2ONKE

Abc transporter modbc in complex with its binding protein moda
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
311
structure length
311
Chain Sequence
NVKLKVFHAGSLTEPMKAFKRAFEEKHPNVEVQTEAAGSAATIRKVTELGRKADVIATADYTLIQKMMYPEFANWTIMFAKNQIVLAYRNDSRYADEINSQNWYEILKRPDVRFGFSNPNDDPCGYRSLMAIQLAELYYNDPTIFDELVAKNSNLRFSEDNGSYVLRMPSSERIEINKSKIMIRSMEMELIHLVESGELDYFFIYKSVAKQHGFNFVELPVEIDLSSPDYAELYSKVKVVLANGKEVTGKPIVYGITIPKNAENRELAVEFVKLVISEEGQEILRELGQEPLVPPRADTAVPSLKAMVEVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Molybdate/tungstate ABC transporter, ATP-binding protein
publication title Structure of an ABC transporter in complex with its binding protein.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
total genus 102
structure length 311
sequence length 311
chains with identical sequence J
ec nomenclature
pdb deposition date 2007-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2onkE01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2onkE02
5FHOA 1N7WA 4PE5B 3T9VA 2ONRA 1XVYA 5CM6A 1FTKA 3ONMA 3LSWA 5FTIA 2Q2CA 2OZZA 3K6VA 2XXQA 4ND9A 1NNTA 5ITPA 1BIYA 3O6IA 1CB6A 2GRVA 2REGA 4RJZA 2GHAA 2F7CA 2UYFA 3OD7A 1MY0A 3S2VA 1JW5A 3O6GA 2XXTA 3MVYA 4RK2A 4H1XA 2PVUA 4YU0A 3C31A 3M8UA 2OLBA 3LSLA 2ZYNA 3FZVA 4R75A 5L8DA 3D4GA 4LQ5A 2GHBA 3T66A 5HPQA 5K2XA 2I4CA 1GGGA 1JEVA 4NTLA 1WDNA 3FUZA 4RNSA 3B7DA 3V5AA 3QUJA 3E13X 4KD5A 4U1ZA 1M5DA 3KGCA 4WEPA 3B6QA 4YKIA 1OIBA 1HSEA 3O29A 2DE3A 4H8IA 4Z7EA 3PUVE 1VFDA 1OVBA 3JZJA 1TWYA 1DPPA 2H4IA 4LVQA 4P0IA 3K2DA 3C9HA 1YCJA 3K6WA 5DT6A 4Q0CA 3P7IA 2Q9TA 1B7ZA 4ZDMA 1MXVA 5HBCA 4NEDA 2XD2A 3MWBA 3PD9A 4H5FA 4LZ7A 3PUZE 5H8QB 3TAJA 1LCTA 4OZ9A 1Z7ME 1B46A 5EHMA 3T9UA 3TEPA 4KHZE 3CIJA 2HXWA 3TODA 2ZNUA 2ALUA 3QAXA 4R6HA 5KCJA 4BLAA 4KPTA 4DE8A 3FV2A 5I58A 3CR9A 2F35A 1NNFA 3H6VA 3DP4A 1R9LA 1SD3A 2PYYA 3RN8A 4Q8RA 3IJXB 1XT8A 1MDQA 4G8MA 3S9MC 4FEDA 3H03A 1MXYA 4XKRA 2B65A 3IAZA 4F1VA 1S50A 2DE4A 4YB7A 2UYEA 3C33A 3H7MA 4H6DA 5CBRA 1FTMA 2P1SA 3MVXA 5DVIA 4DDDA 2HZLA 3VVDA 3HO7A 2Y84A 1M5BA 1QVSA 1XOCA 4NF4B 4ELRA 1QUJA 2VP1A 3MZ9A 4FEBA 3TZAA 1SDXA 3S9LC 5B7DA 4OWDA 1JVXA 2O68A 3EHSA 3RT8A 1A7LA 4GIZA 3ZKKA 4PP0A 2UVJA 4G4PA 4DIGA 3M3KA 1LAHE 3H6WA 3CFZA 3OO8A 3D4CA 4OFLA 4YKJA 4ELOA 1B0LA 3KSXA 1B6HA 5DTBA 3OMBA 2Z22A 3FVGA 2F5XA 2O7UA 2ZXTA 4IY5A 3OO7A 2E0SA 1UIVA 4XIGQ 2IEEA 2H9BA 4QHQA 1AIVA 4IY6A 4EXKA 2DOJA 4OESA 2H99A 4F18A 3FD3A 2IA4A 1VSOA 4KCCA 2V3QA 2VOZA 2OBGA 4TQUQ 4IO5A 3KOSA 3T93B 4WEDA 1XHYA 3DM0A 4OQOA 1EH3A 1S7YA 1MDP1 3K6UA 1A55A 3G3JA 3UA8A 3G3KA 1SBPA 3C35A 4QFLA 4N07A 4LATA 3IK6B 1MQDA 1O64A 4HS7A 2F7BA 4ZECA 1SW4A 4EQBA 2F7AA 3MZ1A 4WXJA 1PB8A 1JVYA 4UACA 1JETA 3HN0A 5CRYA 3CG1A 2Q8JA 4FATA 3TMGA 4FECA 2X7QA 4AB5A 4OEVA 4DZ1A 5FHMA 4QFOA 3EHTA 4GQOA 1Y20A 2A5TB 3HCQA 2O1MA 2DWIA 1L5TA 1SVXB 1FQFA 1MY1A 2AL4A 4KI0E 1WODA 4JBZA 5L9OA 2Z23A 3KN7A 2F78A 1AL3A 1LFGA 1VR5A 4OFOA 2I3VA 3N5LA 4U23A 3L6GA 2O69A 4G8HA 3KEIA 1N04A 3TELA 4YKPA 4G68C 3SKPA 4N13A 2HAVA 5DVFA 1MQIA 4POXA 3LC8A 1B5JA 2G29A 3PPNA 3ZKLA 2A5TA 1SYHA 3I5OA 4LUBA 4U4SA 3VFJA 4U22A 4YICA 4QSCA 2HZKA 3FXRA 5AA1A 3TKDA 2YLNA 3UK4A 3UGWA 2XXHA 1SW1A 3PUWE 1QKBA 3QUFA 1N7XA 3RGYA 1NMUA 1IXGA 3E9XA 5IAIA 3N94A 4F3SA 2XXPA 3MVZA 4EQ9A 2RINA 2R71A 3H3GA 4JSOA 4U1OA 2DVZA 2UVIA 4DXCA 4HW8A 1LCFA 5I2NB 2M8CA 2QS1A 1XS5A 2ZYOA 2V84A 1DSNA 2Z8EA 4FORA 3K01A 4OHNA 1H45A 4F1YA 1I6BA 5DEXB 2ONSA 3C36A 2OJTA 2NXOA 4DXUA 2Q88A 4MFIA 1LBBA 2UVHA 4UA8A 1A99A 2GFEA 1BTJA 4YZZA 4GOTA 5BWJA 1OQGA 3RLFE 1YTVA 3O66A 2RCAA 4EUOA 3K02A 2R6GE 3MC2A 2RC9A 4GD5A 4H5GA 1Y4TA 5I2NA 1SYIA 5JTYB 3OOAA 4PFTA 4JSDA 1NH8A 1P1WA 4F31B 4F2QA 4OXVA 3OELA 1SW2A 3HHGA 3FXQA 1JW1A 3RNNA 4Q30B 5DEXA 3TTKA 2H25A 3MVWA 4YMBA 1H44A 2DWAA 5FHNA 4JWOA 1US4A 2XXWA 3M3LA 1USYE 3TTNA 1ZJLA 4K3FA 5H8FB 4ELQA 4P0GA 4X1BA 3Q28A 2CMOA 3CFXA 4BDMA 5ICTA 4GFRA 1MS7A 1Z7NE 3B6WA 4ZEKA 1RKMA 1II5A 5AA3A 3DP6A 1J1NA 2NUVA 4LONB 4Z0IA 4ZEFA 2PT2A 1P1OA 3V8XB 2X7PA 5JTYA 5F1QA 4KYDA 3T9HB 4MLVA 1D3KA 2QPQA 2REJA 4MH5A 2DQVA 5I59B 1I6QA 2AIXA 4IO7A 4IO3A 4KYSA 2ESNA 4RPOA 4R72A 1B9JA 1A54A 1R1NA 4HTGA 3RT6B 1MQJA 2V3UA 3ECRA 1ZKBA 4H8JA 4ELPA 5KZTA 4XXUA 3N6TA 2DP8A 5H8FA 4KR5A 3FGSA 1H76A 2QRYA 3VVFA 2QS2A 1NH7A 1RYOA 1MY2A 2F6GA 2Y7PA 2RC7A 3TTRA 1M5CA 1FQBA 1PBQA 4EXLA 1OMPA 4KQPA 1BLFA 1FTJA 3TQWA 4X9TA 1JQFA 3TUSA 1ANFA 3MPKA 3V83A 5I59A 3EQ1A 2Y7RA 3MPLA 1TFAA 1LB9A 3MBPA 3DLNA 1LAXA 1PBPA 5ELVA 4F22A 2UVGA 5AE4A 2QS4A 1Y1MA 2Z8FA 1FCKA 3IO6A 4DXBA 1MQHA 4ONYA 3CSGA 1FQAA 2DXRA 3S9EA 1B52A 4X1DA 4F3BA 4OENA 1OLAA 3RQTA 1QKAA 3THIA 2VHAA 4OEUA 3I6VA 2XX7A 1KWHA 3K1NA 3H4ZA 1SQYA 5CMCA 4NWCA 3OEKA 2I49A 4YB6A 2THIA 3U93A 3I3VA 5H8QA 1LSTA 3PUYE 3TCFA 2XX9A 3ILTB 4N6PA 3IB2A 2HFBA 3PD8A 1ZMGA 3GLBA 1B5HA 4ZE8A 4KCDA 2XD3A 1SI1A 4U21A 2F34A 5F7VA 4TLMB 1DMBA 3KSJA 3UN6A 1BP5A 3JV9A 3SEXA 2DWJA 3S9NC 4OETA 4OFJA 3U72A 3QXMA 3ZS6A 3OXNA 3FJGA 4F3GA 1B4ZA 3CFLA 1PB7A 3IOVA 4NF4A 2G93A 3MUQA 1AH5A 2I0BA 1B4HA 4NF5B 1YPNA 1SI0A 4TOZA 5CMBA 1IITA 4RXLA 4NF8B 3PV0E 4FAJA 3WAFA 1LAFE 1O7TA 2BJJX 3K1MA 1NNKA 2P2AA 1ELJA 1EU8A 1P99A 3LR1A 5KDTB 3G7WA 3KFMA 4ZZEA 3CVGA 1JNFA 4IB2A 4QF9A 3ZSFA 4ZEIA 1B3HA 3TDJA 3VVEA 4EF2A 1Y3NA 3PUXE 4RPNA 5I57B 1O63A 3Q29A 3MAMA 3KZGA 2OWSA 1URSA 3H06B 2I4BA 1QUIA 3TQLA 4NF5A 1B3LA 3O9PA 4G68B 4JWXA 1B0HA 1MXUA 3K0VA 4NF8A 1D4NA 4POWA 4JWYA 1RYXA 4YAHX 1TFDA 1QW0A 4G2ZA 4I8CA 1N84A 4YKKA 4C1TA 3VLVA 1LBCA 2W7YA 1FQEA 4THIA 3FVOA 2QL3A 5DYHA 1Y4CA 3FATA 1H43A 4GF8A 4WKMA 5KDTA 5H8HB 2QSXA 2XHDA 2ANJA 4E0WA 5I84A 4OTEA 1AMFA 3Q26A 5TU0A 3QYTA 2CZLA 2P0SA 5I57A 5TP9B 1BKAA 4LQ2A 4R6KA 2ZNSA 3TTMA 4G8NA 4F19A 1B5IA 2I0CA 3RY3A 2HEUA 2D3IA 3T22A 4R9FA 1UQWA 1Y1ZA 3MW0A 4EQ7A 1B3GA 1B3EA 4ESWA 1P1UA 4MLQA 3W15C 3IOTA 5H8HA 4QRZA 2DE2A 3MP1A 4H65A 3G3IA 1ZBMA 3RTWB 1B3FA 3V89B 5ITOA 5A5XB 3TTLA 3QIMA 3EN3A 5TP9A 5JK4A 5CMMA 3SEWA 1MY3A 1R9QA 3O28A 4M4GA 1MM6A 4RK9A 5FTHA 1QUKA 5ICQA 1S9TA 1DPEA 4GL0A 5IKBA 4YB5A 3BFTA 3SERA 4PQJA 3OSQA 1USYH 1OQHA 4H67A 5CMKA 1N3XA 3OENA 1TXFA 1LFIA 1B40A 1FTLA 4R73A 4O3AA 2PBWA 4NMYA 1DTGA 1IEJA 1P1NA 3CI8A 4X48A 4GL8A 3GBBA 1A8FA 2Q2AA 3R6UA 3QK6A 4I9DA 5A5XA 4LZ8A 2B3FA 3SESA 3IOUA 1PEBA 4O3CA 2VGQA 2FA7A 3H6TA 4MBPA 2YPNA 1URGA 2FYIA 3PPQA 3ODBA 3BBRA 3VXBA 3LBSA 2DWHA 3PPPA 4Q5TA 2O7IA 3EPEA 4QSEA 3IJOB 3LSXA 4RYAA 1DOTA 4QFNA 3KJTA 2XXRA 3JYRA 3PPRA 3SEVA 2DXYA 1GV8A 3CSBA 2D5WA 4PFWA 4TLLB 1IZ1A 2VD2A 3VLWA 4MF3A 4RY1A 2H5YA 2O51A 5EHSA 2DYXA 3BFUA 2QMXA 4QFPA 4HCWA 4G77A 3PGFA 2V93A 2HQ0A 3HPIA 1A40A 4BDQA 2ZNTA 2AL5A 3MP8A 4ZEDA 1D9VA 3N26A 4U2RA 1A8EA 1IXIA 1Y3QA 1LAGE 5EYFA 5L9SA 1HSJA 3CRBA 1Y3PA 2WKYA 4QSDA 4ECFA 1B2HA 1MG1A 4NE4A 5AA2B 2XXIA 4O3BA 1QULA 3EHUA 4R2BA 3KJ7A 4XKPA 1MXXA 1OLCA 1OVTA 1MXWA 1FQDA 4IO6A 1B58A 2XX8A 3R7XA 1B05A 4I1DA 1XC1A 5KCJB 1Q1KA 1IXHA 2XXVA 3FVNA 5I58B 4QFKA 3M3FA 3KN8A 3G3FA 3A3CA 1NKXA 5DVJA 3CG3A 3PPOA 3MJNA 3FIRA 4I62A 2UXAA 3SEUA 4F3PA 5AA2A 4GRKA 1R6ZA 3SDFA 2NOOA 2R9JA 2X26A 1SW5A 4C0RA 4FJPA 1GR2A 3FJ7A 3KBRA 5TPAB 4AB6A 3TYHA 3RTFB 2NWJA 1UTHB 3O6HA 1IUDA 4F1UA 3H6UA 3G3HA 3PMVA 2OWTA 1ZLQA 2RC8A 2KLFA 3LUYA 3UIFA 2D21A 2V3TA 4AQ4A 3C32A 3HSTA 3GBAA 2Q89A 4ZS9A 3L6HA 5H8SA 3OO6A 4IGTA 2I48A 1UTBB 1B1XA 3USDA 5ISUA 3Q27A 1LB8A 1JW4A 2NVUB 3SEYA 1MH3A 3FASA 5CI5A 1POTA 1ZTYA 1Y9UA 2ABHA 3TPAA 3IR1A 3PU5A 3E3KA 4OERA 4NF6B 5I2KB 2O1LA 4XKNA 5TPAA 4GXSB 2HAUA 1IQ7A 4LZ5A 3O2AA 1UTHA 4OMBA 4DCXA 4ISUA 4R2FA 1PDAA 3UP9A 3W9WA 1XVXA 4YMAA 3FV1A 2Y7KA 2QS3A 4XKQA 4U4XA 1AOVA 1N3WA 2XXXA 1QJMA 1TT1A 1UTBA 2ONKE 2GH9A 3U8QA 5I56B 4BDOA 1M5FA 3ILUB 3U92A 1I6AA 4FIMA 3AXFA 4OYVA 4NF6A 5I2KA 4KYEA 3KOTA 4BDNA 2RF1A 5HM4B 2ZYMA 4DLDA 4GLIA 2OCUA 4PETA 4E0XA 2B3BA 3BKIB 1M5EA 2RCBA 1FTOA 5JEIA 3MP6A 3PMWA 3GXAA 4GVOA 2F8DA 3Q25A 1HSLA 1B7HA 4L17A 3EF7A 4JDFA 4R6YA 4ZEBA 3VE1B 1NL5A 1MM7A 3RPWA 1MQGA 5I56A 3KG2A 2O84X 2QJEA 1URDA 4HCYA 4F29A 2A5SA 2AYSA 3VXCA 1I69A 1MH4A 3VDFA 3PMXA 3TCHA 2H98A 4EF1A 1MXZA 5LOMA 2RKMA 3A3UA 1PB9A 4NWDA 4GWOA 2O6AA 4JB7A 2I3WA 1GVCA 4KFQA 4FE8A 1LFHA 1VE4A 5B70A 4ZZAA 4IO4A 3OO9A 3C34A 3F11A 2Y7WA 5J1DA 1N0TA 1B32A 1MY4A 4IO2A 1CE2A 1NFTA 1B1HA 3DELB 4IGRA 3IB1A 3G3GA 4R74A 1B7UA 2I58A 3RUMA 1Q35A 1MPCA 1LLSA 4G68A 4ESXA 3O97A 4PFYA 1B51A 4C1UA 2F97A 3MZBA 1ZU0A 2FNCA 4R9GA 5L9MA 4OVJA 2QMWA 5AA4B 1D9YA 3TCGA 3TFLA 1EZ9A 2PMSA 3FJMA 5CBSA 1NNPA 3GZGA 3A09A 2LAOA 3N6UA 2E1SA 3UORA 4JXIA 2F36A 3OSRA 1JEUA 1N76A 3U94A 3VV5A 2ZYKA 3K1PA 4GXAA 1UIUA 4ZE9A 2Y7IA 3FVKA 3IOWA 4RA1A 5K2YA 3IL1B 3DP8A 3LSFB 4BDLA 4H0WA 1IIWA 2I6EA 3IX1A 5H8NB 1POY1 3K00A 3T9XB 1MPDA 2YJPA 3U1OA 4F2OA 4P11A 5AA4A 3S4UA 2PT1A 4LA9A 5CC2A 1H3DA 3IORA 2DVCA 3E4RA 1F9BA 1GTKA 3HV1A 1ZIUA 2ZMBA 3W9VA 1P1QA 3T96B 3MQ9A 1FQCA 1PC3A 4XTCQ 1LGBC 3R26A 1T0KA 2DS9A 5M2VA 2XXUA 3SETA 3VLUA 1ATGA 3IO4A 3FXUA 4DCYA 2F6PA 3C4MA 4F39A 1DTZA 5AA2D 4PFUA 5H8NA 4LP2B 3IB0A 2PX1A 1IXCA 1YAEA 3HHFA 3KN3A 3QSLA 4BDRA 2XXYA 1EZOA 3K6XA 1MPBA 2V25A 1FW0A 3B6TA 5BUUA 4EDPA 3K4UA 1EZPA 2DSFA 4M1VA 2OK2A 1VFEA 1US5A 2Z8DA 1MRPA 2HCAA 3WAEA 2VD3A 3OEMA 1WVJA
chains in the Genus database with same CATH superfamily
5FHOA 1N7WA 4PE5B 3T9VA 2ONRA 1XVYA 5CM6A 1FTKA 3ONMA 4GWWA 4MNPA 3LSWA 4NN3A 5FTIA 4OVRA 2Q2CA 4N8YA 2OZZA 3K6VA 4PFRA 2XXQA 4ND9A 1NNTA 5ITPA 1BIYA 2B4LA 3O6IA 1G0IA 1CB6A 2GRVA 2REGA 1FPIA 4GBVA 4RJZA 2GHAA 2MKZA 2F7CA 1KZ8A 2UYFA 5ET8A 3OD7A 1MY0A 5LDZA 3S2VA 1JW5A 4P8BA 3O6GA 2XXTA 3MVYA 4RK2A 4H1XA 2PVUA 4YU0A 1FPBA 3C31A 4PCDA 3M8UA 2OLBA 3LSLA 1FJ6A 2ZYNA 3FZVA 4R75A 5L8DA 3D4GA 4LQ5A 2GHBA 3T66A 5A5LA 5HPQA 5K2XA 1FBGA 2I4CA 4PGPA 1GGGA 1JEVA 4NTLA 1WDNA 3FUZA 4RNSA 3B7DA 3V5AA 3QUJA 3E13X 4KD5A 1DCUA 4U1ZA 1M5DA 3KGCA 4WEPA 3B6QA 4YKIA 1OIBA 1HSEA 3O29A 2DE3A 4H8IA 4Z7EA 3E79A 3PUVE 1VFDA 1OVBA 3JZJA 1TWYA 1DPPA 2H4IA 2R8TA 4LVQA 4P0IA 3K2DA 3C9HA 1YCJA 3K6WA 1SPIA 1AWBA 5DT6A 4Q0CA 3P7IA 2Q9TA 1B7ZA 4ZDMA 1MXVA 5HBCA 4NEDA 2XD2A 1LEVA 3MWBA 1IMBA 3PD9A 4H5FA 4MAGA 4LZ7A 3PUZE 3SZPA 5H8QB 3TAJA 1LCTA 4OZ9A 1Z7ME 1B46A 5EHMA 3T9UA 4GWYA 3TEPA 4KHZE 3CIJA 2HXWA 4PFBA 3TODA 2ZNUA 1NV3A 2ALUA 4G61A 3QAXA 4R6HA 5KCJA 4BLAA 4KPTA 4DE8A 1LBYA 3FV2A 5I58A 3CR9A 2F35A 1NNFA 3H6VA 3DP4A 1R9LA 5EQ7A 1SD3A 2PYYA 3RN8A 4Q8RA 3IJXB 1XT8A 1MDQA 4G8MA 3S9MC 4FEDA 3H03A 1DK4A 1MXYA 4XKRA 2B65A 4PBHA 3IAZA 4F1VA 1S50A 2DE4A 4YB7A 2UYEA 3C33A 3H7MA 4H6DA 5CBRA 1FTMA 2P1SA 4GWUA 3MVXA 5DVIA 4DDDA 2HZLA 3VVDA 3HO7A 2Y84A 1M5BA 1QVSA 1XOCA 4NF4B 4ELRA 1QUJA 2VP1A 3MZ9A 4FEBA 4MIJA 3TZAA 1SDXA 3S9LC 5B7DA 4OWDA 3LUZA 1JVXA 2O68A 3EHSA 3RT8A 1A7LA 5IGAA 4GIZA 3ZKKA 4PP0A 2XWIA 2UVJA 4G4PA 4DIGA 3M3KA 5IM2A 1LAHE 4P3LA 3H6WA 3CFZA 3OO8A 2CEXA 3D4CA 4OFLA 4YKJA 4ELOA 1B0LA 4MHFA 3KSXA 1B6HA 5DTBA 3OMBA 2Z22A 3FVGA 2F5XA 2O7UA 2ZXTA 4IY5A 3OO7A 2E0SA 1UIVA 1K9ZA 4XIGQ 2IEEA 2Q74A 2H9BA 4QHQA 1AIVA 4IY6A 4EXKA 2DOJA 4OESA 2H99A 4F18A 3FD3A 2IA4A 1VSOA 4KCCA 1FRPA 2V3QA 2VOZA 2OBGA 4MX6A 4TQUQ 4IO5A 3KOSA 3T93B 4WEDA 1XHYA 3DM0A 4OQOA 1EH3A 4OANA 1S7YA 1MDP1 2QFLA 3K6UA 1A55A 3G3JA 3UA8A 3G3KA 1SBPA 3C35A 4QFLA 4N07A 4LATA 3IK6B 1MQDA 4NX1A 1O64A 4HS7A 2F7BA 4ZECA 1SW4A 4EQBA 2F7AA 5LTCA 3MZ1A 4WXJA 1PB8A 1JVYA 4UACA 1JETA 3HN0A 5CRYA 2QVUA 3B8BA 4N81A 3CG1A 2Q8JA 4FATA 3TMGA 4FECA 2X7QA 4AB5A 4OEVA 4DZ1A 5FHMA 4QFOA 3EHTA 4GQOA 5ET5A 1Y20A 2A5TB 3HCQA 2O1MA 2DWIA 2XXKA 1L5TA 1D9QA 1SVXB 1FQFA 1MY1A 2AL4A 4KI0E 1WODA 4JBZA 5L9OA 2Z23A 3KN7A 1NV4A 2F78A 1AL3A 1LFGA 1VR5A 4OFOA 2I3VA 4P47A 3N5LA 4U23A 3L6GA 2O69A 4G8HA 3KEIA 1N04A 1FPKA 3TELA 1YYZA 4YKPA 4G68C 3SKPA 2FIEA 4N13A 1FBDA 2HAVA 5DVFA 1MQIA 4POXA 3LC8A 1B5JA 2G29A 3T1BA 3PPNA 3ZKLA 2A5TA 1SYHA 2PFZA 3I5OA 4MJOA 4LUBA 1FPJA 4U4SA 4PE3A 3VFJA 4U22A 4YICA 4QSCA 4NAPA 2HZKA 3FXRA 5AA1A 3TKDA 2YLNA 3UK4A 3UGWA 2XXHA 1SW1A 3PUWE 1QKBA 3QUFA 1N7XA 3RGYA 1NMUA 1IXGA 2XWKA 3E9XA 5IAIA 3N94A 4MMPA 4F3SA 2XXPA 3MVZA 4EQ9A 2RINA 4GWXA 2R71A 3H3GA 4JSOA 4U1OA 2DVZA 2UVIA 2HXRA 4DXCA 3BIGA 4HW8A 1LCFA 5I2NB 2M8CA 2QS1A 4MNIA 1XS5A 2ZYOA 2V84A 1DSNA 2Z8EA 4FORA 3K01A 4OHNA 1H45A 4F1YA 4O8MA 1I6BA 4NG7A 5DEXB 2ONSA 3C36A 2OJTA 2NXOA 4DXUA 1RDYA 2Q88A 4MFIA 5J16A 1LBBA 2UVHA 4UA8A 1A99A 2GFEA 1BTJA 4YZZA 2P3VA 1IMDA 4GOTA 5BWJA 4N91A 1OQGA 3RLFE 1YTVA 4IR8A 3O66A 2RCAA 4EUOA 3K02A 2R6GE 3MC2A 2RC9A 4GD5A 4H5GA 1Y4TA 5I2NA 5IZ1A 1SYIA 5JTYB 3OOAA 4PFTA 4JSDA 1NH8A 4N6KA 5T3JA 1P1WA 4F31B 4F2QA 4OXVA 3OELA 1SW2A 3HHGA 3FXQA 1JW1A 3RNNA 4Q30B 5DEXA 3TTKA 2H25A 3MVWA 4YMBA 1H44A 2DWAA 5FHNA 4JWOA 4DI3D 1US4A 4P56A 2XXWA 3M3LA 1USYE 3TTNA 1ZJLA 4K3FA 4N15A 5H8FB 4ELQA 4P0GA 4X1BA 3Q28A 3BIHA 2CMOA 3CFXA 3KBZA 4BDMA 5ICTA 1QGXA 4GFRA 1MS7A 5I7IA 1Z7NE 3B6WA 4ZEKA 2XWOA 1RKMA 2B4MA 1II5A 5AA3A 3DP6A 1J1NA 2NUVA 4LONB 3GYYA 4Z0IA 4QXDA 4ZEFA 2PT2A 1P1OA 3V8XB 2X7PA 5JTYA 5F1QA 3RPLB 4KYDA 3T9HB 4MLVA 1D3KA 2QPQA 2REJA 4MH5A 1FPFA 4I3YA 2DQVA 5I59B 1I6QA 2AIXA 1FBCA 4IO7A 4IO3A 4KYSA 2ESNA 4RPOA 4R72A 1B9JA 1A54A 1R1NA 4HTGA 3RT6B 1MQJA 2V3UA 3ECRA 1ZKBA 4H8JA 4ELPA 5KZTA 4XXUA 3N6TA 2DP8A 5H8FA 4KR5A 3FGSA 1H76A 2QRYA 3VVFA 2QS2A 5I5PA 1NH7A 1RYOA 1IMAA 1MY2A 2F6GA 2Y7PA 1IMFA 2RC7A 3TTRA 1M5CA 1FQBA 1PBQA 4EXLA 1OMPA 3ISPA 4KQPA 1BLFA 1FTJA 3TQWA 4X9TA 1JQFA 3RPLA 3TUSA 1ANFA 3MPKA 3V83A 4UABA 5I59A 1DBZA 3EQ1A 2Y7RA 3MPLA 1TFAA 1LB9A 3MBPA 3DLNA 1LAXA 1PBPA 5ELVA 1FSAA 4F22A 2UVGA 5EQ9A 5AE4A 2QS4A 1Y1MA 2Z8FA 1FCKA 3IO6A 2ZZWA 1FBHA 4DXBA 1MQHA 4ONYA 3CSGA 1FQAA 2DXRA 3S9EA 1B52A 4X1DA 4F3BA 4OENA 1OLAA 1RDZA 3RQTA 3KC1A 1RDXA 4PF8A 3CHGA 1QKAA 3THIA 2VHAA 4OEUA 3I6VA 4GWZA 2XX7A 1KWHA 3K1NA 4HXVA 3H4ZA 1SQYA 5CMCA 4NWCA 3OEKA 2I49A 4YB6A 2THIA 3U93A 3I3VA 5H8QA 1LSTA 3PUYE 3TCFA 2CZKA 2XX9A 3ILTB 4N6PA 3IB2A 4GX4A 2HFBA 3PD8A 1ZMGA 3GLBA 1B5HA 4ZE8A 4KCDA 2BJIA 3KC0A 2XD3A 1SI1A 4U21A 2F34A 5F7VA 4TLMB 2VT5A 3A29A 1DMBA 3KSJA 3UN6A 1BP5A 3JV9A 3SEXA 2DWJA 3S9NC 4OETA 4OFJA 2V4CA 4OA4A 3U72A 4XEQA 3QXMA 3ZS6A 3OXNA 3FJGA 1KA0A 4F3GA 4HE2A 4KXPA 1B4ZA 3CFLA 4JVIA 1PB7A 3IOVA 4NF4A 2G93A 3MUQA 1AH5A 2I0BA 1B4HA 4NF5B 1YPNA 1SI0A 4TOZA 5CMBA 1IITA 4RXLA 4NF8B 3PV0E 2VPOA 4FAJA 3WAFA 1LAFE 1O7TA 2BJJX 3K1MA 4GBWA 2QVRA 1G0HA 1NNKA 2P2AA 1ELJA 1EU8A 1P99A 3LR1A 4N17A 5KDTB 3G7WA 3KFMA 4ZZEA 3CVGA 1JNFA 4IB2A 1VDWA 4QF9A 3ZSFA 4ZEIA 1B3HA 3TDJA 3VVEA 4EF2A 1Y3NA 3PUXE 4RPNA 5I57B 1O63A 3Q29A 3MAMA 3KZGA 2OWSA 1URSA 3H06B 2I4BA 1QUIA 3TQLA 4NF5A 1B3LA 3O9PA 4G68B 4JWXA 1B0HA 1MXUA 3K0VA 3QMFA 4NF8A 3ROJA 1D4NA 5IZ3B 4NF0A 4POWA 4JWYA 1RYXA 4YAHX 1TFDA 5IZZA 3RYDA 4N8GA 1QW0A 4G2ZA 4I8CA 1FPDA 1N84A 4YKKA 2WX9A 4C1TA 3VLVA 1LBCA 2W7YA 4PDDA 1FQEA 4THIA 3FVOA 2QL3A 5DYHA 1Y4CA 3FATA 1H43A 4GF8A 4WKMA 5KDTA 5H8HB 1IMCA 2QSXA 2XHDA 1NV6A 4N4UA 2ANJA 4E0WA 5I84A 4OTEA 1AMFA 3Q26A 5TU0A 2WBDA 3QYTA 2CZLA 4PAFA 2P0SA 4PAIA 5I57A 1NV7A 5TP9B 1BKAA 4LQ2A 4R6KA 2ZNSA 3TTMA 4O7IA 4G8NA 2HPGA 3NOHA 4F19A 1B5IA 4PC9A 2I0CA 3RY3A 1NI9A 5IZ3A 2KQZA 2HEUA 4OVQA 2D3IA 3T22A 4R9FA 2XWVA 1UQWA 1Y1ZA 3MW0A 4EQ7A 1B3GA 1B3EA 4ESWA 1P1UA 1FPEA 4MLQA 3W15C 3IOTA 5H8HA 4QRZA 2DE2A 3MP1A 4H65A 3G3IA 1ZBMA 1LBVA 4NHBA 3RTWB 1B3FA 3V89B 5ITOA 5A5XB 3TTLA 3QIMA 3EN3A 5TP9A 5JK4A 5CMMA 3SEWA 1MY3A 1R9QA 3O28A 4AS5A 4M4GA 1MM6A 4RK9A 5FTHA 1QUKA 5ICQA 2ZZXA 4LN5A 1S9TA 1DPEA 1CNQA 4GL0A 5IKBA 4MEVA 4YB5A 3BFTA 3SERA 1FPGA 4PQJA 3OSQA 1USYH 1OQHA 3LV0A 1NUXA 4H67A 5CMKA 1N3XA 3OENA 1TXFA 1LFIA 1B40A 4DI4B 1FTLA 4JVDA 4R73A 4O3AA 2PBWA 4NMYA 1DTGA 1IEJA 1P1NA 3CI8A 2F3BA 2P3NA 4X48A 4GL8A 3GBBA 1A8FA 2Q2AA 3R6UA 4H45A 3QK6A 4I9DA 5A5XA 1FBPA 4LZ8A 2B3FA 3SESA 3IOUA 1PEBA 1NUWA 1LBWA 2VGQA 4O3CA 2FA7A 3H6TA 4MBPA 2YPNA 1URGA 2FYIA 3PPQA 3ODBA 3BBRA 3VXBA 3LBSA 4HE0A 2DWHA 3PPPA 4X04A 4Q5TA 2O7IA 3EPEA 2HHMA 4QSEA 3IJOB 3LSXA 4MNCA 3E78A 4RYAA 1DOTA 4QFNA 3KJTA 2XA5A 2XXRA 3JYRA 1JP4A 3PPRA 3SEVA 2DXYA 1GV8A 3CSBA 2D5WA 4PFWA 4TLLB 1IZ1A 2VD2A 3VLWA 4MF3A 2CZHA 4RY1A 1NUYA 2H5YA 2O51A 5EHSA 2DYXA 3BFUA 2QMXA 4QFPA 4HCWA 4OVPA 4G77A 3PGFA 2V93A 2HQ0A 3HPIA 1A40A 4BDQA 2ZNTA 2AL5A 3MP8A 4ZEDA 1D9VA 3N26A 4U2RA 1A8EA 1IXIA 1Y3QA 1LAGE 5EYFA 2WBBA 5L9SA 1HSJA 3T0JA 3CRBA 1Y3PA 2WKYA 4QSDA 4ECFA 1B2HA 1MG1A 4NE4A 4P9KA 5AA2B 2XXIA 5F24A 4GX3A 4O3BA 1QULA 3EHUA 4R2BA 3KJ7A 4O7MA 4XKPA 1MXXA 1OLCA 1OVTA 1MXWA 1FQDA 4IO6A 1B58A 2XX8A 3R7XA 1B05A 3PTYA 4I1DA 1XC1A 5KCJB 1Q1KA 1IXHA 2XXVA 1YZ0A 3FVNA 5I58B 4QFKA 3M3FA 3KN8A 3G3FA 3A3CA 1NKXA 5DVJA 4O94A 3CG3A 3PPOA 3MJNA 3FIRA 4I62A 2UXAA 3SEUA 3EKIA 3MYUA 4F3PA 4XF5A 5AA2A 4GRKA 1R6ZA 3SDFA 2NOOA 2R9JA 2X26A 1SW5A 1YXIA 4C0RA 4FJPA 1GR2A 3FJ7A 3KBRA 2WYKA 5TPAB 2DDKA 4AB6A 3RTFB 3TYHA 2NWJA 2FVZA 4OVSA 1UTHB 3O6HA 1IUDA 4F1UA 3H6UA 3G3HA 3PMVA 2OWTA 1ZLQA 2OX3A 2RC8A 5ESYA 5EYGA 2KLFA 3LUYA 3UIFA 2D21A 2V3TA 4AQ4A 3C32A 3HSTA 3GBAA 2Q89A 4ZS9A 4PBQA 3L6HA 5H8SA 1KA1A 3OO6A 4MCOA 4IGTA 2I48A 1FPLA 1UTBB 1B1XA 3USDA 5ISUA 3Q27A 1LB8A 1FJ9A 1JW4A 2NVUB 3SEYA 1MH3A 3FASA 5CI5A 1POTA 1ZTYA 1Y9UA 2ABHA 3TPAA 3IR1A 3PU5A 4X8RA 3E3KA 4OERA 1Q9DA 1NV0A 4NF6B 5I2KB 2O1LA 2VPNA 4XKNA 2CEYA 4AS4A 5TPAA 4GXSB 4XFEA 2HAUA 1IQ7A 4LZ5A 3O2AA 4P1EA 1UTHA 4OMBA 4DCXA 4ISUA 4R2FA 1PDAA 4I3EA 3UP9A 4PAKA 3W9WA 1XVXA 4YMAA 5I3SA 3FV1A 3FXBA 1FBEA 2Y7KA 2FHYA 2QS3A 4XKQA 4U4XA 1AOVA 1N3WA 2XXXA 1QJMA 1TT1A 1UTBA 2ONKE 2GH9A 4PTKA 3U8QA 5I56B 4BDOA 1M5FA 3ILUB 5EQ8A 3U92A 1I6AA 1NV5A 4FIMA 5DW8A 3AXFA 4OYVA 4NF6A 4N6DA 5I2KA 4KYEA 4NQ8A 3KOTA 4BDNA 2QVVA 2RF1A 5HM4B 2ZYMA 4DLDA 4GLIA 2OCUA 4PETA 4E0XA 2B3BA 3BKIB 4JVCA 1M5EA 2RCBA 1FTOA 5JEIA 3MP6A 3PMWA 3GXAA 1LBXA 4GVOA 2F8DA 3Q25A 1HSLA 5EYHA 1B7HA 4L17A 3EF7A 4JDFA 4R6YA 4ZEBA 3VE1B 1NL5A 1MM7A 3RPWA 1MQGA 3IFCA 5I56A 5ET7A 3KG2A 2O84X 2QJEA 1URDA 2CZIA 4HCYA 4F29A 1EYJA 2A5SA 2AYSA 3VXCA 1I69A 1MH4A 3PMXA 3TCHA 3VDFA 2H98A 4EF1A 1MXZA 5LOMA 2PCRA 2RKMA 3A3UA 2PFYA 2FIXA 1PB9A 4NWDA 4GWOA 2OWZA 2O6AA 4JB7A 1BK4A 2I3WA 1GVCA 4KFQA 4FE8A 1LFHA 1VE4A 5B70A 4ZZAA 4IO4A 3OO9A 3C34A 3F11A 5EQAA 2Y7WA 2WEFA 3HFUA 5J1DA 1N0TA 1B32A 1MY4A 4IO2A 1CE2A 2KR0A 2Y5LA 3U65A 1NFTA 3FBPA 2GQ1A 1B1HA 3DELB 4IGRA 3IB1A 3G3GA 4R74A 4H46A 1B7UA 4QBAA 2I58A 3RUMA 1Q35A 5FBPA 1MPCA 1LLSA 4G68A 1K9YA 1NV2A 4ESXA 3O97A 4PFYA 1B51A 4C1UA 2F97A 3MZBA 1ZU0A 1EYIA 2FNCA 4R9GA 5L9MA 4OVJA 2QMWA 5AA4B 1D9YA 3TCGA 3TFLA 1EZ9A 2PMSA 1NUZA 3FJMA 5CBSA 1NNPA 2L5VA 3GZGA 4P1LA 1FBFA 3A09A 2LAOA 3B50A 5ET6A 3N6UA 2FBPA 2E1SA 3UORA 4JXIA 2F36A 3OSRA 3IFAA 1JEUA 1N76A 3U94A 4PF6A 3VV5A 1INPA 2F3DA 2ZYKA 3K1PA 4GXAA 1UIUA 4ZE9A 4PFIA 2Y7IA 3FVKA 3IOWA 4RA1A 5K2YA 3IL1B 3DP8A 3LSFB 4BDLA 4H0WA 1IIWA 2I6EA 3IX1A 5H8NB 4FBPA 1POY1 3K00A 3T9XB 1MPDA 2YJPA 3U1OA 4GWSA 1FTAA 4F2OA 4P11A 5AA4A 3S4UA 2PT1A 4LA9A 5CC2A 1H3DA 3IORA 2DVCA 3E4RA 4OVTA 1F9BA 1EYKA 1GTKA 3HV1A 4PGNA 1ZIUA 2ZMBA 3W9VA 4NGUA 2JJKA 1P1QA 3T96B 3MQ9A 1FQCA 3MSTA 1PC3A 4XTCQ 1LGBC 3R26A 1LBZA 1T0KA 2DS9A 5M2VA 2Y5KA 2XXUA 3SETA 3VLUA 1ATGA 3D1RA 3IO4A 1IMEA 3FXUA 4DCYA 1XI6A 2F6PA 3C4MA 4F39A 1DTZA 5AA2D 4PFUA 5H8NA 4LP2B 3IB0A 2PX1A 1IXCA 1YAEA 3HHFA 3KN3A 3QSLA 4BDRA 4I40A 2XXYA 1EZOA 3K6XA 4GX6A 1MPBA 2V25A 4HE1A 1FW0A 1NV1A 2ZZVA 3B6TA 5BUUA 4EDPA 3K4UA 1EZPA 2DSFA 4M1VA 2OK2A 1VFEA 1US5A 2WYPA 2Q8MA 2Z8DA 1MRPA 2HCAA 3WAEA 2VD3A 3OEMA 1WVJA 4PDHA
chains in the Genus database with same CATH topology
5FHOA 1N7WA 4PE5B 3T9VA 2ONRA 1XVYA 5CM6A 1FTKA 3ONMA 3LSWA 5FTIA 2Q2CA 2OZZA 3K6VA 2XXQA 4ND9A 1NNTA 5ITPA 1BIYA 3O6IA 1CB6A 2GRVA 2REGA 4RJZA 2GHAA 2F7CA 2UYFA 3OD7A 1MY0A 3S2VA 1JW5A 3O6GA 2XXTA 3MVYA 4RK2A 4H1XA 2PVUA 4YU0A 3C31A 3M8UA 2OLBA 3LSLA 2ZYNA 3FZVA 4R75A 5L8DA 3D4GA 4LQ5A 2GHBA 3T66A 5HPQA 5K2XA 2I4CA 1GGGA 1JEVA 4NTLA 1WDNA 3FUZA 4RNSA 3B7DA 3V5AA 3QUJA 3E13X 4KD5A 4U1ZA 1M5DA 3KGCA 4WEPA 3B6QA 4YKIA 1OIBA 1HSEA 3O29A 2DE3A 4H8IA 4Z7EA 3PUVE 1VFDA 1OVBA 3JZJA 1TWYA 1DPPA 2H4IA 4LVQA 4P0IA 3K2DA 3C9HA 1YCJA 3K6WA 5DT6A 4Q0CA 3P7IA 2Q9TA 1B7ZA 4ZDMA 1MXVA 5HBCA 4NEDA 2XD2A 3MWBA 3PD9A 4H5FA 4LZ7A 3PUZE 5H8QB 3TAJA 1LCTA 4OZ9A 1Z7ME 1B46A 5EHMA 3T9UA 3TEPA 4KHZE 3CIJA 2HXWA 3TODA 2ZNUA 2ALUA 3QAXA 4R6HA 5KCJA 4BLAA 4KPTA 4DE8A 3FV2A 5I58A 3CR9A 2F35A 1NNFA 3H6VA 3DP4A 1R9LA 1SD3A 2PYYA 3RN8A 4Q8RA 3IJXB 1XT8A 1MDQA 4G8MA 3S9MC 4FEDA 3H03A 1MXYA 4XKRA 2B65A 3IAZA 4F1VA 1S50A 2DE4A 4YB7A 2UYEA 3C33A 3H7MA 4H6DA 5CBRA 1FTMA 2P1SA 3MVXA 5DVIA 4DDDA 2HZLA 3VVDA 3HO7A 2Y84A 1M5BA 1QVSA 1XOCA 4NF4B 4ELRA 1QUJA 2VP1A 3MZ9A 4FEBA 3TZAA 1SDXA 3S9LC 5B7DA 4OWDA 1JVXA 2O68A 3EHSA 3RT8A 1A7LA 4GIZA 3ZKKA 4PP0A 2UVJA 4G4PA 4DIGA 3M3KA 1LAHE 3H6WA 3CFZA 3OO8A 3D4CA 4OFLA 4YKJA 4ELOA 1B0LA 3KSXA 1B6HA 5DTBA 3OMBA 2Z22A 3FVGA 2F5XA 2O7UA 2ZXTA 4IY5A 3OO7A 2E0SA 1UIVA 4XIGQ 2IEEA 2H9BA 4QHQA 1AIVA 4IY6A 4EXKA 2DOJA 4OESA 2H99A 4F18A 3FD3A 2IA4A 1VSOA 4KCCA 2V3QA 2VOZA 2OBGA 4TQUQ 4IO5A 3KOSA 3T93B 4WEDA 1XHYA 3DM0A 4OQOA 1EH3A 1S7YA 1MDP1 3K6UA 1A55A 3G3JA 3UA8A 3G3KA 1SBPA 3C35A 4QFLA 4N07A 4LATA 3IK6B 1MQDA 1O64A 4HS7A 2F7BA 4ZECA 1SW4A 4EQBA 2F7AA 3MZ1A 4WXJA 1PB8A 1JVYA 4UACA 1JETA 3HN0A 5CRYA 3CG1A 2Q8JA 4FATA 3TMGA 4FECA 2X7QA 4AB5A 4OEVA 4DZ1A 5FHMA 4QFOA 3EHTA 4GQOA 1Y20A 2A5TB 3HCQA 2O1MA 2DWIA 1L5TA 1SVXB 1FQFA 1MY1A 2AL4A 4KI0E 1WODA 4JBZA 5L9OA 2Z23A 3KN7A 2F78A 1AL3A 1LFGA 1VR5A 4OFOA 2I3VA 3N5LA 4U23A 3L6GA 2O69A 4G8HA 3KEIA 1N04A 3TELA 4YKPA 4G68C 3SKPA 4N13A 2HAVA 5DVFA 1MQIA 4POXA 3LC8A 1B5JA 2G29A 3PPNA 3ZKLA 2A5TA 1SYHA 3I5OA 4LUBA 4U4SA 3VFJA 4U22A 4YICA 4QSCA 2HZKA 3FXRA 5AA1A 3TKDA 2YLNA 3UK4A 3UGWA 2XXHA 1SW1A 3PUWE 1QKBA 3QUFA 1N7XA 3RGYA 1NMUA 1IXGA 3E9XA 5IAIA 3N94A 4F3SA 2XXPA 3MVZA 4EQ9A 2RINA 2R71A 3H3GA 4JSOA 4U1OA 2DVZA 2UVIA 4DXCA 4HW8A 1LCFA 5I2NB 2M8CA 2QS1A 1XS5A 2ZYOA 2V84A 1DSNA 2Z8EA 4FORA 3K01A 4OHNA 1H45A 4F1YA 1I6BA 5DEXB 2ONSA 3C36A 2OJTA 2NXOA 4DXUA 2Q88A 4MFIA 1LBBA 2UVHA 4UA8A 1A99A 2GFEA 1BTJA 4YZZA 4GOTA 5BWJA 1OQGA 3RLFE 1YTVA 3O66A 2RCAA 4EUOA 3K02A 2R6GE 3MC2A 2RC9A 4GD5A 4H5GA 1Y4TA 5I2NA 1SYIA 5JTYB 3OOAA 4PFTA 4JSDA 1NH8A 1P1WA 4F31B 4F2QA 4OXVA 3OELA 1SW2A 3HHGA 3FXQA 1JW1A 3RNNA 4Q30B 5DEXA 3TTKA 2H25A 3MVWA 4YMBA 1H44A 2DWAA 5FHNA 4JWOA 1US4A 2XXWA 3M3LA 1USYE 3TTNA 1ZJLA 4K3FA 5H8FB 4ELQA 4P0GA 4X1BA 3Q28A 2CMOA 3CFXA 4BDMA 5ICTA 4GFRA 1MS7A 1Z7NE 3B6WA 4ZEKA 1RKMA 1II5A 5AA3A 3DP6A 1J1NA 2NUVA 4LONB 4Z0IA 4ZEFA 2PT2A 1P1OA 3V8XB 2X7PA 5JTYA 5F1QA 4KYDA 3T9HB 4MLVA 1D3KA 2QPQA 2REJA 4MH5A 2DQVA 5I59B 1I6QA 2AIXA 4IO7A 4IO3A 4KYSA 2ESNA 4RPOA 4R72A 1B9JA 1A54A 1R1NA 4HTGA 3RT6B 1MQJA 2V3UA 3ECRA 1ZKBA 4H8JA 4ELPA 5KZTA 4XXUA 3N6TA 2DP8A 5H8FA 4KR5A 3FGSA 1H76A 2QRYA 3VVFA 2QS2A 1NH7A 1RYOA 1MY2A 2F6GA 2Y7PA 2RC7A 3TTRA 1M5CA 1FQBA 1PBQA 4EXLA 1OMPA 4KQPA 1BLFA 1FTJA 3TQWA 4X9TA 1JQFA 3TUSA 1ANFA 3MPKA 3V83A 5I59A 3EQ1A 2Y7RA 3MPLA 1TFAA 1LB9A 3MBPA 3DLNA 1LAXA 1PBPA 5ELVA 4F22A 2UVGA 5AE4A 2QS4A 1Y1MA 2Z8FA 1FCKA 3IO6A 4DXBA 1MQHA 4ONYA 3CSGA 1FQAA 2DXRA 3S9EA 1B52A 4X1DA 4F3BA 4OENA 1OLAA 3RQTA 1QKAA 3THIA 2VHAA 4OEUA 3I6VA 2XX7A 1KWHA 3K1NA 3H4ZA 1SQYA 5CMCA 4NWCA 3OEKA 2I49A 4YB6A 2THIA 3U93A 3I3VA 5H8QA 1LSTA 3PUYE 3TCFA 2XX9A 3ILTB 4N6PA 3IB2A 2HFBA 3PD8A 1ZMGA 3GLBA 1B5HA 4ZE8A 4KCDA 2XD3A 1SI1A 4U21A 2F34A 5F7VA 4TLMB 1DMBA 3KSJA 3UN6A 1BP5A 3JV9A 3SEXA 2DWJA 3S9NC 4OETA 4OFJA 3U72A 3QXMA 3ZS6A 3OXNA 3FJGA 4F3GA 1B4ZA 3CFLA 1PB7A 3IOVA 4NF4A 2G93A 3MUQA 1AH5A 2I0BA 1B4HA 4NF5B 1YPNA 1SI0A 4TOZA 5CMBA 1IITA 4RXLA 4NF8B 3PV0E 4FAJA 3WAFA 1LAFE 1O7TA 2BJJX 3K1MA 1NNKA 2P2AA 1ELJA 1EU8A 1P99A 3LR1A 5KDTB 3G7WA 3KFMA 4ZZEA 3CVGA 1JNFA 4IB2A 4QF9A 3ZSFA 4ZEIA 1B3HA 3TDJA 3VVEA 4EF2A 1Y3NA 3PUXE 4RPNA 5I57B 1O63A 3Q29A 3MAMA 3KZGA 2OWSA 1URSA 3H06B 2I4BA 1QUIA 3TQLA 4NF5A 1B3LA 3O9PA 4G68B 4JWXA 1B0HA 1MXUA 3K0VA 4NF8A 1D4NA 4POWA 4JWYA 1RYXA 4YAHX 1TFDA 1QW0A 4G2ZA 4I8CA 1N84A 4YKKA 4C1TA 3VLVA 1LBCA 2W7YA 1FQEA 4THIA 3FVOA 2QL3A 5DYHA 1Y4CA 3FATA 1H43A 4GF8A 4WKMA 5KDTA 5H8HB 2QSXA 2XHDA 2ANJA 4E0WA 5I84A 4OTEA 1AMFA 3Q26A 5TU0A 3QYTA 2CZLA 2P0SA 5I57A 5TP9B 1BKAA 4LQ2A 4R6KA 2ZNSA 3TTMA 4G8NA 4F19A 1B5IA 2I0CA 3RY3A 2HEUA 2D3IA 3T22A 4R9FA 1UQWA 1Y1ZA 3MW0A 4EQ7A 1B3GA 1B3EA 4ESWA 1P1UA 4MLQA 3W15C 3IOTA 5H8HA 4QRZA 2DE2A 3MP1A 4H65A 3G3IA 1ZBMA 3RTWB 1B3FA 3V89B 5ITOA 5A5XB 3TTLA 3QIMA 3EN3A 5TP9A 5JK4A 5CMMA 3SEWA 1MY3A 1R9QA 3O28A 4M4GA 1MM6A 4RK9A 5FTHA 1QUKA 5ICQA 1S9TA 1DPEA 4GL0A 5IKBA 4YB5A 3BFTA 3SERA 4PQJA 3OSQA 1USYH 1OQHA 4H67A 5CMKA 1N3XA 3OENA 1TXFA 1LFIA 1B40A 1FTLA 4R73A 4O3AA 2PBWA 4NMYA 1DTGA 1IEJA 1P1NA 3CI8A 4X48A 4GL8A 3GBBA 1A8FA 2Q2AA 3R6UA 3QK6A 4I9DA 5A5XA 4LZ8A 2B3FA 3SESA 3IOUA 1PEBA 4O3CA 2VGQA 2FA7A 3H6TA 4MBPA 2YPNA 1URGA 2FYIA 3PPQA 3ODBA 3BBRA 3VXBA 3LBSA 2DWHA 3PPPA 4Q5TA 2O7IA 3EPEA 4QSEA 3IJOB 3LSXA 4RYAA 1DOTA 4QFNA 3KJTA 2XXRA 3JYRA 3PPRA 3SEVA 2DXYA 1GV8A 3CSBA 2D5WA 4PFWA 4TLLB 1IZ1A 2VD2A 3VLWA 4MF3A 4RY1A 2H5YA 2O51A 5EHSA 2DYXA 3BFUA 2QMXA 4QFPA 4HCWA 4G77A 3PGFA 2V93A 2HQ0A 3HPIA 1A40A 4BDQA 2ZNTA 2AL5A 3MP8A 4ZEDA 1D9VA 3N26A 4U2RA 1A8EA 1IXIA 1Y3QA 1LAGE 5EYFA 5L9SA 1HSJA 3CRBA 1Y3PA 2WKYA 4QSDA 4ECFA 1B2HA 1MG1A 4NE4A 5AA2B 2XXIA 4O3BA 1QULA 3EHUA 4R2BA 3KJ7A 4XKPA 1MXXA 1OLCA 1OVTA 1MXWA 1FQDA 4IO6A 1B58A 2XX8A 3R7XA 1B05A 4I1DA 1XC1A 5KCJB 1Q1KA 1IXHA 2XXVA 3FVNA 5I58B 4QFKA 3M3FA 3KN8A 3G3FA 3A3CA 1NKXA 5DVJA 3CG3A 3PPOA 3MJNA 3FIRA 4I62A 2UXAA 3SEUA 4F3PA 5AA2A 4GRKA 1R6ZA 3SDFA 2NOOA 2R9JA 2X26A 1SW5A 4C0RA 4FJPA 1GR2A 3FJ7A 3KBRA 5TPAB 4AB6A 3TYHA 3RTFB 2NWJA 1UTHB 3O6HA 1IUDA 4F1UA 3H6UA 3G3HA 3PMVA 2OWTA 1ZLQA 2RC8A 2KLFA 3LUYA 3UIFA 2D21A 2V3TA 4AQ4A 3C32A 3HSTA 3GBAA 2Q89A 4ZS9A 3L6HA 5H8SA 3OO6A 4IGTA 2I48A 1UTBB 1B1XA 3USDA 5ISUA 3Q27A 1LB8A 1JW4A 2NVUB 3SEYA 1MH3A 3FASA 5CI5A 1POTA 1ZTYA 1Y9UA 2ABHA 3TPAA 3IR1A 3PU5A 3E3KA 4OERA 4NF6B 5I2KB 2O1LA 4XKNA 5TPAA 4GXSB 2HAUA 1IQ7A 4LZ5A 3O2AA 1UTHA 4OMBA 4DCXA 4ISUA 4R2FA 1PDAA 3UP9A 3W9WA 1XVXA 4YMAA 3FV1A 2Y7KA 2QS3A 4XKQA 4U4XA 1AOVA 1N3WA 2XXXA 1QJMA 1TT1A 1UTBA 2ONKE 2GH9A 3U8QA 5I56B 4BDOA 1M5FA 3ILUB 3U92A 1I6AA 4FIMA 3AXFA 4OYVA 4NF6A 5I2KA 4KYEA 3KOTA 4BDNA 2RF1A 5HM4B 2ZYMA 4DLDA 4GLIA 2OCUA 4PETA 4E0XA 2B3BA 3BKIB 1M5EA 2RCBA 1FTOA 5JEIA 3MP6A 3PMWA 3GXAA 4GVOA 2F8DA 3Q25A 1HSLA 1B7HA 4L17A 3EF7A 4JDFA 4R6YA 4ZEBA 3VE1B 1NL5A 1MM7A 3RPWA 1MQGA 5I56A 3KG2A 2O84X 2QJEA 1URDA 4HCYA 4F29A 2A5SA 2AYSA 3VXCA 1I69A 1MH4A 3VDFA 3PMXA 3TCHA 2H98A 4EF1A 1MXZA 5LOMA 2RKMA 3A3UA 1PB9A 4NWDA 4GWOA 2O6AA 4JB7A 2I3WA 1GVCA 4KFQA 4FE8A 1LFHA 1VE4A 5B70A 4ZZAA 4IO4A 3OO9A 3C34A 3F11A 2Y7WA 5J1DA 1N0TA 1B32A 1MY4A 4IO2A 1CE2A 1NFTA 1B1HA 3DELB 4IGRA 3IB1A 3G3GA 4R74A 1B7UA 2I58A 3RUMA 1Q35A 1MPCA 1LLSA 4G68A 4ESXA 3O97A 4PFYA 1B51A 4C1UA 2F97A 3MZBA 1ZU0A 2FNCA 4R9GA 5L9MA 4OVJA 2QMWA 5AA4B 1D9YA 3TCGA 3TFLA 1EZ9A 2PMSA 3FJMA 5CBSA 1NNPA 3GZGA 3A09A 2LAOA 3N6UA 2E1SA 3UORA 4JXIA 2F36A 3OSRA 1JEUA 1N76A 3U94A 3VV5A 2ZYKA 3K1PA 4GXAA 1UIUA 4ZE9A 2Y7IA 3FVKA 3IOWA 4RA1A 5K2YA 3IL1B 3DP8A 3LSFB 4BDLA 4H0WA 1IIWA 2I6EA 3IX1A 5H8NB 1POY1 3K00A 3T9XB 1MPDA 2YJPA 3U1OA 4F2OA 4P11A 5AA4A 3S4UA 2PT1A 4LA9A 5CC2A 1H3DA 3IORA 2DVCA 3E4RA 1F9BA 1GTKA 3HV1A 1ZIUA 2ZMBA 3W9VA 1P1QA 3T96B 3MQ9A 1FQCA 1PC3A 4XTCQ 1LGBC 3R26A 1T0KA 2DS9A 5M2VA 2XXUA 3SETA 3VLUA 1ATGA 3IO4A 3FXUA 4DCYA 2F6PA 3C4MA 4F39A 1DTZA 5AA2D 4PFUA 5H8NA 4LP2B 3IB0A 2PX1A 1IXCA 1YAEA 3HHFA 3KN3A 3QSLA 4BDRA 2XXYA 1EZOA 3K6XA 1MPBA 2V25A 1FW0A 3B6TA 5BUUA 4EDPA 3K4UA 1EZPA 2DSFA 4M1VA 2OK2A 1VFEA 1US5A 2Z8DA 1MRPA 2HCAA 3WAEA 2VD3A 3OEMA 1WVJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FHO A;  1N7W A;  4PE5 B;  3T9V A;  2ONR A;  1XVY A;  5CM6 A;  1FTK A;  3ONM A;  3LSW A;  5FTI A;  2Q2C A;  2OZZ A;  3K6V A;  2XXQ A;  4ND9 A;  1NNT A;  5ITP A;  1BIY A;  3O6I A;  1CB6 A;  2GRV A;  2REG A;  4RJZ A;  2GHA A;  2F7C A;  2UYF A;  3OD7 A;  1MY0 A;  3S2V A;  1JW5 A;  3O6G A;  2XXT A;  3MVY A;  4RK2 A;  4H1X A;  2PVU A;  4YU0 A;  3C31 A;  3M8U A;  2OLB A;  3LSL A;  2ZYN A;  3FZV A;  4R75 A;  5L8D A;  3D4G A;  4LQ5 A;  2GHB A;  3T66 A;  5HPQ A;  5K2X A;  2I4C A;  1GGG A;  1JEV A;  4NTL A;  1WDN A;  3FUZ A;  4RNS A;  3B7D A;  3V5A A;  3QUJ A;  3E13 X;  4KD5 A;  4U1Z A;  1M5D A;  3KGC A;  4WEP A;  3B6Q A;  4YKI A;  1OIB A;  1HSE A;  3O29 A;  2DE3 A;  4H8I A;  4Z7E A;  3PUV E;  1VFD A;  1OVB A;  3JZJ A;  1TWY A;  1DPP A;  2H4I A;  4LVQ A;  4P0I A;  3K2D A;  3C9H A;  1YCJ A;  3K6W A;  5DT6 A;  4Q0C A;  3P7I A;  2Q9T A;  1B7Z A;  4ZDM A;  1MXV A;  5HBC A;  4NED A;  2XD2 A;  3MWB A;  3PD9 A;  4H5F A;  4LZ7 A;  3PUZ E;  5H8Q B;  3TAJ A;  1LCT A;  4OZ9 A;  1Z7M E;  1B46 A;  5EHM A;  3T9U A;  3TEP A;  4KHZ E;  3CIJ A;  2HXW A;  3TOD A;  2ZNU A;  2ALU A;  3QAX A;  4R6H A;  5KCJ A;  4BLA A;  4KPT A;  4DE8 A;  3FV2 A;  5I58 A;  3CR9 A;  2F35 A;  1NNF A;  3H6V A;  3DP4 A;  1R9L A;  1SD3 A;  2PYY A;  3RN8 A;  4Q8R A;  3IJX B;  1XT8 A;  1MDQ A;  4G8M A;  3S9M C;  4FED A;  3H03 A;  1MXY A;  4XKR A;  2B65 A;  3IAZ A;  4F1V A;  1S50 A;  2DE4 A;  4YB7 A;  2UYE A;  3C33 A;  3H7M A;  4H6D A;  5CBR A;  1FTM A;  2P1S A;  3MVX A;  5DVI A;  4DDD A;  2HZL A;  3VVD A;  3HO7 A;  2Y84 A;  1M5B A;  1QVS A;  1XOC A;  4NF4 B;  4ELR A;  1QUJ A;  2VP1 A;  3MZ9 A;  4FEB A;  3TZA A;  1SDX A;  3S9L C;  5B7D A;  4OWD A;  1JVX A;  2O68 A;  3EHS A;  3RT8 A;  1A7L A;  4GIZ A;  3ZKK A;  4PP0 A;  2UVJ A;  4G4P A;  4DIG A;  3M3K A;  1LAH E;  3H6W A;  3CFZ A;  3OO8 A;  3D4C A;  4OFL A;  4YKJ A;  4ELO A;  1B0L A;  3KSX A;  1B6H A;  5DTB A;  3OMB A;  2Z22 A;  3FVG A;  2F5X A;  2O7U A;  2ZXT A;  4IY5 A;  3OO7 A;  2E0S A;  1UIV A;  4XIG Q;  2IEE A;  2H9B A;  4QHQ A;  1AIV A;  4IY6 A;  4EXK A;  2DOJ A;  4OES A;  2H99 A;  4F18 A;  3FD3 A;  2IA4 A;  1VSO A;  4KCC A;  2V3Q A;  2VOZ A;  2OBG A;  4TQU Q;  4IO5 A;  3KOS A;  3T93 B;  4WED A;  1XHY A;  3DM0 A;  4OQO A;  1EH3 A;  1S7Y A;  1MDP 1;  3K6U A;  1A55 A;  3G3J A;  3UA8 A;  3G3K A;  1SBP A;  3C35 A;  4QFL A;  4N07 A;  4LAT A;  3IK6 B;  1MQD A;  1O64 A;  4HS7 A;  2F7B A;  4ZEC A;  1SW4 A;  4EQB A;  2F7A A;  3MZ1 A;  4WXJ A;  1PB8 A;  1JVY A;  4UAC A;  1JET A;  3HN0 A;  5CRY A;  3CG1 A;  2Q8J A;  4FAT A;  3TMG A;  4FEC A;  2X7Q A;  4AB5 A;  4OEV A;  4DZ1 A;  5FHM A;  4QFO A;  3EHT A;  4GQO A;  1Y20 A;  2A5T B;  3HCQ A;  2O1M A;  2DWI A;  1L5T A;  1SVX B;  1FQF A;  1MY1 A;  2AL4 A;  4KI0 E;  1WOD A;  4JBZ A;  5L9O A;  2Z23 A;  3KN7 A;  2F78 A;  1AL3 A;  1LFG A;  1VR5 A;  4OFO A;  2I3V A;  3N5L A;  4U23 A;  3L6G A;  2O69 A;  4G8H A;  3KEI A;  1N04 A;  3TEL A;  4YKP A;  4G68 C;  3SKP A;  4N13 A;  2HAV A;  5DVF A;  1MQI A;  4POX A;  3LC8 A;  1B5J A;  2G29 A;  3PPN A;  3ZKL A;  2A5T A;  1SYH A;  3I5O A;  4LUB A;  4U4S A;  3VFJ A;  4U22 A;  4YIC A;  4QSC A;  2HZK A;  3FXR A;  5AA1 A;  3TKD A;  2YLN A;  3UK4 A;  3UGW A;  2XXH A;  1SW1 A;  3PUW E;  1QKB A;  3QUF A;  1N7X A;  3RGY A;  1NMU A;  1IXG A;  3E9X A;  5IAI A;  3N94 A;  4F3S A;  2XXP A;  3MVZ A;  4EQ9 A;  2RIN A;  2R71 A;  3H3G A;  4JSO A;  4U1O A;  2DVZ A;  2UVI A;  4DXC A;  4HW8 A;  1LCF A;  5I2N B;  2M8C A;  2QS1 A;  1XS5 A;  2ZYO A;  2V84 A;  1DSN A;  2Z8E A;  4FOR A;  3K01 A;  4OHN A;  1H45 A;  4F1Y A;  1I6B A;  5DEX B;  2ONS A;  3C36 A;  2OJT A;  2NXO A;  4DXU A;  2Q88 A;  4MFI A;  1LBB A;  2UVH A;  4UA8 A;  1A99 A;  2GFE A;  1BTJ A;  4YZZ A;  4GOT A;  5BWJ A;  1OQG A;  3RLF E;  1YTV A;  3O66 A;  2RCA A;  4EUO A;  3K02 A;  2R6G E;  3MC2 A;  2RC9 A;  4GD5 A;  4H5G A;  1Y4T A;  5I2N A;  1SYI A;  5JTY B;  3OOA A;  4PFT A;  4JSD A;  1NH8 A;  1P1W A;  4F31 B;  4F2Q A;  4OXV A;  3OEL A;  1SW2 A;  3HHG A;  3FXQ A;  1JW1 A;  3RNN A;  4Q30 B;  5DEX A;  3TTK A;  2H25 A;  3MVW A;  4YMB A;  1H44 A;  2DWA A;  5FHN A;  4JWO A;  1US4 A;  2XXW A;  3M3L A;  1USY E;  3TTN A;  1ZJL A;  4K3F A;  5H8F B;  4ELQ A;  4P0G A;  4X1B A;  3Q28 A;  2CMO A;  3CFX A;  4BDM A;  5ICT A;  4GFR A;  1MS7 A;  1Z7N E;  3B6W A;  4ZEK A;  1RKM A;  1II5 A;  5AA3 A;  3DP6 A;  1J1N A;  2NUV A;  4LON B;  4Z0I A;  4ZEF A;  2PT2 A;  1P1O A;  3V8X B;  2X7P A;  5JTY A;  5F1Q A;  4KYD A;  3T9H B;  4MLV A;  1D3K A;  2QPQ A;  2REJ A;  4MH5 A;  2DQV A;  5I59 B;  1I6Q A;  2AIX A;  4IO7 A;  4IO3 A;  4KYS A;  2ESN A;  4RPO A;  4R72 A;  1B9J A;  1A54 A;  1R1N A;  4HTG A;  3RT6 B;  1MQJ A;  2V3U A;  3ECR A;  1ZKB A;  4H8J A;  4ELP A;  5KZT A;  4XXU A;  3N6T A;  2DP8 A;  5H8F A;  4KR5 A;  3FGS A;  1H76 A;  2QRY A;  3VVF A;  2QS2 A;  1NH7 A;  1RYO A;  1MY2 A;  2F6G A;  2Y7P A;  2RC7 A;  3TTR A;  1M5C A;  1FQB A;  1PBQ A;  4EXL A;  1OMP A;  4KQP A;  1BLF A;  1FTJ A;  3TQW A;  4X9T A;  1JQF A;  3TUS A;  1ANF A;  3MPK A;  3V83 A;  5I59 A;  3EQ1 A;  2Y7R A;  3MPL A;  1TFA A;  1LB9 A;  3MBP A;  3DLN A;  1LAX A;  1PBP A;  5ELV A;  4F22 A;  2UVG A;  5AE4 A;  2QS4 A;  1Y1M A;  2Z8F A;  1FCK A;  3IO6 A;  4DXB A;  1MQH A;  4ONY A;  3CSG A;  1FQA A;  2DXR A;  3S9E A;  1B52 A;  4X1D A;  4F3B A;  4OEN A;  1OLA A;  3RQT A;  1QKA A;  3THI A;  2VHA A;  4OEU A;  3I6V A;  2XX7 A;  1KWH A;  3K1N A;  3H4Z A;  1SQY A;  5CMC A;  4NWC A;  3OEK A;  2I49 A;  4YB6 A;  2THI A;  3U93 A;  3I3V A;  5H8Q A;  1LST A;  3PUY E;  3TCF A;  2XX9 A;  3ILT B;  4N6P A;  3IB2 A;  2HFB A;  3PD8 A;  1ZMG A;  3GLB A;  1B5H A;  4ZE8 A;  4KCD A;  2XD3 A;  1SI1 A;  4U21 A;  2F34 A;  5F7V A;  4TLM B;  1DMB A;  3KSJ A;  3UN6 A;  1BP5 A;  3JV9 A;  3SEX A;  2DWJ A;  3S9N C;  4OET A;  4OFJ A;  3U72 A;  3QXM A;  3ZS6 A;  3OXN A;  3FJG A;  4F3G A;  1B4Z A;  3CFL A;  1PB7 A;  3IOV A;  4NF4 A;  2G93 A;  3MUQ A;  1AH5 A;  2I0B A;  1B4H A;  4NF5 B;  1YPN A;  1SI0 A;  4TOZ A;  5CMB A;  1IIT A;  4RXL A;  4NF8 B;  3PV0 E;  4FAJ A;  3WAF A;  1LAF E;  1O7T A;  2BJJ X;  3K1M A;  1NNK A;  2P2A A;  1ELJ A;  1EU8 A;  1P99 A;  3LR1 A;  5KDT B;  3G7W A;  3KFM A;  4ZZE A;  3CVG A;  1JNF A;  4IB2 A;  4QF9 A;  3ZSF A;  4ZEI A;  1B3H A;  3TDJ A;  3VVE A;  4EF2 A;  1Y3N A;  3PUX E;  4RPN A;  5I57 B;  1O63 A;  3Q29 A;  3MAM A;  3KZG A;  2OWS A;  1URS A;  3H06 B;  2I4B A;  1QUI A;  3TQL A;  4NF5 A;  1B3L A;  3O9P A;  4G68 B;  4JWX A;  1B0H A;  1MXU A;  3K0V A;  4NF8 A;  1D4N A;  4POW A;  4JWY A;  1RYX A;  4YAH X;  1TFD A;  1QW0 A;  4G2Z A;  4I8C A;  1N84 A;  4YKK A;  4C1T A;  3VLV A;  1LBC A;  2W7Y A;  1FQE A;  4THI A;  3FVO A;  2QL3 A;  5DYH A;  1Y4C A;  3FAT A;  1H43 A;  4GF8 A;  4WKM A;  5KDT A;  5H8H B;  2QSX A;  2XHD A;  2ANJ A;  4E0W A;  5I84 A;  4OTE A;  1AMF A;  3Q26 A;  5TU0 A;  3QYT A;  2CZL A;  2P0S A;  5I57 A;  5TP9 B;  1BKA A;  4LQ2 A;  4R6K A;  2ZNS A;  3TTM A;  4G8N A;  4F19 A;  1B5I A;  2I0C A;  3RY3 A;  2HEU A;  2D3I A;  3T22 A;  4R9F A;  1UQW A;  1Y1Z A;  3MW0 A;  4EQ7 A;  1B3G A;  1B3E A;  4ESW A;  1P1U A;  4MLQ A;  3W15 C;  3IOT A;  5H8H A;  4QRZ A;  2DE2 A;  3MP1 A;  4H65 A;  3G3I A;  1ZBM A;  3RTW B;  1B3F A;  3V89 B;  5ITO A;  5A5X B;  3TTL A;  3QIM A;  3EN3 A;  5TP9 A;  5JK4 A;  5CMM A;  3SEW A;  1MY3 A;  1R9Q A;  3O28 A;  4M4G A;  1MM6 A;  4RK9 A;  5FTH A;  1QUK A;  5ICQ A;  1S9T A;  1DPE A;  4GL0 A;  5IKB A;  4YB5 A;  3BFT A;  3SER A;  4PQJ A;  3OSQ A;  1USY H;  1OQH A;  4H67 A;  5CMK A;  1N3X A;  3OEN A;  1TXF A;  1LFI A;  1B40 A;  1FTL A;  4R73 A;  4O3A A;  2PBW A;  4NMY A;  1DTG A;  1IEJ A;  1P1N A;  3CI8 A;  4X48 A;  4GL8 A;  3GBB A;  1A8F A;  2Q2A A;  3R6U A;  3QK6 A;  4I9D A;  5A5X A;  4LZ8 A;  2B3F A;  3SES A;  3IOU A;  1PEB A;  4O3C A;  2VGQ A;  2FA7 A;  3H6T A;  4MBP A;  2YPN A;  1URG A;  2FYI A;  3PPQ A;  3ODB A;  3BBR A;  3VXB A;  3LBS A;  2DWH A;  3PPP A;  4Q5T A;  2O7I A;  3EPE A;  4QSE A;  3IJO B;  3LSX A;  4RYA A;  1DOT A;  4QFN A;  3KJT A;  2XXR A;  3JYR A;  3PPR A;  3SEV A;  2DXY A;  1GV8 A;  3CSB A;  2D5W A;  4PFW A;  4TLL B;  1IZ1 A;  2VD2 A;  3VLW A;  4MF3 A;  4RY1 A;  2H5Y A;  2O51 A;  5EHS A;  2DYX A;  3BFU A;  2QMX A;  4QFP A;  4HCW A;  4G77 A;  3PGF A;  2V93 A;  2HQ0 A;  3HPI A;  1A40 A;  4BDQ A;  2ZNT A;  2AL5 A;  3MP8 A;  4ZED A;  1D9V A;  3N26 A;  4U2R A;  1A8E A;  1IXI A;  1Y3Q A;  1LAG E;  5EYF A;  5L9S A;  1HSJ A;  3CRB A;  1Y3P A;  2WKY A;  4QSD A;  4ECF A;  1B2H A;  1MG1 A;  4NE4 A;  5AA2 B;  2XXI A;  4O3B A;  1QUL A;  3EHU A;  4R2B A;  3KJ7 A;  4XKP A;  1MXX A;  1OLC A;  1OVT A;  1MXW A;  1FQD A;  4IO6 A;  1B58 A;  2XX8 A;  3R7X A;  1B05 A;  4I1D A;  1XC1 A;  5KCJ B;  1Q1K A;  1IXH A;  2XXV A;  3FVN A;  5I58 B;  4QFK A;  3M3F A;  3KN8 A;  3G3F A;  3A3C A;  1NKX A;  5DVJ A;  3CG3 A;  3PPO A;  3MJN A;  3FIR A;  4I62 A;  2UXA A;  3SEU A;  4F3P A;  5AA2 A;  4GRK A;  1R6Z A;  3SDF A;  2NOO A;  2R9J A;  2X26 A;  1SW5 A;  4C0R A;  4FJP A;  1GR2 A;  3FJ7 A;  3KBR A;  5TPA B;  4AB6 A;  3TYH A;  3RTF B;  2NWJ A;  1UTH B;  3O6H A;  1IUD A;  4F1U A;  3H6U A;  3G3H A;  3PMV A;  2OWT A;  1ZLQ A;  2RC8 A;  2KLF A;  3LUY A;  3UIF A;  2D21 A;  2V3T A;  4AQ4 A;  3C32 A;  3HST A;  3GBA A;  2Q89 A;  4ZS9 A;  3L6H A;  5H8S A;  3OO6 A;  4IGT A;  2I48 A;  1UTB B;  1B1X A;  3USD A;  5ISU A;  3Q27 A;  1LB8 A;  1JW4 A;  2NVU B;  3SEY A;  1MH3 A;  3FAS A;  5CI5 A;  1POT A;  1ZTY A;  1Y9U A;  2ABH A;  3TPA A;  3IR1 A;  3PU5 A;  3E3K A;  4OER A;  4NF6 B;  5I2K B;  2O1L A;  4XKN A;  5TPA A;  4GXS B;  2HAU A;  1IQ7 A;  4LZ5 A;  3O2A A;  1UTH A;  4OMB A;  4DCX A;  4ISU A;  4R2F A;  1PDA A;  3UP9 A;  3W9W A;  1XVX A;  4YMA A;  3FV1 A;  2Y7K A;  2QS3 A;  4XKQ A;  4U4X A;  1AOV A;  1N3W A;  2XXX A;  1QJM A;  1TT1 A;  1UTB A;  2ONK E;  2GH9 A;  3U8Q A;  5I56 B;  4BDO A;  1M5F A;  3ILU B;  3U92 A;  1I6A A;  4FIM A;  3AXF A;  4OYV A;  4NF6 A;  5I2K A;  4KYE A;  3KOT A;  4BDN A;  2RF1 A;  5HM4 B;  2ZYM A;  4DLD A;  4GLI A;  2OCU A;  4PET A;  4E0X A;  2B3B A;  3BKI B;  1M5E A;  2RCB A;  1FTO A;  5JEI A;  3MP6 A;  3PMW A;  3GXA A;  4GVO A;  2F8D A;  3Q25 A;  1HSL A;  1B7H A;  4L17 A;  3EF7 A;  4JDF A;  4R6Y A;  4ZEB A;  3VE1 B;  1NL5 A;  1MM7 A;  3RPW A;  1MQG A;  5I56 A;  3KG2 A;  2O84 X;  2QJE A;  1URD A;  4HCY A;  4F29 A;  2A5S A;  2AYS A;  3VXC A;  1I69 A;  1MH4 A;  3VDF A;  3PMX A;  3TCH A;  2H98 A;  4EF1 A;  1MXZ A;  5LOM A;  2RKM A;  3A3U A;  1PB9 A;  4NWD A;  4GWO A;  2O6A A;  4JB7 A;  2I3W A;  1GVC A;  4KFQ A;  4FE8 A;  1LFH A;  1VE4 A;  5B70 A;  4ZZA A;  4IO4 A;  3OO9 A;  3C34 A;  3F11 A;  2Y7W A;  5J1D A;  1N0T A;  1B32 A;  1MY4 A;  4IO2 A;  1CE2 A;  1NFT A;  1B1H A;  3DEL B;  4IGR A;  3IB1 A;  3G3G A;  4R74 A;  1B7U A;  2I58 A;  3RUM A;  1Q35 A;  1MPC A;  1LLS A;  4G68 A;  4ESX A;  3O97 A;  4PFY A;  1B51 A;  4C1U A;  2F97 A;  3MZB A;  1ZU0 A;  2FNC A;  4R9G A;  5L9M A;  4OVJ A;  2QMW A;  5AA4 B;  1D9Y A;  3TCG A;  3TFL A;  1EZ9 A;  2PMS A;  3FJM A;  5CBS A;  1NNP A;  3GZG A;  3A09 A;  2LAO A;  3N6U A;  2E1S A;  3UOR A;  4JXI A;  2F36 A;  3OSR A;  1JEU A;  1N76 A;  3U94 A;  3VV5 A;  2ZYK A;  3K1P A;  4GXA A;  1UIU A;  4ZE9 A;  2Y7I A;  3FVK A;  3IOW A;  4RA1 A;  5K2Y A;  3IL1 B;  3DP8 A;  3LSF B;  4BDL A;  4H0W A;  1IIW A;  2I6E A;  3IX1 A;  5H8N B;  1POY 1;  3K00 A;  3T9X B;  1MPD A;  2YJP A;  3U1O A;  4F2O A;  4P11 A;  5AA4 A;  3S4U A;  2PT1 A;  4LA9 A;  5CC2 A;  1H3D A;  3IOR A;  2DVC A;  3E4R A;  1F9B A;  1GTK A;  3HV1 A;  1ZIU A;  2ZMB A;  3W9V A;  1P1Q A;  3T96 B;  3MQ9 A;  1FQC A;  1PC3 A;  4XTC Q;  1LGB C;  3R26 A;  1T0K A;  2DS9 A;  5M2V A;  2XXU A;  3SET A;  3VLU A;  1ATG A;  3IO4 A;  3FXU A;  4DCY A;  2F6P A;  3C4M A;  4F39 A;  1DTZ A;  5AA2 D;  4PFU A;  5H8N A;  4LP2 B;  3IB0 A;  2PX1 A;  1IXC A;  1YAE A;  3HHF A;  3KN3 A;  3QSL A;  4BDR A;  2XXY A;  1EZO A;  3K6X A;  1MPB A;  2V25 A;  1FW0 A;  3B6T A;  5BUU A;  4EDP A;  3K4U A;  1EZP A;  2DSF A;  4M1V A;  2OK2 A;  1VFE A;  1US5 A;  2Z8D A;  1MRP A;  2HCA A;  3WAE A;  2VD3 A;  3OEM A;  1WVJ A; 
#chains in the Genus database with same CATH topology
 5FHO A;  1N7W A;  4PE5 B;  3T9V A;  2ONR A;  1XVY A;  5CM6 A;  1FTK A;  3ONM A;  4GWW A;  4MNP A;  3LSW A;  4NN3 A;  5FTI A;  4OVR A;  2Q2C A;  4N8Y A;  2OZZ A;  3K6V A;  4PFR A;  2XXQ A;  4ND9 A;  1NNT A;  5ITP A;  1BIY A;  2B4L A;  3O6I A;  1G0I A;  1CB6 A;  2GRV A;  2REG A;  1FPI A;  4GBV A;  4RJZ A;  2GHA A;  2MKZ A;  2F7C A;  1KZ8 A;  2UYF A;  5ET8 A;  3OD7 A;  1MY0 A;  5LDZ A;  3S2V A;  1JW5 A;  4P8B A;  3O6G A;  2XXT A;  3MVY A;  4RK2 A;  4H1X A;  2PVU A;  4YU0 A;  1FPB A;  3C31 A;  4PCD A;  3M8U A;  2OLB A;  3LSL A;  1FJ6 A;  2ZYN A;  3FZV A;  4R75 A;  5L8D A;  3D4G A;  4LQ5 A;  2GHB A;  3T66 A;  5A5L A;  5HPQ A;  5K2X A;  1FBG A;  2I4C A;  4PGP A;  1GGG A;  1JEV A;  4NTL A;  1WDN A;  3FUZ A;  4RNS A;  3B7D A;  3V5A A;  3QUJ A;  3E13 X;  4KD5 A;  1DCU A;  4U1Z A;  1M5D A;  3KGC A;  4WEP A;  3B6Q A;  4YKI A;  1OIB A;  1HSE A;  3O29 A;  2DE3 A;  4H8I A;  4Z7E A;  3E79 A;  3PUV E;  1VFD A;  1OVB A;  3JZJ A;  1TWY A;  1DPP A;  2H4I A;  2R8T A;  4LVQ A;  4P0I A;  3K2D A;  3C9H A;  1YCJ A;  3K6W A;  1SPI A;  1AWB A;  5DT6 A;  4Q0C A;  3P7I A;  2Q9T A;  1B7Z A;  4ZDM A;  1MXV A;  5HBC A;  4NED A;  2XD2 A;  1LEV A;  3MWB A;  1IMB A;  3PD9 A;  4H5F A;  4MAG A;  4LZ7 A;  3PUZ E;  3SZP A;  5H8Q B;  3TAJ A;  1LCT A;  4OZ9 A;  1Z7M E;  1B46 A;  5EHM A;  3T9U A;  4GWY A;  3TEP A;  4KHZ E;  3CIJ A;  2HXW A;  4PFB A;  3TOD A;  2ZNU A;  1NV3 A;  2ALU A;  4G61 A;  3QAX A;  4R6H A;  5KCJ A;  4BLA A;  4KPT A;  4DE8 A;  1LBY A;  3FV2 A;  5I58 A;  3CR9 A;  2F35 A;  1NNF A;  3H6V A;  3DP4 A;  1R9L A;  5EQ7 A;  1SD3 A;  2PYY A;  3RN8 A;  4Q8R A;  3IJX B;  1XT8 A;  1MDQ A;  4G8M A;  3S9M C;  4FED A;  3H03 A;  1DK4 A;  1MXY A;  4XKR A;  2B65 A;  4PBH A;  3IAZ A;  4F1V A;  1S50 A;  2DE4 A;  4YB7 A;  2UYE A;  3C33 A;  3H7M A;  4H6D A;  5CBR A;  1FTM A;  2P1S A;  4GWU A;  3MVX A;  5DVI A;  4DDD A;  2HZL A;  3VVD A;  3HO7 A;  2Y84 A;  1M5B A;  1QVS A;  1XOC A;  4NF4 B;  4ELR A;  1QUJ A;  2VP1 A;  3MZ9 A;  4FEB A;  4MIJ A;  3TZA A;  1SDX A;  3S9L C;  5B7D A;  4OWD A;  3LUZ A;  1JVX A;  2O68 A;  3EHS A;  3RT8 A;  1A7L A;  5IGA A;  4GIZ A;  3ZKK A;  4PP0 A;  2XWI A;  2UVJ A;  4G4P A;  4DIG A;  3M3K A;  5IM2 A;  1LAH E;  4P3L A;  3H6W A;  3CFZ A;  3OO8 A;  2CEX A;  3D4C A;  4OFL A;  4YKJ A;  4ELO A;  1B0L A;  4MHF A;  3KSX A;  1B6H A;  5DTB A;  3OMB A;  2Z22 A;  3FVG A;  2F5X A;  2O7U A;  2ZXT A;  4IY5 A;  3OO7 A;  2E0S A;  1UIV A;  1K9Z A;  4XIG Q;  2IEE A;  2Q74 A;  2H9B A;  4QHQ A;  1AIV A;  4IY6 A;  4EXK A;  2DOJ A;  4OES A;  2H99 A;  4F18 A;  3FD3 A;  2IA4 A;  1VSO A;  4KCC A;  1FRP A;  2V3Q A;  2VOZ A;  2OBG A;  4MX6 A;  4TQU Q;  4IO5 A;  3KOS A;  3T93 B;  4WED A;  1XHY A;  3DM0 A;  4OQO A;  1EH3 A;  4OAN A;  1S7Y A;  1MDP 1;  2QFL A;  3K6U A;  1A55 A;  3G3J A;  3UA8 A;  3G3K A;  1SBP A;  3C35 A;  4QFL A;  4N07 A;  4LAT A;  3IK6 B;  1MQD A;  4NX1 A;  1O64 A;  4HS7 A;  2F7B A;  4ZEC A;  1SW4 A;  4EQB A;  2F7A A;  5LTC A;  3MZ1 A;  4WXJ A;  1PB8 A;  1JVY A;  4UAC A;  1JET A;  3HN0 A;  5CRY A;  2QVU A;  3B8B A;  4N81 A;  3CG1 A;  2Q8J A;  4FAT A;  3TMG A;  4FEC A;  2X7Q A;  4AB5 A;  4OEV A;  4DZ1 A;  5FHM A;  4QFO A;  3EHT A;  4GQO A;  5ET5 A;  1Y20 A;  2A5T B;  3HCQ A;  2O1M A;  2DWI A;  2XXK A;  1L5T A;  1D9Q A;  1SVX B;  1FQF A;  1MY1 A;  2AL4 A;  4KI0 E;  1WOD A;  4JBZ A;  5L9O A;  2Z23 A;  3KN7 A;  1NV4 A;  2F78 A;  1AL3 A;  1LFG A;  1VR5 A;  4OFO A;  2I3V A;  4P47 A;  3N5L A;  4U23 A;  3L6G A;  2O69 A;  4G8H A;  3KEI A;  1N04 A;  1FPK A;  3TEL A;  1YYZ A;  4YKP A;  4G68 C;  3SKP A;  2FIE A;  4N13 A;  1FBD A;  2HAV A;  5DVF A;  1MQI A;  4POX A;  3LC8 A;  1B5J A;  2G29 A;  3T1B A;  3PPN A;  3ZKL A;  2A5T A;  1SYH A;  2PFZ A;  3I5O A;  4MJO A;  4LUB A;  1FPJ A;  4U4S A;  4PE3 A;  3VFJ A;  4U22 A;  4YIC A;  4QSC A;  4NAP A;  2HZK A;  3FXR A;  5AA1 A;  3TKD A;  2YLN A;  3UK4 A;  3UGW A;  2XXH A;  1SW1 A;  3PUW E;  1QKB A;  3QUF A;  1N7X A;  3RGY A;  1NMU A;  1IXG A;  2XWK A;  3E9X A;  5IAI A;  3N94 A;  4MMP A;  4F3S A;  2XXP A;  3MVZ A;  4EQ9 A;  2RIN A;  4GWX A;  2R71 A;  3H3G A;  4JSO A;  4U1O A;  2DVZ A;  2UVI A;  2HXR A;  4DXC A;  3BIG A;  4HW8 A;  1LCF A;  5I2N B;  2M8C A;  2QS1 A;  4MNI A;  1XS5 A;  2ZYO A;  2V84 A;  1DSN A;  2Z8E A;  4FOR A;  3K01 A;  4OHN A;  1H45 A;  4F1Y A;  4O8M A;  1I6B A;  4NG7 A;  5DEX B;  2ONS A;  3C36 A;  2OJT A;  2NXO A;  4DXU A;  1RDY A;  2Q88 A;  4MFI A;  5J16 A;  1LBB A;  2UVH A;  4UA8 A;  1A99 A;  2GFE A;  1BTJ A;  4YZZ A;  2P3V A;  1IMD A;  4GOT A;  5BWJ A;  4N91 A;  1OQG A;  3RLF E;  1YTV A;  4IR8 A;  3O66 A;  2RCA A;  4EUO A;  3K02 A;  2R6G E;  3MC2 A;  2RC9 A;  4GD5 A;  4H5G A;  1Y4T A;  5I2N A;  5IZ1 A;  1SYI A;  5JTY B;  3OOA A;  4PFT A;  4JSD A;  1NH8 A;  4N6K A;  5T3J A;  1P1W A;  4F31 B;  4F2Q A;  4OXV A;  3OEL A;  1SW2 A;  3HHG A;  3FXQ A;  1JW1 A;  3RNN A;  4Q30 B;  5DEX A;  3TTK A;  2H25 A;  3MVW A;  4YMB A;  1H44 A;  2DWA A;  5FHN A;  4JWO A;  4DI3 D;  1US4 A;  4P56 A;  2XXW A;  3M3L A;  1USY E;  3TTN A;  1ZJL A;  4K3F A;  4N15 A;  5H8F B;  4ELQ A;  4P0G A;  4X1B A;  3Q28 A;  3BIH A;  2CMO A;  3CFX A;  3KBZ A;  4BDM A;  5ICT A;  1QGX A;  4GFR A;  1MS7 A;  5I7I A;  1Z7N E;  3B6W A;  4ZEK A;  2XWO A;  1RKM A;  2B4M A;  1II5 A;  5AA3 A;  3DP6 A;  1J1N A;  2NUV A;  4LON B;  3GYY A;  4Z0I A;  4QXD A;  4ZEF A;  2PT2 A;  1P1O A;  3V8X B;  2X7P A;  5JTY A;  5F1Q A;  3RPL B;  4KYD A;  3T9H B;  4MLV A;  1D3K A;  2QPQ A;  2REJ A;  4MH5 A;  1FPF A;  4I3Y A;  2DQV A;  5I59 B;  1I6Q A;  2AIX A;  1FBC A;  4IO7 A;  4IO3 A;  4KYS A;  2ESN A;  4RPO A;  4R72 A;  1B9J A;  1A54 A;  1R1N A;  4HTG A;  3RT6 B;  1MQJ A;  2V3U A;  3ECR A;  1ZKB A;  4H8J A;  4ELP A;  5KZT A;  4XXU A;  3N6T A;  2DP8 A;  5H8F A;  4KR5 A;  3FGS A;  1H76 A;  2QRY A;  3VVF A;  2QS2 A;  5I5P A;  1NH7 A;  1RYO A;  1IMA A;  1MY2 A;  2F6G A;  2Y7P A;  1IMF A;  2RC7 A;  3TTR A;  1M5C A;  1FQB A;  1PBQ A;  4EXL A;  1OMP A;  3ISP A;  4KQP A;  1BLF A;  1FTJ A;  3TQW A;  4X9T A;  1JQF A;  3RPL A;  3TUS A;  1ANF A;  3MPK A;  3V83 A;  4UAB A;  5I59 A;  1DBZ A;  3EQ1 A;  2Y7R A;  3MPL A;  1TFA A;  1LB9 A;  3MBP A;  3DLN A;  1LAX A;  1PBP A;  5ELV A;  1FSA A;  4F22 A;  2UVG A;  5EQ9 A;  5AE4 A;  2QS4 A;  1Y1M A;  2Z8F A;  1FCK A;  3IO6 A;  2ZZW A;  1FBH A;  4DXB A;  1MQH A;  4ONY A;  3CSG A;  1FQA A;  2DXR A;  3S9E A;  1B52 A;  4X1D A;  4F3B A;  4OEN A;  1OLA A;  1RDZ A;  3RQT A;  3KC1 A;  1RDX A;  4PF8 A;  3CHG A;  1QKA A;  3THI A;  2VHA A;  4OEU A;  3I6V A;  4GWZ A;  2XX7 A;  1KWH A;  3K1N A;  4HXV A;  3H4Z A;  1SQY A;  5CMC A;  4NWC A;  3OEK A;  2I49 A;  4YB6 A;  2THI A;  3U93 A;  3I3V A;  5H8Q A;  1LST A;  3PUY E;  3TCF A;  2CZK A;  2XX9 A;  3ILT B;  4N6P A;  3IB2 A;  4GX4 A;  2HFB A;  3PD8 A;  1ZMG A;  3GLB A;  1B5H A;  4ZE8 A;  4KCD A;  2BJI A;  3KC0 A;  2XD3 A;  1SI1 A;  4U21 A;  2F34 A;  5F7V A;  4TLM B;  2VT5 A;  3A29 A;  1DMB A;  3KSJ A;  3UN6 A;  1BP5 A;  3JV9 A;  3SEX A;  2DWJ A;  3S9N C;  4OET A;  4OFJ A;  2V4C A;  4OA4 A;  3U72 A;  4XEQ A;  3QXM A;  3ZS6 A;  3OXN A;  3FJG A;  1KA0 A;  4F3G A;  4HE2 A;  4KXP A;  1B4Z A;  3CFL A;  4JVI A;  1PB7 A;  3IOV A;  4NF4 A;  2G93 A;  3MUQ A;  1AH5 A;  2I0B A;  1B4H A;  4NF5 B;  1YPN A;  1SI0 A;  4TOZ A;  5CMB A;  1IIT A;  4RXL A;  4NF8 B;  3PV0 E;  2VPO A;  4FAJ A;  3WAF A;  1LAF E;  1O7T A;  2BJJ X;  3K1M A;  4GBW A;  2QVR A;  1G0H A;  1NNK A;  2P2A A;  1ELJ A;  1EU8 A;  1P99 A;  3LR1 A;  4N17 A;  5KDT B;  3G7W A;  3KFM A;  4ZZE A;  3CVG A;  1JNF A;  4IB2 A;  1VDW A;  4QF9 A;  3ZSF A;  4ZEI A;  1B3H A;  3TDJ A;  3VVE A;  4EF2 A;  1Y3N A;  3PUX E;  4RPN A;  5I57 B;  1O63 A;  3Q29 A;  3MAM A;  3KZG A;  2OWS A;  1URS A;  3H06 B;  2I4B A;  1QUI A;  3TQL A;  4NF5 A;  1B3L A;  3O9P A;  4G68 B;  4JWX A;  1B0H A;  1MXU A;  3K0V A;  3QMF A;  4NF8 A;  3ROJ A;  1D4N A;  5IZ3 B;  4NF0 A;  4POW A;  4JWY A;  1RYX A;  4YAH X;  1TFD A;  5IZZ A;  3RYD A;  4N8G A;  1QW0 A;  4G2Z A;  4I8C A;  1FPD A;  1N84 A;  4YKK A;  2WX9 A;  4C1T A;  3VLV A;  1LBC A;  2W7Y A;  4PDD A;  1FQE A;  4THI A;  3FVO A;  2QL3 A;  5DYH A;  1Y4C A;  3FAT A;  1H43 A;  4GF8 A;  4WKM A;  5KDT A;  5H8H B;  1IMC A;  2QSX A;  2XHD A;  1NV6 A;  4N4U A;  2ANJ A;  4E0W A;  5I84 A;  4OTE A;  1AMF A;  3Q26 A;  5TU0 A;  2WBD A;  3QYT A;  2CZL A;  4PAF A;  2P0S A;  4PAI A;  5I57 A;  1NV7 A;  5TP9 B;  1BKA A;  4LQ2 A;  4R6K A;  2ZNS A;  3TTM A;  4O7I A;  4G8N A;  2HPG A;  3NOH A;  4F19 A;  1B5I A;  4PC9 A;  2I0C A;  3RY3 A;  1NI9 A;  5IZ3 A;  2KQZ A;  2HEU A;  4OVQ A;  2D3I A;  3T22 A;  4R9F A;  2XWV A;  1UQW A;  1Y1Z A;  3MW0 A;  4EQ7 A;  1B3G A;  1B3E A;  4ESW A;  1P1U A;  1FPE A;  4MLQ A;  3W15 C;  3IOT A;  5H8H A;  4QRZ A;  2DE2 A;  3MP1 A;  4H65 A;  3G3I A;  1ZBM A;  1LBV A;  4NHB A;  3RTW B;  1B3F A;  3V89 B;  5ITO A;  5A5X B;  3TTL A;  3QIM A;  3EN3 A;  5TP9 A;  5JK4 A;  5CMM A;  3SEW A;  1MY3 A;  1R9Q A;  3O28 A;  4AS5 A;  4M4G A;  1MM6 A;  4RK9 A;  5FTH A;  1QUK A;  5ICQ A;  2ZZX A;  4LN5 A;  1S9T A;  1DPE A;  1CNQ A;  4GL0 A;  5IKB A;  4MEV A;  4YB5 A;  3BFT A;  3SER A;  1FPG A;  4PQJ A;  3OSQ A;  1USY H;  1OQH A;  3LV0 A;  1NUX A;  4H67 A;  5CMK A;  1N3X A;  3OEN A;  1TXF A;  1LFI A;  1B40 A;  4DI4 B;  1FTL A;  4JVD A;  4R73 A;  4O3A A;  2PBW A;  4NMY A;  1DTG A;  1IEJ A;  1P1N A;  3CI8 A;  2F3B A;  2P3N A;  4X48 A;  4GL8 A;  3GBB A;  1A8F A;  2Q2A A;  3R6U A;  4H45 A;  3QK6 A;  4I9D A;  5A5X A;  1FBP A;  4LZ8 A;  2B3F A;  3SES A;  3IOU A;  1PEB A;  1NUW A;  1LBW A;  2VGQ A;  4O3C A;  2FA7 A;  3H6T A;  4MBP A;  2YPN A;  1URG A;  2FYI A;  3PPQ A;  3ODB A;  3BBR A;  3VXB A;  3LBS A;  4HE0 A;  2DWH A;  3PPP A;  4X04 A;  4Q5T A;  2O7I A;  3EPE A;  2HHM A;  4QSE A;  3IJO B;  3LSX A;  4MNC A;  3E78 A;  4RYA A;  1DOT A;  4QFN A;  3KJT A;  2XA5 A;  2XXR A;  3JYR A;  1JP4 A;  3PPR A;  3SEV A;  2DXY A;  1GV8 A;  3CSB A;  2D5W A;  4PFW A;  4TLL B;  1IZ1 A;  2VD2 A;  3VLW A;  4MF3 A;  2CZH A;  4RY1 A;  1NUY A;  2H5Y A;  2O51 A;  5EHS A;  2DYX A;  3BFU A;  2QMX A;  4QFP A;  4HCW A;  4OVP A;  4G77 A;  3PGF A;  2V93 A;  2HQ0 A;  3HPI A;  1A40 A;  4BDQ A;  2ZNT A;  2AL5 A;  3MP8 A;  4ZED A;  1D9V A;  3N26 A;  4U2R A;  1A8E A;  1IXI A;  1Y3Q A;  1LAG E;  5EYF A;  2WBB A;  5L9S A;  1HSJ A;  3T0J A;  3CRB A;  1Y3P A;  2WKY A;  4QSD A;  4ECF A;  1B2H A;  1MG1 A;  4NE4 A;  4P9K A;  5AA2 B;  2XXI A;  5F24 A;  4GX3 A;  4O3B A;  1QUL A;  3EHU A;  4R2B A;  3KJ7 A;  4O7M A;  4XKP A;  1MXX A;  1OLC A;  1OVT A;  1MXW A;  1FQD A;  4IO6 A;  1B58 A;  2XX8 A;  3R7X A;  1B05 A;  3PTY A;  4I1D A;  1XC1 A;  5KCJ B;  1Q1K A;  1IXH A;  2XXV A;  1YZ0 A;  3FVN A;  5I58 B;  4QFK A;  3M3F A;  3KN8 A;  3G3F A;  3A3C A;  1NKX A;  5DVJ A;  4O94 A;  3CG3 A;  3PPO A;  3MJN A;  3FIR A;  4I62 A;  2UXA A;  3SEU A;  3EKI A;  3MYU A;  4F3P A;  4XF5 A;  5AA2 A;  4GRK A;  1R6Z A;  3SDF A;  2NOO A;  2R9J A;  2X26 A;  1SW5 A;  1YXI A;  4C0R A;  4FJP A;  1GR2 A;  3FJ7 A;  3KBR A;  2WYK A;  5TPA B;  2DDK A;  4AB6 A;  3RTF B;  3TYH A;  2NWJ A;  2FVZ A;  4OVS A;  1UTH B;  3O6H A;  1IUD A;  4F1U A;  3H6U A;  3G3H A;  3PMV A;  2OWT A;  1ZLQ A;  2OX3 A;  2RC8 A;  5ESY A;  5EYG A;  2KLF A;  3LUY A;  3UIF A;  2D21 A;  2V3T A;  4AQ4 A;  3C32 A;  3HST A;  3GBA A;  2Q89 A;  4ZS9 A;  4PBQ A;  3L6H A;  5H8S A;  1KA1 A;  3OO6 A;  4MCO A;  4IGT A;  2I48 A;  1FPL A;  1UTB B;  1B1X A;  3USD A;  5ISU A;  3Q27 A;  1LB8 A;  1FJ9 A;  1JW4 A;  2NVU B;  3SEY A;  1MH3 A;  3FAS A;  5CI5 A;  1POT A;  1ZTY A;  1Y9U A;  2ABH A;  3TPA A;  3IR1 A;  3PU5 A;  4X8R A;  3E3K A;  4OER A;  1Q9D A;  1NV0 A;  4NF6 B;  5I2K B;  2O1L A;  2VPN A;  4XKN A;  2CEY A;  4AS4 A;  5TPA A;  4GXS B;  4XFE A;  2HAU A;  1IQ7 A;  4LZ5 A;  3O2A A;  4P1E A;  1UTH A;  4OMB A;  4DCX A;  4ISU A;  4R2F A;  1PDA A;  4I3E A;  3UP9 A;  4PAK A;  3W9W A;  1XVX A;  4YMA A;  5I3S A;  3FV1 A;  3FXB A;  1FBE A;  2Y7K A;  2FHY A;  2QS3 A;  4XKQ A;  4U4X A;  1AOV A;  1N3W A;  2XXX A;  1QJM A;  1TT1 A;  1UTB A;  2ONK E;  2GH9 A;  4PTK A;  3U8Q A;  5I56 B;  4BDO A;  1M5F A;  3ILU B;  5EQ8 A;  3U92 A;  1I6A A;  1NV5 A;  4FIM A;  5DW8 A;  3AXF A;  4OYV A;  4NF6 A;  4N6D A;  5I2K A;  4KYE A;  4NQ8 A;  3KOT A;  4BDN A;  2QVV A;  2RF1 A;  5HM4 B;  2ZYM A;  4DLD A;  4GLI A;  2OCU A;  4PET A;  4E0X A;  2B3B A;  3BKI B;  4JVC A;  1M5E A;  2RCB A;  1FTO A;  5JEI A;  3MP6 A;  3PMW A;  3GXA A;  1LBX A;  4GVO A;  2F8D A;  3Q25 A;  1HSL A;  5EYH A;  1B7H A;  4L17 A;  3EF7 A;  4JDF A;  4R6Y A;  4ZEB A;  3VE1 B;  1NL5 A;  1MM7 A;  3RPW A;  1MQG A;  3IFC A;  5I56 A;  5ET7 A;  3KG2 A;  2O84 X;  2QJE A;  1URD A;  2CZI A;  4HCY A;  4F29 A;  1EYJ A;  2A5S A;  2AYS A;  3VXC A;  1I69 A;  1MH4 A;  3PMX A;  3TCH A;  3VDF A;  2H98 A;  4EF1 A;  1MXZ A;  5LOM A;  2PCR A;  2RKM A;  3A3U A;  2PFY A;  2FIX A;  1PB9 A;  4NWD A;  4GWO A;  2OWZ A;  2O6A A;  4JB7 A;  1BK4 A;  2I3W A;  1GVC A;  4KFQ A;  4FE8 A;  1LFH A;  1VE4 A;  5B70 A;  4ZZA A;  4IO4 A;  3OO9 A;  3C34 A;  3F11 A;  5EQA A;  2Y7W A;  2WEF A;  3HFU A;  5J1D A;  1N0T A;  1B32 A;  1MY4 A;  4IO2 A;  1CE2 A;  2KR0 A;  2Y5L A;  3U65 A;  1NFT A;  3FBP A;  2GQ1 A;  1B1H A;  3DEL B;  4IGR A;  3IB1 A;  3G3G A;  4R74 A;  4H46 A;  1B7U A;  4QBA A;  2I58 A;  3RUM A;  1Q35 A;  5FBP A;  1MPC A;  1LLS A;  4G68 A;  1K9Y A;  1NV2 A;  4ESX A;  3O97 A;  4PFY A;  1B51 A;  4C1U A;  2F97 A;  3MZB A;  1ZU0 A;  1EYI A;  2FNC A;  4R9G A;  5L9M A;  4OVJ A;  2QMW A;  5AA4 B;  1D9Y A;  3TCG A;  3TFL A;  1EZ9 A;  2PMS A;  1NUZ A;  3FJM A;  5CBS A;  1NNP A;  2L5V A;  3GZG A;  4P1L A;  1FBF A;  3A09 A;  2LAO A;  3B50 A;  5ET6 A;  3N6U A;  2FBP A;  2E1S A;  3UOR A;  4JXI A;  2F36 A;  3OSR A;  3IFA A;  1JEU A;  1N76 A;  3U94 A;  4PF6 A;  3VV5 A;  1INP A;  2F3D A;  2ZYK A;  3K1P A;  4GXA A;  1UIU A;  4ZE9 A;  4PFI A;  2Y7I A;  3FVK A;  3IOW A;  4RA1 A;  5K2Y A;  3IL1 B;  3DP8 A;  3LSF B;  4BDL A;  4H0W A;  1IIW A;  2I6E A;  3IX1 A;  5H8N B;  4FBP A;  1POY 1;  3K00 A;  3T9X B;  1MPD A;  2YJP A;  3U1O A;  4GWS A;  1FTA A;  4F2O A;  4P11 A;  5AA4 A;  3S4U A;  2PT1 A;  4LA9 A;  5CC2 A;  1H3D A;  3IOR A;  2DVC A;  3E4R A;  4OVT A;  1F9B A;  1EYK A;  1GTK A;  3HV1 A;  4PGN A;  1ZIU A;  2ZMB A;  3W9V A;  4NGU A;  2JJK A;  1P1Q A;  3T96 B;  3MQ9 A;  1FQC A;  3MST A;  1PC3 A;  4XTC Q;  1LGB C;  3R26 A;  1LBZ A;  1T0K A;  2DS9 A;  5M2V A;  2Y5K A;  2XXU A;  3SET A;  3VLU A;  1ATG A;  3D1R A;  3IO4 A;  1IME A;  3FXU A;  4DCY A;  1XI6 A;  2F6P A;  3C4M A;  4F39 A;  1DTZ A;  5AA2 D;  4PFU A;  5H8N A;  4LP2 B;  3IB0 A;  2PX1 A;  1IXC A;  1YAE A;  3HHF A;  3KN3 A;  3QSL A;  4BDR A;  4I40 A;  2XXY A;  1EZO A;  3K6X A;  4GX6 A;  1MPB A;  2V25 A;  4HE1 A;  1FW0 A;  1NV1 A;  2ZZV A;  3B6T A;  5BUU A;  4EDP A;  3K4U A;  1EZP A;  2DSF A;  4M1V A;  2OK2 A;  1VFE A;  1US5 A;  2WYP A;  2Q8M A;  2Z8D A;  1MRP A;  2HCA A;  3WAE A;  2VD3 A;  3OEM A;  1WVJ A;  4PDH A; 
#chains in the Genus database with same CATH homology
 5FHO A;  1N7W A;  4PE5 B;  3T9V A;  2ONR A;  1XVY A;  5CM6 A;  1FTK A;  3ONM A;  3LSW A;  5FTI A;  2Q2C A;  2OZZ A;  3K6V A;  2XXQ A;  4ND9 A;  1NNT A;  5ITP A;  1BIY A;  3O6I A;  1CB6 A;  2GRV A;  2REG A;  4RJZ A;  2GHA A;  2F7C A;  2UYF A;  3OD7 A;  1MY0 A;  3S2V A;  1JW5 A;  3O6G A;  2XXT A;  3MVY A;  4RK2 A;  4H1X A;  2PVU A;  4YU0 A;  3C31 A;  3M8U A;  2OLB A;  3LSL A;  2ZYN A;  3FZV A;  4R75 A;  5L8D A;  3D4G A;  4LQ5 A;  2GHB A;  3T66 A;  5HPQ A;  5K2X A;  2I4C A;  1GGG A;  1JEV A;  4NTL A;  1WDN A;  3FUZ A;  4RNS A;  3B7D A;  3V5A A;  3QUJ A;  3E13 X;  4KD5 A;  4U1Z A;  1M5D A;  3KGC A;  4WEP A;  3B6Q A;  4YKI A;  1OIB A;  1HSE A;  3O29 A;  2DE3 A;  4H8I A;  4Z7E A;  3PUV E;  1VFD A;  1OVB A;  3JZJ A;  1TWY A;  1DPP A;  2H4I A;  4LVQ A;  4P0I A;  3K2D A;  3C9H A;  1YCJ A;  3K6W A;  5DT6 A;  4Q0C A;  3P7I A;  2Q9T A;  1B7Z A;  4ZDM A;  1MXV A;  5HBC A;  4NED A;  2XD2 A;  3MWB A;  3PD9 A;  4H5F A;  4LZ7 A;  3PUZ E;  5H8Q B;  3TAJ A;  1LCT A;  4OZ9 A;  1Z7M E;  1B46 A;  5EHM A;  3T9U A;  3TEP A;  4KHZ E;  3CIJ A;  2HXW A;  3TOD A;  2ZNU A;  2ALU A;  3QAX A;  4R6H A;  5KCJ A;  4BLA A;  4KPT A;  4DE8 A;  3FV2 A;  5I58 A;  3CR9 A;  2F35 A;  1NNF A;  3H6V A;  3DP4 A;  1R9L A;  1SD3 A;  2PYY A;  3RN8 A;  4Q8R A;  3IJX B;  1XT8 A;  1MDQ A;  4G8M A;  3S9M C;  4FED A;  3H03 A;  1MXY A;  4XKR A;  2B65 A;  3IAZ A;  4F1V A;  1S50 A;  2DE4 A;  4YB7 A;  2UYE A;  3C33 A;  3H7M A;  4H6D A;  5CBR A;  1FTM A;  2P1S A;  3MVX A;  5DVI A;  4DDD A;  2HZL A;  3VVD A;  3HO7 A;  2Y84 A;  1M5B A;  1QVS A;  1XOC A;  4NF4 B;  4ELR A;  1QUJ A;  2VP1 A;  3MZ9 A;  4FEB A;  3TZA A;  1SDX A;  3S9L C;  5B7D A;  4OWD A;  1JVX A;  2O68 A;  3EHS A;  3RT8 A;  1A7L A;  4GIZ A;  3ZKK A;  4PP0 A;  2UVJ A;  4G4P A;  4DIG A;  3M3K A;  1LAH E;  3H6W A;  3CFZ A;  3OO8 A;  3D4C A;  4OFL A;  4YKJ A;  4ELO A;  1B0L A;  3KSX A;  1B6H A;  5DTB A;  3OMB A;  2Z22 A;  3FVG A;  2F5X A;  2O7U A;  2ZXT A;  4IY5 A;  3OO7 A;  2E0S A;  1UIV A;  4XIG Q;  2IEE A;  2H9B A;  4QHQ A;  1AIV A;  4IY6 A;  4EXK A;  2DOJ A;  4OES A;  2H99 A;  4F18 A;  3FD3 A;  2IA4 A;  1VSO A;  4KCC A;  2V3Q A;  2VOZ A;  2OBG A;  4TQU Q;  4IO5 A;  3KOS A;  3T93 B;  4WED A;  1XHY A;  3DM0 A;  4OQO A;  1EH3 A;  1S7Y A;  1MDP 1;  3K6U A;  1A55 A;  3G3J A;  3UA8 A;  3G3K A;  1SBP A;  3C35 A;  4QFL A;  4N07 A;  4LAT A;  3IK6 B;  1MQD A;  1O64 A;  4HS7 A;  2F7B A;  4ZEC A;  1SW4 A;  4EQB A;  2F7A A;  3MZ1 A;  4WXJ A;  1PB8 A;  1JVY A;  4UAC A;  1JET A;  3HN0 A;  5CRY A;  3CG1 A;  2Q8J A;  4FAT A;  3TMG A;  4FEC A;  2X7Q A;  4AB5 A;  4OEV A;  4DZ1 A;  5FHM A;  4QFO A;  3EHT A;  4GQO A;  1Y20 A;  2A5T B;  3HCQ A;  2O1M A;  2DWI A;  1L5T A;  1SVX B;  1FQF A;  1MY1 A;  2AL4 A;  4KI0 E;  1WOD A;  4JBZ A;  5L9O A;  2Z23 A;  3KN7 A;  2F78 A;  1AL3 A;  1LFG A;  1VR5 A;  4OFO A;  2I3V A;  3N5L A;  4U23 A;  3L6G A;  2O69 A;  4G8H A;  3KEI A;  1N04 A;  3TEL A;  4YKP A;  4G68 C;  3SKP A;  4N13 A;  2HAV A;  5DVF A;  1MQI A;  4POX A;  3LC8 A;  1B5J A;  2G29 A;  3PPN A;  3ZKL A;  2A5T A;  1SYH A;  3I5O A;  4LUB A;  4U4S A;  3VFJ A;  4U22 A;  4YIC A;  4QSC A;  2HZK A;  3FXR A;  5AA1 A;  3TKD A;  2YLN A;  3UK4 A;  3UGW A;  2XXH A;  1SW1 A;  3PUW E;  1QKB A;  3QUF A;  1N7X A;  3RGY A;  1NMU A;  1IXG A;  3E9X A;  5IAI A;  3N94 A;  4F3S A;  2XXP A;  3MVZ A;  4EQ9 A;  2RIN A;  2R71 A;  3H3G A;  4JSO A;  4U1O A;  2DVZ A;  2UVI A;  4DXC A;  4HW8 A;  1LCF A;  5I2N B;  2M8C A;  2QS1 A;  1XS5 A;  2ZYO A;  2V84 A;  1DSN A;  2Z8E A;  4FOR A;  3K01 A;  4OHN A;  1H45 A;  4F1Y A;  1I6B A;  5DEX B;  2ONS A;  3C36 A;  2OJT A;  2NXO A;  4DXU A;  2Q88 A;  4MFI A;  1LBB A;  2UVH A;  4UA8 A;  1A99 A;  2GFE A;  1BTJ A;  4YZZ A;  4GOT A;  5BWJ A;  1OQG A;  3RLF E;  1YTV A;  3O66 A;  2RCA A;  4EUO A;  3K02 A;  2R6G E;  3MC2 A;  2RC9 A;  4GD5 A;  4H5G A;  1Y4T A;  5I2N A;  1SYI A;  5JTY B;  3OOA A;  4PFT A;  4JSD A;  1NH8 A;  1P1W A;  4F31 B;  4F2Q A;  4OXV A;  3OEL A;  1SW2 A;  3HHG A;  3FXQ A;  1JW1 A;  3RNN A;  4Q30 B;  5DEX A;  3TTK A;  2H25 A;  3MVW A;  4YMB A;  1H44 A;  2DWA A;  5FHN A;  4JWO A;  1US4 A;  2XXW A;  3M3L A;  1USY E;  3TTN A;  1ZJL A;  4K3F A;  5H8F B;  4ELQ A;  4P0G A;  4X1B A;  3Q28 A;  2CMO A;  3CFX A;  4BDM A;  5ICT A;  4GFR A;  1MS7 A;  1Z7N E;  3B6W A;  4ZEK A;  1RKM A;  1II5 A;  5AA3 A;  3DP6 A;  1J1N A;  2NUV A;  4LON B;  4Z0I A;  4ZEF A;  2PT2 A;  1P1O A;  3V8X B;  2X7P A;  5JTY A;  5F1Q A;  4KYD A;  3T9H B;  4MLV A;  1D3K A;  2QPQ A;  2REJ A;  4MH5 A;  2DQV A;  5I59 B;  1I6Q A;  2AIX A;  4IO7 A;  4IO3 A;  4KYS A;  2ESN A;  4RPO A;  4R72 A;  1B9J A;  1A54 A;  1R1N A;  4HTG A;  3RT6 B;  1MQJ A;  2V3U A;  3ECR A;  1ZKB A;  4H8J A;  4ELP A;  5KZT A;  4XXU A;  3N6T A;  2DP8 A;  5H8F A;  4KR5 A;  3FGS A;  1H76 A;  2QRY A;  3VVF A;  2QS2 A;  1NH7 A;  1RYO A;  1MY2 A;  2F6G A;  2Y7P A;  2RC7 A;  3TTR A;  1M5C A;  1FQB A;  1PBQ A;  4EXL A;  1OMP A;  4KQP A;  1BLF A;  1FTJ A;  3TQW A;  4X9T A;  1JQF A;  3TUS A;  1ANF A;  3MPK A;  3V83 A;  5I59 A;  3EQ1 A;  2Y7R A;  3MPL A;  1TFA A;  1LB9 A;  3MBP A;  3DLN A;  1LAX A;  1PBP A;  5ELV A;  4F22 A;  2UVG A;  5AE4 A;  2QS4 A;  1Y1M A;  2Z8F A;  1FCK A;  3IO6 A;  4DXB A;  1MQH A;  4ONY A;  3CSG A;  1FQA A;  2DXR A;  3S9E A;  1B52 A;  4X1D A;  4F3B A;  4OEN A;  1OLA A;  3RQT A;  1QKA A;  3THI A;  2VHA A;  4OEU A;  3I6V A;  2XX7 A;  1KWH A;  3K1N A;  3H4Z A;  1SQY A;  5CMC A;  4NWC A;  3OEK A;  2I49 A;  4YB6 A;  2THI A;  3U93 A;  3I3V A;  5H8Q A;  1LST A;  3PUY E;  3TCF A;  2XX9 A;  3ILT B;  4N6P A;  3IB2 A;  2HFB A;  3PD8 A;  1ZMG A;  3GLB A;  1B5H A;  4ZE8 A;  4KCD A;  2XD3 A;  1SI1 A;  4U21 A;  2F34 A;  5F7V A;  4TLM B;  1DMB A;  3KSJ A;  3UN6 A;  1BP5 A;  3JV9 A;  3SEX A;  2DWJ A;  3S9N C;  4OET A;  4OFJ A;  3U72 A;  3QXM A;  3ZS6 A;  3OXN A;  3FJG A;  4F3G A;  1B4Z A;  3CFL A;  1PB7 A;  3IOV A;  4NF4 A;  2G93 A;  3MUQ A;  1AH5 A;  2I0B A;  1B4H A;  4NF5 B;  1YPN A;  1SI0 A;  4TOZ A;  5CMB A;  1IIT A;  4RXL A;  4NF8 B;  3PV0 E;  4FAJ A;  3WAF A;  1LAF E;  1O7T A;  2BJJ X;  3K1M A;  1NNK A;  2P2A A;  1ELJ A;  1EU8 A;  1P99 A;  3LR1 A;  5KDT B;  3G7W A;  3KFM A;  4ZZE A;  3CVG A;  1JNF A;  4IB2 A;  4QF9 A;  3ZSF A;  4ZEI A;  1B3H A;  3TDJ A;  3VVE A;  4EF2 A;  1Y3N A;  3PUX E;  4RPN A;  5I57 B;  1O63 A;  3Q29 A;  3MAM A;  3KZG A;  2OWS A;  1URS A;  3H06 B;  2I4B A;  1QUI A;  3TQL A;  4NF5 A;  1B3L A;  3O9P A;  4G68 B;  4JWX A;  1B0H A;  1MXU A;  3K0V A;  4NF8 A;  1D4N A;  4POW A;  4JWY A;  1RYX A;  4YAH X;  1TFD A;  1QW0 A;  4G2Z A;  4I8C A;  1N84 A;  4YKK A;  4C1T A;  3VLV A;  1LBC A;  2W7Y A;  1FQE A;  4THI A;  3FVO A;  2QL3 A;  5DYH A;  1Y4C A;  3FAT A;  1H43 A;  4GF8 A;  4WKM A;  5KDT A;  5H8H B;  2QSX A;  2XHD A;  2ANJ A;  4E0W A;  5I84 A;  4OTE A;  1AMF A;  3Q26 A;  5TU0 A;  3QYT A;  2CZL A;  2P0S A;  5I57 A;  5TP9 B;  1BKA A;  4LQ2 A;  4R6K A;  2ZNS A;  3TTM A;  4G8N A;  4F19 A;  1B5I A;  2I0C A;  3RY3 A;  2HEU A;  2D3I A;  3T22 A;  4R9F A;  1UQW A;  1Y1Z A;  3MW0 A;  4EQ7 A;  1B3G A;  1B3E A;  4ESW A;  1P1U A;  4MLQ A;  3W15 C;  3IOT A;  5H8H A;  4QRZ A;  2DE2 A;  3MP1 A;  4H65 A;  3G3I A;  1ZBM A;  3RTW B;  1B3F A;  3V89 B;  5ITO A;  5A5X B;  3TTL A;  3QIM A;  3EN3 A;  5TP9 A;  5JK4 A;  5CMM A;  3SEW A;  1MY3 A;  1R9Q A;  3O28 A;  4M4G A;  1MM6 A;  4RK9 A;  5FTH A;  1QUK A;  5ICQ A;  1S9T A;  1DPE A;  4GL0 A;  5IKB A;  4YB5 A;  3BFT A;  3SER A;  4PQJ A;  3OSQ A;  1USY H;  1OQH A;  4H67 A;  5CMK A;  1N3X A;  3OEN A;  1TXF A;  1LFI A;  1B40 A;  1FTL A;  4R73 A;  4O3A A;  2PBW A;  4NMY A;  1DTG A;  1IEJ A;  1P1N A;  3CI8 A;  4X48 A;  4GL8 A;  3GBB A;  1A8F A;  2Q2A A;  3R6U A;  3QK6 A;  4I9D A;  5A5X A;  4LZ8 A;  2B3F A;  3SES A;  3IOU A;  1PEB A;  4O3C A;  2VGQ A;  2FA7 A;  3H6T A;  4MBP A;  2YPN A;  1URG A;  2FYI A;  3PPQ A;  3ODB A;  3BBR A;  3VXB A;  3LBS A;  2DWH A;  3PPP A;  4Q5T A;  2O7I A;  3EPE A;  4QSE A;  3IJO B;  3LSX A;  4RYA A;  1DOT A;  4QFN A;  3KJT A;  2XXR A;  3JYR A;  3PPR A;  3SEV A;  2DXY A;  1GV8 A;  3CSB A;  2D5W A;  4PFW A;  4TLL B;  1IZ1 A;  2VD2 A;  3VLW A;  4MF3 A;  4RY1 A;  2H5Y A;  2O51 A;  5EHS A;  2DYX A;  3BFU A;  2QMX A;  4QFP A;  4HCW A;  4G77 A;  3PGF A;  2V93 A;  2HQ0 A;  3HPI A;  1A40 A;  4BDQ A;  2ZNT A;  2AL5 A;  3MP8 A;  4ZED A;  1D9V A;  3N26 A;  4U2R A;  1A8E A;  1IXI A;  1Y3Q A;  1LAG E;  5EYF A;  5L9S A;  1HSJ A;  3CRB A;  1Y3P A;  2WKY A;  4QSD A;  4ECF A;  1B2H A;  1MG1 A;  4NE4 A;  5AA2 B;  2XXI A;  4O3B A;  1QUL A;  3EHU A;  4R2B A;  3KJ7 A;  4XKP A;  1MXX A;  1OLC A;  1OVT A;  1MXW A;  1FQD A;  4IO6 A;  1B58 A;  2XX8 A;  3R7X A;  1B05 A;  4I1D A;  1XC1 A;  5KCJ B;  1Q1K A;  1IXH A;  2XXV A;  3FVN A;  5I58 B;  4QFK A;  3M3F A;  3KN8 A;  3G3F A;  3A3C A;  1NKX A;  5DVJ A;  3CG3 A;  3PPO A;  3MJN A;  3FIR A;  4I62 A;  2UXA A;  3SEU A;  4F3P A;  5AA2 A;  4GRK A;  1R6Z A;  3SDF A;  2NOO A;  2R9J A;  2X26 A;  1SW5 A;  4C0R A;  4FJP A;  1GR2 A;  3FJ7 A;  3KBR A;  5TPA B;  4AB6 A;  3TYH A;  3RTF B;  2NWJ A;  1UTH B;  3O6H A;  1IUD A;  4F1U A;  3H6U A;  3G3H A;  3PMV A;  2OWT A;  1ZLQ A;  2RC8 A;  2KLF A;  3LUY A;  3UIF A;  2D21 A;  2V3T A;  4AQ4 A;  3C32 A;  3HST A;  3GBA A;  2Q89 A;  4ZS9 A;  3L6H A;  5H8S A;  3OO6 A;  4IGT A;  2I48 A;  1UTB B;  1B1X A;  3USD A;  5ISU A;  3Q27 A;  1LB8 A;  1JW4 A;  2NVU B;  3SEY A;  1MH3 A;  3FAS A;  5CI5 A;  1POT A;  1ZTY A;  1Y9U A;  2ABH A;  3TPA A;  3IR1 A;  3PU5 A;  3E3K A;  4OER A;  4NF6 B;  5I2K B;  2O1L A;  4XKN A;  5TPA A;  4GXS B;  2HAU A;  1IQ7 A;  4LZ5 A;  3O2A A;  1UTH A;  4OMB A;  4DCX A;  4ISU A;  4R2F A;  1PDA A;  3UP9 A;  3W9W A;  1XVX A;  4YMA A;  3FV1 A;  2Y7K A;  2QS3 A;  4XKQ A;  4U4X A;  1AOV A;  1N3W A;  2XXX A;  1QJM A;  1TT1 A;  1UTB A;  2ONK E;  2GH9 A;  3U8Q A;  5I56 B;  4BDO A;  1M5F A;  3ILU B;  3U92 A;  1I6A A;  4FIM A;  3AXF A;  4OYV A;  4NF6 A;  5I2K A;  4KYE A;  3KOT A;  4BDN A;  2RF1 A;  5HM4 B;  2ZYM A;  4DLD A;  4GLI A;  2OCU A;  4PET A;  4E0X A;  2B3B A;  3BKI B;  1M5E A;  2RCB A;  1FTO A;  5JEI A;  3MP6 A;  3PMW A;  3GXA A;  4GVO A;  2F8D A;  3Q25 A;  1HSL A;  1B7H A;  4L17 A;  3EF7 A;  4JDF A;  4R6Y A;  4ZEB A;  3VE1 B;  1NL5 A;  1MM7 A;  3RPW A;  1MQG A;  5I56 A;  3KG2 A;  2O84 X;  2QJE A;  1URD A;  4HCY A;  4F29 A;  2A5S A;  2AYS A;  3VXC A;  1I69 A;  1MH4 A;  3VDF A;  3PMX A;  3TCH A;  2H98 A;  4EF1 A;  1MXZ A;  5LOM A;  2RKM A;  3A3U A;  1PB9 A;  4NWD A;  4GWO A;  2O6A A;  4JB7 A;  2I3W A;  1GVC A;  4KFQ A;  4FE8 A;  1LFH A;  1VE4 A;  5B70 A;  4ZZA A;  4IO4 A;  3OO9 A;  3C34 A;  3F11 A;  2Y7W A;  5J1D A;  1N0T A;  1B32 A;  1MY4 A;  4IO2 A;  1CE2 A;  1NFT A;  1B1H A;  3DEL B;  4IGR A;  3IB1 A;  3G3G A;  4R74 A;  1B7U A;  2I58 A;  3RUM A;  1Q35 A;  1MPC A;  1LLS A;  4G68 A;  4ESX A;  3O97 A;  4PFY A;  1B51 A;  4C1U A;  2F97 A;  3MZB A;  1ZU0 A;  2FNC A;  4R9G A;  5L9M A;  4OVJ A;  2QMW A;  5AA4 B;  1D9Y A;  3TCG A;  3TFL A;  1EZ9 A;  2PMS A;  3FJM A;  5CBS A;  1NNP A;  3GZG A;  3A09 A;  2LAO A;  3N6U A;  2E1S A;  3UOR A;  4JXI A;  2F36 A;  3OSR A;  1JEU A;  1N76 A;  3U94 A;  3VV5 A;  2ZYK A;  3K1P A;  4GXA A;  1UIU A;  4ZE9 A;  2Y7I A;  3FVK A;  3IOW A;  4RA1 A;  5K2Y A;  3IL1 B;  3DP8 A;  3LSF B;  4BDL A;  4H0W A;  1IIW A;  2I6E A;  3IX1 A;  5H8N B;  1POY 1;  3K00 A;  3T9X B;  1MPD A;  2YJP A;  3U1O A;  4F2O A;  4P11 A;  5AA4 A;  3S4U A;  2PT1 A;  4LA9 A;  5CC2 A;  1H3D A;  3IOR A;  2DVC A;  3E4R A;  1F9B A;  1GTK A;  3HV1 A;  1ZIU A;  2ZMB A;  3W9V A;  1P1Q A;  3T96 B;  3MQ9 A;  1FQC A;  1PC3 A;  4XTC Q;  1LGB C;  3R26 A;  1T0K A;  2DS9 A;  5M2V A;  2XXU A;  3SET A;  3VLU A;  1ATG A;  3IO4 A;  3FXU A;  4DCY A;  2F6P A;  3C4M A;  4F39 A;  1DTZ A;  5AA2 D;  4PFU A;  5H8N A;  4LP2 B;  3IB0 A;  2PX1 A;  1IXC A;  1YAE A;  3HHF A;  3KN3 A;  3QSL A;  4BDR A;  2XXY A;  1EZO A;  3K6X A;  1MPB A;  2V25 A;  1FW0 A;  3B6T A;  5BUU A;  4EDP A;  3K4U A;  1EZP A;  2DSF A;  4M1V A;  2OK2 A;  1VFE A;  1US5 A;  2Z8D A;  1MRP A;  2HCA A;  3WAE A;  2VD3 A;  3OEM A;  1WVJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...