2MKZA

Solution structure of a protein c-terminal domain
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
141
structure length
141
Chain Sequence
SNAILATMNVPAGPAGGQQVDLASVLTPEIMAPILANADVQERLLPYLPSGESLPQTADEIQNTLTSPQFQQALGMFSAALASGQLGPLMCQFGLPAEAVEAANKGDVEAFAKAMQNNAKPEQKEGDTKDKKDEEEDMSLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Proteasomal ubiquitin receptor ADRM1
publication title Mechanism of the Rpn13-induced activation of Uch37
pubmed doi rcsb
source organism Homo sapiens
total genus 34
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2014-02-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.140 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2mkzA01
2KQZA 2L5VA 2KR0A 2MKZA
chains in the Genus database with same CATH superfamily
1GVCA 2I0BA 2QVUA 2AL5A 3K0VA 4KYSA 4TQUQ 3IX1A 3KN7A 4OFOA 1FRPA 2Q89A 4HE2A 3G3HA 5J16A 3EF7A 3VV5A 4MNCA 2DXYA 1SI1A 3IL1B 2L5VA 1FPLA 4NMYA 3IB0A 2V4CA 5TPAA 2QS3A 1MXUA 2QS1A 4PFWA 2R8TA 4U23A 1FQEA 4FJPA 2XXPA 2OWSA 1MY3A 4MJOA 5BUUA 5M2VA 3N6UA 3D4CA 3H3GA 4KXPA 3QXMA 1US5A 3MQ9A 5I57B 4LQ2A 2RF1A 4EQBA 3PMWA 4FBPA 2X7PA 1FBHA 1B52A 4OYVA 3QAXA 3JZJA 4ESWA 1Y20A 5DYHA 4X04A 4C1UA 2A5SA 2AL4A 3IAZA 4EUOA 2F3BA 3RT6B 4EXLA 3LC8A 3O9PA 4H46A 3K01A 4N91A 4NF8A 1HSLA 1DPPA 1QJMA 1MXZA 1VFEA 2DWAA 3ODBA 4RXLA 1FPGA 5ISUA 3FATA 1NUYA 4LUBA 3MP8A 1D9VA 4NN3A 4N81A 3PUXE 1ZTYA 4QRZA 3CG3A 5JK4A 5ELVA 1LBWA 1UTBA 4UA8A 4DXUA 1TT1A 3C32A 3I5OA 3PPQA 4ZEBA 2Q2CA 2VGQA 4EDPA 4R2FA 2D5WA 3QIMA 4RA1A 1H44A 1FQFA 1NMUA 5ICQA 2B4LA 3SZPA 2I4BA 4PBQA 4ZEKA 2Q8JA 1FJ9A 1NUXA 2DYXA 4P9KA 4MLQA 3TQLA 2BJIA 3D4GA 2Q2AA 1RDXA 3G3JA 1P99A 3VVDA 1Q1KA 3PMVA 1FQAA 4ONYA 4OVQA 5KDTA 1LAXA 2PFZA 3FVNA 4LQ5A 3H6TA 2Y7KA 3HN0A 3EHSA 1PDAA 1MQJA 1G0IA 2HPGA 4RY1A 1IITA 1KA1A 4PDDA 5EYFA 2F6GA 5EYGA 3HO7A 3U8QA 2R6GE 2XWKA 2XXKA 4MCOA 1MY4A 1JW1A 1LGBC 2O69A 2O7IA 3U65A 2HZLA 2H99A 3PUZE 3KJ7A 1NV0A 5DEXA 1AL3A 4PF8A 1Y4TA 2CZHA 1N7XA 4PE5B 2RCAA 3TMGA 4WXJA 4ESXA 5ET5A 4TLMB 1MM6A 3KN3A 1Q9DA 1LB8A 4XXUA 5EQ8A 4FATA 5H8FA 3A09A 3UA8A 3LUZA 3WAEA 4OENA 3V5AA 4QXDA 3IFAA 4LONB 4N07A 4OVTA 1A7LA 1XT8A 4LZ8A 1VFDA 4TLLB 3M3KA 4N13A 1JNFA 3ZSFA 5EQ7A 3MAMA 1UTHB 5FTIA 3MJNA 3FV1A 3FXBA 1ZKBA 2P2AA 5I59A 2DVZA 3BFUA 3SEXA 4GL8A 1AIVA 3CFLA 2CZKA 1MQDA 3QK6A 3B7DA 2ZNTA 3PD9A 2QVRA 3CFXA 2V3TA 2V3QA 4JVCA 1NUZA 4OANA 5ESYA 5ICTA 1I69A 1SW1A 5IM2A 1H76A 3RY3A 3PTYA 3QMFA 4DDDA 3HPIA 2HHMA 4YICA 1R9LA 4YKJA 1L5TA 4Z7EA 4O3CA 2QL3A 1VSOA 3C4MA 1YPNA 2PMSA 3OO6A 5A5XA 3MWBA 2HQ0A 1M5EA 3HCQA 4F1VA 1B4HA 4I3EA 1HSEA 3TTMA 4KYDA 1IUDA 3K4UA 4UACA 3E4RA 3Q25A 2F78A 2PX1A 4IO2A 4MIJA 4F19A 1ZMGA 3TTLA 3G3IA 3LSWA 4GWOA 2DDKA 2NWJA 2XXTA 2M8CA 1DTZA 1MY2A 3HFUA 4KYEA 4GF8A 4FE8A 3U1OA 1DTGA 2QPQA 5ET6A 3HSTA 5JTYB 2DWJA 4PFUA 4GX3A 3PV0E 1LCFA 2PFYA 4QF9A 4U4XA 4F39A 3UN6A 3DLNA 4JSDA 4BDLA 2RINA 1POY1 2HAVA 4NQ8A 4PAIA 5H8SA 4GQOA 4IR8A 4R6HA 4LZ7A 2A5TA 3SEVA 3PPOA 4N15A 1WDNA 2VP1A 4ZEIA 4IGRA 4PAKA 3TTKA 4R6YA 3T9HB 2XXQA 4IO4A 4G68A 4N4UA 4ELQA 2F34A 3KEIA 2B3FA 4MHFA 4P0IA 1F9BA 1MDP1 3B6WA 2NXOA 1N3XA 5EQAA 4XEQA 1K9ZA 3SEWA 3H06B 3VVFA 1DOTA 2Y84A 4GWZA 5DTBA 3B8BA 4XKNA 1B7HA 5H8QB 5K2XA 1UQWA 4QSEA 1H3DA 1MRPA 2HZKA 1FQCA 3EQ1A 2NVUB 3DM0A 2R9JA 1O63A 2RKMA 3MVWA 1FW0A 5CBRA 2DP8A 1D3KA 4P3LA 3C34A 1B7UA 2NUVA 1DCUA 3TCHA 3T9XB 1DPEA 1B6HA 4QSCA 1B3GA 2UVJA 1DSNA 2F7CA 2F7AA 2XHDA 4O3BA 4O8MA 4IY6A 4QFLA 5IZZA 2VHAA 3RQTA 4G8NA 4R75A 2X7QA 3AXFA 4LA9A 4MFIA 5I2KB 1NV6A 3OMBA 1FTJA 4MBPA 4G2ZA 3Q27A 3M8UA 4I3YA 4RK2A 2NOOA 1NNTA 3GZGA 2VPOA 1FSAA 4WEDA 4THIA 1B3FA 3OSRA 2G29A 1DBZA 1JETA 3V8XB 4UABA 1FQDA 4X1DA 3CIJA 1LBBA 1B2HA 4JWXA 4IB2A 1MPCA 1SYIA 1PBQA 5FHOA 3VFJA 1QUJA 1R6ZA 2DWHA 1Y4CA 3GYYA 1ATGA 3H03A 1FPEA 4JBZA 1IMCA 4FAJA 1NI9A 3KC0A 3N94A 4GBWA 5ET7A 4LVQA 4PE3A 1EYJA 2E1SA 2X26A 1FPDA 3K1MA 2ZYNA 4I9DA 5I56A 1K9YA 1GGGA 3PD8A 4GWYA 3FJMA 4GXAA 3EHTA 1FBFA 3FIRA 1ZLQA 3C36A 4XF5A 4F1YA 4OQOA 2HEUA 3ROJA 4GL0A 1FTKA 3T9UA 2Y5KA 1NV5A 4H0WA 1EYKA 2CEXA 4XIGQ 3B6TA 3IOVA 2B3BA 3PGFA 1YZ0A 4NF5B 4G4PA 4ZE8A 2XXWA 2PBWA 4XKPA 3K02A 5I58A 4KPTA 4OESA 5TP9B 4DCXA 5CMCA 2FHYA 5H8NB 1FBEA 3R7XA 1PC3A 3FXRA 5H8HB 1I6QA 1OQGA 1O64A 3V83A 1UIVA 3OENA 1IIWA 1YTVA 1B05A 1BP5A 3T0JA 5L9SA 5L9OA 1OLCA 2F8DA 1NNKA 3UGWA 2CZIA 1FPJA 4RPOA 3MZBA 4F3SA 4PFTA 2HXRA 3ECRA 4HS7A 1IZ1A 4M4GA 4I62A 1NV2A 4PDHA 4GWWA 1GR2A 1B5IA 4PQJA 2I3VA 3IOWA 4OZ9A 1R1NA 4R6KA 3TKDA 1QVSA 1JQFA 2DQVA 1JEUA 2I0CA 1CB6A 4U2RA 1CE2A 4OTEA 4JDFA 5I57A 2PVUA 3OD7A 4LZ5A 3JV9A 4P11A 4GLIA 1A55A 1B0HA 1QUKA 3FD3A 4OVSA 1XVYA 4NF6B 1GV8A 3LSXA 4WEPA 1LBVA 3SETA 3E9XA 2R71A 1IXHA 3K6XA 5AE4A 2D21A 5KCJB 4ZE9A 1SQYA 4RJZA 3T1BA 3VVEA 2O1LA 1N3WA 4XKRA 2Q8MA 4PGNA 3S9MC 3TELA 3TEPA 1B46A 1BK4A 4EF1A 3G3KA 3DP6A 3JYRA 3U94A 1OLAA 1B3EA 4MX6A 2GRVA 2B65A 3L6GA 3TUSA 2Y7PA 2FNCA 2ZMBA 1MPBA 4ELOA 3RNNA 5EHSA 1MM7A 4MF3A 5EYHA 1ANFA 3THIA 4G77A 4QFPA 3WAFA 4AQ4A 2O7UA 4IO3A 4MNIA 2OLBA 4H5FA 4GVOA 1H45A 1MS7A 4K3FA 3W9VA 3RGYA 4YMBA 4NWCA 3SEYA 4I40A 4O94A 4BDQA 2JJKA 3GXAA 3T9VA 3KFMA 2H25A 1ZBMA 1IQ7A 4ZEDA 4BDOA 4F3PA 3C35A 3KN8A 1RYXA 2Z8FA 3OXNA 1KZ8A 3MP1A 1AMFA 1BLFA 1P1UA 3RPLB 2XXVA 1DMBA 3RTFB 1EZ9A 1RKMA 3KBRA 4ND9A 3U93A 4ISUA 1VE4A 4QFKA 1OQHA 5I3SA 4FORA 4OWDA 1WODA 3T66A 5AA2D 3K6UA 4HXVA 1B58A 5A5XB 3TZAA 3N26A 4F31B 5CM6A 2O6AA 5CMBA 1G0HA 2F6PA 1NV3A 4QSDA 2ONKE 5JEIA 3I3VA 2QMWA 3MZ9A 1Y3QA 5ITOA 5FBPA 5IKBA 3QSLA 4ZECA 1H43A 3MZ1A 4F18A 2D3IA 1LLSA 2F5XA 3ZKKA 3N6TA 3MVYA 4WKMA 5AA4B 1B32A 3M3LA 4OVPA 3FVOA 3ZKLA 5DT6A 1SYHA 1LBXA 2DWIA 2HXWA 2ALUA 1MXVA 5J1DA 5FTHA 1Y3NA 2UYFA 5CBSA 1CNQA 1NUWA 1UTHA 4AS4A 2ONSA 4Q5TA 1NL5A 5A5LA 4RNSA 2VOZA 4NF4B 3IJXB 3IOTA 3BKIB 1IEJA 1MY1A 3H4ZA 1N76A 3KSXA 1FTMA 3VE1B 1YXIA 1IMBA 3K00A 3HV1A 2OCUA 4PGPA 5AA3A 3VLVA 3VLWA 2CEYA 4GXSB 3MYUA 2GHAA 4G68C 1LB9A 1US4A 1O7TA 4N6DA 4FEBA 4NAPA 1QKBA 3TTRA 4Z0IA 3FV2A 1FBCA 3BFTA 3GBAA 2Z22A 2F35A 4U4SA 2XXUA 1BTJA 2ZZXA 3RTWB 3LBSA 2OBGA 3VDFA 2V84A 2FA7A 3MC2A 5K2YA 1ZU0A 3LV0A 1P1NA 4JVIA 2OZZA 5AA2B 4PCDA 3RLFE 2RC9A 4X48A 1LAGE 2OWTA 4PFYA 1AWBA 4DXCA 3SEUA 4N6PA 2QSXA 4HTGA 4OERA 5B7DA 3PUWE 1IMDA 1IXIA 1LCTA 1JP4A 3IORA 4Q8RA 2P3VA 4U1ZA 2FVZA 1I6BA 5JTYA 1D9QA 4PFRA 4IGTA 3CI8A 5EQ9A 4H67A 4N6KA 4RPNA 4ZS9A 5DVJA 1MQHA 2KR0A 1OIBA 4PFIA 4QHQA 2P3NA 2YLNA 3O97A 5CRYA 4MEVA 2CMOA 4TOZA 3PPPA 3SERA 3R6UA 3H6VA 4NHBA 4GOTA 3E79A 1IMAA 4LATA 3MBPA 1II5A 4MNPA 3E13X 1MXYA 3ISPA 3S4UA 1FPIA 5I2NB 3TQWA 1PB7A 2DOJA 1SDXA 2WYPA 1IMFA 2Y7RA 5DVFA 3A3CA 1ELJA 2Z23A 4R74A 2H4IA 4BDMA 2F7BA 4YB5A 3O2AA 2I4CA 1XC1A 1LBYA 2VPNA 4GWSA 4HE1A 2OX3A 4OVRA 1NKXA 3R26A 5H8QA 1OMPA 4Q30B 3UP9A 4NEDA 1YYZA 4I8CA 3BIGA 3LSLA 2WBBA 2IA4A 1I6AA 2XWOA 1OVTA 2MKZA 4GIZA 4NGUA 2O84X 4YKPA 4AB6A 1LFHA 4DE8A 2DSFA 2O68A 1P1OA 2RCBA 3CVGA 3E78A 4YB6A 3ILUB 3H6UA 1BIYA 3KSJA 5EHMA 2VT5A 4BDNA 4KHZE 4DXBA 2ZYOA 5IZ3B 3SKPA 2WEFA 4OEUA 3CR9A 5I84A 3K1PA 4MLVA 4GX6A 1MPDA 1D4NA 2ZNSA 4GBVA 2V25A 3FXQA 2DVCA 3OSQA 4DI4B 4OXVA 1SI0A 2H5YA 5I2KA 4X1BA 3H6WA 1S9TA 2QFLA 2ABHA 2Y7IA 3F11A 1USYE 2FBPA 1P1WA 3T93B 2RC7A 3IB1A 1SW5A 2I3WA 5CMMA 1FBPA 3CFZA 4KFQA 5TPAB 3GLBA 1GTKA 4KCDA 3SDFA 3FVKA 3TFLA 4NG7A 3IO6A 3OO8A 3UIFA 1JW5A 3C9HA 3HHGA 3C31A 4G8HA 4DLDA 1BKAA 2UVHA 3IB2A 3RN8A 1B3LA 3L6HA 4PAFA 1B4ZA 3O6GA 4JVDA 4JSOA 4AB5A 2AIXA 5CMKA 1Z7NE 2G93A 3CG1A 3IK6B 2ZZVA 5CC2A 1MQIA 2OWZA 2DE2A 4IY5A 3T96B 3Q29A 2DE3A 2DXRA 1Y1MA 3MUQA 3Q26A 1A40A 4NF8B 3KBZA 1POTA 4DZ1A 4JWYA 1SW2A 1AH5A 5KZTA 1NNPA 4POXA 1N04A 4O3AA 1IXGA 3PPNA 1PBPA 4F2OA 3FXUA 4GWUA 3CHGA 1NH7A 4KD5A 2ZXTA 1A54A 4H8IA 2ZNUA 1M5CA 3IO4A 4QBAA 1D9YA 1UTBB 3CSBA 2ZYKA 4ZZEA 4PF6A 3OOAA 5IZ1A 1XHYA 1HSJA 1LAHE 1FPFA 4FECA 4MMPA 1QULA 1SBPA 4NF5A 2XXXA 2CZLA 4EXKA 2F97A 2ANJA 5TP9A 4PP0A 4HCWA 5H8NA 4N17A 1MXXA 1PB9A 4ZZAA 2Y7WA 1JVXA 2THIA 4YZZA 2XWIA 5KDTB 5H8HA 3W9WA 2XX7A 2XXHA 3TDJA 3C33A 1B1HA 2BJJX 3VXBA 4NX1A 3MP6A 4KR5A 1NNFA 1QGXA 1Y1ZA 2XD3A 3IJOB 3K2DA 4PETA 2HAUA 2B4MA 5DVIA 3D1RA 4IO7A 4YB7A 4OEVA 4YKIA 2XX9A 2QMXA 1UIUA 1RDYA 4IO5A 1SD3A 1DK4A 4X8RA 4H1XA 3BIHA 1LAFE 5HBCA 1EZOA 1FBGA 4O7MA 1MY0A 3MVZA 1VDWA 1Q35A 4H45A 5DEXB 3KOSA 3SESA 1NV4A 3IR1A 1JW4A 4F22A 1ZIUA 2UVGA 5L9MA 4P1EA 3KOTA 1URDA 5H8FB 1N84A 1J1NA 2DE4A 3TAJA 4PBHA 1WVJA 4POWA 2HCAA 4NF6A 3FZVA 2KQZA 2WX9A 4F2QA 2O1MA 3DP8A 1RDZA 3MPLA 2F3DA 1Z7ME 5KCJA 1NFTA 1LBCA 1YCJA 1NV1A 2Z8DA 3EN3A 4F1UA 2XX8A 3A29A 5I59B 4DCYA 4I1DA 2QS4A 5IAIA 1XVXA 5F24A 2GQ1A 1IMEA 3UORA 5LTCA 3RPWA 1PEBA 1B1XA 2WKYA 2GH9A 2PT1A 5IGAA 1LSTA 3M3FA 4ELPA 1LBZA 4HW8A 3MPKA 2AYSA 2OK2A 2DS9A 3B50A 4KQPA 5LDZA 3RYDA 1FPBA 4N8GA 2I6EA 2WYKA 2XD2A 3I6VA 1Y9UA 3H7MA 4XTCQ 4G61A 4U22A 3QUJA 1A8FA 4GX4A 1TXFA 4F3BA 2LAOA 1M5BA 2ESNA 4GD5A 2YJPA 3K6WA 3BBRA 2H98A 2I49A 1OVBA 4PFBA 1JVYA 4P1LA 4OFJA 2VD2A 3U92A 4R2BA 2V3UA 2E0SA 3UK4A 3O29A 3KJTA 2Z8EA 4PTKA 3N5LA 4C1TA 2Y5LA 3B6QA 4Q0CA 2H9BA 3RPLA 1LFGA 2XA5A 4DI3D 5FHNA 1YAEA 2QS2A 3A3UA 4E0WA 2ZZWA 1MH3A 4YU0A 1VR5A 4NTLA 1B40A 1XI6A 1TFDA 2A5TB 3PUVE 1S7YA 3KG2A 1PB8A 3S9NC 4LN5A 4HCYA 2KLFA 2W7YA 2GFEA 3EHUA 4NE4A 4PC9A 3GBBA 4YMAA 5I5PA 2QJEA 2XXRA 3NOHA 1KA0A 3TYHA 1FBDA 4XKQA 3U72A 2UYEA 3FVGA 1B3HA 2GHBA 4X9TA 3RT8A 4G68B 4IO6A 2FIEA 3TTNA 1FJ6A 2PYYA 3VXCA 4EQ7A 2Q9TA 3E3KA 3IOUA 1EZPA 1URSA 3V89B 4OETA 5AA4A 1JEVA 3O28A 4JB7A 4P0GA 3S2VA 2IEEA 4R72A 1TWYA 2UVIA 4MAGA 5AA1A 1XOCA 3S9LC 1MH4A 2O51A 4E0XA 3K6VA 5T3JA 3TCGA 4U21A 4F29A 3OO9A 4YKKA 4YAHX 3VLUA 2RC8A 3W15C 4OMBA 3LR1A 1FQBA 1N0TA 2PT2A 3KGCA 4L17A 3LUYA 4NF4A 1MXWA 1Y3PA 2YPNA 1IXCA 3OEKA 1B5HA 1A99A 2XWVA 3IFCA 3CRBA 4NF0A 4JXIA 2F36A 4P47A 4DIGA 4LP2B 2P0SA 3EKIA 4KCCA 1FTAA 2ZYMA 1XS5A 3KZGA 3QUFA 3OO7A 2ONRA 3OEMA 4OFLA 3RUMA 5HM4B 3MW0A 2WBDA 3PU5A 5HPQA 1MG1A 5L8DA 3HHFA 4M1VA 4AS5A 2QVVA 5TU0A 2Q74A 3O66A 5B70A 2UXAA 3DELB 1B7ZA 4QFOA 4FEDA 3KC1A 1MQGA 1B9JA 4OVJA 5AA2A 2Q88A 3S9EA 4ELRA 4R73A 1RYOA 5F7VA 2REJA 3MVXA 3ILTB 4G8MA 5F1QA 1M5FA 3PPRA 4XFEA 2FYIA 1EH3A 3PUYE 4BLAA 3MSTA 3G3GA 1S50A 3G3FA 3ONMA 1M5DA 3FGSA 5DW8A 1FTLA 3G7WA 1QW0A 2PCRA 4P56A 1URGA 2FIXA 1QUIA 1EYIA 1AOVA 1NV7A 4HE0A 4OA4A 4GWXA 3FUZA 1SW4A 2V93A 2OJTA 5BWJA 4C0RA 1B5JA 4ZDMA 1R9QA 2HFBA 4P8BA 3EPEA 3USDA 2I48A 1ZJLA 2QRYA 3K1NA 4U1OA 5LOMA 3O6IA 5ET8A 1FCKA 4N8YA 3TPAA 1B0LA 3LSFB 1EU8A 4JWOA 4OHNA 5I2NA 2VD3A 1FTOA 1NH8A 4EF2A 5I56B 4H5GA 2P1SA 1SVXB 3FASA 4GRKA 2XXIA 3QYTA 1FPKA 4KI0E 4R9GA 4MH5A 3FJGA 3ZS6A 3Q28A 4RYAA 5ITPA 1SPIA 4GFRA 1A8EA 2I58A 4O7IA 1N7WA 3O6HA 3TODA 3OELA 3CSGA 4H8JA 3PMXA 2XXYA 1QKAA 3FBPA 4EQ9A 1INPA 1B51A 1LFIA 1USYH 3P7IA 5CI5A 4FIMA 4R9FA 5I58B 1MDQA 1T0KA 4H65A 1TFAA 4RK9A 4BDRA 5FHMA 4ECFA 1KWHA 3TCFA 4NWDA 3T22A 4H6DA 5IZ3A 5I7IA 3DP4A 2REGA 3FJ7A 1LEVA 1P1QA 4ZEFA 4F3GA 4QFNA
chains in the Genus database with same CATH topology
4H45A 2QVUA 4P3LA 5J1DA 1NV4A 1CNQA 1DCUA 1FRPA 1NUWA 4P1EA 4HE2A 4AS4A 5J16A 4MNCA 5A5LA 2DE4A 2L5VA 1FPLA 4PBHA 2V4CA 4O8MA 5IZZA 2KQZA 2R8TA 2WX9A 1YXIA 1IMBA 1RDZA 2F3DA 4MJOA 4PGPA 1NV6A 2CEYA 1NV1A 3MYUA 4KXPA 4F1UA 4I3YA 4N6DA 3A29A 4NAPA 4FBPA 2VPOA 1FSAA 1FBCA 1FBHA 5F24A 2GQ1A 1IMEA 5LTCA 2ZZXA 1DBZA 5IGAA 4X04A 3LV0A 4UABA 2F3BA 4JVIA 4PCDA 1LBZA 4H46A 3B50A 5LDZA 4N91A 3RYDA 1FPBA 4N8GA 1AWBA 2WYKA 4G61A 1IMDA 1JP4A 1FPGA 4GX4A 1NUYA 2P3VA 4NN3A 3GYYA 4N81A 2FVZA 1FPEA 1D9QA 4PFRA 1IMCA 1NI9A 3KC0A 4GBWA 5EQ9A 5JK4A 5ET7A 1LBWA 4N6KA 4PFBA 4PE3A 1EYJA 4P1LA 1FPDA 2KR0A 1K9YA 2B4LA 4PFIA 3SZPA 4GWYA 4PBQA 2P3NA 4PTKA 1FJ9A 2Y5LA 1FBFA 4MEVA 1NUXA 4P9KA 3RPLA 4NHBA 2BJIA 2XA5A 4DI3D 4XF5A 3E79A 1RDXA 1IMAA 3ROJA 4MNPA 2Y5KA 1NV5A 3ISPA 4OVQA 1EYKA 1FPIA 2CEXA 2PFZA 2ZZWA 1XI6A 2WYPA 1IMFA 1YZ0A 4LN5A 4HCYA 4PC9A 1G0IA 2FHYA 5I5PA 2HPGA 1FBEA 3NOHA 1LBYA 1KA0A 1KA1A 1FBDA 4PDDA 2VPNA 5EYGA 4GWSA 4HE1A 2OX3A 2XWKA 2XXKA 4OVRA 4X9TA 4MCOA 2FIEA 1FJ6A 1YYZA 2Q9TA 3BIGA 2WBBA 3T0JA 3U65A 2XWOA 2HZLA 2MKZA 4NGUA 4MAGA 1NV0A 4PF8A 2CZHA 2CZIA 5T3JA 3E78A 1FPJA 2VT5A 5ET5A 5EQ8A 1Q9DA 5IZ3B 2HXRA 2WEFA 3LUZA 4QXDA 3IFAA 4GX6A 1NV2A 4OVTA 4GWWA 4PDHA 2XWVA 3IFCA 4GBVA 4NF0A 4DI4B 4P47A 3EKIA 1FTAA 2QFLA 5EQ7A 2WBDA 2FBPA 3FXBA 2DVZA 1FBPA 4M1VA 2CZKA 4OVSA 4AS5A 2QVVA 2Q74A 2QVRA 1LBVA 4NG7A 2V3QA 3KC1A 4JVCA 1NUZA 4OANA 5ESYA 5IM2A 3PTYA 3T1BA 3QMFA 2Q8MA 2HHMA 4YICA 4PGNA 4PAFA 4JVDA 4XFEA 1BK4A 3MSTA 2ZZVA 2OWZA 2DE2A 4MX6A 4F1VA 4I3EA 2DE3A 5DW8A 2PCRA 4P56A 2FIXA 5EYHA 1EYIA 3KBZA 4MIJA 4F19A 1NV7A 4HE0A 4OA4A 4GWXA 2DDKA 4MNIA 4GWUA 3CHGA 3HFUA 3W9VA 4P8BA 2QPQA 5ET6A 4I40A 4GX3A 4O94A 4QBAA 2JJKA 5ET8A 2PFYA 4N8YA 4PF6A 4NQ8A 1KZ8A 4PAIA 5IZ1A 4IR8A 1FPFA 4MMPA 3RPLB 4N15A 1FPKA 4PAKA 4HCWA 4N17A 1SPIA 5I3SA 2XWIA 4YZZA 3W9WA 4O7IA 4N4UA 4NX1A 1QGXA 4HXVA 4MHFA 3FBPA 5CM6A 1INPA 5EQAA 4PETA 1G0HA 4XEQA 2B4MA 1K9ZA 1NV3A 3D1RA 5FBPA 1RDYA 4GWZA 3B8BA 1DK4A 4X8RA 3BIHA 4F18A 2HZKA 5IZ3A 5I7IA 1FBGA 2F5XA 4O7MA 1LEVA 4OVPA 1VDWA 1LBXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KQZ A;  2L5V A;  2KR0 A;  2MKZ A; 
#chains in the Genus database with same CATH topology
 1GVC A;  2I0B A;  2QVU A;  2AL5 A;  3K0V A;  4KYS A;  4TQU Q;  3IX1 A;  3KN7 A;  4OFO A;  1FRP A;  2Q89 A;  4HE2 A;  3G3H A;  5J16 A;  3EF7 A;  3VV5 A;  4MNC A;  2DXY A;  1SI1 A;  3IL1 B;  2L5V A;  1FPL A;  4NMY A;  3IB0 A;  2V4C A;  5TPA A;  2QS3 A;  1MXU A;  2QS1 A;  4PFW A;  2R8T A;  4U23 A;  1FQE A;  4FJP A;  2XXP A;  2OWS A;  1MY3 A;  4MJO A;  5BUU A;  5M2V A;  3N6U A;  3D4C A;  3H3G A;  4KXP A;  3QXM A;  1US5 A;  3MQ9 A;  5I57 B;  4LQ2 A;  2RF1 A;  4EQB A;  3PMW A;  4FBP A;  2X7P A;  1FBH A;  1B52 A;  4OYV A;  3QAX A;  3JZJ A;  4ESW A;  1Y20 A;  5DYH A;  4X04 A;  4C1U A;  2A5S A;  2AL4 A;  3IAZ A;  4EUO A;  2F3B A;  3RT6 B;  4EXL A;  3LC8 A;  3O9P A;  4H46 A;  3K01 A;  4N91 A;  4NF8 A;  1HSL A;  1DPP A;  1QJM A;  1MXZ A;  1VFE A;  2DWA A;  3ODB A;  4RXL A;  1FPG A;  5ISU A;  3FAT A;  1NUY A;  4LUB A;  3MP8 A;  1D9V A;  4NN3 A;  4N81 A;  3PUX E;  1ZTY A;  4QRZ A;  3CG3 A;  5JK4 A;  5ELV A;  1LBW A;  1UTB A;  4UA8 A;  4DXU A;  1TT1 A;  3C32 A;  3I5O A;  3PPQ A;  4ZEB A;  2Q2C A;  2VGQ A;  4EDP A;  4R2F A;  2D5W A;  3QIM A;  4RA1 A;  1H44 A;  1FQF A;  1NMU A;  5ICQ A;  2B4L A;  3SZP A;  2I4B A;  4PBQ A;  4ZEK A;  2Q8J A;  1FJ9 A;  1NUX A;  2DYX A;  4P9K A;  4MLQ A;  3TQL A;  2BJI A;  3D4G A;  2Q2A A;  1RDX A;  3G3J A;  1P99 A;  3VVD A;  1Q1K A;  3PMV A;  1FQA A;  4ONY A;  4OVQ A;  5KDT A;  1LAX A;  2PFZ A;  3FVN A;  4LQ5 A;  3H6T A;  2Y7K A;  3HN0 A;  3EHS A;  1PDA A;  1MQJ A;  1G0I A;  2HPG A;  4RY1 A;  1IIT A;  1KA1 A;  4PDD A;  5EYF A;  2F6G A;  5EYG A;  3HO7 A;  3U8Q A;  2R6G E;  2XWK A;  2XXK A;  4MCO A;  1MY4 A;  1JW1 A;  1LGB C;  2O69 A;  2O7I A;  3U65 A;  2HZL A;  2H99 A;  3PUZ E;  3KJ7 A;  1NV0 A;  5DEX A;  1AL3 A;  4PF8 A;  1Y4T A;  2CZH A;  1N7X A;  4PE5 B;  2RCA A;  3TMG A;  4WXJ A;  4ESX A;  5ET5 A;  4TLM B;  1MM6 A;  3KN3 A;  1Q9D A;  1LB8 A;  4XXU A;  5EQ8 A;  4FAT A;  5H8F A;  3A09 A;  3UA8 A;  3LUZ A;  3WAE A;  4OEN A;  3V5A A;  4QXD A;  3IFA A;  4LON B;  4N07 A;  4OVT A;  1A7L A;  1XT8 A;  4LZ8 A;  1VFD A;  4TLL B;  3M3K A;  4N13 A;  1JNF A;  3ZSF A;  5EQ7 A;  3MAM A;  1UTH B;  5FTI A;  3MJN A;  3FV1 A;  3FXB A;  1ZKB A;  2P2A A;  5I59 A;  2DVZ A;  3BFU A;  3SEX A;  4GL8 A;  1AIV A;  3CFL A;  2CZK A;  1MQD A;  3QK6 A;  3B7D A;  2ZNT A;  3PD9 A;  2QVR A;  3CFX A;  2V3T A;  2V3Q A;  4JVC A;  1NUZ A;  4OAN A;  5ESY A;  5ICT A;  1I69 A;  1SW1 A;  5IM2 A;  1H76 A;  3RY3 A;  3PTY A;  3QMF A;  4DDD A;  3HPI A;  2HHM A;  4YIC A;  1R9L A;  4YKJ A;  1L5T A;  4Z7E A;  4O3C A;  2QL3 A;  1VSO A;  3C4M A;  1YPN A;  2PMS A;  3OO6 A;  5A5X A;  3MWB A;  2HQ0 A;  1M5E A;  3HCQ A;  4F1V A;  1B4H A;  4I3E A;  1HSE A;  3TTM A;  4KYD A;  1IUD A;  3K4U A;  4UAC A;  3E4R A;  3Q25 A;  2F78 A;  2PX1 A;  4IO2 A;  4MIJ A;  4F19 A;  1ZMG A;  3TTL A;  3G3I A;  3LSW A;  4GWO A;  2DDK A;  2NWJ A;  2XXT A;  2M8C A;  1DTZ A;  1MY2 A;  3HFU A;  4KYE A;  4GF8 A;  4FE8 A;  3U1O A;  1DTG A;  2QPQ A;  5ET6 A;  3HST A;  5JTY B;  2DWJ A;  4PFU A;  4GX3 A;  3PV0 E;  1LCF A;  2PFY A;  4QF9 A;  4U4X A;  4F39 A;  3UN6 A;  3DLN A;  4JSD A;  4BDL A;  2RIN A;  1POY 1;  2HAV A;  4NQ8 A;  4PAI A;  5H8S A;  4GQO A;  4IR8 A;  4R6H A;  4LZ7 A;  2A5T A;  3SEV A;  3PPO A;  4N15 A;  1WDN A;  2VP1 A;  4ZEI A;  4IGR A;  4PAK A;  3TTK A;  4R6Y A;  3T9H B;  2XXQ A;  4IO4 A;  4G68 A;  4N4U A;  4ELQ A;  2F34 A;  3KEI A;  2B3F A;  4MHF A;  4P0I A;  1F9B A;  1MDP 1;  3B6W A;  2NXO A;  1N3X A;  5EQA A;  4XEQ A;  1K9Z A;  3SEW A;  3H06 B;  3VVF A;  1DOT A;  2Y84 A;  4GWZ A;  5DTB A;  3B8B A;  4XKN A;  1B7H A;  5H8Q B;  5K2X A;  1UQW A;  4QSE A;  1H3D A;  1MRP A;  2HZK A;  1FQC A;  3EQ1 A;  2NVU B;  3DM0 A;  2R9J A;  1O63 A;  2RKM A;  3MVW A;  1FW0 A;  5CBR A;  2DP8 A;  1D3K A;  4P3L A;  3C34 A;  1B7U A;  2NUV A;  1DCU A;  3TCH A;  3T9X B;  1DPE A;  1B6H A;  4QSC A;  1B3G A;  2UVJ A;  1DSN A;  2F7C A;  2F7A A;  2XHD A;  4O3B A;  4O8M A;  4IY6 A;  4QFL A;  5IZZ A;  2VHA A;  3RQT A;  4G8N A;  4R75 A;  2X7Q A;  3AXF A;  4LA9 A;  4MFI A;  5I2K B;  1NV6 A;  3OMB A;  1FTJ A;  4MBP A;  4G2Z A;  3Q27 A;  3M8U A;  4I3Y A;  4RK2 A;  2NOO A;  1NNT A;  3GZG A;  2VPO A;  1FSA A;  4WED A;  4THI A;  1B3F A;  3OSR A;  2G29 A;  1DBZ A;  1JET A;  3V8X B;  4UAB A;  1FQD A;  4X1D A;  3CIJ A;  1LBB A;  1B2H A;  4JWX A;  4IB2 A;  1MPC A;  1SYI A;  1PBQ A;  5FHO A;  3VFJ A;  1QUJ A;  1R6Z A;  2DWH A;  1Y4C A;  3GYY A;  1ATG A;  3H03 A;  1FPE A;  4JBZ A;  1IMC A;  4FAJ A;  1NI9 A;  3KC0 A;  3N94 A;  4GBW A;  5ET7 A;  4LVQ A;  4PE3 A;  1EYJ A;  2E1S A;  2X26 A;  1FPD A;  3K1M A;  2ZYN A;  4I9D A;  5I56 A;  1K9Y A;  1GGG A;  3PD8 A;  4GWY A;  3FJM A;  4GXA A;  3EHT A;  1FBF A;  3FIR A;  1ZLQ A;  3C36 A;  4XF5 A;  4F1Y A;  4OQO A;  2HEU A;  3ROJ A;  4GL0 A;  1FTK A;  3T9U A;  2Y5K A;  1NV5 A;  4H0W A;  1EYK A;  2CEX A;  4XIG Q;  3B6T A;  3IOV A;  2B3B A;  3PGF A;  1YZ0 A;  4NF5 B;  4G4P A;  4ZE8 A;  2XXW A;  2PBW A;  4XKP A;  3K02 A;  5I58 A;  4KPT A;  4OES A;  5TP9 B;  4DCX A;  5CMC A;  2FHY A;  5H8N B;  1FBE A;  3R7X A;  1PC3 A;  3FXR A;  5H8H B;  1I6Q A;  1OQG A;  1O64 A;  3V83 A;  1UIV A;  3OEN A;  1IIW A;  1YTV A;  1B05 A;  1BP5 A;  3T0J A;  5L9S A;  5L9O A;  1OLC A;  2F8D A;  1NNK A;  3UGW A;  2CZI A;  1FPJ A;  4RPO A;  3MZB A;  4F3S A;  4PFT A;  2HXR A;  3ECR A;  4HS7 A;  1IZ1 A;  4M4G A;  4I62 A;  1NV2 A;  4PDH A;  4GWW A;  1GR2 A;  1B5I A;  4PQJ A;  2I3V A;  3IOW A;  4OZ9 A;  1R1N A;  4R6K A;  3TKD A;  1QVS A;  1JQF A;  2DQV A;  1JEU A;  2I0C A;  1CB6 A;  4U2R A;  1CE2 A;  4OTE A;  4JDF A;  5I57 A;  2PVU A;  3OD7 A;  4LZ5 A;  3JV9 A;  4P11 A;  4GLI A;  1A55 A;  1B0H A;  1QUK A;  3FD3 A;  4OVS A;  1XVY A;  4NF6 B;  1GV8 A;  3LSX A;  4WEP A;  1LBV A;  3SET A;  3E9X A;  2R71 A;  1IXH A;  3K6X A;  5AE4 A;  2D21 A;  5KCJ B;  4ZE9 A;  1SQY A;  4RJZ A;  3T1B A;  3VVE A;  2O1L A;  1N3W A;  4XKR A;  2Q8M A;  4PGN A;  3S9M C;  3TEL A;  3TEP A;  1B46 A;  1BK4 A;  4EF1 A;  3G3K A;  3DP6 A;  3JYR A;  3U94 A;  1OLA A;  1B3E A;  4MX6 A;  2GRV A;  2B65 A;  3L6G A;  3TUS A;  2Y7P A;  2FNC A;  2ZMB A;  1MPB A;  4ELO A;  3RNN A;  5EHS A;  1MM7 A;  4MF3 A;  5EYH A;  1ANF A;  3THI A;  4G77 A;  4QFP A;  3WAF A;  4AQ4 A;  2O7U A;  4IO3 A;  4MNI A;  2OLB A;  4H5F A;  4GVO A;  1H45 A;  1MS7 A;  4K3F A;  3W9V A;  3RGY A;  4YMB A;  4NWC A;  3SEY A;  4I40 A;  4O94 A;  4BDQ A;  2JJK A;  3GXA A;  3T9V A;  3KFM A;  2H25 A;  1ZBM A;  1IQ7 A;  4ZED A;  4BDO A;  4F3P A;  3C35 A;  3KN8 A;  1RYX A;  2Z8F A;  3OXN A;  1KZ8 A;  3MP1 A;  1AMF A;  1BLF A;  1P1U A;  3RPL B;  2XXV A;  1DMB A;  3RTF B;  1EZ9 A;  1RKM A;  3KBR A;  4ND9 A;  3U93 A;  4ISU A;  1VE4 A;  4QFK A;  1OQH A;  5I3S A;  4FOR A;  4OWD A;  1WOD A;  3T66 A;  5AA2 D;  3K6U A;  4HXV A;  1B58 A;  5A5X B;  3TZA A;  3N26 A;  4F31 B;  5CM6 A;  2O6A A;  5CMB A;  1G0H A;  2F6P A;  1NV3 A;  4QSD A;  2ONK E;  5JEI A;  3I3V A;  2QMW A;  3MZ9 A;  1Y3Q A;  5ITO A;  5FBP A;  5IKB A;  3QSL A;  4ZEC A;  1H43 A;  3MZ1 A;  4F18 A;  2D3I A;  1LLS A;  2F5X A;  3ZKK A;  3N6T A;  3MVY A;  4WKM A;  5AA4 B;  1B32 A;  3M3L A;  4OVP A;  3FVO A;  3ZKL A;  5DT6 A;  1SYH A;  1LBX A;  2DWI A;  2HXW A;  2ALU A;  1MXV A;  5J1D A;  5FTH A;  1Y3N A;  2UYF A;  5CBS A;  1CNQ A;  1NUW A;  1UTH A;  4AS4 A;  2ONS A;  4Q5T A;  1NL5 A;  5A5L A;  4RNS A;  2VOZ A;  4NF4 B;  3IJX B;  3IOT A;  3BKI B;  1IEJ A;  1MY1 A;  3H4Z A;  1N76 A;  3KSX A;  1FTM A;  3VE1 B;  1YXI A;  1IMB A;  3K00 A;  3HV1 A;  2OCU A;  4PGP A;  5AA3 A;  3VLV A;  3VLW A;  2CEY A;  4GXS B;  3MYU A;  2GHA A;  4G68 C;  1LB9 A;  1US4 A;  1O7T A;  4N6D A;  4FEB A;  4NAP A;  1QKB A;  3TTR A;  4Z0I A;  3FV2 A;  1FBC A;  3BFT A;  3GBA A;  2Z22 A;  2F35 A;  4U4S A;  2XXU A;  1BTJ A;  2ZZX A;  3RTW B;  3LBS A;  2OBG A;  3VDF A;  2V84 A;  2FA7 A;  3MC2 A;  5K2Y A;  1ZU0 A;  3LV0 A;  1P1N A;  4JVI A;  2OZZ A;  5AA2 B;  4PCD A;  3RLF E;  2RC9 A;  4X48 A;  1LAG E;  2OWT A;  4PFY A;  1AWB A;  4DXC A;  3SEU A;  4N6P A;  2QSX A;  4HTG A;  4OER A;  5B7D A;  3PUW E;  1IMD A;  1IXI A;  1LCT A;  1JP4 A;  3IOR A;  4Q8R A;  2P3V A;  4U1Z A;  2FVZ A;  1I6B A;  5JTY A;  1D9Q A;  4PFR A;  4IGT A;  3CI8 A;  5EQ9 A;  4H67 A;  4N6K A;  4RPN A;  4ZS9 A;  5DVJ A;  1MQH A;  2KR0 A;  1OIB A;  4PFI A;  4QHQ A;  2P3N A;  2YLN A;  3O97 A;  5CRY A;  4MEV A;  2CMO A;  4TOZ A;  3PPP A;  3SER A;  3R6U A;  3H6V A;  4NHB A;  4GOT A;  3E79 A;  1IMA A;  4LAT A;  3MBP A;  1II5 A;  4MNP A;  3E13 X;  1MXY A;  3ISP A;  3S4U A;  1FPI A;  5I2N B;  3TQW A;  1PB7 A;  2DOJ A;  1SDX A;  2WYP A;  1IMF A;  2Y7R A;  5DVF A;  3A3C A;  1ELJ A;  2Z23 A;  4R74 A;  2H4I A;  4BDM A;  2F7B A;  4YB5 A;  3O2A A;  2I4C A;  1XC1 A;  1LBY A;  2VPN A;  4GWS A;  4HE1 A;  2OX3 A;  4OVR A;  1NKX A;  3R26 A;  5H8Q A;  1OMP A;  4Q30 B;  3UP9 A;  4NED A;  1YYZ A;  4I8C A;  3BIG A;  3LSL A;  2WBB A;  2IA4 A;  1I6A A;  2XWO A;  1OVT A;  2MKZ A;  4GIZ A;  4NGU A;  2O84 X;  4YKP A;  4AB6 A;  1LFH A;  4DE8 A;  2DSF A;  2O68 A;  1P1O A;  2RCB A;  3CVG A;  3E78 A;  4YB6 A;  3ILU B;  3H6U A;  1BIY A;  3KSJ A;  5EHM A;  2VT5 A;  4BDN A;  4KHZ E;  4DXB A;  2ZYO A;  5IZ3 B;  3SKP A;  2WEF A;  4OEU A;  3CR9 A;  5I84 A;  3K1P A;  4MLV A;  4GX6 A;  1MPD A;  1D4N A;  2ZNS A;  4GBV A;  2V25 A;  3FXQ A;  2DVC A;  3OSQ A;  4DI4 B;  4OXV A;  1SI0 A;  2H5Y A;  5I2K A;  4X1B A;  3H6W A;  1S9T A;  2QFL A;  2ABH A;  2Y7I A;  3F11 A;  1USY E;  2FBP A;  1P1W A;  3T93 B;  2RC7 A;  3IB1 A;  1SW5 A;  2I3W A;  5CMM A;  1FBP A;  3CFZ A;  4KFQ A;  5TPA B;  3GLB A;  1GTK A;  4KCD A;  3SDF A;  3FVK A;  3TFL A;  4NG7 A;  3IO6 A;  3OO8 A;  3UIF A;  1JW5 A;  3C9H A;  3HHG A;  3C31 A;  4G8H A;  4DLD A;  1BKA A;  2UVH A;  3IB2 A;  3RN8 A;  1B3L A;  3L6H A;  4PAF A;  1B4Z A;  3O6G A;  4JVD A;  4JSO A;  4AB5 A;  2AIX A;  5CMK A;  1Z7N E;  2G93 A;  3CG1 A;  3IK6 B;  2ZZV A;  5CC2 A;  1MQI A;  2OWZ A;  2DE2 A;  4IY5 A;  3T96 B;  3Q29 A;  2DE3 A;  2DXR A;  1Y1M A;  3MUQ A;  3Q26 A;  1A40 A;  4NF8 B;  3KBZ A;  1POT A;  4DZ1 A;  4JWY A;  1SW2 A;  1AH5 A;  5KZT A;  1NNP A;  4POX A;  1N04 A;  4O3A A;  1IXG A;  3PPN A;  1PBP A;  4F2O A;  3FXU A;  4GWU A;  3CHG A;  1NH7 A;  4KD5 A;  2ZXT A;  1A54 A;  4H8I A;  2ZNU A;  1M5C A;  3IO4 A;  4QBA A;  1D9Y A;  1UTB B;  3CSB A;  2ZYK A;  4ZZE A;  4PF6 A;  3OOA A;  5IZ1 A;  1XHY A;  1HSJ A;  1LAH E;  1FPF A;  4FEC A;  4MMP A;  1QUL A;  1SBP A;  4NF5 A;  2XXX A;  2CZL A;  4EXK A;  2F97 A;  2ANJ A;  5TP9 A;  4PP0 A;  4HCW A;  5H8N A;  4N17 A;  1MXX A;  1PB9 A;  4ZZA A;  2Y7W A;  1JVX A;  2THI A;  4YZZ A;  2XWI A;  5KDT B;  5H8H A;  3W9W A;  2XX7 A;  2XXH A;  3TDJ A;  3C33 A;  1B1H A;  2BJJ X;  3VXB A;  4NX1 A;  3MP6 A;  4KR5 A;  1NNF A;  1QGX A;  1Y1Z A;  2XD3 A;  3IJO B;  3K2D A;  4PET A;  2HAU A;  2B4M A;  5DVI A;  3D1R A;  4IO7 A;  4YB7 A;  4OEV A;  4YKI A;  2XX9 A;  2QMX A;  1UIU A;  1RDY A;  4IO5 A;  1SD3 A;  1DK4 A;  4X8R A;  4H1X A;  3BIH A;  1LAF E;  5HBC A;  1EZO A;  1FBG A;  4O7M A;  1MY0 A;  3MVZ A;  1VDW A;  1Q35 A;  4H45 A;  5DEX B;  3KOS A;  3SES A;  1NV4 A;  3IR1 A;  1JW4 A;  4F22 A;  1ZIU A;  2UVG A;  5L9M A;  4P1E A;  3KOT A;  1URD A;  5H8F B;  1N84 A;  1J1N A;  2DE4 A;  3TAJ A;  4PBH A;  1WVJ A;  4POW A;  2HCA A;  4NF6 A;  3FZV A;  2KQZ A;  2WX9 A;  4F2Q A;  2O1M A;  3DP8 A;  1RDZ A;  3MPL A;  2F3D A;  1Z7M E;  5KCJ A;  1NFT A;  1LBC A;  1YCJ A;  1NV1 A;  2Z8D A;  3EN3 A;  4F1U A;  2XX8 A;  3A29 A;  5I59 B;  4DCY A;  4I1D A;  2QS4 A;  5IAI A;  1XVX A;  5F24 A;  2GQ1 A;  1IME A;  3UOR A;  5LTC A;  3RPW A;  1PEB A;  1B1X A;  2WKY A;  2GH9 A;  2PT1 A;  5IGA A;  1LST A;  3M3F A;  4ELP A;  1LBZ A;  4HW8 A;  3MPK A;  2AYS A;  2OK2 A;  2DS9 A;  3B50 A;  4KQP A;  5LDZ A;  3RYD A;  1FPB A;  4N8G A;  2I6E A;  2WYK A;  2XD2 A;  3I6V A;  1Y9U A;  3H7M A;  4XTC Q;  4G61 A;  4U22 A;  3QUJ A;  1A8F A;  4GX4 A;  1TXF A;  4F3B A;  2LAO A;  1M5B A;  2ESN A;  4GD5 A;  2YJP A;  3K6W A;  3BBR A;  2H98 A;  2I49 A;  1OVB A;  4PFB A;  1JVY A;  4P1L A;  4OFJ A;  2VD2 A;  3U92 A;  4R2B A;  2V3U A;  2E0S A;  3UK4 A;  3O29 A;  3KJT A;  2Z8E A;  4PTK A;  3N5L A;  4C1T A;  2Y5L A;  3B6Q A;  4Q0C A;  2H9B A;  3RPL A;  1LFG A;  2XA5 A;  4DI3 D;  5FHN A;  1YAE A;  2QS2 A;  3A3U A;  4E0W A;  2ZZW A;  1MH3 A;  4YU0 A;  1VR5 A;  4NTL A;  1B40 A;  1XI6 A;  1TFD A;  2A5T B;  3PUV E;  1S7Y A;  3KG2 A;  1PB8 A;  3S9N C;  4LN5 A;  4HCY A;  2KLF A;  2W7Y A;  2GFE A;  3EHU A;  4NE4 A;  4PC9 A;  3GBB A;  4YMA A;  5I5P A;  2QJE A;  2XXR A;  3NOH A;  1KA0 A;  3TYH A;  1FBD A;  4XKQ A;  3U72 A;  2UYE A;  3FVG A;  1B3H A;  2GHB A;  4X9T A;  3RT8 A;  4G68 B;  4IO6 A;  2FIE A;  3TTN A;  1FJ6 A;  2PYY A;  3VXC A;  4EQ7 A;  2Q9T A;  3E3K A;  3IOU A;  1EZP A;  1URS A;  3V89 B;  4OET A;  5AA4 A;  1JEV A;  3O28 A;  4JB7 A;  4P0G A;  3S2V A;  2IEE A;  4R72 A;  1TWY A;  2UVI A;  4MAG A;  5AA1 A;  1XOC A;  3S9L C;  1MH4 A;  2O51 A;  4E0X A;  3K6V A;  5T3J A;  3TCG A;  4U21 A;  4F29 A;  3OO9 A;  4YKK A;  4YAH X;  3VLU A;  2RC8 A;  3W15 C;  4OMB A;  3LR1 A;  1FQB A;  1N0T A;  2PT2 A;  3KGC A;  4L17 A;  3LUY A;  4NF4 A;  1MXW A;  1Y3P A;  2YPN A;  1IXC A;  3OEK A;  1B5H A;  1A99 A;  2XWV A;  3IFC A;  3CRB A;  4NF0 A;  4JXI A;  2F36 A;  4P47 A;  4DIG A;  4LP2 B;  2P0S A;  3EKI A;  4KCC A;  1FTA A;  2ZYM A;  1XS5 A;  3KZG A;  3QUF A;  3OO7 A;  2ONR A;  3OEM A;  4OFL A;  3RUM A;  5HM4 B;  3MW0 A;  2WBD A;  3PU5 A;  5HPQ A;  1MG1 A;  5L8D A;  3HHF A;  4M1V A;  4AS5 A;  2QVV A;  5TU0 A;  2Q74 A;  3O66 A;  5B70 A;  2UXA A;  3DEL B;  1B7Z A;  4QFO A;  4FED A;  3KC1 A;  1MQG A;  1B9J A;  4OVJ A;  5AA2 A;  2Q88 A;  3S9E A;  4ELR A;  4R73 A;  1RYO A;  5F7V A;  2REJ A;  3MVX A;  3ILT B;  4G8M A;  5F1Q A;  1M5F A;  3PPR A;  4XFE A;  2FYI A;  1EH3 A;  3PUY E;  4BLA A;  3MST A;  3G3G A;  1S50 A;  3G3F A;  3ONM A;  1M5D A;  3FGS A;  5DW8 A;  1FTL A;  3G7W A;  1QW0 A;  2PCR A;  4P56 A;  1URG A;  2FIX A;  1QUI A;  1EYI A;  1AOV A;  1NV7 A;  4HE0 A;  4OA4 A;  4GWX A;  3FUZ A;  1SW4 A;  2V93 A;  2OJT A;  5BWJ A;  4C0R A;  1B5J A;  4ZDM A;  1R9Q A;  2HFB A;  4P8B A;  3EPE A;  3USD A;  2I48 A;  1ZJL A;  2QRY A;  3K1N A;  4U1O A;  5LOM A;  3O6I A;  5ET8 A;  1FCK A;  4N8Y A;  3TPA A;  1B0L A;  3LSF B;  1EU8 A;  4JWO A;  4OHN A;  5I2N A;  2VD3 A;  1FTO A;  1NH8 A;  4EF2 A;  5I56 B;  4H5G A;  2P1S A;  1SVX B;  3FAS A;  4GRK A;  2XXI A;  3QYT A;  1FPK A;  4KI0 E;  4R9G A;  4MH5 A;  3FJG A;  3ZS6 A;  3Q28 A;  4RYA A;  5ITP A;  1SPI A;  4GFR A;  1A8E A;  2I58 A;  4O7I A;  1N7W A;  3O6H A;  3TOD A;  3OEL A;  3CSG A;  4H8J A;  3PMX A;  2XXY A;  1QKA A;  3FBP A;  4EQ9 A;  1INP A;  1B51 A;  1LFI A;  1USY H;  3P7I A;  5CI5 A;  4FIM A;  4R9F A;  5I58 B;  1MDQ A;  1T0K A;  4H65 A;  1TFA A;  4RK9 A;  4BDR A;  5FHM A;  4ECF A;  1KWH A;  3TCF A;  4NWD A;  3T22 A;  4H6D A;  5IZ3 A;  5I7I A;  3DP4 A;  2REG A;  3FJ7 A;  1LEV A;  1P1Q A;  4ZEF A;  4F3G A;  4QFN A; 
#chains in the Genus database with same CATH homology
 4H45 A;  2QVU A;  4P3L A;  5J1D A;  1NV4 A;  1CNQ A;  1DCU A;  1FRP A;  1NUW A;  4P1E A;  4HE2 A;  4AS4 A;  5J16 A;  4MNC A;  5A5L A;  2DE4 A;  2L5V A;  1FPL A;  4PBH A;  2V4C A;  4O8M A;  5IZZ A;  2KQZ A;  2R8T A;  2WX9 A;  1YXI A;  1IMB A;  1RDZ A;  2F3D A;  4MJO A;  4PGP A;  1NV6 A;  2CEY A;  1NV1 A;  3MYU A;  4KXP A;  4F1U A;  4I3Y A;  4N6D A;  3A29 A;  4NAP A;  4FBP A;  2VPO A;  1FSA A;  1FBC A;  1FBH A;  5F24 A;  2GQ1 A;  1IME A;  5LTC A;  2ZZX A;  1DBZ A;  5IGA A;  4X04 A;  3LV0 A;  4UAB A;  2F3B A;  4JVI A;  4PCD A;  1LBZ A;  4H46 A;  3B50 A;  5LDZ A;  4N91 A;  3RYD A;  1FPB A;  4N8G A;  1AWB A;  2WYK A;  4G61 A;  1IMD A;  1JP4 A;  1FPG A;  4GX4 A;  1NUY A;  2P3V A;  4NN3 A;  3GYY A;  4N81 A;  2FVZ A;  1FPE A;  1D9Q A;  4PFR A;  1IMC A;  1NI9 A;  3KC0 A;  4GBW A;  5EQ9 A;  5JK4 A;  5ET7 A;  1LBW A;  4N6K A;  4PFB A;  4PE3 A;  1EYJ A;  4P1L A;  1FPD A;  2KR0 A;  1K9Y A;  2B4L A;  4PFI A;  3SZP A;  4GWY A;  4PBQ A;  2P3N A;  4PTK A;  1FJ9 A;  2Y5L A;  1FBF A;  4MEV A;  1NUX A;  4P9K A;  3RPL A;  4NHB A;  2BJI A;  2XA5 A;  4DI3 D;  4XF5 A;  3E79 A;  1RDX A;  1IMA A;  3ROJ A;  4MNP A;  2Y5K A;  1NV5 A;  3ISP A;  4OVQ A;  1EYK A;  1FPI A;  2CEX A;  2PFZ A;  2ZZW A;  1XI6 A;  2WYP A;  1IMF A;  1YZ0 A;  4LN5 A;  4HCY A;  4PC9 A;  1G0I A;  2FHY A;  5I5P A;  2HPG A;  1FBE A;  3NOH A;  1LBY A;  1KA0 A;  1KA1 A;  1FBD A;  4PDD A;  2VPN A;  5EYG A;  4GWS A;  4HE1 A;  2OX3 A;  2XWK A;  2XXK A;  4OVR A;  4X9T A;  4MCO A;  2FIE A;  1FJ6 A;  1YYZ A;  2Q9T A;  3BIG A;  2WBB A;  3T0J A;  3U65 A;  2XWO A;  2HZL A;  2MKZ A;  4NGU A;  4MAG A;  1NV0 A;  4PF8 A;  2CZH A;  2CZI A;  5T3J A;  3E78 A;  1FPJ A;  2VT5 A;  5ET5 A;  5EQ8 A;  1Q9D A;  5IZ3 B;  2HXR A;  2WEF A;  3LUZ A;  4QXD A;  3IFA A;  4GX6 A;  1NV2 A;  4OVT A;  4GWW A;  4PDH A;  2XWV A;  3IFC A;  4GBV A;  4NF0 A;  4DI4 B;  4P47 A;  3EKI A;  1FTA A;  2QFL A;  5EQ7 A;  2WBD A;  2FBP A;  3FXB A;  2DVZ A;  1FBP A;  4M1V A;  2CZK A;  4OVS A;  4AS5 A;  2QVV A;  2Q74 A;  2QVR A;  1LBV A;  4NG7 A;  2V3Q A;  3KC1 A;  4JVC A;  1NUZ A;  4OAN A;  5ESY A;  5IM2 A;  3PTY A;  3T1B A;  3QMF A;  2Q8M A;  2HHM A;  4YIC A;  4PGN A;  4PAF A;  4JVD A;  4XFE A;  1BK4 A;  3MST A;  2ZZV A;  2OWZ A;  2DE2 A;  4MX6 A;  4F1V A;  4I3E A;  2DE3 A;  5DW8 A;  2PCR A;  4P56 A;  2FIX A;  5EYH A;  1EYI A;  3KBZ A;  4MIJ A;  4F19 A;  1NV7 A;  4HE0 A;  4OA4 A;  4GWX A;  2DDK A;  4MNI A;  4GWU A;  3CHG A;  3HFU A;  3W9V A;  4P8B A;  2QPQ A;  5ET6 A;  4I40 A;  4GX3 A;  4O94 A;  4QBA A;  2JJK A;  5ET8 A;  2PFY A;  4N8Y A;  4PF6 A;  4NQ8 A;  1KZ8 A;  4PAI A;  5IZ1 A;  4IR8 A;  1FPF A;  4MMP A;  3RPL B;  4N15 A;  1FPK A;  4PAK A;  4HCW A;  4N17 A;  1SPI A;  5I3S A;  2XWI A;  4YZZ A;  3W9W A;  4O7I A;  4N4U A;  4NX1 A;  1QGX A;  4HXV A;  4MHF A;  3FBP A;  5CM6 A;  1INP A;  5EQA A;  4PET A;  1G0H A;  4XEQ A;  2B4M A;  1K9Z A;  1NV3 A;  3D1R A;  5FBP A;  1RDY A;  4GWZ A;  3B8B A;  1DK4 A;  4X8R A;  3BIH A;  4F18 A;  2HZK A;  5IZ3 A;  5I7I A;  1FBG A;  2F5X A;  4O7M A;  1LEV A;  4OVP A;  1VDW A;  1LBX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...