2MKZA

Solution structure of a protein c-terminal domain
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
141
structure length
141
Chain Sequence
SNAILATMNVPAGPAGGQQVDLASVLTPEIMAPILANADVQERLLPYLPSGESLPQTADEIQNTLTSPQFQQALGMFSAALASGQLGPLMCQFGLPAEAVEAANKGDVEAFAKAMQNNAKPEQKEGDTKDKKDEEEDMSLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteasomal ubiquitin receptor ADRM1
publication title Mechanism of the Rpn13-induced activation of Uch37
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 34
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2014-02-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.140 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2mkzA01
2KR0A 2L5VA 2KQZA 2MKZA
chains in the Genus database with same CATH superfamily
2O6AA 3TDJA 1IMFA 5TPAA 4G68B 2VHAA 3M3FA 4YZZA 5ET7A 3KN8A 1IXIA 1Y3NA 2QPQA 3ODBA 4LZ7A 2RC9A 2XWVA 3E78A 2PT1A 4MFIA 3IK6B 1XT8A 1VFDA 3IOWA 3FVOA 1H76A 4K3FA 4M1VA 3RQTA 1FW0A 3ONMA 1FPJA 1Y3QA 4PTKA 2XX9A 5EQAA 5ICTA 1MQDA 3A09A 1GR2A 3W15C 1NUWA 2XXXA 4KHZE 5L9SA 1B5JA 1FQFA 4P1EA 1SW1A 4RPOA 1A8EA 4DI4B 4OENA 3M3LA 4ZEFA 4DI3D 4OEVA 4X1DA 4KXPA 2XXHA 2GHBA 4X9TA 2X7PA 3Q26A 3SDFA 3ISPA 3HO7A 3D4GA 1K9YA 3LC8A 5DEXA 4RYAA 2HZLA 2QJEA 3MVZA 1B5IA 4GWWA 1US5A 1MY1A 4ELRA 5JTYA 4YKPA 2VGQA 5CMBA 3NOHA 3RPWA 2E0SA 3FASA 3K6VA 1IMBA 1NH7A 4P47A 4C1UA 4R74A 4P8BA 1M5FA 3MYUA 1XS5A 4QSDA 3U94A 3MPKA 5KZTA 3VVDA 4QRZA 3CSGA 1A40A 4RY1A 4QSEA 1IMDA 3BIHA 3K1MA 4QXDA 3KJTA 2YLNA 2ZYNA 2DDKA 4ZEBA 3K1PA 1SD3A 3BFUA 3CVGA 3CR9A 4R2FA 5I58B 2Q8JA 1OQGA 4TLMB 5LOMA 5I84A 1DPEA 2R6GE 2DYXA 4BDMA 5ITPA 2XWIA 2VD2A 4QFLA 1B4ZA 1F9BA 1S50A 4G4PA 1SW4A 4XF5A 1MG1A 1H3DA 3GBBA 1MQJA 1IMAA 2QS4A 3H03A 2ALUA 2REJA 4N6KA 1B40A 4HXVA 3K6WA 1DCUA 4XKPA 3T93B 2KQZA 2ZYMA 1URDA 2AL4A 3CFXA 4I3EA 2XX8A 2CZIA 5J16A 1FPKA 1MY4A 1GGGA 2QL3A 4RPNA 4JSDA 3KBRA 4JVIA 3OO8A 1NV0A 1MPDA 2IA4A 1AIVA 3KOTA 3DELB 2XHDA 1MPBA 2O69A 1LLSA 5IZ1A 1P1QA 4H0WA 1RDXA 2DXYA 4WKMA 4KYEA 4H1XA 5DTBA 1P1UA 3SESA 1SQYA 3WAEA 3C34A 2O7IA 3MQ9A 2D3IA 2HCAA 2HHMA 3FD3A 1JP4A 4UA8A 4ZZAA 3TTKA 1LBXA 4Q0CA 1D9QA 4MJOA 1NMUA 1EH3A 1RYOA 1POTA 4TLLB 4YAHX 3H06B 5IKBA 4GWSA 1B7HA 3GZGA 3MZ9A 4OZ9A 4FEDA 3Q29A 2Y7PA 5EYHA 3GLBA 3RGYA 2F36A 4GWOA 1IIWA 4QBAA 1P99A 3S9NC 5L9MA 4PFWA 5ICQA 2RF1A 2UYEA 1FJ6A 2I0BA 1MQIA 2RCAA 3IJXB 2PYYA 4OETA 5AE4A 3TYHA 1KZ8A 4P0GA 3K1NA 1IMCA 1ELJA 4EF2A 4R2BA 3O2AA 1XOCA 4R73A 3LSLA 1H44A 4OQOA 4G68C 2OK2A 1K9ZA 5I56B 1B5HA 3ZS6A 4RNSA 4JWXA 1INPA 4LA9A 1TWYA 5L8DA 4FJPA 4MNIA 4PGPA 3HHFA 3E3KA 1B51A 1YCJA 4PFBA 2F7CA 3RPLA 3QUFA 3H6WA 4THIA 4OEUA 1FTAA 4R6KA 3W9VA 4OVJA 4H46A 3BBRA 4GD5A 2ZNUA 3G3KA 3OOAA 1MH3A 1PC3A 4GBVA 4EDPA 3EN3A 1MQGA 4ZDMA 3B8BA 4C1TA 4OMBA 2XWKA 2XXTA 5HPQA 3K6XA 2G93A 4JBZA 2I58A 3Q25A 1MXVA 4GOTA 5CBSA 2XXRA 1Q1KA 3R26A 3E4RA 4IO2A 2ZZVA 4AS4A 1I6BA 5I58A 4OWDA 3PMXA 5H8FB 1BLFA 3MP1A 3LSWA 2OWTA 2HXRA 4WXJA 1QGXA 1B9JA 4M4GA 1N3WA 5FHMA 5H8QA 3T66A 1EZ9A 4F39A 1SW5A 2FIEA 1EYIA 3SEYA 3M3KA 4NF8A 2ZZWA 1SVXB 1JW4A 4LUBA 2DE2A 4N15A 2H98A 2QVVA 3N26A 4NWCA 1B7UA 1SI0A 3B50A 1ZTYA 5AA4B 4KFQA 3SEXA 2Y7RA 2V4CA 1AMFA 1PBQA 2GH9A 1FJ9A 3PD8A 3ZKKA 4OERA 2Q8MA 4DCYA 2Z22A 3EKIA 3TZAA 1HSLA 4OFOA 1G0HA 3V83A 3IOUA 3TKDA 4FE8A 3FVGA 4H5FA 5CM6A 1UIUA 4BDRA 5AA2D 3UGWA 1QVSA 4GWXA 4DE8A 4KD5A 1XVYA 4AS5A 2QMWA 4ELPA 3HSTA 2OBGA 4OHNA 2QS3A 2NUVA 3HV1A 4BDQA 2ZYOA 4ZEIA 2Q74A 1LSTA 3S9EA 1XI6A 2GFEA 1H43A 1AOVA 1HSJA 2GHAA 3ROJA 3PPPA 3PUYE 1YXIA 4U4XA 4BDLA 2R9JA 3A3CA 3O9PA 1B7ZA 3K2DA 3KOSA 4GX4A 3UORA 1URSA 3MVWA 3VFJA 1Q9DA 5JEIA 4R75A 2XXYA 3UIFA 1O64A 3FBPA 5DT6A 1OQHA 4DZ1A 2UVIA 4OVPA 1H45A 2A5SA 1XVXA 1QKBA 2NXOA 1LFHA 3SKPA 4RXLA 3A3UA 4H5GA 3HHGA 5L9OA 1FPLA 4PGNA 2HZKA 1FTMA 4OVSA 1B46A 3R7XA 5H8SA 5KDTA 1NUZA 4ISUA 1Y20A 4MNCA 3Q27A 3Q28A 4LQ2A 4ZEKA 4TQUQ 3QUJA 1LAFE 4N6PA 4XKRA 2F6PA 1BP5A 3UP9A 4H45A 4F22A 1B0LA 5FHNA 5IAIA 4N91A 3LSXA 4PCDA 2ZYKA 2PBWA 2D21A 2DVZA 2XWOA 2KR0A 2V3UA 1A8FA 3R6UA 3O6GA 3KEIA 3CRBA 2CEXA 5EHSA 4UABA 3K02A 4OANA 2HAVA 3H6UA 2V93A 1DTGA 2B4LA 1SYHA 1JVXA 4HE0A 1FPFA 4TOZA 3FATA 1Y3PA 2F7BA 2REGA 1S9TA 1I6AA 3MZ1A 2DP8A 3TFLA 1ZJLA 3DP6A 3MJNA 5H8HB 1N0TA 2CEYA 2DE4A 4IO5A 4LZ5A 4U21A 3V5AA 2G29A 1VE4A 4ELOA 2VOZA 1LBCA 1QUKA 4MH5A 5I2KB 4PDDA 4AQ4A 1B3HA 1Y9UA 1XHYA 2B65A 2O51A 4GBWA 4HCWA 4JSOA 3LUZA 5A5XA 1BTJA 4RK9A 5AA2A 1MQHA 5CBRA 4JVDA 1BIYA 2VPNA 5H8FA 3RNNA 1OMPA 2O68A 1B3EA 4EUOA 5JK4A 1N04A 3C32A 1IITA 3T9VA 3M8UA 1QKAA 4MX6A 3BKIB 4GQOA 4AB5A 4PFUA 2I3WA 4PFIA 2OWZA 4GWUA 3O66A 4I9DA 1UTHA 3KZGA 2Z8FA 2H9BA 3PGFA 1ZMGA 3TCGA 5AA4A 3OO6A 5IGAA 2ZMBA 4NHBA 3A29A 2QVRA 4IY6A 4FBPA 1NNPA 1GV8A 2BJJX 4GX6A 1CNQA 3U72A 1POY1 2I3VA 4ZE9A 1L5TA 3PPNA 3TCFA 1NFTA 2HPGA 3TELA 3K4UA 2F8DA 1A7LA 4NF0A 4PETA 1FPDA 4G8NA 4OVTA 3QK6A 3TTMA 3EHTA 4O7IA 1SW2A 2HXWA 3VLVA 4IO3A 4Z7EA 2ANJA 4EQBA 4KI0E 3CFZA 1QW0A 3GBAA 3QIMA 4N17A 4E0WA 1DBZA 1N7WA 5B70A 3MVYA 5IZ3B 1O7TA 4GLIA 4MNPA 2Q2CA 2UVGA 3GXAA 2WBDA 2Y5KA 5H8NB 3P7IA 3U8QA 2GRVA 4H6DA 4MEVA 1QUJA 1MDQA 4NMYA 5TP9B 3OENA 3H4ZA 1WVJA 1LFIA 4FEBA 1KWHA 4NF4B 4ESXA 1S7YA 1AH5A 4MLVA 1FCKA 3IO4A 1XC1A 3RUMA 2QSXA 2ZNSA 2XXPA 3SEVA 2P1SA 3LSFB 3RT6B 3HN0A 2QVUA 3CSBA 1VFEA 3KSJA 4O8MA 2DOJA 4LP2B 1R6ZA 4KYSA 2Z23A 4BDOA 1B52A 1OIBA 4DXBA 2WEFA 4GVOA 3KSXA 1MY3A 4EQ7A 1N84A 1B3GA 3FGSA 3TQWA 4F18A 1UTBA 4NE4A 2P0SA 1N3XA 4LONB 3PUWE 4NF6A 1IZ1A 1FBHA 4GF8A 3HPIA 1MS7A 2Y7WA 2O1MA 3O29A 4PDHA 1LEVA 3MP8A 3C33A 2B3FA 3PD9A 3IB1A 2WYKA 3VDFA 3IAZA 2XXKA 4OESA 4P0IA 2CZHA 2RC7A 4F29A 2YPNA 3VLWA 4GXAA 3CG1A 1FQCA 4QHQA 5J1DA 2PT2A 1LAXA 3ILTB 3KC0A 3KC1A 4G68A 1MH4A 4NF5B 2B4MA 4QFOA 5I2NB 2PFZA 3QXMA 4FORA 5ET6A 2E1SA 5I2KA 4PQJA 2ABHA 4LATA 4LQ5A 2I4CA 5DVFA 4WEDA 2M8CA 4HW8A 5I3SA 1ZLQA 3KN3A 1EYJA 3RLFE 3TODA 2THIA 4GXSB 2WKYA 3FUZA 1NNTA 4JDFA 2OLBA 4H65A 3FVKA 2WYPA 2ONSA 2XD3A 2F97A 1WODA 4PF8A 5K2YA 3MUQA 3PMWA 4DLDA 5F7VA 1MXXA 3GYYA 2FHYA 1KA1A 2DE3A 4MMPA 2I49A 1QULA 1CE2A 1PB9A 3C36A 1TFDA 4N6DA 3W9WA 3HFUA 1GVCA 3T9UA 1PB8A 4G8HA 1YAEA 3EF7A 1FQDA 4OA4A 2V3TA 1FBDA 1LB8A 3IFCA 5IZZA 4FAJA 5DYHA 4U4SA 2F35A 4GIZA 2H99A 1YTVA 1B6HA 4QF9A 1B3FA 1FBPA 2ZZXA 2F78A 4RA1A 2DXRA 4NWDA 3TTNA 3U65A 1D9YA 2UVHA 1PDAA 2DSFA 4Q8RA 3QMFA 1RKMA 3LR1A 4O3BA 4NQ8A 3I5OA 4MHFA 4F2QA 1DPPA 3PU5A 3OSRA 3IFAA 4R6HA 1MXUA 5IZ3A 3QYTA 3UK4A 5LDZA 4YB5A 4ECFA 2Z8EA 4XKNA 4OXVA 1LGBC 5H8NA 5I57B 3QSLA 1Z7ME 2H4IA 5TP9A 4NEDA 1ZU0A 2FVZA 3C4MA 4NF4A 1NI9A 2HEUA 4F3BA 3U92A 3CIJA 2R71A 5ITOA 5FTHA 5I59B 1MM6A 1YZ0A 1PB7A 3EHSA 2PX1A 3G7WA 1P1OA 2RC8A 1FQEA 2Q88A 1NL5A 2W7YA 4OTEA 4IB2A 4IGTA 3T96B 3FVNA 1NV4A 1I6QA 1LBYA 5DEXB 2I0CA 2UXAA 1JVYA 2DVCA 1M5BA 2VPOA 3EHUA 4JVCA 4F31B 2I48A 2Q2AA 1NV6A 2PVUA 1SDXA 4KPTA 3TMGA 5EHMA 3K6UA 3IX1A 1FSAA 3VE1B 1Z7NE 5FTIA 3RTWB 1A54A 5FBPA 4NAPA 4U2RA 3OXNA 5EYFA 3O6HA 1B05A 1PEBA 4ESWA 3RTFB 3SEWA 2R8TA 3FXUA 1LBWA 1AWBA 1SBPA 1IQ7A 1JEVA 3JYRA 4PC9A 4H67A 1FBCA 3BFTA 1T0KA 3G3FA 3N6UA 1O63A 2OX3A 2DWIA 4PF6A 2Q9TA 1IEJA 1LAGE 1URGA 1LAHE 3PPQA 2OJTA 4HE2A 1SYIA 4IR8A 1EZOA 3N6TA 3PTYA 3VVFA 3T9HB 1LB9A 3LV0A 3L6HA 3O28A 2HFBA 5I56A 1LBVA 3KBZA 5DW8A 3ECRA 4GWYA 1OLCA 3G3JA 3KGCA 3FXQA 2I6EA 4JB7A 3PPRA 3SEUA 1OVBA 2VP1A 2XA5A 4N8GA 3PUZE 2XXWA 3B6WA 4G8MA 3IOTA 4DDDA 5A5LA 2Y5LA 3O97A 4PAKA 1SPIA 5KCJB 1MPCA 3KFMA 2H25A 3G3HA 2NWJA 3FJGA 4N81A 1DK4A 4U23A 5BWJA 1LBBA 2UYFA 3THIA 3O6IA 1LCTA 1DTZA 2B3BA 4POXA 2AIXA 4DXCA 4GL8A 4E0XA 4POWA 4Z0IA 3MZBA 5M2VA 3DLNA 1D4NA 1NH8A 3OELA 1MRPA 4R9FA 5ELVA 2QS2A 4GFRA 3VXCA 4BDNA 4ZEDA 3N5LA 1EYKA 1Y1ZA 1A55A 5I57A 4YB6A 5ET8A 1FRPA 2F7AA 1I69A 5HM4B 1NV3A 2PFYA 1VDWA 2XXQA 1M5DA 3MAMA 4IO4A 1NV1A 2FBPA 4GRKA 3DM0A 2Y84A 3TPAA 2CZKA 4O3AA 3OEMA 1IXGA 3D4CA 4MBPA 3V89B 4YKIA 5I59A 1FBGA 1R1NA 1DOTA 2ONKE 4MLQA 3MPLA 4AB6A 1BKAA 4QFPA 4KYDA 2O1LA 1FBFA 3FJMA 5F1QA 2O84X 4KCDA 3FXBA 3IR1A 1ZBMA 3FJ7A 4HS7A 1ZIUA 4I62A 5ISUA 1B58A 2CZLA 3RPLB 3C35A 3IOVA 2WBBA 2DS9A 2RKMA 2FNCA 3OO7A 4N4UA 3QAXA 3CHGA 5F24A 4PP0A 4JWOA 3B6QA 1NV7A 3PUVE 4PFRA 4NX1A 3OMBA 1OLAA 2RINA 4LVQA 2Z8DA 2F6GA 3G3GA 2XX7A 2QS1A 3KN7A 4YKKA 4YU0A 4G61A 4F1UA 1FQBA 1AL3A 2PCRA 3PUXE 3MP6A 3E9XA 1QUIA 1FTLA 2QFLA 5B7DA 3K01A 3C9HA 1FTJA 1RDYA 3K00A 4KR5A 4OVRA 4Q30B 2IEEA 1G0IA 1LFGA 1WDNA 1MY0A 3MW0A 4JWYA 3H7MA 5H8QB 4PE3A 4U1ZA 1ZKBA 3H6TA 5T3JA 4NF8B 4YB7A 2Q89A 5I7IA 3RYDA 3I6VA 4DCXA 3DP8A 2UVJA 2XXUA 4HTGA 4RK2A 1IXHA 4ONYA 3ZSFA 3FXRA 4GWZA 1MDP1 5K2XA 3V8XB 4XEQA 3ILUB 1SI1A 4ZE8A 4P9KA 5AA1A 1RYXA 3IL1B 4P56A 4ZECA 3T9XB 1PBPA 4NTLA 2P3VA 4JXIA 2VD3A 3S9LC 5CMMA 4R6YA 4F1VA 4P11A 3L6GA 4PAFA 3VXBA 5IM2A 3N94A 1D9VA 2WX9A 3SZPA 1P1NA 5KCJA 1JW1A 5EQ7A 4ND9A 1NV2A 3TUSA 3CG3A 4X04A 2QRYA 1EZPA 1TXFA 5H8HA 1BK4A 4F3GA 3E79A 4ZS9A 2OWSA 4Q5TA 3S9MC 1LCFA 2NVUB 3G3IA 4N07A 4ZZEA 1QJMA 2X7QA 2RCBA 1B1HA 1NNFA 2JJKA 2HAUA 1NUYA 3FV1A 1GTKA 4IO7A 2AL5A 4MF3A 3IO6A 5CMKA 1B4HA 1FBEA 1MXYA 1ANFA 3AXFA 4F19A 4EXKA 3UA8A 4LZ8A 3BIGA 4FATA 4P3LA 4NN3A 4PFYA 4N13A 5DVJA 4LN5A 3LUYA 2XD2A 1JW5A 4QFNA 4KCCA 1IMEA 4NG7A 4BLAA 3JZJA 2ZNTA 3ZKLA 5KDTB 4ELQA 1FPGA 4FIMA 1MXWA 2BJIA 2KLFA 3F11A 2I4BA 4I1DA 3D1RA 2QMXA 1IXCA 4YMBA 2ONRA 1JEUA 4O3CA 1R9QA 1FQAA 2YJPA 4PFTA 3CFLA 2Y7IA 1Q35A 4G2ZA 3SERA 5CI5A 1MY2A 4QFKA 4X48A 4PBHA 4I8CA 4X8RA 2A5TB 1IUDA 4KQPA 3VVEA 4N8YA 4RJZA 4I3YA 4XFEA 1JETA 3TTLA 3IJOB 1A99A 2NOOA 3OO9A 1VSOA 5TPAB 1FPEA 4DXUA 3PV0E 5EQ9A 3OD7A 4R9GA 3K0VA 4XXUA 4P1LA 3SETA 1M5CA 2PMSA 1J1NA 4EQ9A 3H3GA 1B1XA 2DWJA 4FECA 4H8IA 3S2VA 5A5XB 5TU0A 3WAFA 1KA0A 1UIVA 4HCYA 5AA2B 2LAOA 1Y1MA 4UACA 4IGRA 1MM7A 4MCOA 4G77A 4XIGQ 3U1OA 3MWBA 4IO6A 2D5WA 4O94A 5ET5A 2FA7A 2P3NA 4L17A 4GL0A 3IORA 1HSEA 4X1BA 3T0JA 4EXLA 4QSCA 3OSQA 2DWAA 1USYH 4YKJA 1TT1A 3S4UA 3TTRA 5I5PA 1UTHB 4F1YA 5CC2A 5EQ8A 3IB0A 3VV5A 3KG2A 3LBSA 3RN8A 1R9LA 2VT5A 3C31A 1CB6A 4C0RA 2H5YA 3JV9A 2HQ0A 1NV5A 3VLUA 1EU8A 1Y4CA 4YICA 5ESYA 2AYSA 3TAJA 3MBPA 1FTOA 4I40A 2F5XA 4XKQA 2CMOA 3UN6A 2FYIA 5JTYB 1US4A 2DQVA 5HBCA 1NUXA 2Y7KA 4DIGA 2V84A 3FIRA 1M5EA 1Y4TA 1P1WA 1YYZA 5AA3A 2V25A 3B7DA 4OVQA 1II5A 3MVXA 3RY3A 1UQWA 2F34A 2X26A 2GQ1A 4NF5A 5I2NA 1TFAA 3T1BA 5EYGA 1RDZA 3EQ1A 3RT8A 4OFLA 3PMVA 1ATGA 4NGUA 4EF1A 4PE5B 1FTKA 4GX3A 4MAGA 1D3KA 4IY5A 1USYE 4OYVA 2DWHA 1FPIA 1B32A 2P2AA 5LTCA 2XXVA 4WEPA 1FPBA 1MXZA 2F3BA 3U93A 3CI8A 3TEPA 1B2HA 1JNFA 3IB2A 3DP4A 4F2OA 3OEKA 3TQLA 4R72A 4H8JA 4XTCQ 4U1OA 4PAIA 1NNKA 2FIXA 4F3SA 4YMAA 3I3VA 4OFJA 2ESNA 2F3DA 2V3QA 1B3LA 1DMBA 3KJ7A 3FZVA 5FHOA 1JQFA 2OZZA 3USDA 2ZXTA 3B6TA 4HE1A 3H6VA 5CMCA 4F3PA 1YPNA 3PPOA 3T22A 4U22A 5CRYA 3MSTA 5BUUA 3E13X 1OVTA 4MIJA 1B0HA 2MKZA 1UTBB 4PBQA 4NF6B 1LBZA 1N7XA 3FV2A 3EPEA 2A5TA 1N76A 1VR5A 1NKXA 2L5VA 3TCHA 3HCQA 4O7MA 1DSNA 2OCUA 5DVIA 3MC2A 2O7UA 2XXIA
chains in the Genus database with same CATH topology
3GYYA 2FHYA 1KA1A 1IMFA 2DE3A 4OVRA 4MMPA 1G0IA 4GWXA 4YZZA 5ET7A 4AS5A 2QPQA 4N6DA 4PE3A 3W9WA 3HFUA 2XWVA 3E78A 5T3JA 4OA4A 2Q74A 5I7IA 3RYDA 1FBDA 1XI6A 3IFCA 5IZZA 4M1VA 1FPJA 4GWZA 4PTKA 3ROJA 1FBPA 5EQAA 4XEQA 1YXIA 2ZZXA 1NUWA 4P9KA 4P56A 3U65A 4GX4A 2P3VA 4P1EA 3QMFA 4DI4B 1Q9DA 4F1VA 4NQ8A 4MHFA 4DI3D 4PAFA 3FBPA 5IM2A 4KXPA 2WX9A 3SZPA 4OVPA 4X9TA 5EQ7A 3IFAA 1NV2A 4X04A 3ISPA 1K9YA 5IZ3A 1BK4A 1FPLA 4PGNA 2HZKA 4OVSA 2HZLA 3E79A 5LDZA 4GWWA 1NUZA 4MNCA 3NOHA 4H45A 4N91A 2JJKA 4PCDA 1NUYA 2DVZA 1IMBA 4P47A 2FVZA 2XWOA 4P8BA 2KR0A 1NI9A 3MYUA 2CEXA 4UABA 4OANA 1IMDA 3BIHA 1YZ0A 1FBEA 4QXDA 2B4LA 4F19A 3BIGA 1FPFA 2DDKA 4HE0A 4P3LA 4NN3A 4LN5A 1NV4A 1LBYA 1IMEA 2CEYA 2DE4A 4NG7A 2XWIA 1FPGA 2VPOA 4JVCA 4PDDA 4XF5A 2BJIA 1NV6A 1IMAA 4GBWA 4N6KA 3D1RA 4HCWA 3LUZA 4HXVA 4JVDA 1DCUA 1FSAA 2VPNA 5JK4A 2KQZA 4I3EA 5FBPA 2CZIA 5J16A 4PBHA 1FPKA 4NAPA 4X8RA 4JVIA 4MX6A 1NV0A 2R8TA 1LBWA 4N8YA 4PFIA 1AWBA 2OWZA 4GWUA 4I3YA 5IZ1A 4XFEA 4PC9A 1FBCA 5IGAA 1FPEA 1RDXA 4NHBA 5EQ9A 3A29A 2QVRA 2OX3A 4P1LA 4PF6A 2Q9TA 4FBPA 2HHMA 4GX6A 1JP4A 1CNQA 4HE2A 1KA0A 1LBXA 4HCYA 1D9QA 4IR8A 4MJOA 3PTYA 2HPGA 3LV0A 4MCOA 1LBVA 4O94A 5ET5A 4GWSA 2P3NA 4NF0A 4PETA 1FPDA 3KBZA 5DW8A 4OVTA 5EYHA 4GWYA 3T0JA 4O7IA 4QBAA 5I5PA 2XA5A 4N8GA 5EQ8A 1FJ6A 5A5LA 2Y5LA 2VT5A 4PAKA 1SPIA 4N17A 1DBZA 1NV5A 5IZ3B 4YICA 5ESYA 1KZ8A 4MNPA 4N81A 4I40A 1DK4A 2F5XA 2WBDA 2Y5KA 1IMCA 1NUXA 4MEVA 1YYZA 4OVQA 1K9ZA 1INPA 4MNIA 4PGPA 2GQ1A 4PFBA 3T1BA 2QVUA 3RPLA 1EYKA 5EYGA 1RDZA 4O8MA 1FTAA 4NGUA 5ET8A 3W9VA 1FRPA 4GX3A 4MAGA 4H46A 1NV3A 2PFYA 1VDWA 2WEFA 4GBVA 1FPIA 1NV1A 2FBPA 5LTCA 4F18A 1FPBA 2CZKA 2F3BA 3B8BA 2XWKA 1FBHA 4PDHA 1LEVA 1FBGA 2WYKA 4PAIA 1FBFA 2XXKA 2ZZVA 2CZHA 2FIXA 4AS4A 3FXBA 5J1DA 2F3DA 2V3QA 3KC0A 3KC1A 2HXRA 1QGXA 2B4MA 2PFZA 5ET6A 3RPLB 4HE1A 2WBBA 2FIEA 1EYIA 2ZZWA 4N4UA 3CHGA 3MSTA 2DE2A 4N15A 2QVVA 5F24A 5I3SA 1NV7A 3B50A 4MIJA 4PFRA 4NX1A 2MKZA 1EYJA 2V4CA 4PBQA 1FJ9A 1LBZA 4G61A 4F1UA 2Q8MA 2PCRA 3EKIA 2WYPA 1G0HA 2QFLA 2L5VA 4O7MA 1RDYA 4PF8A 5CM6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KR0 A;  2L5V A;  2KQZ A;  2MKZ A; 
#chains in the Genus database with same CATH topology
 2O6A A;  3TDJ A;  1IMF A;  5TPA A;  4G68 B;  2VHA A;  3M3F A;  4YZZ A;  5ET7 A;  3KN8 A;  1IXI A;  1Y3N A;  2QPQ A;  3ODB A;  4LZ7 A;  2RC9 A;  2XWV A;  3E78 A;  2PT1 A;  4MFI A;  3IK6 B;  1XT8 A;  1VFD A;  3IOW A;  3FVO A;  1H76 A;  4K3F A;  4M1V A;  3RQT A;  1FW0 A;  3ONM A;  1FPJ A;  1Y3Q A;  4PTK A;  2XX9 A;  5EQA A;  5ICT A;  1MQD A;  3A09 A;  1GR2 A;  3W15 C;  1NUW A;  2XXX A;  4KHZ E;  5L9S A;  1B5J A;  1FQF A;  4P1E A;  1SW1 A;  4RPO A;  1A8E A;  4DI4 B;  4OEN A;  3M3L A;  4ZEF A;  4DI3 D;  4OEV A;  4X1D A;  4KXP A;  2XXH A;  2GHB A;  4X9T A;  2X7P A;  3Q26 A;  3SDF A;  3ISP A;  3HO7 A;  3D4G A;  1K9Y A;  3LC8 A;  5DEX A;  4RYA A;  2HZL A;  2QJE A;  3MVZ A;  1B5I A;  4GWW A;  1US5 A;  1MY1 A;  4ELR A;  5JTY A;  4YKP A;  2VGQ A;  5CMB A;  3NOH A;  3RPW A;  2E0S A;  3FAS A;  3K6V A;  1IMB A;  1NH7 A;  4P47 A;  4C1U A;  4R74 A;  4P8B A;  1M5F A;  3MYU A;  1XS5 A;  4QSD A;  3U94 A;  3MPK A;  5KZT A;  3VVD A;  4QRZ A;  3CSG A;  1A40 A;  4RY1 A;  4QSE A;  1IMD A;  3BIH A;  3K1M A;  4QXD A;  3KJT A;  2YLN A;  2ZYN A;  2DDK A;  4ZEB A;  3K1P A;  1SD3 A;  3BFU A;  3CVG A;  3CR9 A;  4R2F A;  5I58 B;  2Q8J A;  1OQG A;  4TLM B;  5LOM A;  5I84 A;  1DPE A;  2R6G E;  2DYX A;  4BDM A;  5ITP A;  2XWI A;  2VD2 A;  4QFL A;  1B4Z A;  1F9B A;  1S50 A;  4G4P A;  1SW4 A;  4XF5 A;  1MG1 A;  1H3D A;  3GBB A;  1MQJ A;  1IMA A;  2QS4 A;  3H03 A;  2ALU A;  2REJ A;  4N6K A;  1B40 A;  4HXV A;  3K6W A;  1DCU A;  4XKP A;  3T93 B;  2KQZ A;  2ZYM A;  1URD A;  2AL4 A;  3CFX A;  4I3E A;  2XX8 A;  2CZI A;  5J16 A;  1FPK A;  1MY4 A;  1GGG A;  2QL3 A;  4RPN A;  4JSD A;  3KBR A;  4JVI A;  3OO8 A;  1NV0 A;  1MPD A;  2IA4 A;  1AIV A;  3KOT A;  3DEL B;  2XHD A;  1MPB A;  2O69 A;  1LLS A;  5IZ1 A;  1P1Q A;  4H0W A;  1RDX A;  2DXY A;  4WKM A;  4KYE A;  4H1X A;  5DTB A;  1P1U A;  3SES A;  1SQY A;  3WAE A;  3C34 A;  2O7I A;  3MQ9 A;  2D3I A;  2HCA A;  2HHM A;  3FD3 A;  1JP4 A;  4UA8 A;  4ZZA A;  3TTK A;  1LBX A;  4Q0C A;  1D9Q A;  4MJO A;  1NMU A;  1EH3 A;  1RYO A;  1POT A;  4TLL B;  4YAH X;  3H06 B;  5IKB A;  4GWS A;  1B7H A;  3GZG A;  3MZ9 A;  4OZ9 A;  4FED A;  3Q29 A;  2Y7P A;  5EYH A;  3GLB A;  3RGY A;  2F36 A;  4GWO A;  1IIW A;  4QBA A;  1P99 A;  3S9N C;  5L9M A;  4PFW A;  5ICQ A;  2RF1 A;  2UYE A;  1FJ6 A;  2I0B A;  1MQI A;  2RCA A;  3IJX B;  2PYY A;  4OET A;  5AE4 A;  3TYH A;  1KZ8 A;  4P0G A;  3K1N A;  1IMC A;  1ELJ A;  4EF2 A;  4R2B A;  3O2A A;  1XOC A;  4R73 A;  3LSL A;  1H44 A;  4OQO A;  4G68 C;  2OK2 A;  1K9Z A;  5I56 B;  1B5H A;  3ZS6 A;  4RNS A;  4JWX A;  1INP A;  4LA9 A;  1TWY A;  5L8D A;  4FJP A;  4MNI A;  4PGP A;  3HHF A;  3E3K A;  1B51 A;  1YCJ A;  4PFB A;  2F7C A;  3RPL A;  3QUF A;  3H6W A;  4THI A;  4OEU A;  1FTA A;  4R6K A;  3W9V A;  4OVJ A;  4H46 A;  3BBR A;  4GD5 A;  2ZNU A;  3G3K A;  3OOA A;  1MH3 A;  1PC3 A;  4GBV A;  4EDP A;  3EN3 A;  1MQG A;  4ZDM A;  3B8B A;  4C1T A;  4OMB A;  2XWK A;  2XXT A;  5HPQ A;  3K6X A;  2G93 A;  4JBZ A;  2I58 A;  3Q25 A;  1MXV A;  4GOT A;  5CBS A;  2XXR A;  1Q1K A;  3R26 A;  3E4R A;  4IO2 A;  2ZZV A;  4AS4 A;  1I6B A;  5I58 A;  4OWD A;  3PMX A;  5H8F B;  1BLF A;  3MP1 A;  3LSW A;  2OWT A;  2HXR A;  4WXJ A;  1QGX A;  1B9J A;  4M4G A;  1N3W A;  5FHM A;  5H8Q A;  3T66 A;  1EZ9 A;  4F39 A;  1SW5 A;  2FIE A;  1EYI A;  3SEY A;  3M3K A;  4NF8 A;  2ZZW A;  1SVX B;  1JW4 A;  4LUB A;  2DE2 A;  4N15 A;  2H98 A;  2QVV A;  3N26 A;  4NWC A;  1B7U A;  1SI0 A;  3B50 A;  1ZTY A;  5AA4 B;  4KFQ A;  3SEX A;  2Y7R A;  2V4C A;  1AMF A;  1PBQ A;  2GH9 A;  1FJ9 A;  3PD8 A;  3ZKK A;  4OER A;  2Q8M A;  4DCY A;  2Z22 A;  3EKI A;  3TZA A;  1HSL A;  4OFO A;  1G0H A;  3V83 A;  3IOU A;  3TKD A;  4FE8 A;  3FVG A;  4H5F A;  5CM6 A;  1UIU A;  4BDR A;  5AA2 D;  3UGW A;  1QVS A;  4GWX A;  4DE8 A;  4KD5 A;  1XVY A;  4AS5 A;  2QMW A;  4ELP A;  3HST A;  2OBG A;  4OHN A;  2QS3 A;  2NUV A;  3HV1 A;  4BDQ A;  2ZYO A;  4ZEI A;  2Q74 A;  1LST A;  3S9E A;  1XI6 A;  2GFE A;  1H43 A;  1AOV A;  1HSJ A;  2GHA A;  3ROJ A;  3PPP A;  3PUY E;  1YXI A;  4U4X A;  4BDL A;  2R9J A;  3A3C A;  3O9P A;  1B7Z A;  3K2D A;  3KOS A;  4GX4 A;  3UOR A;  1URS A;  3MVW A;  3VFJ A;  1Q9D A;  5JEI A;  4R75 A;  2XXY A;  3UIF A;  1O64 A;  3FBP A;  5DT6 A;  1OQH A;  4DZ1 A;  2UVI A;  4OVP A;  1H45 A;  2A5S A;  1XVX A;  1QKB A;  2NXO A;  1LFH A;  3SKP A;  4RXL A;  3A3U A;  4H5G A;  3HHG A;  5L9O A;  1FPL A;  4PGN A;  2HZK A;  1FTM A;  4OVS A;  1B46 A;  3R7X A;  5H8S A;  5KDT A;  1NUZ A;  4ISU A;  1Y20 A;  4MNC A;  3Q27 A;  3Q28 A;  4LQ2 A;  4ZEK A;  4TQU Q;  3QUJ A;  1LAF E;  4N6P A;  4XKR A;  2F6P A;  1BP5 A;  3UP9 A;  4H45 A;  4F22 A;  1B0L A;  5FHN A;  5IAI A;  4N91 A;  3LSX A;  4PCD A;  2ZYK A;  2PBW A;  2D21 A;  2DVZ A;  2XWO A;  2KR0 A;  2V3U A;  1A8F A;  3R6U A;  3O6G A;  3KEI A;  3CRB A;  2CEX A;  5EHS A;  4UAB A;  3K02 A;  4OAN A;  2HAV A;  3H6U A;  2V93 A;  1DTG A;  2B4L A;  1SYH A;  1JVX A;  4HE0 A;  1FPF A;  4TOZ A;  3FAT A;  1Y3P A;  2F7B A;  2REG A;  1S9T A;  1I6A A;  3MZ1 A;  2DP8 A;  3TFL A;  1ZJL A;  3DP6 A;  3MJN A;  5H8H B;  1N0T A;  2CEY A;  2DE4 A;  4IO5 A;  4LZ5 A;  4U21 A;  3V5A A;  2G29 A;  1VE4 A;  4ELO A;  2VOZ A;  1LBC A;  1QUK A;  4MH5 A;  5I2K B;  4PDD A;  4AQ4 A;  1B3H A;  1Y9U A;  1XHY A;  2B65 A;  2O51 A;  4GBW A;  4HCW A;  4JSO A;  3LUZ A;  5A5X A;  1BTJ A;  4RK9 A;  5AA2 A;  1MQH A;  5CBR A;  4JVD A;  1BIY A;  2VPN A;  5H8F A;  3RNN A;  1OMP A;  2O68 A;  1B3E A;  4EUO A;  5JK4 A;  1N04 A;  3C32 A;  1IIT A;  3T9V A;  3M8U A;  1QKA A;  4MX6 A;  3BKI B;  4GQO A;  4AB5 A;  4PFU A;  2I3W A;  4PFI A;  2OWZ A;  4GWU A;  3O66 A;  4I9D A;  1UTH A;  3KZG A;  2Z8F A;  2H9B A;  3PGF A;  1ZMG A;  3TCG A;  5AA4 A;  3OO6 A;  5IGA A;  2ZMB A;  4NHB A;  3A29 A;  2QVR A;  4IY6 A;  4FBP A;  1NNP A;  1GV8 A;  2BJJ X;  4GX6 A;  1CNQ A;  3U72 A;  1POY 1;  2I3V A;  4ZE9 A;  1L5T A;  3PPN A;  3TCF A;  1NFT A;  2HPG A;  3TEL A;  3K4U A;  2F8D A;  1A7L A;  4NF0 A;  4PET A;  1FPD A;  4G8N A;  4OVT A;  3QK6 A;  3TTM A;  3EHT A;  4O7I A;  1SW2 A;  2HXW A;  3VLV A;  4IO3 A;  4Z7E A;  2ANJ A;  4EQB A;  4KI0 E;  3CFZ A;  1QW0 A;  3GBA A;  3QIM A;  4N17 A;  4E0W A;  1DBZ A;  1N7W A;  5B70 A;  3MVY A;  5IZ3 B;  1O7T A;  4GLI A;  4MNP A;  2Q2C A;  2UVG A;  3GXA A;  2WBD A;  2Y5K A;  5H8N B;  3P7I A;  3U8Q A;  2GRV A;  4H6D A;  4MEV A;  1QUJ A;  1MDQ A;  4NMY A;  5TP9 B;  3OEN A;  3H4Z A;  1WVJ A;  1LFI A;  4FEB A;  1KWH A;  4NF4 B;  4ESX A;  1S7Y A;  1AH5 A;  4MLV A;  1FCK A;  3IO4 A;  1XC1 A;  3RUM A;  2QSX A;  2ZNS A;  2XXP A;  3SEV A;  2P1S A;  3LSF B;  3RT6 B;  3HN0 A;  2QVU A;  3CSB A;  1VFE A;  3KSJ A;  4O8M A;  2DOJ A;  4LP2 B;  1R6Z A;  4KYS A;  2Z23 A;  4BDO A;  1B52 A;  1OIB A;  4DXB A;  2WEF A;  4GVO A;  3KSX A;  1MY3 A;  4EQ7 A;  1N84 A;  1B3G A;  3FGS A;  3TQW A;  4F18 A;  1UTB A;  4NE4 A;  2P0S A;  1N3X A;  4LON B;  3PUW E;  4NF6 A;  1IZ1 A;  1FBH A;  4GF8 A;  3HPI A;  1MS7 A;  2Y7W A;  2O1M A;  3O29 A;  4PDH A;  1LEV A;  3MP8 A;  3C33 A;  2B3F A;  3PD9 A;  3IB1 A;  2WYK A;  3VDF A;  3IAZ A;  2XXK A;  4OES A;  4P0I A;  2CZH A;  2RC7 A;  4F29 A;  2YPN A;  3VLW A;  4GXA A;  3CG1 A;  1FQC A;  4QHQ A;  5J1D A;  2PT2 A;  1LAX A;  3ILT B;  3KC0 A;  3KC1 A;  4G68 A;  1MH4 A;  4NF5 B;  2B4M A;  4QFO A;  5I2N B;  2PFZ A;  3QXM A;  4FOR A;  5ET6 A;  2E1S A;  5I2K A;  4PQJ A;  2ABH A;  4LAT A;  4LQ5 A;  2I4C A;  5DVF A;  4WED A;  2M8C A;  4HW8 A;  5I3S A;  1ZLQ A;  3KN3 A;  1EYJ A;  3RLF E;  3TOD A;  2THI A;  4GXS B;  2WKY A;  3FUZ A;  1NNT A;  4JDF A;  2OLB A;  4H65 A;  3FVK A;  2WYP A;  2ONS A;  2XD3 A;  2F97 A;  1WOD A;  4PF8 A;  5K2Y A;  3MUQ A;  3PMW A;  4DLD A;  5F7V A;  1MXX A;  3GYY A;  2FHY A;  1KA1 A;  2DE3 A;  4MMP A;  2I49 A;  1QUL A;  1CE2 A;  1PB9 A;  3C36 A;  1TFD A;  4N6D A;  3W9W A;  3HFU A;  1GVC A;  3T9U A;  1PB8 A;  4G8H A;  1YAE A;  3EF7 A;  1FQD A;  4OA4 A;  2V3T A;  1FBD A;  1LB8 A;  3IFC A;  5IZZ A;  4FAJ A;  5DYH A;  4U4S A;  2F35 A;  4GIZ A;  2H99 A;  1YTV A;  1B6H A;  4QF9 A;  1B3F A;  1FBP A;  2ZZX A;  2F78 A;  4RA1 A;  2DXR A;  4NWD A;  3TTN A;  3U65 A;  1D9Y A;  2UVH A;  1PDA A;  2DSF A;  4Q8R A;  3QMF A;  1RKM A;  3LR1 A;  4O3B A;  4NQ8 A;  3I5O A;  4MHF A;  4F2Q A;  1DPP A;  3PU5 A;  3OSR A;  3IFA A;  4R6H A;  1MXU A;  5IZ3 A;  3QYT A;  3UK4 A;  5LDZ A;  4YB5 A;  4ECF A;  2Z8E A;  4XKN A;  4OXV A;  1LGB C;  5H8N A;  5I57 B;  3QSL A;  1Z7M E;  2H4I A;  5TP9 A;  4NED A;  1ZU0 A;  2FVZ A;  3C4M A;  4NF4 A;  1NI9 A;  2HEU A;  4F3B A;  3U92 A;  3CIJ A;  2R71 A;  5ITO A;  5FTH A;  5I59 B;  1MM6 A;  1YZ0 A;  1PB7 A;  3EHS A;  2PX1 A;  3G7W A;  1P1O A;  2RC8 A;  1FQE A;  2Q88 A;  1NL5 A;  2W7Y A;  4OTE A;  4IB2 A;  4IGT A;  3T96 B;  3FVN A;  1NV4 A;  1I6Q A;  1LBY A;  5DEX B;  2I0C A;  2UXA A;  1JVY A;  2DVC A;  1M5B A;  2VPO A;  3EHU A;  4JVC A;  4F31 B;  2I48 A;  2Q2A A;  1NV6 A;  2PVU A;  1SDX A;  4KPT A;  3TMG A;  5EHM A;  3K6U A;  3IX1 A;  1FSA A;  3VE1 B;  1Z7N E;  5FTI A;  3RTW B;  1A54 A;  5FBP A;  4NAP A;  4U2R A;  3OXN A;  5EYF A;  3O6H A;  1B05 A;  1PEB A;  4ESW A;  3RTF B;  3SEW A;  2R8T A;  3FXU A;  1LBW A;  1AWB A;  1SBP A;  1IQ7 A;  1JEV A;  3JYR A;  4PC9 A;  4H67 A;  1FBC A;  3BFT A;  1T0K A;  3G3F A;  3N6U A;  1O63 A;  2OX3 A;  2DWI A;  4PF6 A;  2Q9T A;  1IEJ A;  1LAG E;  1URG A;  1LAH E;  3PPQ A;  2OJT A;  4HE2 A;  1SYI A;  4IR8 A;  1EZO A;  3N6T A;  3PTY A;  3VVF A;  3T9H B;  1LB9 A;  3LV0 A;  3L6H A;  3O28 A;  2HFB A;  5I56 A;  1LBV A;  3KBZ A;  5DW8 A;  3ECR A;  4GWY A;  1OLC A;  3G3J A;  3KGC A;  3FXQ A;  2I6E A;  4JB7 A;  3PPR A;  3SEU A;  1OVB A;  2VP1 A;  2XA5 A;  4N8G A;  3PUZ E;  2XXW A;  3B6W A;  4G8M A;  3IOT A;  4DDD A;  5A5L A;  2Y5L A;  3O97 A;  4PAK A;  1SPI A;  5KCJ B;  1MPC A;  3KFM A;  2H25 A;  3G3H A;  2NWJ A;  3FJG A;  4N81 A;  1DK4 A;  4U23 A;  5BWJ A;  1LBB A;  2UYF A;  3THI A;  3O6I A;  1LCT A;  1DTZ A;  2B3B A;  4POX A;  2AIX A;  4DXC A;  4GL8 A;  4E0X A;  4POW A;  4Z0I A;  3MZB A;  5M2V A;  3DLN A;  1D4N A;  1NH8 A;  3OEL A;  1MRP A;  4R9F A;  5ELV A;  2QS2 A;  4GFR A;  3VXC A;  4BDN A;  4ZED A;  3N5L A;  1EYK A;  1Y1Z A;  1A55 A;  5I57 A;  4YB6 A;  5ET8 A;  1FRP A;  2F7A A;  1I69 A;  5HM4 B;  1NV3 A;  2PFY A;  1VDW A;  2XXQ A;  1M5D A;  3MAM A;  4IO4 A;  1NV1 A;  2FBP A;  4GRK A;  3DM0 A;  2Y84 A;  3TPA A;  2CZK A;  4O3A A;  3OEM A;  1IXG A;  3D4C A;  4MBP A;  3V89 B;  4YKI A;  5I59 A;  1FBG A;  1R1N A;  1DOT A;  2ONK E;  4MLQ A;  3MPL A;  4AB6 A;  1BKA A;  4QFP A;  4KYD A;  2O1L A;  1FBF A;  3FJM A;  5F1Q A;  2O84 X;  4KCD A;  3FXB A;  3IR1 A;  1ZBM A;  3FJ7 A;  4HS7 A;  1ZIU A;  4I62 A;  5ISU A;  1B58 A;  2CZL A;  3RPL B;  3C35 A;  3IOV A;  2WBB A;  2DS9 A;  2RKM A;  2FNC A;  3OO7 A;  4N4U A;  3QAX A;  3CHG A;  5F24 A;  4PP0 A;  4JWO A;  3B6Q A;  1NV7 A;  3PUV E;  4PFR A;  4NX1 A;  3OMB A;  1OLA A;  2RIN A;  4LVQ A;  2Z8D A;  2F6G A;  3G3G A;  2XX7 A;  2QS1 A;  3KN7 A;  4YKK A;  4YU0 A;  4G61 A;  4F1U A;  1FQB A;  1AL3 A;  2PCR A;  3PUX E;  3MP6 A;  3E9X A;  1QUI A;  1FTL A;  2QFL A;  5B7D A;  3K01 A;  3C9H A;  1FTJ A;  1RDY A;  3K00 A;  4KR5 A;  4OVR A;  4Q30 B;  2IEE A;  1G0I A;  1LFG A;  1WDN A;  1MY0 A;  3MW0 A;  4JWY A;  3H7M A;  5H8Q B;  4PE3 A;  4U1Z A;  1ZKB A;  3H6T A;  5T3J A;  4NF8 B;  4YB7 A;  2Q89 A;  5I7I A;  3RYD A;  3I6V A;  4DCX A;  3DP8 A;  2UVJ A;  2XXU A;  4HTG A;  4RK2 A;  1IXH A;  4ONY A;  3ZSF A;  3FXR A;  4GWZ A;  1MDP 1;  5K2X A;  3V8X B;  4XEQ A;  3ILU B;  1SI1 A;  4ZE8 A;  4P9K A;  5AA1 A;  1RYX A;  3IL1 B;  4P56 A;  4ZEC A;  3T9X B;  1PBP A;  4NTL A;  2P3V A;  4JXI A;  2VD3 A;  3S9L C;  5CMM A;  4R6Y A;  4F1V A;  4P11 A;  3L6G A;  4PAF A;  3VXB A;  5IM2 A;  3N94 A;  1D9V A;  2WX9 A;  3SZP A;  1P1N A;  5KCJ A;  1JW1 A;  5EQ7 A;  4ND9 A;  1NV2 A;  3TUS A;  3CG3 A;  4X04 A;  2QRY A;  1EZP A;  1TXF A;  5H8H A;  1BK4 A;  4F3G A;  3E79 A;  4ZS9 A;  2OWS A;  4Q5T A;  3S9M C;  1LCF A;  2NVU B;  3G3I A;  4N07 A;  4ZZE A;  1QJM A;  2X7Q A;  2RCB A;  1B1H A;  1NNF A;  2JJK A;  2HAU A;  1NUY A;  3FV1 A;  1GTK A;  4IO7 A;  2AL5 A;  4MF3 A;  3IO6 A;  5CMK A;  1B4H A;  1FBE A;  1MXY A;  1ANF A;  3AXF A;  4F19 A;  4EXK A;  3UA8 A;  4LZ8 A;  3BIG A;  4FAT A;  4P3L A;  4NN3 A;  4PFY A;  4N13 A;  5DVJ A;  4LN5 A;  3LUY A;  2XD2 A;  1JW5 A;  4QFN A;  4KCC A;  1IME A;  4NG7 A;  4BLA A;  3JZJ A;  2ZNT A;  3ZKL A;  5KDT B;  4ELQ A;  1FPG A;  4FIM A;  1MXW A;  2BJI A;  2KLF A;  3F11 A;  2I4B A;  4I1D A;  3D1R A;  2QMX A;  1IXC A;  4YMB A;  2ONR A;  1JEU A;  4O3C A;  1R9Q A;  1FQA A;  2YJP A;  4PFT A;  3CFL A;  2Y7I A;  1Q35 A;  4G2Z A;  3SER A;  5CI5 A;  1MY2 A;  4QFK A;  4X48 A;  4PBH A;  4I8C A;  4X8R A;  2A5T B;  1IUD A;  4KQP A;  3VVE A;  4N8Y A;  4RJZ A;  4I3Y A;  4XFE A;  1JET A;  3TTL A;  3IJO B;  1A99 A;  2NOO A;  3OO9 A;  1VSO A;  5TPA B;  1FPE A;  4DXU A;  3PV0 E;  5EQ9 A;  3OD7 A;  4R9G A;  3K0V A;  4XXU A;  4P1L A;  3SET A;  1M5C A;  2PMS A;  1J1N A;  4EQ9 A;  3H3G A;  1B1X A;  2DWJ A;  4FEC A;  4H8I A;  3S2V A;  5A5X B;  5TU0 A;  3WAF A;  1KA0 A;  1UIV A;  4HCY A;  5AA2 B;  2LAO A;  1Y1M A;  4UAC A;  4IGR A;  1MM7 A;  4MCO A;  4G77 A;  4XIG Q;  3U1O A;  3MWB A;  4IO6 A;  2D5W A;  4O94 A;  5ET5 A;  2FA7 A;  2P3N A;  4L17 A;  4GL0 A;  3IOR A;  1HSE A;  4X1B A;  3T0J A;  4EXL A;  4QSC A;  3OSQ A;  2DWA A;  1USY H;  4YKJ A;  1TT1 A;  3S4U A;  3TTR A;  5I5P A;  1UTH B;  4F1Y A;  5CC2 A;  5EQ8 A;  3IB0 A;  3VV5 A;  3KG2 A;  3LBS A;  3RN8 A;  1R9L A;  2VT5 A;  3C31 A;  1CB6 A;  4C0R A;  2H5Y A;  3JV9 A;  2HQ0 A;  1NV5 A;  3VLU A;  1EU8 A;  1Y4C A;  4YIC A;  5ESY A;  2AYS A;  3TAJ A;  3MBP A;  1FTO A;  4I40 A;  2F5X A;  4XKQ A;  2CMO A;  3UN6 A;  2FYI A;  5JTY B;  1US4 A;  2DQV A;  5HBC A;  1NUX A;  2Y7K A;  4DIG A;  2V84 A;  3FIR A;  1M5E A;  1Y4T A;  1P1W A;  1YYZ A;  5AA3 A;  2V25 A;  3B7D A;  4OVQ A;  1II5 A;  3MVX A;  3RY3 A;  1UQW A;  2F34 A;  2X26 A;  2GQ1 A;  4NF5 A;  5I2N A;  1TFA A;  3T1B A;  5EYG A;  1RDZ A;  3EQ1 A;  3RT8 A;  4OFL A;  3PMV A;  1ATG A;  4NGU A;  4EF1 A;  4PE5 B;  1FTK A;  4GX3 A;  4MAG A;  1D3K A;  4IY5 A;  1USY E;  4OYV A;  2DWH A;  1FPI A;  1B32 A;  2P2A A;  5LTC A;  2XXV A;  4WEP A;  1FPB A;  1MXZ A;  2F3B A;  3U93 A;  3CI8 A;  3TEP A;  1B2H A;  1JNF A;  3IB2 A;  3DP4 A;  4F2O A;  3OEK A;  3TQL A;  4R72 A;  4H8J A;  4XTC Q;  4U1O A;  4PAI A;  1NNK A;  2FIX A;  4F3S A;  4YMA A;  3I3V A;  4OFJ A;  2ESN A;  2F3D A;  2V3Q A;  1B3L A;  1DMB A;  3KJ7 A;  3FZV A;  5FHO A;  1JQF A;  2OZZ A;  3USD A;  2ZXT A;  3B6T A;  4HE1 A;  3H6V A;  5CMC A;  4F3P A;  1YPN A;  3PPO A;  3T22 A;  4U22 A;  5CRY A;  3MST A;  5BUU A;  3E13 X;  1OVT A;  4MIJ A;  1B0H A;  2MKZ A;  1UTB B;  4PBQ A;  4NF6 B;  1LBZ A;  1N7X A;  3FV2 A;  3EPE A;  2A5T A;  1N76 A;  1VR5 A;  1NKX A;  2L5V A;  3TCH A;  3HCQ A;  4O7M A;  1DSN A;  2OCU A;  5DVI A;  3MC2 A;  2O7U A;  2XXI A; 
#chains in the Genus database with same CATH homology
 3GYY A;  2FHY A;  1KA1 A;  1IMF A;  2DE3 A;  4OVR A;  4MMP A;  1G0I A;  4GWX A;  4YZZ A;  5ET7 A;  4AS5 A;  2QPQ A;  4N6D A;  4PE3 A;  3W9W A;  3HFU A;  2XWV A;  3E78 A;  5T3J A;  4OA4 A;  2Q74 A;  5I7I A;  3RYD A;  1FBD A;  1XI6 A;  3IFC A;  5IZZ A;  4M1V A;  1FPJ A;  4GWZ A;  4PTK A;  3ROJ A;  1FBP A;  5EQA A;  4XEQ A;  1YXI A;  2ZZX A;  1NUW A;  4P9K A;  4P56 A;  3U65 A;  4GX4 A;  2P3V A;  4P1E A;  3QMF A;  4DI4 B;  1Q9D A;  4F1V A;  4NQ8 A;  4MHF A;  4DI3 D;  4PAF A;  3FBP A;  5IM2 A;  4KXP A;  2WX9 A;  3SZP A;  4OVP A;  4X9T A;  5EQ7 A;  3IFA A;  1NV2 A;  4X04 A;  3ISP A;  1K9Y A;  5IZ3 A;  1BK4 A;  1FPL A;  4PGN A;  2HZK A;  4OVS A;  2HZL A;  3E79 A;  5LDZ A;  4GWW A;  1NUZ A;  4MNC A;  3NOH A;  4H45 A;  4N91 A;  2JJK A;  4PCD A;  1NUY A;  2DVZ A;  1IMB A;  4P47 A;  2FVZ A;  2XWO A;  4P8B A;  2KR0 A;  1NI9 A;  3MYU A;  2CEX A;  4UAB A;  4OAN A;  1IMD A;  3BIH A;  1YZ0 A;  1FBE A;  4QXD A;  2B4L A;  4F19 A;  3BIG A;  1FPF A;  2DDK A;  4HE0 A;  4P3L A;  4NN3 A;  4LN5 A;  1NV4 A;  1LBY A;  1IME A;  2CEY A;  2DE4 A;  4NG7 A;  2XWI A;  1FPG A;  2VPO A;  4JVC A;  4PDD A;  4XF5 A;  2BJI A;  1NV6 A;  1IMA A;  4GBW A;  4N6K A;  3D1R A;  4HCW A;  3LUZ A;  4HXV A;  4JVD A;  1DCU A;  1FSA A;  2VPN A;  5JK4 A;  2KQZ A;  4I3E A;  5FBP A;  2CZI A;  5J16 A;  4PBH A;  1FPK A;  4NAP A;  4X8R A;  4JVI A;  4MX6 A;  1NV0 A;  2R8T A;  1LBW A;  4N8Y A;  4PFI A;  1AWB A;  2OWZ A;  4GWU A;  4I3Y A;  5IZ1 A;  4XFE A;  4PC9 A;  1FBC A;  5IGA A;  1FPE A;  1RDX A;  4NHB A;  5EQ9 A;  3A29 A;  2QVR A;  2OX3 A;  4P1L A;  4PF6 A;  2Q9T A;  4FBP A;  2HHM A;  4GX6 A;  1JP4 A;  1CNQ A;  4HE2 A;  1KA0 A;  1LBX A;  4HCY A;  1D9Q A;  4IR8 A;  4MJO A;  3PTY A;  2HPG A;  3LV0 A;  4MCO A;  1LBV A;  4O94 A;  5ET5 A;  4GWS A;  2P3N A;  4NF0 A;  4PET A;  1FPD A;  3KBZ A;  5DW8 A;  4OVT A;  5EYH A;  4GWY A;  3T0J A;  4O7I A;  4QBA A;  5I5P A;  2XA5 A;  4N8G A;  5EQ8 A;  1FJ6 A;  5A5L A;  2Y5L A;  2VT5 A;  4PAK A;  1SPI A;  4N17 A;  1DBZ A;  1NV5 A;  5IZ3 B;  4YIC A;  5ESY A;  1KZ8 A;  4MNP A;  4N81 A;  4I40 A;  1DK4 A;  2F5X A;  2WBD A;  2Y5K A;  1IMC A;  1NUX A;  4MEV A;  1YYZ A;  4OVQ A;  1K9Z A;  1INP A;  4MNI A;  4PGP A;  2GQ1 A;  4PFB A;  3T1B A;  2QVU A;  3RPL A;  1EYK A;  5EYG A;  1RDZ A;  4O8M A;  1FTA A;  4NGU A;  5ET8 A;  3W9V A;  1FRP A;  4GX3 A;  4MAG A;  4H46 A;  1NV3 A;  2PFY A;  1VDW A;  2WEF A;  4GBV A;  1FPI A;  1NV1 A;  2FBP A;  5LTC A;  4F18 A;  1FPB A;  2CZK A;  2F3B A;  3B8B A;  2XWK A;  1FBH A;  4PDH A;  1LEV A;  1FBG A;  2WYK A;  4PAI A;  1FBF A;  2XXK A;  2ZZV A;  2CZH A;  2FIX A;  4AS4 A;  3FXB A;  5J1D A;  2F3D A;  2V3Q A;  3KC0 A;  3KC1 A;  2HXR A;  1QGX A;  2B4M A;  2PFZ A;  5ET6 A;  3RPL B;  4HE1 A;  2WBB A;  2FIE A;  1EYI A;  2ZZW A;  4N4U A;  3CHG A;  3MST A;  2DE2 A;  4N15 A;  2QVV A;  5F24 A;  5I3S A;  1NV7 A;  3B50 A;  4MIJ A;  4PFR A;  4NX1 A;  2MKZ A;  1EYJ A;  2V4C A;  4PBQ A;  1FJ9 A;  1LBZ A;  4G61 A;  4F1U A;  2Q8M A;  2PCR A;  3EKI A;  2WYP A;  1G0H A;  2QFL A;  2L5V A;  4O7M A;  1RDY A;  4PF8 A;  5CM6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...