4MEVA

Crystal structure of a trap periplasmic solute binding protein from rhodoferax ferrireducens (rfer_1840), target efi-510211, with bound malonate, space group i422
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
311
structure length
311
Chain Sequence
SALKISHQFPGGTIKEGDFRDRLVRNFAAEVEKRSKGAMKFEIYPGSSLMKTNAQFSSMRKGALDMALIPLSYAGGEVPELNIGLMPGLVVSYEQAYSWKTKPVGIELTRVLQEKGIVLISWIWQAGGVASRGKPVVEPEDAKGMKIRGGSREMDMILKDAGAAVVSLPSNEIYAAMQTGAMDAAMTSSTSFISFRLEEVAKALTTGRTGAYWFMFEPLMMSKAIFDKLPKDQRDMLMTVGAEMEKFALEAAKKDDIDVAAVYQKAGAKVVDLSDGTIKKWQDIARKTAWKDYGAKNEGCAKLLALAQQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords TRAP dicarboxylate transporter-DctP subunit
publication title Experimental strategies for functional annotation and metabolism discovery: targeted screening of solute binding proteins and unbiased panning of metabolomes.
pubmed doi rcsb
source organism Rhodoferax ferrireducens
total genus 116
structure length 311
sequence length 311
ec nomenclature
pdb deposition date 2013-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4mevA00
2WX9A 2CEYA 4PE3A 4PFIA 4O94A 4NX1A 3GYYA 4OVRA 4NHBA 4X8RA 4P8BA 4OANA 4NG7A 2PFZA 4MNIA 4PGPA 4P56A 3U65A 4XF5A 4PFRA 4OVPA 4PC9A 4PDHA 4MMPA 4P1EA 2VPOA 4N6DA 5CM6A 5I5PA 4X04A 4OVQA 4PF6A 4MNPA 4OVSA 4PETA 2ZZVA 4N6KA 2VPNA 2XWVA 2CEXA 4PCDA 4MX6A 4PBQA 4DI3D 4YZZA 4NF0A 5IM2A 4OA4A 4P3LA 5IZZA 5IGAA 4OVTA 4N4UA 4NGUA 5LTCA 2HPGA 4PDDA 4MEVA 4P9KA 5I7IA 4LN5A 4P47A 4N8GA 2XWOA 4N17A 2ZZXA 4PGNA 2V4CA 4PF8A 4NN3A 3FXBA 4MHFA 4MCOA 4MAGA 2XA5A 4N8YA 4UABA 2WYKA 2WYPA 4O7MA 4XFEA 4MIJA 2XWIA 2PFYA 4MNCA 4PBHA 2HZLA 4P1LA 4PFBA 2XXKA 4N15A 2ZZWA 4N91A 4PAFA 3B50A 2HZKA 4NQ8A 2XWKA 4XEQA 4DI4B 4PAKA 4PAIA 4NAPA 4O8MA 4YICA
chains in the Genus database with same CATH superfamily
1NFTA 3TZAA 3FD3A 3PPRA 1FPJA 4PFYA 1GR2A 5I59A 3E4RA 3D4CA 4PFRA 1OIBA 3ILUB 2XXVA 3V5AA 4QXDA 4PF6A 2WBDA 4I62A 2ABHA 5LDZA 4C1TA 2XWVA 1MY3A 3TKDA 4YAHX 3IOWA 3A3CA 2QPQA 4P3LA 3K1MA 5ICTA 4KFQA 2ZYNA 3FIRA 3K6UA 4NE4A 5L9SA 4F2OA 4F22A 1IXCA 2QVRA 1QVSA 1FPIA 3W9VA 3VFJA 5A5LA 1O63A 3S4UA 4P0IA 2XWIA 1MY2A 5TPAB 4ZEIA 4XKQA 3PMVA 2KR0A 1LAGE 2IEEA 3PUYE 4NQ8A 2HAUA 3T9VA 1MDQA 2F3DA 4XEQA 1FBGA 1NUYA 3TCHA 3K02A 5AA2D 1B3FA 1H43A 2O68A 1XS5A 2F8DA 3MP8A 1TXFA 3ILTB 4G8NA 4JB7A 3H4ZA 3FXUA 3MWBA 1S50A 4KCDA 1OQGA 3LUYA 3E3KA 2Q74A 3RYDA 2O69A 1KA0A 3FXRA 1AMFA 1GTKA 1NNPA 3FVKA 3PPQA 2ZNTA 4DE8A 3RUMA 5TPAA 2DDKA 4PCDA 1FRPA 4QHQA 2Q8MA 5H8NB 3MPLA 5ET6A 3O6GA 1FW0A 4OFOA 3LBSA 5FHNA 4OA4A 4N4UA 1UIUA 3OEMA 5FTIA 2XWOA 5H8HB 2XX8A 3TTLA 1URSA 3PUZE 4F3BA 3C31A 3KSJA 2E1SA 1JEUA 1HSEA 5AE4A 2FHYA 1AIVA 1NNFA 1JP4A 4I3EA 5DVJA 1ANFA 4EUOA 1MQIA 3LSWA 3H7MA 3VXCA 2ZYKA 3SEVA 3M3KA 2XD3A 2YPNA 3SEXA 1FSAA 4R72A 1WVJA 1FPEA 2RCAA 4LONB 1ZU0A 3RTFB 1CE2A 1LBVA 5H8NA 3QYTA 2FIXA 2AL5A 1H76A 3MW0A 4PAIA 2VD2A 2Y7WA 3IB2A 4U2RA 1B58A 4DLDA 1B40A 1B7UA 1FPLA 5H8HA 2DVZA 4NG7A 2QMWA 1BTJA 3UK4A 4HW8A 1QGXA 3TAJA 2QVUA 4Z0IA 4GWZA 1FPKA 2HHMA 1EYKA 2Q88A 1MS7A 2F36A 3K6XA 1UQWA 2GRVA 5BUUA 3R6UA 3GBBA 2HAVA 3G3KA 4X48A 2WEFA 1ZMGA 3FVOA 4PBQA 3VLVA 3PD9A 4KYDA 4YZZA 1A7LA 5IKBA 3KFMA 4GIZA 1JVYA 4FECA 2FIEA 3V8XB 3C9HA 3ZKKA 1VFDA 4YU0A 3ZKLA 3O6HA 1EYIA 3JV9A 3KOSA 3ODBA 3Q28A 2I3VA 2FA7A 1USYE 3A29A 4UABA 3OD7A 1XOCA 3PGFA 1YCJA 1BKAA 2HCAA 2V3UA 4OENA 5F1QA 1G0IA 1Z7NE 4PFBA 1BK4A 3KJTA 3HN0A 1IMBA 1USYH 2Z23A 3B50A 3BBRA 3KN3A 3K4UA 2XWKA 3TPAA 2XXHA 5ET7A 3PPOA 4DI4B 2THIA 3IFAA 4KYEA 1Y3NA 4ZZAA 4YICA 4TLLB 3MSTA 4GWWA 3T9HB 3CHGA 4MFIA 4PE3A 4EQBA 4DXUA 1MG1A 1YTVA 4G2ZA 3M3LA 3G3HA 4XXUA 2ONSA 4NF4B 4R74A 4QF9A 3O28A 4LA9A 1XHYA 3KBZA 4OVQA 4JWXA 3CI8A 5I58B 4GLIA 2DP8A 4RYAA 2CEXA 2D5WA 4IGTA 5AA2A 3PPNA 4QFKA 1MXYA 2I4CA 3U93A 1JNFA 1PC3A 4ZECA 3DP8A 5IZ3B 5LTCA 1WODA 4DDDA 1XVYA 2L5VA 3SDFA 2F78A 3ZSFA 3G3IA 2F6PA 3GZGA 3N5LA 4E0XA 4N81A 1BLFA 2WKYA 5I2KB 3O66A 3Q25A 2UVHA 4PF8A 2QS4A 3FV1A 3RGYA 4AS5A 3N94A 4M4GA 4YB7A 3WAFA 4R6KA 4G4PA 4IO6A 4NF4A 1TFAA 3KSXA 3MP1A 4IR8A 1VSOA 3WAEA 5K2XA 1B51A 1NV3A 1LGBC 1Q9DA 2ONRA 3O9PA 1Q35A 3IL1B 3T1BA 2RKMA 3Q29A 2NOOA 1NV1A 5M2VA 5ITOA 4BDRA 4H1XA 1SI0A 4KYSA 5DEXB 3CVGA 5IZ3A 3UIFA 5B7DA 2GQ1A 3M8UA 2V25A 2E0SA 1FTOA 2I6EA 4QRZA 2R9JA 2RCBA 4KQPA 4TLMB 5I2KA 1M5CA 1RDYA 1OLAA 3O6IA 4LP2B 5I5PA 1K9ZA 4H67A 1SDXA 3QXMA 3C35A 3I6VA 2VPNA 3IB1A 4GWXA 1I6BA 4F18A 5FHOA 4H46A 2ESNA 2OWSA 1POY1 2QJEA 4FEDA 4PDDA 4ZE8A 3VDFA 1FPGA 5DEXA 3IB0A 4F39A 2VGQA 5I7IA 1HSJA 4QSEA 2O1MA 1NNKA 4GWUA 5EQ8A 3MZBA 4R6YA 2B65A 5BWJA 2ZYMA 3FATA 1Y3PA 4OFLA 4WXJA 2XA5A 4POXA 1B2HA 3TUSA 3OXNA 3TCFA 3HSTA 1QKBA 4BDLA 5DTBA 1URDA 1P1WA 3N6UA 5TU0A 4F3GA 1MY4A 5ESYA 4FAJA 1FJ9A 1FTJA 2X7QA 4MF3A 4OERA 4ESXA 4FEBA 5I59B 1I6AA 1FQFA 3C36A 1L5TA 4UACA 3BFUA 4EXLA 3T0JA 1CNQA 3H03A 2O84X 2G93A 4I1DA 4YKKA 1DPEA 2WX9A 3GYYA 4NHBA 3HPIA 2P3NA 4MNIA 3OENA 2I48A 4PGPA 1Z7ME 3IOTA 1P1QA 3FJ7A 4OQOA 3U94A 4R75A 1DSNA 2OCUA 1I69A 1VDWA 1R6ZA 3PUVE 4N6DA 4JWYA 4ELPA 4PETA 4Q0CA 1OVBA 4C0RA 1SW1A 3K00A 3TELA 3H6TA 1MQGA 4IGRA 3RN8A 1MQJA 2FNCA 3EF7A 1D9QA 3FGSA 2DWIA 3LUZA 1ATGA 2DYXA 1LBCA 1MH3A 1ZKBA 5DT6A 3OEKA 4DCXA 3IO4A 2P2AA 3QIMA 4TQUQ 1G0HA 3GBAA 5L9MA 3QAXA 5DYHA 4LZ8A 4RA1A 1MPDA 1ZBMA 1EYJA 2RF1A 2LAOA 4NMYA 2HZLA 3G3FA 3RNNA 3HHFA 3PPPA 5EQ9A 4KHZE 2F5XA 4OVJA 1B5IA 1JQFA 1Y9UA 4LATA 4RJZA 3RPWA 4AQ4A 4C1UA 4F3SA 1SYIA 3L6HA 2O6AA 3MBPA 3A09A 4NAPA 4Q5TA 2Y7KA 3EKIA 5J16A 4YMAA 1A8FA 4G8MA 4ECFA 4N6PA 1YAEA 3RY3A 4OANA 1FQEA 1NV0A 3E9XA 3PD8A 1B9JA 2CZLA 1O64A 4XF5A 1B5JA 4R9FA 5JTYB 3TTKA 1RDZA 3KZGA 1XT8A 3E13X 1JETA 3OO9A 3TTRA 1UTHB 3E78A 1O7TA 3CFXA 1JW4A 3FUZA 4NF8B 3MC2A 4E0WA 1KA1A 3C4MA 1NUWA 4LUBA 4KR5A 1OQHA 1WDNA 3B6TA 4YKPA 2RINA 3MVXA 2NUVA 1Y4CA 2HPGA 3QK6A 2R71A 2Y7RA 3SEUA 2O7UA 1FPDA 2B3BA 4P47A 3D1RA 2MKZA 5F24A 1N04A 3THIA 3KN7A 3TMGA 4N8YA 1QW0A 1MY1A 2PYYA 3PUWE 2WYPA 4O7MA 3T22A 4LQ5A 5JTYA 3EN3A 4U1ZA 3FV2A 4KXPA 1PB9A 1UTHA 4ZZEA 1DTGA 2OLBA 4NF8A 1PB8A 4BLAA 1MXVA 1Y20A 5J1DA 5CBRA 3T66A 4Z7EA 3PMWA 3UGWA 4EQ7A 5I84A 1B7HA 1VE4A 3VVFA 3VLWA 2M8CA 5HBCA 4R2BA 2H99A 2RC7A 4X8RA 4HE1A 3HV1A 4IB2A 3KN8A 4DCYA 2I3WA 1T0KA 4BDNA 4XTCQ 1JW5A 3C33A 2QVVA 3KG2A 4JXIA 1IUDA 1FBPA 3AXFA 1SYHA 4WEPA 4NWCA 1P1NA 2ZYOA 2DXRA 1R9QA 4ELRA 2UVIA 3EHUA 2Q2AA 2HEUA 4PQJA 3T93B 4WEDA 4HXVA 3LR1A 1NNTA 3B7DA 1US4A 2V3TA 4U4SA 1IXIA 4NTLA 1MXZA 3MUQA 4O7IA 1FBEA 4HCYA 3A3UA 1LFIA 2F7BA 3SZPA 2HQ0A 5ET8A 1ZLQA 5L9OA 2AL4A 2RC8A 4PP0A 4IO2A 1NV4A 1IEJA 2VHAA 4R73A 2REJA 2P3VA 2B4MA 2PT2A 4P1LA 3LSFB 5FBPA 1D3KA 3RT8A 2XXKA 3CR9A 3FZVA 4GXSB 2O1LA 4GWOA 2KLFA 3Q26A 1UTBB 3HHGA 3I5OA 1FQBA 5CC2A 4GBWA 2OZZA 2GHBA 4JVDA 4RY1A 3Q27A 1QJMA 2YLNA 3IX1A 4NF5A 4BDQA 4U23A 4JSDA 3SEYA 4O3BA 1IXGA 5CI5A 4QSCA 2QFLA 1FTKA 1LBYA 4LZ5A 1H44A 1EU8A 4Q8RA 5AA2B 2DWAA 4IO3A 2PFZA 4P56A 2ZNSA 3U65A 4ELOA 1IMDA 2VP1A 4OVPA 1QUJA 1FTMA 2I0CA 2H25A 2A5SA 3CG3A 3K1PA 4JSOA 1LAHE 3KGCA 2DE3A 2DVCA 1UTBA 3DELB 2CZKA 1B0LA 4MBPA 3DP6A 1LB8A 1D9VA 2V93A 2O7IA 3S9MC 1FBCA 3H6VA 4GWYA 3OMBA 1BIYA 4OZ9A 4QFPA 3R26A 5A5XB 3FVNA 2ZMBA 2DWHA 4L17A 4N8GA 2OJTA 2GFEA 2W7YA 4JDFA 4EXKA 5EHSA 4H6DA 4OETA 1FTAA 1ZJLA 2HXRA 4AB6A 3EHSA 1MPCA 2X7PA 4P11A 1B3GA 1GVCA 1MDP1 5CBSA 4N15A 1AH5A 4PAFA 5ITPA 4R2FA 1PBQA 2F35A 3RTWB 4GX3A 2GHAA 4GX4A 5H8QB 3KC0A 3ECRA 2OX3A 2D21A 5A5XA 1TWYA 4I3YA 2DQVA 4F1UA 1IXHA 5EQ7A 4OMBA 4ZEFA 4RPOA 3FBPA 5HM4B 3O29A 4XKPA 5TP9A 1B32A 4PDHA 5JK4A 2O51A 4X1DA 2PVUA 2H4IA 2F7AA 3R7XA 1K9YA 4NEDA 2HXWA 3G3JA 1MQHA 1DOTA 2QRYA 2ZNUA 3BFTA 1EZOA 5H8QA 1XVXA 1US5A 1FPFA 1MH4A 2G29A 4N17A 1EZPA 1AL3A 3DP4A 4KI0E 2F97A 1PB7A 4OWDA 2B3FA 1NMUA 3EQ1A 4QBAA 1FTLA 5I57B 1B5HA 4ZEDA 3HO7A 5KZTA 3HCQA 2AIXA 2ZXTA 5EYHA 4WKMA 4GD5A 1IITA 1HSLA 3C34A 2ZZWA 1MM7A 4BDMA 2PMSA 1P1OA 3U8QA 4H8JA 3G7WA 1Y1MA 3H3GA 3PUXE 2HFBA 4GRKA 4U4XA 1LCTA 1SPIA 3VE1B 3B8BA 3NOHA 3KJ7A 3UORA 1NUZA 1IQ7A 1N76A 1DPPA 1YPNA 3PTYA 3V83A 3U72A 3TDJA 4FIMA 4O94A 1A99A 2Y5KA 4P8BA 4G8HA 3RPLB 2A5TA 4Q30B 5DVFA 3KBRA 1JVXA 1NH8A 3IORA 2H9BA 1B1XA 3FVGA 3V89B 4MMPA 5CRYA 2V84A 4ZEBA 3DM0A 5I2NB 4LZ7A 5I57A 3RLFE 1IMAA 4RXLA 1B52A 4N6KA 3TQLA 1QKAA 2QS2A 4ZDMA 1DTZA 4RNSA 1RYXA 1TT1A 2ALUA 4KPTA 2Y7IA 2P1SA 1A55A 5FHMA 3E79A 5ET5A 2AYSA 4OESA 4DXCA 5AA1A 1XC1A 2R8TA 1H45A 5B70A 1SD3A 3T9UA 4LVQA 1LSTA 2NXOA 5EYGA 4PGNA 3K6VA 3MP6A 3CG1A 5JEIA 3RPLA 4MAGA 3T9XB 1IIWA 5ELVA 3G3GA 1N3WA 2WYKA 2F7CA 3IK6B 1XI6A 3FASA 3K0VA 3OO8A 4U1OA 4OHNA 5I2NA 4EF2A 1FJ6A 1JW1A 3S2VA 2YJPA 3H6UA 2Y5LA 1B3HA 3N26A 3JYRA 2QS1A 2Z8EA 4JWOA 1A40A 1SQYA 1FQAA 2H98A 4ZE9A 4FJPA 4OXVA 1B46A 3VLUA 1IMEA 2QSXA 2PBWA 2Q8JA 4GF8A 2CEYA 3SEWA 3SETA 1MY0A 1NV2A 1B3LA 4DXBA 3F11A 2XHDA 4FATA 3ZS6A 5FTHA 4ZEKA 3IOVA 4P1EA 2PCRA 2CZIA 2I4BA 3W9WA 1NUXA 3CSGA 3ISPA 2CMOA 1POTA 3K2DA 5ICQA 3SKPA 2Q2CA 3BIHA 4MX6A 4H5FA 1DCUA 3MZ9A 3W15C 4MLQA 1FCKA 3LV0A 5IZZA 4OVTA 1FBDA 4YKJA 4NGUA 1N3XA 4MEVA 2QMXA 4EF1A 5EHMA 2XXUA 2DWJA 1N7XA 4ELQA 4GBVA 2WBBA 5L8DA 4MH5A 2XXRA 4QFLA 4PFWA 4FORA 2UYEA 5H8SA 3I3VA 1OLCA 3K1NA 1A54A 2D3IA 3TTMA 4P0GA 2IA4A 3VVDA 1NV6A 2I49A 2Q89A 4GL8A 1BP5A 1B7ZA 1LB9A 3T96B 3IOUA 1LBXA 4EQ9A 2XX7A 2XXQA 1EH3A 2X26A 1II5A 1SW2A 5F7VA 3BKIB 2H5YA 3B6WA 2Z22A 4IO5A 1QUKA 2XXXA 1B05A 3VV5A 2NWJA 5EQAA 5K2YA 1QUIA 3TCGA 1H3DA 2FYIA 5DVIA 2UVJA 1B0HA 5IAIA 3LSLA 3RT6B 3OSRA 3O97A 4OVSA 3LC8A 3CIJA 1KZ8A 5DW8A 4PTKA 1QULA 2DE2A 1MRPA 4XKRA 1NV7A 4G77A 3MVZA 2I0BA 1KWHA 4F3PA 3S9NC 2OK2A 4P9KA 4EDPA 3OO7A 3QMFA 3EHTA 2FVZA 3QUFA 2V3QA 4DIGA 1RKMA 2V4CA 4JBZA 1IZ1A 3D4GA 1RYOA 4MCOA 4NF5B 1RDXA 2R6GE 3OSQA 1P99A 1MXWA 2PFYA 4HE0A 4GL0A 3UP9A 1R1NA 4DZ1A 1MPBA 4XIGQ 4N07A 1M5EA 1LBWA 4G61A 4HS7A 4X9TA 2P0SA 4JVIA 3KEIA 1Y4TA 2ANJA 1VFEA 2Z8DA 2HZKA 1NH7A 3CSBA 1Y3QA 3IAZA 4HE2A 1UIVA 4I9DA 2OWZA 4O8MA 1INPA 3MPKA 3CFLA 3K6WA 3L6GA 1M5BA 4GX6A 1GGGA 1ZTYA 1CB6A 1GV8A 4XKNA 3P7IA 2FBPA 4YMBA 2RC9A 3C32A 3LSXA 4X04A 5ISUA 3RQTA 4HCWA 2PX1A 3TODA 4LQ2A 3CFZA 4GOTA 3ONMA 1JEVA 3IJXB 1NI9A 1DK4A 4GFRA 2CZHA 1SW5A 5EYFA 3TTNA 1SI1A 2VOZA 1LEVA 3IJOB 4ISUA 5KDTB 1MQDA 4H5GA 1B1HA 3MVYA 1B6HA 4LN5A 3TFLA 2F6GA 4QFOA 1OMPA 4AS4A 1F9BA 1SVXB 4HTGA 4X1BA 1LAXA 4NF6B 3FJMA 4XFEA 4MIJA 1FBHA 1S9TA 3MVWA 2GH9A 4PBHA 5LOMA 3PMXA 2Z8FA 3CRBA 3OOAA 1ELJA 4N91A 1DBZA 4PFTA 3MQ9A 1LFGA 3SERA 3BIGA 4R9GA 4AB5A 1NL5A 1MXUA 1LCFA 2DXYA 5TP9B 4IO7A 1R9LA 2BJIA 5H8FB 2Q9TA 1NKXA 4KCCA 2UYFA 3SESA 5KDTA 3S9EA 2XXWA 3B6QA 5KCJB 1TFDA 3JZJA 3IO6A 1M5DA 4OVRA 3UA8A 1N0TA 1FQCA 1D9YA 3GXAA 1OVTA 3HFUA 1D4NA 2QL3A 1IMCA 2OWTA 4PC9A 3GLBA 3H06B 1NV5A 1S7YA 2Y84A 4NF6A 3TYHA 2XX9A 5CM6A 1Q1KA 4IY5A 1B4ZA 4ND9A 4YKIA 5HPQA 4I40A 3EPEA 1MM6A 4DI3D 3ROJA 4F31B 2DSFA 4FE8A 4MJOA 3MJNA 4YB6A 1SW4A 1FPBA 1AOVA 4OYVA 3U1OA 2QS3A 1LBBA 3S9LC 4O3AA 5H8FA 4ESWA 2NVUB 2JJKA 4I8CA 4POWA 4U22A 2VD3A 2VT5A 5I58A 2DE4A 1IMFA 4NWDA 5KCJA 2ZZXA 4UA8A 4H65A 4IY6A 3H6WA 2UVGA 3FXBA 1N7WA 2F34A 1YZ0A 2XXYA 2XXIA 2BJJX 4K3FA 1PBPA 4H45A 1B4HA 5I56B 4PE5B 3VXBA 5CMCA 4MNCA 1YYZA 1YXIA 3N6TA 4GWSA 5AA3A 3U92A 2A5TB 1B3EA 3KOTA 3PU5A 5I3SA 2REGA 4GXAA 4BDOA 2XD2A 2OBGA 4YB5A 4THIA 2PT1A 4IO4A 1LBZA 4PAKA 4H8IA 2DS9A 3IR1A 4TOZA 1ZIUA 2B4LA 1Y1ZA 4FBPA 1AWBA 3TEPA 1J1NA 3DLNA 1PEBA 1MXXA 4N13A 4PFIA 4NX1A 4F1YA 4ONYA 4PFUA 5CMMA 2ONKE 1I6QA 3OELA 5CMBA 1VR5A 2F3BA 4OTEA 2VPOA 3OO6A 5I56A 3PV0E 3TQWA 3FJGA 4MNPA 4KD5A 5AA4B 1N84A 2ZZVA 5CMKA 3M3FA 1FQDA 4QFNA 4NF0A 2UXAA 3K01A 5IM2A 4O3CA 4QSDA 2XXPA 5IGAA 4F1VA 2Y7PA 4G68B 4U21A 3IFCA 3MAMA 3QUJA 4F19A 1P1UA 1PDAA 4RK9A 3USDA 3UN6A 1SBPA 1M5FA 4GVOA 4ZS9A 4NN3A 4G68C 3MYUA 4MHFA 4F29A 3VVEA 5IZ1A 1LFHA 4F2QA 1LAFE 2XXTA 4GQOA 3QSLA 4OEVA 2KQZA 3FXQA 4M1VA 1EZ9A 2I58A 1LLSA 4OEUA 1A8EA 1URGA 5AA4A 4MLVA 3MZ1A 4RPNA 4R6HA 3KC1A 1DMBA 1FBFA 2DOJA 4RK2A 4OFJA 4H0WA 4G68A 3O2AA 4JVCA 5T3JA
chains in the Genus database with same CATH topology
2PFZA 1RDYA 5EQAA 1FPJA 4P56A 3U65A 4PFRA 1IMDA 4OVPA 4QXDA 5I5PA 4PF6A 1K9ZA 2WBDA 4OVSA 1KZ8A 5DW8A 5LDZA 2VPNA 2XWVA 2DE3A 4PTKA 2DE2A 4GWXA 1NV7A 4F18A 2CZKA 4H46A 2QPQA 4P3LA 1FBCA 4PDDA 4GWYA 1FPGA 4P9KA 5I7IA 3QMFA 4N8GA 2FVZA 4GWUA 5EQ8A 2QVRA 2V3QA 2V4CA 4MCOA 1FPIA 1RDXA 2XA5A 3W9VA 5A5LA 1FTAA 2XWIA 2PFYA 2HXRA 4HE0A 1LBWA 4G61A 4X9TA 4JVIA 5ESYA 4N15A 1FJ9A 4PAFA 2KR0A 2HZKA 4NQ8A 2F3DA 4GX3A 4XEQA 1FBGA 1NUYA 4HE2A 4GX4A 2OWZA 3T0JA 1CNQA 4O8MA 1INPA 3KC0A 2OX3A 4GX6A 4I3YA 2WX9A 4F1UA 5EQ7A 3GYYA 4NHBA 2P3NA 4MNIA 4PGPA 3FBPA 2Q74A 4PDHA 5JK4A 2FBPA 1VDWA 3RYDA 1KA0A 4N6DA 4X04A 4HCWA 4PETA 1K9YA 2DDKA 4PCDA 1FRPA 2Q8MA 1NI9A 1DK4A 5ET6A 4OA4A 2CZHA 4N4UA 1D9QA 1LEVA 3LUZA 1FPFA 4LN5A 2XWOA 4N17A 4AS4A 1G0HA 2FHYA 1JP4A 4I3EA 4QBAA 4XFEA 4MIJA 1FBHA 1EYJA 4PBHA 2HZLA 1FSAA 5EYHA 5EQ9A 1FPEA 2F5XA 2ZZWA 4N91A 1DBZA 3BIGA 1LBVA 2FIXA 2BJIA 1SPIA 2Q9TA 3B8BA 3NOHA 4PAIA 1NUZA 4NAPA 3EKIA 5J16A 3PTYA 4O94A 4OVRA 2Y5KA 4P8BA 1FPLA 4OANA 2DVZA 4NG7A 1NV0A 3RPLB 1QGXA 2QVUA 3HFUA 1IMCA 4XF5A 4GWZA 4PC9A 1FPKA 1NV5A 2HHMA 1EYKA 4MMPA 1RDZA 5CM6A 1IMAA 3E78A 4N6KA 2WEFA 4I40A 4PBQA 4DI3D 3ROJA 4YZZA 1KA1A 4MJOA 1NUWA 1FPBA 3E79A 5ET5A 2HPGA 2FIEA 2R8TA 2JJKA 1FPDA 2VT5A 2DE4A 4P47A 1IMFA 1EYIA 3D1RA 2MKZA 5F24A 2ZZXA 5EYGA 4PGNA 3FXBA 3RPLA 4MAGA 1YZ0A 3A29A 4N8YA 4UABA 2WYKA 2WYPA 4H45A 4O7MA 1XI6A 4MNCA 1G0IA 1FJ6A 4PFBA 4KXPA 1YYZA 1YXIA 1BK4A 4GWSA 2Y5LA 1IMBA 5I3SA 3B50A 2XWKA 5J1DA 5ET7A 4DI4B 1LBZA 4PAKA 3IFAA 2B4LA 4FBPA 1AWBA 4YICA 4GWWA 3MSTA 3CHGA 1IMEA 2CEYA 4PE3A 4PFIA 4NX1A 4X8RA 4HE1A 1NV2A 2QVVA 4P1EA 2PCRA 2F3BA 2CZIA 2VPOA 1FBPA 3W9WA 1NUXA 3ISPA 3KBZA 4OVQA 4MNPA 2ZZVA 3BIHA 2CEXA 4MX6A 1DCUA 4NF0A 5IM2A 3LV0A 5IZZA 5IGAA 4OVTA 4HXVA 4F1VA 1FBDA 5IZ3B 4NGUA 5LTCA 2L5VA 4F19A 3IFCA 4O7IA 1FBEA 4MEVA 4HCYA 4N81A 3SZPA 5ET8A 4GBVA 4PF8A 4NN3A 3MYUA 2WBBA 4MHFA 5IZ1A 4AS5A 1NV4A 2P3VA 2KQZA 4M1VA 4IR8A 2B4MA 4P1LA 5FBPA 1NV3A 1Q9DA 2XXKA 3T1BA 4GBWA 1NV6A 4JVDA 1NV1A 1LBXA 3KC1A 1FBFA 5IZ3A 2QFLA 2GQ1A 1LBYA 4JVCA 5T3JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WX9 A;  2CEY A;  4PE3 A;  4PFI A;  4O94 A;  4NX1 A;  3GYY A;  4OVR A;  4NHB A;  4X8R A;  4P8B A;  4OAN A;  4NG7 A;  2PFZ A;  4MNI A;  4PGP A;  4P56 A;  3U65 A;  4XF5 A;  4PFR A;  4OVP A;  4PC9 A;  4PDH A;  4MMP A;  4P1E A;  2VPO A;  4N6D A;  5CM6 A;  5I5P A;  4X04 A;  4OVQ A;  4PF6 A;  4MNP A;  4OVS A;  4PET A;  2ZZV A;  4N6K A;  2VPN A;  2XWV A;  2CEX A;  4PCD A;  4MX6 A;  4PBQ A;  4DI3 D;  4YZZ A;  4NF0 A;  5IM2 A;  4OA4 A;  4P3L A;  5IZZ A;  5IGA A;  4OVT A;  4N4U A;  4NGU A;  5LTC A;  2HPG A;  4PDD A;  4MEV A;  4P9K A;  5I7I A;  4LN5 A;  4P47 A;  4N8G A;  2XWO A;  4N17 A;  2ZZX A;  4PGN A;  2V4C A;  4PF8 A;  4NN3 A;  3FXB A;  4MHF A;  4MCO A;  4MAG A;  2XA5 A;  4N8Y A;  4UAB A;  2WYK A;  2WYP A;  4O7M A;  4XFE A;  4MIJ A;  2XWI A;  2PFY A;  4MNC A;  4PBH A;  2HZL A;  4P1L A;  4PFB A;  2XXK A;  4N15 A;  2ZZW A;  4N91 A;  4PAF A;  3B50 A;  2HZK A;  4NQ8 A;  2XWK A;  4XEQ A;  4DI4 B;  4PAK A;  4PAI A;  4NAP A;  4O8M A;  4YIC A; 
#chains in the Genus database with same CATH topology
 1NFT A;  3TZA A;  3FD3 A;  3PPR A;  1FPJ A;  4PFY A;  1GR2 A;  5I59 A;  3E4R A;  3D4C A;  4PFR A;  1OIB A;  3ILU B;  2XXV A;  3V5A A;  4QXD A;  4PF6 A;  2WBD A;  4I62 A;  2ABH A;  5LDZ A;  4C1T A;  2XWV A;  1MY3 A;  3TKD A;  4YAH X;  3IOW A;  3A3C A;  2QPQ A;  4P3L A;  3K1M A;  5ICT A;  4KFQ A;  2ZYN A;  3FIR A;  3K6U A;  4NE4 A;  5L9S A;  4F2O A;  4F22 A;  1IXC A;  2QVR A;  1QVS A;  1FPI A;  3W9V A;  3VFJ A;  5A5L A;  1O63 A;  3S4U A;  4P0I A;  2XWI A;  1MY2 A;  5TPA B;  4ZEI A;  4XKQ A;  3PMV A;  2KR0 A;  1LAG E;  2IEE A;  3PUY E;  4NQ8 A;  2HAU A;  3T9V A;  1MDQ A;  2F3D A;  4XEQ A;  1FBG A;  1NUY A;  3TCH A;  3K02 A;  5AA2 D;  1B3F A;  1H43 A;  2O68 A;  1XS5 A;  2F8D A;  3MP8 A;  1TXF A;  3ILT B;  4G8N A;  4JB7 A;  3H4Z A;  3FXU A;  3MWB A;  1S50 A;  4KCD A;  1OQG A;  3LUY A;  3E3K A;  2Q74 A;  3RYD A;  2O69 A;  1KA0 A;  3FXR A;  1AMF A;  1GTK A;  1NNP A;  3FVK A;  3PPQ A;  2ZNT A;  4DE8 A;  3RUM A;  5TPA A;  2DDK A;  4PCD A;  1FRP A;  4QHQ A;  2Q8M A;  5H8N B;  3MPL A;  5ET6 A;  3O6G A;  1FW0 A;  4OFO A;  3LBS A;  5FHN A;  4OA4 A;  4N4U A;  1UIU A;  3OEM A;  5FTI A;  2XWO A;  5H8H B;  2XX8 A;  3TTL A;  1URS A;  3PUZ E;  4F3B A;  3C31 A;  3KSJ A;  2E1S A;  1JEU A;  1HSE A;  5AE4 A;  2FHY A;  1AIV A;  1NNF A;  1JP4 A;  4I3E A;  5DVJ A;  1ANF A;  4EUO A;  1MQI A;  3LSW A;  3H7M A;  3VXC A;  2ZYK A;  3SEV A;  3M3K A;  2XD3 A;  2YPN A;  3SEX A;  1FSA A;  4R72 A;  1WVJ A;  1FPE A;  2RCA A;  4LON B;  1ZU0 A;  3RTF B;  1CE2 A;  1LBV A;  5H8N A;  3QYT A;  2FIX A;  2AL5 A;  1H76 A;  3MW0 A;  4PAI A;  2VD2 A;  2Y7W A;  3IB2 A;  4U2R A;  1B58 A;  4DLD A;  1B40 A;  1B7U A;  1FPL A;  5H8H A;  2DVZ A;  4NG7 A;  2QMW A;  1BTJ A;  3UK4 A;  4HW8 A;  1QGX A;  3TAJ A;  2QVU A;  4Z0I A;  4GWZ A;  1FPK A;  2HHM A;  1EYK A;  2Q88 A;  1MS7 A;  2F36 A;  3K6X A;  1UQW A;  2GRV A;  5BUU A;  3R6U A;  3GBB A;  2HAV A;  3G3K A;  4X48 A;  2WEF A;  1ZMG A;  3FVO A;  4PBQ A;  3VLV A;  3PD9 A;  4KYD A;  4YZZ A;  1A7L A;  5IKB A;  3KFM A;  4GIZ A;  1JVY A;  4FEC A;  2FIE A;  3V8X B;  3C9H A;  3ZKK A;  1VFD A;  4YU0 A;  3ZKL A;  3O6H A;  1EYI A;  3JV9 A;  3KOS A;  3ODB A;  3Q28 A;  2I3V A;  2FA7 A;  1USY E;  3A29 A;  4UAB A;  3OD7 A;  1XOC A;  3PGF A;  1YCJ A;  1BKA A;  2HCA A;  2V3U A;  4OEN A;  5F1Q A;  1G0I A;  1Z7N E;  4PFB A;  1BK4 A;  3KJT A;  3HN0 A;  1IMB A;  1USY H;  2Z23 A;  3B50 A;  3BBR A;  3KN3 A;  3K4U A;  2XWK A;  3TPA A;  2XXH A;  5ET7 A;  3PPO A;  4DI4 B;  2THI A;  3IFA A;  4KYE A;  1Y3N A;  4ZZA A;  4YIC A;  4TLL B;  3MST A;  4GWW A;  3T9H B;  3CHG A;  4MFI A;  4PE3 A;  4EQB A;  4DXU A;  1MG1 A;  1YTV A;  4G2Z A;  3M3L A;  3G3H A;  4XXU A;  2ONS A;  4NF4 B;  4R74 A;  4QF9 A;  3O28 A;  4LA9 A;  1XHY A;  3KBZ A;  4OVQ A;  4JWX A;  3CI8 A;  5I58 B;  4GLI A;  2DP8 A;  4RYA A;  2CEX A;  2D5W A;  4IGT A;  5AA2 A;  3PPN A;  4QFK A;  1MXY A;  2I4C A;  3U93 A;  1JNF A;  1PC3 A;  4ZEC A;  3DP8 A;  5IZ3 B;  5LTC A;  1WOD A;  4DDD A;  1XVY A;  2L5V A;  3SDF A;  2F78 A;  3ZSF A;  3G3I A;  2F6P A;  3GZG A;  3N5L A;  4E0X A;  4N81 A;  1BLF A;  2WKY A;  5I2K B;  3O66 A;  3Q25 A;  2UVH A;  4PF8 A;  2QS4 A;  3FV1 A;  3RGY A;  4AS5 A;  3N94 A;  4M4G A;  4YB7 A;  3WAF A;  4R6K A;  4G4P A;  4IO6 A;  4NF4 A;  1TFA A;  3KSX A;  3MP1 A;  4IR8 A;  1VSO A;  3WAE A;  5K2X A;  1B51 A;  1NV3 A;  1LGB C;  1Q9D A;  2ONR A;  3O9P A;  1Q35 A;  3IL1 B;  3T1B A;  2RKM A;  3Q29 A;  2NOO A;  1NV1 A;  5M2V A;  5ITO A;  4BDR A;  4H1X A;  1SI0 A;  4KYS A;  5DEX B;  3CVG A;  5IZ3 A;  3UIF A;  5B7D A;  2GQ1 A;  3M8U A;  2V25 A;  2E0S A;  1FTO A;  2I6E A;  4QRZ A;  2R9J A;  2RCB A;  4KQP A;  4TLM B;  5I2K A;  1M5C A;  1RDY A;  1OLA A;  3O6I A;  4LP2 B;  5I5P A;  1K9Z A;  4H67 A;  1SDX A;  3QXM A;  3C35 A;  3I6V A;  2VPN A;  3IB1 A;  4GWX A;  1I6B A;  4F18 A;  5FHO A;  4H46 A;  2ESN A;  2OWS A;  1POY 1;  2QJE A;  4FED A;  4PDD A;  4ZE8 A;  3VDF A;  1FPG A;  5DEX A;  3IB0 A;  4F39 A;  2VGQ A;  5I7I A;  1HSJ A;  4QSE A;  2O1M A;  1NNK A;  4GWU A;  5EQ8 A;  3MZB A;  4R6Y A;  2B65 A;  5BWJ A;  2ZYM A;  3FAT A;  1Y3P A;  4OFL A;  4WXJ A;  2XA5 A;  4POX A;  1B2H A;  3TUS A;  3OXN A;  3TCF A;  3HST A;  1QKB A;  4BDL A;  5DTB A;  1URD A;  1P1W A;  3N6U A;  5TU0 A;  4F3G A;  1MY4 A;  5ESY A;  4FAJ A;  1FJ9 A;  1FTJ A;  2X7Q A;  4MF3 A;  4OER A;  4ESX A;  4FEB A;  5I59 B;  1I6A A;  1FQF A;  3C36 A;  1L5T A;  4UAC A;  3BFU A;  4EXL A;  3T0J A;  1CNQ A;  3H03 A;  2O84 X;  2G93 A;  4I1D A;  4YKK A;  1DPE A;  2WX9 A;  3GYY A;  4NHB A;  3HPI A;  2P3N A;  4MNI A;  3OEN A;  2I48 A;  4PGP A;  1Z7M E;  3IOT A;  1P1Q A;  3FJ7 A;  4OQO A;  3U94 A;  4R75 A;  1DSN A;  2OCU A;  1I69 A;  1VDW A;  1R6Z A;  3PUV E;  4N6D A;  4JWY A;  4ELP A;  4PET A;  4Q0C A;  1OVB A;  4C0R A;  1SW1 A;  3K00 A;  3TEL A;  3H6T A;  1MQG A;  4IGR A;  3RN8 A;  1MQJ A;  2FNC A;  3EF7 A;  1D9Q A;  3FGS A;  2DWI A;  3LUZ A;  1ATG A;  2DYX A;  1LBC A;  1MH3 A;  1ZKB A;  5DT6 A;  3OEK A;  4DCX A;  3IO4 A;  2P2A A;  3QIM A;  4TQU Q;  1G0H A;  3GBA A;  5L9M A;  3QAX A;  5DYH A;  4LZ8 A;  4RA1 A;  1MPD A;  1ZBM A;  1EYJ A;  2RF1 A;  2LAO A;  4NMY A;  2HZL A;  3G3F A;  3RNN A;  3HHF A;  3PPP A;  5EQ9 A;  4KHZ E;  2F5X A;  4OVJ A;  1B5I A;  1JQF A;  1Y9U A;  4LAT A;  4RJZ A;  3RPW A;  4AQ4 A;  4C1U A;  4F3S A;  1SYI A;  3L6H A;  2O6A A;  3MBP A;  3A09 A;  4NAP A;  4Q5T A;  2Y7K A;  3EKI A;  5J16 A;  4YMA A;  1A8F A;  4G8M A;  4ECF A;  4N6P A;  1YAE A;  3RY3 A;  4OAN A;  1FQE A;  1NV0 A;  3E9X A;  3PD8 A;  1B9J A;  2CZL A;  1O64 A;  4XF5 A;  1B5J A;  4R9F A;  5JTY B;  3TTK A;  1RDZ A;  3KZG A;  1XT8 A;  3E13 X;  1JET A;  3OO9 A;  3TTR A;  1UTH B;  3E78 A;  1O7T A;  3CFX A;  1JW4 A;  3FUZ A;  4NF8 B;  3MC2 A;  4E0W A;  1KA1 A;  3C4M A;  1NUW A;  4LUB A;  4KR5 A;  1OQH A;  1WDN A;  3B6T A;  4YKP A;  2RIN A;  3MVX A;  2NUV A;  1Y4C A;  2HPG A;  3QK6 A;  2R71 A;  2Y7R A;  3SEU A;  2O7U A;  1FPD A;  2B3B A;  4P47 A;  3D1R A;  2MKZ A;  5F24 A;  1N04 A;  3THI A;  3KN7 A;  3TMG A;  4N8Y A;  1QW0 A;  1MY1 A;  2PYY A;  3PUW E;  2WYP A;  4O7M A;  3T22 A;  4LQ5 A;  5JTY A;  3EN3 A;  4U1Z A;  3FV2 A;  4KXP A;  1PB9 A;  1UTH A;  4ZZE A;  1DTG A;  2OLB A;  4NF8 A;  1PB8 A;  4BLA A;  1MXV A;  1Y20 A;  5J1D A;  5CBR A;  3T66 A;  4Z7E A;  3PMW A;  3UGW A;  4EQ7 A;  5I84 A;  1B7H A;  1VE4 A;  3VVF A;  3VLW A;  2M8C A;  5HBC A;  4R2B A;  2H99 A;  2RC7 A;  4X8R A;  4HE1 A;  3HV1 A;  4IB2 A;  3KN8 A;  4DCY A;  2I3W A;  1T0K A;  4BDN A;  4XTC Q;  1JW5 A;  3C33 A;  2QVV A;  3KG2 A;  4JXI A;  1IUD A;  1FBP A;  3AXF A;  1SYH A;  4WEP A;  4NWC A;  1P1N A;  2ZYO A;  2DXR A;  1R9Q A;  4ELR A;  2UVI A;  3EHU A;  2Q2A A;  2HEU A;  4PQJ A;  3T93 B;  4WED A;  4HXV A;  3LR1 A;  1NNT A;  3B7D A;  1US4 A;  2V3T A;  4U4S A;  1IXI A;  4NTL A;  1MXZ A;  3MUQ A;  4O7I A;  1FBE A;  4HCY A;  3A3U A;  1LFI A;  2F7B A;  3SZP A;  2HQ0 A;  5ET8 A;  1ZLQ A;  5L9O A;  2AL4 A;  2RC8 A;  4PP0 A;  4IO2 A;  1NV4 A;  1IEJ A;  2VHA A;  4R73 A;  2REJ A;  2P3V A;  2B4M A;  2PT2 A;  4P1L A;  3LSF B;  5FBP A;  1D3K A;  3RT8 A;  2XXK A;  3CR9 A;  3FZV A;  4GXS B;  2O1L A;  4GWO A;  2KLF A;  3Q26 A;  1UTB B;  3HHG A;  3I5O A;  1FQB A;  5CC2 A;  4GBW A;  2OZZ A;  2GHB A;  4JVD A;  4RY1 A;  3Q27 A;  1QJM A;  2YLN A;  3IX1 A;  4NF5 A;  4BDQ A;  4U23 A;  4JSD A;  3SEY A;  4O3B A;  1IXG A;  5CI5 A;  4QSC A;  2QFL A;  1FTK A;  1LBY A;  4LZ5 A;  1H44 A;  1EU8 A;  4Q8R A;  5AA2 B;  2DWA A;  4IO3 A;  2PFZ A;  4P56 A;  2ZNS A;  3U65 A;  4ELO A;  1IMD A;  2VP1 A;  4OVP A;  1QUJ A;  1FTM A;  2I0C A;  2H25 A;  2A5S A;  3CG3 A;  3K1P A;  4JSO A;  1LAH E;  3KGC A;  2DE3 A;  2DVC A;  1UTB A;  3DEL B;  2CZK A;  1B0L A;  4MBP A;  3DP6 A;  1LB8 A;  1D9V A;  2V93 A;  2O7I A;  3S9M C;  1FBC A;  3H6V A;  4GWY A;  3OMB A;  1BIY A;  4OZ9 A;  4QFP A;  3R26 A;  5A5X B;  3FVN A;  2ZMB A;  2DWH A;  4L17 A;  4N8G A;  2OJT A;  2GFE A;  2W7Y A;  4JDF A;  4EXK A;  5EHS A;  4H6D A;  4OET A;  1FTA A;  1ZJL A;  2HXR A;  4AB6 A;  3EHS A;  1MPC A;  2X7P A;  4P11 A;  1B3G A;  1GVC A;  1MDP 1;  5CBS A;  4N15 A;  1AH5 A;  4PAF A;  5ITP A;  4R2F A;  1PBQ A;  2F35 A;  3RTW B;  4GX3 A;  2GHA A;  4GX4 A;  5H8Q B;  3KC0 A;  3ECR A;  2OX3 A;  2D21 A;  5A5X A;  1TWY A;  4I3Y A;  2DQV A;  4F1U A;  1IXH A;  5EQ7 A;  4OMB A;  4ZEF A;  4RPO A;  3FBP A;  5HM4 B;  3O29 A;  4XKP A;  5TP9 A;  1B32 A;  4PDH A;  5JK4 A;  2O51 A;  4X1D A;  2PVU A;  2H4I A;  2F7A A;  3R7X A;  1K9Y A;  4NED A;  2HXW A;  3G3J A;  1MQH A;  1DOT A;  2QRY A;  2ZNU A;  3BFT A;  1EZO A;  5H8Q A;  1XVX A;  1US5 A;  1FPF A;  1MH4 A;  2G29 A;  4N17 A;  1EZP A;  1AL3 A;  3DP4 A;  4KI0 E;  2F97 A;  1PB7 A;  4OWD A;  2B3F A;  1NMU A;  3EQ1 A;  4QBA A;  1FTL A;  5I57 B;  1B5H A;  4ZED A;  3HO7 A;  5KZT A;  3HCQ A;  2AIX A;  2ZXT A;  5EYH A;  4WKM A;  4GD5 A;  1IIT A;  1HSL A;  3C34 A;  2ZZW A;  1MM7 A;  4BDM A;  2PMS A;  1P1O A;  3U8Q A;  4H8J A;  3G7W A;  1Y1M A;  3H3G A;  3PUX E;  2HFB A;  4GRK A;  4U4X A;  1LCT A;  1SPI A;  3VE1 B;  3B8B A;  3NOH A;  3KJ7 A;  3UOR A;  1NUZ A;  1IQ7 A;  1N76 A;  1DPP A;  1YPN A;  3PTY A;  3V83 A;  3U72 A;  3TDJ A;  4FIM A;  4O94 A;  1A99 A;  2Y5K A;  4P8B A;  4G8H A;  3RPL B;  2A5T A;  4Q30 B;  5DVF A;  3KBR A;  1JVX A;  1NH8 A;  3IOR A;  2H9B A;  1B1X A;  3FVG A;  3V89 B;  4MMP A;  5CRY A;  2V84 A;  4ZEB A;  3DM0 A;  5I2N B;  4LZ7 A;  5I57 A;  3RLF E;  1IMA A;  4RXL A;  1B52 A;  4N6K A;  3TQL A;  1QKA A;  2QS2 A;  4ZDM A;  1DTZ A;  4RNS A;  1RYX A;  1TT1 A;  2ALU A;  4KPT A;  2Y7I A;  2P1S A;  1A55 A;  5FHM A;  3E79 A;  5ET5 A;  2AYS A;  4OES A;  4DXC A;  5AA1 A;  1XC1 A;  2R8T A;  1H45 A;  5B70 A;  1SD3 A;  3T9U A;  4LVQ A;  1LST A;  2NXO A;  5EYG A;  4PGN A;  3K6V A;  3MP6 A;  3CG1 A;  5JEI A;  3RPL A;  4MAG A;  3T9X B;  1IIW A;  5ELV A;  3G3G A;  1N3W A;  2WYK A;  2F7C A;  3IK6 B;  1XI6 A;  3FAS A;  3K0V A;  3OO8 A;  4U1O A;  4OHN A;  5I2N A;  4EF2 A;  1FJ6 A;  1JW1 A;  3S2V A;  2YJP A;  3H6U A;  2Y5L A;  1B3H A;  3N26 A;  3JYR A;  2QS1 A;  2Z8E A;  4JWO A;  1A40 A;  1SQY A;  1FQA A;  2H98 A;  4ZE9 A;  4FJP A;  4OXV A;  1B46 A;  3VLU A;  1IME A;  2QSX A;  2PBW A;  2Q8J A;  4GF8 A;  2CEY A;  3SEW A;  3SET A;  1MY0 A;  1NV2 A;  1B3L A;  4DXB A;  3F11 A;  2XHD A;  4FAT A;  3ZS6 A;  5FTH A;  4ZEK A;  3IOV A;  4P1E A;  2PCR A;  2CZI A;  2I4B A;  3W9W A;  1NUX A;  3CSG A;  3ISP A;  2CMO A;  1POT A;  3K2D A;  5ICQ A;  3SKP A;  2Q2C A;  3BIH A;  4MX6 A;  4H5F A;  1DCU A;  3MZ9 A;  3W15 C;  4MLQ A;  1FCK A;  3LV0 A;  5IZZ A;  4OVT A;  1FBD A;  4YKJ A;  4NGU A;  1N3X A;  4MEV A;  2QMX A;  4EF1 A;  5EHM A;  2XXU A;  2DWJ A;  1N7X A;  4ELQ A;  4GBV A;  2WBB A;  5L8D A;  4MH5 A;  2XXR A;  4QFL A;  4PFW A;  4FOR A;  2UYE A;  5H8S A;  3I3V A;  1OLC A;  3K1N A;  1A54 A;  2D3I A;  3TTM A;  4P0G A;  2IA4 A;  3VVD A;  1NV6 A;  2I49 A;  2Q89 A;  4GL8 A;  1BP5 A;  1B7Z A;  1LB9 A;  3T96 B;  3IOU A;  1LBX A;  4EQ9 A;  2XX7 A;  2XXQ A;  1EH3 A;  2X26 A;  1II5 A;  1SW2 A;  5F7V A;  3BKI B;  2H5Y A;  3B6W A;  2Z22 A;  4IO5 A;  1QUK A;  2XXX A;  1B05 A;  3VV5 A;  2NWJ A;  5EQA A;  5K2Y A;  1QUI A;  3TCG A;  1H3D A;  2FYI A;  5DVI A;  2UVJ A;  1B0H A;  5IAI A;  3LSL A;  3RT6 B;  3OSR A;  3O97 A;  4OVS A;  3LC8 A;  3CIJ A;  1KZ8 A;  5DW8 A;  4PTK A;  1QUL A;  2DE2 A;  1MRP A;  4XKR A;  1NV7 A;  4G77 A;  3MVZ A;  2I0B A;  1KWH A;  4F3P A;  3S9N C;  2OK2 A;  4P9K A;  4EDP A;  3OO7 A;  3QMF A;  3EHT A;  2FVZ A;  3QUF A;  2V3Q A;  4DIG A;  1RKM A;  2V4C A;  4JBZ A;  1IZ1 A;  3D4G A;  1RYO A;  4MCO A;  4NF5 B;  1RDX A;  2R6G E;  3OSQ A;  1P99 A;  1MXW A;  2PFY A;  4HE0 A;  4GL0 A;  3UP9 A;  1R1N A;  4DZ1 A;  1MPB A;  4XIG Q;  4N07 A;  1M5E A;  1LBW A;  4G61 A;  4HS7 A;  4X9T A;  2P0S A;  4JVI A;  3KEI A;  1Y4T A;  2ANJ A;  1VFE A;  2Z8D A;  2HZK A;  1NH7 A;  3CSB A;  1Y3Q A;  3IAZ A;  4HE2 A;  1UIV A;  4I9D A;  2OWZ A;  4O8M A;  1INP A;  3MPK A;  3CFL A;  3K6W A;  3L6G A;  1M5B A;  4GX6 A;  1GGG A;  1ZTY A;  1CB6 A;  1GV8 A;  4XKN A;  3P7I A;  2FBP A;  4YMB A;  2RC9 A;  3C32 A;  3LSX A;  4X04 A;  5ISU A;  3RQT A;  4HCW A;  2PX1 A;  3TOD A;  4LQ2 A;  3CFZ A;  4GOT A;  3ONM A;  1JEV A;  3IJX B;  1NI9 A;  1DK4 A;  4GFR A;  2CZH A;  1SW5 A;  5EYF A;  3TTN A;  1SI1 A;  2VOZ A;  1LEV A;  3IJO B;  4ISU A;  5KDT B;  1MQD A;  4H5G A;  1B1H A;  3MVY A;  1B6H A;  4LN5 A;  3TFL A;  2F6G A;  4QFO A;  1OMP A;  4AS4 A;  1F9B A;  1SVX B;  4HTG A;  4X1B A;  1LAX A;  4NF6 B;  3FJM A;  4XFE A;  4MIJ A;  1FBH A;  1S9T A;  3MVW A;  2GH9 A;  4PBH A;  5LOM A;  3PMX A;  2Z8F A;  3CRB A;  3OOA A;  1ELJ A;  4N91 A;  1DBZ A;  4PFT A;  3MQ9 A;  1LFG A;  3SER A;  3BIG A;  4R9G A;  4AB5 A;  1NL5 A;  1MXU A;  1LCF A;  2DXY A;  5TP9 B;  4IO7 A;  1R9L A;  2BJI A;  5H8F B;  2Q9T A;  1NKX A;  4KCC A;  2UYF A;  3SES A;  5KDT A;  3S9E A;  2XXW A;  3B6Q A;  5KCJ B;  1TFD A;  3JZJ A;  3IO6 A;  1M5D A;  4OVR A;  3UA8 A;  1N0T A;  1FQC A;  1D9Y A;  3GXA A;  1OVT A;  3HFU A;  1D4N A;  2QL3 A;  1IMC A;  2OWT A;  4PC9 A;  3GLB A;  3H06 B;  1NV5 A;  1S7Y A;  2Y84 A;  4NF6 A;  3TYH A;  2XX9 A;  5CM6 A;  1Q1K A;  4IY5 A;  1B4Z A;  4ND9 A;  4YKI A;  5HPQ A;  4I40 A;  3EPE A;  1MM6 A;  4DI3 D;  3ROJ A;  4F31 B;  2DSF A;  4FE8 A;  4MJO A;  3MJN A;  4YB6 A;  1SW4 A;  1FPB A;  1AOV A;  4OYV A;  3U1O A;  2QS3 A;  1LBB A;  3S9L C;  4O3A A;  5H8F A;  4ESW A;  2NVU B;  2JJK A;  4I8C A;  4POW A;  4U22 A;  2VD3 A;  2VT5 A;  5I58 A;  2DE4 A;  1IMF A;  4NWD A;  5KCJ A;  2ZZX A;  4UA8 A;  4H65 A;  4IY6 A;  3H6W A;  2UVG A;  3FXB A;  1N7W A;  2F34 A;  1YZ0 A;  2XXY A;  2XXI A;  2BJJ X;  4K3F A;  1PBP A;  4H45 A;  1B4H A;  5I56 B;  4PE5 B;  3VXB A;  5CMC A;  4MNC A;  1YYZ A;  1YXI A;  3N6T A;  4GWS A;  5AA3 A;  3U92 A;  2A5T B;  1B3E A;  3KOT A;  3PU5 A;  5I3S A;  2REG A;  4GXA A;  4BDO A;  2XD2 A;  2OBG A;  4YB5 A;  4THI A;  2PT1 A;  4IO4 A;  1LBZ A;  4PAK A;  4H8I A;  2DS9 A;  3IR1 A;  4TOZ A;  1ZIU A;  2B4L A;  1Y1Z A;  4FBP A;  1AWB A;  3TEP A;  1J1N A;  3DLN A;  1PEB A;  1MXX A;  4N13 A;  4PFI A;  4NX1 A;  4F1Y A;  4ONY A;  4PFU A;  5CMM A;  2ONK E;  1I6Q A;  3OEL A;  5CMB A;  1VR5 A;  2F3B A;  4OTE A;  2VPO A;  3OO6 A;  5I56 A;  3PV0 E;  3TQW A;  3FJG A;  4MNP A;  4KD5 A;  5AA4 B;  1N84 A;  2ZZV A;  5CMK A;  3M3F A;  1FQD A;  4QFN A;  4NF0 A;  2UXA A;  3K01 A;  5IM2 A;  4O3C A;  4QSD A;  2XXP A;  5IGA A;  4F1V A;  2Y7P A;  4G68 B;  4U21 A;  3IFC A;  3MAM A;  3QUJ A;  4F19 A;  1P1U A;  1PDA A;  4RK9 A;  3USD A;  3UN6 A;  1SBP A;  1M5F A;  4GVO A;  4ZS9 A;  4NN3 A;  4G68 C;  3MYU A;  4MHF A;  4F29 A;  3VVE A;  5IZ1 A;  1LFH A;  4F2Q A;  1LAF E;  2XXT A;  4GQO A;  3QSL A;  4OEV A;  2KQZ A;  3FXQ A;  4M1V A;  1EZ9 A;  2I58 A;  1LLS A;  4OEU A;  1A8E A;  1URG A;  5AA4 A;  4MLV A;  3MZ1 A;  4RPN A;  4R6H A;  3KC1 A;  1DMB A;  1FBF A;  2DOJ A;  4RK2 A;  4OFJ A;  4H0W A;  4G68 A;  3O2A A;  4JVC A;  5T3J A; 
#chains in the Genus database with same CATH homology
 2PFZ A;  1RDY A;  5EQA A;  1FPJ A;  4P56 A;  3U65 A;  4PFR A;  1IMD A;  4OVP A;  4QXD A;  5I5P A;  4PF6 A;  1K9Z A;  2WBD A;  4OVS A;  1KZ8 A;  5DW8 A;  5LDZ A;  2VPN A;  2XWV A;  2DE3 A;  4PTK A;  2DE2 A;  4GWX A;  1NV7 A;  4F18 A;  2CZK A;  4H46 A;  2QPQ A;  4P3L A;  1FBC A;  4PDD A;  4GWY A;  1FPG A;  4P9K A;  5I7I A;  3QMF A;  4N8G A;  2FVZ A;  4GWU A;  5EQ8 A;  2QVR A;  2V3Q A;  2V4C A;  4MCO A;  1FPI A;  1RDX A;  2XA5 A;  3W9V A;  5A5L A;  1FTA A;  2XWI A;  2PFY A;  2HXR A;  4HE0 A;  1LBW A;  4G61 A;  4X9T A;  4JVI A;  5ESY A;  4N15 A;  1FJ9 A;  4PAF A;  2KR0 A;  2HZK A;  4NQ8 A;  2F3D A;  4GX3 A;  4XEQ A;  1FBG A;  1NUY A;  4HE2 A;  4GX4 A;  2OWZ A;  3T0J A;  1CNQ A;  4O8M A;  1INP A;  3KC0 A;  2OX3 A;  4GX6 A;  4I3Y A;  2WX9 A;  4F1U A;  5EQ7 A;  3GYY A;  4NHB A;  2P3N A;  4MNI A;  4PGP A;  3FBP A;  2Q74 A;  4PDH A;  5JK4 A;  2FBP A;  1VDW A;  3RYD A;  1KA0 A;  4N6D A;  4X04 A;  4HCW A;  4PET A;  1K9Y A;  2DDK A;  4PCD A;  1FRP A;  2Q8M A;  1NI9 A;  1DK4 A;  5ET6 A;  4OA4 A;  2CZH A;  4N4U A;  1D9Q A;  1LEV A;  3LUZ A;  1FPF A;  4LN5 A;  2XWO A;  4N17 A;  4AS4 A;  1G0H A;  2FHY A;  1JP4 A;  4I3E A;  4QBA A;  4XFE A;  4MIJ A;  1FBH A;  1EYJ A;  4PBH A;  2HZL A;  1FSA A;  5EYH A;  5EQ9 A;  1FPE A;  2F5X A;  2ZZW A;  4N91 A;  1DBZ A;  3BIG A;  1LBV A;  2FIX A;  2BJI A;  1SPI A;  2Q9T A;  3B8B A;  3NOH A;  4PAI A;  1NUZ A;  4NAP A;  3EKI A;  5J16 A;  3PTY A;  4O94 A;  4OVR A;  2Y5K A;  4P8B A;  1FPL A;  4OAN A;  2DVZ A;  4NG7 A;  1NV0 A;  3RPL B;  1QGX A;  2QVU A;  3HFU A;  1IMC A;  4XF5 A;  4GWZ A;  4PC9 A;  1FPK A;  1NV5 A;  2HHM A;  1EYK A;  4MMP A;  1RDZ A;  5CM6 A;  1IMA A;  3E78 A;  4N6K A;  2WEF A;  4I40 A;  4PBQ A;  4DI3 D;  3ROJ A;  4YZZ A;  1KA1 A;  4MJO A;  1NUW A;  1FPB A;  3E79 A;  5ET5 A;  2HPG A;  2FIE A;  2R8T A;  2JJK A;  1FPD A;  2VT5 A;  2DE4 A;  4P47 A;  1IMF A;  1EYI A;  3D1R A;  2MKZ A;  5F24 A;  2ZZX A;  5EYG A;  4PGN A;  3FXB A;  3RPL A;  4MAG A;  1YZ0 A;  3A29 A;  4N8Y A;  4UAB A;  2WYK A;  2WYP A;  4H45 A;  4O7M A;  1XI6 A;  4MNC A;  1G0I A;  1FJ6 A;  4PFB A;  4KXP A;  1YYZ A;  1YXI A;  1BK4 A;  4GWS A;  2Y5L A;  1IMB A;  5I3S A;  3B50 A;  2XWK A;  5J1D A;  5ET7 A;  4DI4 B;  1LBZ A;  4PAK A;  3IFA A;  2B4L A;  4FBP A;  1AWB A;  4YIC A;  4GWW A;  3MST A;  3CHG A;  1IME A;  2CEY A;  4PE3 A;  4PFI A;  4NX1 A;  4X8R A;  4HE1 A;  1NV2 A;  2QVV A;  4P1E A;  2PCR A;  2F3B A;  2CZI A;  2VPO A;  1FBP A;  3W9W A;  1NUX A;  3ISP A;  3KBZ A;  4OVQ A;  4MNP A;  2ZZV A;  3BIH A;  2CEX A;  4MX6 A;  1DCU A;  4NF0 A;  5IM2 A;  3LV0 A;  5IZZ A;  5IGA A;  4OVT A;  4HXV A;  4F1V A;  1FBD A;  5IZ3 B;  4NGU A;  5LTC A;  2L5V A;  4F19 A;  3IFC A;  4O7I A;  1FBE A;  4MEV A;  4HCY A;  4N81 A;  3SZP A;  5ET8 A;  4GBV A;  4PF8 A;  4NN3 A;  3MYU A;  2WBB A;  4MHF A;  5IZ1 A;  4AS5 A;  1NV4 A;  2P3V A;  2KQZ A;  4M1V A;  4IR8 A;  2B4M A;  4P1L A;  5FBP A;  1NV3 A;  1Q9D A;  2XXK A;  3T1B A;  4GBW A;  1NV6 A;  4JVD A;  1NV1 A;  1LBX A;  3KC1 A;  1FBF A;  5IZ3 A;  2QFL A;  2GQ1 A;  1LBY A;  4JVC A;  5T3J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...