2XXUA

Crystal structure of the gluk2 (glur6) m770k lbd dimer in complex with glutamate
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
248
structure length
248
Chain Sequence
SLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKGTPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPKGSPYRDKITIAILQLQEEGKLHMMKEKWW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Conformational Flexibility of the Ligand-Binding Domain Dimer in Kainate Receptor Gating and Desensitization
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein
molecule keywords GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 2
total genus 86
structure length 248
sequence length 248
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-11-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2xxuA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2xxuA02
1QKAA 1B3EA 4Z7EA 5I56A 1IEJA 4BDQA 4KYDA 1UTBA 3U72A 1B5JA 5HPQA 4H5FA 1HSJA 4ZEIA 2B3BA 5EHMA 1IIWA 1FTJA 2ONSA 1QUJA 3TPAA 2VD3A 2I0BA 2A5SA 2XX8A 3CFLA 3VFJA 3CG3A 1HSLA 1ELJA 2F7AA 3TCGA 4F19A 1LSTA 2ZYMA 1B51A 1URSA 1VFDA 4OQOA 4OTEA 1WVJA 4QHQA 5EHSA 5ITOA 3TTNA 4F29A 5JK4A 3D4CA 1BP5A 1SBPA 2OLBA 3CVGA 3T96B 4YKJA 1FQFA 2DE3A 3FJGA 4MFIA 2IA4A 3MZBA 4AQ4A 4ELPA 2RC8A 2CMOA 4UA8A 1SW4A 3PMWA 3IJOB 1JETA 3OO8A 3H7MA 4PFWA 3N6UA 2RINA 1AL3A 1DOTA 1B1HA 4LA9A 1N3XA 2O7UA 1B6HA 4KQPA 1A8FA 3LSFB 3Q28A 4TOZA 3H4ZA 5H8QA 3FXQA 3PGFA 4NF5A 5DVJA 2F7CA 2DQVA 3ECRA 3EHUA 3KSXA 2PMSA 3IOUA 3QAXA 4H8JA 3T22A 3ZS6A 4FATA 1MDQA 1EH3A 4KYEA 2I0CA 1BLFA 3G3GA 2XXVA 3ILUB 3M3LA 4PP0A 3O28A 1S7YA 1MQIA 1YTVA 3PV0E 1N84A 3S9NC 3CRBA 1M5FA 2KLFA 3TQLA 3EHSA 4OFOA 2AL4A 1SD3A 1MY4A 2Q89A 1B46A 1OLCA 2ZNUA 5CMMA 3FVGA 2X7PA 1B3FA 1GGGA 2H98A 4NMYA 3IO6A 4BDOA 1B0LA 4H5GA 4DDDA 2O51A 1QJMA 2RCBA 4YB5A 3TELA 5AE4A 4TLLB 2GRVA 1LFGA 3E13X 1MS7A 3N94A 5A5XB 2QS3A 3IAZA 3S2VA 2ANJA 3R26A 5JTYB 3T9UA 3K1MA 2OWTA 4XKPA 3AXFA 4R6HA 5I57A 1D9VA 1EU8A 3MWBA 5TPAB 1O63A 4NE4A 2XD2A 4NF8B 3ODBA 3VDFA 1ZLQA 1Y3NA 2XXPA 3W15C 2NVUB 1PBPA 3O66A 3V89B 3V83A 4OXVA 1Y9UA 3JZJA 1I6BA 4ESWA 1B52A 1YPNA 4MH5A 3OSRA 1A7LA 1GR2A 3LSWA 2RCAA 3SERA 1SYHA 1QW0A 4PQJA 5H8NB 4OETA 2GFEA 3MBPA 1IZ1A 3PD9A 3TTKA 2NWJA 1A99A 1UTHB 1D3KA 4G68C 4ZE9A 1VFEA 2UVHA 3RQTA 2PVUA 3LR1A 1S50A 1ZBMA 2YLNA 3MVWA 1P1NA 5DYHA 3HO7A 2I3VA 4X48A 3OO7A 5A5XA 4MLVA 3I3VA 1Y1MA 2XD3A 3U8QA 2VGQA 3BFTA 3M3FA 5AA3A 2RC9A 5J1DA 1SI0A 3OD7A 4YKIA 5FHOA 2H99A 3OEMA 4RY1A 5I57B 3H6VA 2HZKA 2H25A 2YPNA 4LONB 4GL8A 1SYIA 5ICQA 2QS2A 1US5A 3PUWE 3H6UA 3H3GA 1MXVA 3GZGA 3MW0A 4G2ZA 1B32A 1JVXA 4PETA 4R2BA 1A40A 4R6KA 4FAJA 4O3CA 2QPQA 4EF2A 5I56B 4U23A 2OK2A 4BDLA 1FQAA 3HHGA 3A3CA 1VE4A 4PFTA 4F31B 3T9HB 5EYFA 4WEDA 3UIFA 4KFQA 4QFPA 4OEVA 3TTRA 2DWJA 3K01A 3R6UA 4XXUA 3JYRA 4KI0E 2XXRA 4H6DA 4FJPA 3DP4A 4GLIA 4LZ8A 4FEBA 5H8QB 4IGTA 1YCJA 1USYH 3C31A 4P11A 4OERA 3TTMA 5DEXA 3L6GA 4YMBA 1IXIA 2Y84A 3IOVA 4F3GA 4G68A 3S9LC 1B58A 1LAFE 1LCTA 1P1QA 2XXUA 2ZNTA 3FJ7A 2HXWA 3OSQA 3FV2A 1IQ7A 4C1TA 2F5XA 2G29A 5ISUA 1NL5A 1SVXB 2DVZA 1LAGE 1N04A 2PT2A 3MUQA 4XKQA 1S9TA 2XX7A 1H76A 4LQ2A 4F3BA 3K6WA 3RTFB 2D21A 2ZYKA 2DOJA 3PUXE 3UA8A 1KWHA 3A3UA 3MP1A 1TFDA 1TT1A 3CG1A 2GHAA 3H6WA 1TFAA 2ONRA 1R9QA 4N13A 4NF8A 4LATA 5CI5A 5JEIA 2DXYA 1N7XA 2DSFA 2HAUA 1JW1A 3D4GA 4THIA 3RT8A 4AB5A 3L6HA 3VLUA 5DVFA 2NOOA 5FTIA 1D9YA 2P1SA 3M3KA 5L9SA 1DPPA 3ZKLA 2GH9A 2ZXTA 2ZYNA 1VSOA 4OVJA 4Z0IA 1MM7A 2I4BA 2V3TA 2XXIA 4FIMA 3W9VA 4RYAA 2F6PA 3DP8A 3LBSA 4ELOA 3FV1A 1II5A 1Y4CA 1MQHA 3OENA 3ZSFA 3TCHA 4BDNA 1UIUA 1B4HA 1D4NA 1P1UA 3U94A 2O6AA 1ZJLA 1NH8A 3IOTA 2Z23A 3KEIA 3FJMA 2GHBA 4RK2A 4RXLA 1GTKA 4F39A 4F2OA 1H44A 4G4PA 1DTZA 4MLQA 4YZZA 1FQBA 4F18A 5I59B 4RNSA 4P0IA 5H8SA 4C0RA 1URGA 4DIGA 5AA4B 4OMBA 3TKDA 1OIBA 1Z7NE 1DSNA 2Z8DA 3IO4A 3M8UA 1M5EA 2HAVA 4WEPA 1LGBC 3CFZA 5ELVA 4DXUA 1Y1ZA 4ZS9A 3CI8A 4GOTA 2VOZA 3VLVA 3VVEA 3RT6B 5AA2A 2O69A 1A54A 4KR5A 4P0GA 2DP8A 3G7WA 4GRKA 2DE4A 5AA1A 1NFTA 3SEWA 4JWXA 1OQGA 2UYEA 1MRPA 3A09A 3O97A 5FTHA 3RGYA 2QS4A 4FEDA 4BLAA 1LFHA 4R73A 5I84A 1MY2A 1Y3PA 1UTHA 4NTLA 1F9BA 3IX1A 3OO6A 4L17A 3HSTA 4G77A 1N76A 2XXQA 1LBCA 1FTLA 4ZE8A 3T66A 1QUKA 4NF6B 2F7BA 1XHYA 4LZ5A 1XVXA 3MVYA 1B3GA 4X1BA 1OMPA 3BFUA 4EXLA 1I69A 1LAXA 1SW5A 3SEYA 3IB2A 5IAIA 1IXGA 4TLMB 2V84A 1MY3A 3IR1A 5KCJA 4GF8A 5TPAA 1UTBB 3FASA 3KG2A 1LFIA 1JNFA 1R9LA 3K1NA 1B1XA 1OLAA 2DWIA 2XXYA 1P1OA 4JDFA 3H6TA 4LZ7A 4ND9A 4ZZAA 3RY3A 2X7QA 3PUVE 4KYSA 1B7UA 2VHAA 4OFLA 3TQWA 5I58A 4ELQA 3O2AA 3FVKA 4G8NA 1B5IA 2UXAA 1R1NA 2DYXA 2LAOA 4X1DA 3RPWA 4KHZE 1P99A 1OQHA 4U4SA 2Q8JA 3SEXA 3SETA 3VVFA 4NF4A 4R9GA 2YJPA 5L8DA 3TTLA 3OOAA 3K4UA 4JSOA 4NWDA 3IORA 1XVYA 1NNFA 1NNTA 2DVCA 3E9XA 2E0SA 1B7HA 1POY1 1DTGA 1LB9A 1QVSA 3KBRA 3QSLA 5KCJB 3U93A 5L9OA 4AB6A 5LOMA 1CE2A 2XXWA 3FVOA 1MY0A 1B3LA 2RF1A 4RA1A 4YKPA 4EQ9A 3Q29A 2O84X 2Z8FA 4EDPA 3C32A 3V5AA 1B2HA 4R2FA 1QKBA 2I48A 2XXHA 1Y20A 1O7TA 3VE1B 5TP9A 3CSGA 5H8HA 1JW4A 3TMGA 1FTKA 4OHNA 3QUFA 3F11A 4KCDA 3U92A 3K2DA 4Q30B 3E3KA 4U21A 4YAHX 2Q9TA 2DXRA 3GBBA 3PPOA 1NNPA 4H8IA 4ZEFA 3KN7A 4ZEBA 5KZTA 5AA2D 3MVZA 1AOVA 1B9JA 3MPKA 3HHFA 4GL0A 2ABHA 3UK4A 4NF5B 2Y7WA 1SI1A 3CFXA 3KGCA 3PMVA 3O9PA 4ISUA 4N07A 4YB7A 1O64A 4PFUA 4F22A 3CSBA 3K6XA 1OVBA 4DCYA 5I58B 1B7ZA 4IO2A 3UN6A 3T93B 5TP9B 4BDMA 2Z8EA 3Q26A 3EQ1A 3SDFA 3KSJA 3EPEA 5CBRA 2F8DA 5F1QA 3KOTA 1H3DA 4IO6A 5I59A 1MH4A 4DCXA 5KDTA 4ZECA 2NUVA 3MAMA 3PPRA 3S9EA 1M5BA 1MQJA 2D3IA 1EZOA 1T0KA 1ZKBA 4GVOA 4EUOA 4OWDA 4G68B 2ZYOA 1USYE 1A8EA 1MG1A 2AL5A 3K1PA 3O29A 3ONMA 4PE5B 3C33A 4Q0CA 3QK6A 5I2KB 3IB0A 4RPOA 4F1YA 3JV9A 1N7WA 1Q35A 2ESNA 1RYXA 3LSLA 4ZZEA 3RN8A 2F6GA 2HEUA 3BKIB 2FYIA 4R9FA 1FQEA 1MY1A 3K6UA 1I6QA 3KJ7A 3G3KA 1EZPA 4ZDMA 1FQDA 1XC1A 2F78A 4JBZA 2OCUA 4QFLA 4LQ5A 4RJZA 1FW0A 4U1OA 2XXXA 4YB6A 5DVIA 3RLFE 2A5TA 3HCQA 2UVJA 4DZ1A 1B05A 4FECA 4OFJA 4E0XA 4H0WA 1MH3A 2Q2AA 1DPEA 2HCAA 1N0TA 2FA7A 2RC7A 4IY5A 3FVNA 1PB9A 4QF9A 4QFKA 3PPPA 2QJEA 2IEEA 4XIGQ 4YU0A 4DXCA 4GWOA 1LCFA 4H1XA 4DXBA 1TWYA 3SKPA 3TFLA 5I2KA 3SESA 3USDA 1FQCA 3G3HA 3MP8A 3MZ1A 3Q27A 3VXCA 5CM6A 4BDRA 1JW5A 3GBAA 1JVYA 4JWYA 2VD2A 3MC2A 2F36A 4PFYA 5B7DA 1AMFA 4YICA 4NF6A 1MPCA 4QFNA 3TEPA 4U22A 3C36A 3O6HA 1N3WA 1YAEA 3FXUA 3TODA 3U1OA 4JXIA 4POWA 4O3BA 3KN3A 1XS5A 3G3FA 4OENA 1H45A 2B3FA 1AH5A 5L9MA 2D5WA 1IXCA 2REGA 3HV1A 3PPNA 4F2QA 2M8CA 3E4RA 4HCYA 5ITPA 2G93A 5AA2B 3MP6A 2XX9A 1PBQA 4I62A 3N5LA 2QL3A 5CMBA 5DEXB 3LSXA 3O6IA 4M4GA 4Q8RA 3PMXA 4GXAA 4R75A 3TUSA 2UVIA 3TDJA 2AYSA 3TYHA 4G8MA 2ALUA 1ZU0A 2I58A 2V3UA 3S4UA 5AA4A 1J1NA 3HPIA 2I4CA 2XHDA 5CRYA 4XKNA 3UGWA 1FTMA 1MQGA 2Q88A 3FD3A 3PPQA 4LP2B 3H06B 4IY6A 5JTYA 4O3AA 3VXBA 3HN0A 2ONKE 4MF3A 3DLNA 2O68A 1SQYA 3TAJA 3PUYE 5I2NA 1RYOA 4U4XA 4EF1A 4EQ7A 4ECFA 2Y7KA 4IO5A 3T9VA 1TXFA 1BKAA 2DS9A 4R74A 4H65A 4HCWA 2QS1A 4OYVA 4POXA 1Y4TA 3EHTA 3Q25A 1RKMA 2QMXA 2I3WA 1WDNA 3C35A 4NF4B 3V8XB 1M5CA 5BUUA 4FORA 3FGSA 2HFBA 4F1VA 3C34A 3MJNA 4M1VA 1MQDA 5DTBA 1MXXA 1EZ9A 3WAEA 2ZNSA 4F3PA 3OXNA 4QRZA 3KZGA 2QRYA 3N26A 3IB1A 1GVCA 3RUMA 4LUBA 3THIA 4LVQA 4EQBA 5KDTB 5K2YA 3QIMA 4HS7A 3R7XA 5CBSA 3KJTA 5H8HB 1PDAA 3B7DA 2H4IA 3LC8A 4ZEKA 2PX1A 2F35A 3TZAA 2F34A 2DWAA 3LUYA 1BTJA 5K2XA 3BBRA 1NMUA 1B3HA 3OELA 4G8HA 2BJJX 1R6ZA 3PU5A 3VVDA 1SW1A 1FCKA 2Z22A 5CMCA 5F7VA 3RNNA 1IXHA 2ZMBA 1NH7A 2QMWA 4Q5TA 1A55A 1XT8A 4XTCQ 3ZKKA 1MXYA 1B0HA 2Y7RA 3DELB 4IB2A 1IITA 3FZVA 4QSCA 4TQUQ 1SW2A 3B6TA 3DM0A 1MXWA 2RKMA 4I8CA 2R9JA 4F3SA 1B4ZA 1HSEA 4RPNA 4RK9A 4JB7A 1BIYA 1MXUA 4GXSB 1QUIA 3EF7A 3K6VA 4UACA 5CMKA 2V3QA 3EN3A 3FUZA 4U1ZA 4GFRA 1L5TA 3H03A 5TU0A 3RTWB 4HW8A 4K3FA 2REJA 2HQ0A 4R72A 4OZ9A 3KOSA 4I1DA 1ZIUA 4JSDA 1JEUA 1MPDA 2Q2CA 2UYFA 3UORA 2DE2A 2A5TB 1PC3A 1ANFA 1URDA 1B40A 1MM6A 1Q1KA 3PD8A 1JEVA 4C1UA 2P0SA 4R6YA 3K00A 4GQOA 2V25A 3VLWA 1AIVA 5HM4B 2P2AA 3I6VA 3IJXB 1LBBA 2X26A 3OMBA 3QXMA 2PT1A 4IO4A 4WKMA 1OVTA 2DWHA 4ONYA 1CB6A 2THIA 3KN8A 3QUJA 2OZZA 3G3JA 1LAHE 1P1WA 3FXRA 1WODA 1MXZA 4ELRA 2H5YA 1LLSA 2PYYA 3CR9A 1ATGA 2CZLA 1NKXA 1IUDA 2Y7PA 3K02A 4IO7A 4NEDA 2WKYA 5IKBA 2F97A 3MVXA 3OO9A 4MBPA 3WAFA 3G3IA 1JQFA 5H8FA 2V93A 2OWSA 1UIVA 1Z7ME 5HBCA 3MZ9A 1SDXA 3S9MC 4QSDA 4GIZA 1DMBA 1NNKA 3IL1B 4HTGA 2UVGA 2VP1A 2NXOA 2AIXA 2HZLA 3PUZE 1B5HA 1POTA 3SEVA 2FNCA 3I5OA 5H8NA 2QSXA 4IO3A 4I9DA 4H67A 1QULA 3UP9A 5M2VA 3B6WA 5FHMA 1PB7A 4ZEDA 2PBWA 2XXTA 4YMAA 3IK6B 3IOWA 4NWCA 1FTOA 3QYTA 2R6GE 4QFOA 4DLDA 3MPLA 1H43A 3SEUA 1PEBA 2OJTA 3KFMA 3P7IA 3DP6A 1VR5A 1MDP1 2R71A 3CIJA 1XOCA 2I49A 1M5DA 4KCCA 3VV5A 4ESXA 4GD5A 2O1MA 3W9WA 1PB8A 1ZMGA 2O7IA 3C9HA 3O6GA 4N6PA 3OEKA 5ICTA 2OBGA 4WXJA 2I6EA 3N6TA 5DT6A 4IGRA 1ZTYA 4DE8A 3FATA 5B70A 1I6AA 2O1LA 3GLBA 3B6QA 5H8FB 2W7YA 1MPBA 4KPTA 4X9TA 2B65A 3MQ9A 4F1UA 1GV8A 2Y7IA 1US4A 4U2RA 4YKKA 1LB8A 3T9XB 2H9BA 3K0VA 4JWOA 3TCFA 5CC2A 4FE8A 5FHNA 4E0WA 4EXKA 3FIRA 1Y3QA 4OESA 3C4MA 4OEUA 5BWJA 2E1SA 4KD5A 4QSEA 4XKRA 3ILTB 1UQWA 3GXAA 5I2NB
chains in the Genus database with same CATH superfamily
1B3EA 4KYDA 4ZEIA 3TPAA 2I0BA 3VFJA 3CFLA 4F19A 1LSTA 2HPGA 1WVJA 5ITOA 5JK4A 4MMPA 1SBPA 3CVGA 2CZKA 1SW4A 3H7MA 4PFWA 4LA9A 1N3XA 1B6HA 4KQPA 1A8FA 3LSFB 3Q28A 4UABA 2F7CA 3T22A 4DCYA 3IOUA 1MDQA 4KYEA 2XXVA 1S7YA 1MQIA 1YTVA 3EHSA 2Q89A 2JJKA 5ESYA 3KC0A 4BDOA 2O51A 1QJMA 4XF5A 2GRVA 2MKZA 4XKPA 5I57A 4GWSA 4H45A 2XD2A 5A5LA 1EYKA 1FPBA 3LSWA 2RCAA 4PQJA 3MBPA 1IZ1A 1UTHB 1D3KA 1VFEA 5DYHA 3HO7A 1FBFA 4MLVA 3I3VA 3U8QA 1FPIA 4OVQA 3OD7A 4RY1A 2YPNA 4GL8A 5KZTA 3PUWE 4MAGA 1MXVA 4R6KA 3MW0A 5I58B 1JVXA 4QXDA 1FSAA 5I56B 1A40A 2QPQA 4BDLA 1FQAA 4PFTA 5T3JA 4QFPA 3TTRA 3K01A 4XXUA 3JYRA 2QFLA 2FVZA 4PDDA 5DEXA 3L6GA 3IOVA 4F3GA 1LCTA 2F5XA 2DVZA 1N04A 2PT2A 3MUQA 4XKQA 1S9TA 1H76A 4F3BA 2D21A 2ZYKA 1KWHA 2GHAA 2ZZXA 4LATA 2HAUA 3RT8A 5FTIA 4GX6A 5L9SA 1DPPA 3CHGA 1NUZA 4Z0IA 1MM7A 3SZPA 2V3TA 4RYAA 3DP8A 1JP4A 4OANA 1VDWA 3FJMA 4H46A 4F2OA 5I59B 5AA4B 1EYJA 4ZS9A 1A54A 4P0GA 3G7WA 4GRKA 2QS4A 4BLAA 5I84A 4PBQA 4O7MA 1SPIA 4HE0A 1N76A 2XXQA 4ZE8A 4GBWA 1FPEA 1XVXA 3MVYA 3BFUA 1I69A 1SW5A 3SEYA 4TLMB 1UTBB 4LZ7A 2DWIA 4ELQA 3RY3A 1P1OA 3H6TA 2X7QA 3FVKA 4X1DA 3VVFA 1P99A 1OQHA 5L8DA 3OOAA 1NNFA 3E9XA 1B7HA 3KBRA 3QSLA 5LOMA 4AB6A 2XXWA 4EQ9A 2Z8FA 1B2HA 2XXHA 5TP9A 3U92A 4OHNA 5IGAA 4YAHX 2Q9TA 4H8IA 3MVZA 4NF5B 2Y7WA 1SI1A 3KGCA 3PMVA 4ISUA 3O9PA 4JVIA 1B7ZA 4IO2A 3SDFA 5ET6A 1QGXA 2Q74A 4IO6A 5KDTA 4ZECA 2NUVA 3PPRA 1MQJA 4N8YA 4G68B 4Q0CA 2AL5A 4F1YA 3JV9A 1N7WA 2ESNA 3RN8A 4R9FA 1FQEA 4PC9A 1FQDA 5DVIA 4U1OA 2XA5A 2XXXA 4OFJA 1MH3A 1IMFA 2Q2AA 1DPEA 2RC7A 4IY5A 3PPPA 1LCFA 4DXBA 1TWYA 1FQCA 1FRPA 3G3HA 3MP8A 5CM6A 4JWYA 5B7DA 1AMFA 4GX3A 4QFNA 3TEPA 5ET7A 3FXUA 4O3BA 2D5WA 2REGA 3HV1A 3E4RA 5AA2B 3MP6A 4I62A 2OWZA 1XI6A 3O6IA 4M4GA 4Q8RA 4R75A 1LBVA 4NF0A 2R8TA 3TDJA 2V3UA 5ET5A 1KZ8A 2FBPA 1J1NA 2XHDA 3KBZA 1FTMA 2Q88A 4LP2B 4IY6A 4PGPA 3DLNA 1IMEA 4PDHA 1BKAA 2DS9A 4POXA 3EHTA 1RKMA 3C35A 5BUUA 4M1VA 4N4UA 2ZNSA 2QRYA 3RUMA 4LUBA 5KDTB 4HS7A 3B7DA 2H4IA 3LC8A 3TZAA 2DWAA 1BTJA 4Q5TA 1NH7A 2QMWA 3ZKKA 3DELB 5L9MA 1IITA 4QSCA 2RKMA 1HSEA 1LBWA 4OVRA 4RPNA 1QUIA 4UACA 3EN3A 4MEVA 4GFRA 2HQ0A 1JEUA 2UYFA 1PC3A 1URDA 1MM6A 5F24A 2P0SA 1D9QA 2P2AA 3I6VA 4IO4A 2X26A 2V4CA 4ONYA 1CB6A 4P8BA 1LAHE 1P1WA 4HXVA 4ELRA 1FPFA 1ATGA 3K02A 1IUDA 5H8FA 1SDXA 3S9MC 4GIZA 3IL1B 4HTGA 2Y5KA 3PUZE 4PE3A 5H8NA 3IK6B 4NWCA 4DLDA 3MPLA 3DP6A 1MDP1 4AS5A 4WXJA 1ZTYA 4DE8A 1I6AA 1IMAA 3B6QA 4U2RA 3K0VA 4FE8A 3FIRA 1Y3QA 1FTAA 5BWJA 3BIGA 4KD5A 4QSEA 4G4PA 1UQWA 3GXAA 1IEJA 2XXKA 3U72A 1B5JA 4H5FA 2B3BA 4P1LA 3CG3A 1HSLA 1ELJA 2QVVA 1URSA 4OTEA 1VFDA 4QHQA 3TTNA 5EYHA 5FBPA 3T96B 1FQFA 2IA4A 3IFAA 3MZBA 4ELPA 1INPA 4UA8A 1JETA 2RINA 4TOZA 3FBPA 3FXQA 3PGFA 2DQVA 4H8JA 3QAXA 1EH3A 1BLFA 3G3GA 3S9NC 3PV0E 3CRBA 1M5FA 2KLFA 4LN5A 4OFOA 1SD3A 1MY4A 1OLCA 2ZNUA 1B3FA 3IO6A 3E13X 1LFGA 1MS7A 2QS3A 4QBAA 3MWBA 1O63A 4NF8B 2XXPA 3W15C 4OXVA 1Y9UA 1I6BA 5H8NB 5EYGA 3PD9A 4G68C 4PF6A 4MIJA 2PVUA 1S50A 4PCDA 3MVWA 4X48A 3OO7A 3M3FA 5FHOA 2H99A 3H6VA 4MCOA 4P56A 3H6UA 4FAJA 4R2BA 3HHGA 1NI9A 3A3CA 1VE4A 4F31B 4WEDA 4P9KA 2XXRA 4FJPA 3C31A 4P11A 4OERA 2OX3A 1IXIA 2Y84A 1P1QA 1LAFE 2VT5A 3OSQA 4C1TA 5ET8A 2DOJA 3PUXE 3MP1A 1TT1A 4NF8A 5CI5A 1FBEA 3D4GA 1N7XA 4THIA 1JW1A 2NOOA 4N81A 2CEYA 3M3KA 2GH9A 1VSOA 4OVJA 2I4BA 3LBSA 4ELOA 1II5A 4NX1A 1MQHA 3ZSFA 4DI3D 3U94A 2O6AA 1ZJLA 3IOTA 1H44A 1DTZA 4YZZA 4C0RA 1URGA 4DIGA 4OMBA 2Z8DA 1NV2A 2HAVA 4GOTA 2VOZA 4PFIA 3RT6B 5IZZA 2UYEA 1MRPA 3O97A 1MY2A 3OO6A 5LTCA 3HSTA 4OA4A 4G77A 5EQ8A 2F7BA 4X1BA 4EXLA 2V84A 3IR1A 5IZ3B 5TPAA 4N17A 1OLAA 4JDFA 4ZZAA 4KYSA 4OFLA 3O2AA 2UXAA 2LAOA 4JVCA 3SEXA 1DK4A 4KHZE 4U4SA 2Q8JA 4R9GA 2YJPA 4JSOA 4NWDA 1XVYA 4QSDA 2DVCA 4PTKA 2E0SA 5L9OA 1B3LA 2RF1A 4RA1A 4EDPA 3V5AA 2CZIA 1Y20A 1O7TA 1JW4A 4MNIA 4KCDA 3K2DA 3E3KA 4U21A 2DXRA 4ZEFA 3KN7A 1B9JA 3UK4A 2ABHA 4YB7A 1O64A 4PFUA 3CSBA 1FBPA 2Z8EA 3Q26A 3EPEA 2F8DA 5F1QA 3KOTA 1H3DA 5I59A 4NHBA 2WYPA 1M5BA 3ROJA 2ZYOA 1FPDA 4OVTA 2F6GA 1I6QA 1EZPA 2F78A 1FBHA 2OCUA 4QFLA 4LQ5A 4RJZA 4IR8A 2HHMA 3HCQA 4E0XA 2HCAA 4QF9A 4DXCA 4YU0A 2IEEA 2XWIA 3TFLA 3SESA 3USDA 4NAPA 3VXCA 4NN3A 1JW5A 4HE1A 2VD2A 3MC2A 4U22A 3TODA 1XS5A 5AA1A 3G3FA 1H45A 4F2QA 1IXCA 3PPNA 2VPNA 2QL3A 5CMBA 5DEXB 2P3NA 3LSXA 3PMXA 3D1RA 2UVIA 4G8MA 3U65A 2ALUA 5AA4A 3HPIA 2WEFA 5CRYA 4XKNA 3UGWA 1MQGA 3FD3A 2FIXA 4EQ7A 5J16A 4ECFA 3T9VA 1TXFA 2F3BA 4H65A 4HCWA 4OYVA 2ZZWA 3Q25A 4O94A 1WDNA 1G0HA 4F1VA 3C34A 2F3DA 5DTBA 1MXXA 4F3PA 4QRZA 3N26A 3IB1A 4EQBA 4LVQA 3QIMA 3R7XA 5CBSA 1PDAA 4ZEKA 2F35A 3LUYA 5DW8A 5K2XA 3BBRA 2B4MA 2BJJX 1SW1A 3RNNA 1IXHA 2ZMBA 4F22A 1XT8A 1FPLA 2Y7RA 4IB2A 3FZVA 1SW2A 4F3SA 1MXWA 2R9JA 3MYUA 4GXSB 3K6VA 5CMKA 1L5TA 3H03A 3T0JA 2REJA 5I5PA 1KA1A 3BIHA 2Q2CA 1JEVA 4PGNA 2Y5LA 1IMDA 5HM4B 2PT1A 3KC1A 2THIA 2OZZA 1MXZA 3CR9A 3LUZA 4IO7A 1NKXA 4NEDA 5IKBA 2F97A 4MBPA 3G3IA 1JQFA 2V93A 1Z7ME 3MZ9A 2KR0A 1DMBA 2AIXA 1B5HA 1EYIA 3I5OA 5IZ3A 4I9DA 4H67A 3B6WA 4P3LA 4X8RA 3IOWA 1FTOA 1PEBA 3CIJA 3VV5A 4ESXA 2O1MA 1PB8A 5DT6A 4IGRA 5H8FB 2W7YA 3PTYA 4YKKA 1LB8A 1FPGA 5FHNA 4EXKA 1FJ6A 5I7IA 4Z7EA 1UTBA 5EHMA 2ONSA 2F7AA 3TCGA 2ZYMA 4OQOA 4F29A 3D4CA 1BP5A 2OLBA 2DE3A 4MNPA 2RC8A 3PMWA 3IJOB 3OO8A 1AL3A 1DOTA 1B1HA 2O7UA 4DI4B 1YYZA 4NF5A 3KSXA 2PMSA 2I0CA 4N6KA 3M3LA 4PP0A 3O28A 5EQ7A 1N84A 2AL4A 2X7PA 1GGGA 4NMYA 1B0LA 4YB5A 2RCBA 5AE4A 3TELA 4GWXA 5A5XB 3N94A 3IAZA 3R26A 2OWTA 1D9VA 5TPAB 4NE4A 3ODBA 2NVUB 3O66A 3V83A 2ZZVA 3OSRA 1A7LA 1GR2A 1QW0A 3TTKA 2NWJA 1A99A 2UVHA 2YLNA 1P1NA 2XD3A 1LBZA 3BFTA 1IMCA 5AA3A 5J1DA 2XWOA 2HZKA 5ICQA 1US5A 3H3GA 4G2ZA 4PETA 1B32A 2HXRA 4EF2A 1NV5A 4U23A 2QVUA 5EYFA 2QVRA 3UIFA 4KFQA 4OEVA 1KA0A 2DWJA 4KI0E 1RDZA 4H6DA 3DP4A 4LZ8A 4O7IA 5H8QB 1USYH 3TTMA 3NOHA 4YMBA 4G68A 1B58A 1NL5A 1SVXB 1LAGE 1K9YA 3RTFB 3E79A 5EQ9A 3UA8A 3A3UA 1TFDA 1TFAA 2ONRA 1R9QA 5JEIA 2DXYA 4AB5A 2P1SA 3W9VA 2XXIA 3QMFA 3OENA 3TCHA 1P1UA 2Z23A 2GHBA 4GWWA 1GTKA 4MLQA 1FQBA 5H8SA 3TKDA 1OIBA 3M8UA 1M5EA 4WEPA 3CFZA 4DXUA 3CI8A 5AA2A 4KR5A 3SEWA 4I3YA 4NTLA 2PFZA 1F9BA 3IX1A 4L17A 1FTLA 3T66A 1G0IA 1XHYA 1B3GA 1LAXA 3IB2A 1IXGA 1MY3A 4GF8A 1JNFA 1B1XA 3TQWA 2VHAA 5I58A 1R1NA 3SETA 3K4UA 3H6WA 1QVSA 5KCJB 1LB9A 3IFCA 4PAIA 3C32A 4N15A 4R2FA 3VE1B 4N8GA 4G61A 3TMGA 3GBBA 3PPOA 5AA2D 1AOVA 1CNQA 3A29A 1NUWA 1NUYA 3K6XA 3UN6A 3T93B 5TP9B 4BDMA 3EQ1A 2XWKA 3S9EA 2D3IA 1T0KA 4OWDA 3QK6A 3IB0A 5EQAA 3LSLA 2KQZA 2HEUA 3BKIB 2FYIA 4PAFA 3K6UA 3KJ7A 1XC1A 4JBZA 3RLFE 1FW0A 2UVJA 4DZ1A 2WYKA 1B05A 4FECA 4H0WA 1N0TA 2FA7A 3FVNA 3SKPA 3Q27A 3MZ1A 1JVYA 4PFYA 2F36A 4YICA 4NF6A 1MPCA 3C36A 3O6HA 1YAEA 3U1OA 4JXIA 1AH5A 4HCYA 2G93A 1PBQA 1BK4A 1NV4A 4PFBA 4O3AA 3VXBA 3HN0A 4MF3A 2O68A 1SQYA 2GQ1A 1RYOA 4U4XA 4PFRA 2Y7KA 2PCRA 2QS1A 4KXPA 1Y4TA 2I3WA 4FORA 2HFBA 3MJNA 1MQDA 1EZ9A 3OXNA 3THIA 3KZGA 4MNCA 1GVCA 5K2YA 3KJTA 3LV0A 3PU5A 1FCKA 5F7VA 4XTCQ 2WX9A 4TQUQ 1B4ZA 4JB7A 3E78A 2V3QA 4NGUA 4U1ZA 5TU0A 3UORA 2A5TB 1ANFA 4XFEA 3PD8A 4C1UA 1Q1KA 2P3VA 4R6YA 4GQOA 3VLWA 2BJIA 3HFUA 3IJXB 3OMBA 4WKMA 2XWVA 4X04A 3B50A 3FXRA 2H5YA 2WKYA 3MVXA 3OO9A 2OWSA 1UIVA 5HBCA 5LDZA 3ISPA 1NNKA 2UVGA 2HZLA 3T1BA 3SEVA 1POTA 2FNCA 4IO3A 5M2VA 5FHMA 4I3EA 4QFOA 1FBDA 3P7IA 1VR5A 2R71A 1XOCA 4N6PA 3OEKA 2OBGA 1NV0A 2I6EA 3N6TA 3FATA 3GLBA 4X9TA 2B65A 3MQ9A 1GV8A 3T9XB 4JWOA 5CC2A 3C4MA 4OEUA 2E1SA 4GWZA 4XKRA 3ILTB 2AYSA 1QKAA 4MJOA 5I56A 4BDQA 5HPQA 1HSJA 1IIWA 1FTJA 1QUJA 1FBCA 2VD3A 2A5SA 2XX8A 2FHYA 4MX6A 1B51A 5EHSA 1NV6A 4YKJA 3FJGA 4AS4A 4MFIA 4AQ4A 2CMOA 3N6UA 3EKIA 3H4ZA 5H8QA 5DVJA 3ECRA 3EHUA 4FATA 3ZS6A 3RYDA 3ILUB 3TQLA 1B46A 5CMMA 3FVGA 2H98A 4H5GA 4DDDA 4TLLB 3S2VA 4NQ8A 2ANJA 5JTYB 3K1MA 3AXFA 4R6HA 1EU8A 3VDFA 1ZLQA 1Y3NA 1LEVA 1PBPA 3V89B 3JZJA 4ESWA 1B52A 1YPNA 4MH5A 3SERA 1SYHA 4GWUA 4OETA 2GFEA 2PFYA 4OVPA 4ZE9A 5IZ1A 1RDXA 3RQTA 3LR1A 1ZBMA 2I3VA 5A5XA 1Y1MA 4OVSA 2VGQA 1YZ0A 2RC9A 1SI0A 4YKIA 5I57B 1NV7A 3OEMA 2H25A 4LONB 1SYIA 1LBXA 2QS2A 3GZGA 4O3CA 2OK2A 3T9HB 3R6UA 4GLIA 4N91A 4FEBA 4IGTA 1YCJA 3S9LC 1FPKA 2XXUA 2ZNTA 3FJ7A 2HXWA 3FV2A 1IQ7A 4MHFA 2G29A 5ISUA 2L5VA 2XX7A 4O8MA 4LQ2A 3K6WA 5H8HA 3CG1A 4N13A 2DSFA 3L6HA 3VLUA 5DVFA 1D9YA 2DDKA 3ZKLA 2ZXTA 2ZYNA 4FIMA 2F6PA 3FV1A 1Y4CA 4I40A 3GYYA 4BDNA 1UIUA 1B4HA 1D4NA 1NH8A 3KEIA 4RK2A 4RXLA 4F39A 4F18A 4GWYA 4RNSA 4P0IA 1Z7NE 1DSNA 3IO4A 1LGBC 5ELVA 1Y1ZA 3VLVA 3VVEA 3MSTA 2O69A 2DP8A 2DE4A 1NFTA 4JWXA 1OQGA 5FTHA 2FIEA 3A09A 3RGYA 4FEDA 5I3SA 1LFHA 4R73A 1Y3PA 1UTHA 1LBCA 1QUKA 4NF6B 1LBYA 4LZ5A 3B8BA 3RPLB 1OMPA 4P47A 5IAIA 5KCJA 3FASA 3KG2A 1LFIA 4GBVA 1R9LA 3K1NA 2XXYA 4ND9A 3PUVE 1IMBA 1B7UA 4FBPA 1FBGA 4PAKA 4G8NA 1B5IA 3RPWA 2DYXA 1DBZA 4NF4A 3TTLA 5ICTA 3IORA 1NNTA 1POY1 1DTGA 3U93A 1NUXA 1CE2A 3FVOA 1MY0A 3Q29A 2O84X 1QKBA 2I48A 3CSGA 1FTKA 3QUFA 3F11A 4Q30B 2Q8MA 4HE2A 1NNPA 4ZEBA 3MPKA 4GL0A 3HHFA 4PBHA 3CFXA 4N07A 1OVBA 3RPLA 3KSJA 5CBRA 4PF8A 1MH4A 4DCXA 3MAMA 1EZOA 1ZKBA 4GVOA 1DCUA 4EUOA 1USYE 1A8EA 1MG1A 3K1PA 3ONMA 3O29A 4PE5B 3C33A 5I2KB 4RPOA 1RYXA 1Q35A 1AWBA 4ZZEA 1MY1A 3G3KA 4ZDMA 1FJ9A 4YB6A 2A5TA 5IM2A 4N6DA 3T9UA 4QFKA 1PB9A 2QJEA 4XIGQ 4GWOA 4H1XA 2B4LA 5I2KA 4GX4A 4BDRA 3GBAA 4JVDA 1K9ZA 1N3WA 4POWA 3KN3A 4OENA 2B3FA 5ITPA 2M8CA 2XX9A 3N5LA 4GXAA 3TUSA 3TYHA 1ZU0A 2I58A 3S4UA 2I4CA 3PPQA 3H06B 5JTYA 2ONKE 3TAJA 3PUYE 3FXBA 4EF1A 1NV1A 4IO5A 4R74A 2QMXA 4NF4B 3V8XB 1M5CA 3FGSA 3WAEA 5H8HB 2PX1A 2F34A 1NMUA 2CEXA 1B3HA 3OELA 4G8HA 1R6ZA 3VVDA 2Z22A 5CMCA 1A55A 1MXYA 4YKPA 1B0HA 3DM0A 3B6TA 4I8CA 4XEQA 4RK9A 1BIYA 1MXUA 3EF7A 3FUZA 3RTWB 4HW8A 4K3FA 4R72A 4OZ9A 2VPOA 3KOSA 4I1DA 1ZIUA 4JSDA 1MPDA 1FPJA 2DE2A 1B40A 3K00A 2V25A 1NV3A 1AIVA 3QXMA 1LBBA 1OVTA 2DWHA 3KN8A 3QUJA 3G3JA 4P1EA 1WODA 1LLSA 2PYYA 2CZLA 2Y7PA 1Q9DA 3WAFA 2VP1A 2NXOA 2QSXA 1QULA 3UP9A 1PB7A 1YXIA 2PBWA 4ZEDA 2XXTA 4YMAA 3QYTA 2R6GE 1H43A 3SEUA 2OJTA 3KFMA 2WBBA 4KCCA 2I49A 1M5DA 4GD5A 3W9WA 1ZMGA 2O7IA 3C9HA 3O6GA 4NG7A 5B70A 2O1LA 1MPBA 4KPTA 4F1UA 2WBDA 2Y7IA 1US4A 3TCFA 2H9BA 4E0WA 1RDYA 4OESA 5I2NB 5I2NA 2CZHA
chains in the Genus database with same CATH topology
1QKAA 1B3EA 4Z7EA 5I56A 1IEJA 4BDQA 4KYDA 1UTBA 3U72A 1B5JA 5HPQA 4H5FA 1HSJA 4ZEIA 2B3BA 5EHMA 1IIWA 1FTJA 2ONSA 1QUJA 3TPAA 2VD3A 2I0BA 2A5SA 2XX8A 3CFLA 3VFJA 3CG3A 1HSLA 1ELJA 2F7AA 3TCGA 4F19A 1LSTA 2ZYMA 1B51A 1URSA 1VFDA 4OQOA 4OTEA 1WVJA 4QHQA 5EHSA 5ITOA 3TTNA 4F29A 5JK4A 3D4CA 1BP5A 1SBPA 2OLBA 3CVGA 3T96B 4YKJA 1FQFA 2DE3A 3FJGA 4MFIA 2IA4A 3MZBA 4AQ4A 4ELPA 2RC8A 2CMOA 4UA8A 1SW4A 3PMWA 3IJOB 1JETA 3OO8A 3H7MA 4PFWA 3N6UA 2RINA 1AL3A 1DOTA 1B1HA 4LA9A 1N3XA 2O7UA 1B6HA 4KQPA 1A8FA 3LSFB 3Q28A 4TOZA 3H4ZA 5H8QA 3FXQA 3PGFA 4NF5A 5DVJA 2F7CA 2DQVA 3ECRA 3EHUA 3KSXA 2PMSA 3IOUA 3QAXA 4H8JA 3T22A 3ZS6A 4FATA 1MDQA 1EH3A 4KYEA 2I0CA 1BLFA 3G3GA 2XXVA 3ILUB 3M3LA 4PP0A 3O28A 1S7YA 1MQIA 1YTVA 3PV0E 1N84A 3S9NC 3CRBA 1M5FA 2KLFA 3TQLA 3EHSA 4OFOA 2AL4A 1SD3A 1MY4A 2Q89A 1B46A 1OLCA 2ZNUA 5CMMA 3FVGA 2X7PA 1B3FA 1GGGA 2H98A 4NMYA 3IO6A 4BDOA 1B0LA 4H5GA 4DDDA 2O51A 1QJMA 2RCBA 4YB5A 3TELA 5AE4A 4TLLB 2GRVA 1LFGA 3E13X 1MS7A 3N94A 5A5XB 2QS3A 3IAZA 3S2VA 2ANJA 3R26A 5JTYB 3T9UA 3K1MA 2OWTA 4XKPA 3AXFA 4R6HA 5I57A 1D9VA 1EU8A 3MWBA 5TPAB 1O63A 4NE4A 2XD2A 4NF8B 3ODBA 3VDFA 1ZLQA 1Y3NA 2XXPA 3W15C 2NVUB 1PBPA 3O66A 3V89B 3V83A 4OXVA 1Y9UA 3JZJA 1I6BA 4ESWA 1B52A 1YPNA 4MH5A 3OSRA 1A7LA 1GR2A 3LSWA 2RCAA 3SERA 1SYHA 1QW0A 4PQJA 5H8NB 4OETA 2GFEA 3MBPA 1IZ1A 3PD9A 3TTKA 2NWJA 1A99A 1UTHB 1D3KA 4G68C 4ZE9A 1VFEA 2UVHA 3RQTA 2PVUA 3LR1A 1S50A 1ZBMA 2YLNA 3MVWA 1P1NA 5DYHA 3HO7A 2I3VA 4X48A 3OO7A 5A5XA 4MLVA 3I3VA 1Y1MA 2XD3A 3U8QA 2VGQA 3BFTA 3M3FA 5AA3A 2RC9A 5J1DA 1SI0A 3OD7A 4YKIA 5FHOA 2H99A 3OEMA 4RY1A 5I57B 3H6VA 2HZKA 2H25A 2YPNA 4LONB 4GL8A 1SYIA 5ICQA 2QS2A 1US5A 3PUWE 3H6UA 3H3GA 1MXVA 3GZGA 3MW0A 4G2ZA 1B32A 1JVXA 4PETA 4R2BA 1A40A 4R6KA 4FAJA 4O3CA 2QPQA 4EF2A 5I56B 4U23A 2OK2A 4BDLA 1FQAA 3HHGA 3A3CA 1VE4A 4PFTA 4F31B 3T9HB 5EYFA 4WEDA 3UIFA 4KFQA 4QFPA 4OEVA 3TTRA 2DWJA 3K01A 3R6UA 4XXUA 3JYRA 4KI0E 2XXRA 4H6DA 4FJPA 3DP4A 4GLIA 4LZ8A 4FEBA 5H8QB 4IGTA 1YCJA 1USYH 3C31A 4P11A 4OERA 3TTMA 5DEXA 3L6GA 4YMBA 1IXIA 2Y84A 3IOVA 4F3GA 4G68A 3S9LC 1B58A 1LAFE 1LCTA 1P1QA 2XXUA 2ZNTA 3FJ7A 2HXWA 3OSQA 3FV2A 1IQ7A 4C1TA 2F5XA 2G29A 5ISUA 1NL5A 1SVXB 2DVZA 1LAGE 1N04A 2PT2A 3MUQA 4XKQA 1S9TA 2XX7A 1H76A 4LQ2A 4F3BA 3K6WA 3RTFB 2D21A 2ZYKA 2DOJA 3PUXE 3UA8A 1KWHA 3A3UA 3MP1A 1TFDA 1TT1A 3CG1A 2GHAA 3H6WA 1TFAA 2ONRA 1R9QA 4N13A 4NF8A 4LATA 5CI5A 5JEIA 2DXYA 1N7XA 2DSFA 2HAUA 1JW1A 3D4GA 4THIA 3RT8A 4AB5A 3L6HA 3VLUA 5DVFA 2NOOA 5FTIA 1D9YA 2P1SA 3M3KA 5L9SA 1DPPA 3ZKLA 2GH9A 2ZXTA 2ZYNA 1VSOA 4OVJA 4Z0IA 1MM7A 2I4BA 2V3TA 2XXIA 4FIMA 3W9VA 4RYAA 2F6PA 3DP8A 3LBSA 4ELOA 3FV1A 1II5A 1Y4CA 1MQHA 3OENA 3ZSFA 3TCHA 4BDNA 1UIUA 1B4HA 1D4NA 1P1UA 3U94A 2O6AA 1ZJLA 1NH8A 3IOTA 2Z23A 3KEIA 3FJMA 2GHBA 4RK2A 4RXLA 1GTKA 4F39A 4F2OA 1H44A 4G4PA 1DTZA 4MLQA 4YZZA 1FQBA 4F18A 5I59B 4RNSA 4P0IA 5H8SA 4C0RA 1URGA 4DIGA 5AA4B 4OMBA 3TKDA 1OIBA 1Z7NE 1DSNA 2Z8DA 3IO4A 3M8UA 1M5EA 2HAVA 4WEPA 1LGBC 3CFZA 5ELVA 4DXUA 1Y1ZA 4ZS9A 3CI8A 4GOTA 2VOZA 3VLVA 3VVEA 3RT6B 5AA2A 2O69A 1A54A 4KR5A 4P0GA 2DP8A 3G7WA 4GRKA 2DE4A 5AA1A 1NFTA 3SEWA 4JWXA 1OQGA 2UYEA 1MRPA 3A09A 3O97A 5FTHA 3RGYA 2QS4A 4FEDA 4BLAA 1LFHA 4R73A 5I84A 1MY2A 1Y3PA 1UTHA 4NTLA 1F9BA 3IX1A 3OO6A 4L17A 3HSTA 4G77A 1N76A 2XXQA 1LBCA 1FTLA 4ZE8A 3T66A 1QUKA 4NF6B 2F7BA 1XHYA 4LZ5A 1XVXA 3MVYA 1B3GA 4X1BA 1OMPA 3BFUA 4EXLA 1I69A 1LAXA 1SW5A 3SEYA 3IB2A 5IAIA 1IXGA 4TLMB 2V84A 1MY3A 3IR1A 5KCJA 4GF8A 5TPAA 1UTBB 3FASA 3KG2A 1LFIA 1JNFA 1R9LA 3K1NA 1B1XA 1OLAA 2DWIA 2XXYA 1P1OA 4JDFA 3H6TA 4LZ7A 4ND9A 4ZZAA 3RY3A 2X7QA 3PUVE 4KYSA 1B7UA 2VHAA 4OFLA 3TQWA 5I58A 4ELQA 3O2AA 3FVKA 4G8NA 1B5IA 2UXAA 1R1NA 2DYXA 2LAOA 4X1DA 3RPWA 4KHZE 1P99A 1OQHA 4U4SA 2Q8JA 3SEXA 3SETA 3VVFA 4NF4A 4R9GA 2YJPA 5L8DA 3TTLA 3OOAA 3K4UA 4JSOA 4NWDA 3IORA 1XVYA 1NNFA 1NNTA 2DVCA 3E9XA 2E0SA 1B7HA 1POY1 1DTGA 1LB9A 1QVSA 3KBRA 3QSLA 5KCJB 3U93A 5L9OA 4AB6A 5LOMA 1CE2A 2XXWA 3FVOA 1MY0A 1B3LA 2RF1A 4RA1A 4YKPA 4EQ9A 3Q29A 2O84X 2Z8FA 4EDPA 3C32A 3V5AA 1B2HA 4R2FA 1QKBA 2I48A 2XXHA 1Y20A 1O7TA 3VE1B 5TP9A 3CSGA 5H8HA 1JW4A 3TMGA 1FTKA 4OHNA 3QUFA 3F11A 4KCDA 3U92A 3K2DA 4Q30B 3E3KA 4U21A 4YAHX 2Q9TA 2DXRA 3GBBA 3PPOA 1NNPA 4H8IA 4ZEFA 3KN7A 4ZEBA 5KZTA 5AA2D 3MVZA 1AOVA 1B9JA 3MPKA 3HHFA 4GL0A 2ABHA 3UK4A 4NF5B 2Y7WA 1SI1A 3CFXA 3KGCA 3PMVA 3O9PA 4ISUA 4N07A 4YB7A 1O64A 4PFUA 4F22A 3CSBA 3K6XA 1OVBA 4DCYA 5I58B 1B7ZA 4IO2A 3UN6A 3T93B 5TP9B 4BDMA 2Z8EA 3Q26A 3EQ1A 3SDFA 3KSJA 3EPEA 5CBRA 2F8DA 5F1QA 3KOTA 1H3DA 4IO6A 5I59A 1MH4A 4DCXA 5KDTA 4ZECA 2NUVA 3MAMA 3PPRA 3S9EA 1M5BA 1MQJA 2D3IA 1EZOA 1T0KA 1ZKBA 4GVOA 4EUOA 4OWDA 4G68B 2ZYOA 1USYE 1A8EA 1MG1A 2AL5A 3K1PA 3O29A 3ONMA 4PE5B 3C33A 4Q0CA 3QK6A 5I2KB 3IB0A 4RPOA 4F1YA 3JV9A 1N7WA 1Q35A 2ESNA 1RYXA 3LSLA 4ZZEA 3RN8A 2F6GA 2HEUA 3BKIB 2FYIA 4R9FA 1FQEA 1MY1A 3K6UA 1I6QA 3KJ7A 3G3KA 1EZPA 4ZDMA 1FQDA 1XC1A 2F78A 4JBZA 2OCUA 4QFLA 4LQ5A 4RJZA 1FW0A 4U1OA 2XXXA 4YB6A 5DVIA 3RLFE 2A5TA 3HCQA 2UVJA 4DZ1A 1B05A 4FECA 4OFJA 4E0XA 4H0WA 1MH3A 2Q2AA 1DPEA 2HCAA 1N0TA 2FA7A 2RC7A 4IY5A 3FVNA 1PB9A 4QF9A 4QFKA 3PPPA 2QJEA 2IEEA 4XIGQ 4YU0A 4DXCA 4GWOA 1LCFA 4H1XA 4DXBA 1TWYA 3SKPA 3TFLA 5I2KA 3SESA 3USDA 1FQCA 3G3HA 3MP8A 3MZ1A 3Q27A 3VXCA 5CM6A 4BDRA 1JW5A 3GBAA 1JVYA 4JWYA 2VD2A 3MC2A 2F36A 4PFYA 5B7DA 1AMFA 4YICA 4NF6A 1MPCA 4QFNA 3TEPA 4U22A 3C36A 3O6HA 1N3WA 1YAEA 3FXUA 3TODA 3U1OA 4JXIA 4POWA 4O3BA 3KN3A 1XS5A 3G3FA 4OENA 1H45A 2B3FA 1AH5A 5L9MA 2D5WA 1IXCA 2REGA 3HV1A 3PPNA 4F2QA 2M8CA 3E4RA 4HCYA 5ITPA 2G93A 5AA2B 3MP6A 2XX9A 1PBQA 4I62A 3N5LA 2QL3A 5CMBA 5DEXB 3LSXA 3O6IA 4M4GA 4Q8RA 3PMXA 4GXAA 4R75A 3TUSA 2UVIA 3TDJA 2AYSA 3TYHA 4G8MA 2ALUA 1ZU0A 2I58A 2V3UA 3S4UA 5AA4A 1J1NA 3HPIA 2I4CA 2XHDA 5CRYA 4XKNA 3UGWA 1FTMA 1MQGA 2Q88A 3FD3A 3PPQA 4LP2B 3H06B 4IY6A 5JTYA 4O3AA 3VXBA 3HN0A 2ONKE 4MF3A 3DLNA 2O68A 1SQYA 3TAJA 3PUYE 5I2NA 1RYOA 4U4XA 4EF1A 4EQ7A 4ECFA 2Y7KA 4IO5A 3T9VA 1TXFA 1BKAA 2DS9A 4R74A 4H65A 4HCWA 2QS1A 4OYVA 4POXA 1Y4TA 3EHTA 3Q25A 1RKMA 2QMXA 2I3WA 1WDNA 3C35A 4NF4B 3V8XB 1M5CA 5BUUA 4FORA 3FGSA 2HFBA 4F1VA 3C34A 3MJNA 4M1VA 1MQDA 5DTBA 1MXXA 1EZ9A 3WAEA 2ZNSA 4F3PA 3OXNA 4QRZA 3KZGA 2QRYA 3N26A 3IB1A 1GVCA 3RUMA 4LUBA 3THIA 4LVQA 4EQBA 5KDTB 5K2YA 3QIMA 4HS7A 3R7XA 5CBSA 3KJTA 5H8HB 1PDAA 3B7DA 2H4IA 3LC8A 4ZEKA 2PX1A 2F35A 3TZAA 2F34A 2DWAA 3LUYA 1BTJA 5K2XA 3BBRA 1NMUA 1B3HA 3OELA 4G8HA 2BJJX 1R6ZA 3PU5A 3VVDA 1SW1A 1FCKA 2Z22A 5CMCA 5F7VA 3RNNA 1IXHA 2ZMBA 1NH7A 2QMWA 4Q5TA 1A55A 1XT8A 4XTCQ 3ZKKA 1MXYA 1B0HA 2Y7RA 3DELB 4IB2A 1IITA 3FZVA 4QSCA 4TQUQ 1SW2A 3B6TA 3DM0A 1MXWA 2RKMA 4I8CA 2R9JA 4F3SA 1B4ZA 1HSEA 4RPNA 4RK9A 4JB7A 1BIYA 1MXUA 4GXSB 1QUIA 3EF7A 3K6VA 4UACA 5CMKA 2V3QA 3EN3A 3FUZA 4U1ZA 4GFRA 1L5TA 3H03A 5TU0A 3RTWB 4HW8A 4K3FA 2REJA 2HQ0A 4R72A 4OZ9A 3KOSA 4I1DA 1ZIUA 4JSDA 1JEUA 1MPDA 2Q2CA 2UYFA 3UORA 2DE2A 2A5TB 1PC3A 1ANFA 1URDA 1B40A 1MM6A 1Q1KA 3PD8A 1JEVA 4C1UA 2P0SA 4R6YA 3K00A 4GQOA 2V25A 3VLWA 1AIVA 5HM4B 2P2AA 3I6VA 3IJXB 1LBBA 2X26A 3OMBA 3QXMA 2PT1A 4IO4A 4WKMA 1OVTA 2DWHA 4ONYA 1CB6A 2THIA 3KN8A 3QUJA 2OZZA 3G3JA 1LAHE 1P1WA 3FXRA 1WODA 1MXZA 4ELRA 2H5YA 1LLSA 2PYYA 3CR9A 1ATGA 2CZLA 1NKXA 1IUDA 2Y7PA 3K02A 4IO7A 4NEDA 2WKYA 5IKBA 2F97A 3MVXA 3OO9A 4MBPA 3WAFA 3G3IA 1JQFA 5H8FA 2V93A 2OWSA 1UIVA 1Z7ME 5HBCA 3MZ9A 1SDXA 3S9MC 4QSDA 4GIZA 1DMBA 1NNKA 3IL1B 4HTGA 2UVGA 2VP1A 2NXOA 2AIXA 2HZLA 3PUZE 1B5HA 1POTA 3SEVA 2FNCA 3I5OA 5H8NA 2QSXA 4IO3A 4I9DA 4H67A 1QULA 3UP9A 5M2VA 3B6WA 5FHMA 1PB7A 4ZEDA 2PBWA 2XXTA 4YMAA 3IK6B 3IOWA 4NWCA 1FTOA 3QYTA 2R6GE 4QFOA 4DLDA 3MPLA 1H43A 3SEUA 1PEBA 2OJTA 3KFMA 3P7IA 3DP6A 1VR5A 1MDP1 2R71A 3CIJA 1XOCA 2I49A 1M5DA 4KCCA 3VV5A 4ESXA 4GD5A 2O1MA 3W9WA 1PB8A 1ZMGA 2O7IA 3C9HA 3O6GA 4N6PA 3OEKA 5ICTA 2OBGA 4WXJA 2I6EA 3N6TA 5DT6A 4IGRA 1ZTYA 4DE8A 3FATA 5B70A 1I6AA 2O1LA 3GLBA 3B6QA 5H8FB 2W7YA 1MPBA 4KPTA 4X9TA 2B65A 3MQ9A 4F1UA 1GV8A 2Y7IA 1US4A 4U2RA 4YKKA 1LB8A 3T9XB 2H9BA 3K0VA 4JWOA 3TCFA 5CC2A 4FE8A 5FHNA 4E0WA 4EXKA 3FIRA 1Y3QA 4OESA 3C4MA 4OEUA 5BWJA 2E1SA 4KD5A 4QSEA 4XKRA 3ILTB 1UQWA 3GXAA 5I2NB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QKA A;  1B3E A;  4Z7E A;  5I56 A;  1IEJ A;  4BDQ A;  4KYD A;  1UTB A;  3U72 A;  1B5J A;  5HPQ A;  4H5F A;  1HSJ A;  4ZEI A;  2B3B A;  5EHM A;  1IIW A;  1FTJ A;  2ONS A;  1QUJ A;  3TPA A;  2VD3 A;  2I0B A;  2A5S A;  2XX8 A;  3CFL A;  3VFJ A;  3CG3 A;  1HSL A;  1ELJ A;  2F7A A;  3TCG A;  4F19 A;  1LST A;  2ZYM A;  1B51 A;  1URS A;  1VFD A;  4OQO A;  4OTE A;  1WVJ A;  4QHQ A;  5EHS A;  5ITO A;  3TTN A;  4F29 A;  5JK4 A;  3D4C A;  1BP5 A;  1SBP A;  2OLB A;  3CVG A;  3T96 B;  4YKJ A;  1FQF A;  2DE3 A;  3FJG A;  4MFI A;  2IA4 A;  3MZB A;  4AQ4 A;  4ELP A;  2RC8 A;  2CMO A;  4UA8 A;  1SW4 A;  3PMW A;  3IJO B;  1JET A;  3OO8 A;  3H7M A;  4PFW A;  3N6U A;  2RIN A;  1AL3 A;  1DOT A;  1B1H A;  4LA9 A;  1N3X A;  2O7U A;  1B6H A;  4KQP A;  1A8F A;  3LSF B;  3Q28 A;  4TOZ A;  3H4Z A;  5H8Q A;  3FXQ A;  3PGF A;  4NF5 A;  5DVJ A;  2F7C A;  2DQV A;  3ECR A;  3EHU A;  3KSX A;  2PMS A;  3IOU A;  3QAX A;  4H8J A;  3T22 A;  3ZS6 A;  4FAT A;  1MDQ A;  1EH3 A;  4KYE A;  2I0C A;  1BLF A;  3G3G A;  2XXV A;  3ILU B;  3M3L A;  4PP0 A;  3O28 A;  1S7Y A;  1MQI A;  1YTV A;  3PV0 E;  1N84 A;  3S9N C;  3CRB A;  1M5F A;  2KLF A;  3TQL A;  3EHS A;  4OFO A;  2AL4 A;  1SD3 A;  1MY4 A;  2Q89 A;  1B46 A;  1OLC A;  2ZNU A;  5CMM A;  3FVG A;  2X7P A;  1B3F A;  1GGG A;  2H98 A;  4NMY A;  3IO6 A;  4BDO A;  1B0L A;  4H5G A;  4DDD A;  2O51 A;  1QJM A;  2RCB A;  4YB5 A;  3TEL A;  5AE4 A;  4TLL B;  2GRV A;  1LFG A;  3E13 X;  1MS7 A;  3N94 A;  5A5X B;  2QS3 A;  3IAZ A;  3S2V A;  2ANJ A;  3R26 A;  5JTY B;  3T9U A;  3K1M A;  2OWT A;  4XKP A;  3AXF A;  4R6H A;  5I57 A;  1D9V A;  1EU8 A;  3MWB A;  5TPA B;  1O63 A;  4NE4 A;  2XD2 A;  4NF8 B;  3ODB A;  3VDF A;  1ZLQ A;  1Y3N A;  2XXP A;  3W15 C;  2NVU B;  1PBP A;  3O66 A;  3V89 B;  3V83 A;  4OXV A;  1Y9U A;  3JZJ A;  1I6B A;  4ESW A;  1B52 A;  1YPN A;  4MH5 A;  3OSR A;  1A7L A;  1GR2 A;  3LSW A;  2RCA A;  3SER A;  1SYH A;  1QW0 A;  4PQJ A;  5H8N B;  4OET A;  2GFE A;  3MBP A;  1IZ1 A;  3PD9 A;  3TTK A;  2NWJ A;  1A99 A;  1UTH B;  1D3K A;  4G68 C;  4ZE9 A;  1VFE A;  2UVH A;  3RQT A;  2PVU A;  3LR1 A;  1S50 A;  1ZBM A;  2YLN A;  3MVW A;  1P1N A;  5DYH A;  3HO7 A;  2I3V A;  4X48 A;  3OO7 A;  5A5X A;  4MLV A;  3I3V A;  1Y1M A;  2XD3 A;  3U8Q A;  2VGQ A;  3BFT A;  3M3F A;  5AA3 A;  2RC9 A;  5J1D A;  1SI0 A;  3OD7 A;  4YKI A;  5FHO A;  2H99 A;  3OEM A;  4RY1 A;  5I57 B;  3H6V A;  2HZK A;  2H25 A;  2YPN A;  4LON B;  4GL8 A;  1SYI A;  5ICQ A;  2QS2 A;  1US5 A;  3PUW E;  3H6U A;  3H3G A;  1MXV A;  3GZG A;  3MW0 A;  4G2Z A;  1B32 A;  1JVX A;  4PET A;  4R2B A;  1A40 A;  4R6K A;  4FAJ A;  4O3C A;  2QPQ A;  4EF2 A;  5I56 B;  4U23 A;  2OK2 A;  4BDL A;  1FQA A;  3HHG A;  3A3C A;  1VE4 A;  4PFT A;  4F31 B;  3T9H B;  5EYF A;  4WED A;  3UIF A;  4KFQ A;  4QFP A;  4OEV A;  3TTR A;  2DWJ A;  3K01 A;  3R6U A;  4XXU A;  3JYR A;  4KI0 E;  2XXR A;  4H6D A;  4FJP A;  3DP4 A;  4GLI A;  4LZ8 A;  4FEB A;  5H8Q B;  4IGT A;  1YCJ A;  1USY H;  3C31 A;  4P11 A;  4OER A;  3TTM A;  5DEX A;  3L6G A;  4YMB A;  1IXI A;  2Y84 A;  3IOV A;  4F3G A;  4G68 A;  3S9L C;  1B58 A;  1LAF E;  1LCT A;  1P1Q A;  2XXU A;  2ZNT A;  3FJ7 A;  2HXW A;  3OSQ A;  3FV2 A;  1IQ7 A;  4C1T A;  2F5X A;  2G29 A;  5ISU A;  1NL5 A;  1SVX B;  2DVZ A;  1LAG E;  1N04 A;  2PT2 A;  3MUQ A;  4XKQ A;  1S9T A;  2XX7 A;  1H76 A;  4LQ2 A;  4F3B A;  3K6W A;  3RTF B;  2D21 A;  2ZYK A;  2DOJ A;  3PUX E;  3UA8 A;  1KWH A;  3A3U A;  3MP1 A;  1TFD A;  1TT1 A;  3CG1 A;  2GHA A;  3H6W A;  1TFA A;  2ONR A;  1R9Q A;  4N13 A;  4NF8 A;  4LAT A;  5CI5 A;  5JEI A;  2DXY A;  1N7X A;  2DSF A;  2HAU A;  1JW1 A;  3D4G A;  4THI A;  3RT8 A;  4AB5 A;  3L6H A;  3VLU A;  5DVF A;  2NOO A;  5FTI A;  1D9Y A;  2P1S A;  3M3K A;  5L9S A;  1DPP A;  3ZKL A;  2GH9 A;  2ZXT A;  2ZYN A;  1VSO A;  4OVJ A;  4Z0I A;  1MM7 A;  2I4B A;  2V3T A;  2XXI A;  4FIM A;  3W9V A;  4RYA A;  2F6P A;  3DP8 A;  3LBS A;  4ELO A;  3FV1 A;  1II5 A;  1Y4C A;  1MQH A;  3OEN A;  3ZSF A;  3TCH A;  4BDN A;  1UIU A;  1B4H A;  1D4N A;  1P1U A;  3U94 A;  2O6A A;  1ZJL A;  1NH8 A;  3IOT A;  2Z23 A;  3KEI A;  3FJM A;  2GHB A;  4RK2 A;  4RXL A;  1GTK A;  4F39 A;  4F2O A;  1H44 A;  4G4P A;  1DTZ A;  4MLQ A;  4YZZ A;  1FQB A;  4F18 A;  5I59 B;  4RNS A;  4P0I A;  5H8S A;  4C0R A;  1URG A;  4DIG A;  5AA4 B;  4OMB A;  3TKD A;  1OIB A;  1Z7N E;  1DSN A;  2Z8D A;  3IO4 A;  3M8U A;  1M5E A;  2HAV A;  4WEP A;  1LGB C;  3CFZ A;  5ELV A;  4DXU A;  1Y1Z A;  4ZS9 A;  3CI8 A;  4GOT A;  2VOZ A;  3VLV A;  3VVE A;  3RT6 B;  5AA2 A;  2O69 A;  1A54 A;  4KR5 A;  4P0G A;  2DP8 A;  3G7W A;  4GRK A;  2DE4 A;  5AA1 A;  1NFT A;  3SEW A;  4JWX A;  1OQG A;  2UYE A;  1MRP A;  3A09 A;  3O97 A;  5FTH A;  3RGY A;  2QS4 A;  4FED A;  4BLA A;  1LFH A;  4R73 A;  5I84 A;  1MY2 A;  1Y3P A;  1UTH A;  4NTL A;  1F9B A;  3IX1 A;  3OO6 A;  4L17 A;  3HST A;  4G77 A;  1N76 A;  2XXQ A;  1LBC A;  1FTL A;  4ZE8 A;  3T66 A;  1QUK A;  4NF6 B;  2F7B A;  1XHY A;  4LZ5 A;  1XVX A;  3MVY A;  1B3G A;  4X1B A;  1OMP A;  3BFU A;  4EXL A;  1I69 A;  1LAX A;  1SW5 A;  3SEY A;  3IB2 A;  5IAI A;  1IXG A;  4TLM B;  2V84 A;  1MY3 A;  3IR1 A;  5KCJ A;  4GF8 A;  5TPA A;  1UTB B;  3FAS A;  3KG2 A;  1LFI A;  1JNF A;  1R9L A;  3K1N A;  1B1X A;  1OLA A;  2DWI A;  2XXY A;  1P1O A;  4JDF A;  3H6T A;  4LZ7 A;  4ND9 A;  4ZZA A;  3RY3 A;  2X7Q A;  3PUV E;  4KYS A;  1B7U A;  2VHA A;  4OFL A;  3TQW A;  5I58 A;  4ELQ A;  3O2A A;  3FVK A;  4G8N A;  1B5I A;  2UXA A;  1R1N A;  2DYX A;  2LAO A;  4X1D A;  3RPW A;  4KHZ E;  1P99 A;  1OQH A;  4U4S A;  2Q8J A;  3SEX A;  3SET A;  3VVF A;  4NF4 A;  4R9G A;  2YJP A;  5L8D A;  3TTL A;  3OOA A;  3K4U A;  4JSO A;  4NWD A;  3IOR A;  1XVY A;  1NNF A;  1NNT A;  2DVC A;  3E9X A;  2E0S A;  1B7H A;  1POY 1;  1DTG A;  1LB9 A;  1QVS A;  3KBR A;  3QSL A;  5KCJ B;  3U93 A;  5L9O A;  4AB6 A;  5LOM A;  1CE2 A;  2XXW A;  3FVO A;  1MY0 A;  1B3L A;  2RF1 A;  4RA1 A;  4YKP A;  4EQ9 A;  3Q29 A;  2O84 X;  2Z8F A;  4EDP A;  3C32 A;  3V5A A;  1B2H A;  4R2F A;  1QKB A;  2I48 A;  2XXH A;  1Y20 A;  1O7T A;  3VE1 B;  5TP9 A;  3CSG A;  5H8H A;  1JW4 A;  3TMG A;  1FTK A;  4OHN A;  3QUF A;  3F11 A;  4KCD A;  3U92 A;  3K2D A;  4Q30 B;  3E3K A;  4U21 A;  4YAH X;  2Q9T A;  2DXR A;  3GBB A;  3PPO A;  1NNP A;  4H8I A;  4ZEF A;  3KN7 A;  4ZEB A;  5KZT A;  5AA2 D;  3MVZ A;  1AOV A;  1B9J A;  3MPK A;  3HHF A;  4GL0 A;  2ABH A;  3UK4 A;  4NF5 B;  2Y7W A;  1SI1 A;  3CFX A;  3KGC A;  3PMV A;  3O9P A;  4ISU A;  4N07 A;  4YB7 A;  1O64 A;  4PFU A;  4F22 A;  3CSB A;  3K6X A;  1OVB A;  4DCY A;  5I58 B;  1B7Z A;  4IO2 A;  3UN6 A;  3T93 B;  5TP9 B;  4BDM A;  2Z8E A;  3Q26 A;  3EQ1 A;  3SDF A;  3KSJ A;  3EPE A;  5CBR A;  2F8D A;  5F1Q A;  3KOT A;  1H3D A;  4IO6 A;  5I59 A;  1MH4 A;  4DCX A;  5KDT A;  4ZEC A;  2NUV A;  3MAM A;  3PPR A;  3S9E A;  1M5B A;  1MQJ A;  2D3I A;  1EZO A;  1T0K A;  1ZKB A;  4GVO A;  4EUO A;  4OWD A;  4G68 B;  2ZYO A;  1USY E;  1A8E A;  1MG1 A;  2AL5 A;  3K1P A;  3O29 A;  3ONM A;  4PE5 B;  3C33 A;  4Q0C A;  3QK6 A;  5I2K B;  3IB0 A;  4RPO A;  4F1Y A;  3JV9 A;  1N7W A;  1Q35 A;  2ESN A;  1RYX A;  3LSL A;  4ZZE A;  3RN8 A;  2F6G A;  2HEU A;  3BKI B;  2FYI A;  4R9F A;  1FQE A;  1MY1 A;  3K6U A;  1I6Q A;  3KJ7 A;  3G3K A;  1EZP A;  4ZDM A;  1FQD A;  1XC1 A;  2F78 A;  4JBZ A;  2OCU A;  4QFL A;  4LQ5 A;  4RJZ A;  1FW0 A;  4U1O A;  2XXX A;  4YB6 A;  5DVI A;  3RLF E;  2A5T A;  3HCQ A;  2UVJ A;  4DZ1 A;  1B05 A;  4FEC A;  4OFJ A;  4E0X A;  4H0W A;  1MH3 A;  2Q2A A;  1DPE A;  2HCA A;  1N0T A;  2FA7 A;  2RC7 A;  4IY5 A;  3FVN A;  1PB9 A;  4QF9 A;  4QFK A;  3PPP A;  2QJE A;  2IEE A;  4XIG Q;  4YU0 A;  4DXC A;  4GWO A;  1LCF A;  4H1X A;  4DXB A;  1TWY A;  3SKP A;  3TFL A;  5I2K A;  3SES A;  3USD A;  1FQC A;  3G3H A;  3MP8 A;  3MZ1 A;  3Q27 A;  3VXC A;  5CM6 A;  4BDR A;  1JW5 A;  3GBA A;  1JVY A;  4JWY A;  2VD2 A;  3MC2 A;  2F36 A;  4PFY A;  5B7D A;  1AMF A;  4YIC A;  4NF6 A;  1MPC A;  4QFN A;  3TEP A;  4U22 A;  3C36 A;  3O6H A;  1N3W A;  1YAE A;  3FXU A;  3TOD A;  3U1O A;  4JXI A;  4POW A;  4O3B A;  3KN3 A;  1XS5 A;  3G3F A;  4OEN A;  1H45 A;  2B3F A;  1AH5 A;  5L9M A;  2D5W A;  1IXC A;  2REG A;  3HV1 A;  3PPN A;  4F2Q A;  2M8C A;  3E4R A;  4HCY A;  5ITP A;  2G93 A;  5AA2 B;  3MP6 A;  2XX9 A;  1PBQ A;  4I62 A;  3N5L A;  2QL3 A;  5CMB A;  5DEX B;  3LSX A;  3O6I A;  4M4G A;  4Q8R A;  3PMX A;  4GXA A;  4R75 A;  3TUS A;  2UVI A;  3TDJ A;  2AYS A;  3TYH A;  4G8M A;  2ALU A;  1ZU0 A;  2I58 A;  2V3U A;  3S4U A;  5AA4 A;  1J1N A;  3HPI A;  2I4C A;  2XHD A;  5CRY A;  4XKN A;  3UGW A;  1FTM A;  1MQG A;  2Q88 A;  3FD3 A;  3PPQ A;  4LP2 B;  3H06 B;  4IY6 A;  5JTY A;  4O3A A;  3VXB A;  3HN0 A;  2ONK E;  4MF3 A;  3DLN A;  2O68 A;  1SQY A;  3TAJ A;  3PUY E;  5I2N A;  1RYO A;  4U4X A;  4EF1 A;  4EQ7 A;  4ECF A;  2Y7K A;  4IO5 A;  3T9V A;  1TXF A;  1BKA A;  2DS9 A;  4R74 A;  4H65 A;  4HCW A;  2QS1 A;  4OYV A;  4POX A;  1Y4T A;  3EHT A;  3Q25 A;  1RKM A;  2QMX A;  2I3W A;  1WDN A;  3C35 A;  4NF4 B;  3V8X B;  1M5C A;  5BUU A;  4FOR A;  3FGS A;  2HFB A;  4F1V A;  3C34 A;  3MJN A;  4M1V A;  1MQD A;  5DTB A;  1MXX A;  1EZ9 A;  3WAE A;  2ZNS A;  4F3P A;  3OXN A;  4QRZ A;  3KZG A;  2QRY A;  3N26 A;  3IB1 A;  1GVC A;  3RUM A;  4LUB A;  3THI A;  4LVQ A;  4EQB A;  5KDT B;  5K2Y A;  3QIM A;  4HS7 A;  3R7X A;  5CBS A;  3KJT A;  5H8H B;  1PDA A;  3B7D A;  2H4I A;  3LC8 A;  4ZEK A;  2PX1 A;  2F35 A;  3TZA A;  2F34 A;  2DWA A;  3LUY A;  1BTJ A;  5K2X A;  3BBR A;  1NMU A;  1B3H A;  3OEL A;  4G8H A;  2BJJ X;  1R6Z A;  3PU5 A;  3VVD A;  1SW1 A;  1FCK A;  2Z22 A;  5CMC A;  5F7V A;  3RNN A;  1IXH A;  2ZMB A;  1NH7 A;  2QMW A;  4Q5T A;  1A55 A;  1XT8 A;  4XTC Q;  3ZKK A;  1MXY A;  1B0H A;  2Y7R A;  3DEL B;  4IB2 A;  1IIT A;  3FZV A;  4QSC A;  4TQU Q;  1SW2 A;  3B6T A;  3DM0 A;  1MXW A;  2RKM A;  4I8C A;  2R9J A;  4F3S A;  1B4Z A;  1HSE A;  4RPN A;  4RK9 A;  4JB7 A;  1BIY A;  1MXU A;  4GXS B;  1QUI A;  3EF7 A;  3K6V A;  4UAC A;  5CMK A;  2V3Q A;  3EN3 A;  3FUZ A;  4U1Z A;  4GFR A;  1L5T A;  3H03 A;  5TU0 A;  3RTW B;  4HW8 A;  4K3F A;  2REJ A;  2HQ0 A;  4R72 A;  4OZ9 A;  3KOS A;  4I1D A;  1ZIU A;  4JSD A;  1JEU A;  1MPD A;  2Q2C A;  2UYF A;  3UOR A;  2DE2 A;  2A5T B;  1PC3 A;  1ANF A;  1URD A;  1B40 A;  1MM6 A;  1Q1K A;  3PD8 A;  1JEV A;  4C1U A;  2P0S A;  4R6Y A;  3K00 A;  4GQO A;  2V25 A;  3VLW A;  1AIV A;  5HM4 B;  2P2A A;  3I6V A;  3IJX B;  1LBB A;  2X26 A;  3OMB A;  3QXM A;  2PT1 A;  4IO4 A;  4WKM A;  1OVT A;  2DWH A;  4ONY A;  1CB6 A;  2THI A;  3KN8 A;  3QUJ A;  2OZZ A;  3G3J A;  1LAH E;  1P1W A;  3FXR A;  1WOD A;  1MXZ A;  4ELR A;  2H5Y A;  1LLS A;  2PYY A;  3CR9 A;  1ATG A;  2CZL A;  1NKX A;  1IUD A;  2Y7P A;  3K02 A;  4IO7 A;  4NED A;  2WKY A;  5IKB A;  2F97 A;  3MVX A;  3OO9 A;  4MBP A;  3WAF A;  3G3I A;  1JQF A;  5H8F A;  2V93 A;  2OWS A;  1UIV A;  1Z7M E;  5HBC A;  3MZ9 A;  1SDX A;  3S9M C;  4QSD A;  4GIZ A;  1DMB A;  1NNK A;  3IL1 B;  4HTG A;  2UVG A;  2VP1 A;  2NXO A;  2AIX A;  2HZL A;  3PUZ E;  1B5H A;  1POT A;  3SEV A;  2FNC A;  3I5O A;  5H8N A;  2QSX A;  4IO3 A;  4I9D A;  4H67 A;  1QUL A;  3UP9 A;  5M2V A;  3B6W A;  5FHM A;  1PB7 A;  4ZED A;  2PBW A;  2XXT A;  4YMA A;  3IK6 B;  3IOW A;  4NWC A;  1FTO A;  3QYT A;  2R6G E;  4QFO A;  4DLD A;  3MPL A;  1H43 A;  3SEU A;  1PEB A;  2OJT A;  3KFM A;  3P7I A;  3DP6 A;  1VR5 A;  1MDP 1;  2R71 A;  3CIJ A;  1XOC A;  2I49 A;  1M5D A;  4KCC A;  3VV5 A;  4ESX A;  4GD5 A;  2O1M A;  3W9W A;  1PB8 A;  1ZMG A;  2O7I A;  3C9H A;  3O6G A;  4N6P A;  3OEK A;  5ICT A;  2OBG A;  4WXJ A;  2I6E A;  3N6T A;  5DT6 A;  4IGR A;  1ZTY A;  4DE8 A;  3FAT A;  5B70 A;  1I6A A;  2O1L A;  3GLB A;  3B6Q A;  5H8F B;  2W7Y A;  1MPB A;  4KPT A;  4X9T A;  2B65 A;  3MQ9 A;  4F1U A;  1GV8 A;  2Y7I A;  1US4 A;  4U2R A;  4YKK A;  1LB8 A;  3T9X B;  2H9B A;  3K0V A;  4JWO A;  3TCF A;  5CC2 A;  4FE8 A;  5FHN A;  4E0W A;  4EXK A;  3FIR A;  1Y3Q A;  4OES A;  3C4M A;  4OEU A;  5BWJ A;  2E1S A;  4KD5 A;  4QSE A;  4XKR A;  3ILT B;  1UQW A;  3GXA A;  5I2N B; 
#chains in the Genus database with same CATH topology
 1B3E A;  4KYD A;  4ZEI A;  3TPA A;  2I0B A;  3VFJ A;  3CFL A;  4F19 A;  1LST A;  2HPG A;  1WVJ A;  5ITO A;  5JK4 A;  4MMP A;  1SBP A;  3CVG A;  2CZK A;  1SW4 A;  3H7M A;  4PFW A;  4LA9 A;  1N3X A;  1B6H A;  4KQP A;  1A8F A;  3LSF B;  3Q28 A;  4UAB A;  2F7C A;  3T22 A;  4DCY A;  3IOU A;  1MDQ A;  4KYE A;  2XXV A;  1S7Y A;  1MQI A;  1YTV A;  3EHS A;  2Q89 A;  2JJK A;  5ESY A;  3KC0 A;  4BDO A;  2O51 A;  1QJM A;  4XF5 A;  2GRV A;  2MKZ A;  4XKP A;  5I57 A;  4GWS A;  4H45 A;  2XD2 A;  5A5L A;  1EYK A;  1FPB A;  3LSW A;  2RCA A;  4PQJ A;  3MBP A;  1IZ1 A;  1UTH B;  1D3K A;  1VFE A;  5DYH A;  3HO7 A;  1FBF A;  4MLV A;  3I3V A;  3U8Q A;  1FPI A;  4OVQ A;  3OD7 A;  4RY1 A;  2YPN A;  4GL8 A;  5KZT A;  3PUW E;  4MAG A;  1MXV A;  4R6K A;  3MW0 A;  5I58 B;  1JVX A;  4QXD A;  1FSA A;  5I56 B;  1A40 A;  2QPQ A;  4BDL A;  1FQA A;  4PFT A;  5T3J A;  4QFP A;  3TTR A;  3K01 A;  4XXU A;  3JYR A;  2QFL A;  2FVZ A;  4PDD A;  5DEX A;  3L6G A;  3IOV A;  4F3G A;  1LCT A;  2F5X A;  2DVZ A;  1N04 A;  2PT2 A;  3MUQ A;  4XKQ A;  1S9T A;  1H76 A;  4F3B A;  2D21 A;  2ZYK A;  1KWH A;  2GHA A;  2ZZX A;  4LAT A;  2HAU A;  3RT8 A;  5FTI A;  4GX6 A;  5L9S A;  1DPP A;  3CHG A;  1NUZ A;  4Z0I A;  1MM7 A;  3SZP A;  2V3T A;  4RYA A;  3DP8 A;  1JP4 A;  4OAN A;  1VDW A;  3FJM A;  4H46 A;  4F2O A;  5I59 B;  5AA4 B;  1EYJ A;  4ZS9 A;  1A54 A;  4P0G A;  3G7W A;  4GRK A;  2QS4 A;  4BLA A;  5I84 A;  4PBQ A;  4O7M A;  1SPI A;  4HE0 A;  1N76 A;  2XXQ A;  4ZE8 A;  4GBW A;  1FPE A;  1XVX A;  3MVY A;  3BFU A;  1I69 A;  1SW5 A;  3SEY A;  4TLM B;  1UTB B;  4LZ7 A;  2DWI A;  4ELQ A;  3RY3 A;  1P1O A;  3H6T A;  2X7Q A;  3FVK A;  4X1D A;  3VVF A;  1P99 A;  1OQH A;  5L8D A;  3OOA A;  1NNF A;  3E9X A;  1B7H A;  3KBR A;  3QSL A;  5LOM A;  4AB6 A;  2XXW A;  4EQ9 A;  2Z8F A;  1B2H A;  2XXH A;  5TP9 A;  3U92 A;  4OHN A;  5IGA A;  4YAH X;  2Q9T A;  4H8I A;  3MVZ A;  4NF5 B;  2Y7W A;  1SI1 A;  3KGC A;  3PMV A;  4ISU A;  3O9P A;  4JVI A;  1B7Z A;  4IO2 A;  3SDF A;  5ET6 A;  1QGX A;  2Q74 A;  4IO6 A;  5KDT A;  4ZEC A;  2NUV A;  3PPR A;  1MQJ A;  4N8Y A;  4G68 B;  4Q0C A;  2AL5 A;  4F1Y A;  3JV9 A;  1N7W A;  2ESN A;  3RN8 A;  4R9F A;  1FQE A;  4PC9 A;  1FQD A;  5DVI A;  4U1O A;  2XA5 A;  2XXX A;  4OFJ A;  1MH3 A;  1IMF A;  2Q2A A;  1DPE A;  2RC7 A;  4IY5 A;  3PPP A;  1LCF A;  4DXB A;  1TWY A;  1FQC A;  1FRP A;  3G3H A;  3MP8 A;  5CM6 A;  4JWY A;  5B7D A;  1AMF A;  4GX3 A;  4QFN A;  3TEP A;  5ET7 A;  3FXU A;  4O3B A;  2D5W A;  2REG A;  3HV1 A;  3E4R A;  5AA2 B;  3MP6 A;  4I62 A;  2OWZ A;  1XI6 A;  3O6I A;  4M4G A;  4Q8R A;  4R75 A;  1LBV A;  4NF0 A;  2R8T A;  3TDJ A;  2V3U A;  5ET5 A;  1KZ8 A;  2FBP A;  1J1N A;  2XHD A;  3KBZ A;  1FTM A;  2Q88 A;  4LP2 B;  4IY6 A;  4PGP A;  3DLN A;  1IME A;  4PDH A;  1BKA A;  2DS9 A;  4POX A;  3EHT A;  1RKM A;  3C35 A;  5BUU A;  4M1V A;  4N4U A;  2ZNS A;  2QRY A;  3RUM A;  4LUB A;  5KDT B;  4HS7 A;  3B7D A;  2H4I A;  3LC8 A;  3TZA A;  2DWA A;  1BTJ A;  4Q5T A;  1NH7 A;  2QMW A;  3ZKK A;  3DEL B;  5L9M A;  1IIT A;  4QSC A;  2RKM A;  1HSE A;  1LBW A;  4OVR A;  4RPN A;  1QUI A;  4UAC A;  3EN3 A;  4MEV A;  4GFR A;  2HQ0 A;  1JEU A;  2UYF A;  1PC3 A;  1URD A;  1MM6 A;  5F24 A;  2P0S A;  1D9Q A;  2P2A A;  3I6V A;  4IO4 A;  2X26 A;  2V4C A;  4ONY A;  1CB6 A;  4P8B A;  1LAH E;  1P1W A;  4HXV A;  4ELR A;  1FPF A;  1ATG A;  3K02 A;  1IUD A;  5H8F A;  1SDX A;  3S9M C;  4GIZ A;  3IL1 B;  4HTG A;  2Y5K A;  3PUZ E;  4PE3 A;  5H8N A;  3IK6 B;  4NWC A;  4DLD A;  3MPL A;  3DP6 A;  1MDP 1;  4AS5 A;  4WXJ A;  1ZTY A;  4DE8 A;  1I6A A;  1IMA A;  3B6Q A;  4U2R A;  3K0V A;  4FE8 A;  3FIR A;  1Y3Q A;  1FTA A;  5BWJ A;  3BIG A;  4KD5 A;  4QSE A;  4G4P A;  1UQW A;  3GXA A;  1IEJ A;  2XXK A;  3U72 A;  1B5J A;  4H5F A;  2B3B A;  4P1L A;  3CG3 A;  1HSL A;  1ELJ A;  2QVV A;  1URS A;  4OTE A;  1VFD A;  4QHQ A;  3TTN A;  5EYH A;  5FBP A;  3T96 B;  1FQF A;  2IA4 A;  3IFA A;  3MZB A;  4ELP A;  1INP A;  4UA8 A;  1JET A;  2RIN A;  4TOZ A;  3FBP A;  3FXQ A;  3PGF A;  2DQV A;  4H8J A;  3QAX A;  1EH3 A;  1BLF A;  3G3G A;  3S9N C;  3PV0 E;  3CRB A;  1M5F A;  2KLF A;  4LN5 A;  4OFO A;  1SD3 A;  1MY4 A;  1OLC A;  2ZNU A;  1B3F A;  3IO6 A;  3E13 X;  1LFG A;  1MS7 A;  2QS3 A;  4QBA A;  3MWB A;  1O63 A;  4NF8 B;  2XXP A;  3W15 C;  4OXV A;  1Y9U A;  1I6B A;  5H8N B;  5EYG A;  3PD9 A;  4G68 C;  4PF6 A;  4MIJ A;  2PVU A;  1S50 A;  4PCD A;  3MVW A;  4X48 A;  3OO7 A;  3M3F A;  5FHO A;  2H99 A;  3H6V A;  4MCO A;  4P56 A;  3H6U A;  4FAJ A;  4R2B A;  3HHG A;  1NI9 A;  3A3C A;  1VE4 A;  4F31 B;  4WED A;  4P9K A;  2XXR A;  4FJP A;  3C31 A;  4P11 A;  4OER A;  2OX3 A;  1IXI A;  2Y84 A;  1P1Q A;  1LAF E;  2VT5 A;  3OSQ A;  4C1T A;  5ET8 A;  2DOJ A;  3PUX E;  3MP1 A;  1TT1 A;  4NF8 A;  5CI5 A;  1FBE A;  3D4G A;  1N7X A;  4THI A;  1JW1 A;  2NOO A;  4N81 A;  2CEY A;  3M3K A;  2GH9 A;  1VSO A;  4OVJ A;  2I4B A;  3LBS A;  4ELO A;  1II5 A;  4NX1 A;  1MQH A;  3ZSF A;  4DI3 D;  3U94 A;  2O6A A;  1ZJL A;  3IOT A;  1H44 A;  1DTZ A;  4YZZ A;  4C0R A;  1URG A;  4DIG A;  4OMB A;  2Z8D A;  1NV2 A;  2HAV A;  4GOT A;  2VOZ A;  4PFI A;  3RT6 B;  5IZZ A;  2UYE A;  1MRP A;  3O97 A;  1MY2 A;  3OO6 A;  5LTC A;  3HST A;  4OA4 A;  4G77 A;  5EQ8 A;  2F7B A;  4X1B A;  4EXL A;  2V84 A;  3IR1 A;  5IZ3 B;  5TPA A;  4N17 A;  1OLA A;  4JDF A;  4ZZA A;  4KYS A;  4OFL A;  3O2A A;  2UXA A;  2LAO A;  4JVC A;  3SEX A;  1DK4 A;  4KHZ E;  4U4S A;  2Q8J A;  4R9G A;  2YJP A;  4JSO A;  4NWD A;  1XVY A;  4QSD A;  2DVC A;  4PTK A;  2E0S A;  5L9O A;  1B3L A;  2RF1 A;  4RA1 A;  4EDP A;  3V5A A;  2CZI A;  1Y20 A;  1O7T A;  1JW4 A;  4MNI A;  4KCD A;  3K2D A;  3E3K A;  4U21 A;  2DXR A;  4ZEF A;  3KN7 A;  1B9J A;  3UK4 A;  2ABH A;  4YB7 A;  1O64 A;  4PFU A;  3CSB A;  1FBP A;  2Z8E A;  3Q26 A;  3EPE A;  2F8D A;  5F1Q A;  3KOT A;  1H3D A;  5I59 A;  4NHB A;  2WYP A;  1M5B A;  3ROJ A;  2ZYO A;  1FPD A;  4OVT A;  2F6G A;  1I6Q A;  1EZP A;  2F78 A;  1FBH A;  2OCU A;  4QFL A;  4LQ5 A;  4RJZ A;  4IR8 A;  2HHM A;  3HCQ A;  4E0X A;  2HCA A;  4QF9 A;  4DXC A;  4YU0 A;  2IEE A;  2XWI A;  3TFL A;  3SES A;  3USD A;  4NAP A;  3VXC A;  4NN3 A;  1JW5 A;  4HE1 A;  2VD2 A;  3MC2 A;  4U22 A;  3TOD A;  1XS5 A;  5AA1 A;  3G3F A;  1H45 A;  4F2Q A;  1IXC A;  3PPN A;  2VPN A;  2QL3 A;  5CMB A;  5DEX B;  2P3N A;  3LSX A;  3PMX A;  3D1R A;  2UVI A;  4G8M A;  3U65 A;  2ALU A;  5AA4 A;  3HPI A;  2WEF A;  5CRY A;  4XKN A;  3UGW A;  1MQG A;  3FD3 A;  2FIX A;  4EQ7 A;  5J16 A;  4ECF A;  3T9V A;  1TXF A;  2F3B A;  4H65 A;  4HCW A;  4OYV A;  2ZZW A;  3Q25 A;  4O94 A;  1WDN A;  1G0H A;  4F1V A;  3C34 A;  2F3D A;  5DTB A;  1MXX A;  4F3P A;  4QRZ A;  3N26 A;  3IB1 A;  4EQB A;  4LVQ A;  3QIM A;  3R7X A;  5CBS A;  1PDA A;  4ZEK A;  2F35 A;  3LUY A;  5DW8 A;  5K2X A;  3BBR A;  2B4M A;  2BJJ X;  1SW1 A;  3RNN A;  1IXH A;  2ZMB A;  4F22 A;  1XT8 A;  1FPL A;  2Y7R A;  4IB2 A;  3FZV A;  1SW2 A;  4F3S A;  1MXW A;  2R9J A;  3MYU A;  4GXS B;  3K6V A;  5CMK A;  1L5T A;  3H03 A;  3T0J A;  2REJ A;  5I5P A;  1KA1 A;  3BIH A;  2Q2C A;  1JEV A;  4PGN A;  2Y5L A;  1IMD A;  5HM4 B;  2PT1 A;  3KC1 A;  2THI A;  2OZZ A;  1MXZ A;  3CR9 A;  3LUZ A;  4IO7 A;  1NKX A;  4NED A;  5IKB A;  2F97 A;  4MBP A;  3G3I A;  1JQF A;  2V93 A;  1Z7M E;  3MZ9 A;  2KR0 A;  1DMB A;  2AIX A;  1B5H A;  1EYI A;  3I5O A;  5IZ3 A;  4I9D A;  4H67 A;  3B6W A;  4P3L A;  4X8R A;  3IOW A;  1FTO A;  1PEB A;  3CIJ A;  3VV5 A;  4ESX A;  2O1M A;  1PB8 A;  5DT6 A;  4IGR A;  5H8F B;  2W7Y A;  3PTY A;  4YKK A;  1LB8 A;  1FPG A;  5FHN A;  4EXK A;  1FJ6 A;  5I7I A;  4Z7E A;  1UTB A;  5EHM A;  2ONS A;  2F7A A;  3TCG A;  2ZYM A;  4OQO A;  4F29 A;  3D4C A;  1BP5 A;  2OLB A;  2DE3 A;  4MNP A;  2RC8 A;  3PMW A;  3IJO B;  3OO8 A;  1AL3 A;  1DOT A;  1B1H A;  2O7U A;  4DI4 B;  1YYZ A;  4NF5 A;  3KSX A;  2PMS A;  2I0C A;  4N6K A;  3M3L A;  4PP0 A;  3O28 A;  5EQ7 A;  1N84 A;  2AL4 A;  2X7P A;  1GGG A;  4NMY A;  1B0L A;  4YB5 A;  2RCB A;  5AE4 A;  3TEL A;  4GWX A;  5A5X B;  3N94 A;  3IAZ A;  3R26 A;  2OWT A;  1D9V A;  5TPA B;  4NE4 A;  3ODB A;  2NVU B;  3O66 A;  3V83 A;  2ZZV A;  3OSR A;  1A7L A;  1GR2 A;  1QW0 A;  3TTK A;  2NWJ A;  1A99 A;  2UVH A;  2YLN A;  1P1N A;  2XD3 A;  1LBZ A;  3BFT A;  1IMC A;  5AA3 A;  5J1D A;  2XWO A;  2HZK A;  5ICQ A;  1US5 A;  3H3G A;  4G2Z A;  4PET A;  1B32 A;  2HXR A;  4EF2 A;  1NV5 A;  4U23 A;  2QVU A;  5EYF A;  2QVR A;  3UIF A;  4KFQ A;  4OEV A;  1KA0 A;  2DWJ A;  4KI0 E;  1RDZ A;  4H6D A;  3DP4 A;  4LZ8 A;  4O7I A;  5H8Q B;  1USY H;  3TTM A;  3NOH A;  4YMB A;  4G68 A;  1B58 A;  1NL5 A;  1SVX B;  1LAG E;  1K9Y A;  3RTF B;  3E79 A;  5EQ9 A;  3UA8 A;  3A3U A;  1TFD A;  1TFA A;  2ONR A;  1R9Q A;  5JEI A;  2DXY A;  4AB5 A;  2P1S A;  3W9V A;  2XXI A;  3QMF A;  3OEN A;  3TCH A;  1P1U A;  2Z23 A;  2GHB A;  4GWW A;  1GTK A;  4MLQ A;  1FQB A;  5H8S A;  3TKD A;  1OIB A;  3M8U A;  1M5E A;  4WEP A;  3CFZ A;  4DXU A;  3CI8 A;  5AA2 A;  4KR5 A;  3SEW A;  4I3Y A;  4NTL A;  2PFZ A;  1F9B A;  3IX1 A;  4L17 A;  1FTL A;  3T66 A;  1G0I A;  1XHY A;  1B3G A;  1LAX A;  3IB2 A;  1IXG A;  1MY3 A;  4GF8 A;  1JNF A;  1B1X A;  3TQW A;  2VHA A;  5I58 A;  1R1N A;  3SET A;  3K4U A;  3H6W A;  1QVS A;  5KCJ B;  1LB9 A;  3IFC A;  4PAI A;  3C32 A;  4N15 A;  4R2F A;  3VE1 B;  4N8G A;  4G61 A;  3TMG A;  3GBB A;  3PPO A;  5AA2 D;  1AOV A;  1CNQ A;  3A29 A;  1NUW A;  1NUY A;  3K6X A;  3UN6 A;  3T93 B;  5TP9 B;  4BDM A;  3EQ1 A;  2XWK A;  3S9E A;  2D3I A;  1T0K A;  4OWD A;  3QK6 A;  3IB0 A;  5EQA A;  3LSL A;  2KQZ A;  2HEU A;  3BKI B;  2FYI A;  4PAF A;  3K6U A;  3KJ7 A;  1XC1 A;  4JBZ A;  3RLF E;  1FW0 A;  2UVJ A;  4DZ1 A;  2WYK A;  1B05 A;  4FEC A;  4H0W A;  1N0T A;  2FA7 A;  3FVN A;  3SKP A;  3Q27 A;  3MZ1 A;  1JVY A;  4PFY A;  2F36 A;  4YIC A;  4NF6 A;  1MPC A;  3C36 A;  3O6H A;  1YAE A;  3U1O A;  4JXI A;  1AH5 A;  4HCY A;  2G93 A;  1PBQ A;  1BK4 A;  1NV4 A;  4PFB A;  4O3A A;  3VXB A;  3HN0 A;  4MF3 A;  2O68 A;  1SQY A;  2GQ1 A;  1RYO A;  4U4X A;  4PFR A;  2Y7K A;  2PCR A;  2QS1 A;  4KXP A;  1Y4T A;  2I3W A;  4FOR A;  2HFB A;  3MJN A;  1MQD A;  1EZ9 A;  3OXN A;  3THI A;  3KZG A;  4MNC A;  1GVC A;  5K2Y A;  3KJT A;  3LV0 A;  3PU5 A;  1FCK A;  5F7V A;  4XTC Q;  2WX9 A;  4TQU Q;  1B4Z A;  4JB7 A;  3E78 A;  2V3Q A;  4NGU A;  4U1Z A;  5TU0 A;  3UOR A;  2A5T B;  1ANF A;  4XFE A;  3PD8 A;  4C1U A;  1Q1K A;  2P3V A;  4R6Y A;  4GQO A;  3VLW A;  2BJI A;  3HFU A;  3IJX B;  3OMB A;  4WKM A;  2XWV A;  4X04 A;  3B50 A;  3FXR A;  2H5Y A;  2WKY A;  3MVX A;  3OO9 A;  2OWS A;  1UIV A;  5HBC A;  5LDZ A;  3ISP A;  1NNK A;  2UVG A;  2HZL A;  3T1B A;  3SEV A;  1POT A;  2FNC A;  4IO3 A;  5M2V A;  5FHM A;  4I3E A;  4QFO A;  1FBD A;  3P7I A;  1VR5 A;  2R71 A;  1XOC A;  4N6P A;  3OEK A;  2OBG A;  1NV0 A;  2I6E A;  3N6T A;  3FAT A;  3GLB A;  4X9T A;  2B65 A;  3MQ9 A;  1GV8 A;  3T9X B;  4JWO A;  5CC2 A;  3C4M A;  4OEU A;  2E1S A;  4GWZ A;  4XKR A;  3ILT B;  2AYS A;  1QKA A;  4MJO A;  5I56 A;  4BDQ A;  5HPQ A;  1HSJ A;  1IIW A;  1FTJ A;  1QUJ A;  1FBC A;  2VD3 A;  2A5S A;  2XX8 A;  2FHY A;  4MX6 A;  1B51 A;  5EHS A;  1NV6 A;  4YKJ A;  3FJG A;  4AS4 A;  4MFI A;  4AQ4 A;  2CMO A;  3N6U A;  3EKI A;  3H4Z A;  5H8Q A;  5DVJ A;  3ECR A;  3EHU A;  4FAT A;  3ZS6 A;  3RYD A;  3ILU B;  3TQL A;  1B46 A;  5CMM A;  3FVG A;  2H98 A;  4H5G A;  4DDD A;  4TLL B;  3S2V A;  4NQ8 A;  2ANJ A;  5JTY B;  3K1M A;  3AXF A;  4R6H A;  1EU8 A;  3VDF A;  1ZLQ A;  1Y3N A;  1LEV A;  1PBP A;  3V89 B;  3JZJ A;  4ESW A;  1B52 A;  1YPN A;  4MH5 A;  3SER A;  1SYH A;  4GWU A;  4OET A;  2GFE A;  2PFY A;  4OVP A;  4ZE9 A;  5IZ1 A;  1RDX A;  3RQT A;  3LR1 A;  1ZBM A;  2I3V A;  5A5X A;  1Y1M A;  4OVS A;  2VGQ A;  1YZ0 A;  2RC9 A;  1SI0 A;  4YKI A;  5I57 B;  1NV7 A;  3OEM A;  2H25 A;  4LON B;  1SYI A;  1LBX A;  2QS2 A;  3GZG A;  4O3C A;  2OK2 A;  3T9H B;  3R6U A;  4GLI A;  4N91 A;  4FEB A;  4IGT A;  1YCJ A;  3S9L C;  1FPK A;  2XXU A;  2ZNT A;  3FJ7 A;  2HXW A;  3FV2 A;  1IQ7 A;  4MHF A;  2G29 A;  5ISU A;  2L5V A;  2XX7 A;  4O8M A;  4LQ2 A;  3K6W A;  5H8H A;  3CG1 A;  4N13 A;  2DSF A;  3L6H A;  3VLU A;  5DVF A;  1D9Y A;  2DDK A;  3ZKL A;  2ZXT A;  2ZYN A;  4FIM A;  2F6P A;  3FV1 A;  1Y4C A;  4I40 A;  3GYY A;  4BDN A;  1UIU A;  1B4H A;  1D4N A;  1NH8 A;  3KEI A;  4RK2 A;  4RXL A;  4F39 A;  4F18 A;  4GWY A;  4RNS A;  4P0I A;  1Z7N E;  1DSN A;  3IO4 A;  1LGB C;  5ELV A;  1Y1Z A;  3VLV A;  3VVE A;  3MST A;  2O69 A;  2DP8 A;  2DE4 A;  1NFT A;  4JWX A;  1OQG A;  5FTH A;  2FIE A;  3A09 A;  3RGY A;  4FED A;  5I3S A;  1LFH A;  4R73 A;  1Y3P A;  1UTH A;  1LBC A;  1QUK A;  4NF6 B;  1LBY A;  4LZ5 A;  3B8B A;  3RPL B;  1OMP A;  4P47 A;  5IAI A;  5KCJ A;  3FAS A;  3KG2 A;  1LFI A;  4GBV A;  1R9L A;  3K1N A;  2XXY A;  4ND9 A;  3PUV E;  1IMB A;  1B7U A;  4FBP A;  1FBG A;  4PAK A;  4G8N A;  1B5I A;  3RPW A;  2DYX A;  1DBZ A;  4NF4 A;  3TTL A;  5ICT A;  3IOR A;  1NNT A;  1POY 1;  1DTG A;  3U93 A;  1NUX A;  1CE2 A;  3FVO A;  1MY0 A;  3Q29 A;  2O84 X;  1QKB A;  2I48 A;  3CSG A;  1FTK A;  3QUF A;  3F11 A;  4Q30 B;  2Q8M A;  4HE2 A;  1NNP A;  4ZEB A;  3MPK A;  4GL0 A;  3HHF A;  4PBH A;  3CFX A;  4N07 A;  1OVB A;  3RPL A;  3KSJ A;  5CBR A;  4PF8 A;  1MH4 A;  4DCX A;  3MAM A;  1EZO A;  1ZKB A;  4GVO A;  1DCU A;  4EUO A;  1USY E;  1A8E A;  1MG1 A;  3K1P A;  3ONM A;  3O29 A;  4PE5 B;  3C33 A;  5I2K B;  4RPO A;  1RYX A;  1Q35 A;  1AWB A;  4ZZE A;  1MY1 A;  3G3K A;  4ZDM A;  1FJ9 A;  4YB6 A;  2A5T A;  5IM2 A;  4N6D A;  3T9U A;  4QFK A;  1PB9 A;  2QJE A;  4XIG Q;  4GWO A;  4H1X A;  2B4L A;  5I2K A;  4GX4 A;  4BDR A;  3GBA A;  4JVD A;  1K9Z A;  1N3W A;  4POW A;  3KN3 A;  4OEN A;  2B3F A;  5ITP A;  2M8C A;  2XX9 A;  3N5L A;  4GXA A;  3TUS A;  3TYH A;  1ZU0 A;  2I58 A;  3S4U A;  2I4C A;  3PPQ A;  3H06 B;  5JTY A;  2ONK E;  3TAJ A;  3PUY E;  3FXB A;  4EF1 A;  1NV1 A;  4IO5 A;  4R74 A;  2QMX A;  4NF4 B;  3V8X B;  1M5C A;  3FGS A;  3WAE A;  5H8H B;  2PX1 A;  2F34 A;  1NMU A;  2CEX A;  1B3H A;  3OEL A;  4G8H A;  1R6Z A;  3VVD A;  2Z22 A;  5CMC A;  1A55 A;  1MXY A;  4YKP A;  1B0H A;  3DM0 A;  3B6T A;  4I8C A;  4XEQ A;  4RK9 A;  1BIY A;  1MXU A;  3EF7 A;  3FUZ A;  3RTW B;  4HW8 A;  4K3F A;  4R72 A;  4OZ9 A;  2VPO A;  3KOS A;  4I1D A;  1ZIU A;  4JSD A;  1MPD A;  1FPJ A;  2DE2 A;  1B40 A;  3K00 A;  2V25 A;  1NV3 A;  1AIV A;  3QXM A;  1LBB A;  1OVT A;  2DWH A;  3KN8 A;  3QUJ A;  3G3J A;  4P1E A;  1WOD A;  1LLS A;  2PYY A;  2CZL A;  2Y7P A;  1Q9D A;  3WAF A;  2VP1 A;  2NXO A;  2QSX A;  1QUL A;  3UP9 A;  1PB7 A;  1YXI A;  2PBW A;  4ZED A;  2XXT A;  4YMA A;  3QYT A;  2R6G E;  1H43 A;  3SEU A;  2OJT A;  3KFM A;  2WBB A;  4KCC A;  2I49 A;  1M5D A;  4GD5 A;  3W9W A;  1ZMG A;  2O7I A;  3C9H A;  3O6G A;  4NG7 A;  5B70 A;  2O1L A;  1MPB A;  4KPT A;  4F1U A;  2WBD A;  2Y7I A;  1US4 A;  3TCF A;  2H9B A;  4E0W A;  1RDY A;  4OES A;  5I2N B;  5I2N A;  2CZH A; 
#chains in the Genus database with same CATH homology
 1QKA A;  1B3E A;  4Z7E A;  5I56 A;  1IEJ A;  4BDQ A;  4KYD A;  1UTB A;  3U72 A;  1B5J A;  5HPQ A;  4H5F A;  1HSJ A;  4ZEI A;  2B3B A;  5EHM A;  1IIW A;  1FTJ A;  2ONS A;  1QUJ A;  3TPA A;  2VD3 A;  2I0B A;  2A5S A;  2XX8 A;  3CFL A;  3VFJ A;  3CG3 A;  1HSL A;  1ELJ A;  2F7A A;  3TCG A;  4F19 A;  1LST A;  2ZYM A;  1B51 A;  1URS A;  1VFD A;  4OQO A;  4OTE A;  1WVJ A;  4QHQ A;  5EHS A;  5ITO A;  3TTN A;  4F29 A;  5JK4 A;  3D4C A;  1BP5 A;  1SBP A;  2OLB A;  3CVG A;  3T96 B;  4YKJ A;  1FQF A;  2DE3 A;  3FJG A;  4MFI A;  2IA4 A;  3MZB A;  4AQ4 A;  4ELP A;  2RC8 A;  2CMO A;  4UA8 A;  1SW4 A;  3PMW A;  3IJO B;  1JET A;  3OO8 A;  3H7M A;  4PFW A;  3N6U A;  2RIN A;  1AL3 A;  1DOT A;  1B1H A;  4LA9 A;  1N3X A;  2O7U A;  1B6H A;  4KQP A;  1A8F A;  3LSF B;  3Q28 A;  4TOZ A;  3H4Z A;  5H8Q A;  3FXQ A;  3PGF A;  4NF5 A;  5DVJ A;  2F7C A;  2DQV A;  3ECR A;  3EHU A;  3KSX A;  2PMS A;  3IOU A;  3QAX A;  4H8J A;  3T22 A;  3ZS6 A;  4FAT A;  1MDQ A;  1EH3 A;  4KYE A;  2I0C A;  1BLF A;  3G3G A;  2XXV A;  3ILU B;  3M3L A;  4PP0 A;  3O28 A;  1S7Y A;  1MQI A;  1YTV A;  3PV0 E;  1N84 A;  3S9N C;  3CRB A;  1M5F A;  2KLF A;  3TQL A;  3EHS A;  4OFO A;  2AL4 A;  1SD3 A;  1MY4 A;  2Q89 A;  1B46 A;  1OLC A;  2ZNU A;  5CMM A;  3FVG A;  2X7P A;  1B3F A;  1GGG A;  2H98 A;  4NMY A;  3IO6 A;  4BDO A;  1B0L A;  4H5G A;  4DDD A;  2O51 A;  1QJM A;  2RCB A;  4YB5 A;  3TEL A;  5AE4 A;  4TLL B;  2GRV A;  1LFG A;  3E13 X;  1MS7 A;  3N94 A;  5A5X B;  2QS3 A;  3IAZ A;  3S2V A;  2ANJ A;  3R26 A;  5JTY B;  3T9U A;  3K1M A;  2OWT A;  4XKP A;  3AXF A;  4R6H A;  5I57 A;  1D9V A;  1EU8 A;  3MWB A;  5TPA B;  1O63 A;  4NE4 A;  2XD2 A;  4NF8 B;  3ODB A;  3VDF A;  1ZLQ A;  1Y3N A;  2XXP A;  3W15 C;  2NVU B;  1PBP A;  3O66 A;  3V89 B;  3V83 A;  4OXV A;  1Y9U A;  3JZJ A;  1I6B A;  4ESW A;  1B52 A;  1YPN A;  4MH5 A;  3OSR A;  1A7L A;  1GR2 A;  3LSW A;  2RCA A;  3SER A;  1SYH A;  1QW0 A;  4PQJ A;  5H8N B;  4OET A;  2GFE A;  3MBP A;  1IZ1 A;  3PD9 A;  3TTK A;  2NWJ A;  1A99 A;  1UTH B;  1D3K A;  4G68 C;  4ZE9 A;  1VFE A;  2UVH A;  3RQT A;  2PVU A;  3LR1 A;  1S50 A;  1ZBM A;  2YLN A;  3MVW A;  1P1N A;  5DYH A;  3HO7 A;  2I3V A;  4X48 A;  3OO7 A;  5A5X A;  4MLV A;  3I3V A;  1Y1M A;  2XD3 A;  3U8Q A;  2VGQ A;  3BFT A;  3M3F A;  5AA3 A;  2RC9 A;  5J1D A;  1SI0 A;  3OD7 A;  4YKI A;  5FHO A;  2H99 A;  3OEM A;  4RY1 A;  5I57 B;  3H6V A;  2HZK A;  2H25 A;  2YPN A;  4LON B;  4GL8 A;  1SYI A;  5ICQ A;  2QS2 A;  1US5 A;  3PUW E;  3H6U A;  3H3G A;  1MXV A;  3GZG A;  3MW0 A;  4G2Z A;  1B32 A;  1JVX A;  4PET A;  4R2B A;  1A40 A;  4R6K A;  4FAJ A;  4O3C A;  2QPQ A;  4EF2 A;  5I56 B;  4U23 A;  2OK2 A;  4BDL A;  1FQA A;  3HHG A;  3A3C A;  1VE4 A;  4PFT A;  4F31 B;  3T9H B;  5EYF A;  4WED A;  3UIF A;  4KFQ A;  4QFP A;  4OEV A;  3TTR A;  2DWJ A;  3K01 A;  3R6U A;  4XXU A;  3JYR A;  4KI0 E;  2XXR A;  4H6D A;  4FJP A;  3DP4 A;  4GLI A;  4LZ8 A;  4FEB A;  5H8Q B;  4IGT A;  1YCJ A;  1USY H;  3C31 A;  4P11 A;  4OER A;  3TTM A;  5DEX A;  3L6G A;  4YMB A;  1IXI A;  2Y84 A;  3IOV A;  4F3G A;  4G68 A;  3S9L C;  1B58 A;  1LAF E;  1LCT A;  1P1Q A;  2XXU A;  2ZNT A;  3FJ7 A;  2HXW A;  3OSQ A;  3FV2 A;  1IQ7 A;  4C1T A;  2F5X A;  2G29 A;  5ISU A;  1NL5 A;  1SVX B;  2DVZ A;  1LAG E;  1N04 A;  2PT2 A;  3MUQ A;  4XKQ A;  1S9T A;  2XX7 A;  1H76 A;  4LQ2 A;  4F3B A;  3K6W A;  3RTF B;  2D21 A;  2ZYK A;  2DOJ A;  3PUX E;  3UA8 A;  1KWH A;  3A3U A;  3MP1 A;  1TFD A;  1TT1 A;  3CG1 A;  2GHA A;  3H6W A;  1TFA A;  2ONR A;  1R9Q A;  4N13 A;  4NF8 A;  4LAT A;  5CI5 A;  5JEI A;  2DXY A;  1N7X A;  2DSF A;  2HAU A;  1JW1 A;  3D4G A;  4THI A;  3RT8 A;  4AB5 A;  3L6H A;  3VLU A;  5DVF A;  2NOO A;  5FTI A;  1D9Y A;  2P1S A;  3M3K A;  5L9S A;  1DPP A;  3ZKL A;  2GH9 A;  2ZXT A;  2ZYN A;  1VSO A;  4OVJ A;  4Z0I A;  1MM7 A;  2I4B A;  2V3T A;  2XXI A;  4FIM A;  3W9V A;  4RYA A;  2F6P A;  3DP8 A;  3LBS A;  4ELO A;  3FV1 A;  1II5 A;  1Y4C A;  1MQH A;  3OEN A;  3ZSF A;  3TCH A;  4BDN A;  1UIU A;  1B4H A;  1D4N A;  1P1U A;  3U94 A;  2O6A A;  1ZJL A;  1NH8 A;  3IOT A;  2Z23 A;  3KEI A;  3FJM A;  2GHB A;  4RK2 A;  4RXL A;  1GTK A;  4F39 A;  4F2O A;  1H44 A;  4G4P A;  1DTZ A;  4MLQ A;  4YZZ A;  1FQB A;  4F18 A;  5I59 B;  4RNS A;  4P0I A;  5H8S A;  4C0R A;  1URG A;  4DIG A;  5AA4 B;  4OMB A;  3TKD A;  1OIB A;  1Z7N E;  1DSN A;  2Z8D A;  3IO4 A;  3M8U A;  1M5E A;  2HAV A;  4WEP A;  1LGB C;  3CFZ A;  5ELV A;  4DXU A;  1Y1Z A;  4ZS9 A;  3CI8 A;  4GOT A;  2VOZ A;  3VLV A;  3VVE A;  3RT6 B;  5AA2 A;  2O69 A;  1A54 A;  4KR5 A;  4P0G A;  2DP8 A;  3G7W A;  4GRK A;  2DE4 A;  5AA1 A;  1NFT A;  3SEW A;  4JWX A;  1OQG A;  2UYE A;  1MRP A;  3A09 A;  3O97 A;  5FTH A;  3RGY A;  2QS4 A;  4FED A;  4BLA A;  1LFH A;  4R73 A;  5I84 A;  1MY2 A;  1Y3P A;  1UTH A;  4NTL A;  1F9B A;  3IX1 A;  3OO6 A;  4L17 A;  3HST A;  4G77 A;  1N76 A;  2XXQ A;  1LBC A;  1FTL A;  4ZE8 A;  3T66 A;  1QUK A;  4NF6 B;  2F7B A;  1XHY A;  4LZ5 A;  1XVX A;  3MVY A;  1B3G A;  4X1B A;  1OMP A;  3BFU A;  4EXL A;  1I69 A;  1LAX A;  1SW5 A;  3SEY A;  3IB2 A;  5IAI A;  1IXG A;  4TLM B;  2V84 A;  1MY3 A;  3IR1 A;  5KCJ A;  4GF8 A;  5TPA A;  1UTB B;  3FAS A;  3KG2 A;  1LFI A;  1JNF A;  1R9L A;  3K1N A;  1B1X A;  1OLA A;  2DWI A;  2XXY A;  1P1O A;  4JDF A;  3H6T A;  4LZ7 A;  4ND9 A;  4ZZA A;  3RY3 A;  2X7Q A;  3PUV E;  4KYS A;  1B7U A;  2VHA A;  4OFL A;  3TQW A;  5I58 A;  4ELQ A;  3O2A A;  3FVK A;  4G8N A;  1B5I A;  2UXA A;  1R1N A;  2DYX A;  2LAO A;  4X1D A;  3RPW A;  4KHZ E;  1P99 A;  1OQH A;  4U4S A;  2Q8J A;  3SEX A;  3SET A;  3VVF A;  4NF4 A;  4R9G A;  2YJP A;  5L8D A;  3TTL A;  3OOA A;  3K4U A;  4JSO A;  4NWD A;  3IOR A;  1XVY A;  1NNF A;  1NNT A;  2DVC A;  3E9X A;  2E0S A;  1B7H A;  1POY 1;  1DTG A;  1LB9 A;  1QVS A;  3KBR A;  3QSL A;  5KCJ B;  3U93 A;  5L9O A;  4AB6 A;  5LOM A;  1CE2 A;  2XXW A;  3FVO A;  1MY0 A;  1B3L A;  2RF1 A;  4RA1 A;  4YKP A;  4EQ9 A;  3Q29 A;  2O84 X;  2Z8F A;  4EDP A;  3C32 A;  3V5A A;  1B2H A;  4R2F A;  1QKB A;  2I48 A;  2XXH A;  1Y20 A;  1O7T A;  3VE1 B;  5TP9 A;  3CSG A;  5H8H A;  1JW4 A;  3TMG A;  1FTK A;  4OHN A;  3QUF A;  3F11 A;  4KCD A;  3U92 A;  3K2D A;  4Q30 B;  3E3K A;  4U21 A;  4YAH X;  2Q9T A;  2DXR A;  3GBB A;  3PPO A;  1NNP A;  4H8I A;  4ZEF A;  3KN7 A;  4ZEB A;  5KZT A;  5AA2 D;  3MVZ A;  1AOV A;  1B9J A;  3MPK A;  3HHF A;  4GL0 A;  2ABH A;  3UK4 A;  4NF5 B;  2Y7W A;  1SI1 A;  3CFX A;  3KGC A;  3PMV A;  3O9P A;  4ISU A;  4N07 A;  4YB7 A;  1O64 A;  4PFU A;  4F22 A;  3CSB A;  3K6X A;  1OVB A;  4DCY A;  5I58 B;  1B7Z A;  4IO2 A;  3UN6 A;  3T93 B;  5TP9 B;  4BDM A;  2Z8E A;  3Q26 A;  3EQ1 A;  3SDF A;  3KSJ A;  3EPE A;  5CBR A;  2F8D A;  5F1Q A;  3KOT A;  1H3D A;  4IO6 A;  5I59 A;  1MH4 A;  4DCX A;  5KDT A;  4ZEC A;  2NUV A;  3MAM A;  3PPR A;  3S9E A;  1M5B A;  1MQJ A;  2D3I A;  1EZO A;  1T0K A;  1ZKB A;  4GVO A;  4EUO A;  4OWD A;  4G68 B;  2ZYO A;  1USY E;  1A8E A;  1MG1 A;  2AL5 A;  3K1P A;  3O29 A;  3ONM A;  4PE5 B;  3C33 A;  4Q0C A;  3QK6 A;  5I2K B;  3IB0 A;  4RPO A;  4F1Y A;  3JV9 A;  1N7W A;  1Q35 A;  2ESN A;  1RYX A;  3LSL A;  4ZZE A;  3RN8 A;  2F6G A;  2HEU A;  3BKI B;  2FYI A;  4R9F A;  1FQE A;  1MY1 A;  3K6U A;  1I6Q A;  3KJ7 A;  3G3K A;  1EZP A;  4ZDM A;  1FQD A;  1XC1 A;  2F78 A;  4JBZ A;  2OCU A;  4QFL A;  4LQ5 A;  4RJZ A;  1FW0 A;  4U1O A;  2XXX A;  4YB6 A;  5DVI A;  3RLF E;  2A5T A;  3HCQ A;  2UVJ A;  4DZ1 A;  1B05 A;  4FEC A;  4OFJ A;  4E0X A;  4H0W A;  1MH3 A;  2Q2A A;  1DPE A;  2HCA A;  1N0T A;  2FA7 A;  2RC7 A;  4IY5 A;  3FVN A;  1PB9 A;  4QF9 A;  4QFK A;  3PPP A;  2QJE A;  2IEE A;  4XIG Q;  4YU0 A;  4DXC A;  4GWO A;  1LCF A;  4H1X A;  4DXB A;  1TWY A;  3SKP A;  3TFL A;  5I2K A;  3SES A;  3USD A;  1FQC A;  3G3H A;  3MP8 A;  3MZ1 A;  3Q27 A;  3VXC A;  5CM6 A;  4BDR A;  1JW5 A;  3GBA A;  1JVY A;  4JWY A;  2VD2 A;  3MC2 A;  2F36 A;  4PFY A;  5B7D A;  1AMF A;  4YIC A;  4NF6 A;  1MPC A;  4QFN A;  3TEP A;  4U22 A;  3C36 A;  3O6H A;  1N3W A;  1YAE A;  3FXU A;  3TOD A;  3U1O A;  4JXI A;  4POW A;  4O3B A;  3KN3 A;  1XS5 A;  3G3F A;  4OEN A;  1H45 A;  2B3F A;  1AH5 A;  5L9M A;  2D5W A;  1IXC A;  2REG A;  3HV1 A;  3PPN A;  4F2Q A;  2M8C A;  3E4R A;  4HCY A;  5ITP A;  2G93 A;  5AA2 B;  3MP6 A;  2XX9 A;  1PBQ A;  4I62 A;  3N5L A;  2QL3 A;  5CMB A;  5DEX B;  3LSX A;  3O6I A;  4M4G A;  4Q8R A;  3PMX A;  4GXA A;  4R75 A;  3TUS A;  2UVI A;  3TDJ A;  2AYS A;  3TYH A;  4G8M A;  2ALU A;  1ZU0 A;  2I58 A;  2V3U A;  3S4U A;  5AA4 A;  1J1N A;  3HPI A;  2I4C A;  2XHD A;  5CRY A;  4XKN A;  3UGW A;  1FTM A;  1MQG A;  2Q88 A;  3FD3 A;  3PPQ A;  4LP2 B;  3H06 B;  4IY6 A;  5JTY A;  4O3A A;  3VXB A;  3HN0 A;  2ONK E;  4MF3 A;  3DLN A;  2O68 A;  1SQY A;  3TAJ A;  3PUY E;  5I2N A;  1RYO A;  4U4X A;  4EF1 A;  4EQ7 A;  4ECF A;  2Y7K A;  4IO5 A;  3T9V A;  1TXF A;  1BKA A;  2DS9 A;  4R74 A;  4H65 A;  4HCW A;  2QS1 A;  4OYV A;  4POX A;  1Y4T A;  3EHT A;  3Q25 A;  1RKM A;  2QMX A;  2I3W A;  1WDN A;  3C35 A;  4NF4 B;  3V8X B;  1M5C A;  5BUU A;  4FOR A;  3FGS A;  2HFB A;  4F1V A;  3C34 A;  3MJN A;  4M1V A;  1MQD A;  5DTB A;  1MXX A;  1EZ9 A;  3WAE A;  2ZNS A;  4F3P A;  3OXN A;  4QRZ A;  3KZG A;  2QRY A;  3N26 A;  3IB1 A;  1GVC A;  3RUM A;  4LUB A;  3THI A;  4LVQ A;  4EQB A;  5KDT B;  5K2Y A;  3QIM A;  4HS7 A;  3R7X A;  5CBS A;  3KJT A;  5H8H B;  1PDA A;  3B7D A;  2H4I A;  3LC8 A;  4ZEK A;  2PX1 A;  2F35 A;  3TZA A;  2F34 A;  2DWA A;  3LUY A;  1BTJ A;  5K2X A;  3BBR A;  1NMU A;  1B3H A;  3OEL A;  4G8H A;  2BJJ X;  1R6Z A;  3PU5 A;  3VVD A;  1SW1 A;  1FCK A;  2Z22 A;  5CMC A;  5F7V A;  3RNN A;  1IXH A;  2ZMB A;  1NH7 A;  2QMW A;  4Q5T A;  1A55 A;  1XT8 A;  4XTC Q;  3ZKK A;  1MXY A;  1B0H A;  2Y7R A;  3DEL B;  4IB2 A;  1IIT A;  3FZV A;  4QSC A;  4TQU Q;  1SW2 A;  3B6T A;  3DM0 A;  1MXW A;  2RKM A;  4I8C A;  2R9J A;  4F3S A;  1B4Z A;  1HSE A;  4RPN A;  4RK9 A;  4JB7 A;  1BIY A;  1MXU A;  4GXS B;  1QUI A;  3EF7 A;  3K6V A;  4UAC A;  5CMK A;  2V3Q A;  3EN3 A;  3FUZ A;  4U1Z A;  4GFR A;  1L5T A;  3H03 A;  5TU0 A;  3RTW B;  4HW8 A;  4K3F A;  2REJ A;  2HQ0 A;  4R72 A;  4OZ9 A;  3KOS A;  4I1D A;  1ZIU A;  4JSD A;  1JEU A;  1MPD A;  2Q2C A;  2UYF A;  3UOR A;  2DE2 A;  2A5T B;  1PC3 A;  1ANF A;  1URD A;  1B40 A;  1MM6 A;  1Q1K A;  3PD8 A;  1JEV A;  4C1U A;  2P0S A;  4R6Y A;  3K00 A;  4GQO A;  2V25 A;  3VLW A;  1AIV A;  5HM4 B;  2P2A A;  3I6V A;  3IJX B;  1LBB A;  2X26 A;  3OMB A;  3QXM A;  2PT1 A;  4IO4 A;  4WKM A;  1OVT A;  2DWH A;  4ONY A;  1CB6 A;  2THI A;  3KN8 A;  3QUJ A;  2OZZ A;  3G3J A;  1LAH E;  1P1W A;  3FXR A;  1WOD A;  1MXZ A;  4ELR A;  2H5Y A;  1LLS A;  2PYY A;  3CR9 A;  1ATG A;  2CZL A;  1NKX A;  1IUD A;  2Y7P A;  3K02 A;  4IO7 A;  4NED A;  2WKY A;  5IKB A;  2F97 A;  3MVX A;  3OO9 A;  4MBP A;  3WAF A;  3G3I A;  1JQF A;  5H8F A;  2V93 A;  2OWS A;  1UIV A;  1Z7M E;  5HBC A;  3MZ9 A;  1SDX A;  3S9M C;  4QSD A;  4GIZ A;  1DMB A;  1NNK A;  3IL1 B;  4HTG A;  2UVG A;  2VP1 A;  2NXO A;  2AIX A;  2HZL A;  3PUZ E;  1B5H A;  1POT A;  3SEV A;  2FNC A;  3I5O A;  5H8N A;  2QSX A;  4IO3 A;  4I9D A;  4H67 A;  1QUL A;  3UP9 A;  5M2V A;  3B6W A;  5FHM A;  1PB7 A;  4ZED A;  2PBW A;  2XXT A;  4YMA A;  3IK6 B;  3IOW A;  4NWC A;  1FTO A;  3QYT A;  2R6G E;  4QFO A;  4DLD A;  3MPL A;  1H43 A;  3SEU A;  1PEB A;  2OJT A;  3KFM A;  3P7I A;  3DP6 A;  1VR5 A;  1MDP 1;  2R71 A;  3CIJ A;  1XOC A;  2I49 A;  1M5D A;  4KCC A;  3VV5 A;  4ESX A;  4GD5 A;  2O1M A;  3W9W A;  1PB8 A;  1ZMG A;  2O7I A;  3C9H A;  3O6G A;  4N6P A;  3OEK A;  5ICT A;  2OBG A;  4WXJ A;  2I6E A;  3N6T A;  5DT6 A;  4IGR A;  1ZTY A;  4DE8 A;  3FAT A;  5B70 A;  1I6A A;  2O1L A;  3GLB A;  3B6Q A;  5H8F B;  2W7Y A;  1MPB A;  4KPT A;  4X9T A;  2B65 A;  3MQ9 A;  4F1U A;  1GV8 A;  2Y7I A;  1US4 A;  4U2R A;  4YKK A;  1LB8 A;  3T9X B;  2H9B A;  3K0V A;  4JWO A;  3TCF A;  5CC2 A;  4FE8 A;  5FHN A;  4E0W A;  4EXK A;  3FIR A;  1Y3Q A;  4OES A;  3C4M A;  4OEU A;  5BWJ A;  2E1S A;  4KD5 A;  4QSE A;  4XKR A;  3ILT B;  1UQW A;  3GXA A;  5I2N B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...