4MEVA

Crystal structure of a trap periplasmic solute binding protein from rhodoferax ferrireducens (rfer_1840), target efi-510211, with bound malonate, space group i422
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
311
structure length
311
Chain Sequence
SALKISHQFPGGTIKEGDFRDRLVRNFAAEVEKRSKGAMKFEIYPGSSLMKTNAQFSSMRKGALDMALIPLSYAGGEVPELNIGLMPGLVVSYEQAYSWKTKPVGIELTRVLQEKGIVLISWIWQAGGVASRGKPVVEPEDAKGMKIRGGSREMDMILKDAGAAVVSLPSNEIYAAMQTGAMDAAMTSSTSFISFRLEEVAKALTTGRTGAYWFMFEPLMMSKAIFDKLPKDQRDMLMTVGAEMEKFALEAAKKDDIDVAAVYQKAGAKVVDLSDGTIKKWQDIARKTAWKDYGAKNEGCAKLLALAQQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Experimental strategies for functional annotation and metabolism discovery: targeted screening of solute binding proteins and unbiased panning of metabolomes.
pubmed doi rcsb
source organism Rhodoferax ferrireducens
molecule tags Transport protein
molecule keywords TRAP dicarboxylate transporter-DctP subunit
total genus 116
structure length 311
sequence length 311
ec nomenclature
pdb deposition date 2013-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4mevA00
4MIJA 4XFEA 4DI4B 4XEQA 4YZZA 2CEYA 4P1EA 2ZZVA 4NG7A 4NHBA 4PE3A 4P47A 4PF8A 4UABA 4PFRA 5IGAA 4PFBA 5IZZA 4PETA 4P1LA 4PFIA 4NQ8A 4PCDA 2XA5A 4NGUA 4P3LA 4MHFA 4MX6A 3B50A 4MNPA 5I5PA 4N15A 2HZLA 2HZKA 5IM2A 4MAGA 4PBQA 4NAPA 2WYPA 4PBHA 4N8YA 4OA4A 3U65A 2VPNA 4OVTA 4X8RA 4N6DA 4XF5A 4DI3D 2XXKA 2PFYA 4O7MA 4O8MA 2WX9A 2XWVA 4OVSA 4LN5A 4P9KA 4MEVA 2ZZWA 4N4UA 2CEXA 2XWIA 2XWOA 4MNCA 4PGPA 4PF6A 4YICA 5LTCA 4NF0A 4MMPA 4N6KA 4OVRA 2V4CA 4NN3A 4OVPA 2HPGA 4PC9A 3FXBA 4OANA 3GYYA 5CM6A 2ZZXA 5I7IA 2XWKA 4P8BA 4NX1A 4OVQA 4MNIA 2VPOA 2WYKA 2PFZA 4PAIA 4PDDA 4X04A 4N91A 4MCOA 4PDHA 4N8GA 4O94A 4PAFA 4PGNA 4P56A 4N17A 4PAKA
chains in the Genus database with same CATH superfamily
2XXQA 3EQ1A 3HSTA 1NUWA 4F31B 4ESWA 4R2BA 3UN6A 3TTMA 2ZXTA 3SERA 1BK4A 1B5HA 4HE0A 1B32A 5IZZA 4GBVA 1FQCA 4RXLA 1FTAA 2DP8A 3UA8A 3JYRA 5EYGA 5AA2B 4GXAA 2HCAA 4ELRA 5TP9A 2I3WA 4GWUA 5K2YA 3SDFA 2REJA 2B4MA 4HTGA 1IMBA 5I3SA 3MSTA 2Q74A 4JVIA 4NF8B 2QL3A 4DXUA 4N07A 1B52A 2XXKA 2O1MA 3H06B 4E0XA 3KG2A 3PD9A 3FGSA 5I2KA 3LSLA 3GBAA 4HCWA 5DVIA 5I59B 1FQAA 2H5YA 2XWOA 3T1BA 3OOAA 3U72A 4OETA 1Z7ME 2Q2AA 3ISPA 4OVRA 4Q0CA 1EZOA 1IUDA 1H45A 4LQ2A 4GBWA 3GYYA 4KHZE 4Q5TA 2RCAA 3T96B 2GFEA 3C4MA 3BFUA 2OK2A 3U1OA 5H8HA 2XX8A 1NKXA 4KPTA 4OVQA 2XX7A 3THIA 2VPOA 1N3WA 2QS3A 1T0KA 4G2ZA 1LCFA 4N8GA 1FQFA 2QVVA 1HSJA 2Y7RA 3O9PA 1HSLA 4TOZA 4O3BA 1M5CA 1IMDA 1FPGA 3CVGA 4F3SA 3LBSA 1SW4A 4HXVA 2DS9A 1Y3QA 4PETA 1P1NA 4LZ5A 4P3LA 1LBCA 5I5PA 1YPNA 3C32A 5FHMA 1MXYA 1B2HA 1Y3PA 3U94A 1QKAA 4PBHA 1R9QA 3I6VA 4GXSB 3VVDA 4DCYA 5H8FB 3LSWA 1FW0A 1Y3NA 5LDZA 2Z8FA 3GBBA 1NV6A 5IZ3A 1KZ8A 3IO4A 2QVRA 4IO2A 1DBZA 3RTFB 2OZZA 5EQ9A 3CSGA 1VR5A 3MVWA 4EF1A 4MF3A 2Q2CA 1DPPA 3S2VA 3RY3A 1SD3A 3OMBA 4BDMA 3FVOA 2ZZXA 5I7IA 1OQGA 3PUZE 4IY6A 1B4ZA 1BIYA 4RY1A 2ZYMA 3UIFA 2E1SA 5AE4A 3MVYA 4RPOA 3TTRA 1USYH 2G29A 4OZ9A 1FPBA 2AYSA 1IITA 3SKPA 4ZS9A 3KC0A 1H44A 4H0WA 3I5OA 2PBWA 1P1OA 1B1HA 2YPNA 4Q30B 4NHBA 3FD3A 1FQEA 4PF8A 3EF7A 1TFAA 2DYXA 4NF4B 3RLFE 4MX6A 3G3KA 1MDQA 2G93A 4HS7A 1LEVA 2B65A 1CE2A 1YTVA 5EQ8A 1TXFA 2F7AA 4XKRA 2XD2A 2GRVA 1JEUA 5IAIA 1US5A 3TUSA 5ISUA 3K02A 4QFOA 3U93A 4OEVA 1LCTA 3VFJA 4R73A 4LN5A 1JNFA 5BUUA 3IOUA 3IK6B 3MQ9A 1B7HA 3S9LC 3FZVA 1XS5A 3K1PA 4PTKA 5KDTB 2P1SA 4YKJA 3IOWA 1DSNA 1G0HA 3OXNA 4KR5A 2DDKA 3N6TA 4NF0A 4JWOA 4ECFA 3CI8A 2V4CA 1R6ZA 4OANA 3HV1A 3UP9A 4RA1A 3SEWA 3D4CA 1MS7A 3RGYA 2I6EA 1MQGA 4WEDA 4DXCA 5DEXA 4ZEBA 1A55A 4OERA 1NV2A 4GIZA 4OFJA 2QS4A 1FBFA 4QBAA 4N91A 4H1XA 4XTCQ 4WKMA 5CBSA 3MWBA 2Y7IA 3MAMA 2DSFA 4DE8A 2RC9A 4P1EA 5A5XB 3K6WA 3C34A 4YMBA 2KQZA 2O7UA 4U22A 2ANJA 2O7IA 1MQIA 4QFNA 2ALUA 3PMXA 2XXIA 1P99A 1LFHA 5IM2A 4EDPA 3S9NC 1NL5A 4ZECA 5FHNA 2YLNA 5I2NB 4H67A 1LFIA 3TMGA 3FXRA 1LBZA 3K01A 3BBRA 3H03A 1D4NA 1FTMA 3PPQA 1LBBA 1IXGA 1HSEA 4OFOA 4PGPA 3CFZA 5AA2D 3R6UA 4YICA 4H5GA 1MM7A 3FIRA 4OVPA 4PC9A 1FBGA 4C1UA 1MXVA 3OO6A 1PBQA 3O97A 4XKQA 3A3CA 2V84A 3KOSA 2F6PA 5B70A 5F7VA 1MQHA 4F3GA 4GWXA 3RN8A 3QAXA 2HEUA 2XXWA 4H8JA 4KXPA 1Z7NE 1IZ1A 3C9HA 1NNPA 5DW8A 1MH4A 2XHDA 1IMFA 1B1XA 4MIJA 3OEKA 4PP0A 1N0TA 2XD3A 3C36A 2F35A 5J16A 3RNNA 5TP9B 3TFLA 4PFBA 2DXRA 4GQOA 1DCUA 1ANFA 2ZMBA 1LBXA 4AS5A 4F1YA 5ET8A 1Q1KA 2XXPA 2HZKA 5AA4A 2DWIA 4G68C 4FJPA 2LAOA 2WYPA 5L9SA 2H4IA 3SEUA 2DE2A 4BDNA 2F97A 4U21A 4G77A 1MM6A 3G3HA 4R6KA 1QULA 1MXWA 2V93A 1FRPA 1RDYA 4O7MA 3IL1B 2PT2A 4O8MA 1J1NA 1FPIA 1US4A 1JVYA 5EQ7A 1NV0A 3KGCA 5EHMA 5ET6A 5FTIA 4G8MA 5CMCA 1MG1A 1OIBA 2XXHA 3R7XA 1NFTA 5H8QA 3K2DA 3FV2A 4EUOA 1RYXA 3FXBA 2I4CA 4PFUA 1YXIA 2OWZA 4JVDA 3MZBA 1M5DA 1B0LA 3IJOB 3UORA 1IEJA 4FBPA 2ONSA 1URSA 2GHBA 4OVJA 3TPAA 1MXUA 2UVGA 3LSFB 1B3EA 4PDHA 3BIGA 3JZJA 1MY4A 2OJTA 4GVOA 4GL8A 3GXAA 1B9JA 3RYDA 4MBPA 4OFLA 1MPDA 2Y7KA 4U4XA 1BKAA 4JVCA 1UTBB 3TCFA 5KCJA 2E0SA 1SI1A 4PCDA 2D3IA 1FSAA 3A3UA 1JW1A 4R9FA 4KYSA 1B46A 5ELVA 4LP2B 3E9XA 4X1BA 1FBHA 3PV0E 5IZ3B 5I2KB 5I58B 3T9XB 4O3AA 2RINA 1XVXA 1AOVA 3T93B 3N5LA 4NF4A 1XOCA 3B8BA 3VXCA 1FBEA 3GLBA 1LAGE 3G3IA 3MZ1A 2UVJA 3SEVA 3LR1A 1N84A 3FJGA 3H3GA 4OYVA 3ECRA 3FJ7A 2ZNUA 2Y5KA 4DCXA 4R75A 4R9GA 4R6YA 3K00A 2IA4A 1NNTA 3PPNA 1N7WA 4LATA 1H76A 4BDRA 3PTYA 3H7MA 3CFLA 2HAVA 1EYJA 4QFKA 3V5AA 3FVKA 3QK6A 4PFWA 2H25A 4U1ZA 2B3FA 2HXWA 4MNIA 4OESA 3OENA 2QMXA 3T22A 5I56A 2ZNSA 3MC2A 1POTA 2DWAA 1IXIA 3KBZA 4NE4A 1B0HA 2VP1A 3HCQA 3PMVA 4F2OA 4JSDA 2XXRA 3RPLA 4G4PA 2OCUA 3FJMA 4NWDA 4F2QA 4I3EA 1LB8A 4H45A 3IORA 3QIMA 3FV1A 2O6AA 3KOTA 3VVFA 1O7TA 1VDWA 5CMBA 3MJNA 4P0IA 4F1UA 2CZLA 3LSXA 1LGBC 2I58A 4P11A 3TQLA 3DELB 4PBQA 4M4GA 1FTLA 1O63A 1OVTA 1NV3A 4L17A 5TPAA 2FYIA 4MLQA 3PPPA 1KWHA 4OMBA 4NMYA 5ICQA 2Q88A 2R9JA 1Q35A 2ABHA 4I62A 1M5BA 2P2AA 2XX9A 4OVSA 2Q89A 4LUBA 3IX1A 4EF2A 2DQVA 2ZZWA 1LBWA 1S9TA 1S7YA 5HPQA 3ZKKA 3MZ9A 1A99A 2H9BA 3Q25A 2O51A 5LTCA 5T3JA 4LZ7A 4N6PA 2A5TA 1OVBA 3ZSFA 4JWYA 4GWWA 2I49A 1USYE 3UGWA 4GX4A 4LQ5A 2O1LA 1URDA 1QUIA 3B6WA 3VV5A 4NF6A 3TELA 2V3TA 1N7XA 2Y84A 4MH5A 2A5SA 4O94A 1AIVA 2V25A 2WBBA 3KN3A 3Q28A 1IMCA 3IAZA 3CR9A 3K1NA 2ZNTA 4WEPA 1F9BA 3USDA 1B7UA 3BFTA 4R74A 4DLDA 3HO7A 1WDNA 1NNKA 3V89B 1UQWA 1IMAA 1FPEA 4O3CA 4G61A 3B50A 4ELPA 3MUQA 3EN3A 4YKKA 2Y7WA 3OO9A 3RQTA 2I48A 4EXLA 3VVEA 4GD5A 4RPNA 1QKBA 3BKIB 1WODA 4ELQA 5FTHA 2GHAA 4HE2A 1FCKA 1JW5A 1ELJA 2PX1A 2BJIA 4G68A 1PDAA 1FJ9A 4GWSA 1JW4A 1H43A 1JVXA 2Y7PA 1O64A 5AA2A 3DM0A 4P0GA 5DVJA 1UIUA 2CEXA 2XWIA 1ZKBA 4R2FA 1SYIA 4PF6A 4BDLA 1RYOA 3KFMA 1QJMA 4ZZAA 2B4LA 1NV1A 2P0SA 1ZIUA 3PGFA 2H99A 1I6BA 1A8EA 1VFDA 2XWKA 2Z23A 3KC1A 2HHMA 4AQ4A 4ND9A 4R6HA 3KEIA 1BTJA 1H3DA 4F3BA 4BDOA 1TWYA 4G8HA 1MXZA 1SBPA 1B7ZA 4ZEKA 2NVUB 3DLNA 1INPA 1M5EA 5F1QA 4HE1A 1GVCA 4RJZA 1DOTA 2WEFA 3PD8A 3IB1A 1YZ0A 3OELA 4ZE9A 3F11A 2Z22A 4N13A 4P1LA 4PFIA 2QSXA 2QPQA 1AL3A 1P1QA 1FJ6A 5K2XA 4N15A 2F7CA 2QRYA 4NAPA 2PMSA 4H46A 4JB7A 4Q8RA 2RKMA 4QSDA 5TU0A 2X26A 1DTGA 4DZ1A 2O68A 1NV7A 3CIJA 3ODBA 5DYHA 4N81A 3P7IA 2R71A 3HFUA 2W7YA 2KR0A 5JK4A 4EQ7A 2CZHA 4IB2A 3A09A 5H8NA 3ILTB 4F18A 5ET7A 1MQDA 3PMWA 1XI6A 1IXHA 4NN3A 2HAUA 3C31A 1SDXA 4U4SA 5CM6A 2D5WA 2PCRA 2Y5LA 1MQJA 5M2VA 2HXRA 3TTNA 1Y4TA 1URGA 4I9DA 2RC7A 1I69A 5KDTA 4LVQA 1EYIA 2XXTA 2VHAA 4MCOA 4EQ9A 1CB6A 4PAFA 4N17A 4XIGQ 1VFEA 1NNFA 3K0VA 4QSEA 1SPIA 1A54A 3K6VA 2FNCA 3K4UA 4YZZA 2D21A 3FXUA 5I57A 4TLMB 4GLIA 2Q9TA 5FBPA 5CMKA 3TCGA 4I8CA 2OX3A 4MHFA 3Q27A 4AB5A 5H8FA 3Q26A 2UVHA 1IXCA 1JEVA 1WVJA 3IOTA 4AB6A 1NUXA 3DP4A 4OXVA 3U92A 3D1RA 1SW5A 3S9EA 1LSTA 1Y9UA 1CNQA 4OVTA 4XF5A 4N6DA 2QVUA 3PPOA 3O6GA 3VLVA 4QXDA 2P3NA 2F5XA 1FQBA 1Q9DA 5JTYB 5KZTA 2I0BA 4MEVA 4YB6A 3N6UA 3MVZA 2FIEA 4C0RA 2O69A 2QFLA 1GGGA 3T66A 4N6KA 4TQUQ 5AA1A 3W9VA 3SESA 1JETA 1UIVA 3KJ7A 4JSOA 4KQPA 2HQ0A 4O7IA 3G3JA 1KA1A 2RF1A 2OLBA 2X7QA 4QFPA 4RK9A 3GZGA 2Q8JA 1KA0A 3H4ZA 2CZIA 5I84A 1DK4A 1NV5A 1UTBA 4P56A 5L8DA 4FECA 5AA4B 1RDZA 4H8IA 3ONMA 3SEYA 4F29A 4MLVA 5JEIA 1AMFA 2THIA 2CEYA 4FORA 5IGAA 3TDJA 1B5IA 1D9QA 1MRPA 1NH7A 4KYDA 1NV4A 3FXQA 3R26A 5I58A 5CC2A 3TKDA 5A5LA 1POY1 4Z0IA 1MDP1 1PC3A 4H5FA 2GH9A 1B6HA 3E13X 3MPLA 1D9YA 2XXYA 3U65A 4OEUA 5H8QB 2VOZA 4DI3D 4NF5A 3E4RA 4H65A 4BLAA 2PFYA 3PUWE 3O29A 4K3FA 3QUJA 1TT1A 3WAEA 2PT1A 4P9KA 3VXBA 3L6GA 4PE5B 5FHOA 2F36A 4ELOA 1K9YA 3SETA 3IOVA 3TTKA 1OQHA 4I40A 4YU0A 3M3FA 1ZU0A 1UTHA 4NEDA 1JQFA 4RK2A 5L9MA 2NOOA 1B3GA 3FASA 3ROJA 1JP4A 3RPLB 4ZEFA 1PB8A 2PFZA 1R1NA 2VT5A 3PUXE 4QFLA 1SW2A 3T0JA 4YKIA 3EHTA 3KN7A 4NWCA 5IKBA 3UK4A 1LBYA 3KJTA 1EU8A 3ZS6A 1N76A 2ZYOA 1A40A 4XFEA 4DI4B 2DWJA 4JXIA 4U2RA 1PB9A 3MP6A 1MPCA 4GFRA 5HBCA 5I2NA 4MNPA 2NXOA 3Q29A 1ZTYA 4NF5B 2XXUA 4G68B 3E3KA 3N94A 2ONKE 1ZJLA 3LV0A 2OWSA 3RT6B 4NTLA 2L5VA 3T9VA 4JDFA 3HPIA 4OA4A 3K6UA 3MYUA 3B6TA 3WAFA 1ZLQA 3TCHA 5KCJB 1LAFE 2QS1A 1VE4A 1FPLA 3AXFA 2XWVA 1XT8A 4C1TA 1L5TA 1UTHB 3QXMA 4JBZA 5DVFA 4TLLB 3MPKA 1D9VA 2UVIA 4N4UA 4OQOA 1I6QA 1LB9A 5I56B 5BWJA 1MY3A 4GWZA 4MMPA 4IGRA 3JV9A 3V83A 2I0CA 2HPGA 4LONB 1VSOA 5I59A 1B5JA 3W15C 1MY2A 3KBRA 1FPDA 2XXXA 3KSXA 1G0IA 1B3LA 2Z8DA 4GWYA 1Y1ZA 3HN0A 5EQAA 1Y1MA 4PAIA 3LUZA 1II5A 3OSQA 4IGTA 4BDQA 3RT8A 3M8UA 3IR1A 1FPJA 2RCBA 3KN8A 4PGNA 3HHGA 1FQDA 1XHYA 4M1VA 3VE1B 1NH8A 2YJPA 1SVXB 1NMUA 1QUJA 2R8TA 1RDXA 2UYFA 2JJKA 2QMWA 2CMOA 4OWDA 4PE3A 4ZDMA 5F24A 5ITOA 1FBPA 3M3KA 3D4GA 4NQ8A 2XA5A 3TQWA 3PPRA 2HFBA 1ZBMA 3H6TA 4XXUA 4AS4A 2H98A 1A7LA 1Y20A 5ET5A 1AWBA 1MPBA 1K9ZA 4N8YA 2WKYA 2V3QA 2I4BA 3O6HA 3CFXA 4F3PA 4XKNA 3O66A 1A8FA 1LAXA 4GOTA 5IZ1A 1EZ9A 1N3XA 1FPFA 4NF8A 4HCYA 4Z7EA 5CMMA 3FBPA 3A29A 4H6DA 1DMBA 3KZGA 3G7WA 2F3DA 4GX3A 1P1UA 5JTYA 2R6GE 4ZE8A 4LZ8A 4JWXA 3EHUA 3T9UA 5CBRA 4KCCA 3RUMA 4IO3A 1RKMA 2VD2A 3OD7A 2P3VA 3RTWB 2KLFA 1TFDA 3KSJA 4KFQA 3V8XB 4UA8A 3VDFA 1S50A 2QJEA 1PEBA 3OSRA 4THIA 3TZAA 3OO7A 4I3YA 2RC8A 1EZPA 1GR2A 5ITPA 1PB7A 4PAKA 5DT6A 2AL5A 2OWTA 5DTBA 5H8HB 3CRBA 1SYHA 1FPKA 5LOMA 1BP5A 2UXAA 1ZMGA 2ZZVA 4NG7A 3BIHA 4PFTA 4UABA 2F8DA 4PFRA 5AA3A 1EYKA 2VGQA 5DEXB 3B6QA 3TAJA 4U1OA 3H6VA 3G3GA 1B3FA 3S9MC 3EHSA 2F3BA 4GX6A 1MY1A 2I3VA 2HZLA 3QUFA 3DP6A 3E79A 4WXJA 3CG1A 4YMAA 2NUVA 3I3VA 4ZEDA 3IFAA 1LLSA 3ZKLA 1EH3A 3CHGA 2MKZA 3H6WA 4DDDA 4X1DA 1QUKA 2WX9A 4IY5A 1MXXA 4FEBA 3O6IA 4OENA 3K6XA 3MBPA 2NWJA 4FATA 3T9HB 5B7DA 2DXYA 3OO8A 3MVXA 1MY0A 1LFGA 1XC1A 1QW0A 1ATGA 1YCJA 3SZPA 4DIGA 1FBDA 2GQ1A 3C35A 4QSCA 1D3KA 5EYFA 2DWHA 2F7BA 3MP1A 5CI5A 1FBCA 4FE8A 1B40A 4IO5A 4F1VA 5I57B 4PQJA 3QMFA 3VLUA 3QYTA 1QGXA 3K1MA 2DE3A 2VD3A 4F22A 2DVZA 1NUYA 3U8QA 5ICTA 4EXKA 1OLCA 1FTKA 3O28A 2FHYA 2DOJA 4NF6B 4EQBA 1SQYA 3E78A 1SW1A 3LC8A 4ESXA 4NGUA 2V3UA 2WBDA 4GL0A 1B4HA 4QF9A 2AL4A 1IQ7A 4MAGA 2Q8MA 1B58A 4ZZEA 2XXVA 3TYHA 5CRYA 2FVZA 5EHSA 3W9WA 4F19A 3IB0A 2IEEA 3IO6A 1Y4CA 3HHFA 3RPWA 1AH5A 2REGA 1DPEA 2Z8EA 4YB5A 4IR8A 3OEMA 4IO7A 4ISUA 3IJXB 2ZYKA 3SEXA 1SI0A 3ILUB 4R72A 4G8NA 4MNCA 2OBGA 4FIMA 3TEPA 3NOHA 2FIXA 2DE4A 2ZYNA 1MH3A 1YYZA 1R9LA 4E0WA 4MJOA 4F39A 2QS2A 2UYEA 4LA9A 4IO6A 3EKIA 3LUYA 4P8BA 5H8SA 2PVUA 1GV8A 3MW0A 3FATA 2A5TB 2WYKA 4PDDA 4POWA 4X04A 1DTZA 5H8NB 2DVCA 4QRZA 4X48A 4GWOA 3IB2A 3S4UA 3PU5A 4YAHX 2AIXA 1NI9A 4OHNA 4XEQA 5TPAB 4GRKA 4HW8A 1FTJA 3FVGA 4P47A 3FUZA 2F34A 1BLFA 1P1WA 3QSLA 1QVSA 4RYAA 4KCDA 4MFIA 1N04A 4QHQA 1YAEA 2ESNA 3PUYE 3MP8A 5A5XA 4UACA 1I6AA 4YB7A 1B51A 1FTOA 2BJJX 1IIWA 1OMPA 3EPEA 2VPNA 4X8RA 2F6GA 3O2AA 4KYEA 5EYHA 3N26A 4OTEA 4KI0E 3L6HA 4ZEIA 3M3LA 4I1DA 2FBPA 2ONRA 4YKPA 4FAJA 1B3HA 2X7PA 4ONYA 2FA7A 4GF8A 5L9OA 4RNSA 4IO4A 4POXA 3G3FA 2B3BA 3FVNA 1IMEA 2M8CA 4DXBA 1NUZA 2PYYA 3DP8A 5J1DA 3VLWA 3C33A 3IFCA 1LBVA 4KD5A 1PBPA 4U23A 4PFYA 4NX1A 1M5FA 2F78A 3H6UA 3TODA 1OLAA 1XVYA 4FEDA 1GTKA 4XKPA 5HM4B 1LAHE 4X9TA 5ESYA 3PUVE 3CG3A 3CSBA 2CZKA 3B7DA 3TTLA 2O84X 1B05A
chains in the Genus database with same CATH topology
4HE1A 5DW8A 1QGXA 1RDZA 2WBBA 2DE3A 1IMFA 1IMCA 4M1VA 3KC0A 1SPIA 1FPKA 1NUWA 2DVZA 2WEFA 1NUYA 1IMDA 1FPGA 1NI9A 2R8TA 4MIJA 4XFEA 3RPLA 4DI4B 1RDXA 3RYDA 4XEQA 4YZZA 2JJKA 4I3EA 4H45A 4HXVA 2CEYA 4P1EA 2FHYA 2ZZVA 4NG7A 3BIHA 4NHBA 4PE3A 4P47A 4PF8A 4JVCA 4UABA 4PFRA 1BK4A 5IGAA 5J16A 1EYKA 4HE0A 1YZ0A 2Q9TA 4PFBA 1D9QA 5F24A 5FBPA 5IZZA 1FBPA 4PETA 4P1LA 2KQZA 4GBVA 1VDWA 4NQ8A 4PFIA 1IMAA 3E78A 1NV4A 2XA5A 2QPQA 1DCUA 1FPEA 1FSAA 4NGUA 2OX3A 4P3LA 4G61A 1LBXA 1FTAA 4MHFA 4AS5A 1FJ6A 2WBDA 3B50A 4MNPA 4MX6A 2F3BA 5ET8A 4GX6A 5A5LA 4F1UA 4N15A 5EYGA 2HZLA 4AS4A 3E79A 1LEVA 2HZKA 5IM2A 4MAGA 2Q8MA 4PBQA 4NAPA 1FBHA 1NUXA 4H46A 2WYPA 5ET5A 3LV0A 1AWBA 1NV3A 4GWUA 5IZ3B 2L5VA 1K9ZA 2B4MA 2FVZA 4N8YA 4PBHA 3W9WA 5EQ8A 1IMBA 2DE2A 5I3SA 3D1RA 4F19A 3IFAA 3MSTA 2Q74A 2V3QA 5LTCA 4JVIA 3MYUA 4OA4A 1CNQA 2VPNA 4HE2A 4N6DA 4OVTA 4X8RA 2QVUA 4XF5A 4DI3D 5LDZA 3CHGA 2BJIA 3B8BA 4QXDA 2P3NA 5EYHA 2MKZA 2F5XA 1FJ9A 4GWSA 2XXKA 1FBEA 1FRPA 1Q9DA 1FPLA 1RDYA 2PFYA 4O7MA 1LBZA 2WX9A 4O8MA 2XWVA 4OVSA 1NV6A 1NV7A 2FBPA 5IZ3A 4LN5A 4N81A 1KZ8A 1FPIA 5IZ1A 2QVRA 4P9KA 4MEVA 1NV0A 4HCWA 3HFUA 5EQ7A 2ZZWA 4N4UA 2KR0A 5JK4A 2CEXA 1DBZA 2CZHA 2XWIA 1FPFA 1LBWA 4HCYA 1K9YA 2XWOA 4MNCA 4PCDA 5ET6A 3T1BA 2FIEA 4PTKA 5EQ9A 2Y5KA 4I40A 4PGPA 3FBPA 5I5PA 4PF6A 3A29A 4F18A 4YICA 5ET7A 5T3JA 2QFLA 4GWZA 1G0HA 4NF0A 4MMPA 2DDKA 3ISPA 3NOHA 4N6KA 4OVRA 2FIXA 2V4CA 1XI6A 2DE4A 3W9VA 4IR8A 2B4LA 1NV1A 1IMEA 1YYZA 4GBWA 4NN3A 3PTYA 2HPGA 1NUZA 4OVPA 2F3DA 4GX3A 4MJOA 4PC9A 3FXBA 1FBGA 5J1DA 4OANA 3SZPA 3GYYA 3IFCA 4GWWA 1LBVA 1FBDA 1EYJA 5CM6A 2ZZXA 5I7IA 3EKIA 1YXIA 2GQ1A 2PCRA 2Y5LA 2XWKA 4GX4A 4P8BA 3U65A 4NX1A 1FPDA 4O7IA 3KC1A 2HXRA 2OWZA 1KA1A 1FBCA 2HHMA 1G0IA 4JVDA 4GWYA 4OVQA 5EQAA 4MNIA 3ROJA 1JP4A 2P3VA 2VPOA 2PFZA 2WYKA 4PAIA 4PDDA 3RPLB 2VT5A 4X04A 3LUZA 1NV2A 4X9TA 4F1VA 4FBPA 5ESYA 1EYIA 1FBFA 1KA0A 4GWXA 3QMFA 4QBAA 3T0JA 4N91A 2CZIA 1INPA 1FPJA 3KBZA 1NV5A 1DK4A 1LBYA 4KXPA 4MCOA 4N8GA 2QVVA 3BIGA 2CZKA 4O94A 4PDHA 1FPBA 4I3YA 4PAFA 4PGNA 4P56A 4N17A 4PAKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MIJ A;  4XFE A;  4DI4 B;  4XEQ A;  4YZZ A;  2CEY A;  4P1E A;  2ZZV A;  4NG7 A;  4NHB A;  4PE3 A;  4P47 A;  4PF8 A;  4UAB A;  4PFR A;  5IGA A;  4PFB A;  5IZZ A;  4PET A;  4P1L A;  4PFI A;  4NQ8 A;  4PCD A;  2XA5 A;  4NGU A;  4P3L A;  4MHF A;  4MX6 A;  3B50 A;  4MNP A;  5I5P A;  4N15 A;  2HZL A;  2HZK A;  5IM2 A;  4MAG A;  4PBQ A;  4NAP A;  2WYP A;  4PBH A;  4N8Y A;  4OA4 A;  3U65 A;  2VPN A;  4OVT A;  4X8R A;  4N6D A;  4XF5 A;  4DI3 D;  2XXK A;  2PFY A;  4O7M A;  4O8M A;  2WX9 A;  2XWV A;  4OVS A;  4LN5 A;  4P9K A;  4MEV A;  2ZZW A;  4N4U A;  2CEX A;  2XWI A;  2XWO A;  4MNC A;  4PGP A;  4PF6 A;  4YIC A;  5LTC A;  4NF0 A;  4MMP A;  4N6K A;  4OVR A;  2V4C A;  4NN3 A;  4OVP A;  2HPG A;  4PC9 A;  3FXB A;  4OAN A;  3GYY A;  5CM6 A;  2ZZX A;  5I7I A;  2XWK A;  4P8B A;  4NX1 A;  4OVQ A;  4MNI A;  2VPO A;  2WYK A;  2PFZ A;  4PAI A;  4PDD A;  4X04 A;  4N91 A;  4MCO A;  4PDH A;  4N8G A;  4O94 A;  4PAF A;  4PGN A;  4P56 A;  4N17 A;  4PAK A; 
#chains in the Genus database with same CATH topology
 2XXQ A;  3EQ1 A;  3HST A;  1NUW A;  4F31 B;  4ESW A;  4R2B A;  3UN6 A;  3TTM A;  2ZXT A;  3SER A;  1BK4 A;  1B5H A;  4HE0 A;  1B32 A;  5IZZ A;  4GBV A;  1FQC A;  4RXL A;  1FTA A;  2DP8 A;  3UA8 A;  3JYR A;  5EYG A;  5AA2 B;  4GXA A;  2HCA A;  4ELR A;  5TP9 A;  2I3W A;  4GWU A;  5K2Y A;  3SDF A;  2REJ A;  2B4M A;  4HTG A;  1IMB A;  5I3S A;  3MST A;  2Q74 A;  4JVI A;  4NF8 B;  2QL3 A;  4DXU A;  4N07 A;  1B52 A;  2XXK A;  2O1M A;  3H06 B;  4E0X A;  3KG2 A;  3PD9 A;  3FGS A;  5I2K A;  3LSL A;  3GBA A;  4HCW A;  5DVI A;  5I59 B;  1FQA A;  2H5Y A;  2XWO A;  3T1B A;  3OOA A;  3U72 A;  4OET A;  1Z7M E;  2Q2A A;  3ISP A;  4OVR A;  4Q0C A;  1EZO A;  1IUD A;  1H45 A;  4LQ2 A;  4GBW A;  3GYY A;  4KHZ E;  4Q5T A;  2RCA A;  3T96 B;  2GFE A;  3C4M A;  3BFU A;  2OK2 A;  3U1O A;  5H8H A;  2XX8 A;  1NKX A;  4KPT A;  4OVQ A;  2XX7 A;  3THI A;  2VPO A;  1N3W A;  2QS3 A;  1T0K A;  4G2Z A;  1LCF A;  4N8G A;  1FQF A;  2QVV A;  1HSJ A;  2Y7R A;  3O9P A;  1HSL A;  4TOZ A;  4O3B A;  1M5C A;  1IMD A;  1FPG A;  3CVG A;  4F3S A;  3LBS A;  1SW4 A;  4HXV A;  2DS9 A;  1Y3Q A;  4PET A;  1P1N A;  4LZ5 A;  4P3L A;  1LBC A;  5I5P A;  1YPN A;  3C32 A;  5FHM A;  1MXY A;  1B2H A;  1Y3P A;  3U94 A;  1QKA A;  4PBH A;  1R9Q A;  3I6V A;  4GXS B;  3VVD A;  4DCY A;  5H8F B;  3LSW A;  1FW0 A;  1Y3N A;  5LDZ A;  2Z8F A;  3GBB A;  1NV6 A;  5IZ3 A;  1KZ8 A;  3IO4 A;  2QVR A;  4IO2 A;  1DBZ A;  3RTF B;  2OZZ A;  5EQ9 A;  3CSG A;  1VR5 A;  3MVW A;  4EF1 A;  4MF3 A;  2Q2C A;  1DPP A;  3S2V A;  3RY3 A;  1SD3 A;  3OMB A;  4BDM A;  3FVO A;  2ZZX A;  5I7I A;  1OQG A;  3PUZ E;  4IY6 A;  1B4Z A;  1BIY A;  4RY1 A;  2ZYM A;  3UIF A;  2E1S A;  5AE4 A;  3MVY A;  4RPO A;  3TTR A;  1USY H;  2G29 A;  4OZ9 A;  1FPB A;  2AYS A;  1IIT A;  3SKP A;  4ZS9 A;  3KC0 A;  1H44 A;  4H0W A;  3I5O A;  2PBW A;  1P1O A;  1B1H A;  2YPN A;  4Q30 B;  4NHB A;  3FD3 A;  1FQE A;  4PF8 A;  3EF7 A;  1TFA A;  2DYX A;  4NF4 B;  3RLF E;  4MX6 A;  3G3K A;  1MDQ A;  2G93 A;  4HS7 A;  1LEV A;  2B65 A;  1CE2 A;  1YTV A;  5EQ8 A;  1TXF A;  2F7A A;  4XKR A;  2XD2 A;  2GRV A;  1JEU A;  5IAI A;  1US5 A;  3TUS A;  5ISU A;  3K02 A;  4QFO A;  3U93 A;  4OEV A;  1LCT A;  3VFJ A;  4R73 A;  4LN5 A;  1JNF A;  5BUU A;  3IOU A;  3IK6 B;  3MQ9 A;  1B7H A;  3S9L C;  3FZV A;  1XS5 A;  3K1P A;  4PTK A;  5KDT B;  2P1S A;  4YKJ A;  3IOW A;  1DSN A;  1G0H A;  3OXN A;  4KR5 A;  2DDK A;  3N6T A;  4NF0 A;  4JWO A;  4ECF A;  3CI8 A;  2V4C A;  1R6Z A;  4OAN A;  3HV1 A;  3UP9 A;  4RA1 A;  3SEW A;  3D4C A;  1MS7 A;  3RGY A;  2I6E A;  1MQG A;  4WED A;  4DXC A;  5DEX A;  4ZEB A;  1A55 A;  4OER A;  1NV2 A;  4GIZ A;  4OFJ A;  2QS4 A;  1FBF A;  4QBA A;  4N91 A;  4H1X A;  4XTC Q;  4WKM A;  5CBS A;  3MWB A;  2Y7I A;  3MAM A;  2DSF A;  4DE8 A;  2RC9 A;  4P1E A;  5A5X B;  3K6W A;  3C34 A;  4YMB A;  2KQZ A;  2O7U A;  4U22 A;  2ANJ A;  2O7I A;  1MQI A;  4QFN A;  2ALU A;  3PMX A;  2XXI A;  1P99 A;  1LFH A;  5IM2 A;  4EDP A;  3S9N C;  1NL5 A;  4ZEC A;  5FHN A;  2YLN A;  5I2N B;  4H67 A;  1LFI A;  3TMG A;  3FXR A;  1LBZ A;  3K01 A;  3BBR A;  3H03 A;  1D4N A;  1FTM A;  3PPQ A;  1LBB A;  1IXG A;  1HSE A;  4OFO A;  4PGP A;  3CFZ A;  5AA2 D;  3R6U A;  4YIC A;  4H5G A;  1MM7 A;  3FIR A;  4OVP A;  4PC9 A;  1FBG A;  4C1U A;  1MXV A;  3OO6 A;  1PBQ A;  3O97 A;  4XKQ A;  3A3C A;  2V84 A;  3KOS A;  2F6P A;  5B70 A;  5F7V A;  1MQH A;  4F3G A;  4GWX A;  3RN8 A;  3QAX A;  2HEU A;  2XXW A;  4H8J A;  4KXP A;  1Z7N E;  1IZ1 A;  3C9H A;  1NNP A;  5DW8 A;  1MH4 A;  2XHD A;  1IMF A;  1B1X A;  4MIJ A;  3OEK A;  4PP0 A;  1N0T A;  2XD3 A;  3C36 A;  2F35 A;  5J16 A;  3RNN A;  5TP9 B;  3TFL A;  4PFB A;  2DXR A;  4GQO A;  1DCU A;  1ANF A;  2ZMB A;  1LBX A;  4AS5 A;  4F1Y A;  5ET8 A;  1Q1K A;  2XXP A;  2HZK A;  5AA4 A;  2DWI A;  4G68 C;  4FJP A;  2LAO A;  2WYP A;  5L9S A;  2H4I A;  3SEU A;  2DE2 A;  4BDN A;  2F97 A;  4U21 A;  4G77 A;  1MM6 A;  3G3H A;  4R6K A;  1QUL A;  1MXW A;  2V93 A;  1FRP A;  1RDY A;  4O7M A;  3IL1 B;  2PT2 A;  4O8M A;  1J1N A;  1FPI A;  1US4 A;  1JVY A;  5EQ7 A;  1NV0 A;  3KGC A;  5EHM A;  5ET6 A;  5FTI A;  4G8M A;  5CMC A;  1MG1 A;  1OIB A;  2XXH A;  3R7X A;  1NFT A;  5H8Q A;  3K2D A;  3FV2 A;  4EUO A;  1RYX A;  3FXB A;  2I4C A;  4PFU A;  1YXI A;  2OWZ A;  4JVD A;  3MZB A;  1M5D A;  1B0L A;  3IJO B;  3UOR A;  1IEJ A;  4FBP A;  2ONS A;  1URS A;  2GHB A;  4OVJ A;  3TPA A;  1MXU A;  2UVG A;  3LSF B;  1B3E A;  4PDH A;  3BIG A;  3JZJ A;  1MY4 A;  2OJT A;  4GVO A;  4GL8 A;  3GXA A;  1B9J A;  3RYD A;  4MBP A;  4OFL A;  1MPD A;  2Y7K A;  4U4X A;  1BKA A;  4JVC A;  1UTB B;  3TCF A;  5KCJ A;  2E0S A;  1SI1 A;  4PCD A;  2D3I A;  1FSA A;  3A3U A;  1JW1 A;  4R9F A;  4KYS A;  1B46 A;  5ELV A;  4LP2 B;  3E9X A;  4X1B A;  1FBH A;  3PV0 E;  5IZ3 B;  5I2K B;  5I58 B;  3T9X B;  4O3A A;  2RIN A;  1XVX A;  1AOV A;  3T93 B;  3N5L A;  4NF4 A;  1XOC A;  3B8B A;  3VXC A;  1FBE A;  3GLB A;  1LAG E;  3G3I A;  3MZ1 A;  2UVJ A;  3SEV A;  3LR1 A;  1N84 A;  3FJG A;  3H3G A;  4OYV A;  3ECR A;  3FJ7 A;  2ZNU A;  2Y5K A;  4DCX A;  4R75 A;  4R9G A;  4R6Y A;  3K00 A;  2IA4 A;  1NNT A;  3PPN A;  1N7W A;  4LAT A;  1H76 A;  4BDR A;  3PTY A;  3H7M A;  3CFL A;  2HAV A;  1EYJ A;  4QFK A;  3V5A A;  3FVK A;  3QK6 A;  4PFW A;  2H25 A;  4U1Z A;  2B3F A;  2HXW A;  4MNI A;  4OES A;  3OEN A;  2QMX A;  3T22 A;  5I56 A;  2ZNS A;  3MC2 A;  1POT A;  2DWA A;  1IXI A;  3KBZ A;  4NE4 A;  1B0H A;  2VP1 A;  3HCQ A;  3PMV A;  4F2O A;  4JSD A;  2XXR A;  3RPL A;  4G4P A;  2OCU A;  3FJM A;  4NWD A;  4F2Q A;  4I3E A;  1LB8 A;  4H45 A;  3IOR A;  3QIM A;  3FV1 A;  2O6A A;  3KOT A;  3VVF A;  1O7T A;  1VDW A;  5CMB A;  3MJN A;  4P0I A;  4F1U A;  2CZL A;  3LSX A;  1LGB C;  2I58 A;  4P11 A;  3TQL A;  3DEL B;  4PBQ A;  4M4G A;  1FTL A;  1O63 A;  1OVT A;  1NV3 A;  4L17 A;  5TPA A;  2FYI A;  4MLQ A;  3PPP A;  1KWH A;  4OMB A;  4NMY A;  5ICQ A;  2Q88 A;  2R9J A;  1Q35 A;  2ABH A;  4I62 A;  1M5B A;  2P2A A;  2XX9 A;  4OVS A;  2Q89 A;  4LUB A;  3IX1 A;  4EF2 A;  2DQV A;  2ZZW A;  1LBW A;  1S9T A;  1S7Y A;  5HPQ A;  3ZKK A;  3MZ9 A;  1A99 A;  2H9B A;  3Q25 A;  2O51 A;  5LTC A;  5T3J A;  4LZ7 A;  4N6P A;  2A5T A;  1OVB A;  3ZSF A;  4JWY A;  4GWW A;  2I49 A;  1USY E;  3UGW A;  4GX4 A;  4LQ5 A;  2O1L A;  1URD A;  1QUI A;  3B6W A;  3VV5 A;  4NF6 A;  3TEL A;  2V3T A;  1N7X A;  2Y84 A;  4MH5 A;  2A5S A;  4O94 A;  1AIV A;  2V25 A;  2WBB A;  3KN3 A;  3Q28 A;  1IMC A;  3IAZ A;  3CR9 A;  3K1N A;  2ZNT A;  4WEP A;  1F9B A;  3USD A;  1B7U A;  3BFT A;  4R74 A;  4DLD A;  3HO7 A;  1WDN A;  1NNK A;  3V89 B;  1UQW A;  1IMA A;  1FPE A;  4O3C A;  4G61 A;  3B50 A;  4ELP A;  3MUQ A;  3EN3 A;  4YKK A;  2Y7W A;  3OO9 A;  3RQT A;  2I48 A;  4EXL A;  3VVE A;  4GD5 A;  4RPN A;  1QKB A;  3BKI B;  1WOD A;  4ELQ A;  5FTH A;  2GHA A;  4HE2 A;  1FCK A;  1JW5 A;  1ELJ A;  2PX1 A;  2BJI A;  4G68 A;  1PDA A;  1FJ9 A;  4GWS A;  1JW4 A;  1H43 A;  1JVX A;  2Y7P A;  1O64 A;  5AA2 A;  3DM0 A;  4P0G A;  5DVJ A;  1UIU A;  2CEX A;  2XWI A;  1ZKB A;  4R2F A;  1SYI A;  4PF6 A;  4BDL A;  1RYO A;  3KFM A;  1QJM A;  4ZZA A;  2B4L A;  1NV1 A;  2P0S A;  1ZIU A;  3PGF A;  2H99 A;  1I6B A;  1A8E A;  1VFD A;  2XWK A;  2Z23 A;  3KC1 A;  2HHM A;  4AQ4 A;  4ND9 A;  4R6H A;  3KEI A;  1BTJ A;  1H3D A;  4F3B A;  4BDO A;  1TWY A;  4G8H A;  1MXZ A;  1SBP A;  1B7Z A;  4ZEK A;  2NVU B;  3DLN A;  1INP A;  1M5E A;  5F1Q A;  4HE1 A;  1GVC A;  4RJZ A;  1DOT A;  2WEF A;  3PD8 A;  3IB1 A;  1YZ0 A;  3OEL A;  4ZE9 A;  3F11 A;  2Z22 A;  4N13 A;  4P1L A;  4PFI A;  2QSX A;  2QPQ A;  1AL3 A;  1P1Q A;  1FJ6 A;  5K2X A;  4N15 A;  2F7C A;  2QRY A;  4NAP A;  2PMS A;  4H46 A;  4JB7 A;  4Q8R A;  2RKM A;  4QSD A;  5TU0 A;  2X26 A;  1DTG A;  4DZ1 A;  2O68 A;  1NV7 A;  3CIJ A;  3ODB A;  5DYH A;  4N81 A;  3P7I A;  2R71 A;  3HFU A;  2W7Y A;  2KR0 A;  5JK4 A;  4EQ7 A;  2CZH A;  4IB2 A;  3A09 A;  5H8N A;  3ILT B;  4F18 A;  5ET7 A;  1MQD A;  3PMW A;  1XI6 A;  1IXH A;  4NN3 A;  2HAU A;  3C31 A;  1SDX A;  4U4S A;  5CM6 A;  2D5W A;  2PCR A;  2Y5L A;  1MQJ A;  5M2V A;  2HXR A;  3TTN A;  1Y4T A;  1URG A;  4I9D A;  2RC7 A;  1I69 A;  5KDT A;  4LVQ A;  1EYI A;  2XXT A;  2VHA A;  4MCO A;  4EQ9 A;  1CB6 A;  4PAF A;  4N17 A;  4XIG Q;  1VFE A;  1NNF A;  3K0V A;  4QSE A;  1SPI A;  1A54 A;  3K6V A;  2FNC A;  3K4U A;  4YZZ A;  2D21 A;  3FXU A;  5I57 A;  4TLM B;  4GLI A;  2Q9T A;  5FBP A;  5CMK A;  3TCG A;  4I8C A;  2OX3 A;  4MHF A;  3Q27 A;  4AB5 A;  5H8F A;  3Q26 A;  2UVH A;  1IXC A;  1JEV A;  1WVJ A;  3IOT A;  4AB6 A;  1NUX A;  3DP4 A;  4OXV A;  3U92 A;  3D1R A;  1SW5 A;  3S9E A;  1LST A;  1Y9U A;  1CNQ A;  4OVT A;  4XF5 A;  4N6D A;  2QVU A;  3PPO A;  3O6G A;  3VLV A;  4QXD A;  2P3N A;  2F5X A;  1FQB A;  1Q9D A;  5JTY B;  5KZT A;  2I0B A;  4MEV A;  4YB6 A;  3N6U A;  3MVZ A;  2FIE A;  4C0R A;  2O69 A;  2QFL A;  1GGG A;  3T66 A;  4N6K A;  4TQU Q;  5AA1 A;  3W9V A;  3SES A;  1JET A;  1UIV A;  3KJ7 A;  4JSO A;  4KQP A;  2HQ0 A;  4O7I A;  3G3J A;  1KA1 A;  2RF1 A;  2OLB A;  2X7Q A;  4QFP A;  4RK9 A;  3GZG A;  2Q8J A;  1KA0 A;  3H4Z A;  2CZI A;  5I84 A;  1DK4 A;  1NV5 A;  1UTB A;  4P56 A;  5L8D A;  4FEC A;  5AA4 B;  1RDZ A;  4H8I A;  3ONM A;  3SEY A;  4F29 A;  4MLV A;  5JEI A;  1AMF A;  2THI A;  2CEY A;  4FOR A;  5IGA A;  3TDJ A;  1B5I A;  1D9Q A;  1MRP A;  1NH7 A;  4KYD A;  1NV4 A;  3FXQ A;  3R26 A;  5I58 A;  5CC2 A;  3TKD A;  5A5L A;  1POY 1;  4Z0I A;  1MDP 1;  1PC3 A;  4H5F A;  2GH9 A;  1B6H A;  3E13 X;  3MPL A;  1D9Y A;  2XXY A;  3U65 A;  4OEU A;  5H8Q B;  2VOZ A;  4DI3 D;  4NF5 A;  3E4R A;  4H65 A;  4BLA A;  2PFY A;  3PUW E;  3O29 A;  4K3F A;  3QUJ A;  1TT1 A;  3WAE A;  2PT1 A;  4P9K A;  3VXB A;  3L6G A;  4PE5 B;  5FHO A;  2F36 A;  4ELO A;  1K9Y A;  3SET A;  3IOV A;  3TTK A;  1OQH A;  4I40 A;  4YU0 A;  3M3F A;  1ZU0 A;  1UTH A;  4NED A;  1JQF A;  4RK2 A;  5L9M A;  2NOO A;  1B3G A;  3FAS A;  3ROJ A;  1JP4 A;  3RPL B;  4ZEF A;  1PB8 A;  2PFZ A;  1R1N A;  2VT5 A;  3PUX E;  4QFL A;  1SW2 A;  3T0J A;  4YKI A;  3EHT A;  3KN7 A;  4NWC A;  5IKB A;  3UK4 A;  1LBY A;  3KJT A;  1EU8 A;  3ZS6 A;  1N76 A;  2ZYO A;  1A40 A;  4XFE A;  4DI4 B;  2DWJ A;  4JXI A;  4U2R A;  1PB9 A;  3MP6 A;  1MPC A;  4GFR A;  5HBC A;  5I2N A;  4MNP A;  2NXO A;  3Q29 A;  1ZTY A;  4NF5 B;  2XXU A;  4G68 B;  3E3K A;  3N94 A;  2ONK E;  1ZJL A;  3LV0 A;  2OWS A;  3RT6 B;  4NTL A;  2L5V A;  3T9V A;  4JDF A;  3HPI A;  4OA4 A;  3K6U A;  3MYU A;  3B6T A;  3WAF A;  1ZLQ A;  3TCH A;  5KCJ B;  1LAF E;  2QS1 A;  1VE4 A;  1FPL A;  3AXF A;  2XWV A;  1XT8 A;  4C1T A;  1L5T A;  1UTH B;  3QXM A;  4JBZ A;  5DVF A;  4TLL B;  3MPK A;  1D9V A;  2UVI A;  4N4U A;  4OQO A;  1I6Q A;  1LB9 A;  5I56 B;  5BWJ A;  1MY3 A;  4GWZ A;  4MMP A;  4IGR A;  3JV9 A;  3V83 A;  2I0C A;  2HPG A;  4LON B;  1VSO A;  5I59 A;  1B5J A;  3W15 C;  1MY2 A;  3KBR A;  1FPD A;  2XXX A;  3KSX A;  1G0I A;  1B3L A;  2Z8D A;  4GWY A;  1Y1Z A;  3HN0 A;  5EQA A;  1Y1M A;  4PAI A;  3LUZ A;  1II5 A;  3OSQ A;  4IGT A;  4BDQ A;  3RT8 A;  3M8U A;  3IR1 A;  1FPJ A;  2RCB A;  3KN8 A;  4PGN A;  3HHG A;  1FQD A;  1XHY A;  4M1V A;  3VE1 B;  1NH8 A;  2YJP A;  1SVX B;  1NMU A;  1QUJ A;  2R8T A;  1RDX A;  2UYF A;  2JJK A;  2QMW A;  2CMO A;  4OWD A;  4PE3 A;  4ZDM A;  5F24 A;  5ITO A;  1FBP A;  3M3K A;  3D4G A;  4NQ8 A;  2XA5 A;  3TQW A;  3PPR A;  2HFB A;  1ZBM A;  3H6T A;  4XXU A;  4AS4 A;  2H98 A;  1A7L A;  1Y20 A;  5ET5 A;  1AWB A;  1MPB A;  1K9Z A;  4N8Y A;  2WKY A;  2V3Q A;  2I4B A;  3O6H A;  3CFX A;  4F3P A;  4XKN A;  3O66 A;  1A8F A;  1LAX A;  4GOT A;  5IZ1 A;  1EZ9 A;  1N3X A;  1FPF A;  4NF8 A;  4HCY A;  4Z7E A;  5CMM A;  3FBP A;  3A29 A;  4H6D A;  1DMB A;  3KZG A;  3G7W A;  2F3D A;  4GX3 A;  1P1U A;  5JTY A;  2R6G E;  4ZE8 A;  4LZ8 A;  4JWX A;  3EHU A;  3T9U A;  5CBR A;  4KCC A;  3RUM A;  4IO3 A;  1RKM A;  2VD2 A;  3OD7 A;  2P3V A;  3RTW B;  2KLF A;  1TFD A;  3KSJ A;  4KFQ A;  3V8X B;  4UA8 A;  3VDF A;  1S50 A;  2QJE A;  1PEB A;  3OSR A;  4THI A;  3TZA A;  3OO7 A;  4I3Y A;  2RC8 A;  1EZP A;  1GR2 A;  5ITP A;  1PB7 A;  4PAK A;  5DT6 A;  2AL5 A;  2OWT A;  5DTB A;  5H8H B;  3CRB A;  1SYH A;  1FPK A;  5LOM A;  1BP5 A;  2UXA A;  1ZMG A;  2ZZV A;  4NG7 A;  3BIH A;  4PFT A;  4UAB A;  2F8D A;  4PFR A;  5AA3 A;  1EYK A;  2VGQ A;  5DEX B;  3B6Q A;  3TAJ A;  4U1O A;  3H6V A;  3G3G A;  1B3F A;  3S9M C;  3EHS A;  2F3B A;  4GX6 A;  1MY1 A;  2I3V A;  2HZL A;  3QUF A;  3DP6 A;  3E79 A;  4WXJ A;  3CG1 A;  4YMA A;  2NUV A;  3I3V A;  4ZED A;  3IFA A;  1LLS A;  3ZKL A;  1EH3 A;  3CHG A;  2MKZ A;  3H6W A;  4DDD A;  4X1D A;  1QUK A;  2WX9 A;  4IY5 A;  1MXX A;  4FEB A;  3O6I A;  4OEN A;  3K6X A;  3MBP A;  2NWJ A;  4FAT A;  3T9H B;  5B7D A;  2DXY A;  3OO8 A;  3MVX A;  1MY0 A;  1LFG A;  1XC1 A;  1QW0 A;  1ATG A;  1YCJ A;  3SZP A;  4DIG A;  1FBD A;  2GQ1 A;  3C35 A;  4QSC A;  1D3K A;  5EYF A;  2DWH A;  2F7B A;  3MP1 A;  5CI5 A;  1FBC A;  4FE8 A;  1B40 A;  4IO5 A;  4F1V A;  5I57 B;  4PQJ A;  3QMF A;  3VLU A;  3QYT A;  1QGX A;  3K1M A;  2DE3 A;  2VD3 A;  4F22 A;  2DVZ A;  1NUY A;  3U8Q A;  5ICT A;  4EXK A;  1OLC A;  1FTK A;  3O28 A;  2FHY A;  2DOJ A;  4NF6 B;  4EQB A;  1SQY A;  3E78 A;  1SW1 A;  3LC8 A;  4ESX A;  4NGU A;  2V3U A;  2WBD A;  4GL0 A;  1B4H A;  4QF9 A;  2AL4 A;  1IQ7 A;  4MAG A;  2Q8M A;  1B58 A;  4ZZE A;  2XXV A;  3TYH A;  5CRY A;  2FVZ A;  5EHS A;  3W9W A;  4F19 A;  3IB0 A;  2IEE A;  3IO6 A;  1Y4C A;  3HHF A;  3RPW A;  1AH5 A;  2REG A;  1DPE A;  2Z8E A;  4YB5 A;  4IR8 A;  3OEM A;  4IO7 A;  4ISU A;  3IJX B;  2ZYK A;  3SEX A;  1SI0 A;  3ILU B;  4R72 A;  4G8N A;  4MNC A;  2OBG A;  4FIM A;  3TEP A;  3NOH A;  2FIX A;  2DE4 A;  2ZYN A;  1MH3 A;  1YYZ A;  1R9L A;  4E0W A;  4MJO A;  4F39 A;  2QS2 A;  2UYE A;  4LA9 A;  4IO6 A;  3EKI A;  3LUY A;  4P8B A;  5H8S A;  2PVU A;  1GV8 A;  3MW0 A;  3FAT A;  2A5T B;  2WYK A;  4PDD A;  4POW A;  4X04 A;  1DTZ A;  5H8N B;  2DVC A;  4QRZ A;  4X48 A;  4GWO A;  3IB2 A;  3S4U A;  3PU5 A;  4YAH X;  2AIX A;  1NI9 A;  4OHN A;  4XEQ A;  5TPA B;  4GRK A;  4HW8 A;  1FTJ A;  3FVG A;  4P47 A;  3FUZ A;  2F34 A;  1BLF A;  1P1W A;  3QSL A;  1QVS A;  4RYA A;  4KCD A;  4MFI A;  1N04 A;  4QHQ A;  1YAE A;  2ESN A;  3PUY E;  3MP8 A;  5A5X A;  4UAC A;  1I6A A;  4YB7 A;  1B51 A;  1FTO A;  2BJJ X;  1IIW A;  1OMP A;  3EPE A;  2VPN A;  4X8R A;  2F6G A;  3O2A A;  4KYE A;  5EYH A;  3N26 A;  4OTE A;  4KI0 E;  3L6H A;  4ZEI A;  3M3L A;  4I1D A;  2FBP A;  2ONR A;  4YKP A;  4FAJ A;  1B3H A;  2X7P A;  4ONY A;  2FA7 A;  4GF8 A;  5L9O A;  4RNS A;  4IO4 A;  4POX A;  3G3F A;  2B3B A;  3FVN A;  1IME A;  2M8C A;  4DXB A;  1NUZ A;  2PYY A;  3DP8 A;  5J1D A;  3VLW A;  3C33 A;  3IFC A;  1LBV A;  4KD5 A;  1PBP A;  4U23 A;  4PFY A;  4NX1 A;  1M5F A;  2F78 A;  3H6U A;  3TOD A;  1OLA A;  1XVY A;  4FED A;  1GTK A;  4XKP A;  5HM4 B;  1LAH E;  4X9T A;  5ESY A;  3PUV E;  3CG3 A;  3CSB A;  2CZK A;  3B7D A;  3TTL A;  2O84 X;  1B05 A; 
#chains in the Genus database with same CATH homology
 4HE1 A;  5DW8 A;  1QGX A;  1RDZ A;  2WBB A;  2DE3 A;  1IMF A;  1IMC A;  4M1V A;  3KC0 A;  1SPI A;  1FPK A;  1NUW A;  2DVZ A;  2WEF A;  1NUY A;  1IMD A;  1FPG A;  1NI9 A;  2R8T A;  4MIJ A;  4XFE A;  3RPL A;  4DI4 B;  1RDX A;  3RYD A;  4XEQ A;  4YZZ A;  2JJK A;  4I3E A;  4H45 A;  4HXV A;  2CEY A;  4P1E A;  2FHY A;  2ZZV A;  4NG7 A;  3BIH A;  4NHB A;  4PE3 A;  4P47 A;  4PF8 A;  4JVC A;  4UAB A;  4PFR A;  1BK4 A;  5IGA A;  5J16 A;  1EYK A;  4HE0 A;  1YZ0 A;  2Q9T A;  4PFB A;  1D9Q A;  5F24 A;  5FBP A;  5IZZ A;  1FBP A;  4PET A;  4P1L A;  2KQZ A;  4GBV A;  1VDW A;  4NQ8 A;  4PFI A;  1IMA A;  3E78 A;  1NV4 A;  2XA5 A;  2QPQ A;  1DCU A;  1FPE A;  1FSA A;  4NGU A;  2OX3 A;  4P3L A;  4G61 A;  1LBX A;  1FTA A;  4MHF A;  4AS5 A;  1FJ6 A;  2WBD A;  3B50 A;  4MNP A;  4MX6 A;  2F3B A;  5ET8 A;  4GX6 A;  5A5L A;  4F1U A;  4N15 A;  5EYG A;  2HZL A;  4AS4 A;  3E79 A;  1LEV A;  2HZK A;  5IM2 A;  4MAG A;  2Q8M A;  4PBQ A;  4NAP A;  1FBH A;  1NUX A;  4H46 A;  2WYP A;  5ET5 A;  3LV0 A;  1AWB A;  1NV3 A;  4GWU A;  5IZ3 B;  2L5V A;  1K9Z A;  2B4M A;  2FVZ A;  4N8Y A;  4PBH A;  3W9W A;  5EQ8 A;  1IMB A;  2DE2 A;  5I3S A;  3D1R A;  4F19 A;  3IFA A;  3MST A;  2Q74 A;  2V3Q A;  5LTC A;  4JVI A;  3MYU A;  4OA4 A;  1CNQ A;  2VPN A;  4HE2 A;  4N6D A;  4OVT A;  4X8R A;  2QVU A;  4XF5 A;  4DI3 D;  5LDZ A;  3CHG A;  2BJI A;  3B8B A;  4QXD A;  2P3N A;  5EYH A;  2MKZ A;  2F5X A;  1FJ9 A;  4GWS A;  2XXK A;  1FBE A;  1FRP A;  1Q9D A;  1FPL A;  1RDY A;  2PFY A;  4O7M A;  1LBZ A;  2WX9 A;  4O8M A;  2XWV A;  4OVS A;  1NV6 A;  1NV7 A;  2FBP A;  5IZ3 A;  4LN5 A;  4N81 A;  1KZ8 A;  1FPI A;  5IZ1 A;  2QVR A;  4P9K A;  4MEV A;  1NV0 A;  4HCW A;  3HFU A;  5EQ7 A;  2ZZW A;  4N4U A;  2KR0 A;  5JK4 A;  2CEX A;  1DBZ A;  2CZH A;  2XWI A;  1FPF A;  1LBW A;  4HCY A;  1K9Y A;  2XWO A;  4MNC A;  4PCD A;  5ET6 A;  3T1B A;  2FIE A;  4PTK A;  5EQ9 A;  2Y5K A;  4I40 A;  4PGP A;  3FBP A;  5I5P A;  4PF6 A;  3A29 A;  4F18 A;  4YIC A;  5ET7 A;  5T3J A;  2QFL A;  4GWZ A;  1G0H A;  4NF0 A;  4MMP A;  2DDK A;  3ISP A;  3NOH A;  4N6K A;  4OVR A;  2FIX A;  2V4C A;  1XI6 A;  2DE4 A;  3W9V A;  4IR8 A;  2B4L A;  1NV1 A;  1IME A;  1YYZ A;  4GBW A;  4NN3 A;  3PTY A;  2HPG A;  1NUZ A;  4OVP A;  2F3D A;  4GX3 A;  4MJO A;  4PC9 A;  3FXB A;  1FBG A;  5J1D A;  4OAN A;  3SZP A;  3GYY A;  3IFC A;  4GWW A;  1LBV A;  1FBD A;  1EYJ A;  5CM6 A;  2ZZX A;  5I7I A;  3EKI A;  1YXI A;  2GQ1 A;  2PCR A;  2Y5L A;  2XWK A;  4GX4 A;  4P8B A;  3U65 A;  4NX1 A;  1FPD A;  4O7I A;  3KC1 A;  2HXR A;  2OWZ A;  1KA1 A;  1FBC A;  2HHM A;  1G0I A;  4JVD A;  4GWY A;  4OVQ A;  5EQA A;  4MNI A;  3ROJ A;  1JP4 A;  2P3V A;  2VPO A;  2PFZ A;  2WYK A;  4PAI A;  4PDD A;  3RPL B;  2VT5 A;  4X04 A;  3LUZ A;  1NV2 A;  4X9T A;  4F1V A;  4FBP A;  5ESY A;  1EYI A;  1FBF A;  1KA0 A;  4GWX A;  3QMF A;  4QBA A;  3T0J A;  4N91 A;  2CZI A;  1INP A;  1FPJ A;  3KBZ A;  1NV5 A;  1DK4 A;  1LBY A;  4KXP A;  4MCO A;  4N8G A;  2QVV A;  3BIG A;  2CZK A;  4O94 A;  4PDH A;  1FPB A;  4I3Y A;  4PAF A;  4PGN A;  4P56 A;  4N17 A;  4PAK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...