4MEVA

Crystal structure of a trap periplasmic solute binding protein from rhodoferax ferrireducens (rfer_1840), target efi-510211, with bound malonate, space group i422
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
311
structure length
311
Chain Sequence
SALKISHQFPGGTIKEGDFRDRLVRNFAAEVEKRSKGAMKFEIYPGSSLMKTNAQFSSMRKGALDMALIPLSYAGGEVPELNIGLMPGLVVSYEQAYSWKTKPVGIELTRVLQEKGIVLISWIWQAGGVASRGKPVVEPEDAKGMKIRGGSREMDMILKDAGAAVVSLPSNEIYAAMQTGAMDAAMTSSTSFISFRLEEVAKALTTGRTGAYWFMFEPLMMSKAIFDKLPKDQRDMLMTVGAEMEKFALEAAKKDDIDVAAVYQKAGAKVVDLSDGTIKKWQDIARKTAWKDYGAKNEGCAKLLALAQQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRAP dicarboxylate transporter-DctP subunit
publication title Experimental strategies for functional annotation and metabolism discovery: targeted screening of solute binding proteins and unbiased panning of metabolomes.
pubmed doi rcsb
source organism Rhodoferax ferrireducens
molecule tags Transport protein
total genus 116
structure length 311
sequence length 311
ec nomenclature
pdb deposition date 2013-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4mevA00
2HPGA 3U65A 4P8BA 5LTCA 4PGPA 4XEQA 5CM6A 2ZZXA 3FXBA 4PETA 4XFEA 5IGAA 4P3LA 4PFBA 4MNCA 4OVQA 4NQ8A 4N17A 3B50A 4PFIA 2WYKA 2XWKA 4YZZA 4MCOA 2PFYA 2XWVA 4PAIA 4X04A 4MAGA 4P1EA 4P9KA 4X8RA 4N4UA 4DI4B 2XWIA 4MNIA 4NN3A 2WYPA 4N8YA 2PFZA 4MNPA 4NX1A 4N91A 4PF6A 4NHBA 4LN5A 4NF0A 5IZZA 4NAPA 3GYYA 4PBHA 4PF8A 4PAFA 4P1LA 4MEVA 4OVSA 4PDDA 2HZKA 5I5PA 4DI3D 4OVRA 4O7MA 4P47A 4N6KA 5IM2A 2CEYA 4N15A 4O94A 4NG7A 2XWOA 4P56A 4UABA 4YICA 4O8MA 2ZZWA 4MHFA 4PAKA 2HZLA 2VPOA 2VPNA 5I7IA 2CEXA 4OVTA 4PFRA 2XXKA 4OA4A 4MMPA 4XF5A 4MX6A 2WX9A 4MIJA 4OANA 4PDHA 4N6DA 4N8GA 4PC9A 4PCDA 2ZZVA 2XA5A 4PGNA 4NGUA 4OVPA 4PE3A 4PBQA 2V4CA
chains in the Genus database with same CATH superfamily
1LBCA 4ELRA 4GX6A 5CMMA 1URGA 2O1LA 3VE1B 2XXYA 4ELQA 1S7YA 4PFBA 1EH3A 4ZEIA 2ALUA 1YTVA 1IMBA 2F78A 4DE8A 1RDZA 1GR2A 2B4LA 3MZBA 2F36A 4ZECA 3TTNA 3EHSA 1LBVA 3HV1A 2V93A 4EQ7A 2KLFA 3SZPA 2Z8FA 1FTJA 4G68B 4WXJA 4ZEKA 3IOVA 1EYKA 4YB5A 3O6HA 4AB5A 2UVIA 1IXHA 1MH4A 2I0CA 1LBZA 1RKMA 5DEXA 3FXQA 1FTAA 5IZZA 2PMSA 3OEMA 4IO5A 1P1QA 4X9TA 3GBAA 3R26A 4Z7EA 3U93A 3A09A 2E0SA 3JYRA 1M5BA 2Q2AA 4O7MA 3KZGA 4YKIA 2RCAA 5ICTA 4OYVA 4DLDA 1Z7ME 4GWOA 1FPBA 5EHMA 4MX6A 4LP2B 2Y7IA 2D21A 2ZZVA 1MG1A 3MPKA 4GRKA 1MS7A 4NF8A 1NUZA 1ELJA 4OZ9A 3E4RA 2V25A 2A5TA 2PBWA 2DWAA 3SEXA 3GZGA 3KOSA 3D1RA 1B7ZA 1OLAA 2NUVA 3JZJA 2RC7A 5L9OA 3MW0A 4DXCA 3QUJA 1B0HA 3USDA 5KCJB 3FJGA 1MDQA 1NV6A 4THIA 3VVFA 2Y7WA 4I8CA 2O51A 4N91A 5A5XA 1B46A 2Y7KA 4EF2A 1FQCA 2AL5A 1NUXA 1FBHA 4GBVA 4PF8A 2WEFA 3PD9A 4XKPA 4KD5A 3L6HA 1USYH 1LBWA 3A3CA 3M3KA 1Y1MA 5I2NB 4O94A 5DW8A 4DCYA 5CMKA 3C34A 1IMAA 1IIWA 2GRVA 3QUFA 4OVTA 1J1NA 4OA4A 2O6AA 4FIMA 4O7IA 4H8JA 4QRZA 2Y5KA 4OFOA 4R74A 3WAFA 2XX9A 5HPQA 1JW4A 4GX3A 2H99A 5H8QB 5T3JA 1D4NA 4O3CA 1XC1A 1DSNA 1QVSA 3FVGA 1IXCA 1MDP1 2OWTA 4KYEA 3DP6A 3U94A 1IMCA 3QSLA 3ZKLA 1QKAA 4H67A 1Y9UA 3ZS6A 2Z8DA 2QVVA 1HSEA 3BKIB 2DSFA 3G3FA 3K1MA 4P3LA 1FPKA 3Q25A 1US4A 4QFLA 3B6QA 1NKXA 1FTMA 3E13X 3VFJA 3PUYE 4RYAA 4WEDA 3IK6B 4NF6A 3ODBA 1MXVA 4MAGA 1B7HA 1M5FA 4JWXA 4FORA 4FEBA 1VDWA 5FHNA 4EDPA 4GOTA 3RPWA 1LLSA 2R9JA 2P2AA 3ILUB 4YKPA 2XXWA 4NHBA 1H76A 4U1ZA 2R6GE 2F5XA 4LN5A 2GQ1A 2QMWA 1PC3A 2ESNA 1DPEA 1H43A 3VXBA 2ZYMA 1NV1A 1YAEA 4GWXA 4IO4A 5JTYB 2O84X 1FQFA 4OFLA 3IOWA 2ZZWA 4PAKA 4KR5A 3RTWB 1EZ9A 4F31B 4IO3A 4TOZA 2Y84A 4PDHA 3UORA 3I3VA 3RYDA 4PE5B 4N13A 3KOTA 4Q30B 2CZHA 4JSOA 3VVEA 4LATA 4FE8A 4KCCA 5DVIA 1XOCA 3PU5A 3MAMA 3IR1A 4NMYA 1FRPA 4P8BA 5BWJA 2QS4A 3IO6A 2JJKA 1WVJA 1DCUA 2FBPA 3L6GA 5F24A 3KC0A 1H44A 4YB7A 3O2AA 1I69A 2QPQA 3K1NA 4KHZE 1LBXA 2I6EA 3HCQA 3HSTA 1FPDA 2IEEA 1M5DA 4JB7A 5EHSA 4PFIA 1CNQA 2XWKA 1JP4A 2PT2A 4U1OA 2I58A 5CI5A 1DMBA 2F6PA 1O64A 1DBZA 3E79A 1GV8A 1MM6A 2ZNUA 2CZLA 4MBPA 1O7TA 4H0WA 2XXVA 1Y4TA 1R6ZA 3BBRA 1ZIUA 1MY1A 2PCRA 3R7XA 4LONB 5FHMA 4U23A 1O63A 3CSBA 3PUVE 2Y7PA 3CFZA 1RYXA 4GIZA 2QFLA 4PAFA 3K6XA 2Y7RA 2HXWA 4I1DA 2V84A 4RK2A 1XT8A 4F3GA 1SW4A 3H4ZA 1QGXA 1MY3A 1Q1KA 2X7QA 1FPLA 1FBPA 1ZJLA 3TCGA 4JXIA 4N8GA 1MY2A 3VDFA 2UVHA 1EYJA 5AE4A 3PTYA 5EYGA 2DE2A 1JETA 5FTHA 1FTLA 4G2ZA 5H8NA 3G3JA 4G68A 2O7IA 3N94A 1FQAA 4XEQA 1A8FA 4H8IA 1B5HA 2BJIA 3U72A 1MPBA 3UGWA 2I48A 2F3DA 3IOUA 2HFBA 1VSOA 1WODA 4BDMA 3G3HA 2VT5A 4GX4A 1B4HA 4HTGA 1N3XA 2F7BA 4XKQA 3BFTA 5I56B 3FD3A 3TKDA 4X04A 2F7AA 1Q9DA 4TQUQ 3PMWA 4OHNA 1T0KA 5LOMA 1BKAA 3OELA 2GFEA 4TLLB 2Z8EA 3TTMA 1INPA 3S9MC 2FVZA 2VD2A 3W9VA 4JSDA 3C36A 3MZ9A 3TQLA 1LAFE 1MM7A 4HS7A 3P7IA 2FA7A 2D5WA 2UYEA 4YU0A 2GHAA 3OO9A 2F6GA 1LBBA 3GLBA 1A99A 4IB2A 3B6TA 2DXYA 3IX1A 4GF8A 1PBPA 5KDTB 1PDAA 3TDJA 1MQJA 1OMPA 3K02A 1UTBA 4GLIA 1B5JA 3RGYA 2Z22A 5DVJA 2XXHA 1DPPA 2CEXA 2I0BA 1A8EA 2FNCA 2F3BA 3MVXA 3V83A 5IKBA 3OEKA 4HW8A 1IZ1A 3QMFA 4JWYA 1NNFA 3Q27A 3JV9A 1A54A 2UYFA 2Q89A 3T9HB 2RC9A 2PVUA 2F97A 5I2KB 5J16A 2DXRA 2ZYKA 4ZZEA 3S4UA 2RC8A 4HCWA 4QXDA 2RCBA 2THIA 2PT1A 3TTLA 2LAOA 5ET7A 4N6PA 2XD3A 3MP1A 1KWHA 2FYIA 1PEBA 3CG3A 5AA4B 1ZLQA 1B05A 3C31A 3U1OA 1NV0A 4GL8A 2L5VA 1FBGA 3SEUA 4F39A 4XKRA 1R9LA 3TODA 2XX8A 1AIVA 4UA8A 1FTOA 2B3BA 1YCJA 2H98A 2W7YA 4GWYA 5I58A 1OIBA 1MRPA 3S2VA 4I9DA 1EU8A 2QL3A 3C32A 4OMBA 2XXIA 3EHUA 4X1BA 4DDDA 5FTIA 2OLBA 4I62A 3KG2A 3N6TA 4P47A 3VLVA 5AA2B 4YICA 4O8MA 3T1BA 2RINA 2UXAA 2H25A 1N84A 4PFRA 1MXXA 1IUDA 1F9BA 1KZ8A 3S9EA 2WKYA 1IXIA 3IOTA 3G3IA 5EQ8A 3RTFB 2DE4A 4U4SA 3MWBA 1MXWA 1NH7A 5TPAA 3B6WA 4F29A 4POXA 3SDFA 3I6VA 1NUWA 3E3KA 3IFAA 5H8FB 1IITA 4BDLA 3QAXA 4N81A 3AXFA 4L17A 3FUZA 1BP5A 4GL0A 4RNSA 4RPOA 2R8TA 1SW5A 1QKBA 2Q88A 1OVTA 3PV0E 3TPAA 1LAGE 1RDYA 4GWSA 1N7XA 4N17A 5TP9A 4KYSA 3FVOA 3K6VA 3PUWE 2B3FA 2XXXA 3C33A 3LSFB 4P1EA 1FBDA 4N4UA 1LCFA 4GD5A 3C4MA 3QK6A 2AYSA 1URSA 4NF5B 1VFDA 2WYPA 4N8YA 2CZIA 1MPCA 1TFAA 3ISPA 1H45A 5TU0A 2I3WA 4YMBA 3UN6A 2O69A 4QFKA 1BK4A 2BJJX 1FJ6A 4EQ9A 1EZOA 1QUKA 1Y3NA 4OVSA 2M8CA 3TELA 3S9NC 4H5GA 1P1NA 1MQDA 4P56A 1P99A 1FTKA 2HZLA 2VPOA 3Q26A 4IY6A 2HEUA 2XXPA 4M1VA 1RYOA 4PFUA 4QFPA 3KGCA 1ZTYA 2DQVA 2WX9A 2QMXA 4N6DA 2H5YA 2NWJA 4PCDA 1EZPA 4PTKA 5ITPA 5ET6A 5AA1A 4QFNA 1B2HA 4G68C 5H8HB 3FV2A 5CMBA 1JQFA 1MH3A 1MY4A 4OVPA 5IM2A 2HPGA 3BFUA 3VVDA 1LBYA 1D3KA 3UIFA 1SYIA 1ZKBA 1I6QA 1MQGA 4GBWA 1NL5A 3KBRA 3KSJA 4HCYA 2Z23A 1BIYA 3FATA 3CHGA 4IO7A 1NV2A 4POWA 1IMDA 1GVCA 3HHGA 3N6UA 4YMAA 3N26A 1Y3PA 1S9TA 3CRBA 1NV7A 3HPIA 1OVBA 4NF4B 1K9ZA 1A40A 3OO6A 1FPFA 3PPOA 2CZKA 3HN0A 1SPIA 4NX1A 4F1VA 2P1SA 1DTGA 1BTJA 3HFUA 1PB7A 4KYDA 3FXRA 3LSXA 2WBDA 2YPNA 4C0RA 1SI0A 5JK4A 1A7LA 2VGQA 3VLWA 4P1LA 1AH5A 1YYZA 4BLAA 1IXGA 1FSAA 5DEXB 3TCHA 4G8MA 4OENA 3LBSA 4KQPA 2I4BA 2REJA 3TAJA 4N15A 5F7VA 1FPGA 4QBAA 1QUIA 3T66A 1USYE 3EF7A 1ZMGA 2F8DA 3QXMA 4MLVA 1LB8A 3MVWA 4MMPA 4ISUA 1G0HA 2VOZA 2HCAA 4H5FA 2I49A 4F18A 5I57A 1VR5A 1DTZA 2HAVA 1Y20A 5DT6A 2DS9A 3RN8A 1I6AA 3C9HA 1D9VA 3U92A 4PGPA 4IO2A 5M2VA 1XI6A 3EQ1A 4NF8B 1Z7NE 2KR0A 4LZ5A 1N04A 3Q28A 2UVJA 4F22A 4HE0A 3KN3A 2O1MA 4EXLA 5L8DA 2WYKA 5EQAA 2ZMBA 1NFTA 1UQWA 4X1DA 1YZ0A 1MPDA 3IO4A 3MVZA 3CFLA 3RPLA 3IB1A 2DYXA 1D9YA 4X48A 3RY3A 3Q29A 4ND9A 2V3UA 3VV5A 2REGA 5K2YA 2PYYA 1FQEA 5HBCA 5B70A 2NXOA 3KJ7A 1JVXA 1B3LA 1MY0A 4U2RA 3IB2A 5H8SA 1URDA 1M5CA 1H3DA 2F34A 3O6IA 4QF9A 3T96B 3LSWA 4G61A 2ONSA 2X26A 3WAEA 3LV0A 1NNTA 3M3FA 4R6YA 4H65A 1YPNA 4EUOA 1EYIA 3O29A 3H6VA 3DLNA 1NV3A 1ZU0A 3M8UA 4RA1A 5IZ1A 1SI1A 2P3VA 2DOJA 4R9FA 5AA4A 3THIA 1PBQA 3GXAA 4G8NA 1B58A 1GTKA 4PE3A 5JEIA 4GQOA 2DWJA 3FGSA 2OJTA 3T22A 5LTCA 2ZZXA 3PPNA 4PETA 1Y1ZA 5ICQA 1AL3A 1GGGA 1IQ7A 5ET8A 4GWUA 4G8HA 4F3SA 3TCFA 1SDXA 1B3FA 3N5LA 4LZ8A 2OZZA 2DWHA 3T9XB 5IAIA 2PX1A 4MJOA 3U8QA 4YZZA 1RDXA 1NNKA 2PFYA 3CFXA 4H6DA 1TXFA 3RUMA 4R6KA 3KSXA 4G77A 5EQ7A 4NF6B 3MJNA 3MP6A 4NEDA 3DP4A 4WEPA 1QW0A 3IFCA 4NF0A 1NNPA 4JDFA 4PBHA 1TT1A 3TQWA 4F2OA 5HM4B 3UA8A 5FHOA 5BUUA 2QS2A 4DI3D 5ISUA 1DOTA 1B3GA 1UTHB 4Z0IA 5H8FA 1BLFA 3H06B 1N7WA 4R73A 3FZVA 3KN7A 4RJZA 3IAZA 4R2FA 3FIRA 3GBBA 3V5AA 2XXKA 5LDZA 4GXSB 1B40A 4YB6A 5B7DA 3K0VA 3OSQA 4PFTA 3CG1A 4OANA 1MXYA 1B51A 1SVXB 4MLQA 4NGUA 3TEPA 1FW0A 4GXAA 4NWDA 3FV1A 4NWCA 3EKIA 4NF5A 2NOOA 1B0LA 3D4CA 1UIVA 2MKZA 4C1UA 5I59B 4QSEA 4JVIA 3T9UA 3FJMA 3OO7A 4EXKA 4QFOA 3SEVA 2DE3A 3FBPA 2G29A 1TFDA 1B52A 4U4XA 5KCJA 2OWSA 3VXCA 4AQ4A 4PAIA 3KEIA 2QVUA 2YLNA 1P1UA 3OSRA 3HHFA 2OX3A 4FATA 5K2XA 1FBEA 1FJ9A 1R9QA 4AB6A 1JNFA 5I2NA 5A5LA 4JVCA 2XXRA 2QSXA 3FXUA 4OETA 3K2DA 1MXZA 3CVGA 2DWIA 4HE2A 4LZ7A 1UIUA 2VPNA 3K6WA 4OESA 3FVKA 4R72A 5H8QA 4OTEA 3PMXA 3SEWA 4LUBA 2OBGA 1MQIA 1I6BA 1NI9A 2ANJA 3V8XB 1JW1A 1US5A 2ZYOA 4E0WA 3SKPA 3H3GA 5IZ3B 3PD8A 4XTCQ 4F1UA 4NF4A 3ONMA 2IA4A 1K9YA 4F19A 5CM6A 1HSLA 1XVYA 3FXBA 4XFEA 2DDKA 3H6UA 4XKNA 4FJPA 4IGRA 5H8NB 1M5EA 4MNCA 1QJMA 3PUXE 1FPJA 4I3EA 3W9WA 4MF3A 1LFIA 2XXQA 1FQBA 1IMEA 3G3GA 1B5IA 4DCXA 4FBPA 1SBPA 3G3KA 3FASA 1NH8A 3TYHA 4Q0CA 3E78A 4F2QA 2V3QA 1B32A 5KZTA 3RT6B 1P1WA 3B7DA 3B8BA 3R6UA 3O97A 4OFJA 1MQHA 5JTYA 3SESA 4IR8A 2QVRA 1R1NA 1WDNA 4F1YA 1HSJA 4MHFA 2NVUB 3BIGA 4F3BA 1UTBB 4EQBA 1KA1A 3HO7A 1LSTA 4GWZA 5CRYA 3K6UA 1B3EA 3LUZA 2XXTA 3LSLA 4IO6A 4PBQA 1B3HA 3VLUA 4NE4A 1P1OA 2Q74A 3CSGA 1Y4CA 2DVCA 4ZDMA 3ROJA 4R2BA 1ZBMA 1NUYA 1FBFA 3S9LC 1JEVA 4QSDA 2ABHA 4U22A 2V3TA 3T9VA 3K4UA 4DZ1A 1II5A 3NOHA 2HQ0A 4DIGA 4BDOA 3PUZE 2P0SA 4P9KA 3F11A 2AIXA 3ZSFA 4C1TA 4QSCA 4ZZAA 2O7UA 1IMFA 2PFZA 4MNPA 4DXBA 4PFYA 4NTLA 5CBSA 1CE2A 3C35A 4PF6A 2ZNTA 1OQGA 4G4PA 1B1HA 1S50A 4GWWA 3OXNA 3OD7A 3SEYA 2VD3A 4O3AA 4I3YA 3EHTA 5I58B 3PMVA 1D9QA 1FCKA 1VFEA 4I40A 3TUSA 2Q9TA 4ZE9A 4ZS9A 1OLCA 2XXUA 1JVYA 4OWDA 3T93B 5ESYA 3DM0A 2HAUA 2XHDA 3O6GA 1SD3A 1IEJA 3PPPA 2UVGA 3MC2A 3ZKKA 3W15C 1KA0A 4YAHX 3M3LA 2GHBA 3LR1A 4ZE8A 4PGNA 4JBZA 1LGBC 2HHMA 4FAJA 3D4GA 5DVFA 3DELB 4AS4A 1POTA 2VHAA 5AA2D 4E0XA 4GVOA 2OCUA 3OO8A 2FIEA 5TPAB 4OQOA 4KI0E 4OVJA 5IGAA 5EYHA 1B6HA 4R6HA 3OENA 1OQHA 5L9SA 5I56A 3H7MA 4LQ2A 2RF1A 2B65A 3RLFE 1UTHA 3PPRA 3SERA 2ZXTA 2QS1A 4TLMB 4X8RA 2ONRA 5TP9B 4DI4B 4YKJA 5CBRA 4Q5TA 4MNIA 2F7CA 1Q35A 2A5SA 3MP8A 1NMUA 4LVQA 3OMBA 2P3NA 3TTRA 2ONKE 2A5TB 1LFGA 4R9GA 5CC2A 1B7UA 3CIJA 4ECFA 1N76A 3GYYA 3G7WA 5KDTA 1AMFA 4HXVA 5EQ9A 3IL1B 3MSTA 3TMGA 4Q8RA 2X7PA 4PDDA 2HZKA 5I5PA 5L9MA 1A55A 1FQDA 5FBPA 4OVRA 3UK4A 4UACA 2FHYA 2XWOA 2GH9A 5I59A 3H6WA 4ZEFA 4P11A 4FECA 3MUQA 5I7IA 1SQYA 4JVDA 4OXVA 2I3VA 3T0JA 3O66A 5A5XB 4MIJA 2ZYNA 4H45A 4BDQA 1NV4A 1JEUA 3CR9A 5ET5A 3IJXB 4M4GA 4YKKA 3PGFA 5I3SA 5I2KA 5AA3A 3IJOB 3QYTA 3CI8A 2I4CA 3IORA 3TTKA 5I84A 4FEDA 3DP8A 3K1PA 4OEVA 1LAXA 3K00A 4ZEDA 3MBPA 4GFRA 4NQ8A 1AWBA 3KFMA 1B9JA 1LAHE 3MPLA 4KPTA 4ESXA 2XX7A 1YXIA 3KN8A 3FJ7A 4PFWA 4OEUA 2DVZA 2XWVA 4XIGQ 3PPQA 4RY1A 5CMCA 3K01A 4H46A 4XXUA 1PB9A 5EYFA 4AS5A 2WBBA 4NN3A 5F1QA 4F3PA 3E9XA 2Q8MA 4BDNA 4KFQA 1DK4A 4ZEBA 3RNNA 1SW1A 2F35A 3MYUA 3LUYA 1QULA 5AA2A 5IZ3A 4LQ5A 3MVYA 3O9PA 3IB0A 2O68A 4ONYA 3QIMA 4O3BA 4N6KA 4OERA 1LEVA 4KXPA 4P0GA 2XD2A 3RT8A 4N07A 3TZAA 3A3UA 1JW5A 4HE1A 4P0IA 4JWOA 1N3WA 4EF1A 4XF5A 1NV5A 2D3IA 3ECRA 1POY1 4DXUA 4MFIA 2H9BA 1B4ZA 1PB8A 2E1SA 4MH5A 5ITOA 4RXLA 2Q2CA 1LB9A 4WKMA 1ATGA 4H1XA 1MXUA 4BDRA 1LCTA 2OWZA 1SYHA 3MZ1A 2V4CA 5J1DA 5I57B 2QJEA 3U65A 3ILTB 1CB6A 3TFLA 5DYHA 4QHQA 3LC8A 4ELOA 2H4IA 4RPNA 5ELVA 3V89B 4ESWA 3MQ9A 3EN3A 1XVXA 1QUJA 4OVQA 1ANFA 2FIXA 4IY5A 2G93A 3FVNA 3B50A 4IGTA 4PQJA 4MCOA 3RQTA 2XWIA 2QS3A 1FBCA 3BIHA 3KBZA 2Y5LA 1Y3QA 3OOAA 2B4MA 2AL4A 2DP8A 2CMOA 2QRYA 1VE4A 2RKMA 4ELPA 3EPEA 2HXRA 3RPLB 2VP1A 4K3FA 1N0TA 2Q8JA 4NAPA 3KJTA 1XS5A 4MEVA 4PP0A 1G0IA 1LFHA 1SW2A 2R71A 1L5TA 2KQZA 2CEYA 4NG7A 5DTBA 2OK2A 4R75A 4UABA 3UP9A 3I5OA 4RK9A 3A29A 1FPEA 1FPIA 4KCDA 1TWYA 3SETA 5H8HA 3H03A 3H6TA 1AOVA 4PC9A 2YJPA 4U21A 2XA5A 1B1XA 2ZNSA 4LA9A 1XHYA 3O28A 3KC1A
chains in the Genus database with same CATH topology
2Q74A 4GX6A 4PGPA 4XEQA 1XI6A 3ROJA 2BJIA 2F3DA 1NUYA 1FBFA 4PFBA 2KR0A 1IMBA 2VT5A 4HE0A 3NOHA 1RDZA 4GX4A 2WYKA 5EQAA 2B4LA 1YZ0A 4X04A 4P9KA 1LBVA 1Q9DA 3SZPA 3RPLA 1IMFA 2PFZA 4MNPA 1EYKA 1INPA 4PF6A 2FVZA 3W9VA 1LBZA 1FTAA 5IZZA 4GWWA 4X9TA 4I3YA 1D9QA 4I40A 2Q9TA 4G61A 4O7MA 3LV0A 1EYIA 5ESYA 1NV3A 2CEXA 5IZ1A 2P3VA 1FPBA 1KA0A 2F3BA 4MX6A 2ZZVA 3QMFA 4PGNA 2HHMA 4PE3A 1NUZA 4AS4A 5J16A 5LTCA 2FIEA 2ZZXA 4PETA 4HCWA 4QXDA 5IGAA 5ET8A 4GWUA 5EYHA 3D1RA 5ET7A 4MJOA 4YZZA 1RDXA 2PFYA 1NV0A 2L5VA 4X8RA 4DI4B 1FBGA 4MNIA 5EQ7A 2P3NA 1NV6A 4N91A 4GWYA 3IFCA 4NF0A 1NUXA 1FBHA 4GBVA 3GYYA 4PBHA 4PF8A 4HXVA 2WEFA 5EQ9A 3MSTA 4PDDA 2HZKA 5I5PA 4DI3D 1LBWA 5FBPA 4OVRA 4P47A 2FHYA 4O94A 2XWOA 5DW8A 4YICA 4O8MA 3T1BA 1IMAA 5I7IA 4JVDA 4OVTA 4PFRA 2XXKA 4OA4A 5LDZA 1KZ8A 4O7IA 3T0JA 4MIJA 2Y5KA 4OANA 4H45A 1NV4A 5EQ8A 4GX3A 2DE4A 5ET5A 5T3JA 5I3SA 4NGUA 3EKIA 1NUWA 1IMCA 3IFAA 2MKZA 4N81A 4JVIA 2QVVA 4P3LA 1FPKA 2R8TA 4NQ8A 1AWBA 1RDYA 2DE3A 3FBPA 4GWSA 4N17A 1YXIA 2DVZA 2XWVA 4PAIA 4MAGA 4P1EA 1FBDA 4N4UA 1VDWA 4H46A 4AS5A 2QVUA 2WBBA 4NN3A 2WYPA 4N8YA 2CZIA 2OX3A 3ISPA 2Q8MA 1FBEA 1FJ9A 4NHBA 1DK4A 2F5XA 4LN5A 2GQ1A 1BK4A 3MYUA 1FJ6A 5IZ3A 5A5LA 4OVSA 4JVCA 1NV1A 4GWXA 4N6KA 1LEVA 4KXPA 4P56A 4HE2A 2ZZWA 4PAKA 2HZLA 2VPOA 2VPNA 4M1VA 4HE1A 4XF5A 1NV5A 2WX9A 4PDHA 4N6DA 3RYDA 1NI9A 4PCDA 4PTKA 5ET6A 2CZHA 5IZ3B 4OVPA 2OWZA 5IM2A 2V4CA 5J1DA 4F1UA 2HPGA 3U65A 1FRPA 4P8BA 1K9YA 4F19A 5CM6A 3FXBA 4XFEA 2DDKA 2JJKA 1DCUA 2FBPA 5F24A 3KC0A 1LBYA 4MNCA 4OVQA 4GBWA 2QPQA 2FIXA 1FPJA 1LBXA 4HCYA 4I3EA 3W9WA 1FPDA 3CHGA 1NV2A 3B50A 4PFIA 1IMEA 1CNQA 2XWKA 1IMDA 1JP4A 4MCOA 1DBZA 4FBPA 3E79A 2XWIA 1NV7A 3E78A 1FBCA 3BIHA 1K9ZA 3KBZA 1FPFA 2Y5LA 2CZKA 2B4MA 2V3QA 1SPIA 4NX1A 4F1VA 3HFUA 2HXRA 3RPLB 2PCRA 2WBDA 3B8BA 4NAPA 5JK4A 2QFLA 4PAFA 4P1LA 1YYZA 1FSAA 4MEVA 4IR8A 1G0IA 2QVRA 2KQZA 2CEYA 4N15A 4NG7A 4UABA 1QGXA 1FPGA 4MHFA 3BIGA 4QBAA 3A29A 1FPEA 1FPLA 1FBPA 1FPIA 4MMPA 1G0HA 4N8GA 4PC9A 1KA1A 1EYJA 3PTYA 4GWZA 5EYGA 4F18A 2XA5A 2DE2A 3LUZA 3KC1A 4PBQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HPG A;  3U65 A;  4P8B A;  5LTC A;  4PGP A;  4XEQ A;  5CM6 A;  2ZZX A;  3FXB A;  4PET A;  4XFE A;  5IGA A;  4P3L A;  4PFB A;  4MNC A;  4OVQ A;  4NQ8 A;  4N17 A;  3B50 A;  4PFI A;  2WYK A;  2XWK A;  4YZZ A;  4MCO A;  2PFY A;  2XWV A;  4PAI A;  4X04 A;  4MAG A;  4P1E A;  4P9K A;  4X8R A;  4N4U A;  4DI4 B;  2XWI A;  4MNI A;  4NN3 A;  2WYP A;  4N8Y A;  2PFZ A;  4MNP A;  4NX1 A;  4N91 A;  4PF6 A;  4NHB A;  4LN5 A;  4NF0 A;  5IZZ A;  4NAP A;  3GYY A;  4PBH A;  4PF8 A;  4PAF A;  4P1L A;  4MEV A;  4OVS A;  4PDD A;  2HZK A;  5I5P A;  4DI3 D;  4OVR A;  4O7M A;  4P47 A;  4N6K A;  5IM2 A;  2CEY A;  4N15 A;  4O94 A;  4NG7 A;  2XWO A;  4P56 A;  4UAB A;  4YIC A;  4O8M A;  2ZZW A;  4MHF A;  4PAK A;  2HZL A;  2VPO A;  2VPN A;  5I7I A;  2CEX A;  4OVT A;  4PFR A;  2XXK A;  4OA4 A;  4MMP A;  4XF5 A;  4MX6 A;  2WX9 A;  4MIJ A;  4OAN A;  4PDH A;  4N6D A;  4N8G A;  4PC9 A;  4PCD A;  2ZZV A;  2XA5 A;  4PGN A;  4NGU A;  4OVP A;  4PE3 A;  4PBQ A;  2V4C A; 
#chains in the Genus database with same CATH topology
 1LBC A;  4ELR A;  4GX6 A;  5CMM A;  1URG A;  2O1L A;  3VE1 B;  2XXY A;  4ELQ A;  1S7Y A;  4PFB A;  1EH3 A;  4ZEI A;  2ALU A;  1YTV A;  1IMB A;  2F78 A;  4DE8 A;  1RDZ A;  1GR2 A;  2B4L A;  3MZB A;  2F36 A;  4ZEC A;  3TTN A;  3EHS A;  1LBV A;  3HV1 A;  2V93 A;  4EQ7 A;  2KLF A;  3SZP A;  2Z8F A;  1FTJ A;  4G68 B;  4WXJ A;  4ZEK A;  3IOV A;  1EYK A;  4YB5 A;  3O6H A;  4AB5 A;  2UVI A;  1IXH A;  1MH4 A;  2I0C A;  1LBZ A;  1RKM A;  5DEX A;  3FXQ A;  1FTA A;  5IZZ A;  2PMS A;  3OEM A;  4IO5 A;  1P1Q A;  4X9T A;  3GBA A;  3R26 A;  4Z7E A;  3U93 A;  3A09 A;  2E0S A;  3JYR A;  1M5B A;  2Q2A A;  4O7M A;  3KZG A;  4YKI A;  2RCA A;  5ICT A;  4OYV A;  4DLD A;  1Z7M E;  4GWO A;  1FPB A;  5EHM A;  4MX6 A;  4LP2 B;  2Y7I A;  2D21 A;  2ZZV A;  1MG1 A;  3MPK A;  4GRK A;  1MS7 A;  4NF8 A;  1NUZ A;  1ELJ A;  4OZ9 A;  3E4R A;  2V25 A;  2A5T A;  2PBW A;  2DWA A;  3SEX A;  3GZG A;  3KOS A;  3D1R A;  1B7Z A;  1OLA A;  2NUV A;  3JZJ A;  2RC7 A;  5L9O A;  3MW0 A;  4DXC A;  3QUJ A;  1B0H A;  3USD A;  5KCJ B;  3FJG A;  1MDQ A;  1NV6 A;  4THI A;  3VVF A;  2Y7W A;  4I8C A;  2O51 A;  4N91 A;  5A5X A;  1B46 A;  2Y7K A;  4EF2 A;  1FQC A;  2AL5 A;  1NUX A;  1FBH A;  4GBV A;  4PF8 A;  2WEF A;  3PD9 A;  4XKP A;  4KD5 A;  3L6H A;  1USY H;  1LBW A;  3A3C A;  3M3K A;  1Y1M A;  5I2N B;  4O94 A;  5DW8 A;  4DCY A;  5CMK A;  3C34 A;  1IMA A;  1IIW A;  2GRV A;  3QUF A;  4OVT A;  1J1N A;  4OA4 A;  2O6A A;  4FIM A;  4O7I A;  4H8J A;  4QRZ A;  2Y5K A;  4OFO A;  4R74 A;  3WAF A;  2XX9 A;  5HPQ A;  1JW4 A;  4GX3 A;  2H99 A;  5H8Q B;  5T3J A;  1D4N A;  4O3C A;  1XC1 A;  1DSN A;  1QVS A;  3FVG A;  1IXC A;  1MDP 1;  2OWT A;  4KYE A;  3DP6 A;  3U94 A;  1IMC A;  3QSL A;  3ZKL A;  1QKA A;  4H67 A;  1Y9U A;  3ZS6 A;  2Z8D A;  2QVV A;  1HSE A;  3BKI B;  2DSF A;  3G3F A;  3K1M A;  4P3L A;  1FPK A;  3Q25 A;  1US4 A;  4QFL A;  3B6Q A;  1NKX A;  1FTM A;  3E13 X;  3VFJ A;  3PUY E;  4RYA A;  4WED A;  3IK6 B;  4NF6 A;  3ODB A;  1MXV A;  4MAG A;  1B7H A;  1M5F A;  4JWX A;  4FOR A;  4FEB A;  1VDW A;  5FHN A;  4EDP A;  4GOT A;  3RPW A;  1LLS A;  2R9J A;  2P2A A;  3ILU B;  4YKP A;  2XXW A;  4NHB A;  1H76 A;  4U1Z A;  2R6G E;  2F5X A;  4LN5 A;  2GQ1 A;  2QMW A;  1PC3 A;  2ESN A;  1DPE A;  1H43 A;  3VXB A;  2ZYM A;  1NV1 A;  1YAE A;  4GWX A;  4IO4 A;  5JTY B;  2O84 X;  1FQF A;  4OFL A;  3IOW A;  2ZZW A;  4PAK A;  4KR5 A;  3RTW B;  1EZ9 A;  4F31 B;  4IO3 A;  4TOZ A;  2Y84 A;  4PDH A;  3UOR A;  3I3V A;  3RYD A;  4PE5 B;  4N13 A;  3KOT A;  4Q30 B;  2CZH A;  4JSO A;  3VVE A;  4LAT A;  4FE8 A;  4KCC A;  5DVI A;  1XOC A;  3PU5 A;  3MAM A;  3IR1 A;  4NMY A;  1FRP A;  4P8B A;  5BWJ A;  2QS4 A;  3IO6 A;  2JJK A;  1WVJ A;  1DCU A;  2FBP A;  3L6G A;  5F24 A;  3KC0 A;  1H44 A;  4YB7 A;  3O2A A;  1I69 A;  2QPQ A;  3K1N A;  4KHZ E;  1LBX A;  2I6E A;  3HCQ A;  3HST A;  1FPD A;  2IEE A;  1M5D A;  4JB7 A;  5EHS A;  4PFI A;  1CNQ A;  2XWK A;  1JP4 A;  2PT2 A;  4U1O A;  2I58 A;  5CI5 A;  1DMB A;  2F6P A;  1O64 A;  1DBZ A;  3E79 A;  1GV8 A;  1MM6 A;  2ZNU A;  2CZL A;  4MBP A;  1O7T A;  4H0W A;  2XXV A;  1Y4T A;  1R6Z A;  3BBR A;  1ZIU A;  1MY1 A;  2PCR A;  3R7X A;  4LON B;  5FHM A;  4U23 A;  1O63 A;  3CSB A;  3PUV E;  2Y7P A;  3CFZ A;  1RYX A;  4GIZ A;  2QFL A;  4PAF A;  3K6X A;  2Y7R A;  2HXW A;  4I1D A;  2V84 A;  4RK2 A;  1XT8 A;  4F3G A;  1SW4 A;  3H4Z A;  1QGX A;  1MY3 A;  1Q1K A;  2X7Q A;  1FPL A;  1FBP A;  1ZJL A;  3TCG A;  4JXI A;  4N8G A;  1MY2 A;  3VDF A;  2UVH A;  1EYJ A;  5AE4 A;  3PTY A;  5EYG A;  2DE2 A;  1JET A;  5FTH A;  1FTL A;  4G2Z A;  5H8N A;  3G3J A;  4G68 A;  2O7I A;  3N94 A;  1FQA A;  4XEQ A;  1A8F A;  4H8I A;  1B5H A;  2BJI A;  3U72 A;  1MPB A;  3UGW A;  2I48 A;  2F3D A;  3IOU A;  2HFB A;  1VSO A;  1WOD A;  4BDM A;  3G3H A;  2VT5 A;  4GX4 A;  1B4H A;  4HTG A;  1N3X A;  2F7B A;  4XKQ A;  3BFT A;  5I56 B;  3FD3 A;  3TKD A;  4X04 A;  2F7A A;  1Q9D A;  4TQU Q;  3PMW A;  4OHN A;  1T0K A;  5LOM A;  1BKA A;  3OEL A;  2GFE A;  4TLL B;  2Z8E A;  3TTM A;  1INP A;  3S9M C;  2FVZ A;  2VD2 A;  3W9V A;  4JSD A;  3C36 A;  3MZ9 A;  3TQL A;  1LAF E;  1MM7 A;  4HS7 A;  3P7I A;  2FA7 A;  2D5W A;  2UYE A;  4YU0 A;  2GHA A;  3OO9 A;  2F6G A;  1LBB A;  3GLB A;  1A99 A;  4IB2 A;  3B6T A;  2DXY A;  3IX1 A;  4GF8 A;  1PBP A;  5KDT B;  1PDA A;  3TDJ A;  1MQJ A;  1OMP A;  3K02 A;  1UTB A;  4GLI A;  1B5J A;  3RGY A;  2Z22 A;  5DVJ A;  2XXH A;  1DPP A;  2CEX A;  2I0B A;  1A8E A;  2FNC A;  2F3B A;  3MVX A;  3V83 A;  5IKB A;  3OEK A;  4HW8 A;  1IZ1 A;  3QMF A;  4JWY A;  1NNF A;  3Q27 A;  3JV9 A;  1A54 A;  2UYF A;  2Q89 A;  3T9H B;  2RC9 A;  2PVU A;  2F97 A;  5I2K B;  5J16 A;  2DXR A;  2ZYK A;  4ZZE A;  3S4U A;  2RC8 A;  4HCW A;  4QXD A;  2RCB A;  2THI A;  2PT1 A;  3TTL A;  2LAO A;  5ET7 A;  4N6P A;  2XD3 A;  3MP1 A;  1KWH A;  2FYI A;  1PEB A;  3CG3 A;  5AA4 B;  1ZLQ A;  1B05 A;  3C31 A;  3U1O A;  1NV0 A;  4GL8 A;  2L5V A;  1FBG A;  3SEU A;  4F39 A;  4XKR A;  1R9L A;  3TOD A;  2XX8 A;  1AIV A;  4UA8 A;  1FTO A;  2B3B A;  1YCJ A;  2H98 A;  2W7Y A;  4GWY A;  5I58 A;  1OIB A;  1MRP A;  3S2V A;  4I9D A;  1EU8 A;  2QL3 A;  3C32 A;  4OMB A;  2XXI A;  3EHU A;  4X1B A;  4DDD A;  5FTI A;  2OLB A;  4I62 A;  3KG2 A;  3N6T A;  4P47 A;  3VLV A;  5AA2 B;  4YIC A;  4O8M A;  3T1B A;  2RIN A;  2UXA A;  2H25 A;  1N84 A;  4PFR A;  1MXX A;  1IUD A;  1F9B A;  1KZ8 A;  3S9E A;  2WKY A;  1IXI A;  3IOT A;  3G3I A;  5EQ8 A;  3RTF B;  2DE4 A;  4U4S A;  3MWB A;  1MXW A;  1NH7 A;  5TPA A;  3B6W A;  4F29 A;  4POX A;  3SDF A;  3I6V A;  1NUW A;  3E3K A;  3IFA A;  5H8F B;  1IIT A;  4BDL A;  3QAX A;  4N81 A;  3AXF A;  4L17 A;  3FUZ A;  1BP5 A;  4GL0 A;  4RNS A;  4RPO A;  2R8T A;  1SW5 A;  1QKB A;  2Q88 A;  1OVT A;  3PV0 E;  3TPA A;  1LAG E;  1RDY A;  4GWS A;  1N7X A;  4N17 A;  5TP9 A;  4KYS A;  3FVO A;  3K6V A;  3PUW E;  2B3F A;  2XXX A;  3C33 A;  3LSF B;  4P1E A;  1FBD A;  4N4U A;  1LCF A;  4GD5 A;  3C4M A;  3QK6 A;  2AYS A;  1URS A;  4NF5 B;  1VFD A;  2WYP A;  4N8Y A;  2CZI A;  1MPC A;  1TFA A;  3ISP A;  1H45 A;  5TU0 A;  2I3W A;  4YMB A;  3UN6 A;  2O69 A;  4QFK A;  1BK4 A;  2BJJ X;  1FJ6 A;  4EQ9 A;  1EZO A;  1QUK A;  1Y3N A;  4OVS A;  2M8C A;  3TEL A;  3S9N C;  4H5G A;  1P1N A;  1MQD A;  4P56 A;  1P99 A;  1FTK A;  2HZL A;  2VPO A;  3Q26 A;  4IY6 A;  2HEU A;  2XXP A;  4M1V A;  1RYO A;  4PFU A;  4QFP A;  3KGC A;  1ZTY A;  2DQV A;  2WX9 A;  2QMX A;  4N6D A;  2H5Y A;  2NWJ A;  4PCD A;  1EZP A;  4PTK A;  5ITP A;  5ET6 A;  5AA1 A;  4QFN A;  1B2H A;  4G68 C;  5H8H B;  3FV2 A;  5CMB A;  1JQF A;  1MH3 A;  1MY4 A;  4OVP A;  5IM2 A;  2HPG A;  3BFU A;  3VVD A;  1LBY A;  1D3K A;  3UIF A;  1SYI A;  1ZKB A;  1I6Q A;  1MQG A;  4GBW A;  1NL5 A;  3KBR A;  3KSJ A;  4HCY A;  2Z23 A;  1BIY A;  3FAT A;  3CHG A;  4IO7 A;  1NV2 A;  4POW A;  1IMD A;  1GVC A;  3HHG A;  3N6U A;  4YMA A;  3N26 A;  1Y3P A;  1S9T A;  3CRB A;  1NV7 A;  3HPI A;  1OVB A;  4NF4 B;  1K9Z A;  1A40 A;  3OO6 A;  1FPF A;  3PPO A;  2CZK A;  3HN0 A;  1SPI A;  4NX1 A;  4F1V A;  2P1S A;  1DTG A;  1BTJ A;  3HFU A;  1PB7 A;  4KYD A;  3FXR A;  3LSX A;  2WBD A;  2YPN A;  4C0R A;  1SI0 A;  5JK4 A;  1A7L A;  2VGQ A;  3VLW A;  4P1L A;  1AH5 A;  1YYZ A;  4BLA A;  1IXG A;  1FSA A;  5DEX B;  3TCH A;  4G8M A;  4OEN A;  3LBS A;  4KQP A;  2I4B A;  2REJ A;  3TAJ A;  4N15 A;  5F7V A;  1FPG A;  4QBA A;  1QUI A;  3T66 A;  1USY E;  3EF7 A;  1ZMG A;  2F8D A;  3QXM A;  4MLV A;  1LB8 A;  3MVW A;  4MMP A;  4ISU A;  1G0H A;  2VOZ A;  2HCA A;  4H5F A;  2I49 A;  4F18 A;  5I57 A;  1VR5 A;  1DTZ A;  2HAV A;  1Y20 A;  5DT6 A;  2DS9 A;  3RN8 A;  1I6A A;  3C9H A;  1D9V A;  3U92 A;  4PGP A;  4IO2 A;  5M2V A;  1XI6 A;  3EQ1 A;  4NF8 B;  1Z7N E;  2KR0 A;  4LZ5 A;  1N04 A;  3Q28 A;  2UVJ A;  4F22 A;  4HE0 A;  3KN3 A;  2O1M A;  4EXL A;  5L8D A;  2WYK A;  5EQA A;  2ZMB A;  1NFT A;  1UQW A;  4X1D A;  1YZ0 A;  1MPD A;  3IO4 A;  3MVZ A;  3CFL A;  3RPL A;  3IB1 A;  2DYX A;  1D9Y A;  4X48 A;  3RY3 A;  3Q29 A;  4ND9 A;  2V3U A;  3VV5 A;  2REG A;  5K2Y A;  2PYY A;  1FQE A;  5HBC A;  5B70 A;  2NXO A;  3KJ7 A;  1JVX A;  1B3L A;  1MY0 A;  4U2R A;  3IB2 A;  5H8S A;  1URD A;  1M5C A;  1H3D A;  2F34 A;  3O6I A;  4QF9 A;  3T96 B;  3LSW A;  4G61 A;  2ONS A;  2X26 A;  3WAE A;  3LV0 A;  1NNT A;  3M3F A;  4R6Y A;  4H65 A;  1YPN A;  4EUO A;  1EYI A;  3O29 A;  3H6V A;  3DLN A;  1NV3 A;  1ZU0 A;  3M8U A;  4RA1 A;  5IZ1 A;  1SI1 A;  2P3V A;  2DOJ A;  4R9F A;  5AA4 A;  3THI A;  1PBQ A;  3GXA A;  4G8N A;  1B58 A;  1GTK A;  4PE3 A;  5JEI A;  4GQO A;  2DWJ A;  3FGS A;  2OJT A;  3T22 A;  5LTC A;  2ZZX A;  3PPN A;  4PET A;  1Y1Z A;  5ICQ A;  1AL3 A;  1GGG A;  1IQ7 A;  5ET8 A;  4GWU A;  4G8H A;  4F3S A;  3TCF A;  1SDX A;  1B3F A;  3N5L A;  4LZ8 A;  2OZZ A;  2DWH A;  3T9X B;  5IAI A;  2PX1 A;  4MJO A;  3U8Q A;  4YZZ A;  1RDX A;  1NNK A;  2PFY A;  3CFX A;  4H6D A;  1TXF A;  3RUM A;  4R6K A;  3KSX A;  4G77 A;  5EQ7 A;  4NF6 B;  3MJN A;  3MP6 A;  4NED A;  3DP4 A;  4WEP A;  1QW0 A;  3IFC A;  4NF0 A;  1NNP A;  4JDF A;  4PBH A;  1TT1 A;  3TQW A;  4F2O A;  5HM4 B;  3UA8 A;  5FHO A;  5BUU A;  2QS2 A;  4DI3 D;  5ISU A;  1DOT A;  1B3G A;  1UTH B;  4Z0I A;  5H8F A;  1BLF A;  3H06 B;  1N7W A;  4R73 A;  3FZV A;  3KN7 A;  4RJZ A;  3IAZ A;  4R2F A;  3FIR A;  3GBB A;  3V5A A;  2XXK A;  5LDZ A;  4GXS B;  1B40 A;  4YB6 A;  5B7D A;  3K0V A;  3OSQ A;  4PFT A;  3CG1 A;  4OAN A;  1MXY A;  1B51 A;  1SVX B;  4MLQ A;  4NGU A;  3TEP A;  1FW0 A;  4GXA A;  4NWD A;  3FV1 A;  4NWC A;  3EKI A;  4NF5 A;  2NOO A;  1B0L A;  3D4C A;  1UIV A;  2MKZ A;  4C1U A;  5I59 B;  4QSE A;  4JVI A;  3T9U A;  3FJM A;  3OO7 A;  4EXK A;  4QFO A;  3SEV A;  2DE3 A;  3FBP A;  2G29 A;  1TFD A;  1B52 A;  4U4X A;  5KCJ A;  2OWS A;  3VXC A;  4AQ4 A;  4PAI A;  3KEI A;  2QVU A;  2YLN A;  1P1U A;  3OSR A;  3HHF A;  2OX3 A;  4FAT A;  5K2X A;  1FBE A;  1FJ9 A;  1R9Q A;  4AB6 A;  1JNF A;  5I2N A;  5A5L A;  4JVC A;  2XXR A;  2QSX A;  3FXU A;  4OET A;  3K2D A;  1MXZ A;  3CVG A;  2DWI A;  4HE2 A;  4LZ7 A;  1UIU A;  2VPN A;  3K6W A;  4OES A;  3FVK A;  4R72 A;  5H8Q A;  4OTE A;  3PMX A;  3SEW A;  4LUB A;  2OBG A;  1MQI A;  1I6B A;  1NI9 A;  2ANJ A;  3V8X B;  1JW1 A;  1US5 A;  2ZYO A;  4E0W A;  3SKP A;  3H3G A;  5IZ3 B;  3PD8 A;  4XTC Q;  4F1U A;  4NF4 A;  3ONM A;  2IA4 A;  1K9Y A;  4F19 A;  5CM6 A;  1HSL A;  1XVY A;  3FXB A;  4XFE A;  2DDK A;  3H6U A;  4XKN A;  4FJP A;  4IGR A;  5H8N B;  1M5E A;  4MNC A;  1QJM A;  3PUX E;  1FPJ A;  4I3E A;  3W9W A;  4MF3 A;  1LFI A;  2XXQ A;  1FQB A;  1IME A;  3G3G A;  1B5I A;  4DCX A;  4FBP A;  1SBP A;  3G3K A;  3FAS A;  1NH8 A;  3TYH A;  4Q0C A;  3E78 A;  4F2Q A;  2V3Q A;  1B32 A;  5KZT A;  3RT6 B;  1P1W A;  3B7D A;  3B8B A;  3R6U A;  3O97 A;  4OFJ A;  1MQH A;  5JTY A;  3SES A;  4IR8 A;  2QVR A;  1R1N A;  1WDN A;  4F1Y A;  1HSJ A;  4MHF A;  2NVU B;  3BIG A;  4F3B A;  1UTB B;  4EQB A;  1KA1 A;  3HO7 A;  1LST A;  4GWZ A;  5CRY A;  3K6U A;  1B3E A;  3LUZ A;  2XXT A;  3LSL A;  4IO6 A;  4PBQ A;  1B3H A;  3VLU A;  4NE4 A;  1P1O A;  2Q74 A;  3CSG A;  1Y4C A;  2DVC A;  4ZDM A;  3ROJ A;  4R2B A;  1ZBM A;  1NUY A;  1FBF A;  3S9L C;  1JEV A;  4QSD A;  2ABH A;  4U22 A;  2V3T A;  3T9V A;  3K4U A;  4DZ1 A;  1II5 A;  3NOH A;  2HQ0 A;  4DIG A;  4BDO A;  3PUZ E;  2P0S A;  4P9K A;  3F11 A;  2AIX A;  3ZSF A;  4C1T A;  4QSC A;  4ZZA A;  2O7U A;  1IMF A;  2PFZ A;  4MNP A;  4DXB A;  4PFY A;  4NTL A;  5CBS A;  1CE2 A;  3C35 A;  4PF6 A;  2ZNT A;  1OQG A;  4G4P A;  1B1H A;  1S50 A;  4GWW A;  3OXN A;  3OD7 A;  3SEY A;  2VD3 A;  4O3A A;  4I3Y A;  3EHT A;  5I58 B;  3PMV A;  1D9Q A;  1FCK A;  1VFE A;  4I40 A;  3TUS A;  2Q9T A;  4ZE9 A;  4ZS9 A;  1OLC A;  2XXU A;  1JVY A;  4OWD A;  3T93 B;  5ESY A;  3DM0 A;  2HAU A;  2XHD A;  3O6G A;  1SD3 A;  1IEJ A;  3PPP A;  2UVG A;  3MC2 A;  3ZKK A;  3W15 C;  1KA0 A;  4YAH X;  3M3L A;  2GHB A;  3LR1 A;  4ZE8 A;  4PGN A;  4JBZ A;  1LGB C;  2HHM A;  4FAJ A;  3D4G A;  5DVF A;  3DEL B;  4AS4 A;  1POT A;  2VHA A;  5AA2 D;  4E0X A;  4GVO A;  2OCU A;  3OO8 A;  2FIE A;  5TPA B;  4OQO A;  4KI0 E;  4OVJ A;  5IGA A;  5EYH A;  1B6H A;  4R6H A;  3OEN A;  1OQH A;  5L9S A;  5I56 A;  3H7M A;  4LQ2 A;  2RF1 A;  2B65 A;  3RLF E;  1UTH A;  3PPR A;  3SER A;  2ZXT A;  2QS1 A;  4TLM B;  4X8R A;  2ONR A;  5TP9 B;  4DI4 B;  4YKJ A;  5CBR A;  4Q5T A;  4MNI A;  2F7C A;  1Q35 A;  2A5S A;  3MP8 A;  1NMU A;  4LVQ A;  3OMB A;  2P3N A;  3TTR A;  2ONK E;  2A5T B;  1LFG A;  4R9G A;  5CC2 A;  1B7U A;  3CIJ A;  4ECF A;  1N76 A;  3GYY A;  3G7W A;  5KDT A;  1AMF A;  4HXV A;  5EQ9 A;  3IL1 B;  3MST A;  3TMG A;  4Q8R A;  2X7P A;  4PDD A;  2HZK A;  5I5P A;  5L9M A;  1A55 A;  1FQD A;  5FBP A;  4OVR A;  3UK4 A;  4UAC A;  2FHY A;  2XWO A;  2GH9 A;  5I59 A;  3H6W A;  4ZEF A;  4P11 A;  4FEC A;  3MUQ A;  5I7I A;  1SQY A;  4JVD A;  4OXV A;  2I3V A;  3T0J A;  3O66 A;  5A5X B;  4MIJ A;  2ZYN A;  4H45 A;  4BDQ A;  1NV4 A;  1JEU A;  3CR9 A;  5ET5 A;  3IJX B;  4M4G A;  4YKK A;  3PGF A;  5I3S A;  5I2K A;  5AA3 A;  3IJO B;  3QYT A;  3CI8 A;  2I4C A;  3IOR A;  3TTK A;  5I84 A;  4FED A;  3DP8 A;  3K1P A;  4OEV A;  1LAX A;  3K00 A;  4ZED A;  3MBP A;  4GFR A;  4NQ8 A;  1AWB A;  3KFM A;  1B9J A;  1LAH E;  3MPL A;  4KPT A;  4ESX A;  2XX7 A;  1YXI A;  3KN8 A;  3FJ7 A;  4PFW A;  4OEU A;  2DVZ A;  2XWV A;  4XIG Q;  3PPQ A;  4RY1 A;  5CMC A;  3K01 A;  4H46 A;  4XXU A;  1PB9 A;  5EYF A;  4AS5 A;  2WBB A;  4NN3 A;  5F1Q A;  4F3P A;  3E9X A;  2Q8M A;  4BDN A;  4KFQ A;  1DK4 A;  4ZEB A;  3RNN A;  1SW1 A;  2F35 A;  3MYU A;  3LUY A;  1QUL A;  5AA2 A;  5IZ3 A;  4LQ5 A;  3MVY A;  3O9P A;  3IB0 A;  2O68 A;  4ONY A;  3QIM A;  4O3B A;  4N6K A;  4OER A;  1LEV A;  4KXP A;  4P0G A;  2XD2 A;  3RT8 A;  4N07 A;  3TZA A;  3A3U A;  1JW5 A;  4HE1 A;  4P0I A;  4JWO A;  1N3W A;  4EF1 A;  4XF5 A;  1NV5 A;  2D3I A;  3ECR A;  1POY 1;  4DXU A;  4MFI A;  2H9B A;  1B4Z A;  1PB8 A;  2E1S A;  4MH5 A;  5ITO A;  4RXL A;  2Q2C A;  1LB9 A;  4WKM A;  1ATG A;  4H1X A;  1MXU A;  4BDR A;  1LCT A;  2OWZ A;  1SYH A;  3MZ1 A;  2V4C A;  5J1D A;  5I57 B;  2QJE A;  3U65 A;  3ILT B;  1CB6 A;  3TFL A;  5DYH A;  4QHQ A;  3LC8 A;  4ELO A;  2H4I A;  4RPN A;  5ELV A;  3V89 B;  4ESW A;  3MQ9 A;  3EN3 A;  1XVX A;  1QUJ A;  4OVQ A;  1ANF A;  2FIX A;  4IY5 A;  2G93 A;  3FVN A;  3B50 A;  4IGT A;  4PQJ A;  4MCO A;  3RQT A;  2XWI A;  2QS3 A;  1FBC A;  3BIH A;  3KBZ A;  2Y5L A;  1Y3Q A;  3OOA A;  2B4M A;  2AL4 A;  2DP8 A;  2CMO A;  2QRY A;  1VE4 A;  2RKM A;  4ELP A;  3EPE A;  2HXR A;  3RPL B;  2VP1 A;  4K3F A;  1N0T A;  2Q8J A;  4NAP A;  3KJT A;  1XS5 A;  4MEV A;  4PP0 A;  1G0I A;  1LFH A;  1SW2 A;  2R71 A;  1L5T A;  2KQZ A;  2CEY A;  4NG7 A;  5DTB A;  2OK2 A;  4R75 A;  4UAB A;  3UP9 A;  3I5O A;  4RK9 A;  3A29 A;  1FPE A;  1FPI A;  4KCD A;  1TWY A;  3SET A;  5H8H A;  3H03 A;  3H6T A;  1AOV A;  4PC9 A;  2YJP A;  4U21 A;  2XA5 A;  1B1X A;  2ZNS A;  4LA9 A;  1XHY A;  3O28 A;  3KC1 A; 
#chains in the Genus database with same CATH homology
 2Q74 A;  4GX6 A;  4PGP A;  4XEQ A;  1XI6 A;  3ROJ A;  2BJI A;  2F3D A;  1NUY A;  1FBF A;  4PFB A;  2KR0 A;  1IMB A;  2VT5 A;  4HE0 A;  3NOH A;  1RDZ A;  4GX4 A;  2WYK A;  5EQA A;  2B4L A;  1YZ0 A;  4X04 A;  4P9K A;  1LBV A;  1Q9D A;  3SZP A;  3RPL A;  1IMF A;  2PFZ A;  4MNP A;  1EYK A;  1INP A;  4PF6 A;  2FVZ A;  3W9V A;  1LBZ A;  1FTA A;  5IZZ A;  4GWW A;  4X9T A;  4I3Y A;  1D9Q A;  4I40 A;  2Q9T A;  4G61 A;  4O7M A;  3LV0 A;  1EYI A;  5ESY A;  1NV3 A;  2CEX A;  5IZ1 A;  2P3V A;  1FPB A;  1KA0 A;  2F3B A;  4MX6 A;  2ZZV A;  3QMF A;  4PGN A;  2HHM A;  4PE3 A;  1NUZ A;  4AS4 A;  5J16 A;  5LTC A;  2FIE A;  2ZZX A;  4PET A;  4HCW A;  4QXD A;  5IGA A;  5ET8 A;  4GWU A;  5EYH A;  3D1R A;  5ET7 A;  4MJO A;  4YZZ A;  1RDX A;  2PFY A;  1NV0 A;  2L5V A;  4X8R A;  4DI4 B;  1FBG A;  4MNI A;  5EQ7 A;  2P3N A;  1NV6 A;  4N91 A;  4GWY A;  3IFC A;  4NF0 A;  1NUX A;  1FBH A;  4GBV A;  3GYY A;  4PBH A;  4PF8 A;  4HXV A;  2WEF A;  5EQ9 A;  3MST A;  4PDD A;  2HZK A;  5I5P A;  4DI3 D;  1LBW A;  5FBP A;  4OVR A;  4P47 A;  2FHY A;  4O94 A;  2XWO A;  5DW8 A;  4YIC A;  4O8M A;  3T1B A;  1IMA A;  5I7I A;  4JVD A;  4OVT A;  4PFR A;  2XXK A;  4OA4 A;  5LDZ A;  1KZ8 A;  4O7I A;  3T0J A;  4MIJ A;  2Y5K A;  4OAN A;  4H45 A;  1NV4 A;  5EQ8 A;  4GX3 A;  2DE4 A;  5ET5 A;  5T3J A;  5I3S A;  4NGU A;  3EKI A;  1NUW A;  1IMC A;  3IFA A;  2MKZ A;  4N81 A;  4JVI A;  2QVV A;  4P3L A;  1FPK A;  2R8T A;  4NQ8 A;  1AWB A;  1RDY A;  2DE3 A;  3FBP A;  4GWS A;  4N17 A;  1YXI A;  2DVZ A;  2XWV A;  4PAI A;  4MAG A;  4P1E A;  1FBD A;  4N4U A;  1VDW A;  4H46 A;  4AS5 A;  2QVU A;  2WBB A;  4NN3 A;  2WYP A;  4N8Y A;  2CZI A;  2OX3 A;  3ISP A;  2Q8M A;  1FBE A;  1FJ9 A;  4NHB A;  1DK4 A;  2F5X A;  4LN5 A;  2GQ1 A;  1BK4 A;  3MYU A;  1FJ6 A;  5IZ3 A;  5A5L A;  4OVS A;  4JVC A;  1NV1 A;  4GWX A;  4N6K A;  1LEV A;  4KXP A;  4P56 A;  4HE2 A;  2ZZW A;  4PAK A;  2HZL A;  2VPO A;  2VPN A;  4M1V A;  4HE1 A;  4XF5 A;  1NV5 A;  2WX9 A;  4PDH A;  4N6D A;  3RYD A;  1NI9 A;  4PCD A;  4PTK A;  5ET6 A;  2CZH A;  5IZ3 B;  4OVP A;  2OWZ A;  5IM2 A;  2V4C A;  5J1D A;  4F1U A;  2HPG A;  3U65 A;  1FRP A;  4P8B A;  1K9Y A;  4F19 A;  5CM6 A;  3FXB A;  4XFE A;  2DDK A;  2JJK A;  1DCU A;  2FBP A;  5F24 A;  3KC0 A;  1LBY A;  4MNC A;  4OVQ A;  4GBW A;  2QPQ A;  2FIX A;  1FPJ A;  1LBX A;  4HCY A;  4I3E A;  3W9W A;  1FPD A;  3CHG A;  1NV2 A;  3B50 A;  4PFI A;  1IME A;  1CNQ A;  2XWK A;  1IMD A;  1JP4 A;  4MCO A;  1DBZ A;  4FBP A;  3E79 A;  2XWI A;  1NV7 A;  3E78 A;  1FBC A;  3BIH A;  1K9Z A;  3KBZ A;  1FPF A;  2Y5L A;  2CZK A;  2B4M A;  2V3Q A;  1SPI A;  4NX1 A;  4F1V A;  3HFU A;  2HXR A;  3RPL B;  2PCR A;  2WBD A;  3B8B A;  4NAP A;  5JK4 A;  2QFL A;  4PAF A;  4P1L A;  1YYZ A;  1FSA A;  4MEV A;  4IR8 A;  1G0I A;  2QVR A;  2KQZ A;  2CEY A;  4N15 A;  4NG7 A;  4UAB A;  1QGX A;  1FPG A;  4MHF A;  3BIG A;  4QBA A;  3A29 A;  1FPE A;  1FPL A;  1FBP A;  1FPI A;  4MMP A;  1G0H A;  4N8G A;  4PC9 A;  1KA1 A;  1EYJ A;  3PTY A;  4GWZ A;  5EYG A;  4F18 A;  2XA5 A;  2DE2 A;  3LUZ A;  3KC1 A;  4PBQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...