3ODBA

Haemophilus influenzae ferric binding protein a -iron loaded -open conformation
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
308
structure length
308
Chain Sequence
DITVYNGQHKEAATAVAKAFEQETGIKVTLNSGKSEQLAGQLKEEGDKTPADVFYTEQTATFADLSEAGLLAPISEQTIQQTAQKGVPLAPKKDWIALSGRSRVVVYDHTKLSEKDMEKSVLDYATPKWKGKIGYVSTSGAFLEQVVALSKMKGDKVALNWLKGLKENGKLYAKNSVALQAVENGEVPAALINNYYWYNLAKEKGVENLKSRLYFVRHQDPGALVSYSGAAVLKASKNQAEAQKFVDFLASKKGQEALVAARAEYPLRADVVSPFNLEPYEKLEAPVVSATTAQDKEHAIKLIEEAGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The role of vicinal tyrosine residues in the function of Haemophilus influenzae ferric binding protein A.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Metal binding protein
molecule keywords Iron-utilization periplasmic protein
total genus 113
structure length 308
sequence length 308
ec nomenclature
pdb deposition date 2010-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3odbA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3odbA02
4R9FA 3MPKA 5TPAB 2UVJA 3FZVA 3K6UA 5AA3A 5B70A 3MW0A 2HCAA 5K2YA 2UYFA 3SEUA 4RXLA 3VXCA 4LQ2A 1ANFA 1PBQA 1TXFA 5I56B 2AL4A 2I4BA 3PUXE 2F78A 1VSOA 4F29A 3JV9A 5ICTA 3B7DA 3ILTB 3C32A 1IEJA 5FTIA 4BDQA 5L9SA 1R6ZA 4RA1A 4O3AA 4THIA 3A3UA 1P1UA 1IXGA 3LSWA 1GTKA 4ZEKA 3RY3A 3WAEA 4IB2A 3V89B 4FORA 5I84A 3T9UA 1ELJA 3UK4A 2I0CA 5I59A 1MY4A 3VVEA 3CG1A 1SVXB 2V84A 4NTLA 5I2NB 1MY3A 4H67A 1KWHA 3DM0A 1D3KA 3E9XA 1UTHA 3PD8A 4KD5A 1FCKA 4GIZA 4R9GA 4DE8A 1D4NA 3K00A 1LBCA 2H5YA 5H8QA 2XXYA 3MQ9A 5H8HB 3HPIA 1B46A 2THIA 3TQLA 3L6HA 3IB0A 3KEIA 1MDP1 1US5A 4PQJA 1M5EA 2A5TA 4MLVA 4DDDA 4HCYA 1Q1KA 4ND9A 3D4CA 3VV5A 1XHYA 5KCJB 3TCHA 1M5BA 4YB5A 2GFEA 3Q29A 4OFOA 4Q0CA 1MDQA 4IGRA 4MF3A 4F3PA 5A5XB 1M5DA 5L9MA 5ELVA 4YB6A 4KQPA 4FIMA 3SEYA 2HAUA 3MZBA 4R75A 4FJPA 3PPQA 3FJ7A 1NH7A 3THIA 2DP8A 2OK2A 3C36A 3G3FA 4GLIA 1ZKBA 3K02A 2DS9A 3C9HA 4GVOA 5HM4B 2DE3A 4QFKA 4LZ7A 1B4HA 3G3JA 4NF8B 1II5A 3FXRA 3KN7A 3Q26A 1A8FA 4G8HA 1FQDA 1MH4A 2I0BA 1QUKA 2DOJA 3TPAA 3EHTA 2ALUA 1BLFA 3JYRA 3PGFA 4LQ5A 4H65A 4C0RA 3K6WA 3SKPA 1MG1A 1ZLQA 3C31A 4DZ1A 4H5FA 3T96B 3N5LA 4G8MA 4KPTA 2GHBA 3TYHA 1LFIA 1QKBA 2YJPA 2DE4A 3N26A 2YPNA 1D9YA 2RCBA 1LBBA 3FASA 1B6HA 1QJMA 1UTBB 2AL5A 1XVXA 5CC2A 1HSLA 4Z0IA 3T9XB 4ZEFA 1PB7A 1GR2A 1XOCA 1LAHE 5KDTA 2ZNUA 4U1ZA 1QUIA 1SYHA 3DELB 5H8FB 2V3UA 1OMPA 2G29A 3LSFB 3Q25A 1Z7NE 1EH3A 1Y3NA 3O66A 4GRKA 3ILUB 4JWYA 5EYFA 3SEVA 5I59B 1UIUA 2YLNA 1MS7A 4PFTA 1B5IA 2REGA 3E4RA 2QS1A 3TCFA 1IXHA 2VP1A 3KSXA 2D5WA 3EHUA 1ZIUA 2DWAA 3IK6B 3PPPA 4YMAA 1URDA 3N6UA 3V83A 1PDAA 1L5TA 2DXRA 2ONKE 3MP6A 2ESNA 3DP4A 3FD3A 3H6UA 4AB5A 4F3SA 3PPNA 3Q28A 3EN3A 2XXRA 1H76A 5A5XA 3R7XA 5FHOA 4BDLA 4DCXA 4GQOA 2PBWA 3O6IA 2FYIA 3Q27A 3T9HB 1B7UA 1IXCA 1LGBC 2H99A 2XXTA 3CSGA 3IJOB 1JW5A 4RPNA 4YAHX 3OENA 4F1YA 4F2OA 1A54A 4QSCA 3LSXA 2O7IA 4P11A 4RK2A 3OEKA 5EHSA 1MXYA 3H6VA 4EQ9A 2I3WA 2DQVA 1Y1ZA 2OWTA 1MQJA 3K0VA 4NE4A 2XXUA 2B65A 4GOTA 4U21A 3UA8A 4KFQA 3CFZA 3RTFB 4DCYA 1US4A 4LUBA 3H06B 2O6AA 2F36A 2Y7WA 3UORA 2QMWA 3O9PA 4ZE9A 3IB1A 2PT1A 1AL3A 4G68B 3KN8A 3LUYA 2R71A 3TKDA 1VFEA 2HXWA 2I6EA 2I49A 2NOOA 1ZMGA 3RT6B 4OQOA 4RK9A 4EXKA 1TFAA 2QPQA 3R26A 4ZDMA 2XXXA 4H8IA 3G3GA 2Q2CA 3MP1A 5DTBA 3TCGA 3O6GA 4QSDA 4EDPA 2OZZA 3CRBA 1NH8A 4JSOA 5ICQA 1O64A 4PFWA 1JW4A 1DMBA 4OXVA 3HSTA 3TELA 1B1HA 1ZU0A 2RINA 2UYEA 2AIXA 4XXUA 2P2AA 2XXQA 1B5JA 1MQGA 2D3IA 1TT1A 1O7TA 5DT6A 1ATGA 4GXAA 2Y7RA 2F97A 3RUMA 1LFGA 3FUZA 3ZS6A 3I5OA 3O2AA 4JSDA 2DYXA 3TAJA 1N3XA 1XC1A 1B0LA 5TPAA 1Y9UA 1NNFA 3QSLA 5CMBA 4AQ4A 3EQ1A 1TFDA 4K3FA 1DSNA 3TTKA 1LAXA 2QRYA 1N76A 3CSBA 4NF5B 1LLSA 3K6VA 5CMCA 5CM6A 3PV0E 1OQGA 4IO3A 3FV2A 4XKRA 3TTMA 4PE5B 3T9VA 2RCAA 3K1NA 2QL3A 3TODA 2NXOA 4QFOA 1I6QA 3QIMA 4O3CA 4C1TA 3TEPA 4YMBA 1LAFE 2F6PA 5JK4A 2WKYA 2XXIA 2CMOA 3QAXA 3GXAA 4OTEA 5LOMA 4ZS9A 2P0SA 3BBRA 3IOVA 4OHNA 1A55A 1I6AA 4OENA 1JVYA 3B6WA 4WEPA 3C4MA 4YKKA 1R9QA 4NF6A 2E0SA 2DWHA 1XT8A 1JW1A 3FJGA 1B3FA 4YB7A 4F3BA 1Y3QA 1MY0A 2HZKA 2VOZA 4LONB 5DVFA 2ZYNA 1UTHB 4N07A 4NWCA 1NKXA 4H5GA 5H8QB 4ONYA 3QUFA 4RNSA 2I48A 3TTRA 2G93A 1SQYA 4MLQA 1IITA 1LSTA 1NNPA 3KG2A 1NNTA 4POXA 4H1XA 1POY1 1AH5A 1PC3A 2A5TB 4ISUA 2HQ0A 2LAOA 4Q5TA 4F2QA 5H8FA 1QVSA 2PVUA 3ECRA 3G3IA 4R74A 4BDMA 4OESA 4IY6A 1GV8A 4JB7A 2QS2A 3RLFE 2NWJA 4GFRA 3D4GA 3FXUA 5H8NA 4ZZAA 1FW0A 1S50A 1BP5A 4XKPA 3TTLA 4KYSA 5F7VA 4TOZA 3PMXA 2F7AA 1M5CA 4RJZA 1GGGA 2ZYOA 1FQFA 3UP9A 4H8JA 2H98A 1N7XA 3FJMA 3M3KA 4ZECA 3RPWA 4G4PA 5HBCA 1M5FA 4G8NA 2X26A 1MPCA 2Y7PA 3TUSA 5AA2D 1SDXA 2H25A 3OMBA 4NF8A 1GVCA 1OLAA 4FATA 2B3BA 3VE1B 3VLVA 3GZGA 2ANJA 5CMMA 4QSEA 4EXLA 2F6GA 4QRZA 3O97A 3ZSFA 2Q9TA 1Q35A 5KZTA 3OO7A 1DPPA 2O1MA 4RYAA 2F34A 3H6TA 1SW1A 3O29A 4WXJA 4ECFA 3H7MA 4U22A 2PMSA 4JWOA 4PETA 4I9DA 4IO2A 5I57B 4YU0A 2DVCA 3OEMA 3PMWA 4F39A 3SETA 3S9EA 5H8HA 2O7UA 1IXIA 1USYH 1VR5A 3B6QA 4HCWA 3OELA 4IO5A 3KOTA 3TZAA 1Y20A 2O1LA 3RTWB 5KDTB 2RKMA 3KFMA 1PB9A 4U2RA 3A3CA 3E3KA 4MBPA 1N3WA 3KSJA 3KZGA 4G68A 1SW4A 4HS7A 3KOSA 3QUJA 4ELPA 1NNKA 2W7YA 3R6UA 1URGA 3RN8A 2HZLA 2B3FA 2OBGA 2I4CA 2AYSA 2GH9A 1UQWA 2R9JA 2Z8FA 2OJTA 3IL1B 3BKIB 2VD3A 1I6BA 1Y1MA 1B9JA 1MM6A 1YTVA 2ONSA 1B2HA 3MVWA 4KYDA 2O69A 4YKPA 1MY1A 3TTNA 3K1PA 3U92A 3W9VA 1B05A 1B32A 3K4UA 3SDFA 3MP8A 1DPEA 5DEXB 4C1UA 1FTJA 4QF9A 3OO6A 4F31B 3B6TA 5CBRA 3CFLA 2UVIA 1EZ9A 2XXVA 4YKJA 4DLDA 4F22A 5AA4A 3MBPA 1N84A 3O6HA 3HCQA 4YZZA 1NL5A 2V3TA 3F11A 3G3HA 2Z22A 4OEVA 1JEUA 2KLFA 2X7PA 2XX7A 2Z23A 3MUQA 2V93A 3QXMA 2OLBA 4U1OA 5K2XA 3T93B 1SYIA 4OFLA 4BDOA 3MPLA 1B3GA 1OLCA 4WKMA 5JTYA 1POTA 3VXBA 4OERA 4JWXA 1BKAA 1FQAA 1ZTYA 4FECA 1ZJLA 2QS3A 3W15C 5J1DA 1SD3A 1XS5A 1B51A 3BFTA 1MPBA 2XX8A 1LCTA 4JDFA 4R2BA 4ZEIA 4HW8A 3V8XB 2ABHA 3FVGA 1SW5A 4FEDA 3VVFA 2QMXA 3TQWA 1MRPA 2F35A 1R1NA 3JZJA 4BDRA 4TLLB 1QKAA 1WODA 4RY1A 1N0TA 1MY2A 1T0KA 4Q30B 1J1NA 3CFXA 4NF6B 4R72A 4DXUA 1IUDA 3DP8A 5I56A 4P0IA 5AA1A 3U93A 4FAJA 5I58A 1JETA 3U1OA 3EF7A 3MVYA 4IGTA 2ZYMA 3OOAA 3SESA 4I62A 4F19A 1A99A 1B4ZA 1FQBA 4E0WA 3IOUA 5CMKA 3KBRA 1PEBA 3TDJA 2XX9A 2FA7A 1NFTA 3U72A 4ELQA 1MPDA 1Y3PA 2P1SA 4F3GA 2ZNSA 2REJA 3CG3A 1RKMA 4UA8A 2VD2A 1F9BA 3MVZA 3U94A 3T66A 3WAFA 1DTGA 4F18A 5TP9B 1MQDA 1A7LA 2DWJA 1OIBA 1O63A 1SBPA 2Z8EA 3K01A 3KJTA 3C35A 4OZ9A 5FHMA 3USDA 3IB2A 4KHZE 2F7CA 4ELOA 1H44A 5H8NB 2F8DA 4NEDA 3FIRA 5CI5A 3PMVA 2Y7IA 1P1NA 3G7WA 3OSQA 4L17A 3QYTA 4R6KA 4X1DA 1QUJA 1LFHA 3UN6A 2F5XA 1MXWA 4ZEBA 2RC8A 1H3DA 2PX1A 3DLNA 1VFDA 3M8UA 4QFPA 2IEEA 3SEWA 4EUOA 1AIVA 4OMBA 5AA4B 1BIYA 2E1SA 3FV1A 1WVJA 2Q89A 3N94A 3M3FA 4LZ5A 2Q8JA 4XTCQ 3FVOA 1MXXA 5FTHA 4U23A 3FGSA 5EHMA 5B7DA 1FTOA 2RF1A 2QS4A 4X48A 2ZMBA 3LSLA 3TFLA 3A09A 2DVZA 4H6DA 5ISUA 1AMFA 4KYEA 1I69A 3KJ7A 4EF2A 4FE8A 1Y4TA 1B3LA 1D9VA 3LC8A 4LA9A 4U4XA 5CBSA 4E0XA 4ZE8A 4O3BA 2DWIA 1JQFA 2Q2AA 1OVTA 4NWDA 3CIJA 3K1MA 2Y7KA 3EHSA 1Y4CA 3LR1A 3ODBA 5I2KA 4G77A 1IZ1A 4M1VA 3P7IA 3OSRA 3I3VA 1B1XA 3HHFA 2Q88A 3RT8A 5H8SA 1IIWA 1B3HA 3TMGA 4AB6A 5IKBA 4MH5A 4PFUA 4ESWA 3FVNA 4F1VA 2O84X 4GD5A 2O68A 4N13A 3S9LC 3LBSA 4NF4A 1MXVA 1UTBA 1OVBA 2DSFA 1MXUA 1S9TA 2BJJX 3IJXB 1A40A 3K6XA 4OYVA 4R73A 4R2FA 4XKQA 1MQIA 2OWSA 2XD2A 4OVJA 4ESXA 3PUWE 3L6GA 4LZ8A 2XXWA 5DEXA 1YPNA 3C33A 5AA2B 4KR5A 4G68C 3OXNA 1MXZA 4OFJA 3PPOA 4NMYA 2PYYA 1SW2A 3OO9A 4GXSB 1USYE 3OO8A 3VVDA 4DXBA 1HSEA 1CE2A 2DXYA 3FATA 4JBZA 4XIGQ 2CZLA 5ITOA 5JEIA 3HV1A 2GRVA 2XHDA 3IORA 5DVIA 3V5AA 2QSXA 3PUZE 1A8EA 5ITPA 3RGYA 1R9LA 1VE4A 3ZKLA 4GF8A 2RC9A 4EF1A 1P99A 3ZKKA 3H03A 4DXCA 4Q8RA 2X7QA 3MZ9A 4YICA 5I57A 1JNFA 3VLUA 5L8DA 2Z8DA 2Y84A 4WEDA 3U8QA 1B7HA 3I6VA 4P0GA 1NMUA 3KN3A 3O28A 3CVGA 4LATA 2IA4A 2H4IA 2PT2A 2QJEA 2XXHA 4IO6A 4M4GA 1WDNA 3IO6A 3CR9A 4PFYA 3VLWA 2F7BA 3N6TA 1DTZA 4EQBA 2UVGA 3BFUA 3PUYE 1SI0A 2V25A 4QHQA 5I2NA 3HO7A 4KCDA 1FQEA 5I58B 5L9OA 1DOTA 1JVXA 4TQUQ 4IO4A 4U4SA 5BWJA 2OCUA 1OQHA 3HHGA 2UVHA 1N04A 1QW0A 2UXAA 3C34A 3GLBA 3W9WA 4I1DA 4KI0E 2I3VA 3UIFA 4XKNA 3S9NC 3T22A 4G2ZA 4BLAA 3CI8A 4RPOA 3M3LA 5KCJA 4ZEDA 1P1QA 4QFNA 2XXPA 1B7ZA 1FTLA 1QULA 2ZXTA 3FVKA 3H3GA 3QK6A 2RC7A 4GL0A 3HN0A 4GWOA 4JXIA 4LVQA 2DE2A 5CRYA 5TP9A 5BUUA 2H9BA 1URSA 1P1WA 2VGQA 3AXFA 1SI1A 4MFIA 1HSJA 3RQTA 1S7YA 4NF4B 5JTYB 1JEVA 2R6GE 5DYHA 3K2DA 2XD3A 4ZZEA 4OEUA 4DIGA 1LAGE 3MVXA 3PPRA 2NVUB 3PU5A 3G3KA 4UACA 5M2VA 1MH3A 4KCCA 4TLMB 4POWA 4BDNA 4ELRA 1UIVA 3PD9A 2M8CA 3IOTA 1XVYA 1IQ7A 3MJNA 1LB8A 1YAEA 4IO7A 3E13X 4NF5A 1B58A 1CB6A 3EPEA 5IAIA 1B52A 1B5HA 4LP2B 5DVJA 3SERA 1EZPA 1H45A 3FXQA 3MZ1A 3H6WA 4N6PA 1LCFA 3SEXA 4H0WA 4X9TA 4IY5A 2FNCA 4GL8A 3IAZA 4QFLA 4F1UA 4PP0A 4R6HA 1FTMA 2D21A 1B3EA 2ZYKA 1RYOA 3DP6A 3S2VA 3IR1A 5HPQA 4OWDA 2HFBA 3PUVE 1ZBMA 3GBAA 4X1BA 5I2KB 1LB9A 3MAMA 2V3QA 2A5SA 3ONMA 1FTKA 2HEUA 4HTGA 1MQHA 1PBPA 1EU8A 4OETA 1EZOA 4Z7EA 1FQCA 3MWBA 1RYXA 2ZNTA 2GHAA 3VFJA 1B40A 2NUVA 3S9MC 1TWYA 1N7WA 3GBBA 5F1QA 2VHAA 3IO4A 5FHNA 3VDFA 1H43A 1B0HA 1P1OA 3MC2A 3H4ZA 2ONRA 3IOWA 4YKIA 1YCJA 3S4UA 3UGWA 4EQ7A 1MM7A 1PB8A 2HAVA 1BTJA 2I58A 2O51A 4I8CA 4FEBA 1Z7ME 1AOVA 3OD7A 3IX1A 3RNNA 5AA2A 3KGCA 4R6YA 5AE4A 5TU0A
chains in the Genus database with same CATH superfamily
5TPAB 3FZVA 5K2YA 5J16A 4HE0A 4RXLA 1TXFA 1VSOA 5FTIA 4O3AA 3A3UA 1P1UA 4N6DA 4PFIA 4ZEKA 3RY3A 4H45A 1SPIA 4FORA 2V84A 3A29A 1D3KA 3E9XA 1VDWA 5H8QA 2H5YA 3MQ9A 3HPIA 1Q1KA 5F24A 5KCJB 4Q0CA 2JJKA 4PDDA 2B4MA 4KQPA 5T3JA 3PPQA 2R8TA 2B4LA 4GWWA 3C9HA 4GVOA 2DE3A 3G3JA 1II5A 1MH4A 2DOJA 3PGFA 4C0RA 3SKPA 4G8MA 2DE4A 2RCBA 1FPGA 1LAHE 2ZNUA 1QUIA 1SYHA 2G29A 1EH3A 2F3BA 2YLNA 1B5IA 3E4RA 2VP1A 2WYPA 3V83A 2ONKE 3PTYA 3T0JA 2PFZA 4H46A 2PBWA 1B7UA 1LGBC 2XXTA 3CSGA 3IJOB 4PE3A 4RPNA 2ZZWA 3LSXA 4P11A 4RK2A 1MXYA 4EQ9A 4N8GA 3K0VA 4GOTA 4U21A 3CFZA 1US4A 4NQ8A 1EYKA 3O9PA 1FSAA 3TKDA 3ROJA 2I49A 1ZMGA 4OQOA 3R26A 2QPQA 2XXXA 4H8IA 3CRBA 1JW4A 1DMBA 4MIJA 4OXVA 1B1HA 2RINA 2UYEA 2AIXA 2XXQA 2D3IA 3RUMA 1XC1A 5TPAA 1LAXA 4GX6A 5CM6A 3PV0E 4XKRA 2RCAA 2NXOA 4C1TA 3TEPA 1NV6A 1LAFE 2P0SA 1A55A 3FXBA 1JVYA 3B6WA 4YKKA 4NF6A 2DWHA 4F3BA 1B3FA 1MY0A 2VOZA 3EKIA 2ZYNA 2XA5A 5H8QB 4ONYA 3TTRA 1AH5A 1PC3A 4I3EA 3BIHA 4OESA 2XWIA 2NWJA 4GFRA 3D4GA 5H8NA 5F7VA 4TOZA 3PMXA 1M5CA 1LBZA 4P47A 1FQFA 4H8JA 1FBPA 4G4PA 4XF5A 2Y7PA 1SDXA 4G61A 4OVQA 2B3BA 3VLVA 2PFYA 3GZGA 5EYGA 3O97A 2Q9TA 3H7MA 4U22A 2PMSA 4I9DA 5I57B 3RPLB 3SETA 4HCWA 1VR5A 1YZ0A 3KOTA 1Y20A 3RTWB 2WBBA 4ELPA 4G68A 3QUJA 2W7YA 1URGA 2FIXA 5A5LA 2I4CA 1UQWA 3BKIB 1G0HA 2ONSA 1MM6A 3MVWA 4MX6A 1LBYA 3U92A 1B32A 3SDFA 2CEYA 5DEXB 4C1UA 3OO6A 4DLDA 5AA4A 3FBPA 1NL5A 1KA1A 3F11A 1JEUA 5K2XA 2KLFA 2X7PA 2Z23A 4BDQA 3T93B 4OFLA 1OLCA 5JTYA 4PBHA 3VXBA 4OERA 1Q9DA 1ZTYA 1ZJLA 3W15C 3BFTA 4R2BA 5IM2A 3LV0A 2ABHA 1QKAA 2Y5LA 4Q30B 3DP8A 4O94A 5AA1A 1JETA 4O7MA 3OOAA 4F19A 4I62A 5CMKA 3TDJA 1NFTA 3D1RA 2P1SA 1F9BA 3U94A 1DTGA 2DWJA 4PFRA 3KJTA 5FHMA 3IB2A 4NEDA 3FIRA 5CI5A 1P1NA 4L17A 1MXWA 2HXRA 1H3DA 3DLNA 3M8UA 4QFPA 4EUOA 1BIYA 3B50A 1WVJA 4LZ5A 4N8YA 4N91A 1LBXA 5FTHA 5EHMA 2QS4A 2ZMBA 2DVZA 4NX1A 4KYEA 3KJ7A 3LC8A 1D9VA 4U4XA 4P3LA 4ZE8A 3T1BA 2DWIA 1OVTA 3K1MA 3EHSA 1Y4CA 4M1VA 3HHFA 3RT8A 2Q88A 5IKBA 4AB6A 2KR0A 4MH5A 2QVUA 2FIEA 2O84X 4GD5A 2O68A 4N13A 4O7IA 1OVBA 1S9TA 3K6XA 4R73A 4JVCA 3SZPA 1BK4A 1MXZA 4NMYA 3VVDA 3OO9A 3OO8A 2CEXA 3FATA 4JBZA 2CZLA 5DVIA 4NAPA 5I57A 2P3VA 2Y84A 4WEDA 3KN3A 3O28A 3CVGA 3IO6A 3N6TA 4EQBA 2V25A 4QHQA 1OQHA 3HHGA 3C34A 2MKZA 2I3VA 3S9NC 4G2ZA 4RPOA 1K9ZA 5I3SA 4QRZA 3QK6A 1B7ZA 4LVQA 2DE2A 4GBVA 1P1WA 1HSJA 4GWSA 3RQTA 4O8MA 5JTYB 3G3KA 2ZZVA 4ELRA 3PD9A 3IOTA 3MJNA 1YAEA 4IO7A 2DDKA 1CB6A 3EPEA 1B5HA 4LP2B 3FXQA 4N6PA 3SEXA 4NGUA 4GL8A 4JVIA 3DP6A 1RYOA 4OVTA 3S2VA 5HPQA 3GBAA 1LB9A 2V3QA 4HTGA 2HEUA 1EZOA 1MQHA 1DBZA 3MWBA 1RYXA 1B40A 4MJOA 5FHNA 1B0HA 2Q74A 4EQ7A 4YKIA 1AOVA 2QFLA 4R6YA 3MPKA 5AA3A 3MW0A 2HCAA 4PCDA 3VXCA 1ANFA 4F29A 5ICTA 1EYIA 3C32A 3LUZA 3V89B 3UK4A 1MY4A 1SVXB 1NV4A 5I2NB 4R9GA 4DE8A 1FCKA 1D4NA 1IMAA 3TQLA 4X04A 1B46A 2THIA 3KEIA 1MDP1 4ND9A 3Q29A 4OFOA 1MDQA 4F3PA 5IZ1A 5L9MA 5EYHA 1NH7A 2OK2A 4MNCA 3Q26A 4G8HA 1QUKA 3TPAA 2HHMA 3T96B 3TYHA 1LFIA 1D9YA 1LBBA 3MSTA 1XVXA 4Z0IA 1PB7A 1GR2A 5KDTA 4U1ZA 5H8FB 5AA2D 3LSFB 1Z7NE 3O66A 5I59B 3MYUA 1D9QA 2REGA 2QS1A 3KSXA 1ZIUA 3PPPA 3IK6B 1URDA 3FD3A 4AB5A 3PPNA 2XXRA 1H76A 3E78A 5A5XA 3O6IA 1IXCA 4YAHX 1JW5A 4F2OA 5LTCA 2DQVA 3UA8A 3RTFB 4LN5A 4LUBA 2O6AA 2F36A 2Y7WA 3UORA 3IB1A 2PT1A 4GBWA 2R71A 2HXWA 4EXKA 3MP1A 4NF0A 1YXIA 3TCGA 3O6GA 4JSOA 1ZU0A 2P2AA 1B5JA 1MQGA 1TT1A 1O7TA 4F1VA 4GXAA 4UABA 1LFGA 3FUZA 4JSDA 3O2AA 1B0LA 1Y9UA 3EQ1A 3TTKA 1NV1A 3CSBA 1LLSA 1FPDA 3TTMA 4IO3A 3T9VA 2QVVA 3QIMA 4O3CA 2HPGA 2F6PA 1I6AA 4OENA 3C4MA 1XT8A 1JW1A 3FJGA 4N07A 3QUFA 4RNSA 2G93A 1NNPA 1NNTA 2HQ0A 2VPOA 1QVSA 2PVUA 4BDMA 4IY6A 2KQZA 1LEVA 2QS2A 3FXUA 2ZYOA 2H98A 1N7XA 3FJMA 4ZECA 2X26A 3OMBA 1OLAA 3VE1B 5CMMA 4ECFA 5FBPA 4YU0A 3OEMA 4F39A 3S9EA 2O7UA 4IO5A 1EYJA 2O1LA 5KDTB 3E3KA 3KZGA 1SW4A 1NV7A 1NNKA 2WBDA 3R6UA 2B3FA 2OBGA 3IFCA 2AYSA 3IL1B 2VD3A 1I6BA 1YTVA 1MY1A 3TTNA 3K4UA 3MP8A 1DPEA 4F31B 4QF9A 3B6TA 3RYDA 5CBRA 1EZ9A 4YKJA 4F22A 1FPEA 1FPFA 1N84A 4U1OA 2PCRA 2OLBA 1SYIA 4WKMA 4JWXA 4FECA 5J1DA 1FPIA 4JDFA 2XX8A 1LCTA 4HW8A 3VVFA 3TQWA 1MRPA 4BDRA 1MY2A 1T0KA 4NF6B 1IUDA 5I58A 3EF7A 3SESA 1B4ZA 1FQBA 2XX9A 2FA7A 4F3GA 4NN3A 3MVZA 3T66A 1MQDA 1A7LA 4KHZE 5H8NB 1H44A 2Y7IA 3OSQA 4R6KA 4X1DA 1QUJA 1FBCA 2F5XA 5IZZA 3N94A 2Q8JA 3FVOA 1MXXA 4U23A 3FGSA 5B7DA 1FTOA 4EF2A 1KA0A 1B3LA 3RPLA 5CBSA 4PAKA 4GWXA 3CIJA 2Q8MA 5I2KA 4G77A 1IZ1A 3I3VA 1B1XA 5H8SA 1B3HA 1RDXA 4PGPA 3S9LC 3LBSA 1MXVA 3IJXB 1A40A 4R2FA 4GWZA 1MQIA 2OWSA 4OVJA 3PUWE 3L6GA 4LZ8A 2XXWA 4N4UA 5DEXA 4KR5A 2PYYA 1SW2A 4GXSB 3ISPA 1HSEA 1CE2A 4XIGQ 4PGNA 1NUXA 3HV1A 2XHDA 2QSXA 5ITPA 1R9LA 4GF8A 2RC9A 1P99A 5IZ3B 3MZ9A 3VLUA 2Z8DA 3I6VA 1NI9A 4LATA 2PT2A 4PFYA 3PUYE 3HO7A 5L9OA 4TQUQ 2OCUA 2UVHA 2UXAA 3W9WA 4I1DA 4XKNA 3CI8A 4ZEDA 2ZXTA 1INPA 4GL0A 4XKQA 1NV0A 3H3GA 4JXIA 3HN0A 2H9BA 2OWZA 3AXFA 4OVRA 1S7YA 4NF4B 1JEVA 2R6GE 4ZZEA 3PPRA 5EQ7A 4KCCA 4TLMB 4BDNA 1UIVA 2M8CA 1XVYA 3E13X 1EZPA 3SERA 1H45A 4H0WA 2FNCA 4QFLA 4PP0A 4R6HA 2D21A 1NUZA 4OWDA 3PUVE 4X1BA 3MAMA 3ONMA 4E0XA 4OETA 1EU8A 2BJIA 4Z7EA 2ZNTA 1TWYA 3IO4A 3VDFA 1H43A 3MC2A 3H4ZA 2ONRA 3S4UA 3UGWA 1YCJA 1MM7A 2O51A 4I8CA 3OD7A 4GWUA 5AE4A 5TU0A 2UVJA 3K6UA 5B70A 1PBQA 5I56B 2I4BA 3PUXE 3JV9A 3B7DA 3ILTB 4MHFA 5L9SA 4RA1A 3GYYA 3LSWA 1GTKA 3IFAA 4GX3A 4PFBA 1ELJA 3VVEA 3CG1A 4H67A 1KWHA 4KD5A 4HE2A 4GIZA 3IB0A 1US5A 2A5TA 3VV5A 1XHYA 3TCHA 2GFEA 4IGRA 4JVDA 1QGXA 1M5DA 5ELVA 4N17A 4YB6A 1FBDA 4FIMA 2HAUA 3MZBA 4R75A 4FJPA 3THIA 3C36A 1ZKBA 4QFKA 2XXKA 2I0BA 3EHTA 2ALUA 4LQ5A 4DZ1A 1ZLQA 3N5LA 4KPTA 1QKBA 2YJPA 3N26A 2YPNA 3FASA 1QJMA 2AL5A 4DI4B 1HSLA 4IR8A 3T9XB 1XOCA 3DELB 1OMPA 1IMDA 2WX9A 3ILUB 3SEVA 1UIUA 1MS7A 4PFTA 4FBPA 3TCFA 1IXHA 5ET7A 2D5WA 3EHUA 4YMAA 4MCOA 5ET5A 3N6UA 1PDAA 2DXRA 3MP6A 3DP4A 3H6UA 4F3SA 3EN3A 3R7XA 4BDLA 2H99A 1G0IA 1A54A 4QSCA 1FBGA 2O7IA 3OEKA 5EHSA 2I3WA 1Y1ZA 1MQJA 4NE4A 2B65A 4KFQA 1NV3A 3H06B 4ZE9A 2QMWA 1AL3A 3KN8A 2XWVA 1VFEA 2I6EA 2NOOA 4ZDMA 2Q2CA 5DTBA 1LBVA 1NH8A 5ICQA 1O64A 4PFWA 3HSTA 3TELA 1ATGA 1RDYA 3ZS6A 3TAJA 2DYXA 1N3XA 1NNFA 3QSLA 5CMBA 1TFDA 2GQ1A 2P3NA 4K3FA 3K6VA 5CMCA 3FV2A 4HXVA 3K1NA 2QL3A 1DCUA 1FPJA 2CMOA 3QAXA 1NV2A 3IOVA 4WEPA 1R9QA 1Y3QA 4NWCA 1NKXA 2I48A 4PC9A 2FBPA 1IITA 1LSTA 3KG2A 4H1XA 2A5TB 4Q5TA 2LAOA 1FPBA 5H8FA 4JB7A 5IGAA 4XKPA 4RJZA 3UP9A 2OX3A 3RPWA 5HBCA 4G8NA 1MPCA 3TUSA 4I3YA 4FATA 5EQ8A 3OO7A 1DPPA 4RYAA 1SW1A 5EQ9A 4PETA 4IO2A 3PMWA 5H8HA 1PB9A 3A3CA 3RN8A 2GH9A 2R9JA 2OJTA 4YKPA 1B2HA 2O69A 1B05A 2UVIA 2Y5KA 3HCQA 4OEVA 3G3HA 2XX7A 3MUQA 2V93A 3MPLA 1POTA 1FQAA 1NUYA 2QVRA 1SW5A 3QMFA 3JZJA 1R1NA 4TLLB 4I40A 4X8RA 1N0TA 4DXUA 3CFXA 4R72A 5I56A 4P0IA 3U93A 4FAJA 3U1OA 4IGTA 1A99A 3IOUA 1PEBA 2WEFA 4ELQA 2ZNSA 3CG3A 1RKMA 4F18A 3WAFA 3KBZA 5TP9B 3K01A 1OIBA 1O63A 1SBPA 2Z8EA 1AIVA 3USDA 2F7CA 2F8DA 5ET8A 3PMVA 3G7WA 1K9YA 4ZEBA 2RC8A 2PX1A 2IEEA 5AA4B 3FV1A 4XTCQ 3BIGA 4OVSA 4X48A 3TFLA 4H6DA 1AMFA 1I69A 4FE8A 1Y4TA 4LA9A 4O3BA 3ODBA 2Y7KA 3LR1A 1IIWA 4PFUA 4ESWA 1MXUA 4OYVA 2XD2A 4ESXA 5AA2B 4G68C 4PTKA 4OFJA 3PPOA 4DXBA 2DXYA 5JEIA 2GRVA 3V5AA 3IORA 1CNQA 3PUZE 1A8EA 4PBQA 4KXPA 3RGYA 1VE4A 3ZKLA 3ZKKA 3H03A 4DXCA 1JNFA 5L8DA 2L5VA 3U8QA 1B7HA 4P1EA 2H4IA 2QJEA 4M4GA 2CZHA 3VLWA 1DTZA 3BFUA 3KC0A 4KCDA 5I58B 1DOTA 4U4SA 4IO4A 1N04A 1QW0A 3GLBA 1FRPA 3T22A 4BLAA 3M3LA 5KCJA 1P1QA 4QFNA 1FTLA 4GWOA 2V4CA 5BUUA 1URSA 4MFIA 5DYHA 3K2DA 2XD3A 4OEUA 4QBAA 4NG7A 4MAGA 4UACA 5M2VA 1FPLA 4POWA 1IQ7A 2VPNA 1LB8A 1B58A 5IAIA 5DVJA 3MZ1A 1LCFA 4F1UA 1FTMA 1B3EA 2ZYKA 3IR1A 2HFBA 5I2KB 2A5SA 1FQCA 2GHAA 2NUVA 3S9MC 1P1OA 5LDZA 2HAVA 2I58A 4FEBA 3IX1A 3RNNA 1JP4A 4PF8A 3KGCA 4R9FA 2UYFA 1FTAA 3SEUA 1YYZA 4MEVA 4LQ2A 2AL4A 2F78A 5IZ3A 1IEJA 1R6ZA 4N81A 4THIA 1IXGA 2XWKA 3WAEA 4IB2A 5I84A 4PAFA 3T9UA 2I0CA 5I59A 4NTLA 1MY3A 3DM0A 3PD8A 1UTHA 3K00A 1LBCA 3KC1A 2XXYA 5H8HB 3L6HA 4PQJA 1M5EA 4MLVA 4DDDA 4HCYA 3D4CA 1M5BA 4YB5A 4MF3A 5A5XB 3SEYA 1IMBA 3FJ7A 2DP8A 3G3FA 4GLIA 3K02A 3B8BA 4HE1A 2DS9A 5HM4B 4LZ7A 1B4HA 4NF8B 3FXRA 3KN7A 1FBHA 1A8FA 1FQDA 4P56A 3JYRA 1BLFA 4H65A 3K6WA 1MG1A 3C31A 4H5FA 2GHBA 1FBFA 1B6HA 1UTBB 5CC2A 2FVZA 4ZEFA 2XWOA 2V3UA 3Q25A 4GRKA 1Y3NA 4JWYA 5EYFA 2DWAA 1L5TA 5I7IA 2ESNA 3Q28A 5FHOA 4DCXA 4GQOA 2FYIA 3Q27A 3T9HB 3OENA 5DW8A 4F1YA 1NUWA 3U65A 4GWYA 3H6VA 2OWTA 2XXUA 4DCYA 4G68B 4N6KA 3LUYA 3RT6B 4RK9A 1TFAA 3G3GA 4EDPA 4QSDA 2OZZA 4XXUA 5DT6A 4BDOA 2Y7RA 2F97A 3I5OA 1FPKA 4AQ4A 1DSNA 2QRYA 1N76A 4MNIA 4NF5B 1OQGA 4PE5B 1RDZA 3TODA 4QFOA 1I6QA 4YMBA 5JK4A 2WKYA 2XXIA 4OTEA 5LOMA 3GXAA 4ZS9A 4OHNA 3BBRA 4PF6A 5I5PA 2E0SA 4YB7A 1DK4A 4N15A 2HZKA 5DVFA 4LONB 1NV5A 1UTHB 4H5GA 1SQYA 4MLQA 4POXA 1POY1 4F2QA 4ISUA 3E79A 3ECRA 4R74A 3G3IA 1GV8A 2WYKA 3RLFE 2CZKA 1FW0A 4ZZAA 1S50A 1BP5A 3TTLA 4KYSA 2F7AA 4AS4A 1GGGA 3HFUA 3M3KA 1M5FA 2H25A 1GVCA 4NF8A 4PAIA 2ANJA 4QSEA 4EXLA 2F6GA 3ZSFA 1LBWA 1Q35A 5KZTA 2O1MA 2F34A 3H6TA 3O29A 4WXJA 4JWOA 2DVCA 1AWBA 1IXIA 1USYH 3B6QA 3OELA 3TZAA 2RKMA 3KFMA 4U2RA 4MBPA 1N3WA 3KSJA 4HS7A 3KOSA 2HZLA 2Z8FA 1Y1MA 1B9JA 4KYDA 3K1PA 3W9VA 1FTJA 3CFLA 2XXVA 3MBPA 3O6HA 5BWJA 4YZZA 2V3TA 2Z22A 2ZZXA 3QXMA 1B3GA 1BKAA 4P8BA 2QS3A 1SD3A 1XS5A 1B51A 1MPBA 4ZEIA 3V8XB 3FVGA 4FEDA 2QMXA 2F35A 1WODA 1FBEA 4RY1A 1J1NA 1FJ6A 4XEQA 3MVYA 2ZYMA 4E0WA 3KBRA 3U72A 5ESYA 1MPDA 1Y3PA 4AS5A 2REJA 4UA8A 2VD2A 4OZ9A 3C35A 4ELOA 1IMCA 4P1LA 3QYTA 1LFHA 3UN6A 1VFDA 3SEWA 4OMBA 2E1SA 4DI3D 2Q89A 3M3FA 3NOHA 2RF1A 3LSLA 3A09A 4QXDA 5ISUA 2CZIA 1JQFA 2Q2AA 4NWDA 4OANA 3P7IA 3OSRA 3TMGA 3FVNA 4NF4A 2DSFA 1UTBA 2BJJX 4MNPA 1YPNA 3C33A 3OXNA 1USYE 5ITOA 4EF1A 4Q8RA 2X7QA 4YICA 5EQAA 4P0GA 1NMUA 2IA4A 2XXHA 4IO6A 1WDNA 3CR9A 2F7BA 2UVGA 1IMFA 1SI0A 5I2NA 1FQEA 1JVXA 1KZ8A 4KI0E 3UIFA 3CHGA 4NHBA 2XXPA 4XFEA 3FVKA 1QULA 2RC7A 5CRYA 5TP9A 2F3DA 2VGQA 1SI1A 2FHYA 4DIGA 1LAGE 3MVXA 2NVUB 3PU5A 4GX4A 1MH3A 4P9KA 1IMEA 4NF5A 5ET6A 1FJ9A 1B52A 4MMPA 3H6WA 4X9TA 4IY5A 3IAZA 1XI6A 1ZBMA 1FTKA 1PBPA 3VFJA 1N7WA 3GBBA 5F1QA 2VHAA 4PDHA 4OA4A 4OVPA 3IOWA 2VT5A 1PB8A 1BTJA 1Z7ME 5AA2A
chains in the Genus database with same CATH topology
4R9FA 3MPKA 5TPAB 2UVJA 3FZVA 3K6UA 5AA3A 5B70A 3MW0A 2HCAA 5K2YA 2UYFA 3SEUA 4RXLA 3VXCA 4LQ2A 1ANFA 1PBQA 1TXFA 5I56B 2AL4A 2I4BA 3PUXE 2F78A 1VSOA 4F29A 3JV9A 5ICTA 3B7DA 3ILTB 3C32A 1IEJA 5FTIA 4BDQA 5L9SA 1R6ZA 4RA1A 4O3AA 4THIA 3A3UA 1P1UA 1IXGA 3LSWA 1GTKA 4ZEKA 3RY3A 3WAEA 4IB2A 3V89B 4FORA 5I84A 3T9UA 1ELJA 3UK4A 2I0CA 5I59A 1MY4A 3VVEA 3CG1A 1SVXB 2V84A 4NTLA 5I2NB 1MY3A 4H67A 1KWHA 3DM0A 1D3KA 3E9XA 1UTHA 3PD8A 4KD5A 1FCKA 4GIZA 4R9GA 4DE8A 1D4NA 3K00A 1LBCA 2H5YA 5H8QA 2XXYA 3MQ9A 5H8HB 3HPIA 1B46A 2THIA 3TQLA 3L6HA 3IB0A 3KEIA 1MDP1 1US5A 4PQJA 1M5EA 2A5TA 4MLVA 4DDDA 4HCYA 1Q1KA 4ND9A 3D4CA 3VV5A 1XHYA 5KCJB 3TCHA 1M5BA 4YB5A 2GFEA 3Q29A 4OFOA 4Q0CA 1MDQA 4IGRA 4MF3A 4F3PA 5A5XB 1M5DA 5L9MA 5ELVA 4YB6A 4KQPA 4FIMA 3SEYA 2HAUA 3MZBA 4R75A 4FJPA 3PPQA 3FJ7A 1NH7A 3THIA 2DP8A 2OK2A 3C36A 3G3FA 4GLIA 1ZKBA 3K02A 2DS9A 3C9HA 4GVOA 5HM4B 2DE3A 4QFKA 4LZ7A 1B4HA 3G3JA 4NF8B 1II5A 3FXRA 3KN7A 3Q26A 1A8FA 4G8HA 1FQDA 1MH4A 2I0BA 1QUKA 2DOJA 3TPAA 3EHTA 2ALUA 1BLFA 3JYRA 3PGFA 4LQ5A 4H65A 4C0RA 3K6WA 3SKPA 1MG1A 1ZLQA 3C31A 4DZ1A 4H5FA 3T96B 3N5LA 4G8MA 4KPTA 2GHBA 3TYHA 1LFIA 1QKBA 2YJPA 2DE4A 3N26A 2YPNA 1D9YA 2RCBA 1LBBA 3FASA 1B6HA 1QJMA 1UTBB 2AL5A 1XVXA 5CC2A 1HSLA 4Z0IA 3T9XB 4ZEFA 1PB7A 1GR2A 1XOCA 1LAHE 5KDTA 2ZNUA 4U1ZA 1QUIA 1SYHA 3DELB 5H8FB 2V3UA 1OMPA 2G29A 3LSFB 3Q25A 1Z7NE 1EH3A 1Y3NA 3O66A 4GRKA 3ILUB 4JWYA 5EYFA 3SEVA 5I59B 1UIUA 2YLNA 1MS7A 4PFTA 1B5IA 2REGA 3E4RA 2QS1A 3TCFA 1IXHA 2VP1A 3KSXA 2D5WA 3EHUA 1ZIUA 2DWAA 3IK6B 3PPPA 4YMAA 1URDA 3N6UA 3V83A 1PDAA 1L5TA 2DXRA 2ONKE 3MP6A 2ESNA 3DP4A 3FD3A 3H6UA 4AB5A 4F3SA 3PPNA 3Q28A 3EN3A 2XXRA 1H76A 5A5XA 3R7XA 5FHOA 4BDLA 4DCXA 4GQOA 2PBWA 3O6IA 2FYIA 3Q27A 3T9HB 1B7UA 1IXCA 1LGBC 2H99A 2XXTA 3CSGA 3IJOB 1JW5A 4RPNA 4YAHX 3OENA 4F1YA 4F2OA 1A54A 4QSCA 3LSXA 2O7IA 4P11A 4RK2A 3OEKA 5EHSA 1MXYA 3H6VA 4EQ9A 2I3WA 2DQVA 1Y1ZA 2OWTA 1MQJA 3K0VA 4NE4A 2XXUA 2B65A 4GOTA 4U21A 3UA8A 4KFQA 3CFZA 3RTFB 4DCYA 1US4A 4LUBA 3H06B 2O6AA 2F36A 2Y7WA 3UORA 2QMWA 3O9PA 4ZE9A 3IB1A 2PT1A 1AL3A 4G68B 3KN8A 3LUYA 2R71A 3TKDA 1VFEA 2HXWA 2I6EA 2I49A 2NOOA 1ZMGA 3RT6B 4OQOA 4RK9A 4EXKA 1TFAA 2QPQA 3R26A 4ZDMA 2XXXA 4H8IA 3G3GA 2Q2CA 3MP1A 5DTBA 3TCGA 3O6GA 4QSDA 4EDPA 2OZZA 3CRBA 1NH8A 4JSOA 5ICQA 1O64A 4PFWA 1JW4A 1DMBA 4OXVA 3HSTA 3TELA 1B1HA 1ZU0A 2RINA 2UYEA 2AIXA 4XXUA 2P2AA 2XXQA 1B5JA 1MQGA 2D3IA 1TT1A 1O7TA 5DT6A 1ATGA 4GXAA 2Y7RA 2F97A 3RUMA 1LFGA 3FUZA 3ZS6A 3I5OA 3O2AA 4JSDA 2DYXA 3TAJA 1N3XA 1XC1A 1B0LA 5TPAA 1Y9UA 1NNFA 3QSLA 5CMBA 4AQ4A 3EQ1A 1TFDA 4K3FA 1DSNA 3TTKA 1LAXA 2QRYA 1N76A 3CSBA 4NF5B 1LLSA 3K6VA 5CMCA 5CM6A 3PV0E 1OQGA 4IO3A 3FV2A 4XKRA 3TTMA 4PE5B 3T9VA 2RCAA 3K1NA 2QL3A 3TODA 2NXOA 4QFOA 1I6QA 3QIMA 4O3CA 4C1TA 3TEPA 4YMBA 1LAFE 2F6PA 5JK4A 2WKYA 2XXIA 2CMOA 3QAXA 3GXAA 4OTEA 5LOMA 4ZS9A 2P0SA 3BBRA 3IOVA 4OHNA 1A55A 1I6AA 4OENA 1JVYA 3B6WA 4WEPA 3C4MA 4YKKA 1R9QA 4NF6A 2E0SA 2DWHA 1XT8A 1JW1A 3FJGA 1B3FA 4YB7A 4F3BA 1Y3QA 1MY0A 2HZKA 2VOZA 4LONB 5DVFA 2ZYNA 1UTHB 4N07A 4NWCA 1NKXA 4H5GA 5H8QB 4ONYA 3QUFA 4RNSA 2I48A 3TTRA 2G93A 1SQYA 4MLQA 1IITA 1LSTA 1NNPA 3KG2A 1NNTA 4POXA 4H1XA 1POY1 1AH5A 1PC3A 2A5TB 4ISUA 2HQ0A 2LAOA 4Q5TA 4F2QA 5H8FA 1QVSA 2PVUA 3ECRA 3G3IA 4R74A 4BDMA 4OESA 4IY6A 1GV8A 4JB7A 2QS2A 3RLFE 2NWJA 4GFRA 3D4GA 3FXUA 5H8NA 4ZZAA 1FW0A 1S50A 1BP5A 4XKPA 3TTLA 4KYSA 5F7VA 4TOZA 3PMXA 2F7AA 1M5CA 4RJZA 1GGGA 2ZYOA 1FQFA 3UP9A 4H8JA 2H98A 1N7XA 3FJMA 3M3KA 4ZECA 3RPWA 4G4PA 5HBCA 1M5FA 4G8NA 2X26A 1MPCA 2Y7PA 3TUSA 5AA2D 1SDXA 2H25A 3OMBA 4NF8A 1GVCA 1OLAA 4FATA 2B3BA 3VE1B 3VLVA 3GZGA 2ANJA 5CMMA 4QSEA 4EXLA 2F6GA 4QRZA 3O97A 3ZSFA 2Q9TA 1Q35A 5KZTA 3OO7A 1DPPA 2O1MA 4RYAA 2F34A 3H6TA 1SW1A 3O29A 4WXJA 4ECFA 3H7MA 4U22A 2PMSA 4JWOA 4PETA 4I9DA 4IO2A 5I57B 4YU0A 2DVCA 3OEMA 3PMWA 4F39A 3SETA 3S9EA 5H8HA 2O7UA 1IXIA 1USYH 1VR5A 3B6QA 4HCWA 3OELA 4IO5A 3KOTA 3TZAA 1Y20A 2O1LA 3RTWB 5KDTB 2RKMA 3KFMA 1PB9A 4U2RA 3A3CA 3E3KA 4MBPA 1N3WA 3KSJA 3KZGA 4G68A 1SW4A 4HS7A 3KOSA 3QUJA 4ELPA 1NNKA 2W7YA 3R6UA 1URGA 3RN8A 2HZLA 2B3FA 2OBGA 2I4CA 2AYSA 2GH9A 1UQWA 2R9JA 2Z8FA 2OJTA 3IL1B 3BKIB 2VD3A 1I6BA 1Y1MA 1B9JA 1MM6A 1YTVA 2ONSA 1B2HA 3MVWA 4KYDA 2O69A 4YKPA 1MY1A 3TTNA 3K1PA 3U92A 3W9VA 1B05A 1B32A 3K4UA 3SDFA 3MP8A 1DPEA 5DEXB 4C1UA 1FTJA 4QF9A 3OO6A 4F31B 3B6TA 5CBRA 3CFLA 2UVIA 1EZ9A 2XXVA 4YKJA 4DLDA 4F22A 5AA4A 3MBPA 1N84A 3O6HA 3HCQA 4YZZA 1NL5A 2V3TA 3F11A 3G3HA 2Z22A 4OEVA 1JEUA 2KLFA 2X7PA 2XX7A 2Z23A 3MUQA 2V93A 3QXMA 2OLBA 4U1OA 5K2XA 3T93B 1SYIA 4OFLA 4BDOA 3MPLA 1B3GA 1OLCA 4WKMA 5JTYA 1POTA 3VXBA 4OERA 4JWXA 1BKAA 1FQAA 1ZTYA 4FECA 1ZJLA 2QS3A 3W15C 5J1DA 1SD3A 1XS5A 1B51A 3BFTA 1MPBA 2XX8A 1LCTA 4JDFA 4R2BA 4ZEIA 4HW8A 3V8XB 2ABHA 3FVGA 1SW5A 4FEDA 3VVFA 2QMXA 3TQWA 1MRPA 2F35A 1R1NA 3JZJA 4BDRA 4TLLB 1QKAA 1WODA 4RY1A 1N0TA 1MY2A 1T0KA 4Q30B 1J1NA 3CFXA 4NF6B 4R72A 4DXUA 1IUDA 3DP8A 5I56A 4P0IA 5AA1A 3U93A 4FAJA 5I58A 1JETA 3U1OA 3EF7A 3MVYA 4IGTA 2ZYMA 3OOAA 3SESA 4I62A 4F19A 1A99A 1B4ZA 1FQBA 4E0WA 3IOUA 5CMKA 3KBRA 1PEBA 3TDJA 2XX9A 2FA7A 1NFTA 3U72A 4ELQA 1MPDA 1Y3PA 2P1SA 4F3GA 2ZNSA 2REJA 3CG3A 1RKMA 4UA8A 2VD2A 1F9BA 3MVZA 3U94A 3T66A 3WAFA 1DTGA 4F18A 5TP9B 1MQDA 1A7LA 2DWJA 1OIBA 1O63A 1SBPA 2Z8EA 3K01A 3KJTA 3C35A 4OZ9A 5FHMA 3USDA 3IB2A 4KHZE 2F7CA 4ELOA 1H44A 5H8NB 2F8DA 4NEDA 3FIRA 5CI5A 3PMVA 2Y7IA 1P1NA 3G7WA 3OSQA 4L17A 3QYTA 4R6KA 4X1DA 1QUJA 1LFHA 3UN6A 2F5XA 1MXWA 4ZEBA 2RC8A 1H3DA 2PX1A 3DLNA 1VFDA 3M8UA 4QFPA 2IEEA 3SEWA 4EUOA 1AIVA 4OMBA 5AA4B 1BIYA 2E1SA 3FV1A 1WVJA 2Q89A 3N94A 3M3FA 4LZ5A 2Q8JA 4XTCQ 3FVOA 1MXXA 5FTHA 4U23A 3FGSA 5EHMA 5B7DA 1FTOA 2RF1A 2QS4A 4X48A 2ZMBA 3LSLA 3TFLA 3A09A 2DVZA 4H6DA 5ISUA 1AMFA 4KYEA 1I69A 3KJ7A 4EF2A 4FE8A 1Y4TA 1B3LA 1D9VA 3LC8A 4LA9A 4U4XA 5CBSA 4E0XA 4ZE8A 4O3BA 2DWIA 1JQFA 2Q2AA 1OVTA 4NWDA 3CIJA 3K1MA 2Y7KA 3EHSA 1Y4CA 3LR1A 3ODBA 5I2KA 4G77A 1IZ1A 4M1VA 3P7IA 3OSRA 3I3VA 1B1XA 3HHFA 2Q88A 3RT8A 5H8SA 1IIWA 1B3HA 3TMGA 4AB6A 5IKBA 4MH5A 4PFUA 4ESWA 3FVNA 4F1VA 2O84X 4GD5A 2O68A 4N13A 3S9LC 3LBSA 4NF4A 1MXVA 1UTBA 1OVBA 2DSFA 1MXUA 1S9TA 2BJJX 3IJXB 1A40A 3K6XA 4OYVA 4R73A 4R2FA 4XKQA 1MQIA 2OWSA 2XD2A 4OVJA 4ESXA 3PUWE 3L6GA 4LZ8A 2XXWA 5DEXA 1YPNA 3C33A 5AA2B 4KR5A 4G68C 3OXNA 1MXZA 4OFJA 3PPOA 4NMYA 2PYYA 1SW2A 3OO9A 4GXSB 1USYE 3OO8A 3VVDA 4DXBA 1HSEA 1CE2A 2DXYA 3FATA 4JBZA 4XIGQ 2CZLA 5ITOA 5JEIA 3HV1A 2GRVA 2XHDA 3IORA 5DVIA 3V5AA 2QSXA 3PUZE 1A8EA 5ITPA 3RGYA 1R9LA 1VE4A 3ZKLA 4GF8A 2RC9A 4EF1A 1P99A 3ZKKA 3H03A 4DXCA 4Q8RA 2X7QA 3MZ9A 4YICA 5I57A 1JNFA 3VLUA 5L8DA 2Z8DA 2Y84A 4WEDA 3U8QA 1B7HA 3I6VA 4P0GA 1NMUA 3KN3A 3O28A 3CVGA 4LATA 2IA4A 2H4IA 2PT2A 2QJEA 2XXHA 4IO6A 4M4GA 1WDNA 3IO6A 3CR9A 4PFYA 3VLWA 2F7BA 3N6TA 1DTZA 4EQBA 2UVGA 3BFUA 3PUYE 1SI0A 2V25A 4QHQA 5I2NA 3HO7A 4KCDA 1FQEA 5I58B 5L9OA 1DOTA 1JVXA 4TQUQ 4IO4A 4U4SA 5BWJA 2OCUA 1OQHA 3HHGA 2UVHA 1N04A 1QW0A 2UXAA 3C34A 3GLBA 3W9WA 4I1DA 4KI0E 2I3VA 3UIFA 4XKNA 3S9NC 3T22A 4G2ZA 4BLAA 3CI8A 4RPOA 3M3LA 5KCJA 4ZEDA 1P1QA 4QFNA 2XXPA 1B7ZA 1FTLA 1QULA 2ZXTA 3FVKA 3H3GA 3QK6A 2RC7A 4GL0A 3HN0A 4GWOA 4JXIA 4LVQA 2DE2A 5CRYA 5TP9A 5BUUA 2H9BA 1URSA 1P1WA 2VGQA 3AXFA 1SI1A 4MFIA 1HSJA 3RQTA 1S7YA 4NF4B 5JTYB 1JEVA 2R6GE 5DYHA 3K2DA 2XD3A 4ZZEA 4OEUA 4DIGA 1LAGE 3MVXA 3PPRA 2NVUB 3PU5A 3G3KA 4UACA 5M2VA 1MH3A 4KCCA 4TLMB 4POWA 4BDNA 4ELRA 1UIVA 3PD9A 2M8CA 3IOTA 1XVYA 1IQ7A 3MJNA 1LB8A 1YAEA 4IO7A 3E13X 4NF5A 1B58A 1CB6A 3EPEA 5IAIA 1B52A 1B5HA 4LP2B 5DVJA 3SERA 1EZPA 1H45A 3FXQA 3MZ1A 3H6WA 4N6PA 1LCFA 3SEXA 4H0WA 4X9TA 4IY5A 2FNCA 4GL8A 3IAZA 4QFLA 4F1UA 4PP0A 4R6HA 1FTMA 2D21A 1B3EA 2ZYKA 1RYOA 3DP6A 3S2VA 3IR1A 5HPQA 4OWDA 2HFBA 3PUVE 1ZBMA 3GBAA 4X1BA 5I2KB 1LB9A 3MAMA 2V3QA 2A5SA 3ONMA 1FTKA 2HEUA 4HTGA 1MQHA 1PBPA 1EU8A 4OETA 1EZOA 4Z7EA 1FQCA 3MWBA 1RYXA 2ZNTA 2GHAA 3VFJA 1B40A 2NUVA 3S9MC 1TWYA 1N7WA 3GBBA 5F1QA 2VHAA 3IO4A 5FHNA 3VDFA 1H43A 1B0HA 1P1OA 3MC2A 3H4ZA 2ONRA 3IOWA 4YKIA 1YCJA 3S4UA 3UGWA 4EQ7A 1MM7A 1PB8A 2HAVA 1BTJA 2I58A 2O51A 4I8CA 4FEBA 1Z7ME 1AOVA 3OD7A 3IX1A 3RNNA 5AA2A 3KGCA 4R6YA 5AE4A 5TU0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R9F A;  3MPK A;  5TPA B;  2UVJ A;  3FZV A;  3K6U A;  5AA3 A;  5B70 A;  3MW0 A;  2HCA A;  5K2Y A;  2UYF A;  3SEU A;  4RXL A;  3VXC A;  4LQ2 A;  1ANF A;  1PBQ A;  1TXF A;  5I56 B;  2AL4 A;  2I4B A;  3PUX E;  2F78 A;  1VSO A;  4F29 A;  3JV9 A;  5ICT A;  3B7D A;  3ILT B;  3C32 A;  1IEJ A;  5FTI A;  4BDQ A;  5L9S A;  1R6Z A;  4RA1 A;  4O3A A;  4THI A;  3A3U A;  1P1U A;  1IXG A;  3LSW A;  1GTK A;  4ZEK A;  3RY3 A;  3WAE A;  4IB2 A;  3V89 B;  4FOR A;  5I84 A;  3T9U A;  1ELJ A;  3UK4 A;  2I0C A;  5I59 A;  1MY4 A;  3VVE A;  3CG1 A;  1SVX B;  2V84 A;  4NTL A;  5I2N B;  1MY3 A;  4H67 A;  1KWH A;  3DM0 A;  1D3K A;  3E9X A;  1UTH A;  3PD8 A;  4KD5 A;  1FCK A;  4GIZ A;  4R9G A;  4DE8 A;  1D4N A;  3K00 A;  1LBC A;  2H5Y A;  5H8Q A;  2XXY A;  3MQ9 A;  5H8H B;  3HPI A;  1B46 A;  2THI A;  3TQL A;  3L6H A;  3IB0 A;  3KEI A;  1MDP 1;  1US5 A;  4PQJ A;  1M5E A;  2A5T A;  4MLV A;  4DDD A;  4HCY A;  1Q1K A;  4ND9 A;  3D4C A;  3VV5 A;  1XHY A;  5KCJ B;  3TCH A;  1M5B A;  4YB5 A;  2GFE A;  3Q29 A;  4OFO A;  4Q0C A;  1MDQ A;  4IGR A;  4MF3 A;  4F3P A;  5A5X B;  1M5D A;  5L9M A;  5ELV A;  4YB6 A;  4KQP A;  4FIM A;  3SEY A;  2HAU A;  3MZB A;  4R75 A;  4FJP A;  3PPQ A;  3FJ7 A;  1NH7 A;  3THI A;  2DP8 A;  2OK2 A;  3C36 A;  3G3F A;  4GLI A;  1ZKB A;  3K02 A;  2DS9 A;  3C9H A;  4GVO A;  5HM4 B;  2DE3 A;  4QFK A;  4LZ7 A;  1B4H A;  3G3J A;  4NF8 B;  1II5 A;  3FXR A;  3KN7 A;  3Q26 A;  1A8F A;  4G8H A;  1FQD A;  1MH4 A;  2I0B A;  1QUK A;  2DOJ A;  3TPA A;  3EHT A;  2ALU A;  1BLF A;  3JYR A;  3PGF A;  4LQ5 A;  4H65 A;  4C0R A;  3K6W A;  3SKP A;  1MG1 A;  1ZLQ A;  3C31 A;  4DZ1 A;  4H5F A;  3T96 B;  3N5L A;  4G8M A;  4KPT A;  2GHB A;  3TYH A;  1LFI A;  1QKB A;  2YJP A;  2DE4 A;  3N26 A;  2YPN A;  1D9Y A;  2RCB A;  1LBB A;  3FAS A;  1B6H A;  1QJM A;  1UTB B;  2AL5 A;  1XVX A;  5CC2 A;  1HSL A;  4Z0I A;  3T9X B;  4ZEF A;  1PB7 A;  1GR2 A;  1XOC A;  1LAH E;  5KDT A;  2ZNU A;  4U1Z A;  1QUI A;  1SYH A;  3DEL B;  5H8F B;  2V3U A;  1OMP A;  2G29 A;  3LSF B;  3Q25 A;  1Z7N E;  1EH3 A;  1Y3N A;  3O66 A;  4GRK A;  3ILU B;  4JWY A;  5EYF A;  3SEV A;  5I59 B;  1UIU A;  2YLN A;  1MS7 A;  4PFT A;  1B5I A;  2REG A;  3E4R A;  2QS1 A;  3TCF A;  1IXH A;  2VP1 A;  3KSX A;  2D5W A;  3EHU A;  1ZIU A;  2DWA A;  3IK6 B;  3PPP A;  4YMA A;  1URD A;  3N6U A;  3V83 A;  1PDA A;  1L5T A;  2DXR A;  2ONK E;  3MP6 A;  2ESN A;  3DP4 A;  3FD3 A;  3H6U A;  4AB5 A;  4F3S A;  3PPN A;  3Q28 A;  3EN3 A;  2XXR A;  1H76 A;  5A5X A;  3R7X A;  5FHO A;  4BDL A;  4DCX A;  4GQO A;  2PBW A;  3O6I A;  2FYI A;  3Q27 A;  3T9H B;  1B7U A;  1IXC A;  1LGB C;  2H99 A;  2XXT A;  3CSG A;  3IJO B;  1JW5 A;  4RPN A;  4YAH X;  3OEN A;  4F1Y A;  4F2O A;  1A54 A;  4QSC A;  3LSX A;  2O7I A;  4P11 A;  4RK2 A;  3OEK A;  5EHS A;  1MXY A;  3H6V A;  4EQ9 A;  2I3W A;  2DQV A;  1Y1Z A;  2OWT A;  1MQJ A;  3K0V A;  4NE4 A;  2XXU A;  2B65 A;  4GOT A;  4U21 A;  3UA8 A;  4KFQ A;  3CFZ A;  3RTF B;  4DCY A;  1US4 A;  4LUB A;  3H06 B;  2O6A A;  2F36 A;  2Y7W A;  3UOR A;  2QMW A;  3O9P A;  4ZE9 A;  3IB1 A;  2PT1 A;  1AL3 A;  4G68 B;  3KN8 A;  3LUY A;  2R71 A;  3TKD A;  1VFE A;  2HXW A;  2I6E A;  2I49 A;  2NOO A;  1ZMG A;  3RT6 B;  4OQO A;  4RK9 A;  4EXK A;  1TFA A;  2QPQ A;  3R26 A;  4ZDM A;  2XXX A;  4H8I A;  3G3G A;  2Q2C A;  3MP1 A;  5DTB A;  3TCG A;  3O6G A;  4QSD A;  4EDP A;  2OZZ A;  3CRB A;  1NH8 A;  4JSO A;  5ICQ A;  1O64 A;  4PFW A;  1JW4 A;  1DMB A;  4OXV A;  3HST A;  3TEL A;  1B1H A;  1ZU0 A;  2RIN A;  2UYE A;  2AIX A;  4XXU A;  2P2A A;  2XXQ A;  1B5J A;  1MQG A;  2D3I A;  1TT1 A;  1O7T A;  5DT6 A;  1ATG A;  4GXA A;  2Y7R A;  2F97 A;  3RUM A;  1LFG A;  3FUZ A;  3ZS6 A;  3I5O A;  3O2A A;  4JSD A;  2DYX A;  3TAJ A;  1N3X A;  1XC1 A;  1B0L A;  5TPA A;  1Y9U A;  1NNF A;  3QSL A;  5CMB A;  4AQ4 A;  3EQ1 A;  1TFD A;  4K3F A;  1DSN A;  3TTK A;  1LAX A;  2QRY A;  1N76 A;  3CSB A;  4NF5 B;  1LLS A;  3K6V A;  5CMC A;  5CM6 A;  3PV0 E;  1OQG A;  4IO3 A;  3FV2 A;  4XKR A;  3TTM A;  4PE5 B;  3T9V A;  2RCA A;  3K1N A;  2QL3 A;  3TOD A;  2NXO A;  4QFO A;  1I6Q A;  3QIM A;  4O3C A;  4C1T A;  3TEP A;  4YMB A;  1LAF E;  2F6P A;  5JK4 A;  2WKY A;  2XXI A;  2CMO A;  3QAX A;  3GXA A;  4OTE A;  5LOM A;  4ZS9 A;  2P0S A;  3BBR A;  3IOV A;  4OHN A;  1A55 A;  1I6A A;  4OEN A;  1JVY A;  3B6W A;  4WEP A;  3C4M A;  4YKK A;  1R9Q A;  4NF6 A;  2E0S A;  2DWH A;  1XT8 A;  1JW1 A;  3FJG A;  1B3F A;  4YB7 A;  4F3B A;  1Y3Q A;  1MY0 A;  2HZK A;  2VOZ A;  4LON B;  5DVF A;  2ZYN A;  1UTH B;  4N07 A;  4NWC A;  1NKX A;  4H5G A;  5H8Q B;  4ONY A;  3QUF A;  4RNS A;  2I48 A;  3TTR A;  2G93 A;  1SQY A;  4MLQ A;  1IIT A;  1LST A;  1NNP A;  3KG2 A;  1NNT A;  4POX A;  4H1X A;  1POY 1;  1AH5 A;  1PC3 A;  2A5T B;  4ISU A;  2HQ0 A;  2LAO A;  4Q5T A;  4F2Q A;  5H8F A;  1QVS A;  2PVU A;  3ECR A;  3G3I A;  4R74 A;  4BDM A;  4OES A;  4IY6 A;  1GV8 A;  4JB7 A;  2QS2 A;  3RLF E;  2NWJ A;  4GFR A;  3D4G A;  3FXU A;  5H8N A;  4ZZA A;  1FW0 A;  1S50 A;  1BP5 A;  4XKP A;  3TTL A;  4KYS A;  5F7V A;  4TOZ A;  3PMX A;  2F7A A;  1M5C A;  4RJZ A;  1GGG A;  2ZYO A;  1FQF A;  3UP9 A;  4H8J A;  2H98 A;  1N7X A;  3FJM A;  3M3K A;  4ZEC A;  3RPW A;  4G4P A;  5HBC A;  1M5F A;  4G8N A;  2X26 A;  1MPC A;  2Y7P A;  3TUS A;  5AA2 D;  1SDX A;  2H25 A;  3OMB A;  4NF8 A;  1GVC A;  1OLA A;  4FAT A;  2B3B A;  3VE1 B;  3VLV A;  3GZG A;  2ANJ A;  5CMM A;  4QSE A;  4EXL A;  2F6G A;  4QRZ A;  3O97 A;  3ZSF A;  2Q9T A;  1Q35 A;  5KZT A;  3OO7 A;  1DPP A;  2O1M A;  4RYA A;  2F34 A;  3H6T A;  1SW1 A;  3O29 A;  4WXJ A;  4ECF A;  3H7M A;  4U22 A;  2PMS A;  4JWO A;  4PET A;  4I9D A;  4IO2 A;  5I57 B;  4YU0 A;  2DVC A;  3OEM A;  3PMW A;  4F39 A;  3SET A;  3S9E A;  5H8H A;  2O7U A;  1IXI A;  1USY H;  1VR5 A;  3B6Q A;  4HCW A;  3OEL A;  4IO5 A;  3KOT A;  3TZA A;  1Y20 A;  2O1L A;  3RTW B;  5KDT B;  2RKM A;  3KFM A;  1PB9 A;  4U2R A;  3A3C A;  3E3K A;  4MBP A;  1N3W A;  3KSJ A;  3KZG A;  4G68 A;  1SW4 A;  4HS7 A;  3KOS A;  3QUJ A;  4ELP A;  1NNK A;  2W7Y A;  3R6U A;  1URG A;  3RN8 A;  2HZL A;  2B3F A;  2OBG A;  2I4C A;  2AYS A;  2GH9 A;  1UQW A;  2R9J A;  2Z8F A;  2OJT A;  3IL1 B;  3BKI B;  2VD3 A;  1I6B A;  1Y1M A;  1B9J A;  1MM6 A;  1YTV A;  2ONS A;  1B2H A;  3MVW A;  4KYD A;  2O69 A;  4YKP A;  1MY1 A;  3TTN A;  3K1P A;  3U92 A;  3W9V A;  1B05 A;  1B32 A;  3K4U A;  3SDF A;  3MP8 A;  1DPE A;  5DEX B;  4C1U A;  1FTJ A;  4QF9 A;  3OO6 A;  4F31 B;  3B6T A;  5CBR A;  3CFL A;  2UVI A;  1EZ9 A;  2XXV A;  4YKJ A;  4DLD A;  4F22 A;  5AA4 A;  3MBP A;  1N84 A;  3O6H A;  3HCQ A;  4YZZ A;  1NL5 A;  2V3T A;  3F11 A;  3G3H A;  2Z22 A;  4OEV A;  1JEU A;  2KLF A;  2X7P A;  2XX7 A;  2Z23 A;  3MUQ A;  2V93 A;  3QXM A;  2OLB A;  4U1O A;  5K2X A;  3T93 B;  1SYI A;  4OFL A;  4BDO A;  3MPL A;  1B3G A;  1OLC A;  4WKM A;  5JTY A;  1POT A;  3VXB A;  4OER A;  4JWX A;  1BKA A;  1FQA A;  1ZTY A;  4FEC A;  1ZJL A;  2QS3 A;  3W15 C;  5J1D A;  1SD3 A;  1XS5 A;  1B51 A;  3BFT A;  1MPB A;  2XX8 A;  1LCT A;  4JDF A;  4R2B A;  4ZEI A;  4HW8 A;  3V8X B;  2ABH A;  3FVG A;  1SW5 A;  4FED A;  3VVF A;  2QMX A;  3TQW A;  1MRP A;  2F35 A;  1R1N A;  3JZJ A;  4BDR A;  4TLL B;  1QKA A;  1WOD A;  4RY1 A;  1N0T A;  1MY2 A;  1T0K A;  4Q30 B;  1J1N A;  3CFX A;  4NF6 B;  4R72 A;  4DXU A;  1IUD A;  3DP8 A;  5I56 A;  4P0I A;  5AA1 A;  3U93 A;  4FAJ A;  5I58 A;  1JET A;  3U1O A;  3EF7 A;  3MVY A;  4IGT A;  2ZYM A;  3OOA A;  3SES A;  4I62 A;  4F19 A;  1A99 A;  1B4Z A;  1FQB A;  4E0W A;  3IOU A;  5CMK A;  3KBR A;  1PEB A;  3TDJ A;  2XX9 A;  2FA7 A;  1NFT A;  3U72 A;  4ELQ A;  1MPD A;  1Y3P A;  2P1S A;  4F3G A;  2ZNS A;  2REJ A;  3CG3 A;  1RKM A;  4UA8 A;  2VD2 A;  1F9B A;  3MVZ A;  3U94 A;  3T66 A;  3WAF A;  1DTG A;  4F18 A;  5TP9 B;  1MQD A;  1A7L A;  2DWJ A;  1OIB A;  1O63 A;  1SBP A;  2Z8E A;  3K01 A;  3KJT A;  3C35 A;  4OZ9 A;  5FHM A;  3USD A;  3IB2 A;  4KHZ E;  2F7C A;  4ELO A;  1H44 A;  5H8N B;  2F8D A;  4NED A;  3FIR A;  5CI5 A;  3PMV A;  2Y7I A;  1P1N A;  3G7W A;  3OSQ A;  4L17 A;  3QYT A;  4R6K A;  4X1D A;  1QUJ A;  1LFH A;  3UN6 A;  2F5X A;  1MXW A;  4ZEB A;  2RC8 A;  1H3D A;  2PX1 A;  3DLN A;  1VFD A;  3M8U A;  4QFP A;  2IEE A;  3SEW A;  4EUO A;  1AIV A;  4OMB A;  5AA4 B;  1BIY A;  2E1S A;  3FV1 A;  1WVJ A;  2Q89 A;  3N94 A;  3M3F A;  4LZ5 A;  2Q8J A;  4XTC Q;  3FVO A;  1MXX A;  5FTH A;  4U23 A;  3FGS A;  5EHM A;  5B7D A;  1FTO A;  2RF1 A;  2QS4 A;  4X48 A;  2ZMB A;  3LSL A;  3TFL A;  3A09 A;  2DVZ A;  4H6D A;  5ISU A;  1AMF A;  4KYE A;  1I69 A;  3KJ7 A;  4EF2 A;  4FE8 A;  1Y4T A;  1B3L A;  1D9V A;  3LC8 A;  4LA9 A;  4U4X A;  5CBS A;  4E0X A;  4ZE8 A;  4O3B A;  2DWI A;  1JQF A;  2Q2A A;  1OVT A;  4NWD A;  3CIJ A;  3K1M A;  2Y7K A;  3EHS A;  1Y4C A;  3LR1 A;  3ODB A;  5I2K A;  4G77 A;  1IZ1 A;  4M1V A;  3P7I A;  3OSR A;  3I3V A;  1B1X A;  3HHF A;  2Q88 A;  3RT8 A;  5H8S A;  1IIW A;  1B3H A;  3TMG A;  4AB6 A;  5IKB A;  4MH5 A;  4PFU A;  4ESW A;  3FVN A;  4F1V A;  2O84 X;  4GD5 A;  2O68 A;  4N13 A;  3S9L C;  3LBS A;  4NF4 A;  1MXV A;  1UTB A;  1OVB A;  2DSF A;  1MXU A;  1S9T A;  2BJJ X;  3IJX B;  1A40 A;  3K6X A;  4OYV A;  4R73 A;  4R2F A;  4XKQ A;  1MQI A;  2OWS A;  2XD2 A;  4OVJ A;  4ESX A;  3PUW E;  3L6G A;  4LZ8 A;  2XXW A;  5DEX A;  1YPN A;  3C33 A;  5AA2 B;  4KR5 A;  4G68 C;  3OXN A;  1MXZ A;  4OFJ A;  3PPO A;  4NMY A;  2PYY A;  1SW2 A;  3OO9 A;  4GXS B;  1USY E;  3OO8 A;  3VVD A;  4DXB A;  1HSE A;  1CE2 A;  2DXY A;  3FAT A;  4JBZ A;  4XIG Q;  2CZL A;  5ITO A;  5JEI A;  3HV1 A;  2GRV A;  2XHD A;  3IOR A;  5DVI A;  3V5A A;  2QSX A;  3PUZ E;  1A8E A;  5ITP A;  3RGY A;  1R9L A;  1VE4 A;  3ZKL A;  4GF8 A;  2RC9 A;  4EF1 A;  1P99 A;  3ZKK A;  3H03 A;  4DXC A;  4Q8R A;  2X7Q A;  3MZ9 A;  4YIC A;  5I57 A;  1JNF A;  3VLU A;  5L8D A;  2Z8D A;  2Y84 A;  4WED A;  3U8Q A;  1B7H A;  3I6V A;  4P0G A;  1NMU A;  3KN3 A;  3O28 A;  3CVG A;  4LAT A;  2IA4 A;  2H4I A;  2PT2 A;  2QJE A;  2XXH A;  4IO6 A;  4M4G A;  1WDN A;  3IO6 A;  3CR9 A;  4PFY A;  3VLW A;  2F7B A;  3N6T A;  1DTZ A;  4EQB A;  2UVG A;  3BFU A;  3PUY E;  1SI0 A;  2V25 A;  4QHQ A;  5I2N A;  3HO7 A;  4KCD A;  1FQE A;  5I58 B;  5L9O A;  1DOT A;  1JVX A;  4TQU Q;  4IO4 A;  4U4S A;  5BWJ A;  2OCU A;  1OQH A;  3HHG A;  2UVH A;  1N04 A;  1QW0 A;  2UXA A;  3C34 A;  3GLB A;  3W9W A;  4I1D A;  4KI0 E;  2I3V A;  3UIF A;  4XKN A;  3S9N C;  3T22 A;  4G2Z A;  4BLA A;  3CI8 A;  4RPO A;  3M3L A;  5KCJ A;  4ZED A;  1P1Q A;  4QFN A;  2XXP A;  1B7Z A;  1FTL A;  1QUL A;  2ZXT A;  3FVK A;  3H3G A;  3QK6 A;  2RC7 A;  4GL0 A;  3HN0 A;  4GWO A;  4JXI A;  4LVQ A;  2DE2 A;  5CRY A;  5TP9 A;  5BUU A;  2H9B A;  1URS A;  1P1W A;  2VGQ A;  3AXF A;  1SI1 A;  4MFI A;  1HSJ A;  3RQT A;  1S7Y A;  4NF4 B;  5JTY B;  1JEV A;  2R6G E;  5DYH A;  3K2D A;  2XD3 A;  4ZZE A;  4OEU A;  4DIG A;  1LAG E;  3MVX A;  3PPR A;  2NVU B;  3PU5 A;  3G3K A;  4UAC A;  5M2V A;  1MH3 A;  4KCC A;  4TLM B;  4POW A;  4BDN A;  4ELR A;  1UIV A;  3PD9 A;  2M8C A;  3IOT A;  1XVY A;  1IQ7 A;  3MJN A;  1LB8 A;  1YAE A;  4IO7 A;  3E13 X;  4NF5 A;  1B58 A;  1CB6 A;  3EPE A;  5IAI A;  1B52 A;  1B5H A;  4LP2 B;  5DVJ A;  3SER A;  1EZP A;  1H45 A;  3FXQ A;  3MZ1 A;  3H6W A;  4N6P A;  1LCF A;  3SEX A;  4H0W A;  4X9T A;  4IY5 A;  2FNC A;  4GL8 A;  3IAZ A;  4QFL A;  4F1U A;  4PP0 A;  4R6H A;  1FTM A;  2D21 A;  1B3E A;  2ZYK A;  1RYO A;  3DP6 A;  3S2V A;  3IR1 A;  5HPQ A;  4OWD A;  2HFB A;  3PUV E;  1ZBM A;  3GBA A;  4X1B A;  5I2K B;  1LB9 A;  3MAM A;  2V3Q A;  2A5S A;  3ONM A;  1FTK A;  2HEU A;  4HTG A;  1MQH A;  1PBP A;  1EU8 A;  4OET A;  1EZO A;  4Z7E A;  1FQC A;  3MWB A;  1RYX A;  2ZNT A;  2GHA A;  3VFJ A;  1B40 A;  2NUV A;  3S9M C;  1TWY A;  1N7W A;  3GBB A;  5F1Q A;  2VHA A;  3IO4 A;  5FHN A;  3VDF A;  1H43 A;  1B0H A;  1P1O A;  3MC2 A;  3H4Z A;  2ONR A;  3IOW A;  4YKI A;  1YCJ A;  3S4U A;  3UGW A;  4EQ7 A;  1MM7 A;  1PB8 A;  2HAV A;  1BTJ A;  2I58 A;  2O51 A;  4I8C A;  4FEB A;  1Z7M E;  1AOV A;  3OD7 A;  3IX1 A;  3RNN A;  5AA2 A;  3KGC A;  4R6Y A;  5AE4 A;  5TU0 A; 
#chains in the Genus database with same CATH topology
 5TPA B;  3FZV A;  5K2Y A;  5J16 A;  4HE0 A;  4RXL A;  1TXF A;  1VSO A;  5FTI A;  4O3A A;  3A3U A;  1P1U A;  4N6D A;  4PFI A;  4ZEK A;  3RY3 A;  4H45 A;  1SPI A;  4FOR A;  2V84 A;  3A29 A;  1D3K A;  3E9X A;  1VDW A;  5H8Q A;  2H5Y A;  3MQ9 A;  3HPI A;  1Q1K A;  5F24 A;  5KCJ B;  4Q0C A;  2JJK A;  4PDD A;  2B4M A;  4KQP A;  5T3J A;  3PPQ A;  2R8T A;  2B4L A;  4GWW A;  3C9H A;  4GVO A;  2DE3 A;  3G3J A;  1II5 A;  1MH4 A;  2DOJ A;  3PGF A;  4C0R A;  3SKP A;  4G8M A;  2DE4 A;  2RCB A;  1FPG A;  1LAH E;  2ZNU A;  1QUI A;  1SYH A;  2G29 A;  1EH3 A;  2F3B A;  2YLN A;  1B5I A;  3E4R A;  2VP1 A;  2WYP A;  3V83 A;  2ONK E;  3PTY A;  3T0J A;  2PFZ A;  4H46 A;  2PBW A;  1B7U A;  1LGB C;  2XXT A;  3CSG A;  3IJO B;  4PE3 A;  4RPN A;  2ZZW A;  3LSX A;  4P11 A;  4RK2 A;  1MXY A;  4EQ9 A;  4N8G A;  3K0V A;  4GOT A;  4U21 A;  3CFZ A;  1US4 A;  4NQ8 A;  1EYK A;  3O9P A;  1FSA A;  3TKD A;  3ROJ A;  2I49 A;  1ZMG A;  4OQO A;  3R26 A;  2QPQ A;  2XXX A;  4H8I A;  3CRB A;  1JW4 A;  1DMB A;  4MIJ A;  4OXV A;  1B1H A;  2RIN A;  2UYE A;  2AIX A;  2XXQ A;  2D3I A;  3RUM A;  1XC1 A;  5TPA A;  1LAX A;  4GX6 A;  5CM6 A;  3PV0 E;  4XKR A;  2RCA A;  2NXO A;  4C1T A;  3TEP A;  1NV6 A;  1LAF E;  2P0S A;  1A55 A;  3FXB A;  1JVY A;  3B6W A;  4YKK A;  4NF6 A;  2DWH A;  4F3B A;  1B3F A;  1MY0 A;  2VOZ A;  3EKI A;  2ZYN A;  2XA5 A;  5H8Q B;  4ONY A;  3TTR A;  1AH5 A;  1PC3 A;  4I3E A;  3BIH A;  4OES A;  2XWI A;  2NWJ A;  4GFR A;  3D4G A;  5H8N A;  5F7V A;  4TOZ A;  3PMX A;  1M5C A;  1LBZ A;  4P47 A;  1FQF A;  4H8J A;  1FBP A;  4G4P A;  4XF5 A;  2Y7P A;  1SDX A;  4G61 A;  4OVQ A;  2B3B A;  3VLV A;  2PFY A;  3GZG A;  5EYG A;  3O97 A;  2Q9T A;  3H7M A;  4U22 A;  2PMS A;  4I9D A;  5I57 B;  3RPL B;  3SET A;  4HCW A;  1VR5 A;  1YZ0 A;  3KOT A;  1Y20 A;  3RTW B;  2WBB A;  4ELP A;  4G68 A;  3QUJ A;  2W7Y A;  1URG A;  2FIX A;  5A5L A;  2I4C A;  1UQW A;  3BKI B;  1G0H A;  2ONS A;  1MM6 A;  3MVW A;  4MX6 A;  1LBY A;  3U92 A;  1B32 A;  3SDF A;  2CEY A;  5DEX B;  4C1U A;  3OO6 A;  4DLD A;  5AA4 A;  3FBP A;  1NL5 A;  1KA1 A;  3F11 A;  1JEU A;  5K2X A;  2KLF A;  2X7P A;  2Z23 A;  4BDQ A;  3T93 B;  4OFL A;  1OLC A;  5JTY A;  4PBH A;  3VXB A;  4OER A;  1Q9D A;  1ZTY A;  1ZJL A;  3W15 C;  3BFT A;  4R2B A;  5IM2 A;  3LV0 A;  2ABH A;  1QKA A;  2Y5L A;  4Q30 B;  3DP8 A;  4O94 A;  5AA1 A;  1JET A;  4O7M A;  3OOA A;  4F19 A;  4I62 A;  5CMK A;  3TDJ A;  1NFT A;  3D1R A;  2P1S A;  1F9B A;  3U94 A;  1DTG A;  2DWJ A;  4PFR A;  3KJT A;  5FHM A;  3IB2 A;  4NED A;  3FIR A;  5CI5 A;  1P1N A;  4L17 A;  1MXW A;  2HXR A;  1H3D A;  3DLN A;  3M8U A;  4QFP A;  4EUO A;  1BIY A;  3B50 A;  1WVJ A;  4LZ5 A;  4N8Y A;  4N91 A;  1LBX A;  5FTH A;  5EHM A;  2QS4 A;  2ZMB A;  2DVZ A;  4NX1 A;  4KYE A;  3KJ7 A;  3LC8 A;  1D9V A;  4U4X A;  4P3L A;  4ZE8 A;  3T1B A;  2DWI A;  1OVT A;  3K1M A;  3EHS A;  1Y4C A;  4M1V A;  3HHF A;  3RT8 A;  2Q88 A;  5IKB A;  4AB6 A;  2KR0 A;  4MH5 A;  2QVU A;  2FIE A;  2O84 X;  4GD5 A;  2O68 A;  4N13 A;  4O7I A;  1OVB A;  1S9T A;  3K6X A;  4R73 A;  4JVC A;  3SZP A;  1BK4 A;  1MXZ A;  4NMY A;  3VVD A;  3OO9 A;  3OO8 A;  2CEX A;  3FAT A;  4JBZ A;  2CZL A;  5DVI A;  4NAP A;  5I57 A;  2P3V A;  2Y84 A;  4WED A;  3KN3 A;  3O28 A;  3CVG A;  3IO6 A;  3N6T A;  4EQB A;  2V25 A;  4QHQ A;  1OQH A;  3HHG A;  3C34 A;  2MKZ A;  2I3V A;  3S9N C;  4G2Z A;  4RPO A;  1K9Z A;  5I3S A;  4QRZ A;  3QK6 A;  1B7Z A;  4LVQ A;  2DE2 A;  4GBV A;  1P1W A;  1HSJ A;  4GWS A;  3RQT A;  4O8M A;  5JTY B;  3G3K A;  2ZZV A;  4ELR A;  3PD9 A;  3IOT A;  3MJN A;  1YAE A;  4IO7 A;  2DDK A;  1CB6 A;  3EPE A;  1B5H A;  4LP2 B;  3FXQ A;  4N6P A;  3SEX A;  4NGU A;  4GL8 A;  4JVI A;  3DP6 A;  1RYO A;  4OVT A;  3S2V A;  5HPQ A;  3GBA A;  1LB9 A;  2V3Q A;  4HTG A;  2HEU A;  1EZO A;  1MQH A;  1DBZ A;  3MWB A;  1RYX A;  1B40 A;  4MJO A;  5FHN A;  1B0H A;  2Q74 A;  4EQ7 A;  4YKI A;  1AOV A;  2QFL A;  4R6Y A;  3MPK A;  5AA3 A;  3MW0 A;  2HCA A;  4PCD A;  3VXC A;  1ANF A;  4F29 A;  5ICT A;  1EYI A;  3C32 A;  3LUZ A;  3V89 B;  3UK4 A;  1MY4 A;  1SVX B;  1NV4 A;  5I2N B;  4R9G A;  4DE8 A;  1FCK A;  1D4N A;  1IMA A;  3TQL A;  4X04 A;  1B46 A;  2THI A;  3KEI A;  1MDP 1;  4ND9 A;  3Q29 A;  4OFO A;  1MDQ A;  4F3P A;  5IZ1 A;  5L9M A;  5EYH A;  1NH7 A;  2OK2 A;  4MNC A;  3Q26 A;  4G8H A;  1QUK A;  3TPA A;  2HHM A;  3T96 B;  3TYH A;  1LFI A;  1D9Y A;  1LBB A;  3MST A;  1XVX A;  4Z0I A;  1PB7 A;  1GR2 A;  5KDT A;  4U1Z A;  5H8F B;  5AA2 D;  3LSF B;  1Z7N E;  3O66 A;  5I59 B;  3MYU A;  1D9Q A;  2REG A;  2QS1 A;  3KSX A;  1ZIU A;  3PPP A;  3IK6 B;  1URD A;  3FD3 A;  4AB5 A;  3PPN A;  2XXR A;  1H76 A;  3E78 A;  5A5X A;  3O6I A;  1IXC A;  4YAH X;  1JW5 A;  4F2O A;  5LTC A;  2DQV A;  3UA8 A;  3RTF B;  4LN5 A;  4LUB A;  2O6A A;  2F36 A;  2Y7W A;  3UOR A;  3IB1 A;  2PT1 A;  4GBW A;  2R71 A;  2HXW A;  4EXK A;  3MP1 A;  4NF0 A;  1YXI A;  3TCG A;  3O6G A;  4JSO A;  1ZU0 A;  2P2A A;  1B5J A;  1MQG A;  1TT1 A;  1O7T A;  4F1V A;  4GXA A;  4UAB A;  1LFG A;  3FUZ A;  4JSD A;  3O2A A;  1B0L A;  1Y9U A;  3EQ1 A;  3TTK A;  1NV1 A;  3CSB A;  1LLS A;  1FPD A;  3TTM A;  4IO3 A;  3T9V A;  2QVV A;  3QIM A;  4O3C A;  2HPG A;  2F6P A;  1I6A A;  4OEN A;  3C4M A;  1XT8 A;  1JW1 A;  3FJG A;  4N07 A;  3QUF A;  4RNS A;  2G93 A;  1NNP A;  1NNT A;  2HQ0 A;  2VPO A;  1QVS A;  2PVU A;  4BDM A;  4IY6 A;  2KQZ A;  1LEV A;  2QS2 A;  3FXU A;  2ZYO A;  2H98 A;  1N7X A;  3FJM A;  4ZEC A;  2X26 A;  3OMB A;  1OLA A;  3VE1 B;  5CMM A;  4ECF A;  5FBP A;  4YU0 A;  3OEM A;  4F39 A;  3S9E A;  2O7U A;  4IO5 A;  1EYJ A;  2O1L A;  5KDT B;  3E3K A;  3KZG A;  1SW4 A;  1NV7 A;  1NNK A;  2WBD A;  3R6U A;  2B3F A;  2OBG A;  3IFC A;  2AYS A;  3IL1 B;  2VD3 A;  1I6B A;  1YTV A;  1MY1 A;  3TTN A;  3K4U A;  3MP8 A;  1DPE A;  4F31 B;  4QF9 A;  3B6T A;  3RYD A;  5CBR A;  1EZ9 A;  4YKJ A;  4F22 A;  1FPE A;  1FPF A;  1N84 A;  4U1O A;  2PCR A;  2OLB A;  1SYI A;  4WKM A;  4JWX A;  4FEC A;  5J1D A;  1FPI A;  4JDF A;  2XX8 A;  1LCT A;  4HW8 A;  3VVF A;  3TQW A;  1MRP A;  4BDR A;  1MY2 A;  1T0K A;  4NF6 B;  1IUD A;  5I58 A;  3EF7 A;  3SES A;  1B4Z A;  1FQB A;  2XX9 A;  2FA7 A;  4F3G A;  4NN3 A;  3MVZ A;  3T66 A;  1MQD A;  1A7L A;  4KHZ E;  5H8N B;  1H44 A;  2Y7I A;  3OSQ A;  4R6K A;  4X1D A;  1QUJ A;  1FBC A;  2F5X A;  5IZZ A;  3N94 A;  2Q8J A;  3FVO A;  1MXX A;  4U23 A;  3FGS A;  5B7D A;  1FTO A;  4EF2 A;  1KA0 A;  1B3L A;  3RPL A;  5CBS A;  4PAK A;  4GWX A;  3CIJ A;  2Q8M A;  5I2K A;  4G77 A;  1IZ1 A;  3I3V A;  1B1X A;  5H8S A;  1B3H A;  1RDX A;  4PGP A;  3S9L C;  3LBS A;  1MXV A;  3IJX B;  1A40 A;  4R2F A;  4GWZ A;  1MQI A;  2OWS A;  4OVJ A;  3PUW E;  3L6G A;  4LZ8 A;  2XXW A;  4N4U A;  5DEX A;  4KR5 A;  2PYY A;  1SW2 A;  4GXS B;  3ISP A;  1HSE A;  1CE2 A;  4XIG Q;  4PGN A;  1NUX A;  3HV1 A;  2XHD A;  2QSX A;  5ITP A;  1R9L A;  4GF8 A;  2RC9 A;  1P99 A;  5IZ3 B;  3MZ9 A;  3VLU A;  2Z8D A;  3I6V A;  1NI9 A;  4LAT A;  2PT2 A;  4PFY A;  3PUY E;  3HO7 A;  5L9O A;  4TQU Q;  2OCU A;  2UVH A;  2UXA A;  3W9W A;  4I1D A;  4XKN A;  3CI8 A;  4ZED A;  2ZXT A;  1INP A;  4GL0 A;  4XKQ A;  1NV0 A;  3H3G A;  4JXI A;  3HN0 A;  2H9B A;  2OWZ A;  3AXF A;  4OVR A;  1S7Y A;  4NF4 B;  1JEV A;  2R6G E;  4ZZE A;  3PPR A;  5EQ7 A;  4KCC A;  4TLM B;  4BDN A;  1UIV A;  2M8C A;  1XVY A;  3E13 X;  1EZP A;  3SER A;  1H45 A;  4H0W A;  2FNC A;  4QFL A;  4PP0 A;  4R6H A;  2D21 A;  1NUZ A;  4OWD A;  3PUV E;  4X1B A;  3MAM A;  3ONM A;  4E0X A;  4OET A;  1EU8 A;  2BJI A;  4Z7E A;  2ZNT A;  1TWY A;  3IO4 A;  3VDF A;  1H43 A;  3MC2 A;  3H4Z A;  2ONR A;  3S4U A;  3UGW A;  1YCJ A;  1MM7 A;  2O51 A;  4I8C A;  3OD7 A;  4GWU A;  5AE4 A;  5TU0 A;  2UVJ A;  3K6U A;  5B70 A;  1PBQ A;  5I56 B;  2I4B A;  3PUX E;  3JV9 A;  3B7D A;  3ILT B;  4MHF A;  5L9S A;  4RA1 A;  3GYY A;  3LSW A;  1GTK A;  3IFA A;  4GX3 A;  4PFB A;  1ELJ A;  3VVE A;  3CG1 A;  4H67 A;  1KWH A;  4KD5 A;  4HE2 A;  4GIZ A;  3IB0 A;  1US5 A;  2A5T A;  3VV5 A;  1XHY A;  3TCH A;  2GFE A;  4IGR A;  4JVD A;  1QGX A;  1M5D A;  5ELV A;  4N17 A;  4YB6 A;  1FBD A;  4FIM A;  2HAU A;  3MZB A;  4R75 A;  4FJP A;  3THI A;  3C36 A;  1ZKB A;  4QFK A;  2XXK A;  2I0B A;  3EHT A;  2ALU A;  4LQ5 A;  4DZ1 A;  1ZLQ A;  3N5L A;  4KPT A;  1QKB A;  2YJP A;  3N26 A;  2YPN A;  3FAS A;  1QJM A;  2AL5 A;  4DI4 B;  1HSL A;  4IR8 A;  3T9X B;  1XOC A;  3DEL B;  1OMP A;  1IMD A;  2WX9 A;  3ILU B;  3SEV A;  1UIU A;  1MS7 A;  4PFT A;  4FBP A;  3TCF A;  1IXH A;  5ET7 A;  2D5W A;  3EHU A;  4YMA A;  4MCO A;  5ET5 A;  3N6U A;  1PDA A;  2DXR A;  3MP6 A;  3DP4 A;  3H6U A;  4F3S A;  3EN3 A;  3R7X A;  4BDL A;  2H99 A;  1G0I A;  1A54 A;  4QSC A;  1FBG A;  2O7I A;  3OEK A;  5EHS A;  2I3W A;  1Y1Z A;  1MQJ A;  4NE4 A;  2B65 A;  4KFQ A;  1NV3 A;  3H06 B;  4ZE9 A;  2QMW A;  1AL3 A;  3KN8 A;  2XWV A;  1VFE A;  2I6E A;  2NOO A;  4ZDM A;  2Q2C A;  5DTB A;  1LBV A;  1NH8 A;  5ICQ A;  1O64 A;  4PFW A;  3HST A;  3TEL A;  1ATG A;  1RDY A;  3ZS6 A;  3TAJ A;  2DYX A;  1N3X A;  1NNF A;  3QSL A;  5CMB A;  1TFD A;  2GQ1 A;  2P3N A;  4K3F A;  3K6V A;  5CMC A;  3FV2 A;  4HXV A;  3K1N A;  2QL3 A;  1DCU A;  1FPJ A;  2CMO A;  3QAX A;  1NV2 A;  3IOV A;  4WEP A;  1R9Q A;  1Y3Q A;  4NWC A;  1NKX A;  2I48 A;  4PC9 A;  2FBP A;  1IIT A;  1LST A;  3KG2 A;  4H1X A;  2A5T B;  4Q5T A;  2LAO A;  1FPB A;  5H8F A;  4JB7 A;  5IGA A;  4XKP A;  4RJZ A;  3UP9 A;  2OX3 A;  3RPW A;  5HBC A;  4G8N A;  1MPC A;  3TUS A;  4I3Y A;  4FAT A;  5EQ8 A;  3OO7 A;  1DPP A;  4RYA A;  1SW1 A;  5EQ9 A;  4PET A;  4IO2 A;  3PMW A;  5H8H A;  1PB9 A;  3A3C A;  3RN8 A;  2GH9 A;  2R9J A;  2OJT A;  4YKP A;  1B2H A;  2O69 A;  1B05 A;  2UVI A;  2Y5K A;  3HCQ A;  4OEV A;  3G3H A;  2XX7 A;  3MUQ A;  2V93 A;  3MPL A;  1POT A;  1FQA A;  1NUY A;  2QVR A;  1SW5 A;  3QMF A;  3JZJ A;  1R1N A;  4TLL B;  4I40 A;  4X8R A;  1N0T A;  4DXU A;  3CFX A;  4R72 A;  5I56 A;  4P0I A;  3U93 A;  4FAJ A;  3U1O A;  4IGT A;  1A99 A;  3IOU A;  1PEB A;  2WEF A;  4ELQ A;  2ZNS A;  3CG3 A;  1RKM A;  4F18 A;  3WAF A;  3KBZ A;  5TP9 B;  3K01 A;  1OIB A;  1O63 A;  1SBP A;  2Z8E A;  1AIV A;  3USD A;  2F7C A;  2F8D A;  5ET8 A;  3PMV A;  3G7W A;  1K9Y A;  4ZEB A;  2RC8 A;  2PX1 A;  2IEE A;  5AA4 B;  3FV1 A;  4XTC Q;  3BIG A;  4OVS A;  4X48 A;  3TFL A;  4H6D A;  1AMF A;  1I69 A;  4FE8 A;  1Y4T A;  4LA9 A;  4O3B A;  3ODB A;  2Y7K A;  3LR1 A;  1IIW A;  4PFU A;  4ESW A;  1MXU A;  4OYV A;  2XD2 A;  4ESX A;  5AA2 B;  4G68 C;  4PTK A;  4OFJ A;  3PPO A;  4DXB A;  2DXY A;  5JEI A;  2GRV A;  3V5A A;  3IOR A;  1CNQ A;  3PUZ E;  1A8E A;  4PBQ A;  4KXP A;  3RGY A;  1VE4 A;  3ZKL A;  3ZKK A;  3H03 A;  4DXC A;  1JNF A;  5L8D A;  2L5V A;  3U8Q A;  1B7H A;  4P1E A;  2H4I A;  2QJE A;  4M4G A;  2CZH A;  3VLW A;  1DTZ A;  3BFU A;  3KC0 A;  4KCD A;  5I58 B;  1DOT A;  4U4S A;  4IO4 A;  1N04 A;  1QW0 A;  3GLB A;  1FRP A;  3T22 A;  4BLA A;  3M3L A;  5KCJ A;  1P1Q A;  4QFN A;  1FTL A;  4GWO A;  2V4C A;  5BUU A;  1URS A;  4MFI A;  5DYH A;  3K2D A;  2XD3 A;  4OEU A;  4QBA A;  4NG7 A;  4MAG A;  4UAC A;  5M2V A;  1FPL A;  4POW A;  1IQ7 A;  2VPN A;  1LB8 A;  1B58 A;  5IAI A;  5DVJ A;  3MZ1 A;  1LCF A;  4F1U A;  1FTM A;  1B3E A;  2ZYK A;  3IR1 A;  2HFB A;  5I2K B;  2A5S A;  1FQC A;  2GHA A;  2NUV A;  3S9M C;  1P1O A;  5LDZ A;  2HAV A;  2I58 A;  4FEB A;  3IX1 A;  3RNN A;  1JP4 A;  4PF8 A;  3KGC A;  4R9F A;  2UYF A;  1FTA A;  3SEU A;  1YYZ A;  4MEV A;  4LQ2 A;  2AL4 A;  2F78 A;  5IZ3 A;  1IEJ A;  1R6Z A;  4N81 A;  4THI A;  1IXG A;  2XWK A;  3WAE A;  4IB2 A;  5I84 A;  4PAF A;  3T9U A;  2I0C A;  5I59 A;  4NTL A;  1MY3 A;  3DM0 A;  3PD8 A;  1UTH A;  3K00 A;  1LBC A;  3KC1 A;  2XXY A;  5H8H B;  3L6H A;  4PQJ A;  1M5E A;  4MLV A;  4DDD A;  4HCY A;  3D4C A;  1M5B A;  4YB5 A;  4MF3 A;  5A5X B;  3SEY A;  1IMB A;  3FJ7 A;  2DP8 A;  3G3F A;  4GLI A;  3K02 A;  3B8B A;  4HE1 A;  2DS9 A;  5HM4 B;  4LZ7 A;  1B4H A;  4NF8 B;  3FXR A;  3KN7 A;  1FBH A;  1A8F A;  1FQD A;  4P56 A;  3JYR A;  1BLF A;  4H65 A;  3K6W A;  1MG1 A;  3C31 A;  4H5F A;  2GHB A;  1FBF A;  1B6H A;  1UTB B;  5CC2 A;  2FVZ A;  4ZEF A;  2XWO A;  2V3U A;  3Q25 A;  4GRK A;  1Y3N A;  4JWY A;  5EYF A;  2DWA A;  1L5T A;  5I7I A;  2ESN A;  3Q28 A;  5FHO A;  4DCX A;  4GQO A;  2FYI A;  3Q27 A;  3T9H B;  3OEN A;  5DW8 A;  4F1Y A;  1NUW A;  3U65 A;  4GWY A;  3H6V A;  2OWT A;  2XXU A;  4DCY A;  4G68 B;  4N6K A;  3LUY A;  3RT6 B;  4RK9 A;  1TFA A;  3G3G A;  4EDP A;  4QSD A;  2OZZ A;  4XXU A;  5DT6 A;  4BDO A;  2Y7R A;  2F97 A;  3I5O A;  1FPK A;  4AQ4 A;  1DSN A;  2QRY A;  1N76 A;  4MNI A;  4NF5 B;  1OQG A;  4PE5 B;  1RDZ A;  3TOD A;  4QFO A;  1I6Q A;  4YMB A;  5JK4 A;  2WKY A;  2XXI A;  4OTE A;  5LOM A;  3GXA A;  4ZS9 A;  4OHN A;  3BBR A;  4PF6 A;  5I5P A;  2E0S A;  4YB7 A;  1DK4 A;  4N15 A;  2HZK A;  5DVF A;  4LON B;  1NV5 A;  1UTH B;  4H5G A;  1SQY A;  4MLQ A;  4POX A;  1POY 1;  4F2Q A;  4ISU A;  3E79 A;  3ECR A;  4R74 A;  3G3I A;  1GV8 A;  2WYK A;  3RLF E;  2CZK A;  1FW0 A;  4ZZA A;  1S50 A;  1BP5 A;  3TTL A;  4KYS A;  2F7A A;  4AS4 A;  1GGG A;  3HFU A;  3M3K A;  1M5F A;  2H25 A;  1GVC A;  4NF8 A;  4PAI A;  2ANJ A;  4QSE A;  4EXL A;  2F6G A;  3ZSF A;  1LBW A;  1Q35 A;  5KZT A;  2O1M A;  2F34 A;  3H6T A;  3O29 A;  4WXJ A;  4JWO A;  2DVC A;  1AWB A;  1IXI A;  1USY H;  3B6Q A;  3OEL A;  3TZA A;  2RKM A;  3KFM A;  4U2R A;  4MBP A;  1N3W A;  3KSJ A;  4HS7 A;  3KOS A;  2HZL A;  2Z8F A;  1Y1M A;  1B9J A;  4KYD A;  3K1P A;  3W9V A;  1FTJ A;  3CFL A;  2XXV A;  3MBP A;  3O6H A;  5BWJ A;  4YZZ A;  2V3T A;  2Z22 A;  2ZZX A;  3QXM A;  1B3G A;  1BKA A;  4P8B A;  2QS3 A;  1SD3 A;  1XS5 A;  1B51 A;  1MPB A;  4ZEI A;  3V8X B;  3FVG A;  4FED A;  2QMX A;  2F35 A;  1WOD A;  1FBE A;  4RY1 A;  1J1N A;  1FJ6 A;  4XEQ A;  3MVY A;  2ZYM A;  4E0W A;  3KBR A;  3U72 A;  5ESY A;  1MPD A;  1Y3P A;  4AS5 A;  2REJ A;  4UA8 A;  2VD2 A;  4OZ9 A;  3C35 A;  4ELO A;  1IMC A;  4P1L A;  3QYT A;  1LFH A;  3UN6 A;  1VFD A;  3SEW A;  4OMB A;  2E1S A;  4DI3 D;  2Q89 A;  3M3F A;  3NOH A;  2RF1 A;  3LSL A;  3A09 A;  4QXD A;  5ISU A;  2CZI A;  1JQF A;  2Q2A A;  4NWD A;  4OAN A;  3P7I A;  3OSR A;  3TMG A;  3FVN A;  4NF4 A;  2DSF A;  1UTB A;  2BJJ X;  4MNP A;  1YPN A;  3C33 A;  3OXN A;  1USY E;  5ITO A;  4EF1 A;  4Q8R A;  2X7Q A;  4YIC A;  5EQA A;  4P0G A;  1NMU A;  2IA4 A;  2XXH A;  4IO6 A;  1WDN A;  3CR9 A;  2F7B A;  2UVG A;  1IMF A;  1SI0 A;  5I2N A;  1FQE A;  1JVX A;  1KZ8 A;  4KI0 E;  3UIF A;  3CHG A;  4NHB A;  2XXP A;  4XFE A;  3FVK A;  1QUL A;  2RC7 A;  5CRY A;  5TP9 A;  2F3D A;  2VGQ A;  1SI1 A;  2FHY A;  4DIG A;  1LAG E;  3MVX A;  2NVU B;  3PU5 A;  4GX4 A;  1MH3 A;  4P9K A;  1IME A;  4NF5 A;  5ET6 A;  1FJ9 A;  1B52 A;  4MMP A;  3H6W A;  4X9T A;  4IY5 A;  3IAZ A;  1XI6 A;  1ZBM A;  1FTK A;  1PBP A;  3VFJ A;  1N7W A;  3GBB A;  5F1Q A;  2VHA A;  4PDH A;  4OA4 A;  4OVP A;  3IOW A;  2VT5 A;  1PB8 A;  1BTJ A;  1Z7M E;  5AA2 A; 
#chains in the Genus database with same CATH homology
 4R9F A;  3MPK A;  5TPA B;  2UVJ A;  3FZV A;  3K6U A;  5AA3 A;  5B70 A;  3MW0 A;  2HCA A;  5K2Y A;  2UYF A;  3SEU A;  4RXL A;  3VXC A;  4LQ2 A;  1ANF A;  1PBQ A;  1TXF A;  5I56 B;  2AL4 A;  2I4B A;  3PUX E;  2F78 A;  1VSO A;  4F29 A;  3JV9 A;  5ICT A;  3B7D A;  3ILT B;  3C32 A;  1IEJ A;  5FTI A;  4BDQ A;  5L9S A;  1R6Z A;  4RA1 A;  4O3A A;  4THI A;  3A3U A;  1P1U A;  1IXG A;  3LSW A;  1GTK A;  4ZEK A;  3RY3 A;  3WAE A;  4IB2 A;  3V89 B;  4FOR A;  5I84 A;  3T9U A;  1ELJ A;  3UK4 A;  2I0C A;  5I59 A;  1MY4 A;  3VVE A;  3CG1 A;  1SVX B;  2V84 A;  4NTL A;  5I2N B;  1MY3 A;  4H67 A;  1KWH A;  3DM0 A;  1D3K A;  3E9X A;  1UTH A;  3PD8 A;  4KD5 A;  1FCK A;  4GIZ A;  4R9G A;  4DE8 A;  1D4N A;  3K00 A;  1LBC A;  2H5Y A;  5H8Q A;  2XXY A;  3MQ9 A;  5H8H B;  3HPI A;  1B46 A;  2THI A;  3TQL A;  3L6H A;  3IB0 A;  3KEI A;  1MDP 1;  1US5 A;  4PQJ A;  1M5E A;  2A5T A;  4MLV A;  4DDD A;  4HCY A;  1Q1K A;  4ND9 A;  3D4C A;  3VV5 A;  1XHY A;  5KCJ B;  3TCH A;  1M5B A;  4YB5 A;  2GFE A;  3Q29 A;  4OFO A;  4Q0C A;  1MDQ A;  4IGR A;  4MF3 A;  4F3P A;  5A5X B;  1M5D A;  5L9M A;  5ELV A;  4YB6 A;  4KQP A;  4FIM A;  3SEY A;  2HAU A;  3MZB A;  4R75 A;  4FJP A;  3PPQ A;  3FJ7 A;  1NH7 A;  3THI A;  2DP8 A;  2OK2 A;  3C36 A;  3G3F A;  4GLI A;  1ZKB A;  3K02 A;  2DS9 A;  3C9H A;  4GVO A;  5HM4 B;  2DE3 A;  4QFK A;  4LZ7 A;  1B4H A;  3G3J A;  4NF8 B;  1II5 A;  3FXR A;  3KN7 A;  3Q26 A;  1A8F A;  4G8H A;  1FQD A;  1MH4 A;  2I0B A;  1QUK A;  2DOJ A;  3TPA A;  3EHT A;  2ALU A;  1BLF A;  3JYR A;  3PGF A;  4LQ5 A;  4H65 A;  4C0R A;  3K6W A;  3SKP A;  1MG1 A;  1ZLQ A;  3C31 A;  4DZ1 A;  4H5F A;  3T96 B;  3N5L A;  4G8M A;  4KPT A;  2GHB A;  3TYH A;  1LFI A;  1QKB A;  2YJP A;  2DE4 A;  3N26 A;  2YPN A;  1D9Y A;  2RCB A;  1LBB A;  3FAS A;  1B6H A;  1QJM A;  1UTB B;  2AL5 A;  1XVX A;  5CC2 A;  1HSL A;  4Z0I A;  3T9X B;  4ZEF A;  1PB7 A;  1GR2 A;  1XOC A;  1LAH E;  5KDT A;  2ZNU A;  4U1Z A;  1QUI A;  1SYH A;  3DEL B;  5H8F B;  2V3U A;  1OMP A;  2G29 A;  3LSF B;  3Q25 A;  1Z7N E;  1EH3 A;  1Y3N A;  3O66 A;  4GRK A;  3ILU B;  4JWY A;  5EYF A;  3SEV A;  5I59 B;  1UIU A;  2YLN A;  1MS7 A;  4PFT A;  1B5I A;  2REG A;  3E4R A;  2QS1 A;  3TCF A;  1IXH A;  2VP1 A;  3KSX A;  2D5W A;  3EHU A;  1ZIU A;  2DWA A;  3IK6 B;  3PPP A;  4YMA A;  1URD A;  3N6U A;  3V83 A;  1PDA A;  1L5T A;  2DXR A;  2ONK E;  3MP6 A;  2ESN A;  3DP4 A;  3FD3 A;  3H6U A;  4AB5 A;  4F3S A;  3PPN A;  3Q28 A;  3EN3 A;  2XXR A;  1H76 A;  5A5X A;  3R7X A;  5FHO A;  4BDL A;  4DCX A;  4GQO A;  2PBW A;  3O6I A;  2FYI A;  3Q27 A;  3T9H B;  1B7U A;  1IXC A;  1LGB C;  2H99 A;  2XXT A;  3CSG A;  3IJO B;  1JW5 A;  4RPN A;  4YAH X;  3OEN A;  4F1Y A;  4F2O A;  1A54 A;  4QSC A;  3LSX A;  2O7I A;  4P11 A;  4RK2 A;  3OEK A;  5EHS A;  1MXY A;  3H6V A;  4EQ9 A;  2I3W A;  2DQV A;  1Y1Z A;  2OWT A;  1MQJ A;  3K0V A;  4NE4 A;  2XXU A;  2B65 A;  4GOT A;  4U21 A;  3UA8 A;  4KFQ A;  3CFZ A;  3RTF B;  4DCY A;  1US4 A;  4LUB A;  3H06 B;  2O6A A;  2F36 A;  2Y7W A;  3UOR A;  2QMW A;  3O9P A;  4ZE9 A;  3IB1 A;  2PT1 A;  1AL3 A;  4G68 B;  3KN8 A;  3LUY A;  2R71 A;  3TKD A;  1VFE A;  2HXW A;  2I6E A;  2I49 A;  2NOO A;  1ZMG A;  3RT6 B;  4OQO A;  4RK9 A;  4EXK A;  1TFA A;  2QPQ A;  3R26 A;  4ZDM A;  2XXX A;  4H8I A;  3G3G A;  2Q2C A;  3MP1 A;  5DTB A;  3TCG A;  3O6G A;  4QSD A;  4EDP A;  2OZZ A;  3CRB A;  1NH8 A;  4JSO A;  5ICQ A;  1O64 A;  4PFW A;  1JW4 A;  1DMB A;  4OXV A;  3HST A;  3TEL A;  1B1H A;  1ZU0 A;  2RIN A;  2UYE A;  2AIX A;  4XXU A;  2P2A A;  2XXQ A;  1B5J A;  1MQG A;  2D3I A;  1TT1 A;  1O7T A;  5DT6 A;  1ATG A;  4GXA A;  2Y7R A;  2F97 A;  3RUM A;  1LFG A;  3FUZ A;  3ZS6 A;  3I5O A;  3O2A A;  4JSD A;  2DYX A;  3TAJ A;  1N3X A;  1XC1 A;  1B0L A;  5TPA A;  1Y9U A;  1NNF A;  3QSL A;  5CMB A;  4AQ4 A;  3EQ1 A;  1TFD A;  4K3F A;  1DSN A;  3TTK A;  1LAX A;  2QRY A;  1N76 A;  3CSB A;  4NF5 B;  1LLS A;  3K6V A;  5CMC A;  5CM6 A;  3PV0 E;  1OQG A;  4IO3 A;  3FV2 A;  4XKR A;  3TTM A;  4PE5 B;  3T9V A;  2RCA A;  3K1N A;  2QL3 A;  3TOD A;  2NXO A;  4QFO A;  1I6Q A;  3QIM A;  4O3C A;  4C1T A;  3TEP A;  4YMB A;  1LAF E;  2F6P A;  5JK4 A;  2WKY A;  2XXI A;  2CMO A;  3QAX A;  3GXA A;  4OTE A;  5LOM A;  4ZS9 A;  2P0S A;  3BBR A;  3IOV A;  4OHN A;  1A55 A;  1I6A A;  4OEN A;  1JVY A;  3B6W A;  4WEP A;  3C4M A;  4YKK A;  1R9Q A;  4NF6 A;  2E0S A;  2DWH A;  1XT8 A;  1JW1 A;  3FJG A;  1B3F A;  4YB7 A;  4F3B A;  1Y3Q A;  1MY0 A;  2HZK A;  2VOZ A;  4LON B;  5DVF A;  2ZYN A;  1UTH B;  4N07 A;  4NWC A;  1NKX A;  4H5G A;  5H8Q B;  4ONY A;  3QUF A;  4RNS A;  2I48 A;  3TTR A;  2G93 A;  1SQY A;  4MLQ A;  1IIT A;  1LST A;  1NNP A;  3KG2 A;  1NNT A;  4POX A;  4H1X A;  1POY 1;  1AH5 A;  1PC3 A;  2A5T B;  4ISU A;  2HQ0 A;  2LAO A;  4Q5T A;  4F2Q A;  5H8F A;  1QVS A;  2PVU A;  3ECR A;  3G3I A;  4R74 A;  4BDM A;  4OES A;  4IY6 A;  1GV8 A;  4JB7 A;  2QS2 A;  3RLF E;  2NWJ A;  4GFR A;  3D4G A;  3FXU A;  5H8N A;  4ZZA A;  1FW0 A;  1S50 A;  1BP5 A;  4XKP A;  3TTL A;  4KYS A;  5F7V A;  4TOZ A;  3PMX A;  2F7A A;  1M5C A;  4RJZ A;  1GGG A;  2ZYO A;  1FQF A;  3UP9 A;  4H8J A;  2H98 A;  1N7X A;  3FJM A;  3M3K A;  4ZEC A;  3RPW A;  4G4P A;  5HBC A;  1M5F A;  4G8N A;  2X26 A;  1MPC A;  2Y7P A;  3TUS A;  5AA2 D;  1SDX A;  2H25 A;  3OMB A;  4NF8 A;  1GVC A;  1OLA A;  4FAT A;  2B3B A;  3VE1 B;  3VLV A;  3GZG A;  2ANJ A;  5CMM A;  4QSE A;  4EXL A;  2F6G A;  4QRZ A;  3O97 A;  3ZSF A;  2Q9T A;  1Q35 A;  5KZT A;  3OO7 A;  1DPP A;  2O1M A;  4RYA A;  2F34 A;  3H6T A;  1SW1 A;  3O29 A;  4WXJ A;  4ECF A;  3H7M A;  4U22 A;  2PMS A;  4JWO A;  4PET A;  4I9D A;  4IO2 A;  5I57 B;  4YU0 A;  2DVC A;  3OEM A;  3PMW A;  4F39 A;  3SET A;  3S9E A;  5H8H A;  2O7U A;  1IXI A;  1USY H;  1VR5 A;  3B6Q A;  4HCW A;  3OEL A;  4IO5 A;  3KOT A;  3TZA A;  1Y20 A;  2O1L A;  3RTW B;  5KDT B;  2RKM A;  3KFM A;  1PB9 A;  4U2R A;  3A3C A;  3E3K A;  4MBP A;  1N3W A;  3KSJ A;  3KZG A;  4G68 A;  1SW4 A;  4HS7 A;  3KOS A;  3QUJ A;  4ELP A;  1NNK A;  2W7Y A;  3R6U A;  1URG A;  3RN8 A;  2HZL A;  2B3F A;  2OBG A;  2I4C A;  2AYS A;  2GH9 A;  1UQW A;  2R9J A;  2Z8F A;  2OJT A;  3IL1 B;  3BKI B;  2VD3 A;  1I6B A;  1Y1M A;  1B9J A;  1MM6 A;  1YTV A;  2ONS A;  1B2H A;  3MVW A;  4KYD A;  2O69 A;  4YKP A;  1MY1 A;  3TTN A;  3K1P A;  3U92 A;  3W9V A;  1B05 A;  1B32 A;  3K4U A;  3SDF A;  3MP8 A;  1DPE A;  5DEX B;  4C1U A;  1FTJ A;  4QF9 A;  3OO6 A;  4F31 B;  3B6T A;  5CBR A;  3CFL A;  2UVI A;  1EZ9 A;  2XXV A;  4YKJ A;  4DLD A;  4F22 A;  5AA4 A;  3MBP A;  1N84 A;  3O6H A;  3HCQ A;  4YZZ A;  1NL5 A;  2V3T A;  3F11 A;  3G3H A;  2Z22 A;  4OEV A;  1JEU A;  2KLF A;  2X7P A;  2XX7 A;  2Z23 A;  3MUQ A;  2V93 A;  3QXM A;  2OLB A;  4U1O A;  5K2X A;  3T93 B;  1SYI A;  4OFL A;  4BDO A;  3MPL A;  1B3G A;  1OLC A;  4WKM A;  5JTY A;  1POT A;  3VXB A;  4OER A;  4JWX A;  1BKA A;  1FQA A;  1ZTY A;  4FEC A;  1ZJL A;  2QS3 A;  3W15 C;  5J1D A;  1SD3 A;  1XS5 A;  1B51 A;  3BFT A;  1MPB A;  2XX8 A;  1LCT A;  4JDF A;  4R2B A;  4ZEI A;  4HW8 A;  3V8X B;  2ABH A;  3FVG A;  1SW5 A;  4FED A;  3VVF A;  2QMX A;  3TQW A;  1MRP A;  2F35 A;  1R1N A;  3JZJ A;  4BDR A;  4TLL B;  1QKA A;  1WOD A;  4RY1 A;  1N0T A;  1MY2 A;  1T0K A;  4Q30 B;  1J1N A;  3CFX A;  4NF6 B;  4R72 A;  4DXU A;  1IUD A;  3DP8 A;  5I56 A;  4P0I A;  5AA1 A;  3U93 A;  4FAJ A;  5I58 A;  1JET A;  3U1O A;  3EF7 A;  3MVY A;  4IGT A;  2ZYM A;  3OOA A;  3SES A;  4I62 A;  4F19 A;  1A99 A;  1B4Z A;  1FQB A;  4E0W A;  3IOU A;  5CMK A;  3KBR A;  1PEB A;  3TDJ A;  2XX9 A;  2FA7 A;  1NFT A;  3U72 A;  4ELQ A;  1MPD A;  1Y3P A;  2P1S A;  4F3G A;  2ZNS A;  2REJ A;  3CG3 A;  1RKM A;  4UA8 A;  2VD2 A;  1F9B A;  3MVZ A;  3U94 A;  3T66 A;  3WAF A;  1DTG A;  4F18 A;  5TP9 B;  1MQD A;  1A7L A;  2DWJ A;  1OIB A;  1O63 A;  1SBP A;  2Z8E A;  3K01 A;  3KJT A;  3C35 A;  4OZ9 A;  5FHM A;  3USD A;  3IB2 A;  4KHZ E;  2F7C A;  4ELO A;  1H44 A;  5H8N B;  2F8D A;  4NED A;  3FIR A;  5CI5 A;  3PMV A;  2Y7I A;  1P1N A;  3G7W A;  3OSQ A;  4L17 A;  3QYT A;  4R6K A;  4X1D A;  1QUJ A;  1LFH A;  3UN6 A;  2F5X A;  1MXW A;  4ZEB A;  2RC8 A;  1H3D A;  2PX1 A;  3DLN A;  1VFD A;  3M8U A;  4QFP A;  2IEE A;  3SEW A;  4EUO A;  1AIV A;  4OMB A;  5AA4 B;  1BIY A;  2E1S A;  3FV1 A;  1WVJ A;  2Q89 A;  3N94 A;  3M3F A;  4LZ5 A;  2Q8J A;  4XTC Q;  3FVO A;  1MXX A;  5FTH A;  4U23 A;  3FGS A;  5EHM A;  5B7D A;  1FTO A;  2RF1 A;  2QS4 A;  4X48 A;  2ZMB A;  3LSL A;  3TFL A;  3A09 A;  2DVZ A;  4H6D A;  5ISU A;  1AMF A;  4KYE A;  1I69 A;  3KJ7 A;  4EF2 A;  4FE8 A;  1Y4T A;  1B3L A;  1D9V A;  3LC8 A;  4LA9 A;  4U4X A;  5CBS A;  4E0X A;  4ZE8 A;  4O3B A;  2DWI A;  1JQF A;  2Q2A A;  1OVT A;  4NWD A;  3CIJ A;  3K1M A;  2Y7K A;  3EHS A;  1Y4C A;  3LR1 A;  3ODB A;  5I2K A;  4G77 A;  1IZ1 A;  4M1V A;  3P7I A;  3OSR A;  3I3V A;  1B1X A;  3HHF A;  2Q88 A;  3RT8 A;  5H8S A;  1IIW A;  1B3H A;  3TMG A;  4AB6 A;  5IKB A;  4MH5 A;  4PFU A;  4ESW A;  3FVN A;  4F1V A;  2O84 X;  4GD5 A;  2O68 A;  4N13 A;  3S9L C;  3LBS A;  4NF4 A;  1MXV A;  1UTB A;  1OVB A;  2DSF A;  1MXU A;  1S9T A;  2BJJ X;  3IJX B;  1A40 A;  3K6X A;  4OYV A;  4R73 A;  4R2F A;  4XKQ A;  1MQI A;  2OWS A;  2XD2 A;  4OVJ A;  4ESX A;  3PUW E;  3L6G A;  4LZ8 A;  2XXW A;  5DEX A;  1YPN A;  3C33 A;  5AA2 B;  4KR5 A;  4G68 C;  3OXN A;  1MXZ A;  4OFJ A;  3PPO A;  4NMY A;  2PYY A;  1SW2 A;  3OO9 A;  4GXS B;  1USY E;  3OO8 A;  3VVD A;  4DXB A;  1HSE A;  1CE2 A;  2DXY A;  3FAT A;  4JBZ A;  4XIG Q;  2CZL A;  5ITO A;  5JEI A;  3HV1 A;  2GRV A;  2XHD A;  3IOR A;  5DVI A;  3V5A A;  2QSX A;  3PUZ E;  1A8E A;  5ITP A;  3RGY A;  1R9L A;  1VE4 A;  3ZKL A;  4GF8 A;  2RC9 A;  4EF1 A;  1P99 A;  3ZKK A;  3H03 A;  4DXC A;  4Q8R A;  2X7Q A;  3MZ9 A;  4YIC A;  5I57 A;  1JNF A;  3VLU A;  5L8D A;  2Z8D A;  2Y84 A;  4WED A;  3U8Q A;  1B7H A;  3I6V A;  4P0G A;  1NMU A;  3KN3 A;  3O28 A;  3CVG A;  4LAT A;  2IA4 A;  2H4I A;  2PT2 A;  2QJE A;  2XXH A;  4IO6 A;  4M4G A;  1WDN A;  3IO6 A;  3CR9 A;  4PFY A;  3VLW A;  2F7B A;  3N6T A;  1DTZ A;  4EQB A;  2UVG A;  3BFU A;  3PUY E;  1SI0 A;  2V25 A;  4QHQ A;  5I2N A;  3HO7 A;  4KCD A;  1FQE A;  5I58 B;  5L9O A;  1DOT A;  1JVX A;  4TQU Q;  4IO4 A;  4U4S A;  5BWJ A;  2OCU A;  1OQH A;  3HHG A;  2UVH A;  1N04 A;  1QW0 A;  2UXA A;  3C34 A;  3GLB A;  3W9W A;  4I1D A;  4KI0 E;  2I3V A;  3UIF A;  4XKN A;  3S9N C;  3T22 A;  4G2Z A;  4BLA A;  3CI8 A;  4RPO A;  3M3L A;  5KCJ A;  4ZED A;  1P1Q A;  4QFN A;  2XXP A;  1B7Z A;  1FTL A;  1QUL A;  2ZXT A;  3FVK A;  3H3G A;  3QK6 A;  2RC7 A;  4GL0 A;  3HN0 A;  4GWO A;  4JXI A;  4LVQ A;  2DE2 A;  5CRY A;  5TP9 A;  5BUU A;  2H9B A;  1URS A;  1P1W A;  2VGQ A;  3AXF A;  1SI1 A;  4MFI A;  1HSJ A;  3RQT A;  1S7Y A;  4NF4 B;  5JTY B;  1JEV A;  2R6G E;  5DYH A;  3K2D A;  2XD3 A;  4ZZE A;  4OEU A;  4DIG A;  1LAG E;  3MVX A;  3PPR A;  2NVU B;  3PU5 A;  3G3K A;  4UAC A;  5M2V A;  1MH3 A;  4KCC A;  4TLM B;  4POW A;  4BDN A;  4ELR A;  1UIV A;  3PD9 A;  2M8C A;  3IOT A;  1XVY A;  1IQ7 A;  3MJN A;  1LB8 A;  1YAE A;  4IO7 A;  3E13 X;  4NF5 A;  1B58 A;  1CB6 A;  3EPE A;  5IAI A;  1B52 A;  1B5H A;  4LP2 B;  5DVJ A;  3SER A;  1EZP A;  1H45 A;  3FXQ A;  3MZ1 A;  3H6W A;  4N6P A;  1LCF A;  3SEX A;  4H0W A;  4X9T A;  4IY5 A;  2FNC A;  4GL8 A;  3IAZ A;  4QFL A;  4F1U A;  4PP0 A;  4R6H A;  1FTM A;  2D21 A;  1B3E A;  2ZYK A;  1RYO A;  3DP6 A;  3S2V A;  3IR1 A;  5HPQ A;  4OWD A;  2HFB A;  3PUV E;  1ZBM A;  3GBA A;  4X1B A;  5I2K B;  1LB9 A;  3MAM A;  2V3Q A;  2A5S A;  3ONM A;  1FTK A;  2HEU A;  4HTG A;  1MQH A;  1PBP A;  1EU8 A;  4OET A;  1EZO A;  4Z7E A;  1FQC A;  3MWB A;  1RYX A;  2ZNT A;  2GHA A;  3VFJ A;  1B40 A;  2NUV A;  3S9M C;  1TWY A;  1N7W A;  3GBB A;  5F1Q A;  2VHA A;  3IO4 A;  5FHN A;  3VDF A;  1H43 A;  1B0H A;  1P1O A;  3MC2 A;  3H4Z A;  2ONR A;  3IOW A;  4YKI A;  1YCJ A;  3S4U A;  3UGW A;  4EQ7 A;  1MM7 A;  1PB8 A;  2HAV A;  1BTJ A;  2I58 A;  2O51 A;  4I8C A;  4FEB A;  1Z7M E;  1AOV A;  3OD7 A;  3IX1 A;  3RNN A;  5AA2 A;  3KGC A;  4R6Y A;  5AE4 A;  5TU0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...