X B;  1YXI A;  1QVS A;  2XWO A;  3O28 A;  4GD5 A;  3PV0 E;  2QVV A;  2RC9 A;  1B3F A;  2ALU A;  5JTY A;  3TEP A;  4O3B A;  4U4S A;  4LVQ A;  2F7C A;  4DIG A;  2I4C A;  4G8M A;  4NF4 A;  4EF2 A;  1OLA A;  2UVG A;  5F24 A;  5AA4 A;  4U23 A;  5BWJ A;  3CFZ A;  1P1N A;  1B46 A;  4JSD A;  4ELQ A;  2D5W A;  4PAK A;  4NG7 A;  2QS1 A;  1URG A;  2DXY A;  2HAV A;  2Y7W A;  4DI3 D;  2DE3 A;  2O51 A;  1EYI A;  5L8D A;  2XWK A;  4GXS B;  3OSQ A;  4XEQ A;  3LSF B;  2ZYK A;  4MH5 A;  3DLN A;  3O66 A;  4NN3 A;  3IX1 A;  1FTJ A;  4P1L A;  1OMP A;  3VLV A;  3SEW A;  1Z7N E;  4YAH X;  3KN7 A;  5H8F B;  2XXV A;  3RYD A;  3VE1 B;  1TT1 A;  4R2B A;  3NOH A;  4U21 A;  4KYD A;  3P7I A;  4F1U A;  3W15 C;  3DP6 A;  4R74 A;  3C34 A;  4OFJ A;  3OO8 A;  5EYF A;  5HM4 B;  1UTH A;  3S9M C;  3PUX E;  1FPB A;  2F8D A;  2DWI A;  1XOC A;  4BLA A;  4MIJ A;  1LLS A;  4DZ1 A;  1PC3 A;  4I8C A;  4U2R A;  3UGW A;  1B4Z A;  4ZEK A;  3CR9 A;  3TQW A;  1FPF A;  1DPP A;  3C35 A;  2Y84 A;  4FBP A;  1M5F A;  3BFT A;  1IXH A;  3VVD A;  2KQZ A;  5IKB A;  2H98 A;  4QF9 A;  1XI6 A;  2FA7 A;  4RPN A;  2XXR A;  5AA1 A;  4LQ5 A;  1K9Y A;  3E78 A;  2B4M A;  4MEV A;  4PF8 A;  3JV9 A;  1IUD A;  2CZK A;  2CZL A;  2DE2 A;  4GX4 A;  1FCK A;  4NHB A;  4I1D A;  1IZ1 A;  3IOW A;  3C36 A;  3SEY A;  3WAF A;  1FTL A;  1MDQ A;  1YAE A;  2RF1 A;  1BP5 A;  1FPI A;  2XXW A;  3KJT A;  1LB9 A;  5FTI A;  1FJ6 A;  4KHZ E;  4YB5 A;  2BJJ X;  2WYK A;  5KZT A;  1EYK A;  4N8Y A;  4FE8 A;  1H3D A;  1YCJ A;  2R71 A;  3SKP A;  4PTK A;  4IO5 A;  1NUX A;  5FBP A;  3IO4 A;  4POW A;  1FBE A;  1WDN A;  4NTL A;  3R7X A;  2V25 A;  3LUZ A;  1DTZ A;  4ZE9 A;  4GBW A;  3GZG A;  4G77 A;  3PMV A;  1FPD A;  3CG1 A;  3K6V A;  3MUQ A;  5EYH A;  5AA3 A;  4K3F A;  3MZ1 A;  1FSA A;  3QIM A;  5IM2 A;  2X26 A;  4PET A;  4EQ7 A;  1H45 A;  3B8B A;  4H65 A;  3HST A;  3TDJ A;  4ZE8 A;  5IZ3 B;  2OLB A;  1WVJ A;  5ET5 A;  2HCA A;  3FJ7 A;  4NF6 A;  2XD3 A;  3QSL A;  4YKI A;  4PGP A;  4ELR A;  5DTB A;  4ESW A; 
#chains in the Genus database with same CATH homology
 4GF8 A;  3G3K A;  2OWS A;  4PQJ A;  2DS9 A;  3N5L A;  4QSE A;  4OWD A;  2Q9T A;  3PPO A;  4KYE A;  3UP9 A;  2I48 A;  2AYS A;  3SEV A;  1VE4 A;  1A8E A;  1BTJ A;  2QL3 A;  4OEU A;  1PB7 A;  4YB7 A;  1LAX A;  3I5O A;  1LFI A;  2DOJ A;  4ONY A;  3OEK A;  3V83 A;  2DE4 A;  1USY E;  4LON B;  3TYH A;  4DCX A;  3IOR A;  1IIT A;  4OXV A;  3Q29 A;  2H4I A;  2HZK A;  4FEB A;  3K1P A;  3FZV A;  3SES A;  4H5G A;  4TQU Q;  2NOO A;  1JW4 A;  1FTM A;  1B3H A;  1NNT A;  2PVU A;  2O68 A;  2XXH A;  3FVG A;  3IB0 A;  3LC8 A;  2Q88 A;  3LSW A;  4OQO A;  4QFK A;  4RY1 A;  4NF6 B;  3G3H A;  4F3S A;  3SEX A;  4QHQ A;  4JWY A;  5I58 A;  1FTK A;  2VD3 A;  1WOD A;  1O63 A;  3U72 A;  4OFO A;  4GVO A;  4R73 A;  1FQC A;  1Y4C A;  3C33 A;  1Y3P A;  4H67 A;  5DT6 A;  3THI A;  3VVF A;  1LFH A;  1TFA A;  2W7Y A;  3KN3 A;  1AMF A;  2O7U A;  3MP1 A;  4XKR A;  1TWY A;  3IAZ A;  3PUZ E;  4DXU A;  1SVX B;  2REJ A;  1QKB A;  2RCB A;  1SQY A;  4OER A;  3S9N C;  4FED A;  1B2H A;  2XHD A;  3K1N A;  2QS2 A;  4N07 A;  4OTE A;  4YB6 A;  1VR5 A;  4TLL B;  3ZS6 A;  5ICQ A;  1GGG A;  4XIG Q;  1MY1 A;  3UOR A;  2X7Q A;  1PEB A;  3PMX A;  4BDL A;  2QMW A;  4R72 A;  1UIV A;  5CBS A;  5AA2 A;  5L9O A;  1B4H A;  2V3T A;  4X48 A;  1H44 A;  5J1D A;  1MXX A;  3T9U A;  3Q26 A;  3C4M A;  2V3U A;  4F3P A;  3H6V A;  2B3B A;  3K6U A;  3F11 A;  5TPA A;  1MQH A;  3H4Z A;  3MWB A;  2OK2 A;  3KOS A;  2H9B A;  2HXW A;  1B3G A;  4UA8 A;  4F22 A;  3H7M A;  1QUK A;  2DWA A;  2R6G E;  3M3L A;  1QKA A;  4JBZ A;  5I57 B;  4KCC A;  4PFU A;  1OLC A;  2P0S A;  3GBB A;  1UIU A;  3IL1 B;  3MZB A;  3QK6 A;  1M5B A;  3T9V A;  1VSO A;  1Z7M E;  4FEC A;  1NFT A;  1LCF A;  1BIY A;  4F2Q A;  1SYI A;  2F6G A;  3FJG A;  4DXB A;  1IXI A;  2XXQ A;  2XXU A;  2RKM A;  3MPK A;  4EXL A;  3KOT A;  1POY 1;  1QJM A;  3C9H A;  1MH4 A;  4IO3 A;  1NNF A;  3ZKK A;  3S9L C;  2ONS A;  4IGR A;  1NH7 A;  3H6U A;  3FD3 A;  5KDT B;  3IK6 B;  3MQ9 A;  5FHM A;  3ILU B;  2E0S A;  3T9X B;  4BDM A;  1HSE A;  2F7B A;  3FGS A;  5I58 B;  2IA4 A;  2GHA A;  1R1N A;  2KLF A;  3Q28 A;  1RYO A;  1SW1 A;  4LA9 A;  3RNN A;  1Y4T A;  4N6P A;  1MXZ A;  4PFY A;  2DVZ A;  4DCY A;  2QS3 A;  4DXC A;  4R75 A;  1MXU A;  1MQG A;  1MQI A;  4QSD A;  3S4U A;  5H8H B;  1DTG A;  3R26 A;  4G8H A;  1GV8 A;  3ZSF A;  2PBW A;  3OOA A;  3QXM A;  4GRK A;  4RK9 A;  3RGY A;  2I6E A;  3K6X A;  2ESN A;  4LP2 B;  4U4X A;  3W9W A;  4EF1 A;  1DOT A;  3EHT A;  5ICT A;  3KEI A;  2DQV A;  1UTB B;  4THI A;  1L5T A;  2DXR A;  1ZJL A;  5CMK A;  4OEN A;  2THI A;  1I6A A;  3PPQ A;  1MDP 1;  3O97 A;  2D3I A;  4QFN A;  3S9E A;  1JEV A;  2NUV A;  4G4P A;  4KI0 E;  1LBC A;  3UIF A;  1Y3Q A;  4C1U A;  4ND9 A;  3Q25 A;  3IJO B;  4EQ9 A;  3G3F A;  3MVW A;  4EUO A;  2ONR A;  1QUL A;  5KDT A;  1B5H A;  3M8U A;  1FQD A;  1SDX A;  3H06 B;  3FAS A;  1Y9U A;  5L9M A;  3IOU A;  4YMA A;  4NF8 B;  3FV1 A;  5F7V A;  3KSJ A;  5I2N A;  4O3A A;  4GLI A;  4IY6 A;  3TTL A;  4UAC A;  1QW0 A;  3E9X A;  1TXF A;  3ONM A;  3EPE A;  4XTC Q;  4AQ4 A;  4BDQ A;  2O7I A;  1MXV A;  5F1Q A;  4JXI A;  1JEU A;  2Z8E A;  4HCY A;  2Z8F A;  4JWX A;  4Q30 B;  2GFE A;  1M5C A;  3UA8 A;  4GQO A;  3MW0 A;  3KJ7 A;  3B6T A;  4GIZ A;  1BKA A;  1XC1 A;  3IOV A;  4F19 A;  3KGC A;  5DVJ A;  1CE2 A;  2XX9 A;  1MG1 A;  1XT8 A;  2VP1 A;  2O84 X;  1US4 A;  2ZYM A;  5CMC A;  2HFB A;  1USY H;  3A3C A;  3LR1 A;  4ZDM A;  5H8F A;  2DWH A;  2I0B A;  5JK4 A;  4G8N A;  4H0W A;  3FV2 A;  1MM7 A;  1B52 A;  1B05 A;  2UYF A;  4YKJ A;  1KWH A;  5HBC A;  5K2Y A;  1R9L A;  2AL5 A;  1FQF A;  4PFW A;  5L9S A;  2O1L A;  4G68 A;  4QFL A;  4XXU A;  5I57 A;  3RN8 A;  3CG3 A;  4MFI A;  1PBP A;  3BKI B;  2PT1 A;  4Q5T A;  4WED A;  5H8H A;  2YPN A;  3RT6 B;  5I2K A;  2Z8D A;  3TAJ A;  4JSO A;  4OYV A;  2Z22 A;  5I59 B;  1DMB A;  5IAI A;  3GBA A;  2GHB A;  1LGB C;  3C31 A;  4O3C A;  1H76 A;  3V89 B;  2PYY A;  2UXA A;  2Y7I A;  4OFL A;  3K02 A;  4JDF A;  5H8Q B;  1I6Q A;  3SET A;  4AB5 A;  2VGQ A;  3H3G A;  3IJX B;  5AA2 B;  4FAJ A;  1NMU A;  3K1M A;  1Y20 A;  1HSJ A;  3K0V A;  1NNP A;  3IOT A;  4R9F A;  3VDF A;  3WAE A;  2Y7R A;  2UVH A;  1I6B A;  1D3K A;  4YKP A;  2M8C A;  3U1O A;  1Y1Z A;  1MRP A;  1SW4 A;  1NNK A;  3VXC A;  3FXQ A;  2PT2 A;  4F31 B;  4XKQ A;  4EDP A;  1IIW A;  1MQD A;  2I3W A;  4HTG A;  4ISU A;  3TEL A;  1MH3 A;  3D4C A;  1MPC A;  1UQW A;  1ZIU A;  4Z0I A;  1N0T A;  2AL4 A;  4NF4 B;  3LSX A;  3FXU A;  1A99 A;  5AA4 B;  3TUS A;  4GXA A;  4KPT A;  3A09 A;  3HPI A;  4Q0C A;  3RTW B;  1MQJ A;  2P1S A;  2Q2C A;  2ZYO A;  5A5X A;  2F6P A;  1N04 A;  5I59 A;  5TP9 A;  3MVX A;  3K00 A;  1AOV A;  2F35 A;  3TOD A;  3EHS A;  1LBB A;  1ZU0 A;  3FUZ A;  2I4B A;  3MP8 A;  3OO6 A;  2B65 A;  3DEL B;  4LZ5 A;  4OET A;  5K2X A;  3RLF E;  3R6U A;  4FAT A;  3G3J A;  4G68 C;  1ZTY A;  4PP0 A;  1P1W A;  3PPN A;  2A5T B;  4POX A;  3K01 A;  2QJE A;  4YIC A;  3K6W A;  4TLM B;  1FQB A;  2F97 A;  4IO6 A;  1EZ9 A;  4LUB A;  1P1Q A;  3N94 A;  2Z23 A;  4NF5 B;  3MC2 A;  1B5I A;  5I2N B;  4HCW A;  4ESX A;  2E1S A;  1O7T A;  1N3X A;  5FTH A;  4F3G A;  3TKD A;  1FQA A;  4QFP A;  1MXY A;  3SER A;  3CIJ A;  1B5J A;  4PFT A;  2O6A A;  1GR2 A;  3D4G A;  3E4R A;  3U8Q A;  1EU8 A;  2PX1 A;  5I56 A;  1T0K A;  1LAG E;  2DWJ A;  5CI5 A;  1MY3 A;  1SYH A;  4LZ7 A;  4OVJ A;  1B32 A;  1R6Z A;  3H6W A;  4TOZ A;  3TTM A;  1B9J A;  3FVO A;  1RKM A;  1EZO A;  1BLF A;  3CI8 A;  2O69 A;  3PD8 A;  3U93 A;  3CSG A;  1LFG A;  1JW5 A;  1B0L A;  1YPN A;  3PPP A;  4AB6 A;  1PBQ A;  2FNC A;  2I0C A;  5JEI A;  1PB9 A;  2WKY A;  2ANJ A;  3N6U A;  5DEX A;  1S9T A;  3T22 A;  3TCH A;  5CMB A;  1B40 A;  2ZYN A;  2A5T A;  3CRB A;  3ILT B;  3PPR A;  3GLB A;  4OZ9 A;  5FHO A;  1XHY A;  2Q2A A;  3RY3 A;  4DLD A;  3FVN A;  1OQH A;  3B7D A;  3RPW A;  4G2Z A;  3DP4 A;  2VOZ A;  4RNS A;  2G93 A;  3HHG A;  4G68 B;  4WEP A;  3SEU A;  4IO4 A;  3T93 B;  2DSF A;  2XXX A;  2RC7 A;  1MY4 A;  1D4N A;  3K4U A;  2ZNT A;  4FIM A;  4H6D A;  4I62 A;  4XKN A;  5DVF A;  1VFD A;  3LSL A;  1MY0 A;  2OWT A;  4KYS A;  3TMG A;  4BDN A;  4XKP A;  4F1V A;  5DVI A;  3BBR A;  1YTV A;  4M4G A;  1QUI A;  1IXG A;  4EXK A;  1SD3 A;  5A5X B;  2B3F A;  3RQT A;  3CFL A;  3ZKL A;  3PD9 A;  2I3V A;  3TQL A;  1QVS A;  3O28 A;  2UVI A;  4GD5 A;  2A5S A;  3PV0 E;  5HPQ A;  4ZS9 A;  3TTR A;  2RC9 A;  1UTH B;  1B3F A;  2O1M A;  4P0I A;  2RIN A;  1JQF A;  3FAT A;  4PE5 B;  4RA1 A;  3IO6 A;  2VD2 A;  2ALU A;  3G3I A;  5DEX B;  5JTY A;  5CC2 A;  1A40 A;  4O3B A;  5CMM A;  3TEP A;  4U4S A;  4NF5 A;  4LVQ A;  3HO7 A;  2F7C A;  4OEV A;  3VLU A;  4DIG A;  2I4C A;  5M2V A;  1II5 A;  4GL0 A;  3M3F A;  4I9D A;  3I6V A;  4G8M A;  3FVK A;  4NF4 A;  4EF2 A;  1J1N A;  1B58 A;  1OLA A;  2UVG A;  3Q27 A;  4ZZE A;  3LUY A;  5AA4 A;  4ZEC A;  2H5Y A;  2R9J A;  4NWC A;  4HS7 A;  3TPA A;  2H99 A;  1LCT A;  4U23 A;  3T66 A;  5TP9 B;  5BWJ A;  3O6I A;  3CFZ A;  3W9V A;  1P1N A;  1B46 A;  2XXI A;  2XD2 A;  4Q8R A;  3CFX A;  4JSD A;  1UTB A;  3TTK A;  2HQ0 A;  2LAO A;  2G29 A;  4ELQ A;  2D5W A;  5TU0 A;  1LB8 A;  1SBP A;  3MVZ A;  4YZZ A;  1ZMG A;  2UYE A;  3OEN A;  1ZLQ A;  2DVC A;  4NED A;  1M5E A;  3KBR A;  1OIB A;  2QS1 A;  5BUU A;  1AH5 A;  1URG A;  1R9Q A;  2DXY A;  1ZBM A;  3KSX A;  4ZED A;  2AIX A;  4R6Y A;  1O64 A;  1FQE A;  2IEE A;  4JWO A;  4C0R A;  3PMW A;  3DM0 A;  1SI1 A;  2HAV A;  4NF8 A;  3VFJ A;  2XX8 A;  2Y7W A;  3QYT A;  4LZ8 A;  2PMS A;  1US5 A;  1N76 A;  2DE3 A;  5DYH A;  4LAT A;  1Q1K A;  3A3U A;  5B7D A;  2O51 A;  3EHU A;  3V5A A;  3UK4 A;  5I56 B;  1NL5 A;  4X9T A;  4GXS B;  5L8D A;  2FYI A;  3OSQ A;  3VXB A;  1ATG A;  4F29 A;  3LSF B;  3OEM A;  2ZYK A;  4MH5 A;  2X7P A;  3PU5 A;  1N84 A;  3DLN A;  3O66 A;  3T9H B;  4IY5 A;  1FTO A;  2V93 A;  1P1O A;  2XXT A;  3IX1 A;  1ZKB A;  3CVG A;  1FTJ A;  4NE4 A;  3MAM A;  4P11 A;  3LBS A;  4MBP A;  1OMP A;  4BDO A;  1LAF E;  3VLV A;  1P1U A;  4JB7 A;  5H8N A;  1Z7N E;  3BFU A;  4R2F A;  4YAH X;  3KN7 A;  5H8F B;  3SEW A;  4F2O A;  1A8F A;  2VHA A;  3MJN A;  2XXV A;  3V8X B;  3VE1 B;  2YLN A;  1GVC A;  4U22 A;  1B7Z A;  3TFL A;  2V84 A;  3S2V A;  1S7Y A;  2F34 A;  3K2D A;  1OQG A;  1TT1 A;  4R2B A;  1JNF A;  3SDF A;  4U21 A;  5I2K B;  4KYD A;  3P7I A;  4EQB A;  4F18 A;  4F1U A;  4MLQ A;  5I84 A;  1D9V A;  3VLW A;  5CM6 A;  1A7L A;  1B51 A;  3W15 C;  3DP6 A;  3FJM A;  3O29 A;  1B7U A;  3DP8 A;  4R74 A;  1B6H A;  3C34 A;  5ITP A;  4H1X A;  4OFJ A;  1OVT A;  3OO8 A;  3KFM A;  5EYF A;  5ISU A;  1MY2 A;  5HM4 B;  1UTH A;  4MF3 A;  1LAH E;  2XXY A;  3EF7 A;  4KR5 A;  3S9M C;  3PUX E;  3VVE A;  2F8D A;  4GOT A;  4FJP A;  1F9B A;  2DWI A;  1XOC A;  2CMO A;  4BLA A;  1JVY A;  3MBP A;  2GRV A;  5ELV A;  1LLS A;  3O6H A;  1PC3 A;  4I8C A;  4DZ1 A;  3OSR A;  5FHN A;  4U2R A;  4KQP A;  3E13 X;  3UGW A;  5AE4 A;  4BDR A;  2XXP A;  3PGF A;  4F3B A;  3E3K A;  3FXR A;  1B4Z A;  1URS A;  3CR9 A;  1N7X A;  1N3W A;  1MXW A;  1I69 A;  1DPP A;  1IXC A;  2ONK E;  4ZEK A;  3RUM A;  2OBG A;  3TQW A;  3C35 A;  2Y84 A;  1B1H A;  3C32 A;  3OXN A;  1M5F A;  4ZZA A;  3VV5 A;  1DPE A;  3BFT A;  1IXH A;  3H6T A;  2D21 A;  3FIR A;  4RJZ A;  3TTN A;  3VVD A;  5IKB A;  3U92 A;  2H98 A;  4QF9 A;  4H5F A;  2FA7 A;  2DP8 A;  2HZL A;  3MPL A;  3EN3 A;  3O6G A;  2Y7K A;  1URD A;  5H8N B;  4RPN A;  2OCU A;  2XXR A;  1QUJ A;  1CB6 A;  3AXF A;  1LST A;  3QAX A;  4LQ5 A;  1XVY A;  1Y1M A;  5AA1 A;  1ANF A;  4HW8 A;  2F5X A;  1B3L A;  1SW2 A;  2Q8J A;  3MZ9 A;  1SW5 A;  4ZEF A;  3UN6 A;  1MPD A;  3JV9 A;  1IUD A;  2UVJ A;  2Q89 A;  2CZL A;  3O2A A;  4RXL A;  1JET A;  2DE2 A;  3L6H A;  4QRZ A;  2RC8 A;  1B1X A;  1MS7 A;  3MVY A;  1B0H A;  4YKK A;  1POT A;  5B70 A;  4ELP A;  1EH3 A;  4GL8 A;  4WXJ A;  1FCK A;  4H8I A;  2Y7P A;  1NKX A;  5AA2 D;  1MPB A;  1IZ1 A;  3IOW A;  3C36 A;  2XX7 A;  3L6G A;  1SI0 A;  4I1D A;  4ECF A;  3SEY A;  3OO7 A;  4GWO A;  3B6W A;  4IO7 A;  3WAF A;  1FTL A;  1MDQ A;  1YAE A;  3IB2 A;  1TFD A;  4NMY A;  3H03 A;  4DDD A;  2GH9 A;  2OJT A;  1OVB A;  1BP5 A;  2RF1 A;  3HN0 A;  3QUF A;  4P0G A;  5EHM A;  4Z7E A;  3KJT A;  2XXW A;  1A55 A;  3TCG A;  1LB9 A;  4F39 A;  1MM6 A;  2NXO A;  5LOM A;  3RTF B;  1EZP A;  3KN8 A;  1FW0 A;  3M3K A;  5FTI A;  4E0X A;  4MLV A;  2QSX A;  1A54 A;  1Y3N A;  4LQ2 A;  4KHZ E;  2F7A A;  1B7H A;  1S50 A;  1Q35 A;  4L17 A;  2BJJ X;  2P2A A;  3QUJ A;  4YB5 A;  2QS4 A;  5CRY A;  4ZEI A;  2REG A;  4DE8 A;  3PUW E;  3IB1 A;  5KZT A;  1B3E A;  3OO9 A;  2H25 A;  4FE8 A;  1H3D A;  4IO2 A;  1YCJ A;  2R71 A;  3MP6 A;  4R9G A;  2ZNU A;  3JYR A;  2YJP A;  3SKP A;  4IO5 A;  3IR1 A;  4U1Z A;  4RPO A;  4OHN A;  2OZZ A;  4X1B A;  3GXA A;  5EHS A;  3IO4 A;  4POW A;  1AIV A;  1HSL A;  5KCJ A;  1WDN A;  1PDA A;  4NTL A;  3R7X A;  2V25 A;  3I3V A;  3B6Q A;  4M1V A;  4R6K A;  4YU0 A;  4C1T A;  1ELJ A;  4R6H A;  3OMB A;  1PB8 A;  2I58 A;  1DTZ A;  3ECR A;  4ZE9 A;  5JTY B;  2I49 A;  3HHF A;  2ABH A;  4IGT A;  3GZG A;  1H43 A;  4G77 A;  4H8J A;  4KCD A;  3TZA A;  1IQ7 A;  1RYX A;  2DYX A;  3CG1 A;  3CSB A;  3K6V A;  3PMV A;  3G3G A;  4IB2 A;  4X1D A;  3MUQ A;  5TPA B;  1JW1 A;  2NWJ A;  5AA3 A;  4U1O A;  2ZXT A;  4OES A;  4K3F A;  3OD7 A;  3MZ1 A;  3QIM A;  1XVX A;  2QRY A;  4N13 A;  5KCJ B;  4RYA A;  4ZEB A;  1AL3 A;  2X26 A;  4OMB A;  4PET A;  5ITO A;  4FOR A;  4EQ7 A;  4GFR A;  1H45 A;  5H8S A;  4H65 A;  3T96 B;  3ODB A;  3HST A;  4NWD A;  1N7W A;  3TDJ A;  2F36 A;  4KD5 A;  3HV1 A;  2V3Q A;  3PUV E;  4ZE8 A;  4E0W A;  1GTK A;  2OLB A;  2HAU A;  1WVJ A;  1JVX A;  1XS5 A;  3PUY E;  5H8Q A;  2HCA A;  3FJ7 A;  2NVU B;  5CBR A;  1VFE A;  3N6T A;  4QSC A;  4QFO A;  4WKM A;  3EQ1 A;  4ELO A;  2HEU A;  2RCA A;  1P99 A;  1DSN A;  1NH8 A;  4NF6 A;  1D9Y A;  3KZG A;  2ZMB A;  2XD3 A;  3JZJ A;  4KFQ A;  4YMB A;  4F1Y A;  1IEJ A;  2QPQ A;  1M5D A;  3HCQ A;  3QSL A;  4YKI A;  3TCF A;  3N26 A;  2ZNS A;  3KG2 A;  4RK2 A;  4ELR A;  2QMX A;  3OEL A;  3USD A;  5DTB A;  3G7W A;  2F78 A;  4ESW A;  3RT8 A;  3O9P A;  3U94 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...