2V4CA

Structure of sialic acid binding protein (siap) in the presence of kdn
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
309
structure length
306
Chain Sequence
ADYDLKFGMNAGTSSNEYKAAEMFAKEVKEKSQGKIEISLYPSSQLGDDRAMLKQLKDGSLDFTFAESARFQLFYPEAAVFALPYVISNYNVAQKALFDTEFGKDLIKKMDKDLGVTLLSQAYNGTRQTTSNAINSIADMKGLKLRVPNAATNLAYAKYVGASPTPMAFSEVYLALQTNAVDGQENPLAAVQAQKFYEVQKFLAMTNHILNDQLYLVSNETYKLPEDLQKVVKDAAENAAKYHTKLFVDGEKDLVTFFEKQGVKTHPDLVPFKESMKPYYAEFVKQTGQKGESALKQIEAINPHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Sialic Acid Binding Protein (Siap) in the Presence of Kdn
rcsb
source organism Haemophilus influenzae
molecule tags Transport protein
molecule keywords SIALIC ACID-BINDING PERIPLASMIC PROTEIN SIAP
total genus 120
structure length 306
sequence length 309
ec nomenclature
pdb deposition date 2008-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2v4cA00
4OVPA 4N8GA 4P47A 4O94A 4O8MA 5IZZA 4OVRA 4P1LA 4MX6A 4PAIA 4PFIA 5IM2A 4PFRA 4NAPA 4PF8A 2HZLA 5I7IA 2VPOA 4NN3A 2PFYA 2XWIA 4O7MA 2XA5A 2WYKA 2ZZXA 4PDDA 2WYPA 4LN5A 4MNPA 4PFBA 4PGNA 2WX9A 4PCDA 4PBHA 4DI3D 4PAFA 4P8BA 4OVQA 4NQ8A 4NG7A 4OVSA 4OVTA 4P1EA 4PC9A 4MNCA 3GYYA 2ZZWA 4XEQA 4OANA 4P9KA 4NF0A 3B50A 4N15A 5CM6A 4XFEA 4MNIA 2VPNA 4MEVA 4XF5A 4N4UA 4PETA 4N6KA 4X8RA 4N91A 4PF6A 4PBQA 2HZKA 4N8YA 4N6DA 4UABA 2CEXA 4PE3A 2XWVA 2CEYA 4OA4A 4MMPA 4YICA 4PAKA 4MAGA 4P56A 2XWKA 2ZZVA 2PFZA 4PGPA 5LTCA 4NHBA 2V4CA 4PDHA 4P3LA 5I5PA 3U65A 4DI4B 5IGAA 4MIJA 2HPGA 3FXBA 4NX1A 2XXKA 4MHFA 4MCOA 4N17A 4YZZA 2XWOA 4X04A 4NGUA
chains in the Genus database with same CATH superfamily
4G2ZA 1EYIA 4F29A 2ONRA 2Z23A 1IQ7A 4GXSB 1A8FA 3PD8A 3IL1B 1LBBA 2I0CA 3B6WA 4FIMA 1UTBB 3VXCA 1JEVA 3CFZA 1ATGA 4Z0IA 4PFIA 1NV5A 1LCFA 3T22A 3BFUA 3UIFA 5IZ3A 3O6IA 4YMBA 2V3QA 4R6YA 4H6DA 3N94A 3E13X 3CSGA 4U22A 4XKRA 1P1NA 2XXPA 3IOVA 1ZKBA 3MBPA 3O9PA 4OVTA 4P1EA 3O97A 2O84X 2PX1A 4ZEBA 3ZS6A 3OO9A 2B3BA 2LAOA 2O7IA 2CZKA 3RLFE 1SQYA 2XXTA 3TCFA 2V84A 4FATA 4FAJA 1MY1A 3LSXA 3HCQA 3MC2A 3KC1A 2FYIA 1MXZA 4KI0E 3VVFA 4PE3A 1QVSA 2NXOA 5ISUA 1Y1MA 3RUMA 3Q29A 2XWKA 1SVXB 5DYHA 2KQZA 3K01A 3UORA 1YPNA 3TDJA 4GWYA 3PUWE 4YMAA 3E79A 1Q1KA 5A5LA 3MPKA 2DVZA 3C33A 4JVCA 1JEUA 2HXRA 1EU8A 1B46A 2Y5LA 1LAHE 2F6PA 1VFEA 4NGUA 3ILUB 1Y3NA 3FV1A 4YB5A 2QSXA 2H5YA 1B4ZA 4GOTA 3MVZA 5H8QB 3T9HB 1IMCA 3MJNA 4ELPA 4BDQA 4FORA 1LAXA 2WKYA 3TTNA 1N7WA 3UN6A 4NEDA 1VDWA 3Q28A 2GHBA 1M5BA 4H0WA 1LAGE 1FBGA 1S50A 2VT5A 1BTJA 4QXDA 1FTMA 2DQVA 4G8HA 5HM4B 1LFHA 3K02A 2O7UA 1B51A 3U1OA 3FVGA 4LP2B 3HFUA 4NF5A 1CNQA 4P9KA 3FJ7A 1MDP1 2O1LA 4L17A 4P0GA 2Q88A 3ONMA 3HO7A 1YTVA 3IOTA 3PGFA 1MXVA 5BWJA 4I62A 4FBPA 2V3TA 4KCDA 4AQ4A 3IORA 1SYHA 2R6GE 4R2FA 4JDFA 4QSEA 3G3KA 5ET6A 3RQTA 2FIXA 1B9JA 1JW5A 1D9VA 2XX9A 4N81A 2DP8A 3THIA 4F2OA 4DXCA 3RY3A 4NMYA 1SBPA 1URDA 3MVXA 5ET7A 3E3KA 3G7WA 3ROJA 1Y3QA 2HXWA 2Q8MA 2MKZA 1I6QA 1B3FA 2DXRA 4UA8A 5F24A 3PPNA 4GL8A 5I84A 3TTKA 5EQ9A 2DWHA 3FIRA 4P47A 1CB6A 4MF3A 3MP8A 3FV2A 5AA2A 1B32A 4U2RA 1JQFA 4MX6A 1OLCA 2WBBA 4GWOA 1INPA 1D4NA 3T1BA 1M5DA 4PFRA 1PB8A 1LBZA 2H98A 1A54A 5I7IA 1NV7A 2I4BA 2PFYA 3KBZA 5ELVA 1FPBA 4LZ5A 2NOOA 4MNPA 1SW1A 2WX9A 2F36A 1EYJA 1B0HA 1K9ZA 5A5XA 3MZ9A 4NQ8A 4JWYA 3BBRA 3SEXA 4PQJA 4WKMA 4Z7EA 4OVJA 1LGBC 2PT2A 1PEBA 3IJXB 2Y7KA 4RPNA 2I58A 3QUJA 5DVIA 3V83A 2OWZA 2F97A 3I3VA 2HFBA 2P2AA 1NH8A 4F3BA 2VOZA 4Q8RA 1LCTA 4ELQA 2OBGA 3ZKKA 4XKPA 2V4CA 5I2NA 4DXUA 4GIZA 5I5PA 5J16A 3RGYA 3F11A 5L8DA 3Q25A 3A09A 1OVBA 4NX1A 5AA3A 2XXKA 1M5CA 1B40A 1DK4A 1KA0A 1ZBMA 3FVKA 2X26A 4JXIA 1M5FA 3C32A 3RYDA 2XXYA 3SZPA 3A3CA 3MQ9A 1YAEA 3CVGA 3MVYA 5IZZA 2F5XA 5AA2D 1L5TA 3T66A 4RJZA 3BFTA 2ZNSA 1VR5A 1ZTYA 3O2AA 5IM2A 1YCJA 3PPOA 1RYXA 5EQ8A 4U1ZA 5L9SA 1A40A 5I2KA 1QUKA 1SD3A 4MLVA 1K9YA 4RK2A 3KJTA 1EZOA 4PCDA 5DTBA 3IO6A 1FQAA 3IK6B 1B3HA 3PPRA 2P3VA 4E0WA 2G29A 1FBCA 2OZZA 4NF5B 3KJ7A 5EHMA 3O66A 2I3VA 3IB0A 4IO2A 3W9VA 3KOSA 5ICQA 3VLUA 4OHNA 3EQ1A 1H76A 3KN3A 2RCBA 5H8QA 2QJEA 2QL3A 3TTRA 4N6KA 1MM7A 4N8YA 4TOZA 3TUSA 3O29A 5CMBA 4F19A 4MMPA 2UVIA 2DWAA 5I56A 1SW4A 3H6WA 1BP5A 4PDHA 1WVJA 5CBRA 2Q2AA 2HCAA 1S7YA 3V89B 1B1HA 1GGGA 4PTKA 1ZIUA 3CR9A 3R6UA 1TWYA 4MCOA 1SW5A 5CMCA 4FEDA 4GBVA 1XVYA 4QFNA 4M4GA 4U1OA 4N8GA 3VXBA 4O94A 4ZEKA 4OVRA 2I48A 4QRZA 1BK4A 2UVGA 1N04A 3FUZA 4THIA 1FBDA 4OFJA 1LBVA 3FVNA 1R9LA 1FCKA 3DM0A 4XTCQ 4NN3A 1Y20A 5B7DA 3FJGA 3NOHA 4AS5A 2XXUA 2UXAA 4LZ7A 3H6TA 2OLBA 3SDFA 3MWBA 1UTHA 4QHQA 1NUYA 3I6VA 5FHOA 2UYFA 4ELOA 2QVRA 4GBWA 3CRBA 4EUOA 2WEFA 1B52A 4OFLA 5ITPA 2PYYA 5CM6A 1RYOA 4ELRA 1R6ZA 3PMVA 1NL5A 1I6AA 4PBQA 3PPPA 3U72A 2ZXTA 1RDZA 4GL0A 1GVCA 3PD9A 3IOUA 2O68A 4JWOA 2P1SA 1JNFA 2YLNA 3KBRA 5CRYA 1B3EA 1MPDA 1EYKA 4BDOA 4F1YA 4KHZE 1RDXA 5I58B 4LQ2A 3Q26A 3K2DA 3MAMA 3B8BA 1ANFA 5DEXB 4YZZA 2DWIA 4F2QA 5DVJA 4RY1A 5L9OA 1JVYA 5DW8A 4G77A 3LSLA 1MQIA 4JB7A 3S2VA 1QUIA 2ZNTA 1FPEA 3H3GA 4OETA 1Y4TA 5I3SA 3LSFB 4U21A 4R74A 2XXRA 3CG1A 1Y9UA 1Z7ME 5I2KB 1LBXA 2O1MA 4POWA 2FNCA 2WYKA 4Q0CA 1FPJA 4ZE8A 4H46A 2D21A 4G68A 2AL5A 3PV0E 3MPLA 4P8BA 2KLFA 1MM6A 4ONYA 2B4MA 1HSJA 2Q89A 3M8UA 2B3FA 4I1DA 3OO7A 1NNTA 4M1VA 4NF0A 3KSJA 1N76A 4O3AA 1MG1A 4XKNA 2VHAA 4IO5A 3SESA 2I49A 2XXQA 4OQOA 4N91A 1NNPA 3N6TA 3U92A 1FPKA 4K3FA 1CE2A 1FRPA 3H6UA 4MBPA 2GFEA 4P11A 5I56B 4ND9A 2I6EA 2H99A 2NWJA 4IB2A 4ESXA 1NFTA 4MAGA 1MPBA 1VFDA 4PGPA 3H7MA 4NHBA 1B6HA 3S9MC 2B4LA 2Y5KA 4QSDA 2CZLA 3VDFA 1MY3A 4U4XA 2ALUA 1IMEA 3GXAA 1DSNA 1DBZA 2OJTA 3CFLA 4QFOA 4IR8A 1SPIA 3PU5A 2F7CA 2VGQA 4OYVA 1NH7A 1HSEA 5CMMA 3JYRA 3RPLB 1D9YA 1US4A 2Y7WA 4PAIA 2HAVA 5I57B 3G3FA 4RNSA 3G3IA 1DCUA 5FBPA 4QBAA 2E1SA 5HPQA 4MH5A 1OLAA 4OENA 3UGWA 3GBAA 4GWZA 1XS5A 4DI3D 4KYEA 3RNNA 2L5VA 3KG2A 3H03A 3KZGA 2R8TA 3RN8A 1YYZA 3IOWA 2RINA 5KCJB 5ICTA 1IMAA 4GWXA 4N4UA 1R9QA 1MRPA 3FXUA 3IJOB 4PF6A 1Q9DA 3LBSA 3LR1A 5L9MA 2XWVA 1NKXA 3QIMA 4AB6A 3RT6B 4R2BA 3KN8A 4P56A 1II5A 4QFLA 1OQHA 4HE0A 3PUXE 1B4HA 1LB8A 1AL3A 4OEUA 3OD7A 4H5GA 4QFKA 1LEVA 3MUQA 2ONKE 3KC0A 2HPGA 3IFAA 5AA2B 1UTBA 2A5TA 5AE4A 4GWUA 3OSRA 3QMFA 2RC8A 4LVQA 2VD2A 4P1LA 2YPNA 3KFMA 3MP6A 1NUWA 2XXHA 5H8FA 1NV4A 1Y3PA 1H45A 1IXHA 2ESNA 3D4CA 3QK6A 4LATA 1MQHA 2F7AA 4H1XA 3EPEA 3MZ1A 4KQPA 1MY2A 4R9GA 4PP0A 4HE1A 5I57A 4LA9A 4RA1A 1LB9A 1YZ0A 3OSQA 4LZ8A 5H8NB 2ABHA 3M3LA 4OVQA 4OESA 4MNCA 3GLBA 2PMSA 3MSTA 4FE8A 4WEPA 3D1RA 4YKPA 4OXVA 3T0JA 1G0HA 1GTKA 5EYFA 3VV5A 4LONB 3MVWA 3VFJA 2RC9A 1ZMGA 4C1UA 2CEXA 3T9XB 4RPOA 3KSXA 4NWCA 4KXPA 2DYXA 1TFDA 4EDPA 1B5IA 3SEUA 4OZ9A 3T9VA 4MIJA 3TEPA 1EZ9A 5B70A 2IA4A 3B6TA 4ZEFA 5FTIA 5JTYA 1USYE 1DPEA 3Q27A 5TU0A 4OEVA 4R73A 1NV2A 2Q8JA 2DSFA 2CMOA 1D3KA 5ITOA 3TZAA 3TAJA 2AYSA 3K0VA 4KFQA 5H8HB 4DE8A 3E4RA 3O6GA 4I8CA 1FJ6A 1P1OA 4DIGA 1IEJA 5CI5A 4HS7A 4NF8B 1FJ9A 1ELJA 1FPDA 3TODA 2ZZXA 4PDDA 5BUUA 3IO4A 4NWDA 4PFBA 4N13A 1GV8A 4HCWA 4Q30B 3VE1B 5I2NB 1POY1 1IMDA 2GHAA 4PFUA 4GD5A 2XX8A 3G3JA 3IAZA 2PVUA 4KYSA 5CC2A 4HE2A 3VLVA 4XEQA 2HQ0A 1LSTA 1B7ZA 2D3IA 2ZYNA 3GBBA 4N15A 4G68B 1T0KA 1MXYA 4X8RA 1FBHA 1NV0A 5EQAA 2WBDA 4ECFA 2QFLA 3IR1A 1JETA 2O51A 3TTMA 1LFIA 4FEBA 4NF6A 4DCXA 2F8DA 4EF2A 2DE4A 3TYHA 4QFPA 3A29A 4HTGA 4BLAA 3D4GA 3UP9A 5I59A 2XXIA 1IXIA 1DTGA 3HN0A 1F9BA 1I6BA 5IGAA 4RYAA 4GLIA 3EKIA 3EN3A 2XXWA 3VVEA 3IB1A 4ZEIA 3E78A 2QPQA 4DLDA 3PPQA 3P7IA 4YKKA 4F3GA 2BJIA 4X1BA 5IAIA 3BIGA 4F3PA 5JK4A 2YJPA 3TMGA 3ILTB 4XKQA 4FECA 3T96B 1B3LA 1URSA 1FQEA 3S9EA 4F1VA 4TLLB 3C9HA 2UVHA 2RKMA 4YKIA 3RPLA 4POXA 4ZZEA 4PE5B 4LN5A 5H8NA 2O69A 4PGNA 4IY6A 2E0SA 5H8HA 3WAFA 4PC9A 1YXIA 4OANA 4XIGQ 4RK9A 3JV9A 1XOCA 2GH9A 4XF5A 3EF7A 4C1TA 3LC8A 3K6XA 4F39A 3U93A 2RF1A 1B2HA 1KWHA 4MLQA 5M2VA 5I58A 2Q74A 1FTOA 2UYEA 2Z8DA 3K00A 3ISPA 3B6QA 1H44A 2HAUA 3MZBA 1MH4A 4F3SA 3HHGA 4OTEA 4YKJA 3PMXA 1IMFA 4JSDA 1MY4A 5TPAA 2ZNUA 3K1MA 3TCGA 4P0IA 4JWXA 3LUYA 2QVVA 1AH5A 3DLNA 2XWOA 4GQOA 5K2XA 3C4MA 5I59B 4JBZA 3FJMA 4GX3A 1SI0A 3HSTA 4O8MA 2BJJX 3CIJA 3W15C 1IUDA 3BKIB 1WDNA 3TKDA 1PBPA 1NI9A 1MQDA 3QSLA 3V5AA 1AOVA 1AMFA 4DZ1A 3DP8A 2OWTA 2P0SA 3ECRA 3VLWA 1LAFE 3FATA 5AA1A 1TT1A 4ISUA 4UACA 5ET8A 4OERA 2DE3A 1OQGA 3V8XB 2F34A 4O7IA 5JTYB 1USYH 2QS2A 1FPGA 2X7QA 3K4UA 4DCYA 2R71A 1MPCA 1IXGA 3N26A 4H8IA 4MNIA 2X7PA 3RTWB 4EQ7A 1Q35A 4JVIA 2NVUB 2Z22A 2HZKA 5EHSA 4N6DA 5IZ3B 4ZECA 1FPIA 5EYGA 1TFAA 2I4CA 4F22A 4F31B 1JP4A 4GWWA 4OA4A 4YICA 2DDKA 1FSAA 4BDNA 3TQLA 2ZZVA 2G93A 5EQ7A 5T3JA 3PMWA 3EHTA 3LUZA 2F7BA 3ZSFA 4GX6A 3UA8A 3FXBA 3HPIA 3UK4A 2W7YA 1DOTA 3CG3A 3WAEA 3PUVE 1MXXA 1WODA 2F35A 4EF1A 5TPAB 1KA1A 3S4UA 3FD3A 1UTHB 5LDZA 1PB9A 1B3GA 2Y7PA 1IXCA 2XWIA 5F1QA 4GVOA 1MY0A 3K6UA 2WYPA 1XT8A 1MQJA 4I3EA 4G68C 3C36A 1FTLA 3A3UA 3K6WA 2Y7RA 1FQFA 2Z8FA 4PAFA 1NMUA 1SYIA 1NV3A 3S9LC 1OIBA 4N07A 3GYYA 4ZDMA 4PFYA 2ZZWA 2FBPA 2PT1A 3E9XA 4H45A 3B50A 3PTYA 1ZLQA 1FBFA 2B65A 1MXWA 4OMBA 4EQBA 4GXAA 3GZGA 3OOAA 4MJOA 3KEIA 3OO8A 1TXFA 2Q2CA 1QGXA 3FXRA 1SW2A 1O7TA 1JW4A 1IIWA 4LUBA 1N3WA 4PFWA 1MH3A 2DOJA 1QULA 3MYUA 2THIA 3OELA 1FQCA 4AS4A 4NF4B 4KYDA 4QSCA 4WEDA 4IO6A 4PFTA 4LQ5A 5CBSA 5CMKA 4E0XA 1A55A 1LBCA 2GRVA 4EXKA 3ODBA 1N7XA 1QW0A 1NUZA 1G0IA 3EHSA 3RT8A 3TQWA 4NAPA 4KCCA 2DE2A 3RPWA 2V25A 2DWJA 4RXLA 3OO6A 4QF9A 4YU0A 3SEWA 4TQUQ 4HW8A 3M3FA 4X48A 4DXBA 4JSOA 1NV1A 3W9WA 1FQBA 2P3NA 2XXXA 3O6HA 4JVDA 1XC1A 5AA4A 4NG7A 3QAXA 2XD3A 2ZYKA 1FQDA 4U4SA 2F3BA 3KN7A 3U8QA 1MQGA 3B7DA 2AL4A 1PC3A 2A5TB 3U94A 1VE4A 4BDRA 3L6HA 2DXYA 2QMWA 4IO3A 3FGSA 3IX1A 3HV1A 3EHUA 1IITA 4GRKA 2ONSA 2OK2A 2FVZA 2Q9TA 2UVJA 2QMXA 4GF8A 4O3BA 5H8SA 4FJPA 4R6HA 5A5XB 2JJKA 1DTZA 4BDMA 1P1UA 5JEIA 2M8CA 5TP9B 1POTA 4Q5TA 2R9JA 3FBPA 3SEVA 3N5LA 1US5A 3K1PA 4NE4A 3RTFB 3SKPA 3FXQA 2IEEA 1M5EA 1LFGA 4HXVA 1AWBA 3OEKA 2PBWA 1OMPA 1MS7A 1QKBA 1LLSA 3DP4A 4H67A 1NUXA 1XI6A 5FTHA 1O63A 4H8JA 5H8FB 4PF8A 2HZLA 4N6PA 4KPTA 1BIYA 3C34A 1RKMA 1B58A 1LBWA 2XA5A 3SEYA 5LOMA 3OENA 4YAHX 4OWDA 4X1DA 4ESWA 1B5HA 2AIXA 1GR2A 5DVFA 3TTLA 1B7UA 1PDAA 3VVDA 2F3DA 4ZE9A 3C31A 4EQ9A 4DDDA 1JVXA 1QKAA 5KDTB 4WXJA 3JZJA 5FHMA 1B0LA 4GWSA 5FHNA 4UABA 1FTAA 2O6AA 4KR5A 2FHYA 1PBQA 5DT6A 3T9UA 4PAKA 1I69A 2F78A 2OCUA 1NV6A 1SDXA 1FW0A 3DELB 2FIEA 4MFIA 2ZYOA 1FTKA 4DI4B 3I5OA 3OXNA 1B1XA 2RC7A 1SI1A 2REJA 1EZPA 1RDYA 4I3YA 3ZKLA 4IGRA 3MW0A 3FZVA 4KD5A 3QUFA 1DMBA 4C0RA 1A7LA 3C35A 2NUVA 1LBYA 4OVPA 2VD3A 3CI8A 4X9TA 1FBPA 5TP9A 1IZ1A 1PB7A 3H06B 1P1QA 2RCAA 1H43A 3M3KA 2DVCA 4I9DA 3KOTA 2FA7A 3TELA 2VPOA 1B05A 5ET5A 2XHDA 4O7MA 3OEMA 2XX7A 1J1NA 4NF8A 3TPAA 4NTLA 5AA4B 1NNFA 4R75A 1N0TA 1FPLA 2OWSA 4GFRA 3FVOA 3LV0A 1Y1ZA 4IGTA 5IZ1A 3PUZE 1MXUA 4G61A 4OVSA 2H9BA 3LSWA 1JW1A 1UQWA 4NF4A 1P99A 1NNKA 3BIHA 4AB5A 3CSBA 1KZ8A 3MP1A 3OMBA 3H6VA 2I0BA 4R72A 2ZYMA 3R7XA 2CZIA 2VP1A 2QRYA 2OX3A 2VPNA 5F7VA 4BDLA 1N3XA 4PETA 3R26A 3DP6A 2CZHA 2CEYA 4H5FA 3S9NC 2PFZA 3FASA 4R6KA 1B5JA 4F18A 4NF6B 1BLFA 2V93A 4P3LA 3U65A 1XVXA 1MDQA 2HEUA 2REGA 3USDA 1FTJA 2QVUA 4IO4A 4MHFA 5DEXA 1D9QA 4TLMB 4N17A 2A5SA 2H4IA 3L6GA 5IKBA 1FBEA 5KZTA 2V3UA 1ZU0A 4ZEDA 1UIVA 1A99A 1VSOA 2H25A 4OFOA 5EYHA 5ESYA 4IO7A 1QJMA 1A8EA 2XD2A 1EH3A 4YB6A 2I3WA 1AIVA 1FPFA 1OVTA 1UIUA 3G3GA 2F6GA 4ZS9A 5HBCA 3HHFA 3H4ZA 2Z8EA 4G8MA 5K2YA 1ZJLA 1HSLA 3IFCA 1B7HA 2QS4A 5J1DA 2ANJA 3K1NA 4PBHA 1Y4CA 1XHYA 2XXVA 1O64A 1N84A 2GQ1A 1R1NA 2DS9A 3K6VA 4ZZAA 2KR0A 4EXLA 1P1WA 4G8NA 4O3CA 4H65A 3G3HA 2PCRA 1IMBA 3KGCA 5KDTA 1QUJA 4YB7A 3SERA 4XFEA 1DPPA 4MEVA 4HCYA 1H3DA 3CHGA 3AXFA 3N6UA 4GX4A 3QYTA 2HHMA 3T93B 2Y7IA 2ZMBA 4IY5A 3CFXA 2Y84A 5KCJA 3PUYE 1Z7NE 5LTCA 2QS3A 3O28A 4XXUA 1S9TA 4U23A 4G4PA 4I40A 3TFLA 3SETA 2QS1A 3IB2A 1BKAA 2D5WA 3TCHA 4R9FA 3QXMA 4X04A 1URGA 4F1UA
chains in the Genus database with same CATH topology
4OVPA 4N8GA 1NV2A 3RYDA 4P47A 1EYIA 4GX3A 4O94A 1FBEA 4O8MA 5IZZA 4OVRA 2F5XA 2BJIA 4P1LA 4X9TA 3BIGA 4HXVA 5JK4A 1AWBA 1FBPA 5DW8A 1BK4A 3RPLB 4UABA 1KA1A 5EYHA 4MX6A 1NUWA 1NUZA 2WBBA 5ESYA 4PAIA 1FBDA 1INPA 1LBVA 1NV4A 4PFIA 1NV5A 1G0IA 1FPEA 1NUXA 1XI6A 3T1BA 5LDZA 5IM2A 1NI9A 1FJ6A 4PFRA 1IMCA 4NAPA 4PF8A 5I3SA 4F1VA 1LBZA 2HZLA 1FPFA 2DE2A 5I7IA 2VPOA 5ET5A 5EQ8A 1NV7A 4NN3A 5IZ3A 1LBXA 2PFYA 1FJ9A 3KBZA 2XWIA 1DCUA 4O7MA 2V3QA 3RPLA 1FPDA 1LBWA 5FBPA 2XA5A 2WYKA 4QBAA 2ZZXA 4PDDA 1FPJA 2WYPA 3IFCA 3NOHA 1FPBA 4LN5A 1VDWA 1NV1A 4I3EA 4MNPA 4PFBA 3W9WA 1FPLA 1K9YA 4H46A 2WX9A 4HCWA 2P3NA 4PGNA 4JVDA 4HE1A 5ET8A 4GWZA 3LV0A 4PCDA 4PBHA 1EYJA 1FBGA 1YZ0A 2DE3A 4DI3D 4PAFA 5IZ1A 1K9ZA 2L5VA 1NUYA 1NV3A 2P3VA 2VT5A 4G61A 4NG7A 1IMDA 4NQ8A 4OVSA 4OVTA 4OVQA 4P1EA 4P8BA 4O7IA 4PC9A 2R8TA 1FBCA 2B4MA 2F3BA 4MNCA 3BIHA 3GYYA 1YXIA 3MSTA 1KZ8A 2GQ1A 2QVRA 2ZZWA 4GBWA 1YYZA 3D1RA 1FPGA 4HE2A 2F3DA 2FBPA 4XEQA 2KR0A 2WEFA 4OANA 3HFUA 1CNQA 2CZKA 4H45A 4P9KA 3T0JA 3B50A 4M1VA 4NF0A 3W9VA 1G0HA 2CZIA 3PTYA 2PCRA 1IMBA 5J1DA 4N15A 5CM6A 2OWZA 4XFEA 4MNIA 2OX3A 2VPNA 4MEVA 4HCYA 1FBFA 4XF5A 1IMAA 4GWXA 3CHGA 4N4UA 4PETA 4FBPA 4JVIA 4N6KA 4GX4A 4X8RA 4N91A 4PF6A 4PBQA 1FBHA 1FPKA 2HZKA 3KC1A 4N8YA 4GWSA 1Q9DA 4MJOA 1NV0A 4N6DA 1RDZA 1FRPA 2HHMA 2CEXA 1FPIA 2CZHA 4PE3A 2XWVA 1FTAA 5EYGA 5IZ3B 4AS5A 4F19A 2CEYA 1JP4A 5EQAA 2FHYA 4GWWA 2WBDA 4OA4A 2FVZA 2QFLA 5ET6A 2Q9TA 4MMPA 4YICA 4PAKA 1QGXA 4MAGA 2Q74A 2XWKA 2DDKA 1FSAA 2KQZA 4KXPA 4P56A 4GWYA 2DE4A 2FIXA 2PFZA 2ZZVA 4HE0A 4PGPA 5LTCA 4NHBA 3E79A 5EQ7A 5A5LA 2V4CA 4PDHA 5T3JA 1NV6A 3ISPA 4QXDA 4F18A 2B4LA 1EYKA 3A29A 2Y5KA 4N81A 2DVZA 4P3LA 2FIEA 2JJKA 3LUZA 5I5PA 4JVCA 3U65A 5J16A 1LEVA 4DI4B 4GX6A 2HXRA 1RDYA 4I3YA 1IMEA 1RDXA 4PTKA 1IMFA 5ET7A 3KC0A 4MIJA 5IGAA 2QVUA 2HPGA 3FXBA 3EKIA 4NX1A 2XXKA 2Y5LA 3IFAA 3FBPA 3ROJA 1DBZA 3MYUA 4I40A 1D9QA 4MHFA 1DK4A 4MCOA 4X04A 1KA0A 2MKZA 2Q8MA 4GBVA 4IR8A 4GWUA 3B8BA 5F24A 3QMFA 3E78A 4AS4A 1SPIA 2QPQA 2QVVA 4N17A 4YZZA 5EQ9A 2XWOA 4F1UA 1LBYA 3SZPA 4NGUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OVP A;  4N8G A;  4P47 A;  4O94 A;  4O8M A;  5IZZ A;  4OVR A;  4P1L A;  4MX6 A;  4PAI A;  4PFI A;  5IM2 A;  4PFR A;  4NAP A;  4PF8 A;  2HZL A;  5I7I A;  2VPO A;  4NN3 A;  2PFY A;  2XWI A;  4O7M A;  2XA5 A;  2WYK A;  2ZZX A;  4PDD A;  2WYP A;  4LN5 A;  4MNP A;  4PFB A;  4PGN A;  2WX9 A;  4PCD A;  4PBH A;  4DI3 D;  4PAF A;  4P8B A;  4OVQ A;  4NQ8 A;  4NG7 A;  4OVS A;  4OVT A;  4P1E A;  4PC9 A;  4MNC A;  3GYY A;  2ZZW A;  4XEQ A;  4OAN A;  4P9K A;  4NF0 A;  3B50 A;  4N15 A;  5CM6 A;  4XFE A;  4MNI A;  2VPN A;  4MEV A;  4XF5 A;  4N4U A;  4PET A;  4N6K A;  4X8R A;  4N91 A;  4PF6 A;  4PBQ A;  2HZK A;  4N8Y A;  4N6D A;  4UAB A;  2CEX A;  4PE3 A;  2XWV A;  2CEY A;  4OA4 A;  4MMP A;  4YIC A;  4PAK A;  4MAG A;  4P56 A;  2XWK A;  2ZZV A;  2PFZ A;  4PGP A;  5LTC A;  4NHB A;  2V4C A;  4PDH A;  4P3L A;  5I5P A;  3U65 A;  4DI4 B;  5IGA A;  4MIJ A;  2HPG A;  3FXB A;  4NX1 A;  2XXK A;  4MHF A;  4MCO A;  4N17 A;  4YZZ A;  2XWO A;  4X04 A;  4NGU A; 
#chains in the Genus database with same CATH topology
 4G2Z A;  1EYI A;  4F29 A;  2ONR A;  2Z23 A;  1IQ7 A;  4GXS B;  1A8F A;  3PD8 A;  3IL1 B;  1LBB A;  2I0C A;  3B6W A;  4FIM A;  1UTB B;  3VXC A;  1JEV A;  3CFZ A;  1ATG A;  4Z0I A;  4PFI A;  1NV5 A;  1LCF A;  3T22 A;  3BFU A;  3UIF A;  5IZ3 A;  3O6I A;  4YMB A;  2V3Q A;  4R6Y A;  4H6D A;  3N94 A;  3E13 X;  3CSG A;  4U22 A;  4XKR A;  1P1N A;  2XXP A;  3IOV A;  1ZKB A;  3MBP A;  3O9P A;  4OVT A;  4P1E A;  3O97 A;  2O84 X;  2PX1 A;  4ZEB A;  3ZS6 A;  3OO9 A;  2B3B A;  2LAO A;  2O7I A;  2CZK A;  3RLF E;  1SQY A;  2XXT A;  3TCF A;  2V84 A;  4FAT A;  4FAJ A;  1MY1 A;  3LSX A;  3HCQ A;  3MC2 A;  3KC1 A;  2FYI A;  1MXZ A;  4KI0 E;  3VVF A;  4PE3 A;  1QVS A;  2NXO A;  5ISU A;  1Y1M A;  3RUM A;  3Q29 A;  2XWK A;  1SVX B;  5DYH A;  2KQZ A;  3K01 A;  3UOR A;  1YPN A;  3TDJ A;  4GWY A;  3PUW E;  4YMA A;  3E79 A;  1Q1K A;  5A5L A;  3MPK A;  2DVZ A;  3C33 A;  4JVC A;  1JEU A;  2HXR A;  1EU8 A;  1B46 A;  2Y5L A;  1LAH E;  2F6P A;  1VFE A;  4NGU A;  3ILU B;  1Y3N A;  3FV1 A;  4YB5 A;  2QSX A;  2H5Y A;  1B4Z A;  4GOT A;  3MVZ A;  5H8Q B;  3T9H B;  1IMC A;  3MJN A;  4ELP A;  4BDQ A;  4FOR A;  1LAX A;  2WKY A;  3TTN A;  1N7W A;  3UN6 A;  4NED A;  1VDW A;  3Q28 A;  2GHB A;  1M5B A;  4H0W A;  1LAG E;  1FBG A;  1S50 A;  2VT5 A;  1BTJ A;  4QXD A;  1FTM A;  2DQV A;  4G8H A;  5HM4 B;  1LFH A;  3K02 A;  2O7U A;  1B51 A;  3U1O A;  3FVG A;  4LP2 B;  3HFU A;  4NF5 A;  1CNQ A;  4P9K A;  3FJ7 A;  1MDP 1;  2O1L A;  4L17 A;  4P0G A;  2Q88 A;  3ONM A;  3HO7 A;  1YTV A;  3IOT A;  3PGF A;  1MXV A;  5BWJ A;  4I62 A;  4FBP A;  2V3T A;  4KCD A;  4AQ4 A;  3IOR A;  1SYH A;  2R6G E;  4R2F A;  4JDF A;  4QSE A;  3G3K A;  5ET6 A;  3RQT A;  2FIX A;  1B9J A;  1JW5 A;  1D9V A;  2XX9 A;  4N81 A;  2DP8 A;  3THI A;  4F2O A;  4DXC A;  3RY3 A;  4NMY A;  1SBP A;  1URD A;  3MVX A;  5ET7 A;  3E3K A;  3G7W A;  3ROJ A;  1Y3Q A;  2HXW A;  2Q8M A;  2MKZ A;  1I6Q A;  1B3F A;  2DXR A;  4UA8 A;  5F24 A;  3PPN A;  4GL8 A;  5I84 A;  3TTK A;  5EQ9 A;  2DWH A;  3FIR A;  4P47 A;  1CB6 A;  4MF3 A;  3MP8 A;  3FV2 A;  5AA2 A;  1B32 A;  4U2R A;  1JQF A;  4MX6 A;  1OLC A;  2WBB A;  4GWO A;  1INP A;  1D4N A;  3T1B A;  1M5D A;  4PFR A;  1PB8 A;  1LBZ A;  2H98 A;  1A54 A;  5I7I A;  1NV7 A;  2I4B A;  2PFY A;  3KBZ A;  5ELV A;  1FPB A;  4LZ5 A;  2NOO A;  4MNP A;  1SW1 A;  2WX9 A;  2F36 A;  1EYJ A;  1B0H A;  1K9Z A;  5A5X A;  3MZ9 A;  4NQ8 A;  4JWY A;  3BBR A;  3SEX A;  4PQJ A;  4WKM A;  4Z7E A;  4OVJ A;  1LGB C;  2PT2 A;  1PEB A;  3IJX B;  2Y7K A;  4RPN A;  2I58 A;  3QUJ A;  5DVI A;  3V83 A;  2OWZ A;  2F97 A;  3I3V A;  2HFB A;  2P2A A;  1NH8 A;  4F3B A;  2VOZ A;  4Q8R A;  1LCT A;  4ELQ A;  2OBG A;  3ZKK A;  4XKP A;  2V4C A;  5I2N A;  4DXU A;  4GIZ A;  5I5P A;  5J16 A;  3RGY A;  3F11 A;  5L8D A;  3Q25 A;  3A09 A;  1OVB A;  4NX1 A;  5AA3 A;  2XXK A;  1M5C A;  1B40 A;  1DK4 A;  1KA0 A;  1ZBM A;  3FVK A;  2X26 A;  4JXI A;  1M5F A;  3C32 A;  3RYD A;  2XXY A;  3SZP A;  3A3C A;  3MQ9 A;  1YAE A;  3CVG A;  3MVY A;  5IZZ A;  2F5X A;  5AA2 D;  1L5T A;  3T66 A;  4RJZ A;  3BFT A;  2ZNS A;  1VR5 A;  1ZTY A;  3O2A A;  5IM2 A;  1YCJ A;  3PPO A;  1RYX A;  5EQ8 A;  4U1Z A;  5L9S A;  1A40 A;  5I2K A;  1QUK A;  1SD3 A;  4MLV A;  1K9Y A;  4RK2 A;  3KJT A;  1EZO A;  4PCD A;  5DTB A;  3IO6 A;  1FQA A;  3IK6 B;  1B3H A;  3PPR A;  2P3V A;  4E0W A;  2G29 A;  1FBC A;  2OZZ A;  4NF5 B;  3KJ7 A;  5EHM A;  3O66 A;  2I3V A;  3IB0 A;  4IO2 A;  3W9V A;  3KOS A;  5ICQ A;  3VLU A;  4OHN A;  3EQ1 A;  1H76 A;  3KN3 A;  2RCB A;  5H8Q A;  2QJE A;  2QL3 A;  3TTR A;  4N6K A;  1MM7 A;  4N8Y A;  4TOZ A;  3TUS A;  3O29 A;  5CMB A;  4F19 A;  4MMP A;  2UVI A;  2DWA A;  5I56 A;  1SW4 A;  3H6W A;  1BP5 A;  4PDH A;  1WVJ A;  5CBR A;  2Q2A A;  2HCA A;  1S7Y A;  3V89 B;  1B1H A;  1GGG A;  4PTK A;  1ZIU A;  3CR9 A;  3R6U A;  1TWY A;  4MCO A;  1SW5 A;  5CMC A;  4FED A;  4GBV A;  1XVY A;  4QFN A;  4M4G A;  4U1O A;  4N8G A;  3VXB A;  4O94 A;  4ZEK A;  4OVR A;  2I48 A;  4QRZ A;  1BK4 A;  2UVG A;  1N04 A;  3FUZ A;  4THI A;  1FBD A;  4OFJ A;  1LBV A;  3FVN A;  1R9L A;  1FCK A;  3DM0 A;  4XTC Q;  4NN3 A;  1Y20 A;  5B7D A;  3FJG A;  3NOH A;  4AS5 A;  2XXU A;  2UXA A;  4LZ7 A;  3H6T A;  2OLB A;  3SDF A;  3MWB A;  1UTH A;  4QHQ A;  1NUY A;  3I6V A;  5FHO A;  2UYF A;  4ELO A;  2QVR A;  4GBW A;  3CRB A;  4EUO A;  2WEF A;  1B52 A;  4OFL A;  5ITP A;  2PYY A;  5CM6 A;  1RYO A;  4ELR A;  1R6Z A;  3PMV A;  1NL5 A;  1I6A A;  4PBQ A;  3PPP A;  3U72 A;  2ZXT A;  1RDZ A;  4GL0 A;  1GVC A;  3PD9 A;  3IOU A;  2O68 A;  4JWO A;  2P1S A;  1JNF A;  2YLN A;  3KBR A;  5CRY A;  1B3E A;  1MPD A;  1EYK A;  4BDO A;  4F1Y A;  4KHZ E;  1RDX A;  5I58 B;  4LQ2 A;  3Q26 A;  3K2D A;  3MAM A;  3B8B A;  1ANF A;  5DEX B;  4YZZ A;  2DWI A;  4F2Q A;  5DVJ A;  4RY1 A;  5L9O A;  1JVY A;  5DW8 A;  4G77 A;  3LSL A;  1MQI A;  4JB7 A;  3S2V A;  1QUI A;  2ZNT A;  1FPE A;  3H3G A;  4OET A;  1Y4T A;  5I3S A;  3LSF B;  4U21 A;  4R74 A;  2XXR A;  3CG1 A;  1Y9U A;  1Z7M E;  5I2K B;  1LBX A;  2O1M A;  4POW A;  2FNC A;  2WYK A;  4Q0C A;  1FPJ A;  4ZE8 A;  4H46 A;  2D21 A;  4G68 A;  2AL5 A;  3PV0 E;  3MPL A;  4P8B A;  2KLF A;  1MM6 A;  4ONY A;  2B4M A;  1HSJ A;  2Q89 A;  3M8U A;  2B3F A;  4I1D A;  3OO7 A;  1NNT A;  4M1V A;  4NF0 A;  3KSJ A;  1N76 A;  4O3A A;  1MG1 A;  4XKN A;  2VHA A;  4IO5 A;  3SES A;  2I49 A;  2XXQ A;  4OQO A;  4N91 A;  1NNP A;  3N6T A;  3U92 A;  1FPK A;  4K3F A;  1CE2 A;  1FRP A;  3H6U A;  4MBP A;  2GFE A;  4P11 A;  5I56 B;  4ND9 A;  2I6E A;  2H99 A;  2NWJ A;  4IB2 A;  4ESX A;  1NFT A;  4MAG A;  1MPB A;  1VFD A;  4PGP A;  3H7M A;  4NHB A;  1B6H A;  3S9M C;  2B4L A;  2Y5K A;  4QSD A;  2CZL A;  3VDF A;  1MY3 A;  4U4X A;  2ALU A;  1IME A;  3GXA A;  1DSN A;  1DBZ A;  2OJT A;  3CFL A;  4QFO A;  4IR8 A;  1SPI A;  3PU5 A;  2F7C A;  2VGQ A;  4OYV A;  1NH7 A;  1HSE A;  5CMM A;  3JYR A;  3RPL B;  1D9Y A;  1US4 A;  2Y7W A;  4PAI A;  2HAV A;  5I57 B;  3G3F A;  4RNS A;  3G3I A;  1DCU A;  5FBP A;  4QBA A;  2E1S A;  5HPQ A;  4MH5 A;  1OLA A;  4OEN A;  3UGW A;  3GBA A;  4GWZ A;  1XS5 A;  4DI3 D;  4KYE A;  3RNN A;  2L5V A;  3KG2 A;  3H03 A;  3KZG A;  2R8T A;  3RN8 A;  1YYZ A;  3IOW A;  2RIN A;  5KCJ B;  5ICT A;  1IMA A;  4GWX A;  4N4U A;  1R9Q A;  1MRP A;  3FXU A;  3IJO B;  4PF6 A;  1Q9D A;  3LBS A;  3LR1 A;  5L9M A;  2XWV A;  1NKX A;  3QIM A;  4AB6 A;  3RT6 B;  4R2B A;  3KN8 A;  4P56 A;  1II5 A;  4QFL A;  1OQH A;  4HE0 A;  3PUX E;  1B4H A;  1LB8 A;  1AL3 A;  4OEU A;  3OD7 A;  4H5G A;  4QFK A;  1LEV A;  3MUQ A;  2ONK E;  3KC0 A;  2HPG A;  3IFA A;  5AA2 B;  1UTB A;  2A5T A;  5AE4 A;  4GWU A;  3OSR A;  3QMF A;  2RC8 A;  4LVQ A;  2VD2 A;  4P1L A;  2YPN A;  3KFM A;  3MP6 A;  1NUW A;  2XXH A;  5H8F A;  1NV4 A;  1Y3P A;  1H45 A;  1IXH A;  2ESN A;  3D4C A;  3QK6 A;  4LAT A;  1MQH A;  2F7A A;  4H1X A;  3EPE A;  3MZ1 A;  4KQP A;  1MY2 A;  4R9G A;  4PP0 A;  4HE1 A;  5I57 A;  4LA9 A;  4RA1 A;  1LB9 A;  1YZ0 A;  3OSQ A;  4LZ8 A;  5H8N B;  2ABH A;  3M3L A;  4OVQ A;  4OES A;  4MNC A;  3GLB A;  2PMS A;  3MST A;  4FE8 A;  4WEP A;  3D1R A;  4YKP A;  4OXV A;  3T0J A;  1G0H A;  1GTK A;  5EYF A;  3VV5 A;  4LON B;  3MVW A;  3VFJ A;  2RC9 A;  1ZMG A;  4C1U A;  2CEX A;  3T9X B;  4RPO A;  3KSX A;  4NWC A;  4KXP A;  2DYX A;  1TFD A;  4EDP A;  1B5I A;  3SEU A;  4OZ9 A;  3T9V A;  4MIJ A;  3TEP A;  1EZ9 A;  5B70 A;  2IA4 A;  3B6T A;  4ZEF A;  5FTI A;  5JTY A;  1USY E;  1DPE A;  3Q27 A;  5TU0 A;  4OEV A;  4R73 A;  1NV2 A;  2Q8J A;  2DSF A;  2CMO A;  1D3K A;  5ITO A;  3TZA A;  3TAJ A;  2AYS A;  3K0V A;  4KFQ A;  5H8H B;  4DE8 A;  3E4R A;  3O6G A;  4I8C A;  1FJ6 A;  1P1O A;  4DIG A;  1IEJ A;  5CI5 A;  4HS7 A;  4NF8 B;  1FJ9 A;  1ELJ A;  1FPD A;  3TOD A;  2ZZX A;  4PDD A;  5BUU A;  3IO4 A;  4NWD A;  4PFB A;  4N13 A;  1GV8 A;  4HCW A;  4Q30 B;  3VE1 B;  5I2N B;  1POY 1;  1IMD A;  2GHA A;  4PFU A;  4GD5 A;  2XX8 A;  3G3J A;  3IAZ A;  2PVU A;  4KYS A;  5CC2 A;  4HE2 A;  3VLV A;  4XEQ A;  2HQ0 A;  1LST A;  1B7Z A;  2D3I A;  2ZYN A;  3GBB A;  4N15 A;  4G68 B;  1T0K A;  1MXY A;  4X8R A;  1FBH A;  1NV0 A;  5EQA A;  2WBD A;  4ECF A;  2QFL A;  3IR1 A;  1JET A;  2O51 A;  3TTM A;  1LFI A;  4FEB A;  4NF6 A;  4DCX A;  2F8D A;  4EF2 A;  2DE4 A;  3TYH A;  4QFP A;  3A29 A;  4HTG A;  4BLA A;  3D4G A;  3UP9 A;  5I59 A;  2XXI A;  1IXI A;  1DTG A;  3HN0 A;  1F9B A;  1I6B A;  5IGA A;  4RYA A;  4GLI A;  3EKI A;  3EN3 A;  2XXW A;  3VVE A;  3IB1 A;  4ZEI A;  3E78 A;  2QPQ A;  4DLD A;  3PPQ A;  3P7I A;  4YKK A;  4F3G A;  2BJI A;  4X1B A;  5IAI A;  3BIG A;  4F3P A;  5JK4 A;  2YJP A;  3TMG A;  3ILT B;  4XKQ A;  4FEC A;  3T96 B;  1B3L A;  1URS A;  1FQE A;  3S9E A;  4F1V A;  4TLL B;  3C9H A;  2UVH A;  2RKM A;  4YKI A;  3RPL A;  4POX A;  4ZZE A;  4PE5 B;  4LN5 A;  5H8N A;  2O69 A;  4PGN A;  4IY6 A;  2E0S A;  5H8H A;  3WAF A;  4PC9 A;  1YXI A;  4OAN A;  4XIG Q;  4RK9 A;  3JV9 A;  1XOC A;  2GH9 A;  4XF5 A;  3EF7 A;  4C1T A;  3LC8 A;  3K6X A;  4F39 A;  3U93 A;  2RF1 A;  1B2H A;  1KWH A;  4MLQ A;  5M2V A;  5I58 A;  2Q74 A;  1FTO A;  2UYE A;  2Z8D A;  3K00 A;  3ISP A;  3B6Q A;  1H44 A;  2HAU A;  3MZB A;  1MH4 A;  4F3S A;  3HHG A;  4OTE A;  4YKJ A;  3PMX A;  1IMF A;  4JSD A;  1MY4 A;  5TPA A;  2ZNU A;  3K1M A;  3TCG A;  4P0I A;  4JWX A;  3LUY A;  2QVV A;  1AH5 A;  3DLN A;  2XWO A;  4GQO A;  5K2X A;  3C4M A;  5I59 B;  4JBZ A;  3FJM A;  4GX3 A;  1SI0 A;  3HST A;  4O8M A;  2BJJ X;  3CIJ A;  3W15 C;  1IUD A;  3BKI B;  1WDN A;  3TKD A;  1PBP A;  1NI9 A;  1MQD A;  3QSL A;  3V5A A;  1AOV A;  1AMF A;  4DZ1 A;  3DP8 A;  2OWT A;  2P0S A;  3ECR A;  3VLW A;  1LAF E;  3FAT A;  5AA1 A;  1TT1 A;  4ISU A;  4UAC A;  5ET8 A;  4OER A;  2DE3 A;  1OQG A;  3V8X B;  2F34 A;  4O7I A;  5JTY B;  1USY H;  2QS2 A;  1FPG A;  2X7Q A;  3K4U A;  4DCY A;  2R71 A;  1MPC A;  1IXG A;  3N26 A;  4H8I A;  4MNI A;  2X7P A;  3RTW B;  4EQ7 A;  1Q35 A;  4JVI A;  2NVU B;  2Z22 A;  2HZK A;  5EHS A;  4N6D A;  5IZ3 B;  4ZEC A;  1FPI A;  5EYG A;  1TFA A;  2I4C A;  4F22 A;  4F31 B;  1JP4 A;  4GWW A;  4OA4 A;  4YIC A;  2DDK A;  1FSA A;  4BDN A;  3TQL A;  2ZZV A;  2G93 A;  5EQ7 A;  5T3J A;  3PMW A;  3EHT A;  3LUZ A;  2F7B A;  3ZSF A;  4GX6 A;  3UA8 A;  3FXB A;  3HPI A;  3UK4 A;  2W7Y A;  1DOT A;  3CG3 A;  3WAE A;  3PUV E;  1MXX A;  1WOD A;  2F35 A;  4EF1 A;  5TPA B;  1KA1 A;  3S4U A;  3FD3 A;  1UTH B;  5LDZ A;  1PB9 A;  1B3G A;  2Y7P A;  1IXC A;  2XWI A;  5F1Q A;  4GVO A;  1MY0 A;  3K6U A;  2WYP A;  1XT8 A;  1MQJ A;  4I3E A;  4G68 C;  3C36 A;  1FTL A;  3A3U A;  3K6W A;  2Y7R A;  1FQF A;  2Z8F A;  4PAF A;  1NMU A;  1SYI A;  1NV3 A;  3S9L C;  1OIB A;  4N07 A;  3GYY A;  4ZDM A;  4PFY A;  2ZZW A;  2FBP A;  2PT1 A;  3E9X A;  4H45 A;  3B50 A;  3PTY A;  1ZLQ A;  1FBF A;  2B65 A;  1MXW A;  4OMB A;  4EQB A;  4GXA A;  3GZG A;  3OOA A;  4MJO A;  3KEI A;  3OO8 A;  1TXF A;  2Q2C A;  1QGX A;  3FXR A;  1SW2 A;  1O7T A;  1JW4 A;  1IIW A;  4LUB A;  1N3W A;  4PFW A;  1MH3 A;  2DOJ A;  1QUL A;  3MYU A;  2THI A;  3OEL A;  1FQC A;  4AS4 A;  4NF4 B;  4KYD A;  4QSC A;  4WED A;  4IO6 A;  4PFT A;  4LQ5 A;  5CBS A;  5CMK A;  4E0X A;  1A55 A;  1LBC A;  2GRV A;  4EXK A;  3ODB A;  1N7X A;  1QW0 A;  1NUZ A;  1G0I A;  3EHS A;  3RT8 A;  3TQW A;  4NAP A;  4KCC A;  2DE2 A;  3RPW A;  2V25 A;  2DWJ A;  4RXL A;  3OO6 A;  4QF9 A;  4YU0 A;  3SEW A;  4TQU Q;  4HW8 A;  3M3F A;  4X48 A;  4DXB A;  4JSO A;  1NV1 A;  3W9W A;  1FQB A;  2P3N A;  2XXX A;  3O6H A;  4JVD A;  1XC1 A;  5AA4 A;  4NG7 A;  3QAX A;  2XD3 A;  2ZYK A;  1FQD A;  4U4S A;  2F3B A;  3KN7 A;  3U8Q A;  1MQG A;  3B7D A;  2AL4 A;  1PC3 A;  2A5T B;  3U94 A;  1VE4 A;  4BDR A;  3L6H A;  2DXY A;  2QMW A;  4IO3 A;  3FGS A;  3IX1 A;  3HV1 A;  3EHU A;  1IIT A;  4GRK A;  2ONS A;  2OK2 A;  2FVZ A;  2Q9T A;  2UVJ A;  2QMX A;  4GF8 A;  4O3B A;  5H8S A;  4FJP A;  4R6H A;  5A5X B;  2JJK A;  1DTZ A;  4BDM A;  1P1U A;  5JEI A;  2M8C A;  5TP9 B;  1POT A;  4Q5T A;  2R9J A;  3FBP A;  3SEV A;  3N5L A;  1US5 A;  3K1P A;  4NE4 A;  3RTF B;  3SKP A;  3FXQ A;  2IEE A;  1M5E A;  1LFG A;  4HXV A;  1AWB A;  3OEK A;  2PBW A;  1OMP A;  1MS7 A;  1QKB A;  1LLS A;  3DP4 A;  4H67 A;  1NUX A;  1XI6 A;  5FTH A;  1O63 A;  4H8J A;  5H8F B;  4PF8 A;  2HZL A;  4N6P A;  4KPT A;  1BIY A;  3C34 A;  1RKM A;  1B58 A;  1LBW A;  2XA5 A;  3SEY A;  5LOM A;  3OEN A;  4YAH X;  4OWD A;  4X1D A;  4ESW A;  1B5H A;  2AIX A;  1GR2 A;  5DVF A;  3TTL A;  1B7U A;  1PDA A;  3VVD A;  2F3D A;  4ZE9 A;  3C31 A;  4EQ9 A;  4DDD A;  1JVX A;  1QKA A;  5KDT B;  4WXJ A;  3JZJ A;  5FHM A;  1B0L A;  4GWS A;  5FHN A;  4UAB A;  1FTA A;  2O6A A;  4KR5 A;  2FHY A;  1PBQ A;  5DT6 A;  3T9U A;  4PAK A;  1I69 A;  2F78 A;  2OCU A;  1NV6 A;  1SDX A;  1FW0 A;  3DEL B;  2FIE A;  4MFI A;  2ZYO A;  1FTK A;  4DI4 B;  3I5O A;  3OXN A;  1B1X A;  2RC7 A;  1SI1 A;  2REJ A;  1EZP A;  1RDY A;  4I3Y A;  3ZKL A;  4IGR A;  3MW0 A;  3FZV A;  4KD5 A;  3QUF A;  1DMB A;  4C0R A;  1A7L A;  3C35 A;  2NUV A;  1LBY A;  4OVP A;  2VD3 A;  3CI8 A;  4X9T A;  1FBP A;  5TP9 A;  1IZ1 A;  1PB7 A;  3H06 B;  1P1Q A;  2RCA A;  1H43 A;  3M3K A;  2DVC A;  4I9D A;  3KOT A;  2FA7 A;  3TEL A;  2VPO A;  1B05 A;  5ET5 A;  2XHD A;  4O7M A;  3OEM A;  2XX7 A;  1J1N A;  4NF8 A;  3TPA A;  4NTL A;  5AA4 B;  1NNF A;  4R75 A;  1N0T A;  1FPL A;  2OWS A;  4GFR A;  3FVO A;  3LV0 A;  1Y1Z A;  4IGT A;  5IZ1 A;  3PUZ E;  1MXU A;  4G61 A;  4OVS A;  2H9B A;  3LSW A;  1JW1 A;  1UQW A;  4NF4 A;  1P99 A;  1NNK A;  3BIH A;  4AB5 A;  3CSB A;  1KZ8 A;  3MP1 A;  3OMB A;  3H6V A;  2I0B A;  4R72 A;  2ZYM A;  3R7X A;  2CZI A;  2VP1 A;  2QRY A;  2OX3 A;  2VPN A;  5F7V A;  4BDL A;  1N3X A;  4PET A;  3R26 A;  3DP6 A;  2CZH A;  2CEY A;  4H5F A;  3S9N C;  2PFZ A;  3FAS A;  4R6K A;  1B5J A;  4F18 A;  4NF6 B;  1BLF A;  2V93 A;  4P3L A;  3U65 A;  1XVX A;  1MDQ A;  2HEU A;  2REG A;  3USD A;  1FTJ A;  2QVU A;  4IO4 A;  4MHF A;  5DEX A;  1D9Q A;  4TLM B;  4N17 A;  2A5S A;  2H4I A;  3L6G A;  5IKB A;  1FBE A;  5KZT A;  2V3U A;  1ZU0 A;  4ZED A;  1UIV A;  1A99 A;  1VSO A;  2H25 A;  4OFO A;  5EYH A;  5ESY A;  4IO7 A;  1QJM A;  1A8E A;  2XD2 A;  1EH3 A;  4YB6 A;  2I3W A;  1AIV A;  1FPF A;  1OVT A;  1UIU A;  3G3G A;  2F6G A;  4ZS9 A;  5HBC A;  3HHF A;  3H4Z A;  2Z8E A;  4G8M A;  5K2Y A;  1ZJL A;  1HSL A;  3IFC A;  1B7H A;  2QS4 A;  5J1D A;  2ANJ A;  3K1N A;  4PBH A;  1Y4C A;  1XHY A;  2XXV A;  1O64 A;  1N84 A;  2GQ1 A;  1R1N A;  2DS9 A;  3K6V A;  4ZZA A;  2KR0 A;  4EXL A;  1P1W A;  4G8N A;  4O3C A;  4H65 A;  3G3H A;  2PCR A;  1IMB A;  3KGC A;  5KDT A;  1QUJ A;  4YB7 A;  3SER A;  4XFE A;  1DPP A;  4MEV A;  4HCY A;  1H3D A;  3CHG A;  3AXF A;  3N6U A;  4GX4 A;  3QYT A;  2HHM A;  3T93 B;  2Y7I A;  2ZMB A;  4IY5 A;  3CFX A;  2Y84 A;  5KCJ A;  3PUY E;  1Z7N E;  5LTC A;  2QS3 A;  3O28 A;  4XXU A;  1S9T A;  4U23 A;  4G4P A;  4I40 A;  3TFL A;  3SET A;  2QS1 A;  3IB2 A;  1BKA A;  2D5W A;  3TCH A;  4R9F A;  3QXM A;  4X04 A;  1URG A;  4F1U A; 
#chains in the Genus database with same CATH homology
 4OVP A;  4N8G A;  1NV2 A;  3RYD A;  4P47 A;  1EYI A;  4GX3 A;  4O94 A;  1FBE A;  4O8M A;  5IZZ A;  4OVR A;  2F5X A;  2BJI A;  4P1L A;  4X9T A;  3BIG A;  4HXV A;  5JK4 A;  1AWB A;  1FBP A;  5DW8 A;  1BK4 A;  3RPL B;  4UAB A;  1KA1 A;  5EYH A;  4MX6 A;  1NUW A;  1NUZ A;  2WBB A;  5ESY A;  4PAI A;  1FBD A;  1INP A;  1LBV A;  1NV4 A;  4PFI A;  1NV5 A;  1G0I A;  1FPE A;  1NUX A;  1XI6 A;  3T1B A;  5LDZ A;  5IM2 A;  1NI9 A;  1FJ6 A;  4PFR A;  1IMC A;  4NAP A;  4PF8 A;  5I3S A;  4F1V A;  1LBZ A;  2HZL A;  1FPF A;  2DE2 A;  5I7I A;  2VPO A;  5ET5 A;  5EQ8 A;  1NV7 A;  4NN3 A;  5IZ3 A;  1LBX A;  2PFY A;  1FJ9 A;  3KBZ A;  2XWI A;  1DCU A;  4O7M A;  2V3Q A;  3RPL A;  1FPD A;  1LBW A;  5FBP A;  2XA5 A;  2WYK A;  4QBA A;  2ZZX A;  4PDD A;  1FPJ A;  2WYP A;  3IFC A;  3NOH A;  1FPB A;  4LN5 A;  1VDW A;  1NV1 A;  4I3E A;  4MNP A;  4PFB A;  3W9W A;  1FPL A;  1K9Y A;  4H46 A;  2WX9 A;  4HCW A;  2P3N A;  4PGN A;  4JVD A;  4HE1 A;  5ET8 A;  4GWZ A;  3LV0 A;  4PCD A;  4PBH A;  1EYJ A;  1FBG A;  1YZ0 A;  2DE3 A;  4DI3 D;  4PAF A;  5IZ1 A;  1K9Z A;  2L5V A;  1NUY A;  1NV3 A;  2P3V A;  2VT5 A;  4G61 A;  4NG7 A;  1IMD A;  4NQ8 A;  4OVS A;  4OVT A;  4OVQ A;  4P1E A;  4P8B A;  4O7I A;  4PC9 A;  2R8T A;  1FBC A;  2B4M A;  2F3B A;  4MNC A;  3BIH A;  3GYY A;  1YXI A;  3MST A;  1KZ8 A;  2GQ1 A;  2QVR A;  2ZZW A;  4GBW A;  1YYZ A;  3D1R A;  1FPG A;  4HE2 A;  2F3D A;  2FBP A;  4XEQ A;  2KR0 A;  2WEF A;  4OAN A;  3HFU A;  1CNQ A;  2CZK A;  4H45 A;  4P9K A;  3T0J A;  3B50 A;  4M1V A;  4NF0 A;  3W9V A;  1G0H A;  2CZI A;  3PTY A;  2PCR A;  1IMB A;  5J1D A;  4N15 A;  5CM6 A;  2OWZ A;  4XFE A;  4MNI A;  2OX3 A;  2VPN A;  4MEV A;  4HCY A;  1FBF A;  4XF5 A;  1IMA A;  4GWX A;  3CHG A;  4N4U A;  4PET A;  4FBP A;  4JVI A;  4N6K A;  4GX4 A;  4X8R A;  4N91 A;  4PF6 A;  4PBQ A;  1FBH A;  1FPK A;  2HZK A;  3KC1 A;  4N8Y A;  4GWS A;  1Q9D A;  4MJO A;  1NV0 A;  4N6D A;  1RDZ A;  1FRP A;  2HHM A;  2CEX A;  1FPI A;  2CZH A;  4PE3 A;  2XWV A;  1FTA A;  5EYG A;  5IZ3 B;  4AS5 A;  4F19 A;  2CEY A;  1JP4 A;  5EQA A;  2FHY A;  4GWW A;  2WBD A;  4OA4 A;  2FVZ A;  2QFL A;  5ET6 A;  2Q9T A;  4MMP A;  4YIC A;  4PAK A;  1QGX A;  4MAG A;  2Q74 A;  2XWK A;  2DDK A;  1FSA A;  2KQZ A;  4KXP A;  4P56 A;  4GWY A;  2DE4 A;  2FIX A;  2PFZ A;  2ZZV A;  4HE0 A;  4PGP A;  5LTC A;  4NHB A;  3E79 A;  5EQ7 A;  5A5L A;  2V4C A;  4PDH A;  5T3J A;  1NV6 A;  3ISP A;  4QXD A;  4F18 A;  2B4L A;  1EYK A;  3A29 A;  2Y5K A;  4N81 A;  2DVZ A;  4P3L A;  2FIE A;  2JJK A;  3LUZ A;  5I5P A;  4JVC A;  3U65 A;  5J16 A;  1LEV A;  4DI4 B;  4GX6 A;  2HXR A;  1RDY A;  4I3Y A;  1IME A;  1RDX A;  4PTK A;  1IMF A;  5ET7 A;  3KC0 A;  4MIJ A;  5IGA A;  2QVU A;  2HPG A;  3FXB A;  3EKI A;  4NX1 A;  2XXK A;  2Y5L A;  3IFA A;  3FBP A;  3ROJ A;  1DBZ A;  3MYU A;  4I40 A;  1D9Q A;  4MHF A;  1DK4 A;  4MCO A;  4X04 A;  1KA0 A;  2MKZ A;  2Q8M A;  4GBV A;  4IR8 A;  4GWU A;  3B8B A;  5F24 A;  3QMF A;  3E78 A;  4AS4 A;  1SPI A;  2QPQ A;  2QVV A;  4N17 A;  4YZZ A;  5EQ9 A;  2XWO A;  4F1U A;  1LBY A;  3SZP A;  4NGU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...