4OZ9A

Crystal structure of mltf from pseudomonas aeruginosa complexed with isoleucine
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
426
structure length
424
Chain Sequence
PTALERVQKEGVLRVITRNSPATYFQDRNGETGFEYELAKRFAERLGVELKIETADNLDDLYAQLSREGGPALAAAGLTPGDDASVRYSHTYLDVTPQIIYRNGQQRPTRPEDLVGKRIMVLKGSSHAEQLAELKKQYPELKYEESDAVEVVDLLRMVDVGDIDLTLVDSNELAMNQVYFPNVRVAFDFGEARGLAWALPGGDDDSLMNEVNAFLDQAKKEGLLQRLKDRYYGHVDVLGYVGAYTFAQHLQQRLPRYESHFKQSGKQLDTDWRLLAAIGYQESLWQPGATSKTGVRGLMMLTNRTAQAMGVSNRLDPKQSIQGGSKYFVQIRSELPESIKEPDRSWFALAAYNIGGAHLEDARKMAEKEGLNPNKWLDVKKMLPRLAQKQWYAKTRYGYARGGETVHFVQNVRRYYDILTWVTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Membrane-bound lytic murein transglycosylase F
publication title Crystal structure of MltF from Pseudomonas aeruginosa complexed with isoleucine
rcsb
source organism Pseudomonas aeruginosa
total genus 143
structure length 424
sequence length 426
ec nomenclature ec 4.2.2.n1: Peptidoglycan lytic exotransglycosylase.
pdb deposition date 2014-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
A PF01464 SLT Transglycosylase SLT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4oz9A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4oz9A02
3PMWA 2B65A 4MLQA 2Z22A 4HCYA 3IB1A 4XKPA 2DYXA 5F1QA 2YPNA 4KHZE 1P99A 2ANJA 3TCFA 3VE1B 3V83A 1H76A 3O28A 2Q8JA 2YLNA 1I6QA 5EHSA 1D9YA 1LAXA 4NWCA 2DWJA 3PUVE 3DM0A 3K4UA 2ZYNA 3LUYA 4KYSA 3BFTA 3OSQA 5BUUA 2NUVA 4YKPA 1SD3A 4QHQA 1LAFE 2I0BA 1LB8A 3M3LA 4EQ7A 1JW5A 1EH3A 3HN0A 4TQUQ 2P2AA 4RJZA 4YKJA 1FCKA 2DE4A 1AMFA 1UQWA 3FJ7A 4NF6B 1MXUA 1LBBA 3O9PA 1FW0A 4KPTA 4OYVA 4YAHX 1MQGA 2F7BA 2DE3A 1PDAA 3SERA 3IO4A 2RCAA 4G8MA 1IUDA 2XXTA 2GH9A 2A5TA 3Q29A 5TPAB 3H3GA 1ELJA 4H1XA 4OEUA 3OOAA 3FV1A 3CR9A 3T9XB 3VVFA 1M5EA 3OD7A 2UXAA 2I48A 2DQVA 3SKPA 5CMCA 1B3EA 4LQ2A 4ELQA 1S50A 4PFWA 1MQJA 1Y9UA 5DT6A 5I58A 4F2OA 3R7XA 3K2DA 4NF5B 2XXQA 3PPPA 1M5DA 3USDA 1P1UA 3D4GA 2UVJA 1JNFA 3S2VA 3QAXA 1AH5A 4YZZA 2GHAA 4U22A 2V3TA 4GLIA 5CRYA 3VVDA 2H98A 3W9WA 2DWIA 3K00A 1P1NA 3FVKA 1MS7A 2OBGA 1SW2A 4KR5A 1R9LA 2F34A 3OXNA 4KYEA 4XKRA 4F1YA 1SI0A 3JZJA 5KCJA 5AA1A 3TTLA 1OVTA 4TLLB 2XD3A 4IO3A 3K6XA 3MVXA 4H65A 3RTFB 4ZZEA 3MPKA 1XC1A 1FQDA 1B0LA 1ZBMA 5H8NB 3BKIB 3K6UA 3K02A 2VGQA 5JTYA 1LSTA 3FXUA 5H8FB 3S9NC 1PEBA 1N76A 5ITPA 3ILTB 3RTWB 3SEUA 3QSLA 1B3GA 5F7VA 5ITOA 1O7TA 3VXBA 4YKKA 1MXXA 4E0XA 4H5FA 1B51A 3N5LA 1R6ZA 4H8JA 4OESA 4QSEA 3CVGA 2ONRA 4ELOA 2ESNA 5ICTA 4ZDMA 1TFDA 1B05A 2NWJA 4I9DA 1Y4CA 1H43A 3QIMA 2V93A 1N0TA 3Q26A 1ZLQA 5CI5A 3T9VA 5HPQA 1FTOA 4U4XA 5AA4B 4RY1A 1LB9A 2G29A 3IORA 4Q5TA 3N26A 2XXWA 2KLFA 3S4UA 5CMKA 2ZYKA 4FECA 4OWDA 1USYH 4OMBA 4YMBA 4NF8B 3CSGA 1USYE 2I58A 5CMBA 3C33A 4DIGA 1US4A 2O51A 1QUKA 3FJMA 1BLFA 1URDA 2ALUA 3N6UA 1L5TA 4ZE9A 4BDQA 4MLVA 3CFXA 1IZ1A 2Q89A 3TCHA 2LAOA 4HS7A 4F2QA 3MQ9A 4G68B 2AL5A 3G3JA 2Q2AA 4F3GA 4ZEKA 5AE4A 2UVGA 3JYRA 3KSJA 2OWTA 2O1LA 5K2XA 2XXVA 3K6WA 2IA4A 2REJA 1IXCA 5ELVA 2I6EA 3S9EA 3KOTA 5BWJA 3U72A 4EDPA 2XXRA 3DP4A 2ZMBA 1M5CA 3ZSFA 1P1OA 1B3LA 4F3BA 3C4MA 1DTZA 1QVSA 3H6TA 2PBWA 3T9HB 4BDRA 2PYYA 3U92A 4KQPA 3TKDA 3A09A 3TELA 2P0SA 5JTYB 4K3FA 4DZ1A 3RT8A 4U2RA 3K01A 3KGCA 1LAHE 2Q2CA 2Y84A 3IO6A 3ZS6A 3B6QA 1N84A 3O29A 1IXIA 1PB9A 4F39A 3UIFA 3CG3A 1B7ZA 1YPNA 1CB6A 4F3SA 1J1NA 1TFAA 4RK2A 1B40A 3OEKA 4X9TA 3QXMA 1OQGA 1POTA 3TODA 2HAVA 4H67A 3SETA 3MUQA 4Q8RA 4JXIA 3FXQA 1OVBA 3MPLA 3IJXB 4F3PA 2P1SA 4YB6A 5A5XB 3FJGA 4R2BA 1QUIA 2NXOA 3OELA 1T0KA 3O66A 3BBRA 2ONKE 3FZVA 1R9QA 3MAMA 1YAEA 5I57A 2DWHA 1MXWA 2DVZA 2NVUB 3G3FA 1UIUA 3ILUB 4GIZA 3FVOA 3E4RA 4OENA 1HSJA 3TDJA 3IL1B 1LFGA 3C36A 5I2KB 4IGRA 3EF7A 4ZEBA 2F7AA 3OEMA 1DPPA 3IOTA 4PP0A 2HZKA 1MY0A 1GV8A 3MBPA 1PC3A 3PMVA 3M3KA 1NKXA 4N07A 1SYIA 3K6VA 3OO7A 4GXAA 3TTKA 3PPRA 4FATA 3UP9A 4WEPA 3KOSA 4G8NA 5AA2A 1WVJA 2V3QA 3B6WA 3I5OA 3PGFA 1IXHA 1B9JA 3MZ1A 3ECRA 5CC2A 2H25A 1TWYA 5I2NB 4LZ7A 4UA8A 3UORA 3RUMA 1S9TA 2XD2A 4DCXA 1NNTA 1SBPA 5TP9A 1NH7A 5H8HA 3LSLA 1MXZA 4ESWA 1B1HA 3ZKKA 1MH3A 4R9GA 4KFQA 2HCAA 2PX1A 3RT6B 3PU5A 1VR5A 3LSXA 4X1DA 4XKNA 1A99A 3FIRA 4KCDA 4H5GA 2UYFA 4RNSA 1O64A 2RC9A 4AB6A 1PBPA 1VE4A 4XTCQ 5JEIA 4R6YA 2Y7IA 3A3CA 1M5FA 2AL4A 3OMBA 1A55A 3CFZA 3L6GA 3VLUA 4F29A 3FVNA 1MM7A 1B52A 5I57B 3JV9A 3TMGA 4IY5A 3TQWA 2Z8EA 3V89B 4DXUA 4XKQA 2XXYA 3RY3A 3EQ1A 2Z8DA 1Q1KA 1MH4A 5FTHA 3TFLA 1A54A 1QW0A 2DXYA 3RNNA 3CSBA 3V8XB 3W15C 5IAIA 2F5XA 2VD2A 4ZS9A 3C31A 1OLAA 1FTJA 2UVHA 2DP8A 4KYDA 2O69A 3K0VA 2REGA 1IQ7A 3PD9A 1JQFA 5AA2B 3OO6A 2UVIA 5HM4B 1NL5A 1MDQA 4MBPA 5FHNA 2G93A 3KZGA 1ANFA 1A7LA 3KEIA 3EN3A 4ZZAA 4G2ZA 3MVWA 5TP9B 1OIBA 4JWOA 1D4NA 3OENA 1WDNA 4GVOA 3PUWE 1ZIUA 4RK9A 3K1PA 1AIVA 1URGA 2V25A 1N3WA 1SI1A 2YJPA 2O6AA 5I59A 1ZJLA 1LBCA 5L9MA 3HSTA 2DOJA 1JW1A 3TAJA 4P0IA 1MPDA 3C35A 3OSRA 3U8QA 3MP8A 1H44A 4IO7A 2CZLA 1LCFA 1EZOA 4U1OA 4I8CA 4UACA 4OXVA 3A3UA 2DVCA 4XIGQ 3GBAA 1BP5A 4U1ZA 4F19A 4IO5A 4ELRA 1PBQA 4WEDA 5TU0A 3B7DA 4FEDA 1SW5A 1Y3PA 1MQIA 1QJMA 4R75A 3G3HA 4NEDA 3T93B 2A5TB 1N7WA 1B2HA 1MDP1 1MG1A 4TLMB 4ZEDA 4KCCA 4OHNA 4LUBA 1LCTA 1WODA 3TYHA 1XT8A 3VLVA 4IO4A 2F8DA 4N6PA 4EF1A 5KDTA 1GGGA 3TUSA 3K1NA 2I4BA 1N7XA 2D3IA 2F36A 1QKAA 5I58B 3UGWA 4U4SA 2ABHA 4F18A 5I84A 4Z0IA 4Z7EA 4X48A 4YICA 1FTKA 4AB5A 2O84X 4NTLA 5CMMA 3EHSA 3IR1A 4NE4A 3O2AA 4Q0CA 3IX1A 2ZNUA 1MRPA 1LAGE 3T96B 1JW4A 1D3KA 1CE2A 2VP1A 4LATA 4RYAA 4FJPA 4G4PA 2F97A 3ODBA 4DXCA 3SEYA 3KG2A 3UA8A 2RCBA 1H45A 4DE8A 1OLCA 4ELPA 1FTLA 4F1UA 3IK6B 4F31B 3LR1A 4YKIA 3FD3A 5DEXA 1YTVA 1SW4A 1B7HA 3H6VA 3PPQA 1B6HA 3ZKLA 5KCJB 5I59B 3O6GA 3Q28A 4GRKA 1I6BA 2HXWA 5H8QA 3PPOA 2E0SA 1GVCA 1DMBA 4JBZA 3IB0A 1B4HA 2QJEA 3H6WA 4JWYA 4NF4A 2PT1A 2XXIA 4GL0A 3C32A 2F78A 4MH5A 2ZYOA 2HZLA 1EZPA 4DDDA 1DOTA 2IEEA 2ONSA 3G7WA 4ECFA 1RYOA 2RINA 2QRYA 5HBCA 4YU0A 4GFRA 3C34A 5EYFA 1B1XA 5KZTA 2O7UA 4GWOA 1FQEA 1SDXA 4LA9A 1XVXA 1B7UA 4C1TA 5J1DA 4OETA 2B3FA 4O3CA 3MJNA 4QRZA 2RKMA 4FE8A 1B46A 3MZ9A 4YB5A 3KJ7A 2AYSA 1BIYA 4QSCA 4LONB 1B32A 1VFEA 2XXHA 1DSNA 4DXBA 3W9VA 3THIA 2QSXA 3TPAA 3T9UA 2H99A 2V84A 1FTMA 4NMYA 3OO9A 4QFLA 2RF1A 2GFEA 4FIMA 4KI0E 2R6GE 3OO8A 3MWBA 4QFPA 1POY1 2QMXA 1Y20A 3FATA 2F6GA 1XOCA 4BDMA 4MF3A 3LSWA 5TPAA 2QS4A 1NFTA 4OFOA 3QUJA 1DPEA 4GXSB 1US5A 3GLBA 4G77A 4WXJA 1I6AA 1A8FA 4PETA 4F1VA 1XHYA 2XX7A 3UN6A 4FORA 3IOWA 2DE2A 3CFLA 2QS1A 3DP6A 4IGTA 5B7DA 4C1UA 4G68C 4KD5A 2XXUA 3VV5A 1KWHA 3MP1A 4DCYA 1B0HA 5AA2D 1NH8A 3CG1A 1VSOA 1PB8A 4N13A 4ZECA 4P11A 1Y4TA 3KBRA 2DSFA 3TCGA 3HO7A 2Y7KA 2A5SA 2QPQA 4JDFA 4RA1A 2PMSA 2OZZA 1XS5A 1JEUA 3G3GA 3QK6A 3EPEA 4TOZA 1MQHA 2VHAA 2ZYMA 2Q88A 3KSXA 1NNPA 3TEPA 1LFIA 3FUZA 3D4CA 1B4ZA 1Z7NE 1MY2A 1A40A 1MXYA 4THIA 1SQYA 4BDOA 2R9JA 3O97A 4R6HA 1SYHA 1ATGA 3DELB 3HCQA 2E1SA 3KN7A 2O68A 3N6TA 3TQLA 2PVUA 1Y1ZA 1NNFA 1IITA 3HPIA 2I4CA 4R74A 5H8NA 3P7IA 3KN3A 3PUYE 4BLAA 2OLBA 3CI8A 5H8FA 2X26A 3MC2A 5B70A 1FQBA 4EQ9A 2QMWA 4E0WA 3GXAA 3MW0A 4OEVA 4ESXA 3F11A 1B3HA 3TZAA 4LP2B 1B5HA 3PUXE 1MY1A 1BKAA 2I3VA 2H4IA 3LC8A 2DWAA 3U93A 3E3KA 2NOOA 1MXVA 1A8EA 1JETA 4IO2A 1UIVA 3DLNA 2VD3A 5DVIA 1LGBC 3PUZE 1D9VA 4F22A 5AA4A 5CBRA 2R71A 1S7YA 2HAUA 3RLFE 5I56A 4ZEIA 4M1VA 1PB7A 2DXRA 2Y7PA 2B3BA 4NF8A 3QUFA 1IEJA 2WKYA 4R72A 3SEVA 2HFBA 4MFIA 3V5AA 1GTKA 3E9XA 4H8IA 3VLWA 1Y3NA 2GRVA 1SVXB 3FVGA 1ZKBA 3U1OA 1FQCA 4G68A 3G3IA 3L6HA 4L17A 3K1MA 5H8HB 4G8HA 1EU8A 2UYEA 4R73A 4O3BA 3M3FA 4LZ5A 1H3DA 4H0WA 4BDLA 5FHMA 4LZ8A 4AQ4A 1IXGA 5DYHA 2DS9A 5DVJA 1ZU0A 2W7YA 1UTBA 4U23A 4PQJA 3MZBA 5DVFA 3T66A 3Q27A 4DLDA 4EF2A 1MY4A 4PFUA 4GF8A 4PFYA 3VXCA 3ONMA 2QS2A 2Y7RA 4C0RA 4OVJA 3T22A 4ZEFA 4PE5B 2V3UA 4QF9A 4QFOA 3WAFA 2ZNTA 3VDFA 1I69A 3VFJA 3R6UA 3TTRA 4OERA 2XXXA 4H6DA 2OK2A 3H6UA 1B3FA 3AXFA 3FV2A 4GL8A 2ZNSA 3M8UA 3UK4A 2I49A 2QL3A 5JK4A 1SW1A 4RPOA 4QSDA 3RQTA 1FQFA 2F7CA 5FTIA 3CIJA 3HHGA 4ONYA 2FYIA 4EQBA 3U94A 5I56B 4EXKA 4R9FA 2FA7A 3GZGA 2VOZA 4PFTA 4WKMA 3SEWA 4JSOA 3BFUA 1B5JA 1MY3A 2XHDA 3KN8A 2D5WA 3IJOB 2XXPA 4U21A 1P1QA 4LQ5A 5A5XA 4IB2A 5LOMA 3H7MA 3RPWA 4FAJA 2O1MA 3IB2A 3EHUA 1QULA 1Y1MA 2H5YA 1IIWA 2Z23A 5IKBA 3CRBA 2D21A 1ZTYA 4I62A 4OQOA 3RGYA 3O6IA 1OQHA 1B58A 2BJJX 1Q35A 4OZ9A 1II5A 2OJTA 2RC7A 4GD5A 4HTGA 3C9HA 2QS3A 4QFKA 5AA3A 3H4ZA 2M8CA 1NMUA 3FASA 4ND9A 4P0GA 4OFJA 1Z7ME 1JEVA 3PD8A 4M4GA 5I2KA 1RYXA 1UTBB 4GQOA 3LSFB 2Z8FA 1LFHA 4ZE8A 2H9BA 4EUOA 2HEUA 2XX8A 1TXFA 2CMOA 1UTHA 1HSEA 3LBSA 1LLSA 3GBBA 3N94A 4QFNA 4IY6A 4OFLA 2FNCA 4I1DA 3H03A 4OTEA 3IOVA 4YMAA 1URSA 2THIA 3I6VA 1N04A 2F35A 4ISUA 3PMXA 4FEBA 3EHTA 3MP6A 5I2NA 3SEXA 4POWA 1MPCA 1XVYA 3S9LC 5L9OA 4RXLA 5FHOA 4JWXA 1EZ9A 1B5IA 1DTGA 4NWDA 3S9MC 1OMPA 3IOUA 4BDNA 3PPNA 4IO6A 3SESA 2GHBA 1QUJA 2F6PA 3MVYA 1QKBA 3FXRA 4JSDA 3G3KA 1YCJA 5K2YA 2I0CA 1MM6A 1R1NA 3KFMA 1MQDA 2X7PA 3RN8A 2PT2A 5KDTB 5CBSA 1VFDA 3WAEA 5L8DA 2RC8A 2ZXTA 2OWSA 4RPNA 4LVQA 1Y3QA 2Y7WA 3H06B 1HSLA 3R26A 1F9BA 3B6TA 2HQ0A 4R6KA 5L9SA 1AOVA 5CM6A 2X7QA 1MPBA 5DTBA 5ICQA 3TTNA 4JB7A 1NNKA 3QYTA 3FGSA 4HCWA 4NF6A 1JVYA 3KJTA 3O6HA 3I3VA 2Q9TA 3HV1A 4YB7A 5EHMA 5H8SA 4R2FA 1P1WA 1ZMGA 2OCUA 1TT1A 2AIXA 3E13X 5ISUA 1JVXA 4HW8A 1AL3A 5DEXB 1BTJA 1GR2A 5M2VA 3SDFA 3Q25A 1M5BA 4X1BA 3VVEA 1O63A 3MVZA 1RKMA 3PV0E 5H8QB 2XX9A 3HHFA 3DP8A 4O3AA 1FQAA 4XXUA 1UTHB 2I3WA 3IAZA 4EXLA 4NF4B 1N3XA 2O7IA 4Q30B 3TTMA 4NF5A 4GOTA 4POXA
chains in the Genus database with same CATH superfamily
3PMWA 1KA1A 2B65A 4MLQA 2Z22A 2F3BA 5T3JA 4HCYA 3IB1A 4XKPA 2DYXA 5F1QA 2YPNA 4KHZE 5I7IA 1P99A 2ANJA 3TCFA 3VE1B 3V83A 1H76A 3O28A 1G0HA 2Q8JA 3NOHA 2YLNA 1I6QA 5EHSA 1D9YA 1LAXA 1SPIA 4NWCA 2DWJA 2P3VA 3PUVE 3E78A 3DM0A 3K4UA 2ZYNA 3LUYA 4KYSA 3BFTA 1FRPA 1YXIA 3OSQA 5BUUA 2NUVA 4YKPA 1SD3A 4QHQA 1LAFE 4OA4A 2I0BA 1LB8A 3M3LA 4EQ7A 5FBPA 4MCOA 1JW5A 1EH3A 3HN0A 4TQUQ 2P2AA 4RJZA 4YKJA 1FCKA 2DE4A 1AMFA 5IZ1A 1UQWA 3FJ7A 4NF6B 1NI9A 1MXUA 1LBBA 3O9PA 1FW0A 4KPTA 4OYVA 4YAHX 4NAPA 1MQGA 2F7BA 2DE3A 1PDAA 3SERA 3IO4A 2RCAA 4G8MA 1IUDA 2XXTA 4O7IA 2GH9A 2A5TA 3Q29A 5TPAB 2CZIA 3H3GA 1ELJA 4H1XA 3A29A 4OEUA 4GWXA 3OOAA 3FV1A 3CR9A 3T9XB 3VVFA 1M5EA 2OX3A 3OD7A 2UXAA 2I48A 2DQVA 5EQ7A 1G0IA 1KA0A 3SKPA 5CMCA 1B3EA 4LQ2A 4ELQA 1S50A 4PFWA 1MQJA 1Y9UA 5DT6A 5I58A 4F2OA 3R7XA 3K2DA 2B4LA 4NF5B 4JVCA 2XXQA 3PPPA 1M5DA 3USDA 1P1UA 1FPGA 1FPBA 3D4GA 2UVJA 2WX9A 1JNFA 3S2VA 3QAXA 4QBAA 1AH5A 4YZZA 2GHAA 4U22A 2V3TA 4GLIA 5CRYA 3VVDA 2H98A 3W9WA 2DWIA 3K00A 1P1NA 3FVKA 1MS7A 1FBCA 1NUZA 2OBGA 1SW2A 4KR5A 1R9LA 5IGAA 2F34A 3OXNA 4KYEA 4XKRA 4F1YA 1NV5A 1SI0A 3JZJA 5KCJA 4O7MA 5AA1A 3TTLA 1OVTA 1K9YA 4TLLB 2XD3A 4IO3A 3K6XA 3MVXA 4H65A 3RTFB 1LBWA 4ZZEA 3MPKA 1XC1A 1FQDA 1Q9DA 1B0LA 1ZBMA 3B50A 5H8NB 3BKIB 3K6UA 3K02A 2VGQA 5JTYA 1LSTA 1RDXA 3FXUA 1RDZA 5H8FB 3S9NC 1PEBA 1N76A 5ITPA 2XWIA 3ILTB 3RTWB 3SEUA 3QSLA 1B3GA 5F7VA 4P1LA 5ITOA 1O7TA 3VXBA 4YKKA 1MXXA 4E0XA 4H5FA 1B51A 3N5LA 1R6ZA 4H8JA 3RPLA 4OESA 4QSEA 3CVGA 2KQZA 2ONRA 4ELOA 2ESNA 5ICTA 4ZDMA 1TFDA 1B05A 2NWJA 4I9DA 1Y4CA 1H43A 3QIMA 2V93A 1N0TA 4OVTA 3EKIA 3Q26A 1ZLQA 5CI5A 3T9VA 5HPQA 1FTOA 4U4XA 5AA4B 4RY1A 1LB9A 2G29A 3IORA 4Q5TA 4HXVA 3N26A 2XXWA 2KLFA 3S4UA 5CMKA 2ZYKA 4FECA 4OWDA 1USYH 1NV6A 4OMBA 1EYJA 4YMBA 4OANA 4NF8B 3CSGA 1USYE 2I58A 5CMBA 2XWKA 4PGPA 3C33A 4DIGA 1US4A 2O51A 1QUKA 3FJMA 1BLFA 1URDA 3LV0A 2ALUA 3N6UA 1L5TA 4ZE9A 4BDQA 4MLVA 3CFXA 5F24A 1IZ1A 2Q89A 3TCHA 2FVZA 2LAOA 1FBFA 4HS7A 4F2QA 3MQ9A 4G68B 2AL5A 4XEQA 3G3JA 2Q2AA 4F3GA 4ZEKA 4KXPA 5AE4A 2UVGA 3JYRA 3KSJA 2OWTA 2O1LA 5K2XA 2XXVA 3K6WA 2IA4A 5DW8A 2REJA 1IXCA 5ESYA 5ELVA 2I6EA 3S9EA 4AS5A 3KOTA 4PDHA 4AS4A 5BWJA 3U72A 4EDPA 4GX6A 2XXRA 3DP4A 4HE1A 2ZMBA 4N6DA 1M5CA 3ZSFA 1FJ9A 1P1OA 1B3LA 4F3BA 3C4MA 1DTZA 1QVSA 3H6TA 2PBWA 3T9HB 4BDRA 2PYYA 3U92A 4KQPA 3TKDA 1NV4A 3A09A 3TELA 2P0SA 4K3FA 5JTYB 4DZ1A 3RT8A 4U2RA 3K01A 5ET8A 3FBPA 3KGCA 1RDYA 1LAHE 3T0JA 2Q2CA 2Y84A 2OWZA 3IO6A 3B6QA 3ZS6A 2XA5A 1N84A 1LBXA 3O29A 1IXIA 1PB9A 4F39A 1CNQA 3UIFA 3CG3A 2ZZVA 3CHGA 1B7ZA 1YPNA 1CB6A 4F3SA 1J1NA 1TFAA 4RK2A 4P8BA 1B40A 3OEKA 4X9TA 3QXMA 1OQGA 1POTA 3TODA 2HAVA 4H67A 3SETA 3MUQA 4Q8RA 4JXIA 3FXQA 1OVBA 3MPLA 3IJXB 4F3PA 2P1SA 4YB6A 5A5XB 3FJGA 4R2BA 1QUIA 2NXOA 3OELA 1T0KA 3O66A 3BBRA 2ONKE 3FZVA 1R9QA 1IMFA 4NX1A 3MAMA 1YAEA 5I57A 2DWHA 1MXWA 2DVZA 2NVUB 3G3FA 1UIUA 3ILUB 4GIZA 3FVOA 3PTYA 3E4RA 4OENA 4PBQA 1HSJA 3TDJA 3IL1B 2L5VA 1LFGA 3C36A 1DCUA 2BJIA 2HXRA 5I2KB 4IGRA 3EF7A 4ZEBA 2F7AA 4GWUA 4NQ8A 3OEMA 1DPPA 3IOTA 4PP0A 2HZKA 1MY0A 1GV8A 4N81A 3MBPA 1PC3A 3PMVA 3M3KA 1NKXA 4N07A 4O8MA 1SYIA 3K6VA 3OO7A 4GXAA 2V4CA 3PPRA 3TTKA 1XI6A 4FATA 3UP9A 4WEPA 3KOSA 3MYUA 4G8NA 2FIXA 5AA2A 1WVJA 2V3QA 1FPEA 3B6WA 3I5OA 3PGFA 1IXHA 1B9JA 3MZ1A 3ECRA 5CC2A 5EQ8A 2H25A 1TWYA 5I2NB 1LBVA 1JP4A 4LZ7A 1LBZA 4UA8A 3UORA 3RUMA 4OVQA 1S9TA 2XD2A 4DCXA 1NNTA 1SBPA 5TP9A 1NH7A 5H8HA 3LSLA 4GX4A 1MXZA 4ESWA 1B1HA 3ZKKA 1MH3A 4R9GA 4KFQA 2HCAA 2PX1A 3RT6B 5EQAA 3PU5A 1VR5A 3LSXA 4X1DA 4XKNA 1A99A 3FIRA 4KCDA 4H5GA 5ET7A 4JVIA 2UYFA 4RNSA 1O64A 2RC9A 4PAFA 4AB6A 1PBPA 1VE4A 2Q74A 4XTCQ 5JEIA 4R6YA 1VDWA 2Y7IA 2MKZA 3A3CA 1M5FA 2AL4A 2XWOA 3OMBA 1A55A 4HE2A 3CFZA 3L6GA 3VLUA 4F29A 3FVNA 1MM7A 4PBHA 1B52A 5I57B 3JV9A 3TMGA 4IY5A 3KC0A 3TQWA 2PFZA 2Z8EA 4GBVA 3V89B 4DXUA 4XKQA 2XXYA 2R8TA 1DBZA 3RY3A 3EQ1A 2Z8DA 1Q1KA 1MH4A 5FTHA 3TFLA 1A54A 1QW0A 2VPNA 2DXYA 3RNNA 3CSBA 3V8XB 4PC9A 3W15C 5IAIA 4PCDA 2F5XA 2VD2A 4ZS9A 3C31A 4GWSA 1OLAA 1FTJA 2UVHA 2DP8A 4KYDA 2O69A 4MEVA 3K0VA 2REGA 1IQ7A 3PD9A 1JQFA 5AA2B 4JVDA 3OO6A 2UVIA 5HM4B 1NL5A 3KC1A 1MDQA 4MBPA 4N15A 5FHNA 2G93A 3KZGA 4N4UA 1ANFA 1A7LA 3KEIA 3EN3A 1FPDA 4ZZAA 5IZ3A 4G2ZA 3MVWA 5TP9B 1OIBA 4JWOA 1D4NA 3OENA 1WDNA 4GVOA 3PUWE 1ZIUA 3HFUA 4RK9A 3K1PA 1AIVA 4PF6A 4X04A 4NHBA 1URGA 2V25A 4H45A 1N3WA 1SI1A 2YJPA 2O6AA 5I59A 1ZJLA 1LBCA 5L9MA 3HSTA 2DOJA 1JW1A 3TAJA 4P0IA 1MPDA 3C35A 3OSRA 3U8QA 3MP8A 1H44A 4IO7A 2CZLA 1LCFA 1EZOA 4U1OA 4I8CA 4UACA 4OXVA 3A3UA 2DVCA 1EYIA 4XIGQ 3GBAA 1BP5A 4U1ZA 4F19A 4IO5A 4ELRA 1PBQA 5ET6A 2CZHA 4WEDA 5TU0A 1NUYA 3B7DA 4FEDA 1FSAA 1SW5A 1Y3PA 1MQIA 1QJMA 4R75A 3G3HA 4NEDA 3T93B 2A5TB 1N7WA 1B2HA 1MDP1 1MG1A 4TLMB 4ZEDA 4GWYA 4KCCA 4OHNA 4LUBA 1LCTA 1WODA 3TYHA 4MHFA 1XT8A 3VLVA 4IO4A 2F8DA 4N6PA 4PE3A 4EF1A 5KDTA 1GGGA 3TUSA 3K1NA 4PF8A 2I4BA 1N7XA 2D3IA 3LUZA 2F36A 1QKAA 5I58B 4P47A 3UGWA 4U4SA 2ABHA 4F18A 2WYKA 5I84A 4Z0IA 4Z7EA 4X48A 4YICA 1FTKA 4AB5A 2O84X 4NTLA 5CMMA 3EHSA 3IR1A 1FJ6A 4NE4A 3O2AA 4Q0CA 3IX1A 2ZNUA 1MRPA 1LAGE 3T96B 1JW4A 1D3KA 1CE2A 2VP1A 4LATA 4RYAA 4FJPA 4G4PA 2F97A 5IM2A 3ODBA 4DXCA 3SEYA 3KG2A 3UA8A 2RCBA 1H45A 2PCRA 4DE8A 1OLCA 4ELPA 1FTLA 4F1UA 3IK6B 4F31B 3LR1A 4YKIA 3FD3A 5DEXA 1YTVA 1SW4A 1B7HA 3H6VA 3PPQA 1B6HA 3ZKLA 5KCJB 5I59B 3O6GA 3Q28A 4GRKA 1I6BA 2HXWA 5H8QA 3PPOA 2E0SA 1GVCA 3FXBA 4H46A 1DMBA 4JBZA 3IB0A 1B4HA 4NF0A 2QJEA 3H6WA 4JWYA 4NF4A 2PT1A 1NV7A 2XXIA 2HPGA 4GL0A 3C32A 2FBPA 3RPLB 2F78A 4DI4B 4MH5A 2ZYOA 2HZLA 1EZPA 2QVUA 4N91A 4DDDA 1DOTA 2IEEA 2ONSA 3G7WA 4ECFA 1RYOA 2RINA 2QRYA 5HBCA 4YU0A 1QGXA 1FBHA 3C34A 4GFRA 4QXDA 5EYFA 1B1XA 4NG7A 5KZTA 2WYPA 2O7UA 4GWOA 4UABA 1FPIA 1FQEA 1EYKA 1SDXA 4LA9A 1XVXA 1B7UA 4C1TA 2QVVA 5J1DA 4OETA 2B3FA 4PTKA 4O3CA 3MJNA 4QRZA 2RKMA 4FE8A 1B46A 3MZ9A 4YB5A 3KJ7A 2AYSA 1BIYA 4QSCA 4LONB 1B32A 1VFEA 2XXHA 1DSNA 4DXBA 3W9VA 3THIA 2QSXA 3TPAA 3T9UA 2H99A 2V84A 1FTMA 4N8GA 4NMYA 4NGUA 3OO9A 4QFLA 2CEXA 2RF1A 1YZ0A 2GFEA 2WBDA 4FIMA 4KI0E 2R6GE 3OO8A 3MWBA 1FBEA 4QFPA 1POY1 1IMCA 2QMXA 1Y20A 3FATA 2F6GA 1XOCA 4BDMA 1INPA 4MF3A 3LSWA 5TPAA 2QS4A 1NV1A 1FPKA 1NFTA 4OFOA 3QUJA 1DPEA 4GXSB 4PFRA 2FHYA 1US5A 3GLBA 4G77A 3BIGA 4WXJA 1I6AA 1A8FA 3IFCA 5I5PA 4P56A 4PETA 4F1VA 1XHYA 2XX7A 3UN6A 4FORA 3IOWA 4MAGA 4MX6A 2DE2A 3CFLA 2QS1A 3DP6A 4IGTA 5B7DA 4C1UA 4N8YA 4G68C 4KD5A 2XXUA 3VV5A 1KWHA 3MP1A 4DCYA 1D9QA 1B0HA 5AA2D 1NH8A 3CG1A 4O94A 3GYYA 1VSOA 1PB8A 4N13A 4ZECA 4P11A 1Y4TA 3KBRA 2DSFA 3TCGA 3HO7A 2Y7KA 4PFBA 2A5SA 2QPQA 4JDFA 2VPOA 4RA1A 2PMSA 2OZZA 1XS5A 1JEUA 3G3GA 3QK6A 3EPEA 4TOZA 1MQHA 2VHAA 2ZYMA 2Q88A 3KSXA 1NNPA 3TEPA 1LFIA 3FUZA 3D4CA 1B4ZA 1Z7NE 1MY2A 1A40A 1MXYA 4GBWA 4THIA 1SQYA 4BDOA 2R9JA 2PFYA 3O97A 4R6HA 3BIHA 1SYHA 3E79A 1ATGA 4LN5A 3DELB 2FIEA 3HCQA 2E1SA 3KN7A 2O68A 3N6TA 3TQLA 2PVUA 1Y1ZA 1NNFA 1IITA 1AWBA 3HPIA 2I4CA 4R74A 5H8NA 4PAKA 3P7IA 3KN3A 3PUYE 2Q8MA 4BLAA 2OLBA 3CI8A 5H8FA 2X26A 3MC2A 5B70A 1FQBA 4EQ9A 2QMWA 4E0WA 3GXAA 3MW0A 4OEVA 4ESXA 3F11A 1B3HA 3TZAA 4LP2B 1B5HA 3PUXE 1MY1A 1BKAA 4IR8A 2I3VA 2H4IA 3LC8A 2DWAA 3U93A 5ET5A 3E3KA 2NOOA 1MXVA 1A8EA 1JETA 4IO2A 1UIVA 3DLNA 2VD3A 5DVIA 1LGBC 3PUZE 1D9VA 4F22A 4MMPA 5AA4A 5CBRA 2R71A 1S7YA 2HAUA 4PAIA 3RLFE 5I56A 4ZEIA 4M1VA 1NV0A 1IMDA 1PB7A 2DXRA 2Y7PA 4I40A 2B3BA 4NF8A 3QUFA 1IEJA 3ISPA 4FBPA 1FPFA 1NUXA 2WKYA 4R72A 3SEVA 2HFBA 2B4MA 4MFIA 3V5AA 1GTKA 4X8RA 3E9XA 4H8IA 4XF5A 3VLWA 1Y3NA 2ZZWA 3SZPA 1LBYA 2GRVA 1SVXB 5EYGA 3FVGA 1ZKBA 3U1OA 1FQCA 4G68A 3G3IA 3L6HA 4L17A 3K1MA 3U65A 5H8HB 4G8HA 1EU8A 4NN3A 2UYEA 4R73A 4O3BA 3M3FA 1FPJA 4LZ5A 1H3DA 4H0WA 4BDLA 3B8BA 4LZ8A 5FHMA 4AQ4A 1IXGA 2QFLA 5DYHA 2DS9A 2Y5LA 5DVJA 1ZU0A 4DI3D 2W7YA 1UTBA 1DK4A 4U23A 4PQJA 3MZBA 5DVFA 3T66A 3Q27A 2VT5A 4DLDA 4OVSA 4GWZA 4EF2A 1MY4A 2WBBA 4PFUA 4GF8A 1NUWA 4PFYA 3VXCA 3ONMA 2QS2A 2Y7RA 4C0RA 4OVJA 3T22A 4ZEFA 4PE5B 2V3UA 4QF9A 4QFOA 5EYHA 3WAFA 2ZNTA 3VDFA 1I69A 3VFJA 1NV2A 3R6UA 3TTRA 4OERA 2XXXA 4H6DA 2OK2A 3H6UA 1B3FA 3AXFA 3FV2A 3QMFA 4GL8A 2ZNSA 3M8UA 4MIJA 4I3YA 4MNPA 3UK4A 2I49A 2QL3A 4PGNA 2CEYA 5JK4A 3MSTA 1SW1A 2CZKA 4RPOA 4QSDA 3RQTA 1FQFA 4PDDA 2F7CA 5FTIA 3CIJA 3HHGA 4OVPA 3KBZA 4ONYA 4N17A 2FYIA 4EQBA 3U94A 5I56B 4P9KA 4EXKA 4R9FA 2FA7A 3GZGA 2VOZA 4PFTA 4WKMA 3SEWA 4JSOA 3BFUA 1B5JA 1MY3A 2XHDA 3KN8A 2D5WA 3IJOB 2XXPA 4U21A 1P1QA 4LQ5A 5A5XA 4IB2A 5LOMA 3H7MA 3RPWA 1IMBA 4FAJA 2O1MA 3IB2A 3EHUA 1QULA 1Y1MA 2H5YA 1IMEA 1IIWA 2Z23A 3ROJA 5IKBA 1KZ8A 3CRBA 2D21A 5IZ3B 1ZTYA 4I62A 4OQOA 3RGYA 3O6IA 1OQHA 1B58A 2BJJX 1Q35A 4MNCA 4OZ9A 1II5A 2OJTA 2RC7A 4GD5A 4HTGA 3C9HA 2QS3A 4QFKA 3H4ZA 5AA3A 2M8CA 1NMUA 3FASA 4ND9A 4P0GA 4XFEA 4OFJA 1Z7ME 1JEVA 1IMAA 3PD8A 4M4GA 5I2KA 3IFAA 1RYXA 2QVRA 1UTBB 4GQOA 3LSFB 5LDZA 2Z8FA 1LFHA 4ZE8A 1YYZA 2H9BA 4OVRA 4EUOA 1FBDA 4GX3A 2HEUA 2XX8A 1TXFA 2CMOA 1FTAA 1UTHA 1HSEA 3LBSA 1LLSA 3GBBA 3N94A 2DDKA 4QFNA 4IY6A 1NV3A 4OFLA 1LEVA 2FNCA 4I1DA 3H03A 4OTEA 5A5LA 3IOVA 1URSA 2THIA 3I6VA 4YMAA 1N04A 2F35A 4ISUA 3PMXA 3D1RA 5I3SA 4P3LA 4FEBA 3EHTA 4GWWA 2XWVA 4G61A 3MP6A 5I2NA 3SEXA 4POWA 1MPCA 1XVYA 3S9LC 5L9OA 4RXLA 5FHOA 4JWXA 1EZ9A 1B5IA 1DTGA 4NWDA 3S9MC 1OMPA 3IOUA 2ZZXA 2GQ1A 1FPLA 4BDNA 3PPNA 4IO6A 3SESA 2GHBA 1QUJA 2F6PA 3MVYA 1QKBA 3FXRA 4JSDA 3G3KA 1YCJA 5K2YA 2I0CA 1MM6A 1R1NA 4MJOA 5IZZA 5J16A 3KFMA 1MQDA 2X7PA 3RN8A 2PT2A 3RYDA 4MNIA 5KDTB 5CBSA 1VFDA 3WAEA 5L8DA 2RC8A 2Y5KA 2OWSA 2ZXTA 4RPNA 2KR0A 4LVQA 1Y3QA 2Y7WA 3H06B 1HSLA 3R26A 1F9BA 3B6TA 2HQ0A 4R6KA 4N6KA 2P3NA 5L9SA 1AOVA 5CM6A 2X7QA 1MPBA 5DTBA 5ICQA 3TTNA 4JB7A 1NNKA 3QYTA 1FBPA 3FGSA 4HCWA 4NF6A 1JVYA 3KJTA 2WEFA 1BK4A 3O6HA 3I3VA 2Q9TA 5LTCA 3HV1A 4YB7A 5EHMA 5H8SA 4R2FA 1FBGA 1P1WA 1ZMGA 2OCUA 1K9ZA 1TT1A 2AIXA 3E13X 5ISUA 1JVXA 4HW8A 1AL3A 4HE0A 5DEXB 1BTJA 1GR2A 4PFIA 4P1EA 5M2VA 3SDFA 3Q25A 1M5BA 4X1BA 3VVEA 1O63A 3MVZA 1RKMA 3PV0E 5H8QB 2XXKA 2XX9A 3HHFA 3DP8A 4O3AA 1FQAA 2JJKA 4I3EA 2F3DA 4XXUA 1UTHB 2I3WA 3IAZA 4EXLA 4NF4B 1N3XA 2O7IA 4Q30B 3TTMA 5EQ9A 4NF5A 2HHMA 4GOTA 4POXA 3T1BA
chains in the Genus database with same CATH topology
3PMWA 2B65A 4MLQA 2Z22A 4HCYA 3IB1A 4XKPA 2DYXA 5F1QA 2YPNA 4KHZE 1P99A 2ANJA 3TCFA 3VE1B 3V83A 1H76A 3O28A 2Q8JA 2YLNA 1I6QA 5EHSA 1D9YA 1LAXA 4NWCA 2DWJA 3PUVE 3DM0A 3K4UA 2ZYNA 3LUYA 4KYSA 3BFTA 3OSQA 5BUUA 2NUVA 4YKPA 1SD3A 4QHQA 1LAFE 2I0BA 1LB8A 3M3LA 4EQ7A 1JW5A 1EH3A 3HN0A 4TQUQ 2P2AA 4RJZA 4YKJA 1FCKA 2DE4A 1AMFA 1UQWA 3FJ7A 4NF6B 1MXUA 1LBBA 3O9PA 1FW0A 4KPTA 4OYVA 4YAHX 1MQGA 2F7BA 2DE3A 1PDAA 3SERA 3IO4A 2RCAA 4G8MA 1IUDA 2XXTA 2GH9A 2A5TA 3Q29A 5TPAB 3H3GA 1ELJA 4H1XA 4OEUA 3OOAA 3FV1A 3CR9A 3T9XB 3VVFA 1M5EA 3OD7A 2UXAA 2I48A 2DQVA 3SKPA 5CMCA 1B3EA 4LQ2A 4ELQA 1S50A 4PFWA 1MQJA 1Y9UA 5DT6A 5I58A 4F2OA 3R7XA 3K2DA 4NF5B 2XXQA 3PPPA 1M5DA 3USDA 1P1UA 3D4GA 2UVJA 1JNFA 3S2VA 3QAXA 1AH5A 4YZZA 2GHAA 4U22A 2V3TA 4GLIA 5CRYA 3VVDA 2H98A 3W9WA 2DWIA 3K00A 1P1NA 3FVKA 1MS7A 2OBGA 1SW2A 4KR5A 1R9LA 2F34A 3OXNA 4KYEA 4XKRA 4F1YA 1SI0A 3JZJA 5KCJA 5AA1A 3TTLA 1OVTA 4TLLB 2XD3A 4IO3A 3K6XA 3MVXA 4H65A 3RTFB 4ZZEA 3MPKA 1XC1A 1FQDA 1B0LA 1ZBMA 5H8NB 3BKIB 3K6UA 3K02A 2VGQA 5JTYA 1LSTA 3FXUA 5H8FB 3S9NC 1PEBA 1N76A 5ITPA 3ILTB 3RTWB 3SEUA 3QSLA 1B3GA 5F7VA 5ITOA 1O7TA 3VXBA 4YKKA 1MXXA 4E0XA 4H5FA 1B51A 3N5LA 1R6ZA 4H8JA 4OESA 4QSEA 3CVGA 2ONRA 4ELOA 2ESNA 5ICTA 4ZDMA 1TFDA 1B05A 2NWJA 4I9DA 1Y4CA 1H43A 3QIMA 2V93A 1N0TA 3Q26A 1ZLQA 5CI5A 3T9VA 5HPQA 1FTOA 4U4XA 5AA4B 4RY1A 1LB9A 2G29A 3IORA 4Q5TA 3N26A 2XXWA 2KLFA 3S4UA 5CMKA 2ZYKA 4FECA 4OWDA 1USYH 4OMBA 4YMBA 4NF8B 3CSGA 1USYE 2I58A 5CMBA 3C33A 4DIGA 1US4A 2O51A 1QUKA 3FJMA 1BLFA 1URDA 2ALUA 3N6UA 1L5TA 4ZE9A 4BDQA 4MLVA 3CFXA 1IZ1A 2Q89A 3TCHA 2LAOA 4HS7A 4F2QA 3MQ9A 4G68B 2AL5A 3G3JA 2Q2AA 4F3GA 4ZEKA 5AE4A 2UVGA 3JYRA 3KSJA 2OWTA 2O1LA 5K2XA 2XXVA 3K6WA 2IA4A 2REJA 1IXCA 5ELVA 2I6EA 3S9EA 3KOTA 5BWJA 3U72A 4EDPA 2XXRA 3DP4A 2ZMBA 1M5CA 3ZSFA 1P1OA 1B3LA 4F3BA 3C4MA 1DTZA 1QVSA 3H6TA 2PBWA 3T9HB 4BDRA 2PYYA 3U92A 4KQPA 3TKDA 3A09A 3TELA 2P0SA 5JTYB 4K3FA 4DZ1A 3RT8A 4U2RA 3K01A 3KGCA 1LAHE 2Q2CA 2Y84A 3IO6A 3ZS6A 3B6QA 1N84A 3O29A 1IXIA 1PB9A 4F39A 3UIFA 3CG3A 1B7ZA 1YPNA 1CB6A 4F3SA 1J1NA 1TFAA 4RK2A 1B40A 3OEKA 4X9TA 3QXMA 1OQGA 1POTA 3TODA 2HAVA 4H67A 3SETA 3MUQA 4Q8RA 4JXIA 3FXQA 1OVBA 3MPLA 3IJXB 4F3PA 2P1SA 4YB6A 5A5XB 3FJGA 4R2BA 1QUIA 2NXOA 3OELA 1T0KA 3O66A 3BBRA 2ONKE 3FZVA 1R9QA 3MAMA 1YAEA 5I57A 2DWHA 1MXWA 2DVZA 2NVUB 3G3FA 1UIUA 3ILUB 4GIZA 3FVOA 3E4RA 4OENA 1HSJA 3TDJA 3IL1B 1LFGA 3C36A 5I2KB 4IGRA 3EF7A 4ZEBA 2F7AA 3OEMA 1DPPA 3IOTA 4PP0A 2HZKA 1MY0A 1GV8A 3MBPA 1PC3A 3PMVA 3M3KA 1NKXA 4N07A 1SYIA 3K6VA 3OO7A 4GXAA 3TTKA 3PPRA 4FATA 3UP9A 4WEPA 3KOSA 4G8NA 5AA2A 1WVJA 2V3QA 3B6WA 3I5OA 3PGFA 1IXHA 1B9JA 3MZ1A 3ECRA 5CC2A 2H25A 1TWYA 5I2NB 4LZ7A 4UA8A 3UORA 3RUMA 1S9TA 2XD2A 4DCXA 1NNTA 1SBPA 5TP9A 1NH7A 5H8HA 3LSLA 1MXZA 4ESWA 1B1HA 3ZKKA 1MH3A 4R9GA 4KFQA 2HCAA 2PX1A 3RT6B 3PU5A 1VR5A 3LSXA 4X1DA 4XKNA 1A99A 3FIRA 4KCDA 4H5GA 2UYFA 4RNSA 1O64A 2RC9A 4AB6A 1PBPA 1VE4A 4XTCQ 5JEIA 4R6YA 2Y7IA 3A3CA 1M5FA 2AL4A 3OMBA 1A55A 3CFZA 3L6GA 3VLUA 4F29A 3FVNA 1MM7A 1B52A 5I57B 3JV9A 3TMGA 4IY5A 3TQWA 2Z8EA 3V89B 4DXUA 4XKQA 2XXYA 3RY3A 3EQ1A 2Z8DA 1Q1KA 1MH4A 5FTHA 3TFLA 1A54A 1QW0A 2DXYA 3RNNA 3CSBA 3V8XB 3W15C 5IAIA 2F5XA 2VD2A 4ZS9A 3C31A 1OLAA 1FTJA 2UVHA 2DP8A 4KYDA 2O69A 3K0VA 2REGA 1IQ7A 3PD9A 1JQFA 5AA2B 3OO6A 2UVIA 5HM4B 1NL5A 1MDQA 4MBPA 5FHNA 2G93A 3KZGA 1ANFA 1A7LA 3KEIA 3EN3A 4ZZAA 4G2ZA 3MVWA 5TP9B 1OIBA 4JWOA 1D4NA 3OENA 1WDNA 4GVOA 3PUWE 1ZIUA 4RK9A 3K1PA 1AIVA 1URGA 2V25A 1N3WA 1SI1A 2YJPA 2O6AA 5I59A 1ZJLA 1LBCA 5L9MA 3HSTA 2DOJA 1JW1A 3TAJA 4P0IA 1MPDA 3C35A 3OSRA 3U8QA 3MP8A 1H44A 4IO7A 2CZLA 1LCFA 1EZOA 4U1OA 4I8CA 4UACA 4OXVA 3A3UA 2DVCA 4XIGQ 3GBAA 1BP5A 4U1ZA 4F19A 4IO5A 4ELRA 1PBQA 4WEDA 5TU0A 3B7DA 4FEDA 1SW5A 1Y3PA 1MQIA 1QJMA 4R75A 3G3HA 4NEDA 3T93B 2A5TB 1N7WA 1B2HA 1MDP1 1MG1A 4TLMB 4ZEDA 4KCCA 4OHNA 4LUBA 1LCTA 1WODA 3TYHA 1XT8A 3VLVA 4IO4A 2F8DA 4N6PA 4EF1A 5KDTA 1GGGA 3TUSA 3K1NA 2I4BA 1N7XA 2D3IA 2F36A 1QKAA 5I58B 3UGWA 4U4SA 2ABHA 4F18A 5I84A 4Z0IA 4Z7EA 4X48A 4YICA 1FTKA 4AB5A 2O84X 4NTLA 5CMMA 3EHSA 3IR1A 4NE4A 3O2AA 4Q0CA 3IX1A 2ZNUA 1MRPA 1LAGE 3T96B 1JW4A 1D3KA 1CE2A 2VP1A 4LATA 4RYAA 4FJPA 4G4PA 2F97A 3ODBA 4DXCA 3SEYA 3KG2A 3UA8A 2RCBA 1H45A 4DE8A 1OLCA 4ELPA 1FTLA 4F1UA 3IK6B 4F31B 3LR1A 4YKIA 3FD3A 5DEXA 1YTVA 1SW4A 1B7HA 3H6VA 3PPQA 1B6HA 3ZKLA 5KCJB 5I59B 3O6GA 3Q28A 4GRKA 1I6BA 2HXWA 5H8QA 3PPOA 2E0SA 1GVCA 1DMBA 4JBZA 3IB0A 1B4HA 2QJEA 3H6WA 4JWYA 4NF4A 2PT1A 2XXIA 4GL0A 3C32A 2F78A 4MH5A 2ZYOA 2HZLA 1EZPA 4DDDA 1DOTA 2IEEA 2ONSA 3G7WA 4ECFA 1RYOA 2RINA 2QRYA 5HBCA 4YU0A 4GFRA 3C34A 5EYFA 1B1XA 5KZTA 2O7UA 4GWOA 1FQEA 1SDXA 4LA9A 1XVXA 1B7UA 4C1TA 5J1DA 4OETA 2B3FA 4O3CA 3MJNA 4QRZA 2RKMA 4FE8A 1B46A 3MZ9A 4YB5A 3KJ7A 2AYSA 1BIYA 4QSCA 4LONB 1B32A 1VFEA 2XXHA 1DSNA 4DXBA 3W9VA 3THIA 2QSXA 3TPAA 3T9UA 2H99A 2V84A 1FTMA 4NMYA 3OO9A 4QFLA 2RF1A 2GFEA 4FIMA 4KI0E 2R6GE 3OO8A 3MWBA 4QFPA 1POY1 2QMXA 1Y20A 3FATA 2F6GA 1XOCA 4BDMA 4MF3A 3LSWA 5TPAA 2QS4A 1NFTA 4OFOA 3QUJA 1DPEA 4GXSB 1US5A 3GLBA 4G77A 4WXJA 1I6AA 1A8FA 4PETA 4F1VA 1XHYA 2XX7A 3UN6A 4FORA 3IOWA 2DE2A 3CFLA 2QS1A 3DP6A 4IGTA 5B7DA 4C1UA 4G68C 4KD5A 2XXUA 3VV5A 1KWHA 3MP1A 4DCYA 1B0HA 5AA2D 1NH8A 3CG1A 1VSOA 1PB8A 4N13A 4ZECA 4P11A 1Y4TA 3KBRA 2DSFA 3TCGA 3HO7A 2Y7KA 2A5SA 2QPQA 4JDFA 4RA1A 2PMSA 2OZZA 1XS5A 1JEUA 3G3GA 3QK6A 3EPEA 4TOZA 1MQHA 2VHAA 2ZYMA 2Q88A 3KSXA 1NNPA 3TEPA 1LFIA 3FUZA 3D4CA 1B4ZA 1Z7NE 1MY2A 1A40A 1MXYA 4THIA 1SQYA 4BDOA 2R9JA 3O97A 4R6HA 1SYHA 1ATGA 3DELB 3HCQA 2E1SA 3KN7A 2O68A 3N6TA 3TQLA 2PVUA 1Y1ZA 1NNFA 1IITA 3HPIA 2I4CA 4R74A 5H8NA 3P7IA 3KN3A 3PUYE 4BLAA 2OLBA 3CI8A 5H8FA 2X26A 3MC2A 5B70A 1FQBA 4EQ9A 2QMWA 4E0WA 3GXAA 3MW0A 4OEVA 4ESXA 3F11A 1B3HA 3TZAA 4LP2B 1B5HA 3PUXE 1MY1A 1BKAA 2I3VA 2H4IA 3LC8A 2DWAA 3U93A 3E3KA 2NOOA 1MXVA 1A8EA 1JETA 4IO2A 1UIVA 3DLNA 2VD3A 5DVIA 1LGBC 3PUZE 1D9VA 4F22A 5AA4A 5CBRA 2R71A 1S7YA 2HAUA 3RLFE 5I56A 4ZEIA 4M1VA 1PB7A 2DXRA 2Y7PA 2B3BA 4NF8A 3QUFA 1IEJA 2WKYA 4R72A 3SEVA 2HFBA 4MFIA 3V5AA 1GTKA 3E9XA 4H8IA 3VLWA 1Y3NA 2GRVA 1SVXB 3FVGA 1ZKBA 3U1OA 1FQCA 4G68A 3G3IA 3L6HA 4L17A 3K1MA 5H8HB 4G8HA 1EU8A 2UYEA 4R73A 4O3BA 3M3FA 4LZ5A 1H3DA 4H0WA 4BDLA 5FHMA 4LZ8A 4AQ4A 1IXGA 5DYHA 2DS9A 5DVJA 1ZU0A 2W7YA 1UTBA 4U23A 4PQJA 3MZBA 5DVFA 3T66A 3Q27A 4DLDA 4EF2A 1MY4A 4PFUA 4GF8A 4PFYA 3VXCA 3ONMA 2QS2A 2Y7RA 4C0RA 4OVJA 3T22A 4ZEFA 4PE5B 2V3UA 4QF9A 4QFOA 3WAFA 2ZNTA 3VDFA 1I69A 3VFJA 3R6UA 3TTRA 4OERA 2XXXA 4H6DA 2OK2A 3H6UA 1B3FA 3AXFA 3FV2A 4GL8A 2ZNSA 3M8UA 3UK4A 2I49A 2QL3A 5JK4A 1SW1A 4RPOA 4QSDA 3RQTA 1FQFA 2F7CA 5FTIA 3CIJA 3HHGA 4ONYA 2FYIA 4EQBA 3U94A 5I56B 4EXKA 4R9FA 2FA7A 3GZGA 2VOZA 4PFTA 4WKMA 3SEWA 4JSOA 3BFUA 1B5JA 1MY3A 2XHDA 3KN8A 2D5WA 3IJOB 2XXPA 4U21A 1P1QA 4LQ5A 5A5XA 4IB2A 5LOMA 3H7MA 3RPWA 4FAJA 2O1MA 3IB2A 3EHUA 1QULA 1Y1MA 2H5YA 1IIWA 2Z23A 5IKBA 3CRBA 2D21A 1ZTYA 4I62A 4OQOA 3RGYA 3O6IA 1OQHA 1B58A 2BJJX 1Q35A 4OZ9A 1II5A 2OJTA 2RC7A 4GD5A 4HTGA 3C9HA 2QS3A 4QFKA 5AA3A 3H4ZA 2M8CA 1NMUA 3FASA 4ND9A 4P0GA 4OFJA 1Z7ME 1JEVA 3PD8A 4M4GA 5I2KA 1RYXA 1UTBB 4GQOA 3LSFB 2Z8FA 1LFHA 4ZE8A 2H9BA 4EUOA 2HEUA 2XX8A 1TXFA 2CMOA 1UTHA 1HSEA 3LBSA 1LLSA 3GBBA 3N94A 4QFNA 4IY6A 4OFLA 2FNCA 4I1DA 3H03A 4OTEA 3IOVA 4YMAA 1URSA 2THIA 3I6VA 1N04A 2F35A 4ISUA 3PMXA 4FEBA 3EHTA 3MP6A 5I2NA 3SEXA 4POWA 1MPCA 1XVYA 3S9LC 5L9OA 4RXLA 5FHOA 4JWXA 1EZ9A 1B5IA 1DTGA 4NWDA 3S9MC 1OMPA 3IOUA 4BDNA 3PPNA 4IO6A 3SESA 2GHBA 1QUJA 2F6PA 3MVYA 1QKBA 3FXRA 4JSDA 3G3KA 1YCJA 5K2YA 2I0CA 1MM6A 1R1NA 3KFMA 1MQDA 2X7PA 3RN8A 2PT2A 5KDTB 5CBSA 1VFDA 3WAEA 5L8DA 2RC8A 2ZXTA 2OWSA 4RPNA 4LVQA 1Y3QA 2Y7WA 3H06B 1HSLA 3R26A 1F9BA 3B6TA 2HQ0A 4R6KA 5L9SA 1AOVA 5CM6A 2X7QA 1MPBA 5DTBA 5ICQA 3TTNA 4JB7A 1NNKA 3QYTA 3FGSA 4HCWA 4NF6A 1JVYA 3KJTA 3O6HA 3I3VA 2Q9TA 3HV1A 4YB7A 5EHMA 5H8SA 4R2FA 1P1WA 1ZMGA 2OCUA 1TT1A 2AIXA 3E13X 5ISUA 1JVXA 4HW8A 1AL3A 5DEXB 1BTJA 1GR2A 5M2VA 3SDFA 3Q25A 1M5BA 4X1BA 3VVEA 1O63A 3MVZA 1RKMA 3PV0E 5H8QB 2XX9A 3HHFA 3DP8A 4O3AA 1FQAA 4XXUA 1UTHB 2I3WA 3IAZA 4EXLA 4NF4B 1N3XA 2O7IA 4Q30B 3TTMA 4NF5A 4GOTA 4POXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PMW A;  2B65 A;  4MLQ A;  2Z22 A;  4HCY A;  3IB1 A;  4XKP A;  2DYX A;  5F1Q A;  2YPN A;  4KHZ E;  1P99 A;  2ANJ A;  3TCF A;  3VE1 B;  3V83 A;  1H76 A;  3O28 A;  2Q8J A;  2YLN A;  1I6Q A;  5EHS A;  1D9Y A;  1LAX A;  4NWC A;  2DWJ A;  3PUV E;  3DM0 A;  3K4U A;  2ZYN A;  3LUY A;  4KYS A;  3BFT A;  3OSQ A;  5BUU A;  2NUV A;  4YKP A;  1SD3 A;  4QHQ A;  1LAF E;  2I0B A;  1LB8 A;  3M3L A;  4EQ7 A;  1JW5 A;  1EH3 A;  3HN0 A;  4TQU Q;  2P2A A;  4RJZ A;  4YKJ A;  1FCK A;  2DE4 A;  1AMF A;  1UQW A;  3FJ7 A;  4NF6 B;  1MXU A;  1LBB A;  3O9P A;  1FW0 A;  4KPT A;  4OYV A;  4YAH X;  1MQG A;  2F7B A;  2DE3 A;  1PDA A;  3SER A;  3IO4 A;  2RCA A;  4G8M A;  1IUD A;  2XXT A;  2GH9 A;  2A5T A;  3Q29 A;  5TPA B;  3H3G A;  1ELJ A;  4H1X A;  4OEU A;  3OOA A;  3FV1 A;  3CR9 A;  3T9X B;  3VVF A;  1M5E A;  3OD7 A;  2UXA A;  2I48 A;  2DQV A;  3SKP A;  5CMC A;  1B3E A;  4LQ2 A;  4ELQ A;  1S50 A;  4PFW A;  1MQJ A;  1Y9U A;  5DT6 A;  5I58 A;  4F2O A;  3R7X A;  3K2D A;  4NF5 B;  2XXQ A;  3PPP A;  1M5D A;  3USD A;  1P1U A;  3D4G A;  2UVJ A;  1JNF A;  3S2V A;  3QAX A;  1AH5 A;  4YZZ A;  2GHA A;  4U22 A;  2V3T A;  4GLI A;  5CRY A;  3VVD A;  2H98 A;  3W9W A;  2DWI A;  3K00 A;  1P1N A;  3FVK A;  1MS7 A;  2OBG A;  1SW2 A;  4KR5 A;  1R9L A;  2F34 A;  3OXN A;  4KYE A;  4XKR A;  4F1Y A;  1SI0 A;  3JZJ A;  5KCJ A;  5AA1 A;  3TTL A;  1OVT A;  4TLL B;  2XD3 A;  4IO3 A;  3K6X A;  3MVX A;  4H65 A;  3RTF B;  4ZZE A;  3MPK A;  1XC1 A;  1FQD A;  1B0L A;  1ZBM A;  5H8N B;  3BKI B;  3K6U A;  3K02 A;  2VGQ A;  5JTY A;  1LST A;  3FXU A;  5H8F B;  3S9N C;  1PEB A;  1N76 A;  5ITP A;  3ILT B;  3RTW B;  3SEU A;  3QSL A;  1B3G A;  5F7V A;  5ITO A;  1O7T A;  3VXB A;  4YKK A;  1MXX A;  4E0X A;  4H5F A;  1B51 A;  3N5L A;  1R6Z A;  4H8J A;  4OES A;  4QSE A;  3CVG A;  2ONR A;  4ELO A;  2ESN A;  5ICT A;  4ZDM A;  1TFD A;  1B05 A;  2NWJ A;  4I9D A;  1Y4C A;  1H43 A;  3QIM A;  2V93 A;  1N0T A;  3Q26 A;  1ZLQ A;  5CI5 A;  3T9V A;  5HPQ A;  1FTO A;  4U4X A;  5AA4 B;  4RY1 A;  1LB9 A;  2G29 A;  3IOR A;  4Q5T A;  3N26 A;  2XXW A;  2KLF A;  3S4U A;  5CMK A;  2ZYK A;  4FEC A;  4OWD A;  1USY H;  4OMB A;  4YMB A;  4NF8 B;  3CSG A;  1USY E;  2I58 A;  5CMB A;  3C33 A;  4DIG A;  1US4 A;  2O51 A;  1QUK A;  3FJM A;  1BLF A;  1URD A;  2ALU A;  3N6U A;  1L5T A;  4ZE9 A;  4BDQ A;  4MLV A;  3CFX A;  1IZ1 A;  2Q89 A;  3TCH A;  2LAO A;  4HS7 A;  4F2Q A;  3MQ9 A;  4G68 B;  2AL5 A;  3G3J A;  2Q2A A;  4F3G A;  4ZEK A;  5AE4 A;  2UVG A;  3JYR A;  3KSJ A;  2OWT A;  2O1L A;  5K2X A;  2XXV A;  3K6W A;  2IA4 A;  2REJ A;  1IXC A;  5ELV A;  2I6E A;  3S9E A;  3KOT A;  5BWJ A;  3U72 A;  4EDP A;  2XXR A;  3DP4 A;  2ZMB A;  1M5C A;  3ZSF A;  1P1O A;  1B3L A;  4F3B A;  3C4M A;  1DTZ A;  1QVS A;  3H6T A;  2PBW A;  3T9H B;  4BDR A;  2PYY A;  3U92 A;  4KQP A;  3TKD A;  3A09 A;  3TEL A;  2P0S A;  5JTY B;  4K3F A;  4DZ1 A;  3RT8 A;  4U2R A;  3K01 A;  3KGC A;  1LAH E;  2Q2C A;  2Y84 A;  3IO6 A;  3ZS6 A;  3B6Q A;  1N84 A;  3O29 A;  1IXI A;  1PB9 A;  4F39 A;  3UIF A;  3CG3 A;  1B7Z A;  1YPN A;  1CB6 A;  4F3S A;  1J1N A;  1TFA A;  4RK2 A;  1B40 A;  3OEK A;  4X9T A;  3QXM A;  1OQG A;  1POT A;  3TOD A;  2HAV A;  4H67 A;  3SET A;  3MUQ A;  4Q8R A;  4JXI A;  3FXQ A;  1OVB A;  3MPL A;  3IJX B;  4F3P A;  2P1S A;  4YB6 A;  5A5X B;  3FJG A;  4R2B A;  1QUI A;  2NXO A;  3OEL A;  1T0K A;  3O66 A;  3BBR A;  2ONK E;  3FZV A;  1R9Q A;  3MAM A;  1YAE A;  5I57 A;  2DWH A;  1MXW A;  2DVZ A;  2NVU B;  3G3F A;  1UIU A;  3ILU B;  4GIZ A;  3FVO A;  3E4R A;  4OEN A;  1HSJ A;  3TDJ A;  3IL1 B;  1LFG A;  3C36 A;  5I2K B;  4IGR A;  3EF7 A;  4ZEB A;  2F7A A;  3OEM A;  1DPP A;  3IOT A;  4PP0 A;  2HZK A;  1MY0 A;  1GV8 A;  3MBP A;  1PC3 A;  3PMV A;  3M3K A;  1NKX A;  4N07 A;  1SYI A;  3K6V A;  3OO7 A;  4GXA A;  3TTK A;  3PPR A;  4FAT A;  3UP9 A;  4WEP A;  3KOS A;  4G8N A;  5AA2 A;  1WVJ A;  2V3Q A;  3B6W A;  3I5O A;  3PGF A;  1IXH A;  1B9J A;  3MZ1 A;  3ECR A;  5CC2 A;  2H25 A;  1TWY A;  5I2N B;  4LZ7 A;  4UA8 A;  3UOR A;  3RUM A;  1S9T A;  2XD2 A;  4DCX A;  1NNT A;  1SBP A;  5TP9 A;  1NH7 A;  5H8H A;  3LSL A;  1MXZ A;  4ESW A;  1B1H A;  3ZKK A;  1MH3 A;  4R9G A;  4KFQ A;  2HCA A;  2PX1 A;  3RT6 B;  3PU5 A;  1VR5 A;  3LSX A;  4X1D A;  4XKN A;  1A99 A;  3FIR A;  4KCD A;  4H5G A;  2UYF A;  4RNS A;  1O64 A;  2RC9 A;  4AB6 A;  1PBP A;  1VE4 A;  4XTC Q;  5JEI A;  4R6Y A;  2Y7I A;  3A3C A;  1M5F A;  2AL4 A;  3OMB A;  1A55 A;  3CFZ A;  3L6G A;  3VLU A;  4F29 A;  3FVN A;  1MM7 A;  1B52 A;  5I57 B;  3JV9 A;  3TMG A;  4IY5 A;  3TQW A;  2Z8E A;  3V89 B;  4DXU A;  4XKQ A;  2XXY A;  3RY3 A;  3EQ1 A;  2Z8D A;  1Q1K A;  1MH4 A;  5FTH A;  3TFL A;  1A54 A;  1QW0 A;  2DXY A;  3RNN A;  3CSB A;  3V8X B;  3W15 C;  5IAI A;  2F5X A;  2VD2 A;  4ZS9 A;  3C31 A;  1OLA A;  1FTJ A;  2UVH A;  2DP8 A;  4KYD A;  2O69 A;  3K0V A;  2REG A;  1IQ7 A;  3PD9 A;  1JQF A;  5AA2 B;  3OO6 A;  2UVI A;  5HM4 B;  1NL5 A;  1MDQ A;  4MBP A;  5FHN A;  2G93 A;  3KZG A;  1ANF A;  1A7L A;  3KEI A;  3EN3 A;  4ZZA A;  4G2Z A;  3MVW A;  5TP9 B;  1OIB A;  4JWO A;  1D4N A;  3OEN A;  1WDN A;  4GVO A;  3PUW E;  1ZIU A;  4RK9 A;  3K1P A;  1AIV A;  1URG A;  2V25 A;  1N3W A;  1SI1 A;  2YJP A;  2O6A A;  5I59 A;  1ZJL A;  1LBC A;  5L9M A;  3HST A;  2DOJ A;  1JW1 A;  3TAJ A;  4P0I A;  1MPD A;  3C35 A;  3OSR A;  3U8Q A;  3MP8 A;  1H44 A;  4IO7 A;  2CZL A;  1LCF A;  1EZO A;  4U1O A;  4I8C A;  4UAC A;  4OXV A;  3A3U A;  2DVC A;  4XIG Q;  3GBA A;  1BP5 A;  4U1Z A;  4F19 A;  4IO5 A;  4ELR A;  1PBQ A;  4WED A;  5TU0 A;  3B7D A;  4FED A;  1SW5 A;  1Y3P A;  1MQI A;  1QJM A;  4R75 A;  3G3H A;  4NED A;  3T93 B;  2A5T B;  1N7W A;  1B2H A;  1MDP 1;  1MG1 A;  4TLM B;  4ZED A;  4KCC A;  4OHN A;  4LUB A;  1LCT A;  1WOD A;  3TYH A;  1XT8 A;  3VLV A;  4IO4 A;  2F8D A;  4N6P A;  4EF1 A;  5KDT A;  1GGG A;  3TUS A;  3K1N A;  2I4B A;  1N7X A;  2D3I A;  2F36 A;  1QKA A;  5I58 B;  3UGW A;  4U4S A;  2ABH A;  4F18 A;  5I84 A;  4Z0I A;  4Z7E A;  4X48 A;  4YIC A;  1FTK A;  4AB5 A;  2O84 X;  4NTL A;  5CMM A;  3EHS A;  3IR1 A;  4NE4 A;  3O2A A;  4Q0C A;  3IX1 A;  2ZNU A;  1MRP A;  1LAG E;  3T96 B;  1JW4 A;  1D3K A;  1CE2 A;  2VP1 A;  4LAT A;  4RYA A;  4FJP A;  4G4P A;  2F97 A;  3ODB A;  4DXC A;  3SEY A;  3KG2 A;  3UA8 A;  2RCB A;  1H45 A;  4DE8 A;  1OLC A;  4ELP A;  1FTL A;  4F1U A;  3IK6 B;  4F31 B;  3LR1 A;  4YKI A;  3FD3 A;  5DEX A;  1YTV A;  1SW4 A;  1B7H A;  3H6V A;  3PPQ A;  1B6H A;  3ZKL A;  5KCJ B;  5I59 B;  3O6G A;  3Q28 A;  4GRK A;  1I6B A;  2HXW A;  5H8Q A;  3PPO A;  2E0S A;  1GVC A;  1DMB A;  4JBZ A;  3IB0 A;  1B4H A;  2QJE A;  3H6W A;  4JWY A;  4NF4 A;  2PT1 A;  2XXI A;  4GL0 A;  3C32 A;  2F78 A;  4MH5 A;  2ZYO A;  2HZL A;  1EZP A;  4DDD A;  1DOT A;  2IEE A;  2ONS A;  3G7W A;  4ECF A;  1RYO A;  2RIN A;  2QRY A;  5HBC A;  4YU0 A;  4GFR A;  3C34 A;  5EYF A;  1B1X A;  5KZT A;  2O7U A;  4GWO A;  1FQE A;  1SDX A;  4LA9 A;  1XVX A;  1B7U A;  4C1T A;  5J1D A;  4OET A;  2B3F A;  4O3C A;  3MJN A;  4QRZ A;  2RKM A;  4FE8 A;  1B46 A;  3MZ9 A;  4YB5 A;  3KJ7 A;  2AYS A;  1BIY A;  4QSC A;  4LON B;  1B32 A;  1VFE A;  2XXH A;  1DSN A;  4DXB A;  3W9V A;  3THI A;  2QSX A;  3TPA A;  3T9U A;  2H99 A;  2V84 A;  1FTM A;  4NMY A;  3OO9 A;  4QFL A;  2RF1 A;  2GFE A;  4FIM A;  4KI0 E;  2R6G E;  3OO8 A;  3MWB A;  4QFP A;  1POY 1;  2QMX A;  1Y20 A;  3FAT A;  2F6G A;  1XOC A;  4BDM A;  4MF3 A;  3LSW A;  5TPA A;  2QS4 A;  1NFT A;  4OFO A;  3QUJ A;  1DPE A;  4GXS B;  1US5 A;  3GLB A;  4G77 A;  4WXJ A;  1I6A A;  1A8F A;  4PET A;  4F1V A;  1XHY A;  2XX7 A;  3UN6 A;  4FOR A;  3IOW A;  2DE2 A;  3CFL A;  2QS1 A;  3DP6 A;  4IGT A;  5B7D A;  4C1U A;  4G68 C;  4KD5 A;  2XXU A;  3VV5 A;  1KWH A;  3MP1 A;  4DCY A;  1B0H A;  5AA2 D;  1NH8 A;  3CG1 A;  1VSO A;  1PB8 A;  4N13 A;  4ZEC A;  4P11 A;  1Y4T A;  3KBR A;  2DSF A;  3TCG A;  3HO7 A;  2Y7K A;  2A5S A;  2QPQ A;  4JDF A;  4RA1 A;  2PMS A;  2OZZ A;  1XS5 A;  1JEU A;  3G3G A;  3QK6 A;  3EPE A;  4TOZ A;  1MQH A;  2VHA A;  2ZYM A;  2Q88 A;  3KSX A;  1NNP A;  3TEP A;  1LFI A;  3FUZ A;  3D4C A;  1B4Z A;  1Z7N E;  1MY2 A;  1A40 A;  1MXY A;  4THI A;  1SQY A;  4BDO A;  2R9J A;  3O97 A;  4R6H A;  1SYH A;  1ATG A;  3DEL B;  3HCQ A;  2E1S A;  3KN7 A;  2O68 A;  3N6T A;  3TQL A;  2PVU A;  1Y1Z A;  1NNF A;  1IIT A;  3HPI A;  2I4C A;  4R74 A;  5H8N A;  3P7I A;  3KN3 A;  3PUY E;  4BLA A;  2OLB A;  3CI8 A;  5H8F A;  2X26 A;  3MC2 A;  5B70 A;  1FQB A;  4EQ9 A;  2QMW A;  4E0W A;  3GXA A;  3MW0 A;  4OEV A;  4ESX A;  3F11 A;  1B3H A;  3TZA A;  4LP2 B;  1B5H A;  3PUX E;  1MY1 A;  1BKA A;  2I3V A;  2H4I A;  3LC8 A;  2DWA A;  3U93 A;  3E3K A;  2NOO A;  1MXV A;  1A8E A;  1JET A;  4IO2 A;  1UIV A;  3DLN A;  2VD3 A;  5DVI A;  1LGB C;  3PUZ E;  1D9V A;  4F22 A;  5AA4 A;  5CBR A;  2R71 A;  1S7Y A;  2HAU A;  3RLF E;  5I56 A;  4ZEI A;  4M1V A;  1PB7 A;  2DXR A;  2Y7P A;  2B3B A;  4NF8 A;  3QUF A;  1IEJ A;  2WKY A;  4R72 A;  3SEV A;  2HFB A;  4MFI A;  3V5A A;  1GTK A;  3E9X A;  4H8I A;  3VLW A;  1Y3N A;  2GRV A;  1SVX B;  3FVG A;  1ZKB A;  3U1O A;  1FQC A;  4G68 A;  3G3I A;  3L6H A;  4L17 A;  3K1M A;  5H8H B;  4G8H A;  1EU8 A;  2UYE A;  4R73 A;  4O3B A;  3M3F A;  4LZ5 A;  1H3D A;  4H0W A;  4BDL A;  5FHM A;  4LZ8 A;  4AQ4 A;  1IXG A;  5DYH A;  2DS9 A;  5DVJ A;  1ZU0 A;  2W7Y A;  1UTB A;  4U23 A;  4PQJ A;  3MZB A;  5DVF A;  3T66 A;  3Q27 A;  4DLD A;  4EF2 A;  1MY4 A;  4PFU A;  4GF8 A;  4PFY A;  3VXC A;  3ONM A;  2QS2 A;  2Y7R A;  4C0R A;  4OVJ A;  3T22 A;  4ZEF A;  4PE5 B;  2V3U A;  4QF9 A;  4QFO A;  3WAF A;  2ZNT A;  3VDF A;  1I69 A;  3VFJ A;  3R6U A;  3TTR A;  4OER A;  2XXX A;  4H6D A;  2OK2 A;  3H6U A;  1B3F A;  3AXF A;  3FV2 A;  4GL8 A;  2ZNS A;  3M8U A;  3UK4 A;  2I49 A;  2QL3 A;  5JK4 A;  1SW1 A;  4RPO A;  4QSD A;  3RQT A;  1FQF A;  2F7C A;  5FTI A;  3CIJ A;  3HHG A;  4ONY A;  2FYI A;  4EQB A;  3U94 A;  5I56 B;  4EXK A;  4R9F A;  2FA7 A;  3GZG A;  2VOZ A;  4PFT A;  4WKM A;  3SEW A;  4JSO A;  3BFU A;  1B5J A;  1MY3 A;  2XHD A;  3KN8 A;  2D5W A;  3IJO B;  2XXP A;  4U21 A;  1P1Q A;  4LQ5 A;  5A5X A;  4IB2 A;  5LOM A;  3H7M A;  3RPW A;  4FAJ A;  2O1M A;  3IB2 A;  3EHU A;  1QUL A;  1Y1M A;  2H5Y A;  1IIW A;  2Z23 A;  5IKB A;  3CRB A;  2D21 A;  1ZTY A;  4I62 A;  4OQO A;  3RGY A;  3O6I A;  1OQH A;  1B58 A;  2BJJ X;  1Q35 A;  4OZ9 A;  1II5 A;  2OJT A;  2RC7 A;  4GD5 A;  4HTG A;  3C9H A;  2QS3 A;  4QFK A;  5AA3 A;  3H4Z A;  2M8C A;  1NMU A;  3FAS A;  4ND9 A;  4P0G A;  4OFJ A;  1Z7M E;  1JEV A;  3PD8 A;  4M4G A;  5I2K A;  1RYX A;  1UTB B;  4GQO A;  3LSF B;  2Z8F A;  1LFH A;  4ZE8 A;  2H9B A;  4EUO A;  2HEU A;  2XX8 A;  1TXF A;  2CMO A;  1UTH A;  1HSE A;  3LBS A;  1LLS A;  3GBB A;  3N94 A;  4QFN A;  4IY6 A;  4OFL A;  2FNC A;  4I1D A;  3H03 A;  4OTE A;  3IOV A;  4YMA A;  1URS A;  2THI A;  3I6V A;  1N04 A;  2F35 A;  4ISU A;  3PMX A;  4FEB A;  3EHT A;  3MP6 A;  5I2N A;  3SEX A;  4POW A;  1MPC A;  1XVY A;  3S9L C;  5L9O A;  4RXL A;  5FHO A;  4JWX A;  1EZ9 A;  1B5I A;  1DTG A;  4NWD A;  3S9M C;  1OMP A;  3IOU A;  4BDN A;  3PPN A;  4IO6 A;  3SES A;  2GHB A;  1QUJ A;  2F6P A;  3MVY A;  1QKB A;  3FXR A;  4JSD A;  3G3K A;  1YCJ A;  5K2Y A;  2I0C A;  1MM6 A;  1R1N A;  3KFM A;  1MQD A;  2X7P A;  3RN8 A;  2PT2 A;  5KDT B;  5CBS A;  1VFD A;  3WAE A;  5L8D A;  2RC8 A;  2ZXT A;  2OWS A;  4RPN A;  4LVQ A;  1Y3Q A;  2Y7W A;  3H06 B;  1HSL A;  3R26 A;  1F9B A;  3B6T A;  2HQ0 A;  4R6K A;  5L9S A;  1AOV A;  5CM6 A;  2X7Q A;  1MPB A;  5DTB A;  5ICQ A;  3TTN A;  4JB7 A;  1NNK A;  3QYT A;  3FGS A;  4HCW A;  4NF6 A;  1JVY A;  3KJT A;  3O6H A;  3I3V A;  2Q9T A;  3HV1 A;  4YB7 A;  5EHM A;  5H8S A;  4R2F A;  1P1W A;  1ZMG A;  2OCU A;  1TT1 A;  2AIX A;  3E13 X;  5ISU A;  1JVX A;  4HW8 A;  1AL3 A;  5DEX B;  1BTJ A;  1GR2 A;  5M2V A;  3SDF A;  3Q25 A;  1M5B A;  4X1B A;  3VVE A;  1O63 A;  3MVZ A;  1RKM A;  3PV0 E;  5H8Q B;  2XX9 A;  3HHF A;  3DP8 A;  4O3A A;  1FQA A;  4XXU A;  1UTH B;  2I3W A;  3IAZ A;  4EXL A;  4NF4 B;  1N3X A;  2O7I A;  4Q30 B;  3TTM A;  4NF5 A;  4GOT A;  4POX A; 
#chains in the Genus database with same CATH topology
 3PMW A;  1KA1 A;  2B65 A;  4MLQ A;  2Z22 A;  2F3B A;  5T3J A;  4HCY A;  3IB1 A;  4XKP A;  2DYX A;  5F1Q A;  2YPN A;  4KHZ E;  5I7I A;  1P99 A;  2ANJ A;  3TCF A;  3VE1 B;  3V83 A;  1H76 A;  3O28 A;  1G0H A;  2Q8J A;  3NOH A;  2YLN A;  1I6Q A;  5EHS A;  1D9Y A;  1LAX A;  1SPI A;  4NWC A;  2DWJ A;  2P3V A;  3PUV E;  3E78 A;  3DM0 A;  3K4U A;  2ZYN A;  3LUY A;  4KYS A;  3BFT A;  1FRP A;  1YXI A;  3OSQ A;  5BUU A;  2NUV A;  4YKP A;  1SD3 A;  4QHQ A;  1LAF E;  4OA4 A;  2I0B A;  1LB8 A;  3M3L A;  4EQ7 A;  5FBP A;  4MCO A;  1JW5 A;  1EH3 A;  3HN0 A;  4TQU Q;  2P2A A;  4RJZ A;  4YKJ A;  1FCK A;  2DE4 A;  1AMF A;  5IZ1 A;  1UQW A;  3FJ7 A;  4NF6 B;  1NI9 A;  1MXU A;  1LBB A;  3O9P A;  1FW0 A;  4KPT A;  4OYV A;  4YAH X;  4NAP A;  1MQG A;  2F7B A;  2DE3 A;  1PDA A;  3SER A;  3IO4 A;  2RCA A;  4G8M A;  1IUD A;  2XXT A;  4O7I A;  2GH9 A;  2A5T A;  3Q29 A;  5TPA B;  2CZI A;  3H3G A;  1ELJ A;  4H1X A;  3A29 A;  4OEU A;  4GWX A;  3OOA A;  3FV1 A;  3CR9 A;  3T9X B;  3VVF A;  1M5E A;  2OX3 A;  3OD7 A;  2UXA A;  2I48 A;  2DQV A;  5EQ7 A;  1G0I A;  1KA0 A;  3SKP A;  5CMC A;  1B3E A;  4LQ2 A;  4ELQ A;  1S50 A;  4PFW A;  1MQJ A;  1Y9U A;  5DT6 A;  5I58 A;  4F2O A;  3R7X A;  3K2D A;  2B4L A;  4NF5 B;  4JVC A;  2XXQ A;  3PPP A;  1M5D A;  3USD A;  1P1U A;  1FPG A;  1FPB A;  3D4G A;  2UVJ A;  2WX9 A;  1JNF A;  3S2V A;  3QAX A;  4QBA A;  1AH5 A;  4YZZ A;  2GHA A;  4U22 A;  2V3T A;  4GLI A;  5CRY A;  3VVD A;  2H98 A;  3W9W A;  2DWI A;  3K00 A;  1P1N A;  3FVK A;  1MS7 A;  1FBC A;  1NUZ A;  2OBG A;  1SW2 A;  4KR5 A;  1R9L A;  5IGA A;  2F34 A;  3OXN A;  4KYE A;  4XKR A;  4F1Y A;  1NV5 A;  1SI0 A;  3JZJ A;  5KCJ A;  4O7M A;  5AA1 A;  3TTL A;  1OVT A;  1K9Y A;  4TLL B;  2XD3 A;  4IO3 A;  3K6X A;  3MVX A;  4H65 A;  3RTF B;  1LBW A;  4ZZE A;  3MPK A;  1XC1 A;  1FQD A;  1Q9D A;  1B0L A;  1ZBM A;  3B50 A;  5H8N B;  3BKI B;  3K6U A;  3K02 A;  2VGQ A;  5JTY A;  1LST A;  1RDX A;  3FXU A;  1RDZ A;  5H8F B;  3S9N C;  1PEB A;  1N76 A;  5ITP A;  2XWI A;  3ILT B;  3RTW B;  3SEU A;  3QSL A;  1B3G A;  5F7V A;  4P1L A;  5ITO A;  1O7T A;  3VXB A;  4YKK A;  1MXX A;  4E0X A;  4H5F A;  1B51 A;  3N5L A;  1R6Z A;  4H8J A;  3RPL A;  4OES A;  4QSE A;  3CVG A;  2KQZ A;  2ONR A;  4ELO A;  2ESN A;  5ICT A;  4ZDM A;  1TFD A;  1B05 A;  2NWJ A;  4I9D A;  1Y4C A;  1H43 A;  3QIM A;  2V93 A;  1N0T A;  4OVT A;  3EKI A;  3Q26 A;  1ZLQ A;  5CI5 A;  3T9V A;  5HPQ A;  1FTO A;  4U4X A;  5AA4 B;  4RY1 A;  1LB9 A;  2G29 A;  3IOR A;  4Q5T A;  4HXV A;  3N26 A;  2XXW A;  2KLF A;  3S4U A;  5CMK A;  2ZYK A;  4FEC A;  4OWD A;  1USY H;  1NV6 A;  4OMB A;  1EYJ A;  4YMB A;  4OAN A;  4NF8 B;  3CSG A;  1USY E;  2I58 A;  5CMB A;  2XWK A;  4PGP A;  3C33 A;  4DIG A;  1US4 A;  2O51 A;  1QUK A;  3FJM A;  1BLF A;  1URD A;  3LV0 A;  2ALU A;  3N6U A;  1L5T A;  4ZE9 A;  4BDQ A;  4MLV A;  3CFX A;  5F24 A;  1IZ1 A;  2Q89 A;  3TCH A;  2FVZ A;  2LAO A;  1FBF A;  4HS7 A;  4F2Q A;  3MQ9 A;  4G68 B;  2AL5 A;  4XEQ A;  3G3J A;  2Q2A A;  4F3G A;  4ZEK A;  4KXP A;  5AE4 A;  2UVG A;  3JYR A;  3KSJ A;  2OWT A;  2O1L A;  5K2X A;  2XXV A;  3K6W A;  2IA4 A;  5DW8 A;  2REJ A;  1IXC A;  5ESY A;  5ELV A;  2I6E A;  3S9E A;  4AS5 A;  3KOT A;  4PDH A;  4AS4 A;  5BWJ A;  3U72 A;  4EDP A;  4GX6 A;  2XXR A;  3DP4 A;  4HE1 A;  2ZMB A;  4N6D A;  1M5C A;  3ZSF A;  1FJ9 A;  1P1O A;  1B3L A;  4F3B A;  3C4M A;  1DTZ A;  1QVS A;  3H6T A;  2PBW A;  3T9H B;  4BDR A;  2PYY A;  3U92 A;  4KQP A;  3TKD A;  1NV4 A;  3A09 A;  3TEL A;  2P0S A;  4K3F A;  5JTY B;  4DZ1 A;  3RT8 A;  4U2R A;  3K01 A;  5ET8 A;  3FBP A;  3KGC A;  1RDY A;  1LAH E;  3T0J A;  2Q2C A;  2Y84 A;  2OWZ A;  3IO6 A;  3B6Q A;  3ZS6 A;  2XA5 A;  1N84 A;  1LBX A;  3O29 A;  1IXI A;  1PB9 A;  4F39 A;  1CNQ A;  3UIF A;  3CG3 A;  2ZZV A;  3CHG A;  1B7Z A;  1YPN A;  1CB6 A;  4F3S A;  1J1N A;  1TFA A;  4RK2 A;  4P8B A;  1B40 A;  3OEK A;  4X9T A;  3QXM A;  1OQG A;  1POT A;  3TOD A;  2HAV A;  4H67 A;  3SET A;  3MUQ A;  4Q8R A;  4JXI A;  3FXQ A;  1OVB A;  3MPL A;  3IJX B;  4F3P A;  2P1S A;  4YB6 A;  5A5X B;  3FJG A;  4R2B A;  1QUI A;  2NXO A;  3OEL A;  1T0K A;  3O66 A;  3BBR A;  2ONK E;  3FZV A;  1R9Q A;  1IMF A;  4NX1 A;  3MAM A;  1YAE A;  5I57 A;  2DWH A;  1MXW A;  2DVZ A;  2NVU B;  3G3F A;  1UIU A;  3ILU B;  4GIZ A;  3FVO A;  3PTY A;  3E4R A;  4OEN A;  4PBQ A;  1HSJ A;  3TDJ A;  3IL1 B;  2L5V A;  1LFG A;  3C36 A;  1DCU A;  2BJI A;  2HXR A;  5I2K B;  4IGR A;  3EF7 A;  4ZEB A;  2F7A A;  4GWU A;  4NQ8 A;  3OEM A;  1DPP A;  3IOT A;  4PP0 A;  2HZK A;  1MY0 A;  1GV8 A;  4N81 A;  3MBP A;  1PC3 A;  3PMV A;  3M3K A;  1NKX A;  4N07 A;  4O8M A;  1SYI A;  3K6V A;  3OO7 A;  4GXA A;  2V4C A;  3PPR A;  3TTK A;  1XI6 A;  4FAT A;  3UP9 A;  4WEP A;  3KOS A;  3MYU A;  4G8N A;  2FIX A;  5AA2 A;  1WVJ A;  2V3Q A;  1FPE A;  3B6W A;  3I5O A;  3PGF A;  1IXH A;  1B9J A;  3MZ1 A;  3ECR A;  5CC2 A;  5EQ8 A;  2H25 A;  1TWY A;  5I2N B;  1LBV A;  1JP4 A;  4LZ7 A;  1LBZ A;  4UA8 A;  3UOR A;  3RUM A;  4OVQ A;  1S9T A;  2XD2 A;  4DCX A;  1NNT A;  1SBP A;  5TP9 A;  1NH7 A;  5H8H A;  3LSL A;  4GX4 A;  1MXZ A;  4ESW A;  1B1H A;  3ZKK A;  1MH3 A;  4R9G A;  4KFQ A;  2HCA A;  2PX1 A;  3RT6 B;  5EQA A;  3PU5 A;  1VR5 A;  3LSX A;  4X1D A;  4XKN A;  1A99 A;  3FIR A;  4KCD A;  4H5G A;  5ET7 A;  4JVI A;  2UYF A;  4RNS A;  1O64 A;  2RC9 A;  4PAF A;  4AB6 A;  1PBP A;  1VE4 A;  2Q74 A;  4XTC Q;  5JEI A;  4R6Y A;  1VDW A;  2Y7I A;  2MKZ A;  3A3C A;  1M5F A;  2AL4 A;  2XWO A;  3OMB A;  1A55 A;  4HE2 A;  3CFZ A;  3L6G A;  3VLU A;  4F29 A;  3FVN A;  1MM7 A;  4PBH A;  1B52 A;  5I57 B;  3JV9 A;  3TMG A;  4IY5 A;  3KC0 A;  3TQW A;  2PFZ A;  2Z8E A;  4GBV A;  3V89 B;  4DXU A;  4XKQ A;  2XXY A;  2R8T A;  1DBZ A;  3RY3 A;  3EQ1 A;  2Z8D A;  1Q1K A;  1MH4 A;  5FTH A;  3TFL A;  1A54 A;  1QW0 A;  2VPN A;  2DXY A;  3RNN A;  3CSB A;  3V8X B;  4PC9 A;  3W15 C;  5IAI A;  4PCD A;  2F5X A;  2VD2 A;  4ZS9 A;  3C31 A;  4GWS A;  1OLA A;  1FTJ A;  2UVH A;  2DP8 A;  4KYD A;  2O69 A;  4MEV A;  3K0V A;  2REG A;  1IQ7 A;  3PD9 A;  1JQF A;  5AA2 B;  4JVD A;  3OO6 A;  2UVI A;  5HM4 B;  1NL5 A;  3KC1 A;  1MDQ A;  4MBP A;  4N15 A;  5FHN A;  2G93 A;  3KZG A;  4N4U A;  1ANF A;  1A7L A;  3KEI A;  3EN3 A;  1FPD A;  4ZZA A;  5IZ3 A;  4G2Z A;  3MVW A;  5TP9 B;  1OIB A;  4JWO A;  1D4N A;  3OEN A;  1WDN A;  4GVO A;  3PUW E;  1ZIU A;  3HFU A;  4RK9 A;  3K1P A;  1AIV A;  4PF6 A;  4X04 A;  4NHB A;  1URG A;  2V25 A;  4H45 A;  1N3W A;  1SI1 A;  2YJP A;  2O6A A;  5I59 A;  1ZJL A;  1LBC A;  5L9M A;  3HST A;  2DOJ A;  1JW1 A;  3TAJ A;  4P0I A;  1MPD A;  3C35 A;  3OSR A;  3U8Q A;  3MP8 A;  1H44 A;  4IO7 A;  2CZL A;  1LCF A;  1EZO A;  4U1O A;  4I8C A;  4UAC A;  4OXV A;  3A3U A;  2DVC A;  1EYI A;  4XIG Q;  3GBA A;  1BP5 A;  4U1Z A;  4F19 A;  4IO5 A;  4ELR A;  1PBQ A;  5ET6 A;  2CZH A;  4WED A;  5TU0 A;  1NUY A;  3B7D A;  4FED A;  1FSA A;  1SW5 A;  1Y3P A;  1MQI A;  1QJM A;  4R75 A;  3G3H A;  4NED A;  3T93 B;  2A5T B;  1N7W A;  1B2H A;  1MDP 1;  1MG1 A;  4TLM B;  4ZED A;  4GWY A;  4KCC A;  4OHN A;  4LUB A;  1LCT A;  1WOD A;  3TYH A;  4MHF A;  1XT8 A;  3VLV A;  4IO4 A;  2F8D A;  4N6P A;  4PE3 A;  4EF1 A;  5KDT A;  1GGG A;  3TUS A;  3K1N A;  4PF8 A;  2I4B A;  1N7X A;  2D3I A;  3LUZ A;  2F36 A;  1QKA A;  5I58 B;  4P47 A;  3UGW A;  4U4S A;  2ABH A;  4F18 A;  2WYK A;  5I84 A;  4Z0I A;  4Z7E A;  4X48 A;  4YIC A;  1FTK A;  4AB5 A;  2O84 X;  4NTL A;  5CMM A;  3EHS A;  3IR1 A;  1FJ6 A;  4NE4 A;  3O2A A;  4Q0C A;  3IX1 A;  2ZNU A;  1MRP A;  1LAG E;  3T96 B;  1JW4 A;  1D3K A;  1CE2 A;  2VP1 A;  4LAT A;  4RYA A;  4FJP A;  4G4P A;  2F97 A;  5IM2 A;  3ODB A;  4DXC A;  3SEY A;  3KG2 A;  3UA8 A;  2RCB A;  1H45 A;  2PCR A;  4DE8 A;  1OLC A;  4ELP A;  1FTL A;  4F1U A;  3IK6 B;  4F31 B;  3LR1 A;  4YKI A;  3FD3 A;  5DEX A;  1YTV A;  1SW4 A;  1B7H A;  3H6V A;  3PPQ A;  1B6H A;  3ZKL A;  5KCJ B;  5I59 B;  3O6G A;  3Q28 A;  4GRK A;  1I6B A;  2HXW A;  5H8Q A;  3PPO A;  2E0S A;  1GVC A;  3FXB A;  4H46 A;  1DMB A;  4JBZ A;  3IB0 A;  1B4H A;  4NF0 A;  2QJE A;  3H6W A;  4JWY A;  4NF4 A;  2PT1 A;  1NV7 A;  2XXI A;  2HPG A;  4GL0 A;  3C32 A;  2FBP A;  3RPL B;  2F78 A;  4DI4 B;  4MH5 A;  2ZYO A;  2HZL A;  1EZP A;  2QVU A;  4N91 A;  4DDD A;  1DOT A;  2IEE A;  2ONS A;  3G7W A;  4ECF A;  1RYO A;  2RIN A;  2QRY A;  5HBC A;  4YU0 A;  1QGX A;  1FBH A;  3C34 A;  4GFR A;  4QXD A;  5EYF A;  1B1X A;  4NG7 A;  5KZT A;  2WYP A;  2O7U A;  4GWO A;  4UAB A;  1FPI A;  1FQE A;  1EYK A;  1SDX A;  4LA9 A;  1XVX A;  1B7U A;  4C1T A;  2QVV A;  5J1D A;  4OET A;  2B3F A;  4PTK A;  4O3C A;  3MJN A;  4QRZ A;  2RKM A;  4FE8 A;  1B46 A;  3MZ9 A;  4YB5 A;  3KJ7 A;  2AYS A;  1BIY A;  4QSC A;  4LON B;  1B32 A;  1VFE A;  2XXH A;  1DSN A;  4DXB A;  3W9V A;  3THI A;  2QSX A;  3TPA A;  3T9U A;  2H99 A;  2V84 A;  1FTM A;  4N8G A;  4NMY A;  4NGU A;  3OO9 A;  4QFL A;  2CEX A;  2RF1 A;  1YZ0 A;  2GFE A;  2WBD A;  4FIM A;  4KI0 E;  2R6G E;  3OO8 A;  3MWB A;  1FBE A;  4QFP A;  1POY 1;  1IMC A;  2QMX A;  1Y20 A;  3FAT A;  2F6G A;  1XOC A;  4BDM A;  1INP A;  4MF3 A;  3LSW A;  5TPA A;  2QS4 A;  1NV1 A;  1FPK A;  1NFT A;  4OFO A;  3QUJ A;  1DPE A;  4GXS B;  4PFR A;  2FHY A;  1US5 A;  3GLB A;  4G77 A;  3BIG A;  4WXJ A;  1I6A A;  1A8F A;  3IFC A;  5I5P A;  4P56 A;  4PET A;  4F1V A;  1XHY A;  2XX7 A;  3UN6 A;  4FOR A;  3IOW A;  4MAG A;  4MX6 A;  2DE2 A;  3CFL A;  2QS1 A;  3DP6 A;  4IGT A;  5B7D A;  4C1U A;  4N8Y A;  4G68 C;  4KD5 A;  2XXU A;  3VV5 A;  1KWH A;  3MP1 A;  4DCY A;  1D9Q A;  1B0H A;  5AA2 D;  1NH8 A;  3CG1 A;  4O94 A;  3GYY A;  1VSO A;  1PB8 A;  4N13 A;  4ZEC A;  4P11 A;  1Y4T A;  3KBR A;  2DSF A;  3TCG A;  3HO7 A;  2Y7K A;  4PFB A;  2A5S A;  2QPQ A;  4JDF A;  2VPO A;  4RA1 A;  2PMS A;  2OZZ A;  1XS5 A;  1JEU A;  3G3G A;  3QK6 A;  3EPE A;  4TOZ A;  1MQH A;  2VHA A;  2ZYM A;  2Q88 A;  3KSX A;  1NNP A;  3TEP A;  1LFI A;  3FUZ A;  3D4C A;  1B4Z A;  1Z7N E;  1MY2 A;  1A40 A;  1MXY A;  4GBW A;  4THI A;  1SQY A;  4BDO A;  2R9J A;  2PFY A;  3O97 A;  4R6H A;  3BIH A;  1SYH A;  3E79 A;  1ATG A;  4LN5 A;  3DEL B;  2FIE A;  3HCQ A;  2E1S A;  3KN7 A;  2O68 A;  3N6T A;  3TQL A;  2PVU A;  1Y1Z A;  1NNF A;  1IIT A;  1AWB A;  3HPI A;  2I4C A;  4R74 A;  5H8N A;  4PAK A;  3P7I A;  3KN3 A;  3PUY E;  2Q8M A;  4BLA A;  2OLB A;  3CI8 A;  5H8F A;  2X26 A;  3MC2 A;  5B70 A;  1FQB A;  4EQ9 A;  2QMW A;  4E0W A;  3GXA A;  3MW0 A;  4OEV A;  4ESX A;  3F11 A;  1B3H A;  3TZA A;  4LP2 B;  1B5H A;  3PUX E;  1MY1 A;  1BKA A;  4IR8 A;  2I3V A;  2H4I A;  3LC8 A;  2DWA A;  3U93 A;  5ET5 A;  3E3K A;  2NOO A;  1MXV A;  1A8E A;  1JET A;  4IO2 A;  1UIV A;  3DLN A;  2VD3 A;  5DVI A;  1LGB C;  3PUZ E;  1D9V A;  4F22 A;  4MMP A;  5AA4 A;  5CBR A;  2R71 A;  1S7Y A;  2HAU A;  4PAI A;  3RLF E;  5I56 A;  4ZEI A;  4M1V A;  1NV0 A;  1IMD A;  1PB7 A;  2DXR A;  2Y7P A;  4I40 A;  2B3B A;  4NF8 A;  3QUF A;  1IEJ A;  3ISP A;  4FBP A;  1FPF A;  1NUX A;  2WKY A;  4R72 A;  3SEV A;  2HFB A;  2B4M A;  4MFI A;  3V5A A;  1GTK A;  4X8R A;  3E9X A;  4H8I A;  4XF5 A;  3VLW A;  1Y3N A;  2ZZW A;  3SZP A;  1LBY A;  2GRV A;  1SVX B;  5EYG A;  3FVG A;  1ZKB A;  3U1O A;  1FQC A;  4G68 A;  3G3I A;  3L6H A;  4L17 A;  3K1M A;  3U65 A;  5H8H B;  4G8H A;  1EU8 A;  4NN3 A;  2UYE A;  4R73 A;  4O3B A;  3M3F A;  1FPJ A;  4LZ5 A;  1H3D A;  4H0W A;  4BDL A;  3B8B A;  4LZ8 A;  5FHM A;  4AQ4 A;  1IXG A;  2QFL A;  5DYH A;  2DS9 A;  2Y5L A;  5DVJ A;  1ZU0 A;  4DI3 D;  2W7Y A;  1UTB A;  1DK4 A;  4U23 A;  4PQJ A;  3MZB A;  5DVF A;  3T66 A;  3Q27 A;  2VT5 A;  4DLD A;  4OVS A;  4GWZ A;  4EF2 A;  1MY4 A;  2WBB A;  4PFU A;  4GF8 A;  1NUW A;  4PFY A;  3VXC A;  3ONM A;  2QS2 A;  2Y7R A;  4C0R A;  4OVJ A;  3T22 A;  4ZEF A;  4PE5 B;  2V3U A;  4QF9 A;  4QFO A;  5EYH A;  3WAF A;  2ZNT A;  3VDF A;  1I69 A;  3VFJ A;  1NV2 A;  3R6U A;  3TTR A;  4OER A;  2XXX A;  4H6D A;  2OK2 A;  3H6U A;  1B3F A;  3AXF A;  3FV2 A;  3QMF A;  4GL8 A;  2ZNS A;  3M8U A;  4MIJ A;  4I3Y A;  4MNP A;  3UK4 A;  2I49 A;  2QL3 A;  4PGN A;  2CEY A;  5JK4 A;  3MST A;  1SW1 A;  2CZK A;  4RPO A;  4QSD A;  3RQT A;  1FQF A;  4PDD A;  2F7C A;  5FTI A;  3CIJ A;  3HHG A;  4OVP A;  3KBZ A;  4ONY A;  4N17 A;  2FYI A;  4EQB A;  3U94 A;  5I56 B;  4P9K A;  4EXK A;  4R9F A;  2FA7 A;  3GZG A;  2VOZ A;  4PFT A;  4WKM A;  3SEW A;  4JSO A;  3BFU A;  1B5J A;  1MY3 A;  2XHD A;  3KN8 A;  2D5W A;  3IJO B;  2XXP A;  4U21 A;  1P1Q A;  4LQ5 A;  5A5X A;  4IB2 A;  5LOM A;  3H7M A;  3RPW A;  1IMB A;  4FAJ A;  2O1M A;  3IB2 A;  3EHU A;  1QUL A;  1Y1M A;  2H5Y A;  1IME A;  1IIW A;  2Z23 A;  3ROJ A;  5IKB A;  1KZ8 A;  3CRB A;  2D21 A;  5IZ3 B;  1ZTY A;  4I62 A;  4OQO A;  3RGY A;  3O6I A;  1OQH A;  1B58 A;  2BJJ X;  1Q35 A;  4MNC A;  4OZ9 A;  1II5 A;  2OJT A;  2RC7 A;  4GD5 A;  4HTG A;  3C9H A;  2QS3 A;  4QFK A;  3H4Z A;  5AA3 A;  2M8C A;  1NMU A;  3FAS A;  4ND9 A;  4P0G A;  4XFE A;  4OFJ A;  1Z7M E;  1JEV A;  1IMA A;  3PD8 A;  4M4G A;  5I2K A;  3IFA A;  1RYX A;  2QVR A;  1UTB B;  4GQO A;  3LSF B;  5LDZ A;  2Z8F A;  1LFH A;  4ZE8 A;  1YYZ A;  2H9B A;  4OVR A;  4EUO A;  1FBD A;  4GX3 A;  2HEU A;  2XX8 A;  1TXF A;  2CMO A;  1FTA A;  1UTH A;  1HSE A;  3LBS A;  1LLS A;  3GBB A;  3N94 A;  2DDK A;  4QFN A;  4IY6 A;  1NV3 A;  4OFL A;  1LEV A;  2FNC A;  4I1D A;  3H03 A;  4OTE A;  5A5L A;  3IOV A;  1URS A;  2THI A;  3I6V A;  4YMA A;  1N04 A;  2F35 A;  4ISU A;  3PMX A;  3D1R A;  5I3S A;  4P3L A;  4FEB A;  3EHT A;  4GWW A;  2XWV A;  4G61 A;  3MP6 A;  5I2N A;  3SEX A;  4POW A;  1MPC A;  1XVY A;  3S9L C;  5L9O A;  4RXL A;  5FHO A;  4JWX A;  1EZ9 A;  1B5I A;  1DTG A;  4NWD A;  3S9M C;  1OMP A;  3IOU A;  2ZZX A;  2GQ1 A;  1FPL A;  4BDN A;  3PPN A;  4IO6 A;  3SES A;  2GHB A;  1QUJ A;  2F6P A;  3MVY A;  1QKB A;  3FXR A;  4JSD A;  3G3K A;  1YCJ A;  5K2Y A;  2I0C A;  1MM6 A;  1R1N A;  4MJO A;  5IZZ A;  5J16 A;  3KFM A;  1MQD A;  2X7P A;  3RN8 A;  2PT2 A;  3RYD A;  4MNI A;  5KDT B;  5CBS A;  1VFD A;  3WAE A;  5L8D A;  2RC8 A;  2Y5K A;  2OWS A;  2ZXT A;  4RPN A;  2KR0 A;  4LVQ A;  1Y3Q A;  2Y7W A;  3H06 B;  1HSL A;  3R26 A;  1F9B A;  3B6T A;  2HQ0 A;  4R6K A;  4N6K A;  2P3N A;  5L9S A;  1AOV A;  5CM6 A;  2X7Q A;  1MPB A;  5DTB A;  5ICQ A;  3TTN A;  4JB7 A;  1NNK A;  3QYT A;  1FBP A;  3FGS A;  4HCW A;  4NF6 A;  1JVY A;  3KJT A;  2WEF A;  1BK4 A;  3O6H A;  3I3V A;  2Q9T A;  5LTC A;  3HV1 A;  4YB7 A;  5EHM A;  5H8S A;  4R2F A;  1FBG A;  1P1W A;  1ZMG A;  2OCU A;  1K9Z A;  1TT1 A;  2AIX A;  3E13 X;  5ISU A;  1JVX A;  4HW8 A;  1AL3 A;  4HE0 A;  5DEX B;  1BTJ A;  1GR2 A;  4PFI A;  4P1E A;  5M2V A;  3SDF A;  3Q25 A;  1M5B A;  4X1B A;  3VVE A;  1O63 A;  3MVZ A;  1RKM A;  3PV0 E;  5H8Q B;  2XXK A;  2XX9 A;  3HHF A;  3DP8 A;  4O3A A;  1FQA A;  2JJK A;  4I3E A;  2F3D A;  4XXU A;  1UTH B;  2I3W A;  3IAZ A;  4EXL A;  4NF4 B;  1N3X A;  2O7I A;  4Q30 B;  3TTM A;  5EQ9 A;  4NF5 A;  2HHM A;  4GOT A;  4POX A;  3T1B A; 
#chains in the Genus database with same CATH homology
 3PMW A;  2B65 A;  4MLQ A;  2Z22 A;  4HCY A;  3IB1 A;  4XKP A;  2DYX A;  5F1Q A;  2YPN A;  4KHZ E;  1P99 A;  2ANJ A;  3TCF A;  3VE1 B;  3V83 A;  1H76 A;  3O28 A;  2Q8J A;  2YLN A;  1I6Q A;  5EHS A;  1D9Y A;  1LAX A;  4NWC A;  2DWJ A;  3PUV E;  3DM0 A;  3K4U A;  2ZYN A;  3LUY A;  4KYS A;  3BFT A;  3OSQ A;  5BUU A;  2NUV A;  4YKP A;  1SD3 A;  4QHQ A;  1LAF E;  2I0B A;  1LB8 A;  3M3L A;  4EQ7 A;  1JW5 A;  1EH3 A;  3HN0 A;  4TQU Q;  2P2A A;  4RJZ A;  4YKJ A;  1FCK A;  2DE4 A;  1AMF A;  1UQW A;  3FJ7 A;  4NF6 B;  1MXU A;  1LBB A;  3O9P A;  1FW0 A;  4KPT A;  4OYV A;  4YAH X;  1MQG A;  2F7B A;  2DE3 A;  1PDA A;  3SER A;  3IO4 A;  2RCA A;  4G8M A;  1IUD A;  2XXT A;  2GH9 A;  2A5T A;  3Q29 A;  5TPA B;  3H3G A;  1ELJ A;  4H1X A;  4OEU A;  3OOA A;  3FV1 A;  3CR9 A;  3T9X B;  3VVF A;  1M5E A;  3OD7 A;  2UXA A;  2I48 A;  2DQV A;  3SKP A;  5CMC A;  1B3E A;  4LQ2 A;  4ELQ A;  1S50 A;  4PFW A;  1MQJ A;  1Y9U A;  5DT6 A;  5I58 A;  4F2O A;  3R7X A;  3K2D A;  4NF5 B;  2XXQ A;  3PPP A;  1M5D A;  3USD A;  1P1U A;  3D4G A;  2UVJ A;  1JNF A;  3S2V A;  3QAX A;  1AH5 A;  4YZZ A;  2GHA A;  4U22 A;  2V3T A;  4GLI A;  5CRY A;  3VVD A;  2H98 A;  3W9W A;  2DWI A;  3K00 A;  1P1N A;  3FVK A;  1MS7 A;  2OBG A;  1SW2 A;  4KR5 A;  1R9L A;  2F34 A;  3OXN A;  4KYE A;  4XKR A;  4F1Y A;  1SI0 A;  3JZJ A;  5KCJ A;  5AA1 A;  3TTL A;  1OVT A;  4TLL B;  2XD3 A;  4IO3 A;  3K6X A;  3MVX A;  4H65 A;  3RTF B;  4ZZE A;  3MPK A;  1XC1 A;  1FQD A;  1B0L A;  1ZBM A;  5H8N B;  3BKI B;  3K6U A;  3K02 A;  2VGQ A;  5JTY A;  1LST A;  3FXU A;  5H8F B;  3S9N C;  1PEB A;  1N76 A;  5ITP A;  3ILT B;  3RTW B;  3SEU A;  3QSL A;  1B3G A;  5F7V A;  5ITO A;  1O7T A;  3VXB A;  4YKK A;  1MXX A;  4E0X A;  4H5F A;  1B51 A;  3N5L A;  1R6Z A;  4H8J A;  4OES A;  4QSE A;  3CVG A;  2ONR A;  4ELO A;  2ESN A;  5ICT A;  4ZDM A;  1TFD A;  1B05 A;  2NWJ A;  4I9D A;  1Y4C A;  1H43 A;  3QIM A;  2V93 A;  1N0T A;  3Q26 A;  1ZLQ A;  5CI5 A;  3T9V A;  5HPQ A;  1FTO A;  4U4X A;  5AA4 B;  4RY1 A;  1LB9 A;  2G29 A;  3IOR A;  4Q5T A;  3N26 A;  2XXW A;  2KLF A;  3S4U A;  5CMK A;  2ZYK A;  4FEC A;  4OWD A;  1USY H;  4OMB A;  4YMB A;  4NF8 B;  3CSG A;  1USY E;  2I58 A;  5CMB A;  3C33 A;  4DIG A;  1US4 A;  2O51 A;  1QUK A;  3FJM A;  1BLF A;  1URD A;  2ALU A;  3N6U A;  1L5T A;  4ZE9 A;  4BDQ A;  4MLV A;  3CFX A;  1IZ1 A;  2Q89 A;  3TCH A;  2LAO A;  4HS7 A;  4F2Q A;  3MQ9 A;  4G68 B;  2AL5 A;  3G3J A;  2Q2A A;  4F3G A;  4ZEK A;  5AE4 A;  2UVG A;  3JYR A;  3KSJ A;  2OWT A;  2O1L A;  5K2X A;  2XXV A;  3K6W A;  2IA4 A;  2REJ A;  1IXC A;  5ELV A;  2I6E A;  3S9E A;  3KOT A;  5BWJ A;  3U72 A;  4EDP A;  2XXR A;  3DP4 A;  2ZMB A;  1M5C A;  3ZSF A;  1P1O A;  1B3L A;  4F3B A;  3C4M A;  1DTZ A;  1QVS A;  3H6T A;  2PBW A;  3T9H B;  4BDR A;  2PYY A;  3U92 A;  4KQP A;  3TKD A;  3A09 A;  3TEL A;  2P0S A;  5JTY B;  4K3F A;  4DZ1 A;  3RT8 A;  4U2R A;  3K01 A;  3KGC A;  1LAH E;  2Q2C A;  2Y84 A;  3IO6 A;  3ZS6 A;  3B6Q A;  1N84 A;  3O29 A;  1IXI A;  1PB9 A;  4F39 A;  3UIF A;  3CG3 A;  1B7Z A;  1YPN A;  1CB6 A;  4F3S A;  1J1N A;  1TFA A;  4RK2 A;  1B40 A;  3OEK A;  4X9T A;  3QXM A;  1OQG A;  1POT A;  3TOD A;  2HAV A;  4H67 A;  3SET A;  3MUQ A;  4Q8R A;  4JXI A;  3FXQ A;  1OVB A;  3MPL A;  3IJX B;  4F3P A;  2P1S A;  4YB6 A;  5A5X B;  3FJG A;  4R2B A;  1QUI A;  2NXO A;  3OEL A;  1T0K A;  3O66 A;  3BBR A;  2ONK E;  3FZV A;  1R9Q A;  3MAM A;  1YAE A;  5I57 A;  2DWH A;  1MXW A;  2DVZ A;  2NVU B;  3G3F A;  1UIU A;  3ILU B;  4GIZ A;  3FVO A;  3E4R A;  4OEN A;  1HSJ A;  3TDJ A;  3IL1 B;  1LFG A;  3C36 A;  5I2K B;  4IGR A;  3EF7 A;  4ZEB A;  2F7A A;  3OEM A;  1DPP A;  3IOT A;  4PP0 A;  2HZK A;  1MY0 A;  1GV8 A;  3MBP A;  1PC3 A;  3PMV A;  3M3K A;  1NKX A;  4N07 A;  1SYI A;  3K6V A;  3OO7 A;  4GXA A;  3TTK A;  3PPR A;  4FAT A;  3UP9 A;  4WEP A;  3KOS A;  4G8N A;  5AA2 A;  1WVJ A;  2V3Q A;  3B6W A;  3I5O A;  3PGF A;  1IXH A;  1B9J A;  3MZ1 A;  3ECR A;  5CC2 A;  2H25 A;  1TWY A;  5I2N B;  4LZ7 A;  4UA8 A;  3UOR A;  3RUM A;  1S9T A;  2XD2 A;  4DCX A;  1NNT A;  1SBP A;  5TP9 A;  1NH7 A;  5H8H A;  3LSL A;  1MXZ A;  4ESW A;  1B1H A;  3ZKK A;  1MH3 A;  4R9G A;  4KFQ A;  2HCA A;  2PX1 A;  3RT6 B;  3PU5 A;  1VR5 A;  3LSX A;  4X1D A;  4XKN A;  1A99 A;  3FIR A;  4KCD A;  4H5G A;  2UYF A;  4RNS A;  1O64 A;  2RC9 A;  4AB6 A;  1PBP A;  1VE4 A;  4XTC Q;  5JEI A;  4R6Y A;  2Y7I A;  3A3C A;  1M5F A;  2AL4 A;  3OMB A;  1A55 A;  3CFZ A;  3L6G A;  3VLU A;  4F29 A;  3FVN A;  1MM7 A;  1B52 A;  5I57 B;  3JV9 A;  3TMG A;  4IY5 A;  3TQW A;  2Z8E A;  3V89 B;  4DXU A;  4XKQ A;  2XXY A;  3RY3 A;  3EQ1 A;  2Z8D A;  1Q1K A;  1MH4 A;  5FTH A;  3TFL A;  1A54 A;  1QW0 A;  2DXY A;  3RNN A;  3CSB A;  3V8X B;  3W15 C;  5IAI A;  2F5X A;  2VD2 A;  4ZS9 A;  3C31 A;  1OLA A;  1FTJ A;  2UVH A;  2DP8 A;  4KYD A;  2O69 A;  3K0V A;  2REG A;  1IQ7 A;  3PD9 A;  1JQF A;  5AA2 B;  3OO6 A;  2UVI A;  5HM4 B;  1NL5 A;  1MDQ A;  4MBP A;  5FHN A;  2G93 A;  3KZG A;  1ANF A;  1A7L A;  3KEI A;  3EN3 A;  4ZZA A;  4G2Z A;  3MVW A;  5TP9 B;  1OIB A;  4JWO A;  1D4N A;  3OEN A;  1WDN A;  4GVO A;  3PUW E;  1ZIU A;  4RK9 A;  3K1P A;  1AIV A;  1URG A;  2V25 A;  1N3W A;  1SI1 A;  2YJP A;  2O6A A;  5I59 A;  1ZJL A;  1LBC A;  5L9M A;  3HST A;  2DOJ A;  1JW1 A;  3TAJ A;  4P0I A;  1MPD A;  3C35 A;  3OSR A;  3U8Q A;  3MP8 A;  1H44 A;  4IO7 A;  2CZL A;  1LCF A;  1EZO A;  4U1O A;  4I8C A;  4UAC A;  4OXV A;  3A3U A;  2DVC A;  4XIG Q;  3GBA A;  1BP5 A;  4U1Z A;  4F19 A;  4IO5 A;  4ELR A;  1PBQ A;  4WED A;  5TU0 A;  3B7D A;  4FED A;  1SW5 A;  1Y3P A;  1MQI A;  1QJM A;  4R75 A;  3G3H A;  4NED A;  3T93 B;  2A5T B;  1N7W A;  1B2H A;  1MDP 1;  1MG1 A;  4TLM B;  4ZED A;  4KCC A;  4OHN A;  4LUB A;  1LCT A;  1WOD A;  3TYH A;  1XT8 A;  3VLV A;  4IO4 A;  2F8D A;  4N6P A;  4EF1 A;  5KDT A;  1GGG A;  3TUS A;  3K1N A;  2I4B A;  1N7X A;  2D3I A;  2F36 A;  1QKA A;  5I58 B;  3UGW A;  4U4S A;  2ABH A;  4F18 A;  5I84 A;  4Z0I A;  4Z7E A;  4X48 A;  4YIC A;  1FTK A;  4AB5 A;  2O84 X;  4NTL A;  5CMM A;  3EHS A;  3IR1 A;  4NE4 A;  3O2A A;  4Q0C A;  3IX1 A;  2ZNU A;  1MRP A;  1LAG E;  3T96 B;  1JW4 A;  1D3K A;  1CE2 A;  2VP1 A;  4LAT A;  4RYA A;  4FJP A;  4G4P A;  2F97 A;  3ODB A;  4DXC A;  3SEY A;  3KG2 A;  3UA8 A;  2RCB A;  1H45 A;  4DE8 A;  1OLC A;  4ELP A;  1FTL A;  4F1U A;  3IK6 B;  4F31 B;  3LR1 A;  4YKI A;  3FD3 A;  5DEX A;  1YTV A;  1SW4 A;  1B7H A;  3H6V A;  3PPQ A;  1B6H A;  3ZKL A;  5KCJ B;  5I59 B;  3O6G A;  3Q28 A;  4GRK A;  1I6B A;  2HXW A;  5H8Q A;  3PPO A;  2E0S A;  1GVC A;  1DMB A;  4JBZ A;  3IB0 A;  1B4H A;  2QJE A;  3H6W A;  4JWY A;  4NF4 A;  2PT1 A;  2XXI A;  4GL0 A;  3C32 A;  2F78 A;  4MH5 A;  2ZYO A;  2HZL A;  1EZP A;  4DDD A;  1DOT A;  2IEE A;  2ONS A;  3G7W A;  4ECF A;  1RYO A;  2RIN A;  2QRY A;  5HBC A;  4YU0 A;  4GFR A;  3C34 A;  5EYF A;  1B1X A;  5KZT A;  2O7U A;  4GWO A;  1FQE A;  1SDX A;  4LA9 A;  1XVX A;  1B7U A;  4C1T A;  5J1D A;  4OET A;  2B3F A;  4O3C A;  3MJN A;  4QRZ A;  2RKM A;  4FE8 A;  1B46 A;  3MZ9 A;  4YB5 A;  3KJ7 A;  2AYS A;  1BIY A;  4QSC A;  4LON B;  1B32 A;  1VFE A;  2XXH A;  1DSN A;  4DXB A;  3W9V A;  3THI A;  2QSX A;  3TPA A;  3T9U A;  2H99 A;  2V84 A;  1FTM A;  4NMY A;  3OO9 A;  4QFL A;  2RF1 A;  2GFE A;  4FIM A;  4KI0 E;  2R6G E;  3OO8 A;  3MWB A;  4QFP A;  1POY 1;  2QMX A;  1Y20 A;  3FAT A;  2F6G A;  1XOC A;  4BDM A;  4MF3 A;  3LSW A;  5TPA A;  2QS4 A;  1NFT A;  4OFO A;  3QUJ A;  1DPE A;  4GXS B;  1US5 A;  3GLB A;  4G77 A;  4WXJ A;  1I6A A;  1A8F A;  4PET A;  4F1V A;  1XHY A;  2XX7 A;  3UN6 A;  4FOR A;  3IOW A;  2DE2 A;  3CFL A;  2QS1 A;  3DP6 A;  4IGT A;  5B7D A;  4C1U A;  4G68 C;  4KD5 A;  2XXU A;  3VV5 A;  1KWH A;  3MP1 A;  4DCY A;  1B0H A;  5AA2 D;  1NH8 A;  3CG1 A;  1VSO A;  1PB8 A;  4N13 A;  4ZEC A;  4P11 A;  1Y4T A;  3KBR A;  2DSF A;  3TCG A;  3HO7 A;  2Y7K A;  2A5S A;  2QPQ A;  4JDF A;  4RA1 A;  2PMS A;  2OZZ A;  1XS5 A;  1JEU A;  3G3G A;  3QK6 A;  3EPE A;  4TOZ A;  1MQH A;  2VHA A;  2ZYM A;  2Q88 A;  3KSX A;  1NNP A;  3TEP A;  1LFI A;  3FUZ A;  3D4C A;  1B4Z A;  1Z7N E;  1MY2 A;  1A40 A;  1MXY A;  4THI A;  1SQY A;  4BDO A;  2R9J A;  3O97 A;  4R6H A;  1SYH A;  1ATG A;  3DEL B;  3HCQ A;  2E1S A;  3KN7 A;  2O68 A;  3N6T A;  3TQL A;  2PVU A;  1Y1Z A;  1NNF A;  1IIT A;  3HPI A;  2I4C A;  4R74 A;  5H8N A;  3P7I A;  3KN3 A;  3PUY E;  4BLA A;  2OLB A;  3CI8 A;  5H8F A;  2X26 A;  3MC2 A;  5B70 A;  1FQB A;  4EQ9 A;  2QMW A;  4E0W A;  3GXA A;  3MW0 A;  4OEV A;  4ESX A;  3F11 A;  1B3H A;  3TZA A;  4LP2 B;  1B5H A;  3PUX E;  1MY1 A;  1BKA A;  2I3V A;  2H4I A;  3LC8 A;  2DWA A;  3U93 A;  3E3K A;  2NOO A;  1MXV A;  1A8E A;  1JET A;  4IO2 A;  1UIV A;  3DLN A;  2VD3 A;  5DVI A;  1LGB C;  3PUZ E;  1D9V A;  4F22 A;  5AA4 A;  5CBR A;  2R71 A;  1S7Y A;  2HAU A;  3RLF E;  5I56 A;  4ZEI A;  4M1V A;  1PB7 A;  2DXR A;  2Y7P A;  2B3B A;  4NF8 A;  3QUF A;  1IEJ A;  2WKY A;  4R72 A;  3SEV A;  2HFB A;  4MFI A;  3V5A A;  1GTK A;  3E9X A;  4H8I A;  3VLW A;  1Y3N A;  2GRV A;  1SVX B;  3FVG A;  1ZKB A;  3U1O A;  1FQC A;  4G68 A;  3G3I A;  3L6H A;  4L17 A;  3K1M A;  5H8H B;  4G8H A;  1EU8 A;  2UYE A;  4R73 A;  4O3B A;  3M3F A;  4LZ5 A;  1H3D A;  4H0W A;  4BDL A;  5FHM A;  4LZ8 A;  4AQ4 A;  1IXG A;  5DYH A;  2DS9 A;  5DVJ A;  1ZU0 A;  2W7Y A;  1UTB A;  4U23 A;  4PQJ A;  3MZB A;  5DVF A;  3T66 A;  3Q27 A;  4DLD A;  4EF2 A;  1MY4 A;  4PFU A;  4GF8 A;  4PFY A;  3VXC A;  3ONM A;  2QS2 A;  2Y7R A;  4C0R A;  4OVJ A;  3T22 A;  4ZEF A;  4PE5 B;  2V3U A;  4QF9 A;  4QFO A;  3WAF A;  2ZNT A;  3VDF A;  1I69 A;  3VFJ A;  3R6U A;  3TTR A;  4OER A;  2XXX A;  4H6D A;  2OK2 A;  3H6U A;  1B3F A;  3AXF A;  3FV2 A;  4GL8 A;  2ZNS A;  3M8U A;  3UK4 A;  2I49 A;  2QL3 A;  5JK4 A;  1SW1 A;  4RPO A;  4QSD A;  3RQT A;  1FQF A;  2F7C A;  5FTI A;  3CIJ A;  3HHG A;  4ONY A;  2FYI A;  4EQB A;  3U94 A;  5I56 B;  4EXK A;  4R9F A;  2FA7 A;  3GZG A;  2VOZ A;  4PFT A;  4WKM A;  3SEW A;  4JSO A;  3BFU A;  1B5J A;  1MY3 A;  2XHD A;  3KN8 A;  2D5W A;  3IJO B;  2XXP A;  4U21 A;  1P1Q A;  4LQ5 A;  5A5X A;  4IB2 A;  5LOM A;  3H7M A;  3RPW A;  4FAJ A;  2O1M A;  3IB2 A;  3EHU A;  1QUL A;  1Y1M A;  2H5Y A;  1IIW A;  2Z23 A;  5IKB A;  3CRB A;  2D21 A;  1ZTY A;  4I62 A;  4OQO A;  3RGY A;  3O6I A;  1OQH A;  1B58 A;  2BJJ X;  1Q35 A;  4OZ9 A;  1II5 A;  2OJT A;  2RC7 A;  4GD5 A;  4HTG A;  3C9H A;  2QS3 A;  4QFK A;  5AA3 A;  3H4Z A;  2M8C A;  1NMU A;  3FAS A;  4ND9 A;  4P0G A;  4OFJ A;  1Z7M E;  1JEV A;  3PD8 A;  4M4G A;  5I2K A;  1RYX A;  1UTB B;  4GQO A;  3LSF B;  2Z8F A;  1LFH A;  4ZE8 A;  2H9B A;  4EUO A;  2HEU A;  2XX8 A;  1TXF A;  2CMO A;  1UTH A;  1HSE A;  3LBS A;  1LLS A;  3GBB A;  3N94 A;  4QFN A;  4IY6 A;  4OFL A;  2FNC A;  4I1D A;  3H03 A;  4OTE A;  3IOV A;  4YMA A;  1URS A;  2THI A;  3I6V A;  1N04 A;  2F35 A;  4ISU A;  3PMX A;  4FEB A;  3EHT A;  3MP6 A;  5I2N A;  3SEX A;  4POW A;  1MPC A;  1XVY A;  3S9L C;  5L9O A;  4RXL A;  5FHO A;  4JWX A;  1EZ9 A;  1B5I A;  1DTG A;  4NWD A;  3S9M C;  1OMP A;  3IOU A;  4BDN A;  3PPN A;  4IO6 A;  3SES A;  2GHB A;  1QUJ A;  2F6P A;  3MVY A;  1QKB A;  3FXR A;  4JSD A;  3G3K A;  1YCJ A;  5K2Y A;  2I0C A;  1MM6 A;  1R1N A;  3KFM A;  1MQD A;  2X7P A;  3RN8 A;  2PT2 A;  5KDT B;  5CBS A;  1VFD A;  3WAE A;  5L8D A;  2RC8 A;  2ZXT A;  2OWS A;  4RPN A;  4LVQ A;  1Y3Q A;  2Y7W A;  3H06 B;  1HSL A;  3R26 A;  1F9B A;  3B6T A;  2HQ0 A;  4R6K A;  5L9S A;  1AOV A;  5CM6 A;  2X7Q A;  1MPB A;  5DTB A;  5ICQ A;  3TTN A;  4JB7 A;  1NNK A;  3QYT A;  3FGS A;  4HCW A;  4NF6 A;  1JVY A;  3KJT A;  3O6H A;  3I3V A;  2Q9T A;  3HV1 A;  4YB7 A;  5EHM A;  5H8S A;  4R2F A;  1P1W A;  1ZMG A;  2OCU A;  1TT1 A;  2AIX A;  3E13 X;  5ISU A;  1JVX A;  4HW8 A;  1AL3 A;  5DEX B;  1BTJ A;  1GR2 A;  5M2V A;  3SDF A;  3Q25 A;  1M5B A;  4X1B A;  3VVE A;  1O63 A;  3MVZ A;  1RKM A;  3PV0 E;  5H8Q B;  2XX9 A;  3HHF A;  3DP8 A;  4O3A A;  1FQA A;  4XXU A;  1UTH B;  2I3W A;  3IAZ A;  4EXL A;  4NF4 B;  1N3X A;  2O7I A;  4Q30 B;  3TTM A;  4NF5 A;  4GOT A;  4POX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...