2V4CA

Structure of sialic acid binding protein (siap) in the presence of kdn
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
309
structure length
306
Chain Sequence
ADYDLKFGMNAGTSSNEYKAAEMFAKEVKEKSQGKIEISLYPSSQLGDDRAMLKQLKDGSLDFTFAESARFQLFYPEAAVFALPYVISNYNVAQKALFDTEFGKDLIKKMDKDLGVTLLSQAYNGTRQTTSNAINSIADMKGLKLRVPNAATNLAYAKYVGASPTPMAFSEVYLALQTNAVDGQENPLAAVQAQKFYEVQKFLAMTNHILNDQLYLVSNETYKLPEDLQKVVKDAAENAAKYHTKLFVDGEKDLVTFFEKQGVKTHPDLVPFKESMKPYYAEFVKQTGQKGESALKQIEAINPHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords SIALIC ACID-BINDING PERIPLASMIC PROTEIN SIAP
publication title Structure of Sialic Acid Binding Protein (Siap) in the Presence of Kdn
rcsb
source organism Haemophilus influenzae
total genus 120
structure length 306
sequence length 309
ec nomenclature
pdb deposition date 2008-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2v4cA00
4MX6A 4N8GA 4P47A 4PF8A 2XWKA 4PAKA 4O94A 4OA4A 4PBQA 4N4UA 3GYYA 4P1EA 4OVPA 5IM2A 4NG7A 2WYPA 4N17A 2ZZWA 2WX9A 4DI3D 4XEQA 4NF0A 4PF6A 3B50A 4LN5A 4MCOA 2XWOA 4N91A 2ZZVA 4O7MA 4X04A 4NGUA 2VPOA 2CEYA 2XA5A 5IZZA 3FXBA 4PDHA 2PFYA 4XFEA 4X8RA 5I7IA 5CM6A 4P1LA 4PAFA 4PDDA 4MIJA 4N6DA 5IGAA 4OVTA 4PE3A 4N6KA 4YICA 2XWVA 4DI4B 4PBHA 4OVQA 4PETA 4NAPA 4MAGA 4MHFA 4NX1A 4MNPA 4MNIA 3U65A 4P8BA 2CEXA 2PFZA 2VPNA 2V4CA 4N15A 4P56A 4YZZA 4PCDA 2HPGA 4N8YA 4PC9A 4PGPA 4PAIA 4NQ8A 4UABA 4XF5A 2HZKA 2ZZXA 4NN3A 4O8MA 4MEVA 4P9KA 4PFRA 2XWIA 4PFBA 4OVRA 4MMPA 4P3LA 5LTCA 5I5PA 4NHBA 2HZLA 4OVSA 2XXKA 4OANA 4PFIA 2WYKA 4PGNA 4MNCA
chains in the Genus database with same CATH superfamily
2OWSA 4GBWA 4XIGQ 4YMAA 1H43A 3L6GA 4M1VA 4NE4A 3FATA 3KG2A 1MY2A 1QGXA 1ZTYA 2V3UA 2ZNUA 3OENA 3KN3A 2OLBA 3QUFA 3OSQA 1MS7A 1MY1A 4QFOA 4MFIA 4QSEA 1JW4A 3MSTA 3IO6A 2VT5A 3MQ9A 2XWOA 5H8NB 1TFAA 3IAZA 3O66A 2RC9A 3UP9A 1EU8A 2A5SA 4I3EA 1DOTA 3ODBA 4FORA 4Q0CA 5I2NA 2F34A 1URSA 3B8BA 2F7BA 4I9DA 2RCAA 4EUOA 4F31B 2VD3A 1O64A 3LSWA 3PPPA 2VHAA 4N6DA 4U21A 5JK4A 2XXQA 4WEPA 2OWTA 1SW2A 1IQ7A 1Y1ZA 4LA9A 1PDAA 4BDRA 2H99A 3T9VA 4ZEFA 1FBDA 3W9WA 4JBZA 3TZAA 2P1SA 1L5TA 2FIEA 1H45A 1DK4A 4OYVA 1B5JA 4O8MA 2X7PA 3OO6A 4PFRA 4OVRA 3GLBA 2HAVA 4LQ2A 3ZKKA 3CR9A 1SI1A 1VSOA 3K6VA 3FBPA 3C33A 3C36A 4F18A 1SW5A 2YPNA 4MNCA 4P47A 3P7IA 1IMCA 4P0IA 4O94A 1LAGE 1ZJLA 1OQHA 1Y3QA 2DYXA 3GZGA 3LSXA 2Q8MA 2ONRA 4IGTA 5K2YA 4F39A 4IY6A 4QFLA 5BWJA 3G3HA 4F2QA 3PPNA 2FNCA 1YYZA 2VD2A 1JW1A 4HW8A 5AA3A 1US4A 3QAXA 4LP2B 2X7QA 4JSDA 5ET6A 3H6UA 3Q28A 5I59A 1FPKA 1T0KA 3U1OA 5IAIA 2F3BA 1BIYA 3USDA 5B70A 4H8IA 1SVXB 3KSXA 1CB6A 1M5BA 3OO8A 1RYOA 4GWYA 4GX4A 5ICQA 3TCFA 1FPEA 1LLSA 3R7XA 2B3BA 2B3FA 4IO2A 4QHQA 4DXBA 4DI4B 5AA2A 3RN8A 4PETA 1FRPA 2R8TA 4NX1A 1B5HA 4GWWA 3IJXB 3U65A 4P8BA 2UXAA 1LB9A 4GX6A 4GLIA 1FTKA 1YAEA 2O68A 3T9HB 2VGQA 5ITPA 5LTCA 3IOVA 2RF1A 3MZBA 4RPOA 2CZKA 3G3GA 4XXUA 5L9MA 1B3FA 3C32A 5CMMA 2WYKA 3K02A 4GWOA 1IMEA 1ATGA 3CFXA 5M2VA 3E13X 3TQLA 4OFOA 4H0WA 1FBCA 2O84X 4WEDA 3VXBA 4PQJA 5H8FA 3VXCA 3FIRA 3BFUA 3O97A 1B2HA 3OEKA 3SEUA 3NOHA 2THIA 1RDXA 4IO3A 2IA4A 3IB1A 5ELVA 2HHMA 3B50A 1NNFA 5TP9A 4OQOA 4MCOA 3KGCA 1S7YA 2X26A 1GTKA 3FD3A 3MVXA 2O7IA 1F9BA 1URDA 2R71A 3S9MC 2Q89A 3S9NC 5H8FB 1ELJA 5J16A 5DVIA 1FTOA 3BBRA 3C9HA 3TTKA 2REGA 3O6IA 4DIGA 1LBCA 4ESXA 3E78A 1QUKA 4POXA 4GVOA 5CBRA 5ET7A 4QFPA 2H4IA 3EN3A 2I3WA 5A5XB 3K2DA 4TLLB 3CI8A 3C4MA 5I2KB 2PMSA 2VPNA 4N15A 4IO4A 5CMKA 1UTHA 1MQHA 1MY3A 4I62A 4YB5A 1CNQA 4DCYA 1Q35A 3FZVA 1YPNA 1MG1A 3TAJA 3MPLA 4U1ZA 2I4CA 2XXKA 3I5OA 4MX6A 1N3XA 3B6WA 3HPIA 4AS4A 1UTHB 3B6QA 4F19A 3T96B 5EQAA 2F6GA 1B51A 4R74A 4XEQA 5ESYA 3ILTB 3A29A 1IZ1A 3SKPA 2UVJA 2HXRA 3U94A 2HCAA 3K1PA 2F7CA 1D4NA 2G29A 5AA2D 3H7MA 3TFLA 2XXVA 2DVCA 4OEVA 4NWCA 1N7XA 4UA8A 3RQTA 3B6TA 5IZ1A 3CFZA 2H9BA 3DM0A 2ONSA 1GGGA 1FBEA 4JXIA 2I4BA 1O7TA 3U72A 2O1MA 2YJPA 4N6KA 2V3TA 4MHFA 3K6XA 4RJZA 4KFQA 4AS5A 4P56A 4POWA 3HFUA 2I58A 2QSXA 1B40A 3TTNA 5IZ3B 2XD3A 4P3LA 3QUJA 5EYHA 2QMXA 4U22A 2F8DA 1B3EA 1I6QA 2A5TA 2HZLA 4G68C 3KJ7A 3MPKA 1DPEA 4GX3A 3JV9A 5CMBA 1FPGA 1B4ZA 5CI5A 3TUSA 3L6HA 4NF5A 2DQVA 4KCCA 4R2FA 5FHMA 1LAXA 4H65A 2HAUA 1PBQA 1XI6A 3FASA 1EYJA 1H44A 1NUXA 2QPQA 4ZS9A 1AWBA 3FXUA 2W7YA 4DCXA 1B7ZA 1MRPA 4FATA 3CG1A 5CC2A 4FE8A 3H06B 1VDWA 3SZPA 5KZTA 1NV7A 4X04A 1IXIA 2HQ0A 2QS2A 1FPLA 4H46A 1I6AA 2AL5A 4NF5B 2ZYMA 2ZMBA 4ZEKA 2P2AA 3IJOB 3R6UA 1A7LA 2PBWA 4H45A 1NI9A 1P1WA 4PTKA 1NKXA 1RYXA 2RKMA 3G3FA 4QRZA 1G0HA 1OLCA 1M5FA 3C35A 3JZJA 1GR2A 5ISUA 1NNKA 2HPGA 3O29A 3CIJA 3KC0A 4BDOA 1BKAA 2Z8EA 3TPAA 5I56A 2RC8A 4NN3A 3V5AA 4P9KA 4OENA 4XTCQ 1Y9UA 2UVGA 4MMPA 3GBAA 1QVSA 1P1NA 3FV1A 3DP4A 4XKNA 3TTLA 1NFTA 1MY4A 3H03A 5EQ8A 4PFIA 4X48A 3T93B 1LBBA 3FJMA 3KN7A 1N84A 4PFWA 3QSLA 1GVCA 4PE5B 4AQ4A 4HXVA 3TEPA 4F3PA 3GBBA 3OO7A 1CE2A 2RC7A 3MC2A 2DSFA 4LZ5A 2V3QA 3PUWE 2ESNA 3MJNA 4P11A 3VLWA 1WVJA 3PGFA 2M8CA 1N04A 4XKPA 3ZKLA 3FVNA 3K1NA 2ZZVA 4GQOA 4BLAA 1FTAA 1Q1KA 1VFEA 5KCJA 4KYEA 1LCTA 4RK9A 3H6TA 3UA8A 4C0RA 2R9JA 1JEUA 2ZYOA 2Q9TA 4Q8RA 3SDFA 3UN6A 1A8EA 4PDDA 3KOTA 3S4UA 2ABHA 3Q25A 4X1BA 4OWDA 3SEVA 5IGAA 1POY1 1YXIA 4PBHA 1NV4A 1QKAA 1FJ9A 3IB2A 1K9ZA 1RDZA 3W9VA 4HE2A 1M5EA 1SDXA 1TFDA 3IFAA 3MVZA 5AA1A 1NNTA 1IMDA 3PTYA 5DEXA 2PX1A 1PB8A 1PB7A 2B65A 1SBPA 1SD3A 4NMYA 1A99A 3PPRA 3MYUA 3V83A 4PF8A 2XWKA 3KSJA 5I2NB 1MQDA 3S2VA 3MP6A 3PD8A 4QBAA 4YAHX 3IB0A 2H25A 1FPIA 5DEXB 1A55A 2WBDA 3TDJA 5I3SA 1R1NA 4GXSB 4F2OA 1XS5A 4NF0A 3VDFA 4RYAA 3SEXA 3R26A 2P3VA 2QS4A 3LSLA 3TELA 2OJTA 4IB2A 3KEIA 4GBVA 2OZZA 2D5WA 4FEDA 4F1UA 1FQFA 1HSLA 3OMBA 1FJ6A 2PCRA 4PDHA 1FBHA 2REJA 2DWIA 1LSTA 1NV6A 3H4ZA 1II5A 3DLNA 1EZ9A 3RUMA 3IORA 2Y7RA 1LB8A 2DOJA 4YKKA 3O28A 3CG3A 2GHBA 4KYDA 1LBYA 4NF4A 4JB7A 2XD2A 3WAFA 2WBBA 4LQ5A 1D3KA 5ET5A 4RNSA 3RLFE 1BP5A 2PFZA 4YZZA 4KR5A 4R6HA 3B7DA 4XF5A 2ZZXA 2GHAA 4MBPA 3OXNA 3ONMA 2F35A 2DE3A 1SW1A 1IMFA 4U2RA 3MP8A 3TCHA 4NF4B 4DE8A 5I59B 4WXJA 1FTMA 2YLNA 4ELOA 4OANA 1ZLQA 1FQAA 3M8UA 2F78A 4F22A 3G3IA 4PAKA 1QUJA 3RYDA 3BKIB 1NH7A 3ECRA 2I3VA 1BTJA 5HM4B 3BFTA 3TMGA 1BK4A 3QMFA 3CVGA 4OETA 4NG7A 5AA2B 1I6BA 1M5CA 4FEBA 3T1BA 3MVYA 3TODA 3VLUA 3H6WA 4MH5A 3D4GA 4RK2A 4BDNA 5LDZA 4THIA 2D3IA 3HO7A 4C1UA 3IOTA 4DDDA 1RKMA 3HCQA 4LATA 2PFYA 3U92A 1N7WA 3D4CA 1VE4A 2CZIA 2V93A 2DP8A 4P1LA 1NH8A 4HE0A 3T9XB 1AIVA 4R6KA 2OBGA 1N76A 2B4MA 4G77A 1JNFA 1SI0A 3FJGA 3MAMA 1MQGA 3O6GA 4YKPA 2ZNTA 3UGWA 3Q29A 1NUWA 5H8QA 2GQ1A 1VFDA 1IEJA 3VVFA 1XVYA 3C31A 4X9TA 3N94A 2HZKA 3CRBA 3E4RA 3I3VA 5TP9B 1UQWA 4NF6A 4OZ9A 1SPIA 3PD9A 4I1DA 4TLMB 2OWZA 4ELQA 3PMVA 3EKIA 4I8CA 1KA0A 4NHBA 3TCGA 5L9OA 2QVVA 5H8QB 3FXRA 1IXCA 3U8QA 4MF3A 3M3LA 1LFIA 1B4HA 4XKQA 4H1XA 4PBQA 3GYYA 1IXHA 4R9GA 2O69A 3H3GA 3MZ9A 4OTEA 3V89B 3IX1A 4G4PA 1MPBA 2AYSA 2QVRA 2ZNSA 4FECA 4ZE9A 4F3GA 1MXXA 3SEWA 2H5YA 2RINA 4MLQA 2XXHA 1Y3PA 1Q9DA 1NV5A 1LFGA 3UORA 4XFEA 5T3JA 1XC1A 1JETA 2P3NA 1TT1A 2I0CA 2KQZA 4ESWA 4GWUA 1QULA 2XXIA 3RGYA 4EF2A 1B3HA 3TQWA 1O63A 1B0LA 4O3BA 2NVUB 4NAPA 4OFJA 3OELA 3PUZE 2UYFA 2I49A 1KWHA 2UYEA 5LOMA 1KZ8A 2GRVA 2XXTA 4PGPA 1DTZA 4HS7A 3IO4A 2I6EA 4MEVA 1NV0A 5IKBA 5TU0A 2XWIA 2NOOA 1B46A 3TKDA 1JW5A 3IOUA 1XOCA 3BIGA 4EQBA 2F97A 4EF1A 2V25A 3IFCA 4JDFA 1JEVA 1FPBA 3PUYE 1JQFA 2Y7PA 2XX8A 2RCBA 1GV8A 4PF6A 1YTVA 5AA4A 1SYHA 2Z8FA 3G7WA 3U93A 5JTYA 3M3KA 2BJIA 4F29A 3LSFB 3Q27A 2H98A 2CEYA 3A3CA 1B32A 4U4SA 5DW8A 3ROJA 4MJOA 3RT6B 4QFKA 1AL3A 2A5TB 5AA4B 1HSEA 3THIA 2QVUA 3HV1A 2CMOA 1DCUA 3AXFA 1AH5A 1PC3A 3RT8A 3RPLA 3I6VA 4GF8A 2O1LA 1QJMA 4MNPA 1NV1A 3T9UA 2DXYA 2F5XA 4OVJA 3KBZA 4P0GA 5DTBA 4GD5A 3N26A 4G8HA 4OFLA 5CRYA 3A09A 1N3WA 2Y7WA 4H5FA 4UACA 2ONKE 1B58A 3CFLA 3KJTA 1MXYA 3OD7A 4NTLA 5K2XA 2OCUA 1FTJA 4FBPA 1G0IA 4JVCA 3RPLB 4EQ9A 1LBVA 2QS3A 3LBSA 4JVDA 2DWAA 3ILUB 4H67A 1IUDA 4G8NA 5TPAA 4OA4A 1P1UA 4YMBA 4O7IA 5A5LA 3T66A 3FGSA 4LZ8A 1AOVA 5F1QA 4F1VA 1K9YA 1IMAA 3PUXE 2WX9A 1FQDA 5H8SA 3EHSA 3EF7A 3RY3A 5DVJA 1LEVA 1EYIA 5AE4A 5EHMA 3E79A 3PPQA 2DS9A 5TPAB 4QSDA 1B3LA 5DYHA 5I56B 2GH9A 5IZZA 2HFBA 4GOTA 4OESA 4ZEDA 3QXMA 1DBZA 3T0JA 1B7HA 4QXDA 3HHGA 3IR1A 3FVOA 3KN8A 3M3FA 4WKMA 3ISPA 1MDP1 1H76A 4GL8A 3MUQA 1FBGA 1M5DA 1B3GA 3D1RA 1POTA 2XWVA 2DWJA 1Z7NE 3O6HA 3TTMA 5B7DA 4JWXA 1DMBA 2JJKA 3Q26A 3GXAA 1B1HA 2F7AA 1J1NA 5I84A 3V8XB 4EDPA 4QF9A 5DT6A 3MWBA 2LAOA 4ZZEA 4QSCA 5ET8A 1ZKBA 4NQ8A 4UABA 4ONYA 4Z0IA 4PFBA 4RY1A 3DP8A 2Q8JA 3FUZA 3S9EA 4LVQA 5KCJB 1NV2A 4OVSA 4HCYA 4GRKA 2XX7A 3O2AA 4YKJA 4YKIA 1EZPA 4PFTA 4FJPA 3N5LA 1B9JA 4KI0E 2Z23A 1BLFA 1D9YA 3DELB 3PPOA 4RXLA 1OLAA 1R6ZA 1WDNA 1USYE 4KQPA 3TYHA 1SQYA 3MZ1A 3RNNA 3VE1B 4I40A 3G3JA 3KBRA 4L17A 2XA5A 1NNPA 3K4UA 2KR0A 4HCWA 4PFUA 4X8RA 3MBPA 1FQCA 3ZSFA 3VV5A 2D21A 4ZE8A 4PAFA 5EHSA 3KZGA 4Z7EA 4OXVA 4ZECA 3PUVE 1UTBA 4JSOA 2Y7IA 2Q2AA 1D9QA 2QRYA 3H6VA 1PEBA 2V4CA 3PMXA 4U23A 3UIFA 1A40A 1FBPA 2Z22A 5KDTA 5F24A 3OO9A 2CZHA 3MW0A 4YB6A 4FAJA 2DDKA 1UTBB 2V84A 4BDLA 1JP4A 5EQ7A 4PGNA 4N13A 4OHNA 4TOZA 3PU5A 3VFJA 1USYH 4RA1A 4N4UA 5KDTB 4P1EA 2O51A 4G8MA 1EYKA 1NMUA 4QFNA 1OQGA 4N17A 3N6UA 2IEEA 2VOZA 1P1OA 2R6GE 4ELRA 2G93A 4FIMA 1LAFE 4X1DA 4I3YA 1FPFA 2FIXA 4F3SA 2DVZA 4DXCA 1QW0A 3SETA 2WKYA 2OK2A 4GXAA 4C1TA 1B6HA 1DTGA 3LUZA 1MXUA 2BJJX 3LUYA 2VPOA 1TWYA 4KCDA 3IOWA 3PMWA 1PB9A 3TTRA 2NUVA 2E1SA 2Q74A 2DE4A 5I58A 1Y4TA 3QK6A 1R9LA 2Y5LA 4GIZA 4R73A 3RPWA 4LUBA 4R9FA 5FTHA 2L5VA 1NV3A 2F36A 3FJ7A 4G2ZA 1YZ0A 2XHDA 3HSTA 4PE3A 2HEUA 3QYTA 4E0WA 3SESA 1Y4CA 1B5IA 2Q2CA 2Y7KA 4NEDA 3G3KA 1XHYA 2OX3A 2CEXA 1MM6A 5I58B 1YCJA 4G61A 2AL4A 1OIBA 1LFHA 1VR5A 2PYYA 2NXOA 1B1XA 4XKRA 3KC1A 1MQJA 3FVKA 2FVZA 1ZMGA 1N0TA 4IO5A 2QS1A 5I5PA 5FTIA 2F3DA 4N07A 4NF8A 4TQUQ 3UK4A 4RPNA 2MKZA 3O9PA 3RTFB 1A54A 4N8GA 4E0XA 1B0HA 1LAHE 2XXWA 2FA7A 3LR1A 4Q30B 1INPA 4KPTA 5CMCA 4NWDA 5A5XA 1UIUA 3K01A 3E3KA 2ZXTA 2DWHA 2UVHA 1P99A 1Y1MA 5I2KA 4EXKA 1LBZA 3E9XA 2WEFA 3CSBA 5ITOA 1SYIA 1URGA 2P0SA 4GWXA 4ND9A 3N6TA 4NF8B 1MXWA 4JVIA 3KFMA 1PBPA 1NUYA 1DSNA 4F1YA 4R6YA 3S9LC 4N91A 4F3BA 3MP1A 5HPQA 4O7MA 1DPPA 1MDQA 4NGUA 4U4XA 3HHFA 3QIMA 4IR8A 1B7UA 4YU0A 4NF6B 1IITA 5CM6A 1H3DA 1QUIA 5HBCA 1UIVA 2E0SA 2AIXA 4ELPA 2VP1A 3A3UA 1LGBC 4H8JA 1NL5A 4O3AA 4YICA 2PT2A 4OVQA 1FCKA 1AMFA 3VLVA 4OEUA 2I0BA 3ZS6A 5L9SA 1I69A 5H8HA 4ZEIA 1ZU0A 1HSJA 3VVEA 2NWJA 4OMBA 3FV2A 1MXZA 1FSAA 3CSGA 3BIHA 3OOAA 1MH4A 1FTLA 3FXQA 1KA1A 3KOSA 4AB5A 1MM7A 4JWOA 1ZIUA 2XXYA 4BDMA 4DXUA 3F11A 5H8HB 1FPDA 4N6PA 1FQEA 1LCFA 4GFRA 1FBFA 1US5A 1WODA 1Y20A 4LZ7A 5FBPA 4GWZA 2Y84A 4G68A 1ANFA 5IM2A 4OVPA 4IGRA 2XXXA 2I48A 3K6WA 1Y3NA 4MLVA 4DI3D 2XXUA 5BUUA 1MY0A 1MQIA 1EZOA 5IZ3A 4EXLA 4JWYA 3SEYA 4R2BA 1MH3A 2FYIA 1MPDA 4G68B 4O3CA 4GL0A 1D9VA 1NUZA 3EHUA 5I7IA 1XVXA 2XXPA 2QJEA 1EH3A 3K00A 2KLFA 3EHTA 2DE2A 3EQ1A 1IXGA 3K0VA 4H5GA 5ICTA 1FQBA 2FBPA 5EYGA 4DLDA 1OVBA 4IY5A 4OVTA 4M4GA 3WAEA 5I57A 1B52A 1FW0A 3IK6B 3OSRA 4PP0A 4MNIA 4N8YA 2Q88A 1ZBMA 3T22A 3JYRA 3IL1B 5JTYB 2O6AA 4YB7A 3K1MA 4HTGA 3DP6A 1FPJA 1OMPA 2XXRA 4ZZAA 2Y5KA 3FVGA 5F7VA 2PT1A 4KYSA 5I57B 2QMWA 1IIWA 5FHOA 2B4LA 3HN0A 1SW4A 2Z8DA 4KD5A 4AB6A 1P1QA 1R9QA 2QL3A 3RTWB 2WYPA 4LONB 1Z7ME 2UVIA 2ZZWA 2ZYNA 4N81A 1MXVA 2ANJA 5CBSA 4PFYA 1XT8A 4K3FA 2O7UA 4DZ1A 4LN5A 2ALUA 4IO7A 3MVWA 1JVYA 5FHNA 1RDYA 1JVXA 1B05A 4U1OA 4R75A 3FXBA 1IMBA 2QFLA 1TXFA 4KXPA 3C34A 4R72A 3SERA 4MIJA 5DVFA 3W15C 3LC8A 4ECFA 2GFEA 4GWSA 2XX9A 1MPCA 1A8FA 4Q5TA 2DXRA 2PVUA 4MAGA 5EYFA 3VVDA 2HXWA 4IO6A 1LBWA 4ZEBA 3LV0A 3K6UA 5EQ9A 4PCDA 3EPEA 4PC9A 1QKBA 2ZYKA 4PAIA 3PV0E 1S9TA 4EQ7A 1OVTA 3CHGA 3OEMA 4ZDMA 1LBXA 4H6DA 4OERA 2CZLA 4KHZE 5J1DA 2F6PA 4HE1A 1S50A 5JEIA 4ISUA 5L8DA 2FHYA 4BDQA 5H8NA
chains in the Genus database with same CATH topology
4GX3A 4GBWA 1FPGA 4PBQA 4M1VA 3GYYA 4N4UA 4P1EA 1QGXA 1EYKA 1XI6A 4N17A 1EYJA 2QPQA 1NUXA 2QVRA 1AWBA 3MSTA 4I3YA 2VT5A 1FPFA 2XWOA 2FIXA 2DVZA 1VDWA 3SZPA 3LUZA 1NV7A 4X04A 1Q9DA 1NV5A 1FPLA 2VPOA 4H46A 4I3EA 4XFEA 5T3JA 2Q74A 2DE4A 4H45A 2P3NA 3B8BA 1NI9A 2Y5LA 2KQZA 4GWUA 4PTKA 2L5VA 1NV3A 4N6DA 5JK4A 1YZ0A 4PE3A 1G0HA 4NAPA 1FBDA 2OX3A 3W9WA 1KZ8A 2CEXA 2HPGA 2FIEA 4PGPA 3KC0A 1DK4A 4G61A 4NN3A 4O8MA 4MEVA 1NV0A 4P9KA 4PFRA 2XWIA 4OVRA 4MMPA 3KC1A 2FVZA 3BIGA 5I5PA 2F3DA 3FBPA 5EQ8A 2MKZA 4F18A 4PFIA 4MNCA 4P47A 4N8GA 3IFCA 1IMCA 1INPA 4O94A 1FPBA 2Q8MA 4HXVA 1LBZA 2WEFA 2V3QA 4GWXA 4PF6A 1YYZA 4JVIA 1NUYA 4N91A 2BJIA 5ET6A 2ZZVA 4O7MA 1FTAA 4NGUA 1FPKA 2CEYA 5DW8A 4IR8A 3ROJA 4MJOA 2F3BA 5CM6A 2Q9TA 4GWYA 4GX4A 4PDDA 1FPEA 2QVUA 5IGAA 1DCUA 4YICA 4DI4B 1YXIA 4PBHA 4OVQA 4PETA 1NV4A 1FRPA 3RPLA 2R8TA 4NX1A 4GWWA 1FJ9A 4MNPA 1NV1A 1K9ZA 3U65A 4P8BA 1RDZA 3W9VA 4HE2A 4GX6A 2F5XA 3KBZA 3IFAA 1FSAA 3BIHA 1IMDA 3PTYA 1KA1A 5LTCA 2CZKA 4FBPA 1G0IA 4JVCA 3RPLB 1LBVA 2WYKA 3MYUA 1FPDA 4JVDA 4PF8A 2XWKA 1FBFA 1IMEA 4OA4A 5FBPA 4GWZA 4O7IA 5A5LA 1FBCA 5IM2A 4OVPA 4QBAA 4F1VA 1K9YA 1IMAA 1FPIA 2WBDA 3NOHA 2WX9A 4DI3D 1RDXA 5I3SA 4NF0A 2HHMA 2P3VA 3B50A 1LEVA 4GBVA 1EYIA 5IZ3A 4MCOA 3E79A 4F1UA 1FJ6A 5IZZA 2PCRA 4PDHA 5J16A 1FBHA 1DBZA 1NUZA 3T0JA 5I7IA 1NV6A 4QXDA 3E78A 2DE2A 3ISPA 1FBGA 2FBPA 5EYGA 5ET7A 3D1RA 4OVTA 1LBYA 2XWVA 2JJKA 2WBBA 4MNIA 5ET5A 2VPNA 4YZZA 2PFZA 4N15A 5ET8A 4N8YA 4NQ8A 4UABA 4XF5A 2ZZXA 4PFBA 1CNQA 2DE3A 1IMFA 1FPJA 2Y5KA 1NV2A 4OVSA 2XXKA 4HCYA 4OANA 4MX6A 2B4LA 4PAKA 3RYDA 4AS4A 4F19A 1BK4A 5EQAA 3QMFA 4NG7A 2WYPA 2ZZWA 4N81A 4XEQA 5ESYA 3T1BA 3A29A 4I40A 4LN5A 2HXRA 5LDZA 1RDYA 2XA5A 3FXBA 2KR0A 1IMBA 4HCWA 2PFYA 5IZ1A 2QFLA 4X8RA 4KXPA 2CZIA 1FBEA 4P1LA 4PAFA 4MIJA 4HE0A 2B4MA 4GWSA 4N6KA 4MAGA 4MHFA 1NUWA 2GQ1A 1D9QA 1LBWA 3LV0A 4AS5A 2V4CA 5EQ9A 4P56A 4PCDA 4X9TA 4PC9A 3HFUA 1FBPA 4PAIA 2HZKA 5F24A 3CHGA 5IZ3B 1LBXA 2CZHA 4P3LA 1SPIA 5EYHA 2OWZA 5J1DA 2DDKA 3EKIA 4HE1A 1JP4A 1KA0A 4NHBA 2HZLA 2QVVA 5EQ7A 2FHYA 4PGNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MX6 A;  4N8G A;  4P47 A;  4PF8 A;  2XWK A;  4PAK A;  4O94 A;  4OA4 A;  4PBQ A;  4N4U A;  3GYY A;  4P1E A;  4OVP A;  5IM2 A;  4NG7 A;  2WYP A;  4N17 A;  2ZZW A;  2WX9 A;  4DI3 D;  4XEQ A;  4NF0 A;  4PF6 A;  3B50 A;  4LN5 A;  4MCO A;  2XWO A;  4N91 A;  2ZZV A;  4O7M A;  4X04 A;  4NGU A;  2VPO A;  2CEY A;  2XA5 A;  5IZZ A;  3FXB A;  4PDH A;  2PFY A;  4XFE A;  4X8R A;  5I7I A;  5CM6 A;  4P1L A;  4PAF A;  4PDD A;  4MIJ A;  4N6D A;  5IGA A;  4OVT A;  4PE3 A;  4N6K A;  4YIC A;  2XWV A;  4DI4 B;  4PBH A;  4OVQ A;  4PET A;  4NAP A;  4MAG A;  4MHF A;  4NX1 A;  4MNP A;  4MNI A;  3U65 A;  4P8B A;  2CEX A;  2PFZ A;  2VPN A;  2V4C A;  4N15 A;  4P56 A;  4YZZ A;  4PCD A;  2HPG A;  4N8Y A;  4PC9 A;  4PGP A;  4PAI A;  4NQ8 A;  4UAB A;  4XF5 A;  2HZK A;  2ZZX A;  4NN3 A;  4O8M A;  4MEV A;  4P9K A;  4PFR A;  2XWI A;  4PFB A;  4OVR A;  4MMP A;  4P3L A;  5LTC A;  5I5P A;  4NHB A;  2HZL A;  4OVS A;  2XXK A;  4OAN A;  4PFI A;  2WYK A;  4PGN A;  4MNC A; 
#chains in the Genus database with same CATH topology
 2OWS A;  4GBW A;  4XIG Q;  4YMA A;  1H43 A;  3L6G A;  4M1V A;  4NE4 A;  3FAT A;  3KG2 A;  1MY2 A;  1QGX A;  1ZTY A;  2V3U A;  2ZNU A;  3OEN A;  3KN3 A;  2OLB A;  3QUF A;  3OSQ A;  1MS7 A;  1MY1 A;  4QFO A;  4MFI A;  4QSE A;  1JW4 A;  3MST A;  3IO6 A;  2VT5 A;  3MQ9 A;  2XWO A;  5H8N B;  1TFA A;  3IAZ A;  3O66 A;  2RC9 A;  3UP9 A;  1EU8 A;  2A5S A;  4I3E A;  1DOT A;  3ODB A;  4FOR A;  4Q0C A;  5I2N A;  2F34 A;  1URS A;  3B8B A;  2F7B A;  4I9D A;  2RCA A;  4EUO A;  4F31 B;  2VD3 A;  1O64 A;  3LSW A;  3PPP A;  2VHA A;  4N6D A;  4U21 A;  5JK4 A;  2XXQ A;  4WEP A;  2OWT A;  1SW2 A;  1IQ7 A;  1Y1Z A;  4LA9 A;  1PDA A;  4BDR A;  2H99 A;  3T9V A;  4ZEF A;  1FBD A;  3W9W A;  4JBZ A;  3TZA A;  2P1S A;  1L5T A;  2FIE A;  1H45 A;  1DK4 A;  4OYV A;  1B5J A;  4O8M A;  2X7P A;  3OO6 A;  4PFR A;  4OVR A;  3GLB A;  2HAV A;  4LQ2 A;  3ZKK A;  3CR9 A;  1SI1 A;  1VSO A;  3K6V A;  3FBP A;  3C33 A;  3C36 A;  4F18 A;  1SW5 A;  2YPN A;  4MNC A;  4P47 A;  3P7I A;  1IMC A;  4P0I A;  4O94 A;  1LAG E;  1ZJL A;  1OQH A;  1Y3Q A;  2DYX A;  3GZG A;  3LSX A;  2Q8M A;  2ONR A;  4IGT A;  5K2Y A;  4F39 A;  4IY6 A;  4QFL A;  5BWJ A;  3G3H A;  4F2Q A;  3PPN A;  2FNC A;  1YYZ A;  2VD2 A;  1JW1 A;  4HW8 A;  5AA3 A;  1US4 A;  3QAX A;  4LP2 B;  2X7Q A;  4JSD A;  5ET6 A;  3H6U A;  3Q28 A;  5I59 A;  1FPK A;  1T0K A;  3U1O A;  5IAI A;  2F3B A;  1BIY A;  3USD A;  5B70 A;  4H8I A;  1SVX B;  3KSX A;  1CB6 A;  1M5B A;  3OO8 A;  1RYO A;  4GWY A;  4GX4 A;  5ICQ A;  3TCF A;  1FPE A;  1LLS A;  3R7X A;  2B3B A;  2B3F A;  4IO2 A;  4QHQ A;  4DXB A;  4DI4 B;  5AA2 A;  3RN8 A;  4PET A;  1FRP A;  2R8T A;  4NX1 A;  1B5H A;  4GWW A;  3IJX B;  3U65 A;  4P8B A;  2UXA A;  1LB9 A;  4GX6 A;  4GLI A;  1FTK A;  1YAE A;  2O68 A;  3T9H B;  2VGQ A;  5ITP A;  5LTC A;  3IOV A;  2RF1 A;  3MZB A;  4RPO A;  2CZK A;  3G3G A;  4XXU A;  5L9M A;  1B3F A;  3C32 A;  5CMM A;  2WYK A;  3K02 A;  4GWO A;  1IME A;  1ATG A;  3CFX A;  5M2V A;  3E13 X;  3TQL A;  4OFO A;  4H0W A;  1FBC A;  2O84 X;  4WED A;  3VXB A;  4PQJ A;  5H8F A;  3VXC A;  3FIR A;  3BFU A;  3O97 A;  1B2H A;  3OEK A;  3SEU A;  3NOH A;  2THI A;  1RDX A;  4IO3 A;  2IA4 A;  3IB1 A;  5ELV A;  2HHM A;  3B50 A;  1NNF A;  5TP9 A;  4OQO A;  4MCO A;  3KGC A;  1S7Y A;  2X26 A;  1GTK A;  3FD3 A;  3MVX A;  2O7I A;  1F9B A;  1URD A;  2R71 A;  3S9M C;  2Q89 A;  3S9N C;  5H8F B;  1ELJ A;  5J16 A;  5DVI A;  1FTO A;  3BBR A;  3C9H A;  3TTK A;  2REG A;  3O6I A;  4DIG A;  1LBC A;  4ESX A;  3E78 A;  1QUK A;  4POX A;  4GVO A;  5CBR A;  5ET7 A;  4QFP A;  2H4I A;  3EN3 A;  2I3W A;  5A5X B;  3K2D A;  4TLL B;  3CI8 A;  3C4M A;  5I2K B;  2PMS A;  2VPN A;  4N15 A;  4IO4 A;  5CMK A;  1UTH A;  1MQH A;  1MY3 A;  4I62 A;  4YB5 A;  1CNQ A;  4DCY A;  1Q35 A;  3FZV A;  1YPN A;  1MG1 A;  3TAJ A;  3MPL A;  4U1Z A;  2I4C A;  2XXK A;  3I5O A;  4MX6 A;  1N3X A;  3B6W A;  3HPI A;  4AS4 A;  1UTH B;  3B6Q A;  4F19 A;  3T96 B;  5EQA A;  2F6G A;  1B51 A;  4R74 A;  4XEQ A;  5ESY A;  3ILT B;  3A29 A;  1IZ1 A;  3SKP A;  2UVJ A;  2HXR A;  3U94 A;  2HCA A;  3K1P A;  2F7C A;  1D4N A;  2G29 A;  5AA2 D;  3H7M A;  3TFL A;  2XXV A;  2DVC A;  4OEV A;  4NWC A;  1N7X A;  4UA8 A;  3RQT A;  3B6T A;  5IZ1 A;  3CFZ A;  2H9B A;  3DM0 A;  2ONS A;  1GGG A;  1FBE A;  4JXI A;  2I4B A;  1O7T A;  3U72 A;  2O1M A;  2YJP A;  4N6K A;  2V3T A;  4MHF A;  3K6X A;  4RJZ A;  4KFQ A;  4AS5 A;  4P56 A;  4POW A;  3HFU A;  2I58 A;  2QSX A;  1B40 A;  3TTN A;  5IZ3 B;  2XD3 A;  4P3L A;  3QUJ A;  5EYH A;  2QMX A;  4U22 A;  2F8D A;  1B3E A;  1I6Q A;  2A5T A;  2HZL A;  4G68 C;  3KJ7 A;  3MPK A;  1DPE A;  4GX3 A;  3JV9 A;  5CMB A;  1FPG A;  1B4Z A;  5CI5 A;  3TUS A;  3L6H A;  4NF5 A;  2DQV A;  4KCC A;  4R2F A;  5FHM A;  1LAX A;  4H65 A;  2HAU A;  1PBQ A;  1XI6 A;  3FAS A;  1EYJ A;  1H44 A;  1NUX A;  2QPQ A;  4ZS9 A;  1AWB A;  3FXU A;  2W7Y A;  4DCX A;  1B7Z A;  1MRP A;  4FAT A;  3CG1 A;  5CC2 A;  4FE8 A;  3H06 B;  1VDW A;  3SZP A;  5KZT A;  1NV7 A;  4X04 A;  1IXI A;  2HQ0 A;  2QS2 A;  1FPL A;  4H46 A;  1I6A A;  2AL5 A;  4NF5 B;  2ZYM A;  2ZMB A;  4ZEK A;  2P2A A;  3IJO B;  3R6U A;  1A7L A;  2PBW A;  4H45 A;  1NI9 A;  1P1W A;  4PTK A;  1NKX A;  1RYX A;  2RKM A;  3G3F A;  4QRZ A;  1G0H A;  1OLC A;  1M5F A;  3C35 A;  3JZJ A;  1GR2 A;  5ISU A;  1NNK A;  2HPG A;  3O29 A;  3CIJ A;  3KC0 A;  4BDO A;  1BKA A;  2Z8E A;  3TPA A;  5I56 A;  2RC8 A;  4NN3 A;  3V5A A;  4P9K A;  4OEN A;  4XTC Q;  1Y9U A;  2UVG A;  4MMP A;  3GBA A;  1QVS A;  1P1N A;  3FV1 A;  3DP4 A;  4XKN A;  3TTL A;  1NFT A;  1MY4 A;  3H03 A;  5EQ8 A;  4PFI A;  4X48 A;  3T93 B;  1LBB A;  3FJM A;  3KN7 A;  1N84 A;  4PFW A;  3QSL A;  1GVC A;  4PE5 B;  4AQ4 A;  4HXV A;  3TEP A;  4F3P A;  3GBB A;  3OO7 A;  1CE2 A;  2RC7 A;  3MC2 A;  2DSF A;  4LZ5 A;  2V3Q A;  3PUW E;  2ESN A;  3MJN A;  4P11 A;  3VLW A;  1WVJ A;  3PGF A;  2M8C A;  1N04 A;  4XKP A;  3ZKL A;  3FVN A;  3K1N A;  2ZZV A;  4GQO A;  4BLA A;  1FTA A;  1Q1K A;  1VFE A;  5KCJ A;  4KYE A;  1LCT A;  4RK9 A;  3H6T A;  3UA8 A;  4C0R A;  2R9J A;  1JEU A;  2ZYO A;  2Q9T A;  4Q8R A;  3SDF A;  3UN6 A;  1A8E A;  4PDD A;  3KOT A;  3S4U A;  2ABH A;  3Q25 A;  4X1B A;  4OWD A;  3SEV A;  5IGA A;  1POY 1;  1YXI A;  4PBH A;  1NV4 A;  1QKA A;  1FJ9 A;  3IB2 A;  1K9Z A;  1RDZ A;  3W9V A;  4HE2 A;  1M5E A;  1SDX A;  1TFD A;  3IFA A;  3MVZ A;  5AA1 A;  1NNT A;  1IMD A;  3PTY A;  5DEX A;  2PX1 A;  1PB8 A;  1PB7 A;  2B65 A;  1SBP A;  1SD3 A;  4NMY A;  1A99 A;  3PPR A;  3MYU A;  3V83 A;  4PF8 A;  2XWK A;  3KSJ A;  5I2N B;  1MQD A;  3S2V A;  3MP6 A;  3PD8 A;  4QBA A;  4YAH X;  3IB0 A;  2H25 A;  1FPI A;  5DEX B;  1A55 A;  2WBD A;  3TDJ A;  5I3S A;  1R1N A;  4GXS B;  4F2O A;  1XS5 A;  4NF0 A;  3VDF A;  4RYA A;  3SEX A;  3R26 A;  2P3V A;  2QS4 A;  3LSL A;  3TEL A;  2OJT A;  4IB2 A;  3KEI A;  4GBV A;  2OZZ A;  2D5W A;  4FED A;  4F1U A;  1FQF A;  1HSL A;  3OMB A;  1FJ6 A;  2PCR A;  4PDH A;  1FBH A;  2REJ A;  2DWI A;  1LST A;  1NV6 A;  3H4Z A;  1II5 A;  3DLN A;  1EZ9 A;  3RUM A;  3IOR A;  2Y7R A;  1LB8 A;  2DOJ A;  4YKK A;  3O28 A;  3CG3 A;  2GHB A;  4KYD A;  1LBY A;  4NF4 A;  4JB7 A;  2XD2 A;  3WAF A;  2WBB A;  4LQ5 A;  1D3K A;  5ET5 A;  4RNS A;  3RLF E;  1BP5 A;  2PFZ A;  4YZZ A;  4KR5 A;  4R6H A;  3B7D A;  4XF5 A;  2ZZX A;  2GHA A;  4MBP A;  3OXN A;  3ONM A;  2F35 A;  2DE3 A;  1SW1 A;  1IMF A;  4U2R A;  3MP8 A;  3TCH A;  4NF4 B;  4DE8 A;  5I59 B;  4WXJ A;  1FTM A;  2YLN A;  4ELO A;  4OAN A;  1ZLQ A;  1FQA A;  3M8U A;  2F78 A;  4F22 A;  3G3I A;  4PAK A;  1QUJ A;  3RYD A;  3BKI B;  1NH7 A;  3ECR A;  2I3V A;  1BTJ A;  5HM4 B;  3BFT A;  3TMG A;  1BK4 A;  3QMF A;  3CVG A;  4OET A;  4NG7 A;  5AA2 B;  1I6B A;  1M5C A;  4FEB A;  3T1B A;  3MVY A;  3TOD A;  3VLU A;  3H6W A;  4MH5 A;  3D4G A;  4RK2 A;  4BDN A;  5LDZ A;  4THI A;  2D3I A;  3HO7 A;  4C1U A;  3IOT A;  4DDD A;  1RKM A;  3HCQ A;  4LAT A;  2PFY A;  3U92 A;  1N7W A;  3D4C A;  1VE4 A;  2CZI A;  2V93 A;  2DP8 A;  4P1L A;  1NH8 A;  4HE0 A;  3T9X B;  1AIV A;  4R6K A;  2OBG A;  1N76 A;  2B4M A;  4G77 A;  1JNF A;  1SI0 A;  3FJG A;  3MAM A;  1MQG A;  3O6G A;  4YKP A;  2ZNT A;  3UGW A;  3Q29 A;  1NUW A;  5H8Q A;  2GQ1 A;  1VFD A;  1IEJ A;  3VVF A;  1XVY A;  3C31 A;  4X9T A;  3N94 A;  2HZK A;  3CRB A;  3E4R A;  3I3V A;  5TP9 B;  1UQW A;  4NF6 A;  4OZ9 A;  1SPI A;  3PD9 A;  4I1D A;  4TLM B;  2OWZ A;  4ELQ A;  3PMV A;  3EKI A;  4I8C A;  1KA0 A;  4NHB A;  3TCG A;  5L9O A;  2QVV A;  5H8Q B;  3FXR A;  1IXC A;  3U8Q A;  4MF3 A;  3M3L A;  1LFI A;  1B4H A;  4XKQ A;  4H1X A;  4PBQ A;  3GYY A;  1IXH A;  4R9G A;  2O69 A;  3H3G A;  3MZ9 A;  4OTE A;  3V89 B;  3IX1 A;  4G4P A;  1MPB A;  2AYS A;  2QVR A;  2ZNS A;  4FEC A;  4ZE9 A;  4F3G A;  1MXX A;  3SEW A;  2H5Y A;  2RIN A;  4MLQ A;  2XXH A;  1Y3P A;  1Q9D A;  1NV5 A;  1LFG A;  3UOR A;  4XFE A;  5T3J A;  1XC1 A;  1JET A;  2P3N A;  1TT1 A;  2I0C A;  2KQZ A;  4ESW A;  4GWU A;  1QUL A;  2XXI A;  3RGY A;  4EF2 A;  1B3H A;  3TQW A;  1O63 A;  1B0L A;  4O3B A;  2NVU B;  4NAP A;  4OFJ A;  3OEL A;  3PUZ E;  2UYF A;  2I49 A;  1KWH A;  2UYE A;  5LOM A;  1KZ8 A;  2GRV A;  2XXT A;  4PGP A;  1DTZ A;  4HS7 A;  3IO4 A;  2I6E A;  4MEV A;  1NV0 A;  5IKB A;  5TU0 A;  2XWI A;  2NOO A;  1B46 A;  3TKD A;  1JW5 A;  3IOU A;  1XOC A;  3BIG A;  4EQB A;  2F97 A;  4EF1 A;  2V25 A;  3IFC A;  4JDF A;  1JEV A;  1FPB A;  3PUY E;  1JQF A;  2Y7P A;  2XX8 A;  2RCB A;  1GV8 A;  4PF6 A;  1YTV A;  5AA4 A;  1SYH A;  2Z8F A;  3G7W A;  3U93 A;  5JTY A;  3M3K A;  2BJI A;  4F29 A;  3LSF B;  3Q27 A;  2H98 A;  2CEY A;  3A3C A;  1B32 A;  4U4S A;  5DW8 A;  3ROJ A;  4MJO A;  3RT6 B;  4QFK A;  1AL3 A;  2A5T B;  5AA4 B;  1HSE A;  3THI A;  2QVU A;  3HV1 A;  2CMO A;  1DCU A;  3AXF A;  1AH5 A;  1PC3 A;  3RT8 A;  3RPL A;  3I6V A;  4GF8 A;  2O1L A;  1QJM A;  4MNP A;  1NV1 A;  3T9U A;  2DXY A;  2F5X A;  4OVJ A;  3KBZ A;  4P0G A;  5DTB A;  4GD5 A;  3N26 A;  4G8H A;  4OFL A;  5CRY A;  3A09 A;  1N3W A;  2Y7W A;  4H5F A;  4UAC A;  2ONK E;  1B58 A;  3CFL A;  3KJT A;  1MXY A;  3OD7 A;  4NTL A;  5K2X A;  2OCU A;  1FTJ A;  4FBP A;  1G0I A;  4JVC A;  3RPL B;  4EQ9 A;  1LBV A;  2QS3 A;  3LBS A;  4JVD A;  2DWA A;  3ILU B;  4H67 A;  1IUD A;  4G8N A;  5TPA A;  4OA4 A;  1P1U A;  4YMB A;  4O7I A;  5A5L A;  3T66 A;  3FGS A;  4LZ8 A;  1AOV A;  5F1Q A;  4F1V A;  1K9Y A;  1IMA A;  3PUX E;  2WX9 A;  1FQD A;  5H8S A;  3EHS A;  3EF7 A;  3RY3 A;  5DVJ A;  1LEV A;  1EYI A;  5AE4 A;  5EHM A;  3E79 A;  3PPQ A;  2DS9 A;  5TPA B;  4QSD A;  1B3L A;  5DYH A;  5I56 B;  2GH9 A;  5IZZ A;  2HFB A;  4GOT A;  4OES A;  4ZED A;  3QXM A;  1DBZ A;  3T0J A;  1B7H A;  4QXD A;  3HHG A;  3IR1 A;  3FVO A;  3KN8 A;  3M3F A;  4WKM A;  3ISP A;  1MDP 1;  1H76 A;  4GL8 A;  3MUQ A;  1FBG A;  1M5D A;  1B3G A;  3D1R A;  1POT A;  2XWV A;  2DWJ A;  1Z7N E;  3O6H A;  3TTM A;  5B7D A;  4JWX A;  1DMB A;  2JJK A;  3Q26 A;  3GXA A;  1B1H A;  2F7A A;  1J1N A;  5I84 A;  3V8X B;  4EDP A;  4QF9 A;  5DT6 A;  3MWB A;  2LAO A;  4ZZE A;  4QSC A;  5ET8 A;  1ZKB A;  4NQ8 A;  4UAB A;  4ONY A;  4Z0I A;  4PFB A;  4RY1 A;  3DP8 A;  2Q8J A;  3FUZ A;  3S9E A;  4LVQ A;  5KCJ B;  1NV2 A;  4OVS A;  4HCY A;  4GRK A;  2XX7 A;  3O2A A;  4YKJ A;  4YKI A;  1EZP A;  4PFT A;  4FJP A;  3N5L A;  1B9J A;  4KI0 E;  2Z23 A;  1BLF A;  1D9Y A;  3DEL B;  3PPO A;  4RXL A;  1OLA A;  1R6Z A;  1WDN A;  1USY E;  4KQP A;  3TYH A;  1SQY A;  3MZ1 A;  3RNN A;  3VE1 B;  4I40 A;  3G3J A;  3KBR A;  4L17 A;  2XA5 A;  1NNP A;  3K4U A;  2KR0 A;  4HCW A;  4PFU A;  4X8R A;  3MBP A;  1FQC A;  3ZSF A;  3VV5 A;  2D21 A;  4ZE8 A;  4PAF A;  5EHS A;  3KZG A;  4Z7E A;  4OXV A;  4ZEC A;  3PUV E;  1UTB A;  4JSO A;  2Y7I A;  2Q2A A;  1D9Q A;  2QRY A;  3H6V A;  1PEB A;  2V4C A;  3PMX A;  4U23 A;  3UIF A;  1A40 A;  1FBP A;  2Z22 A;  5KDT A;  5F24 A;  3OO9 A;  2CZH A;  3MW0 A;  4YB6 A;  4FAJ A;  2DDK A;  1UTB B;  2V84 A;  4BDL A;  1JP4 A;  5EQ7 A;  4PGN A;  4N13 A;  4OHN A;  4TOZ A;  3PU5 A;  3VFJ A;  1USY H;  4RA1 A;  4N4U A;  5KDT B;  4P1E A;  2O51 A;  4G8M A;  1EYK A;  1NMU A;  4QFN A;  1OQG A;  4N17 A;  3N6U A;  2IEE A;  2VOZ A;  1P1O A;  2R6G E;  4ELR A;  2G93 A;  4FIM A;  1LAF E;  4X1D A;  4I3Y A;  1FPF A;  2FIX A;  4F3S A;  2DVZ A;  4DXC A;  1QW0 A;  3SET A;  2WKY A;  2OK2 A;  4GXA A;  4C1T A;  1B6H A;  1DTG A;  3LUZ A;  1MXU A;  2BJJ X;  3LUY A;  2VPO A;  1TWY A;  4KCD A;  3IOW A;  3PMW A;  1PB9 A;  3TTR A;  2NUV A;  2E1S A;  2Q74 A;  2DE4 A;  5I58 A;  1Y4T A;  3QK6 A;  1R9L A;  2Y5L A;  4GIZ A;  4R73 A;  3RPW A;  4LUB A;  4R9F A;  5FTH A;  2L5V A;  1NV3 A;  2F36 A;  3FJ7 A;  4G2Z A;  1YZ0 A;  2XHD A;  3HST A;  4PE3 A;  2HEU A;  3QYT A;  4E0W A;  3SES A;  1Y4C A;  1B5I A;  2Q2C A;  2Y7K A;  4NED A;  3G3K A;  1XHY A;  2OX3 A;  2CEX A;  1MM6 A;  5I58 B;  1YCJ A;  4G61 A;  2AL4 A;  1OIB A;  1LFH A;  1VR5 A;  2PYY A;  2NXO A;  1B1X A;  4XKR A;  3KC1 A;  1MQJ A;  3FVK A;  2FVZ A;  1ZMG A;  1N0T A;  4IO5 A;  2QS1 A;  5I5P A;  5FTI A;  2F3D A;  4N07 A;  4NF8 A;  4TQU Q;  3UK4 A;  4RPN A;  2MKZ A;  3O9P A;  3RTF B;  1A54 A;  4N8G A;  4E0X A;  1B0H A;  1LAH E;  2XXW A;  2FA7 A;  3LR1 A;  4Q30 B;  1INP A;  4KPT A;  5CMC A;  4NWD A;  5A5X A;  1UIU A;  3K01 A;  3E3K A;  2ZXT A;  2DWH A;  2UVH A;  1P99 A;  1Y1M A;  5I2K A;  4EXK A;  1LBZ A;  3E9X A;  2WEF A;  3CSB A;  5ITO A;  1SYI A;  1URG A;  2P0S A;  4GWX A;  4ND9 A;  3N6T A;  4NF8 B;  1MXW A;  4JVI A;  3KFM A;  1PBP A;  1NUY A;  1DSN A;  4F1Y A;  4R6Y A;  3S9L C;  4N91 A;  4F3B A;  3MP1 A;  5HPQ A;  4O7M A;  1DPP A;  1MDQ A;  4NGU A;  4U4X A;  3HHF A;  3QIM A;  4IR8 A;  1B7U A;  4YU0 A;  4NF6 B;  1IIT A;  5CM6 A;  1H3D A;  1QUI A;  5HBC A;  1UIV A;  2E0S A;  2AIX A;  4ELP A;  2VP1 A;  3A3U A;  1LGB C;  4H8J A;  1NL5 A;  4O3A A;  4YIC A;  2PT2 A;  4OVQ A;  1FCK A;  1AMF A;  3VLV A;  4OEU A;  2I0B A;  3ZS6 A;  5L9S A;  1I69 A;  5H8H A;  4ZEI A;  1ZU0 A;  1HSJ A;  3VVE A;  2NWJ A;  4OMB A;  3FV2 A;  1MXZ A;  1FSA A;  3CSG A;  3BIH A;  3OOA A;  1MH4 A;  1FTL A;  3FXQ A;  1KA1 A;  3KOS A;  4AB5 A;  1MM7 A;  4JWO A;  1ZIU A;  2XXY A;  4BDM A;  4DXU A;  3F11 A;  5H8H B;  1FPD A;  4N6P A;  1FQE A;  1LCF A;  4GFR A;  1FBF A;  1US5 A;  1WOD A;  1Y20 A;  4LZ7 A;  5FBP A;  4GWZ A;  2Y84 A;  4G68 A;  1ANF A;  5IM2 A;  4OVP A;  4IGR A;  2XXX A;  2I48 A;  3K6W A;  1Y3N A;  4MLV A;  4DI3 D;  2XXU A;  5BUU A;  1MY0 A;  1MQI A;  1EZO A;  5IZ3 A;  4EXL A;  4JWY A;  3SEY A;  4R2B A;  1MH3 A;  2FYI A;  1MPD A;  4G68 B;  4O3C A;  4GL0 A;  1D9V A;  1NUZ A;  3EHU A;  5I7I A;  1XVX A;  2XXP A;  2QJE A;  1EH3 A;  3K00 A;  2KLF A;  3EHT A;  2DE2 A;  3EQ1 A;  1IXG A;  3K0V A;  4H5G A;  5ICT A;  1FQB A;  2FBP A;  5EYG A;  4DLD A;  1OVB A;  4IY5 A;  4OVT A;  4M4G A;  3WAE A;  5I57 A;  1B52 A;  1FW0 A;  3IK6 B;  3OSR A;  4PP0 A;  4MNI A;  4N8Y A;  2Q88 A;  1ZBM A;  3T22 A;  3JYR A;  3IL1 B;  5JTY B;  2O6A A;  4YB7 A;  3K1M A;  4HTG A;  3DP6 A;  1FPJ A;  1OMP A;  2XXR A;  4ZZA A;  2Y5K A;  3FVG A;  5F7V A;  2PT1 A;  4KYS A;  5I57 B;  2QMW A;  1IIW A;  5FHO A;  2B4L A;  3HN0 A;  1SW4 A;  2Z8D A;  4KD5 A;  4AB6 A;  1P1Q A;  1R9Q A;  2QL3 A;  3RTW B;  2WYP A;  4LON B;  1Z7M E;  2UVI A;  2ZZW A;  2ZYN A;  4N81 A;  1MXV A;  2ANJ A;  5CBS A;  4PFY A;  1XT8 A;  4K3F A;  2O7U A;  4DZ1 A;  4LN5 A;  2ALU A;  4IO7 A;  3MVW A;  1JVY A;  5FHN A;  1RDY A;  1JVX A;  1B05 A;  4U1O A;  4R75 A;  3FXB A;  1IMB A;  2QFL A;  1TXF A;  4KXP A;  3C34 A;  4R72 A;  3SER A;  4MIJ A;  5DVF A;  3W15 C;  3LC8 A;  4ECF A;  2GFE A;  4GWS A;  2XX9 A;  1MPC A;  1A8F A;  4Q5T A;  2DXR A;  2PVU A;  4MAG A;  5EYF A;  3VVD A;  2HXW A;  4IO6 A;  1LBW A;  4ZEB A;  3LV0 A;  3K6U A;  5EQ9 A;  4PCD A;  3EPE A;  4PC9 A;  1QKB A;  2ZYK A;  4PAI A;  3PV0 E;  1S9T A;  4EQ7 A;  1OVT A;  3CHG A;  3OEM A;  4ZDM A;  1LBX A;  4H6D A;  4OER A;  2CZL A;  4KHZ E;  5J1D A;  2F6P A;  4HE1 A;  1S50 A;  5JEI A;  4ISU A;  5L8D A;  2FHY A;  4BDQ A;  5H8N A; 
#chains in the Genus database with same CATH homology
 4GX3 A;  4GBW A;  1FPG A;  4PBQ A;  4M1V A;  3GYY A;  4N4U A;  4P1E A;  1QGX A;  1EYK A;  1XI6 A;  4N17 A;  1EYJ A;  2QPQ A;  1NUX A;  2QVR A;  1AWB A;  3MST A;  4I3Y A;  2VT5 A;  1FPF A;  2XWO A;  2FIX A;  2DVZ A;  1VDW A;  3SZP A;  3LUZ A;  1NV7 A;  4X04 A;  1Q9D A;  1NV5 A;  1FPL A;  2VPO A;  4H46 A;  4I3E A;  4XFE A;  5T3J A;  2Q74 A;  2DE4 A;  4H45 A;  2P3N A;  3B8B A;  1NI9 A;  2Y5L A;  2KQZ A;  4GWU A;  4PTK A;  2L5V A;  1NV3 A;  4N6D A;  5JK4 A;  1YZ0 A;  4PE3 A;  1G0H A;  4NAP A;  1FBD A;  2OX3 A;  3W9W A;  1KZ8 A;  2CEX A;  2HPG A;  2FIE A;  4PGP A;  3KC0 A;  1DK4 A;  4G61 A;  4NN3 A;  4O8M A;  4MEV A;  1NV0 A;  4P9K A;  4PFR A;  2XWI A;  4OVR A;  4MMP A;  3KC1 A;  2FVZ A;  3BIG A;  5I5P A;  2F3D A;  3FBP A;  5EQ8 A;  2MKZ A;  4F18 A;  4PFI A;  4MNC A;  4P47 A;  4N8G A;  3IFC A;  1IMC A;  1INP A;  4O94 A;  1FPB A;  2Q8M A;  4HXV A;  1LBZ A;  2WEF A;  2V3Q A;  4GWX A;  4PF6 A;  1YYZ A;  4JVI A;  1NUY A;  4N91 A;  2BJI A;  5ET6 A;  2ZZV A;  4O7M A;  1FTA A;  4NGU A;  1FPK A;  2CEY A;  5DW8 A;  4IR8 A;  3ROJ A;  4MJO A;  2F3B A;  5CM6 A;  2Q9T A;  4GWY A;  4GX4 A;  4PDD A;  1FPE A;  2QVU A;  5IGA A;  1DCU A;  4YIC A;  4DI4 B;  1YXI A;  4PBH A;  4OVQ A;  4PET A;  1NV4 A;  1FRP A;  3RPL A;  2R8T A;  4NX1 A;  4GWW A;  1FJ9 A;  4MNP A;  1NV1 A;  1K9Z A;  3U65 A;  4P8B A;  1RDZ A;  3W9V A;  4HE2 A;  4GX6 A;  2F5X A;  3KBZ A;  3IFA A;  1FSA A;  3BIH A;  1IMD A;  3PTY A;  1KA1 A;  5LTC A;  2CZK A;  4FBP A;  1G0I A;  4JVC A;  3RPL B;  1LBV A;  2WYK A;  3MYU A;  1FPD A;  4JVD A;  4PF8 A;  2XWK A;  1FBF A;  1IME A;  4OA4 A;  5FBP A;  4GWZ A;  4O7I A;  5A5L A;  1FBC A;  5IM2 A;  4OVP A;  4QBA A;  4F1V A;  1K9Y A;  1IMA A;  1FPI A;  2WBD A;  3NOH A;  2WX9 A;  4DI3 D;  1RDX A;  5I3S A;  4NF0 A;  2HHM A;  2P3V A;  3B50 A;  1LEV A;  4GBV A;  1EYI A;  5IZ3 A;  4MCO A;  3E79 A;  4F1U A;  1FJ6 A;  5IZZ A;  2PCR A;  4PDH A;  5J16 A;  1FBH A;  1DBZ A;  1NUZ A;  3T0J A;  5I7I A;  1NV6 A;  4QXD A;  3E78 A;  2DE2 A;  3ISP A;  1FBG A;  2FBP A;  5EYG A;  5ET7 A;  3D1R A;  4OVT A;  1LBY A;  2XWV A;  2JJK A;  2WBB A;  4MNI A;  5ET5 A;  2VPN A;  4YZZ A;  2PFZ A;  4N15 A;  5ET8 A;  4N8Y A;  4NQ8 A;  4UAB A;  4XF5 A;  2ZZX A;  4PFB A;  1CNQ A;  2DE3 A;  1IMF A;  1FPJ A;  2Y5K A;  1NV2 A;  4OVS A;  2XXK A;  4HCY A;  4OAN A;  4MX6 A;  2B4L A;  4PAK A;  3RYD A;  4AS4 A;  4F19 A;  1BK4 A;  5EQA A;  3QMF A;  4NG7 A;  2WYP A;  2ZZW A;  4N81 A;  4XEQ A;  5ESY A;  3T1B A;  3A29 A;  4I40 A;  4LN5 A;  2HXR A;  5LDZ A;  1RDY A;  2XA5 A;  3FXB A;  2KR0 A;  1IMB A;  4HCW A;  2PFY A;  5IZ1 A;  2QFL A;  4X8R A;  4KXP A;  2CZI A;  1FBE A;  4P1L A;  4PAF A;  4MIJ A;  4HE0 A;  2B4M A;  4GWS A;  4N6K A;  4MAG A;  4MHF A;  1NUW A;  2GQ1 A;  1D9Q A;  1LBW A;  3LV0 A;  4AS5 A;  2V4C A;  5EQ9 A;  4P56 A;  4PCD A;  4X9T A;  4PC9 A;  3HFU A;  1FBP A;  4PAI A;  2HZK A;  5F24 A;  3CHG A;  5IZ3 B;  1LBX A;  2CZH A;  4P3L A;  1SPI A;  5EYH A;  2OWZ A;  5J1D A;  2DDK A;  3EKI A;  4HE1 A;  1JP4 A;  1KA0 A;  4NHB A;  2HZL A;  2QVV A;  5EQ7 A;  2FHY A;  4PGN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...