3OXNA

The crystal structure of a putative transcriptional regulator from vibrio parahaemolyticus
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
215
structure length
213
Chain Sequence
PQQCDQTFTIATTDYAMQTILPFALPRIYQEAPNVSFNFLPLQHDRLSDQLTYEGADLAICRPTGPVEPLRSEILGRVGVLCLLSKQHPLANQEMSLDDYLSHPHAMIAISDGVKALIEQALIDKPQRKMVLRAYHLEAALAIVLPIIITVPADLAYLVAERYDLVVKPLPFQFTPFDYSMIWHARCEHSPAQEWLRSVVREECSRLIAKRIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of a putative transcriptional regulator from Vibrio parahaemolyticus
rcsb
source organism Vibrio parahaemolyticus
molecule tags Transcription regulator
molecule keywords Putative transcriptional regulator, LysR family
total genus 48
structure length 213
sequence length 215
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3oxnA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3oxnA02
2QMWA 5ICTA 2HFBA 5I59B 1HSLA 4JWXA 4EF2A 2ZNUA 2KLFA 3U1OA 1XOCA 3UN6A 2QJEA 1AH5A 4FEDA 1SYIA 3K1MA 1FQCA 5I2KA 2ONRA 5ITPA 4MF3A 5CMBA 2F34A 4LQ5A 5TP9A 5CMKA 1TFDA 2Y7IA 4IGTA 2XX8A 4ZEDA 1HSEA 4G68C 1LCTA 5KZTA 1B3FA 1ZMGA 3MZ1A 2VGQA 1DTGA 3MQ9A 4LATA 2Y84A 4RJZA 5I2NA 2F36A 3PV0E 3T9XB 1TT1A 1AIVA 1VSOA 4MBPA 4C1TA 2YLNA 3KG2A 3TYHA 3C32A 3QUJA 3OXNA 1GR2A 1UTBB 3TELA 1QUJA 3ZS6A 2QL3A 1FTLA 2QS4A 3C4MA 2XXYA 3PD8A 3MJNA 2NWJA 4ESWA 4PE5B 1D9VA 1MY0A 2GH9A 2QS2A 4OWDA 3RTFB 1BP5A 5I59A 1N7WA 1S7YA 3IB1A 3BFUA 3K2DA 3N5LA 1YCJA 4OHNA 1Y3NA 3EQ1A 1SW2A 5H8HA 1PB7A 3THIA 3ILTB 4ELOA 3RQTA 3VE1B 4F19A 1P1NA 4DXCA 1B05A 1SD3A 3EHUA 3I6VA 4G8MA 4XTCQ 3OENA 2XXHA 5CRYA 2Q88A 4G77A 3CI8A 2RC8A 4IY6A 5TPAA 1D3KA 1WDNA 1USYE 3EN3A 3FVOA 3VXBA 2F8DA 3HCQA 3S4UA 2I6EA 4BLAA 4OFJA 3B7DA 1JEVA 3K6WA 2G93A 3PUWE 1B1HA 1JW4A 3T9VA 2ZXTA 1UTHB 1P1WA 3O6IA 4YKKA 4ZZEA 3C36A 2Z8EA 2Q89A 3EHSA 4IB2A 1GVCA 4ESXA 3IOUA 4FIMA 2FYIA 2O69A 1Z7ME 2I0BA 1SI1A 4NWCA 3PGFA 4C0RA 2ZMBA 2R71A 4GF8A 4XKPA 1B6HA 3OD7A 4GVOA 1R6ZA 5I2KB 4TLLB 5H8QA 3SETA 5CC2A 3VFJA 3H6VA 2DWAA 1B3GA 2HXWA 2VD3A 1HSJA 1QUIA 1B32A 2V25A 1B51A 3V8XB 3PUXE 4LONB 1LFHA 1S50A 4LUBA 2XXIA 5DEXB 3TQLA 1OQGA 2ANJA 3PUVE 4ECFA 3IJOB 4Q5TA 5DYHA 5M2VA 2F5XA 4RPOA 2F35A 4F31B 2VD2A 4OYVA 3RLFE 1OIBA 3W15C 4JWOA 3FJ7A 5CM6A 2UYEA 3IOWA 4I62A 3VXCA 2UVGA 2ZYKA 2ABHA 4PFWA 4E0XA 5JK4A 3V83A 3CVGA 1ELJA 1BKAA 1QUKA 1I6BA 4NE4A 4F1UA 2AIXA 3U92A 1MH4A 2XXUA 3OO8A 2D21A 1LBCA 4QFNA 3RY3A 3N26A 4QFLA 4AB5A 5I2NB 4NWDA 4YAHX 4PP0A 2D5WA 5IAIA 1BTJA 2E1SA 4G2ZA 4R9GA 3S9EA 4RYAA 1EZOA 3UGWA 3QUFA 4F2QA 1SDXA 4AQ4A 3MPLA 1SW4A 3C34A 1NNPA 1OLAA 1YPNA 3O9PA 3PMXA 4HS7A 4OETA 1NMUA 2QS3A 1XT8A 3CFXA 4ND9A 5L9MA 3T66A 1LAXA 3KGCA 3MC2A 1FTOA 3TTKA 2I3VA 3FXQA 3H7MA 3MP6A 4JB7A 5FHOA 3SEXA 5HM4B 3U72A 2Q8JA 5LOMA 1RKMA 1Y1MA 4X9TA 5JEIA 4YICA 2R6GE 1RYXA 3T9UA 1URDA 1ZLQA 4OXVA 4NF6B 5B70A 2M8CA 2XXWA 4XXUA 4R75A 5AE4A 1B0HA 3AXFA 3VLUA 4OERA 2PBWA 4ZEIA 5AA4B 4YB6A 1LFGA 2I3WA 4GLIA 4YKPA 3ONMA 3GBBA 5DTBA 1JVXA 1N3WA 4QSEA 1TXFA 4YKIA 1QULA 4H5FA 4RNSA 3RTWB 2CZLA 3A09A 5DVFA 3CG1A 2AYSA 4HW8A 1NH7A 3CIJA 2UVHA 2QRYA 5FHNA 4BDOA 1MQIA 1IXIA 1JW1A 4H1XA 3KOSA 1YAEA 3Q27A 4RK9A 5HPQA 1FQDA 5BWJA 1MQJA 2PMSA 2XXTA 3OO9A 4MFIA 3U8QA 3FJMA 3MVWA 1NNKA 1O63A 3IB2A 1PB9A 3CFZA 1SQYA 3QYTA 5CI5A 3IOVA 4AB6A 3H03A 4IO4A 5TU0A 5KDTA 5ICQA 4F2OA 1JW5A 1LCFA 2VHAA 1IXCA 1M5DA 4GFRA 5H8SA 2F6PA 3H3GA 3DP4A 1MPBA 3ECRA 2ZYOA 3KBRA 3MUQA 4U4SA 5H8NB 1P1OA 4BDMA 2H99A 3IAZA 3FIRA 3FVKA 2HCAA 1MY4A 1B52A 4EDPA 1ANFA 4XKQA 2H4IA 4KQPA 3KN7A 3HHGA 3DP8A 3MVYA 4I8CA 4EQ9A 1O7TA 2XXXA 1D4NA 3UORA 1EZPA 3LC8A 3K1NA 2UYFA 4H8JA 2ZYMA 3N94A 4WKMA 1A55A 3A3CA 5TPAB 3LR1A 5K2YA 3MBPA 4YMAA 1QW0A 2O51A 3T9HB 4EF1A 1MY2A 1P1UA 3KJTA 4OFLA 3I3VA 4JBZA 3SKPA 3K4UA 3U94A 3WAFA 1XC1A 2O1MA 3TCHA 3ODBA 1O64A 1B3EA 1B4ZA 3N6TA 4N13A 2I0CA 4G68B 3O6GA 5BUUA 1Q35A 4THIA 1NH8A 1AL3A 4FORA 3V5AA 2A5SA 1N7XA 4WEDA 3O2AA 5EHSA 4LZ5A 4MLVA 3M8UA 3UA8A 1I6AA 4ZE8A 3ZKLA 4P11A 4OTEA 4JSDA 1A7LA 1R1NA 1D9YA 1MXYA 3TTMA 1Q1KA 2O84X 3Q25A 4YKJA 3S2VA 3VLWA 2OJTA 3C33A 1ZBMA 1RYOA 1EU8A 2XD2A 4U1ZA 3S9MC 1XS5A 4OZ9A 1LAFE 1US4A 3H6UA 4N6PA 1H76A 1B5JA 1IEJA 1MM6A 1XVXA 4OVJA 4R6HA 4KCCA 4ZZAA 1DSNA 4GL8A 4QHQA 4FJPA 4PQJA 5AA4A 1A8EA 2QSXA 3M3KA 3CR9A 2YPNA 3R6UA 5K2XA 4MH5A 4BDLA 4EQ7A 3B6QA 1LAGE 1B1XA 5DT6A 4GXSB 4LZ8A 5AA2A 3KEIA 1GGGA 3W9VA 3RGYA 1FQAA 1OMPA 2WKYA 4RK2A 1LB8A 2OBGA 2DE4A 2P1SA 3IORA 3HN0A 3MVZA 4XKNA 4KFQA 2V3QA 4NF6A 1USYH 1KWHA 1QKBA 2G29A 3B6WA 5CMMA 3DLNA 3FZVA 4DXBA 4ELRA 1AOVA 2XXPA 3TMGA 1M5BA 4H67A 3MPKA 2V93A 2DXYA 1FQBA 1LLSA 4F3BA 2NOOA 1NFTA 3E4RA 4G4PA 1VE4A 3IOTA 4GXAA 4U2RA 2V84A 4GIZA 5I56B 5F7VA 1M5EA 2W7YA 1WVJA 3HSTA 1Y1ZA 3C31A 2I58A 2E0SA 3IX1A 1NKXA 4JXIA 4OEVA 4OQOA 3ZKKA 1Y3QA 4U23A 2GFEA 2A5TB 4EXLA 2Q2AA 3U93A 5J1DA 4ISUA 3RNNA 4IO3A 1OLCA 4PFYA 2DP8A 2DWJA 2ZNTA 3VV5A 5CBSA 2H98A 1CE2A 4PFUA 1UIUA 3PPNA 1AMFA 2HEUA 5AA3A 5KCJA 3HO7A 1IZ1A 4NF8A 4YZZA 4G68A 1XHYA 5CMCA 4F22A 5FHMA 3FATA 4NEDA 3H6TA 2QMXA 1CB6A 1B58A 2Y7WA 3TQWA 1MQDA 3DM0A 2P2AA 3FVGA 4I1DA 1BIYA 5DVJA 3O28A 4IO7A 1S9TA 3IO6A 4QFKA 4C1UA 4OESA 3RUMA 3TFLA 2HZLA 3GLBA 5I58B 1FTJA 2DXRA 2DQVA 3L6GA 3TUSA 3IR1A 4R72A 3SDFA 4Q30B 4R9FA 2DS9A 4ZDMA 2ZYNA 4KR5A 3USDA 5A5XB 5DEXA 4Z0IA 1QJMA 3MP8A 4G8HA 3C35A 1N04A 3PUZE 1EZ9A 3TTNA 2I49A 4GRKA 2QS1A 3MVXA 4Z7EA 3K6UA 2ESNA 2OK2A 3O6HA 3PMWA 1EH3A 3R7XA 4E0WA 2B3BA 1POTA 1WODA 3B6TA 3FGSA 4ZEKA 4P0IA 1SBPA 5JTYB 4DZ1A 1R9QA 2HAUA 3LSFB 1J1NA 4FECA 1A99A 3OELA 1UTBA 4RA1A 5F1QA 2REJA 2Z8FA 1LFIA 2VP1A 4KCDA 4N07A 5L8DA 2F7BA 2OWSA 2PT1A 2V3UA 4YB7A 3MWBA 3SEUA 2X26A 4ZEBA 2HAVA 3DP6A 3K00A 1SW1A 4ZE9A 1OVBA 5I58A 1Y4CA 4R2FA 4U22A 4JDFA 1B3LA 1UIVA 3EHTA 1VR5A 2FNCA 4IO5A 4NF5B 3VVFA 1JETA 2THIA 3FV2A 4KHZE 1MH3A 5H8FB 3JZJA 3O97A 3CG3A 4NMYA 3K0VA 3PPRA 4GOTA 3CSGA 5ELVA 5JTYA 1B0LA 4F39A 1B9JA 5DVIA 5KCJB 1N0TA 1P99A 1T0KA 5B7DA 4RPNA 1B7ZA 4X1DA 1MXZA 4LP2B 1POY1 3H4ZA 4O3BA 4X1BA 1LB9A 2A5TA 2PYYA 2GHBA 4QF9A 3F11A 4HCWA 4R73A 3PD9A 1IXHA 1H43A 4R74A 3MZBA 1A8FA 3G3KA 3R26A 3UK4A 3CRBA 2DWHA 3OOAA 2Z8DA 3KN8A 3D4CA 4YMBA 2NVUB 4ELQA 1URSA 4H5GA 2UXAA 3LSWA 2DYXA 2XXVA 1B40A 1L5TA 3LUYA 3KZGA 4OENA 1FTMA 4DLDA 3KOTA 3E3KA 4F3PA 5AA1A 1Y4TA 2V3TA 1PEBA 3A3UA 4GD5A 1JQFA 4DIGA 3JV9A 2CMOA 4RY1A 4IO2A 4JWYA 4M1VA 4QRZA 4NF4B 3I5OA 5L9OA 4WXJA 3MW0A 4IO6A 3G3HA 3HV1A 2XX7A 3RN8A 3T93B 1UQWA 5AA2B 1MXXA 1IQ7A 3OSQA 3SEWA 1NL5A 3O29A 3TTLA 3FXRA 3IB0A 2DSFA 2XXQA 1Y3PA 3FUZA 4PFTA 5AA2D 5I57B 1URGA 2O68A 3GBAA 3HHFA 2DVZA 1N84A 3G3FA 5L9SA 1SI0A 1N76A 1QVSA 1PB8A 3KJ7A 4DCYA 1H44A 1MDP1 2O7UA 3O66A 4Q0CA 1LBBA 2ALUA 2F97A 2UVJA 2Y7KA 3SESA 5I56A 2GHAA 1MM7A 1IITA 1MG1A 1TFAA 3K1PA 2Q9TA 2NXOA 1Y20A 3KFMA 2DVCA 3Q29A 2AL4A 1JVYA 2FA7A 4XKRA 1P1QA 1TWYA 1ZU0A 2DE2A 4OMBA 5EHMA 3TDJA 1NNFA 1PBPA 1M5CA 4POWA 2O6AA 2I4BA 2LAOA 2P0SA 3EF7A 4HTGA 2I4CA 3E9XA 2IA4A 2XHDA 4KYEA 1DTZA 2RCBA 1B7HA 1MPCA 3LSXA 4OEUA 3OO7A 1Z7NE 4FE8A 1IIWA 3LBSA 1B3HA 4QFOA 1VFDA 3E13X 3IO4A 3P7IA 4R2BA 3VLVA 4F29A 5I84A 3OSRA 1MY3A 2IEEA 4LVQA 2Y7RA 3PU5A 2OWTA 1I6QA 4ZS9A 3G3JA 1US5A 3ILUB 4NTLA 3TZAA 4EQBA 1A40A 5ITOA 3DELB 5KDTB 1MQGA 2H25A 5FTHA 3RPWA 4QSDA 3RT8A 4MLQA 1XVYA 1FW0A 3SEYA 2I48A 3PUYE 3UIFA 4KI0E 4L17A 5H8NA 4F18A 1SYHA 2RC9A 1LAHE 1MQHA 4M4GA 3K6VA 2XD3A 1B7UA 1B5HA 2ONSA 3Q26A 1II5A 1VFEA 3KSJA 3SEVA 3V89B 3N6UA 4JSOA 4Q8RA 5H8HB 2F78A 1M5FA 3IL1B 3QIMA 4I9DA 3OEMA 2O7IA 4IGRA 2B65A 2Z22A 1ATGA 2UVIA 1H45A 2F7CA 4KD5A 5EYFA 4F1VA 1FQEA 4DDDA 4NF4A 1B46A 1F9BA 2NUVA 3L6HA 4OFOA 4P0GA 2QPQA 4GQOA 2GRVA 2VOZA 3SERA 3VDFA 4YB5A 3MZ9A 1R9LA 3TCGA 3FJGA 3TKDA 1MXUA 4TQUQ 1OQHA 3LSLA 4G8NA 4NF8B 4POXA 4FATA 4PETA 1MY1A 1DPPA 4GWOA 2D3IA 1MS7A 4BDQA 2HQ0A 2DWIA 2ZNSA 3PPOA 1IUDA 4QFPA 3W9WA 5FTIA 5HBCA 4LA9A 4U21A 1FQFA 1MDQA 4H65A 4ONYA 4ZEFA 2R9JA 1LSTA 1MXWA 1YTVA 4GL0A 5TP9B 3Q28A 5CBRA 1SVXB 2RINA 3TEPA 2DOJA 1QKAA 2PT2A 3KSXA 3M3LA 4QSCA 4F1YA 2REGA 3QXMA 3G3IA 4LZ7A 4HCYA 3D4GA 5H8QB 1DPEA 4UA8A 3PPQA 3TPAA 4BDRA 1DOTA 5I57A 3MP1A 1NNTA 1MPDA 3G3GA 1LGBC 2H5YA 4LQ2A 2F6GA 2BJJX 1SW5A 3RT6B 4H6DA 1ZKBA 1Y9UA 2F7AA 2OZZA 2Z23A 4F3SA 1A54A 1UTHA 4U4XA 4TLMB 1GTKA 3HPIA 3WAEA 2RKMA 2O1LA 1PC3A 3VVEA 1FCKA 3BFTA 3S9LC 2X7PA 3QAXA 1IXGA 1FTKA 3MAMA 3BBRA 3G7WA 3IK6B 3TODA 4U1OA 4BDNA 4R6KA 4KPTA 3S9NC 3TTRA 4R6YA 2XXRA 1ZIUA 2HZKA 2ONKE 3FVNA 3GXAA 1I69A 2RF1A 3BKIB 1GV8A 3UP9A 3T96B 1BLFA 1B4HA 3H6WA 4RXLA 5A5XA 3T22A 3K6XA 4KYDA 2OCUA 1H3DA 3TCFA 2OLBA 1N3XA 3CFLA 4EUOA 1B5IA 1JEUA 2B3FA 2PVUA 4H0WA 4DXUA 3ZSFA 3GZGA 3VVDA 3PPPA 3OMBA 4H8IA 1DMBA 4F3GA 1ZJLA 2H9BA 4FEBA 3C9HA 3TAJA 4KYSA 4YU0A 2Y7PA 2X7QA 3KN3A 4DE8A 4DCXA 5H8FA 1B2HA 1ZTYA 3JYRA 4TOZA 4XIGQ 3IJXB 3QSLA 1MXVA 1JNFA 1OVTA 2RCAA 3FV1A 3OEKA 4NF5A 5IKBA 4O3AA 4FAJA 3H06B 2RC7A 3EPEA 3OO6A 2AL5A 2PX1A 3CSBA 1PDAA 1MRPA 2XX9A 2YJPA 4ZECA 4EXKA 4ELPA 3FASA 3M3FA 4IY5A 4O3CA 4UACA 3FXUA 3K02A 3K01A 3QK6A 4X48A 2Q2CA 1PBQA 5ISUA 3PMVA 4WEPA 3FD3A 4K3FA 2DE3A
chains in the Genus database with same CATH superfamily
5ICTA 2HFBA 1HSLA 1NV6A 4JWXA 2KLFA 2FVZA 1FQCA 5I2KA 1FBPA 1D9QA 4MF3A 2ZZVA 5TP9A 4MJOA 4G68C 2WBBA 2VGQA 4RJZA 3PV0E 1TT1A 4C1TA 1FTLA 3C4MA 3MJNA 1IMFA 5I59A 1S7YA 4MAGA 3BFUA 3K2DA 3B8BA 1Y3NA 4PAIA 3VE1B 1SD3A 4XTCQ 2Q88A 4IY6A 1USYE 3PUWE 1JEVA 3T9VA 2ZXTA 1UTHB 4ZZEA 4PGNA 4IB2A 4FIMA 5EYGA 4C0RA 4NWCA 3PGFA 4OVPA 3H6VA 1B3GA 1HSJA 2V25A 4LONB 1S50A 2XXIA 1DBZA 4O8MA 3PUVE 3IJOB 5DYHA 1FBFA 2F35A 3IFCA 1OIBA 3FJ7A 2UYEA 2ABHA 4PFWA 4E0XA 1ELJA 2XXKA 4F1UA 2XXUA 5IAIA 3IFAA 1EZOA 1Q9DA 4RYAA 4N81A 4AQ4A 1FTOA 5I59B 3MP6A 3U72A 4X9TA 3T9UA 4OXVA 4NF6B 4R75A 2PBWA 5AA4B 4YB6A 4GLIA 4ZEDA 1N3WA 4QSEA 4HW8A 1LEVA 2CZLA 3A09A 5DVFA 3CG1A 1NH7A 5FHNA 4PF6A 2ZZXA 4P1LA 3E78A 5BWJA 2XXTA 3SZPA 1NI9A 3FJMA 3CFZA 1SQYA 4AB6A 4OVTA 3KC0A 4GFRA 5F24A 1MPBA 2ZYOA 4U4SA 1P1OA 3IAZA 3FIRA 3FVKA 1B52A 4EDPA 4EQ9A 2XXXA 4JVCA 3K1NA 2ZYMA 3CHGA 3MBPA 4EF1A 4MIJA 2QVUA 3I3VA 1O64A 3N6TA 2ZZWA 2CZKA 2I0CA 5BUUA 4HE1A 4WEDA 3UA8A 1A7LA 1R1NA 1D9YA 1Q1KA 2O84X 4MHFA 3C33A 1EU8A 3S9MC 4OZ9A 5ET6A 3H6UA 1H76A 1B5JA 3GYYA 1DSNA 4QHQA 2OX3A 4PQJA 2R8TA 5EQ8A 1LAGE 2WYKA 4LZ8A 2QVRA 2DE4A 1CNQA 3B6WA 4DXBA 3FZVA 3TMGA 2V93A 1NFTA 3IOTA 2I58A 1NKXA 3ZKKA 2GFEA 4ISUA 3T0JA 3ISPA 4PFYA 5CBSA 2DWJA 4HE0A 2H98A 1CE2A 2HEUA 3HO7A 2P3NA 3H6TA 4O7MA 1CB6A 1B58A 2XWKA 4DI3D 1BIYA 5DVJA 4OESA 2HXRA 3IR1A 4KR5A 5A5XB 1FPJA 5DEXA 5DW8A 1N04A 2I49A 1FPBA 3FGSA 3MSTA 4P0IA 4FECA 1J1NA 5F1QA 4P1EA 2Z8FA 3TTKA 2VP1A 3SEUA 2F7BA 2PT1A 3MWBA 5I58A 3DP6A 1OVBA 1FBCA 3VVFA 2Q8MA 4GWYA 5H8FB 3RPLA 3PPRA 1IMBA 4F39A 1B9JA 1N0TA 1FJ6A 1B7ZA 5LDZA 4LP2B 1LB9A 4HCWA 3LV0A 1H43A 3G3KA 3CRBA 2DWHA 3D4CA 2NVUB 2DYXA 3LUYA 1FTMA 1Y4TA 2V3TA 1PEBA 4PFIA 4NF4B 1MXXA 3SEWA 3TTLA 2XXQA 1URGA 2O68A 3GBAA 5IZ1A 3G3FA 4DCYA 1QVSA 3KJ7A 1PB8A 2UVJA 2Y7KA 3SESA 1MG1A 2Q9TA 4DI4B 1Y20A 1TWYA 2DE2A 2CZIA 4XF5A 4POWA 2P0SA 2I4BA 2LAOA 2QFLA 2I4CA 2XHDA 2RCBA 3LSXA 4OEUA 3OO7A 1Z7NE 4FE8A 3E13X 2OWTA 1BK4A 1US5A 4NQ8A 1A40A 4QSDA 4MLQA 4L17A 2Y5LA 1B5HA 3BIGA 1IMDA 3IL1B 1FBHA 2O7IA 3OEMA 1FPDA 1H45A 1B46A 1F9BA 4P0GA 4X04A 3SERA 3VDFA 3MZ9A 2GQ1A 4TQUQ 4P9KA 1DPPA 4GWOA 2D3IA 2HQ0A 1IUDA 5FTIA 1MDQA 3MYUA 3B50A 4GL0A 1SVXB 1NUXA 1QKAA 4HCYA 1DPEA 1NUWA 1DOTA 1YYZA 5ESYA 5IGAA 2BJJX 1JP4A 1ZKBA 4F3SA 1UTHA 4U4XA 3HPIA 3WAEA 5J16A 2O1LA 1FTKA 3BBRA 2CEXA 4U1OA 3TTRA 4LN5A 4R6YA 4NAPA 3GXAA 4PF8A 3K6XA 1N3XA 3T1BA 1B5IA 1JEUA 1QGXA 4DXUA 4KYSA 4YU0A 2OWZA 2PFYA 4DE8A 3QMFA 3E79A 1ZTYA 3QSLA 2WYPA 3OEKA 3H06B 3EPEA 2PX1A 3CSBA 1PDAA 1G0IA 3K01A 4X48A 5ISUA 4OTEA 3U65A 3UN6A 2VPNA 1AH5A 3K1MA 2ONRA 2F34A 2Y7IA 1HSEA 1NV4A 5KZTA 4AS4A 2WBDA 1B3FA 1ZMGA 1DTGA 4LATA 4PFRA 3KG2A 3C32A 2QL3A 3PD8A 4PE5B 1MY0A 4GWXA 2QS2A 4OWDA 1N7WA 3FXBA 4F19A 1P1NA 4G8MA 5CRYA 1FRPA 4G77A 3CI8A 2RC8A 1WDNA 3EN3A 3VXBA 4BLAA 3FVOA 4OFJA 3B7DA 3K6WA 2G93A 1JW4A 3C36A 2Z8EA 2I0BA 1SI1A 4PAFA 2R71A 4NN3A 3SETA 1QUIA 1B32A 1B51A 3PUXE 4LUBA 2V4CA 3TQLA 1OQGA 4Q5TA 4P3LA 2VD2A 4OYVA 3RLFE 5CM6A 3VXCA 2UVGA 2ZYKA 5JK4A 1EYJA 3CVGA 1BKAA 1QUKA 2AIXA 1MH4A 3OO8A 4AB5A 4YAHX 2D5WA 4GBVA 3UGWA 1SDXA 4O94A 1SW4A 1YPNA 4O7IA 2QS3A 3FXQA 3SEXA 1RKMA 5JEIA 2JJKA 4MCOA 1RYXA 1FBGA 4XXUA 5AE4A 3VLUA 1LBXA 4ZEIA 1LFGA 2I3WA 3GBBA 1JVXA 1TXFA 2Y5KA 2KQZA 1JW1A 4QBAA 3Q27A 4RK9A 1FQDA 1MQJA 3U8QA 3MVWA 1O63A 3IB2A 1PB9A 3H03A 5TU0A 2VHAA 1IXCA 1M5DA 3H3GA 3MUQA 4BDMA 1NUZA 1MY4A 2H4IA 3DP8A 1D4NA 1EZPA 5AA4A 2UYFA 5TPAB 4YMAA 1QW0A 3KJTA 4OFLA 4JBZA 1XC1A 3ODBA 4N13A 1VDWA 1Q35A 1YXIA 4FORA 1AL3A 4THIA 2A5SA 4LZ5A 4MLVA 4P11A 1RYOA 1XVXA 4KCCA 4ZZAA 5K2XA 4MH5A 5AA2A 1GGGA 3RGYA 1FQAA 1LB8A 2OBGA 2P1SA 3MVZA 3HN0A 4XKNA 4KFQA 1KWHA 1AOVA 2XXPA 3MPKA 4F3BA 2NOOA 1VE4A 4GIZA 5F7VA 1M5EA 3HSTA 3IX1A 3C31A 4OEVA 1FBDA 4U23A 1RDXA 4IO3A 2DP8A 3VV5A 2ZNTA 1K9YA 4F22A 5FHMA 4NEDA 2Y7WA 3TQWA 1MQDA 3FVGA 1S9TA 4C1UA 3TFLA 3TUSA 4XEQA 2DQVA 3L6GA 4R72A 4R9FA 2DS9A 4ZDMA 3USDA 4Z0IA 3MP8A 3PUZE 3TTNA 2QS1A 3MVXA 3K6UA 4PE3A 2ESNA 2OK2A 2XWIA 1POTA 1WODA 4ZEKA 1DK4A 4DZ1A 3LSFB 4RA1A 5ET8A 4KCDA 4N07A 2OWSA 2HAVA 4R2FA 4U22A 4JDFA 3EHTA 3FV2A 2THIA 3JZJA 3CG3A 4GOTA 5KCJB 4X1BA 4O3BA 2A5TA 2PYYA 2GHBA 4QF9A 4R73A 3MZBA 1A8FA 4PGPA 5I3SA 4N8GA 1URSA 4H5GA 1L5TA 3KZGA 4OENA 4DLDA 4F3PA 5AA1A 3JV9A 2CMOA 4JWYA 3I5OA 5L9OA 1NV3A 2F3BA 3MW0A 3G3HA 3HV1A 3T93B 3BIHA 4UABA 4OVSA 1Y3PA 5ET5A 2DVZA 1N84A 1FJ9A 1H44A 2O7UA 1IITA 1TFAA 2NXOA 2AL4A 2FA7A 3TDJA 1P1QA 2P3VA 4PC9A 1DTZA 1MPCA 4MNPA 3LBSA 4QFOA 4F29A 5I84A 2IEEA 2Y7RA 5KDTB 1MQGA 2H25A 3UIFA 2I48A 3PUYE 5H8NA 4F18A 1SYHA 2RC9A 1LAHE 4M4GA 1B7UA 3N6UA 3KBZA 5EHSA 2UVIA 2F7CA 5EYFA 5A5LA 1FQEA 4DDDA 4I40A 3L6HA 2GRVA 2VOZA 4YB5A 3TKDA 3FJGA 1MXUA 3LSLA 4NF8B 4FATA 1MY1A 4QFPA 4H65A 4ONYA 1YTVA 5TP9B 2HPGA 2REGA 3QXMA 5H8QB 3D4GA 4UA8A 2PFZA 1NNTA 3RT6B 2F7AA 1GTKA 3VVEA 1FCKA 2X7PA 1AWBA 3G7WA 3IK6B 4GWZA 4BDNA 4R6KA 2XXRA 1ZIUA 2BJIA 3FVNA 1I69A 3BKIB 1B4HA 4RXLA 3T22A 4KYDA 1H3DA 3CFLA 4H0WA 3GZGA 3VVDA 3C9HA 5H8FA 1B2HA 4XIGQ 2WX9A 3IJXB 1MXVA 3FV1A 2RC7A 4ZECA 2YJPA 3M3FA 3PMVA 3FD3A 4N8YA 1FBEA 2QMWA 4EF2A 2ZNUA 4FEDA 1SYIA 5CMBA 4LQ5A 1TFDA 3MZ1A 2F36A 3T9XB 1AIVA 1VSOA 2YLNA 1UTBB 3TELA 3ZS6A 1D9VA 2GH9A 2FIEA 1BP5A 3IB1A 4JVDA 1YCJA 4OHNA 1PB7A 3RQTA 1B05A 3I6VA 4GWUA 5TPAA 1D3KA 3HCQA 5EQAA 3S4UA 4NGUA 4GWSA 3O6IA 1GVCA 3IOUA 2FYIA 2O69A 2ZMBA 4XKPA 2B4MA 3OD7A 4GVOA 1R6ZA 5CC2A 3LUZA 4TLLB 2DWAA 2VD3A 5EQ7A 5EQ9A 3V8XB 1FTAA 2FHYA 3FBPA 4H45A 3RPLB 2ANJA 4ECFA 5M2VA 2F5XA 4RPOA 3W15C 4JWOA 1I6BA 2QVVA 3U92A 5I2NB 2D21A 3RY3A 4QFLA 4PP0A 1BTJA 3MPLA 3O9PA 3PMXA 1NNPA 1OLAA 4HS7A 1NMUA 3CFXA 4ND9A 3T66A 1LAXA 2I3VA 3H7MA 5FHOA 3KC1A 2Q8JA 5LOMA 1Y1MA 1ZLQA 5IZ3B 5B70A 2M8CA 1B0HA 3AXFA 4OERA 4YKPA 3ONMA 5DTBA 4F2QA 1QULA 4RNSA 1RDZA 3CIJA 2QRYA 4BDOA 1MQIA 4H1XA 3KOSA 1YAEA 5HPQA 2PMSA 1NNKA 1INPA 3QYTA 3IOVA 5KDTA 5ICQA 2F6PA 3DP4A 3KBRA 3ECRA 5H8NB 2H99A 4N17A 1ANFA 1FPGA 3KN7A 3MVYA 4X8RA 3UORA 3LC8A 3THIA 1A55A 3LR1A 5K2YA 2O51A 3T9HB 3U94A 3SKPA 2O1MA 3RYDA 4G68B 4MMPA 3O2AA 3ZKLA 1I6AA 3TTMA 1XI6A 4YKJA 2WEFA 3S2VA 3VLWA 2OJTA 1ZBMA 2XD2A 1XS5A 1LAFE 4N6PA 1IEJA 1MM6A 1EYKA 4GL8A 4BDLA 3CR9A 2YPNA 3R6UA 4EQ7A 1B1XA 5DT6A 4GXSB 3W9VA 1OMPA 3IORA 2V3QA 1USYH 1QKBA 2G29A 5CMMA 1FQBA 1LLSA 3E4RA 4G4PA 4U2RA 2FBPA 1LBWA 2V84A 1WVJA 4JXIA 2E0SA 2A5TB 4EXLA 2Q2AA 3U93A 5J1DA 3RNNA 1OLCA 4GX3A 4PFUA 1UIUA 3PPNA 4PDDA 5KCJA 1IZ1A 4NF8A 4YZZA 2QMXA 3DM0A 4IO7A 3RUMA 2HZLA 1FTJA 2DXRA 3SDFA 4Q30B 4G61A 1QJMA 1EZ9A 4GRKA 4NF0A 5EYHA 4Z7EA 2B4LA 3R7XA 1FPKA 3PMWA 4E0WA 3B6TA 2CZHA 1R9QA 2HAUA 3OELA 2REJA 5L8DA 4YB7A 2X26A 1SW1A 1UIVA 1VR5A 4NF5B 4OA4A 4KHZE 3O97A 4NMYA 3K0VA 4OANA 3CSGA 5ELVA 5JTYA 1T0KA 5DVIA 1P99A 5B7DA 4RPNA 1LBYA 1MXZA 1POY1 3H4ZA 5FBPA 3UK4A 3PD9A 1IXHA 3OOAA 3KN8A 4YMBA 2UXAA 3LSWA 2XXVA 3KOTA 4DIGA 4GD5A 4PBHA 4M1VA 4QRZA 4WXJA 5AA2B 3RN8A 1UQWA 3O29A 3IB0A 2DSFA 3FUZA 5AA2D 5I57B 3HHFA 3A29A 5L9SA 4Q0CA 2F97A 1MM7A 3K1PA 4QXDA 2DVCA 1JVYA 4XKRA 4OMBA 5EHMA 1PBPA 3E9XA 2IA4A 4KYEA 1K9ZA 1B3HA 1VFDA 3P7IA 3OSRA 1MY3A 4PAKA 4ZS9A 4EQBA 3G3JA 3ILUB 5ITOA 3DELB 4MX6A 3TCFA 3RPWA 4XFEA 4KI0E 3SEVA 4PCDA 1II5A 1VFEA 2MKZA 3KSJA 4JSOA 5H8HB 2F78A 1M5FA 3QIMA 4IGRA 4KD5A 4NF4A 4OFOA 2NUVA 4HE2A 4MEVA 4GBWA 4AS5A 1OQHA 4G8NA 4FBPA 4MNIA 1MS7A 4BDQA 3PPOA 4LA9A 1LSTA 1MXWA 5CBRA 3Q28A 5ET7A 2DOJA 4QSCA 3KSXA 3M3LA 3PPQA 3TPAA 4BDRA 5I5PA 1KZ8A 4N15A 4KXPA 4LQ2A 4H6DA 2Z23A 1A54A 4TLMB 2L5VA 1IXGA 3MAMA 3TODA 1NV2A 4KPTA 2HZKA 1GV8A 5A5XA 2OCUA 1RDYA 2PVUA 3PPPA 4H8IA 1DMBA 4F3GA 1ZJLA 4FEBA 3TAJA 2X7QA 4DCXA 5IKBA 2RCAA 2CEYA 4H46A 4FAJA 3OO6A 1MRPA 4EXKA 4ELPA 4IY5A 4I3YA 3K02A 3QK6A 2Q2CA 1PBQA 4WEPA 4K3FA 2DE3A 3U1OA 1XOCA 2QJEA 4PTKA 5ITPA 5CMKA 4IGTA 2XX8A 1LCTA 3MQ9A 2Y84A 5I2NA 4MBPA 3TYHA 3QUJA 3OXNA 1GR2A 1QUJA 2QS4A 2NWJA 2XXYA 2KR0A 3RTFB 3N5LA 3EQ1A 1SW2A 5H8HA 3ILTB 4ELOA 4DXCA 3EHUA 3OENA 2XXHA 1FPFA 2F8DA 2I6EA 1B1HA 4PBQA 1P1WA 4YKKA 4N4UA 3EHSA 2Q89A 4ESXA 1Z7ME 4GF8A 1B6HA 5I2KB 5H8QA 3VFJA 2HXWA 1FSAA 1LFHA 5DEXB 2HHMA 4F31B 1FPIA 3IOWA 4I62A 3V83A 4NE4A 4QFNA 1LBCA 3N26A 3NOHA 4NWDA 2E1SA 4G2ZA 4R9GA 3S9EA 3QUFA 4JVIA 3C34A 4P8BA 4NX1A 4OETA 5IZZA 5L9MA 1XT8A 3KGCA 3MC2A 4JB7A 1NV0A 4YICA 2R6GE 1URDA 2XXWA 5HM4B 4YKIA 4H5FA 3RTWB 2AYSA 2UVHA 2PCRA 1IXIA 1NUYA 3OO9A 4MFIA 5CI5A 4IO4A 4N6KA 4F2OA 1JW5A 1LCFA 5H8SA 2HCAA 4XKQA 4KQPA 1FPEA 3HHGA 4I8CA 1O7TA 2F3DA 4H8JA 3N94A 4WKMA 3A3CA 1MY2A 1P1UA 3WAFA 3K4UA 3TCHA 1B3EA 1B4ZA 3O6GA 1NH8A 3V5AA 1N7XA 3M8UA 4ZE8A 4JSDA 1NV5A 1MXYA 3Q25A 4U1ZA 1US4A 4N6DA 4R6HA 4OVJA 1EYIA 4FJPA 1A8EA 2QSXA 3M3KA 3B6QA 3KEIA 2DDKA 2WKYA 2VPOA 4NF6A 4ELRA 3DLNA 1M5BA 4H67A 2DXYA 4GXAA 1NV1A 5I56B 2W7YA 1Y1ZA 4OQOA 1NV7A 1Y3QA 4HXVA 1AMFA 5AA3A 4G68A 1XHYA 5CMCA 3FATA 1KA0A 1KA1A 2P2AA 4I1DA 3O28A 3IO6A 4QFKA 1G0HA 4GX6A 3GLBA 5I58B 4P56A 2ZYNA 4G8HA 3C35A 4PFBA 3O6HA 1EH3A 1IMEA 2B3BA 5JTYB 1SBPA 1A99A 4N91A 1UTBA 1LFIA 2V3UA 4ZE9A 4ZEBA 3K00A 1Y4CA 1B3LA 4IO5A 2FNCA 2XWVA 4MNCA 1JETA 1MH3A 4I3EA 2XWOA 1B0LA 3ROJA 4X1DA 4R74A 3F11A 5LTCA 4GX4A 3R26A 2Z8DA 4NHBA 4ELQA 1B40A 1LBVA 3E3KA 2XA5A 1FPLA 3A3UA 1JQFA 4RY1A 4IO2A 4IO6A 2XX7A 1IQ7A 3OSQA 1NL5A 3FXRA 4PFTA 1SI0A 1N76A 1MDP1 3O66A 1LBBA 2ALUA 5I56A 2GHAA 3KFMA 3Q29A 1ZU0A 1NNFA 1M5CA 2O6AA 3EF7A 4HTGA 5T3JA 4PDHA 1IMAA 3EKIA 1B7HA 3D1RA 4GWWA 1IIWA 2VT5A 3IO4A 3VLVA 4R2BA 4LVQA 3PU5A 5I7IA 1I6QA 4NTLA 3TZAA 5FTHA 3SEYA 3RT8A 2FIXA 1XVYA 1FW0A 1MQHA 3K6VA 2XD3A 2ONSA 3Q26A 3V89B 4Q8RA 4RK2A 4ESWA 4I9DA 2B65A 2Z22A 1ATGA 4NG7A 4F1VA 2QPQA 4GQOA 1R9LA 1YZ0A 4OVQA 3TCGA 1LBZA 4POXA 4PETA 2ZNSA 2DWIA 3W9WA 5HBCA 4U21A 4ZEFA 1FQFA 2R9JA 1SPIA 3TEPA 2RINA 2PT2A 4F1YA 3G3IA 4LZ7A 5I57A 3MP1A 1MPDA 3G3GA 1LGBC 2H5YA 2F6GA 1SW5A 1Y9UA 2OZZA 3PTYA 2RKMA 1PC3A 3BFTA 3S9LC 3QAXA 5IZ3A 3S9NC 3HFUA 4P47A 1DCUA 2ONKE 3UP9A 1IMCA 2RF1A 3T96B 1BLFA 3H6WA 5IM2A 2OLBA 4EUOA 2B3FA 3ZSFA 3OMBA 4OVRA 2H9BA 2Y7PA 3KN3A 3JYRA 4TOZA 2Q74A 1JNFA 1OVTA 4IR8A 4NF5A 4O3AA 2AL5A 2XX9A 3FASA 4O3CA 4UACA 3FXUA
chains in the Genus database with same CATH topology
2QMWA 5ICTA 2HFBA 5I59B 1HSLA 4JWXA 4EF2A 2ZNUA 2KLFA 3U1OA 1XOCA 3UN6A 2QJEA 1AH5A 4FEDA 1SYIA 3K1MA 1FQCA 5I2KA 2ONRA 5ITPA 4MF3A 5CMBA 2F34A 4LQ5A 5TP9A 5CMKA 1TFDA 2Y7IA 4IGTA 2XX8A 4ZEDA 1HSEA 4G68C 1LCTA 5KZTA 1B3FA 1ZMGA 3MZ1A 2VGQA 1DTGA 3MQ9A 4LATA 2Y84A 4RJZA 5I2NA 2F36A 3PV0E 3T9XB 1TT1A 1AIVA 1VSOA 4MBPA 4C1TA 2YLNA 3KG2A 3TYHA 3C32A 3QUJA 3OXNA 1GR2A 1UTBB 3TELA 1QUJA 3ZS6A 2QL3A 1FTLA 2QS4A 3C4MA 2XXYA 3PD8A 3MJNA 2NWJA 4ESWA 4PE5B 1D9VA 1MY0A 2GH9A 2QS2A 4OWDA 3RTFB 1BP5A 5I59A 1N7WA 1S7YA 3IB1A 3BFUA 3K2DA 3N5LA 1YCJA 4OHNA 1Y3NA 3EQ1A 1SW2A 5H8HA 1PB7A 3THIA 3ILTB 4ELOA 3RQTA 3VE1B 4F19A 1P1NA 4DXCA 1B05A 1SD3A 3EHUA 3I6VA 4G8MA 4XTCQ 3OENA 2XXHA 5CRYA 2Q88A 4G77A 3CI8A 2RC8A 4IY6A 5TPAA 1D3KA 1WDNA 1USYE 3EN3A 3FVOA 3VXBA 2F8DA 3HCQA 3S4UA 2I6EA 4BLAA 4OFJA 3B7DA 1JEVA 3K6WA 2G93A 3PUWE 1B1HA 1JW4A 3T9VA 2ZXTA 1UTHB 1P1WA 3O6IA 4YKKA 4ZZEA 3C36A 2Z8EA 2Q89A 3EHSA 4IB2A 1GVCA 4ESXA 3IOUA 4FIMA 2FYIA 2O69A 1Z7ME 2I0BA 1SI1A 4NWCA 3PGFA 4C0RA 2ZMBA 2R71A 4GF8A 4XKPA 1B6HA 3OD7A 4GVOA 1R6ZA 5I2KB 4TLLB 5H8QA 3SETA 5CC2A 3VFJA 3H6VA 2DWAA 1B3GA 2HXWA 2VD3A 1HSJA 1QUIA 1B32A 2V25A 1B51A 3V8XB 3PUXE 4LONB 1LFHA 1S50A 4LUBA 2XXIA 5DEXB 3TQLA 1OQGA 2ANJA 3PUVE 4ECFA 3IJOB 4Q5TA 5DYHA 5M2VA 2F5XA 4RPOA 2F35A 4F31B 2VD2A 4OYVA 3RLFE 1OIBA 3W15C 4JWOA 3FJ7A 5CM6A 2UYEA 3IOWA 4I62A 3VXCA 2UVGA 2ZYKA 2ABHA 4PFWA 4E0XA 5JK4A 3V83A 3CVGA 1ELJA 1BKAA 1QUKA 1I6BA 4NE4A 4F1UA 2AIXA 3U92A 1MH4A 2XXUA 3OO8A 2D21A 1LBCA 4QFNA 3RY3A 3N26A 4QFLA 4AB5A 5I2NB 4NWDA 4YAHX 4PP0A 2D5WA 5IAIA 1BTJA 2E1SA 4G2ZA 4R9GA 3S9EA 4RYAA 1EZOA 3UGWA 3QUFA 4F2QA 1SDXA 4AQ4A 3MPLA 1SW4A 3C34A 1NNPA 1OLAA 1YPNA 3O9PA 3PMXA 4HS7A 4OETA 1NMUA 2QS3A 1XT8A 3CFXA 4ND9A 5L9MA 3T66A 1LAXA 3KGCA 3MC2A 1FTOA 3TTKA 2I3VA 3FXQA 3H7MA 3MP6A 4JB7A 5FHOA 3SEXA 5HM4B 3U72A 2Q8JA 5LOMA 1RKMA 1Y1MA 4X9TA 5JEIA 4YICA 2R6GE 1RYXA 3T9UA 1URDA 1ZLQA 4OXVA 4NF6B 5B70A 2M8CA 2XXWA 4XXUA 4R75A 5AE4A 1B0HA 3AXFA 3VLUA 4OERA 2PBWA 4ZEIA 5AA4B 4YB6A 1LFGA 2I3WA 4GLIA 4YKPA 3ONMA 3GBBA 5DTBA 1JVXA 1N3WA 4QSEA 1TXFA 4YKIA 1QULA 4H5FA 4RNSA 3RTWB 2CZLA 3A09A 5DVFA 3CG1A 2AYSA 4HW8A 1NH7A 3CIJA 2UVHA 2QRYA 5FHNA 4BDOA 1MQIA 1IXIA 1JW1A 4H1XA 3KOSA 1YAEA 3Q27A 4RK9A 5HPQA 1FQDA 5BWJA 1MQJA 2PMSA 2XXTA 3OO9A 4MFIA 3U8QA 3FJMA 3MVWA 1NNKA 1O63A 3IB2A 1PB9A 3CFZA 1SQYA 3QYTA 5CI5A 3IOVA 4AB6A 3H03A 4IO4A 5TU0A 5KDTA 5ICQA 4F2OA 1JW5A 1LCFA 2VHAA 1IXCA 1M5DA 4GFRA 5H8SA 2F6PA 3H3GA 3DP4A 1MPBA 3ECRA 2ZYOA 3KBRA 3MUQA 4U4SA 5H8NB 1P1OA 4BDMA 2H99A 3IAZA 3FIRA 3FVKA 2HCAA 1MY4A 1B52A 4EDPA 1ANFA 4XKQA 2H4IA 4KQPA 3KN7A 3HHGA 3DP8A 3MVYA 4I8CA 4EQ9A 1O7TA 2XXXA 1D4NA 3UORA 1EZPA 3LC8A 3K1NA 2UYFA 4H8JA 2ZYMA 3N94A 4WKMA 1A55A 3A3CA 5TPAB 3LR1A 5K2YA 3MBPA 4YMAA 1QW0A 2O51A 3T9HB 4EF1A 1MY2A 1P1UA 3KJTA 4OFLA 3I3VA 4JBZA 3SKPA 3K4UA 3U94A 3WAFA 1XC1A 2O1MA 3TCHA 3ODBA 1O64A 1B3EA 1B4ZA 3N6TA 4N13A 2I0CA 4G68B 3O6GA 5BUUA 1Q35A 4THIA 1NH8A 1AL3A 4FORA 3V5AA 2A5SA 1N7XA 4WEDA 3O2AA 5EHSA 4LZ5A 4MLVA 3M8UA 3UA8A 1I6AA 4ZE8A 3ZKLA 4P11A 4OTEA 4JSDA 1A7LA 1R1NA 1D9YA 1MXYA 3TTMA 1Q1KA 2O84X 3Q25A 4YKJA 3S2VA 3VLWA 2OJTA 3C33A 1ZBMA 1RYOA 1EU8A 2XD2A 4U1ZA 3S9MC 1XS5A 4OZ9A 1LAFE 1US4A 3H6UA 4N6PA 1H76A 1B5JA 1IEJA 1MM6A 1XVXA 4OVJA 4R6HA 4KCCA 4ZZAA 1DSNA 4GL8A 4QHQA 4FJPA 4PQJA 5AA4A 1A8EA 2QSXA 3M3KA 3CR9A 2YPNA 3R6UA 5K2XA 4MH5A 4BDLA 4EQ7A 3B6QA 1LAGE 1B1XA 5DT6A 4GXSB 4LZ8A 5AA2A 3KEIA 1GGGA 3W9VA 3RGYA 1FQAA 1OMPA 2WKYA 4RK2A 1LB8A 2OBGA 2DE4A 2P1SA 3IORA 3HN0A 3MVZA 4XKNA 4KFQA 2V3QA 4NF6A 1USYH 1KWHA 1QKBA 2G29A 3B6WA 5CMMA 3DLNA 3FZVA 4DXBA 4ELRA 1AOVA 2XXPA 3TMGA 1M5BA 4H67A 3MPKA 2V93A 2DXYA 1FQBA 1LLSA 4F3BA 2NOOA 1NFTA 3E4RA 4G4PA 1VE4A 3IOTA 4GXAA 4U2RA 2V84A 4GIZA 5I56B 5F7VA 1M5EA 2W7YA 1WVJA 3HSTA 1Y1ZA 3C31A 2I58A 2E0SA 3IX1A 1NKXA 4JXIA 4OEVA 4OQOA 3ZKKA 1Y3QA 4U23A 2GFEA 2A5TB 4EXLA 2Q2AA 3U93A 5J1DA 4ISUA 3RNNA 4IO3A 1OLCA 4PFYA 2DP8A 2DWJA 2ZNTA 3VV5A 5CBSA 2H98A 1CE2A 4PFUA 1UIUA 3PPNA 1AMFA 2HEUA 5AA3A 5KCJA 3HO7A 1IZ1A 4NF8A 4YZZA 4G68A 1XHYA 5CMCA 4F22A 5FHMA 3FATA 4NEDA 3H6TA 2QMXA 1CB6A 1B58A 2Y7WA 3TQWA 1MQDA 3DM0A 2P2AA 3FVGA 4I1DA 1BIYA 5DVJA 3O28A 4IO7A 1S9TA 3IO6A 4QFKA 4C1UA 4OESA 3RUMA 3TFLA 2HZLA 3GLBA 5I58B 1FTJA 2DXRA 2DQVA 3L6GA 3TUSA 3IR1A 4R72A 3SDFA 4Q30B 4R9FA 2DS9A 4ZDMA 2ZYNA 4KR5A 3USDA 5A5XB 5DEXA 4Z0IA 1QJMA 3MP8A 4G8HA 3C35A 1N04A 3PUZE 1EZ9A 3TTNA 2I49A 4GRKA 2QS1A 3MVXA 4Z7EA 3K6UA 2ESNA 2OK2A 3O6HA 3PMWA 1EH3A 3R7XA 4E0WA 2B3BA 1POTA 1WODA 3B6TA 3FGSA 4ZEKA 4P0IA 1SBPA 5JTYB 4DZ1A 1R9QA 2HAUA 3LSFB 1J1NA 4FECA 1A99A 3OELA 1UTBA 4RA1A 5F1QA 2REJA 2Z8FA 1LFIA 2VP1A 4KCDA 4N07A 5L8DA 2F7BA 2OWSA 2PT1A 2V3UA 4YB7A 3MWBA 3SEUA 2X26A 4ZEBA 2HAVA 3DP6A 3K00A 1SW1A 4ZE9A 1OVBA 5I58A 1Y4CA 4R2FA 4U22A 4JDFA 1B3LA 1UIVA 3EHTA 1VR5A 2FNCA 4IO5A 4NF5B 3VVFA 1JETA 2THIA 3FV2A 4KHZE 1MH3A 5H8FB 3JZJA 3O97A 3CG3A 4NMYA 3K0VA 3PPRA 4GOTA 3CSGA 5ELVA 5JTYA 1B0LA 4F39A 1B9JA 5DVIA 5KCJB 1N0TA 1P99A 1T0KA 5B7DA 4RPNA 1B7ZA 4X1DA 1MXZA 4LP2B 1POY1 3H4ZA 4O3BA 4X1BA 1LB9A 2A5TA 2PYYA 2GHBA 4QF9A 3F11A 4HCWA 4R73A 3PD9A 1IXHA 1H43A 4R74A 3MZBA 1A8FA 3G3KA 3R26A 3UK4A 3CRBA 2DWHA 3OOAA 2Z8DA 3KN8A 3D4CA 4YMBA 2NVUB 4ELQA 1URSA 4H5GA 2UXAA 3LSWA 2DYXA 2XXVA 1B40A 1L5TA 3LUYA 3KZGA 4OENA 1FTMA 4DLDA 3KOTA 3E3KA 4F3PA 5AA1A 1Y4TA 2V3TA 1PEBA 3A3UA 4GD5A 1JQFA 4DIGA 3JV9A 2CMOA 4RY1A 4IO2A 4JWYA 4M1VA 4QRZA 4NF4B 3I5OA 5L9OA 4WXJA 3MW0A 4IO6A 3G3HA 3HV1A 2XX7A 3RN8A 3T93B 1UQWA 5AA2B 1MXXA 1IQ7A 3OSQA 3SEWA 1NL5A 3O29A 3TTLA 3FXRA 3IB0A 2DSFA 2XXQA 1Y3PA 3FUZA 4PFTA 5AA2D 5I57B 1URGA 2O68A 3GBAA 3HHFA 2DVZA 1N84A 3G3FA 5L9SA 1SI0A 1N76A 1QVSA 1PB8A 3KJ7A 4DCYA 1H44A 1MDP1 2O7UA 3O66A 4Q0CA 1LBBA 2ALUA 2F97A 2UVJA 2Y7KA 3SESA 5I56A 2GHAA 1MM7A 1IITA 1MG1A 1TFAA 3K1PA 2Q9TA 2NXOA 1Y20A 3KFMA 2DVCA 3Q29A 2AL4A 1JVYA 2FA7A 4XKRA 1P1QA 1TWYA 1ZU0A 2DE2A 4OMBA 5EHMA 3TDJA 1NNFA 1PBPA 1M5CA 4POWA 2O6AA 2I4BA 2LAOA 2P0SA 3EF7A 4HTGA 2I4CA 3E9XA 2IA4A 2XHDA 4KYEA 1DTZA 2RCBA 1B7HA 1MPCA 3LSXA 4OEUA 3OO7A 1Z7NE 4FE8A 1IIWA 3LBSA 1B3HA 4QFOA 1VFDA 3E13X 3IO4A 3P7IA 4R2BA 3VLVA 4F29A 5I84A 3OSRA 1MY3A 2IEEA 4LVQA 2Y7RA 3PU5A 2OWTA 1I6QA 4ZS9A 3G3JA 1US5A 3ILUB 4NTLA 3TZAA 4EQBA 1A40A 5ITOA 3DELB 5KDTB 1MQGA 2H25A 5FTHA 3RPWA 4QSDA 3RT8A 4MLQA 1XVYA 1FW0A 3SEYA 2I48A 3PUYE 3UIFA 4KI0E 4L17A 5H8NA 4F18A 1SYHA 2RC9A 1LAHE 1MQHA 4M4GA 3K6VA 2XD3A 1B7UA 1B5HA 2ONSA 3Q26A 1II5A 1VFEA 3KSJA 3SEVA 3V89B 3N6UA 4JSOA 4Q8RA 5H8HB 2F78A 1M5FA 3IL1B 3QIMA 4I9DA 3OEMA 2O7IA 4IGRA 2B65A 2Z22A 1ATGA 2UVIA 1H45A 2F7CA 4KD5A 5EYFA 4F1VA 1FQEA 4DDDA 4NF4A 1B46A 1F9BA 2NUVA 3L6HA 4OFOA 4P0GA 2QPQA 4GQOA 2GRVA 2VOZA 3SERA 3VDFA 4YB5A 3MZ9A 1R9LA 3TCGA 3FJGA 3TKDA 1MXUA 4TQUQ 1OQHA 3LSLA 4G8NA 4NF8B 4POXA 4FATA 4PETA 1MY1A 1DPPA 4GWOA 2D3IA 1MS7A 4BDQA 2HQ0A 2DWIA 2ZNSA 3PPOA 1IUDA 4QFPA 3W9WA 5FTIA 5HBCA 4LA9A 4U21A 1FQFA 1MDQA 4H65A 4ONYA 4ZEFA 2R9JA 1LSTA 1MXWA 1YTVA 4GL0A 5TP9B 3Q28A 5CBRA 1SVXB 2RINA 3TEPA 2DOJA 1QKAA 2PT2A 3KSXA 3M3LA 4QSCA 4F1YA 2REGA 3QXMA 3G3IA 4LZ7A 4HCYA 3D4GA 5H8QB 1DPEA 4UA8A 3PPQA 3TPAA 4BDRA 1DOTA 5I57A 3MP1A 1NNTA 1MPDA 3G3GA 1LGBC 2H5YA 4LQ2A 2F6GA 2BJJX 1SW5A 3RT6B 4H6DA 1ZKBA 1Y9UA 2F7AA 2OZZA 2Z23A 4F3SA 1A54A 1UTHA 4U4XA 4TLMB 1GTKA 3HPIA 3WAEA 2RKMA 2O1LA 1PC3A 3VVEA 1FCKA 3BFTA 3S9LC 2X7PA 3QAXA 1IXGA 1FTKA 3MAMA 3BBRA 3G7WA 3IK6B 3TODA 4U1OA 4BDNA 4R6KA 4KPTA 3S9NC 3TTRA 4R6YA 2XXRA 1ZIUA 2HZKA 2ONKE 3FVNA 3GXAA 1I69A 2RF1A 3BKIB 1GV8A 3UP9A 3T96B 1BLFA 1B4HA 3H6WA 4RXLA 5A5XA 3T22A 3K6XA 4KYDA 2OCUA 1H3DA 3TCFA 2OLBA 1N3XA 3CFLA 4EUOA 1B5IA 1JEUA 2B3FA 2PVUA 4H0WA 4DXUA 3ZSFA 3GZGA 3VVDA 3PPPA 3OMBA 4H8IA 1DMBA 4F3GA 1ZJLA 2H9BA 4FEBA 3C9HA 3TAJA 4KYSA 4YU0A 2Y7PA 2X7QA 3KN3A 4DE8A 4DCXA 5H8FA 1B2HA 1ZTYA 3JYRA 4TOZA 4XIGQ 3IJXB 3QSLA 1MXVA 1JNFA 1OVTA 2RCAA 3FV1A 3OEKA 4NF5A 5IKBA 4O3AA 4FAJA 3H06B 2RC7A 3EPEA 3OO6A 2AL5A 2PX1A 3CSBA 1PDAA 1MRPA 2XX9A 2YJPA 4ZECA 4EXKA 4ELPA 3FASA 3M3FA 4IY5A 4O3CA 4UACA 3FXUA 3K02A 3K01A 3QK6A 4X48A 2Q2CA 1PBQA 5ISUA 3PMVA 4WEPA 3FD3A 4K3FA 2DE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QMW A;  5ICT A;  2HFB A;  5I59 B;  1HSL A;  4JWX A;  4EF2 A;  2ZNU A;  2KLF A;  3U1O A;  1XOC A;  3UN6 A;  2QJE A;  1AH5 A;  4FED A;  1SYI A;  3K1M A;  1FQC A;  5I2K A;  2ONR A;  5ITP A;  4MF3 A;  5CMB A;  2F34 A;  4LQ5 A;  5TP9 A;  5CMK A;  1TFD A;  2Y7I A;  4IGT A;  2XX8 A;  4ZED A;  1HSE A;  4G68 C;  1LCT A;  5KZT A;  1B3F A;  1ZMG A;  3MZ1 A;  2VGQ A;  1DTG A;  3MQ9 A;  4LAT A;  2Y84 A;  4RJZ A;  5I2N A;  2F36 A;  3PV0 E;  3T9X B;  1TT1 A;  1AIV A;  1VSO A;  4MBP A;  4C1T A;  2YLN A;  3KG2 A;  3TYH A;  3C32 A;  3QUJ A;  3OXN A;  1GR2 A;  1UTB B;  3TEL A;  1QUJ A;  3ZS6 A;  2QL3 A;  1FTL A;  2QS4 A;  3C4M A;  2XXY A;  3PD8 A;  3MJN A;  2NWJ A;  4ESW A;  4PE5 B;  1D9V A;  1MY0 A;  2GH9 A;  2QS2 A;  4OWD A;  3RTF B;  1BP5 A;  5I59 A;  1N7W A;  1S7Y A;  3IB1 A;  3BFU A;  3K2D A;  3N5L A;  1YCJ A;  4OHN A;  1Y3N A;  3EQ1 A;  1SW2 A;  5H8H A;  1PB7 A;  3THI A;  3ILT B;  4ELO A;  3RQT A;  3VE1 B;  4F19 A;  1P1N A;  4DXC A;  1B05 A;  1SD3 A;  3EHU A;  3I6V A;  4G8M A;  4XTC Q;  3OEN A;  2XXH A;  5CRY A;  2Q88 A;  4G77 A;  3CI8 A;  2RC8 A;  4IY6 A;  5TPA A;  1D3K A;  1WDN A;  1USY E;  3EN3 A;  3FVO A;  3VXB A;  2F8D A;  3HCQ A;  3S4U A;  2I6E A;  4BLA A;  4OFJ A;  3B7D A;  1JEV A;  3K6W A;  2G93 A;  3PUW E;  1B1H A;  1JW4 A;  3T9V A;  2ZXT A;  1UTH B;  1P1W A;  3O6I A;  4YKK A;  4ZZE A;  3C36 A;  2Z8E A;  2Q89 A;  3EHS A;  4IB2 A;  1GVC A;  4ESX A;  3IOU A;  4FIM A;  2FYI A;  2O69 A;  1Z7M E;  2I0B A;  1SI1 A;  4NWC A;  3PGF A;  4C0R A;  2ZMB A;  2R71 A;  4GF8 A;  4XKP A;  1B6H A;  3OD7 A;  4GVO A;  1R6Z A;  5I2K B;  4TLL B;  5H8Q A;  3SET A;  5CC2 A;  3VFJ A;  3H6V A;  2DWA A;  1B3G A;  2HXW A;  2VD3 A;  1HSJ A;  1QUI A;  1B32 A;  2V25 A;  1B51 A;  3V8X B;  3PUX E;  4LON B;  1LFH A;  1S50 A;  4LUB A;  2XXI A;  5DEX B;  3TQL A;  1OQG A;  2ANJ A;  3PUV E;  4ECF A;  3IJO B;  4Q5T A;  5DYH A;  5M2V A;  2F5X A;  4RPO A;  2F35 A;  4F31 B;  2VD2 A;  4OYV A;  3RLF E;  1OIB A;  3W15 C;  4JWO A;  3FJ7 A;  5CM6 A;  2UYE A;  3IOW A;  4I62 A;  3VXC A;  2UVG A;  2ZYK A;  2ABH A;  4PFW A;  4E0X A;  5JK4 A;  3V83 A;  3CVG A;  1ELJ A;  1BKA A;  1QUK A;  1I6B A;  4NE4 A;  4F1U A;  2AIX A;  3U92 A;  1MH4 A;  2XXU A;  3OO8 A;  2D21 A;  1LBC A;  4QFN A;  3RY3 A;  3N26 A;  4QFL A;  4AB5 A;  5I2N B;  4NWD A;  4YAH X;  4PP0 A;  2D5W A;  5IAI A;  1BTJ A;  2E1S A;  4G2Z A;  4R9G A;  3S9E A;  4RYA A;  1EZO A;  3UGW A;  3QUF A;  4F2Q A;  1SDX A;  4AQ4 A;  3MPL A;  1SW4 A;  3C34 A;  1NNP A;  1OLA A;  1YPN A;  3O9P A;  3PMX A;  4HS7 A;  4OET A;  1NMU A;  2QS3 A;  1XT8 A;  3CFX A;  4ND9 A;  5L9M A;  3T66 A;  1LAX A;  3KGC A;  3MC2 A;  1FTO A;  3TTK A;  2I3V A;  3FXQ A;  3H7M A;  3MP6 A;  4JB7 A;  5FHO A;  3SEX A;  5HM4 B;  3U72 A;  2Q8J A;  5LOM A;  1RKM A;  1Y1M A;  4X9T A;  5JEI A;  4YIC A;  2R6G E;  1RYX A;  3T9U A;  1URD A;  1ZLQ A;  4OXV A;  4NF6 B;  5B70 A;  2M8C A;  2XXW A;  4XXU A;  4R75 A;  5AE4 A;  1B0H A;  3AXF A;  3VLU A;  4OER A;  2PBW A;  4ZEI A;  5AA4 B;  4YB6 A;  1LFG A;  2I3W A;  4GLI A;  4YKP A;  3ONM A;  3GBB A;  5DTB A;  1JVX A;  1N3W A;  4QSE A;  1TXF A;  4YKI A;  1QUL A;  4H5F A;  4RNS A;  3RTW B;  2CZL A;  3A09 A;  5DVF A;  3CG1 A;  2AYS A;  4HW8 A;  1NH7 A;  3CIJ A;  2UVH A;  2QRY A;  5FHN A;  4BDO A;  1MQI A;  1IXI A;  1JW1 A;  4H1X A;  3KOS A;  1YAE A;  3Q27 A;  4RK9 A;  5HPQ A;  1FQD A;  5BWJ A;  1MQJ A;  2PMS A;  2XXT A;  3OO9 A;  4MFI A;  3U8Q A;  3FJM A;  3MVW A;  1NNK A;  1O63 A;  3IB2 A;  1PB9 A;  3CFZ A;  1SQY A;  3QYT A;  5CI5 A;  3IOV A;  4AB6 A;  3H03 A;  4IO4 A;  5TU0 A;  5KDT A;  5ICQ A;  4F2O A;  1JW5 A;  1LCF A;  2VHA A;  1IXC A;  1M5D A;  4GFR A;  5H8S A;  2F6P A;  3H3G A;  3DP4 A;  1MPB A;  3ECR A;  2ZYO A;  3KBR A;  3MUQ A;  4U4S A;  5H8N B;  1P1O A;  4BDM A;  2H99 A;  3IAZ A;  3FIR A;  3FVK A;  2HCA A;  1MY4 A;  1B52 A;  4EDP A;  1ANF A;  4XKQ A;  2H4I A;  4KQP A;  3KN7 A;  3HHG A;  3DP8 A;  3MVY A;  4I8C A;  4EQ9 A;  1O7T A;  2XXX A;  1D4N A;  3UOR A;  1EZP A;  3LC8 A;  3K1N A;  2UYF A;  4H8J A;  2ZYM A;  3N94 A;  4WKM A;  1A55 A;  3A3C A;  5TPA B;  3LR1 A;  5K2Y A;  3MBP A;  4YMA A;  1QW0 A;  2O51 A;  3T9H B;  4EF1 A;  1MY2 A;  1P1U A;  3KJT A;  4OFL A;  3I3V A;  4JBZ A;  3SKP A;  3K4U A;  3U94 A;  3WAF A;  1XC1 A;  2O1M A;  3TCH A;  3ODB A;  1O64 A;  1B3E A;  1B4Z A;  3N6T A;  4N13 A;  2I0C A;  4G68 B;  3O6G A;  5BUU A;  1Q35 A;  4THI A;  1NH8 A;  1AL3 A;  4FOR A;  3V5A A;  2A5S A;  1N7X A;  4WED A;  3O2A A;  5EHS A;  4LZ5 A;  4MLV A;  3M8U A;  3UA8 A;  1I6A A;  4ZE8 A;  3ZKL A;  4P11 A;  4OTE A;  4JSD A;  1A7L A;  1R1N A;  1D9Y A;  1MXY A;  3TTM A;  1Q1K A;  2O84 X;  3Q25 A;  4YKJ A;  3S2V A;  3VLW A;  2OJT A;  3C33 A;  1ZBM A;  1RYO A;  1EU8 A;  2XD2 A;  4U1Z A;  3S9M C;  1XS5 A;  4OZ9 A;  1LAF E;  1US4 A;  3H6U A;  4N6P A;  1H76 A;  1B5J A;  1IEJ A;  1MM6 A;  1XVX A;  4OVJ A;  4R6H A;  4KCC A;  4ZZA A;  1DSN A;  4GL8 A;  4QHQ A;  4FJP A;  4PQJ A;  5AA4 A;  1A8E A;  2QSX A;  3M3K A;  3CR9 A;  2YPN A;  3R6U A;  5K2X A;  4MH5 A;  4BDL A;  4EQ7 A;  3B6Q A;  1LAG E;  1B1X A;  5DT6 A;  4GXS B;  4LZ8 A;  5AA2 A;  3KEI A;  1GGG A;  3W9V A;  3RGY A;  1FQA A;  1OMP A;  2WKY A;  4RK2 A;  1LB8 A;  2OBG A;  2DE4 A;  2P1S A;  3IOR A;  3HN0 A;  3MVZ A;  4XKN A;  4KFQ A;  2V3Q A;  4NF6 A;  1USY H;  1KWH A;  1QKB A;  2G29 A;  3B6W A;  5CMM A;  3DLN A;  3FZV A;  4DXB A;  4ELR A;  1AOV A;  2XXP A;  3TMG A;  1M5B A;  4H67 A;  3MPK A;  2V93 A;  2DXY A;  1FQB A;  1LLS A;  4F3B A;  2NOO A;  1NFT A;  3E4R A;  4G4P A;  1VE4 A;  3IOT A;  4GXA A;  4U2R A;  2V84 A;  4GIZ A;  5I56 B;  5F7V A;  1M5E A;  2W7Y A;  1WVJ A;  3HST A;  1Y1Z A;  3C31 A;  2I58 A;  2E0S A;  3IX1 A;  1NKX A;  4JXI A;  4OEV A;  4OQO A;  3ZKK A;  1Y3Q A;  4U23 A;  2GFE A;  2A5T B;  4EXL A;  2Q2A A;  3U93 A;  5J1D A;  4ISU A;  3RNN A;  4IO3 A;  1OLC A;  4PFY A;  2DP8 A;  2DWJ A;  2ZNT A;  3VV5 A;  5CBS A;  2H98 A;  1CE2 A;  4PFU A;  1UIU A;  3PPN A;  1AMF A;  2HEU A;  5AA3 A;  5KCJ A;  3HO7 A;  1IZ1 A;  4NF8 A;  4YZZ A;  4G68 A;  1XHY A;  5CMC A;  4F22 A;  5FHM A;  3FAT A;  4NED A;  3H6T A;  2QMX A;  1CB6 A;  1B58 A;  2Y7W A;  3TQW A;  1MQD A;  3DM0 A;  2P2A A;  3FVG A;  4I1D A;  1BIY A;  5DVJ A;  3O28 A;  4IO7 A;  1S9T A;  3IO6 A;  4QFK A;  4C1U A;  4OES A;  3RUM A;  3TFL A;  2HZL A;  3GLB A;  5I58 B;  1FTJ A;  2DXR A;  2DQV A;  3L6G A;  3TUS A;  3IR1 A;  4R72 A;  3SDF A;  4Q30 B;  4R9F A;  2DS9 A;  4ZDM A;  2ZYN A;  4KR5 A;  3USD A;  5A5X B;  5DEX A;  4Z0I A;  1QJM A;  3MP8 A;  4G8H A;  3C35 A;  1N04 A;  3PUZ E;  1EZ9 A;  3TTN A;  2I49 A;  4GRK A;  2QS1 A;  3MVX A;  4Z7E A;  3K6U A;  2ESN A;  2OK2 A;  3O6H A;  3PMW A;  1EH3 A;  3R7X A;  4E0W A;  2B3B A;  1POT A;  1WOD A;  3B6T A;  3FGS A;  4ZEK A;  4P0I A;  1SBP A;  5JTY B;  4DZ1 A;  1R9Q A;  2HAU A;  3LSF B;  1J1N A;  4FEC A;  1A99 A;  3OEL A;  1UTB A;  4RA1 A;  5F1Q A;  2REJ A;  2Z8F A;  1LFI A;  2VP1 A;  4KCD A;  4N07 A;  5L8D A;  2F7B A;  2OWS A;  2PT1 A;  2V3U A;  4YB7 A;  3MWB A;  3SEU A;  2X26 A;  4ZEB A;  2HAV A;  3DP6 A;  3K00 A;  1SW1 A;  4ZE9 A;  1OVB A;  5I58 A;  1Y4C A;  4R2F A;  4U22 A;  4JDF A;  1B3L A;  1UIV A;  3EHT A;  1VR5 A;  2FNC A;  4IO5 A;  4NF5 B;  3VVF A;  1JET A;  2THI A;  3FV2 A;  4KHZ E;  1MH3 A;  5H8F B;  3JZJ A;  3O97 A;  3CG3 A;  4NMY A;  3K0V A;  3PPR A;  4GOT A;  3CSG A;  5ELV A;  5JTY A;  1B0L A;  4F39 A;  1B9J A;  5DVI A;  5KCJ B;  1N0T A;  1P99 A;  1T0K A;  5B7D A;  4RPN A;  1B7Z A;  4X1D A;  1MXZ A;  4LP2 B;  1POY 1;  3H4Z A;  4O3B A;  4X1B A;  1LB9 A;  2A5T A;  2PYY A;  2GHB A;  4QF9 A;  3F11 A;  4HCW A;  4R73 A;  3PD9 A;  1IXH A;  1H43 A;  4R74 A;  3MZB A;  1A8F A;  3G3K A;  3R26 A;  3UK4 A;  3CRB A;  2DWH A;  3OOA A;  2Z8D A;  3KN8 A;  3D4C A;  4YMB A;  2NVU B;  4ELQ A;  1URS A;  4H5G A;  2UXA A;  3LSW A;  2DYX A;  2XXV A;  1B40 A;  1L5T A;  3LUY A;  3KZG A;  4OEN A;  1FTM A;  4DLD A;  3KOT A;  3E3K A;  4F3P A;  5AA1 A;  1Y4T A;  2V3T A;  1PEB A;  3A3U A;  4GD5 A;  1JQF A;  4DIG A;  3JV9 A;  2CMO A;  4RY1 A;  4IO2 A;  4JWY A;  4M1V A;  4QRZ A;  4NF4 B;  3I5O A;  5L9O A;  4WXJ A;  3MW0 A;  4IO6 A;  3G3H A;  3HV1 A;  2XX7 A;  3RN8 A;  3T93 B;  1UQW A;  5AA2 B;  1MXX A;  1IQ7 A;  3OSQ A;  3SEW A;  1NL5 A;  3O29 A;  3TTL A;  3FXR A;  3IB0 A;  2DSF A;  2XXQ A;  1Y3P A;  3FUZ A;  4PFT A;  5AA2 D;  5I57 B;  1URG A;  2O68 A;  3GBA A;  3HHF A;  2DVZ A;  1N84 A;  3G3F A;  5L9S A;  1SI0 A;  1N76 A;  1QVS A;  1PB8 A;  3KJ7 A;  4DCY A;  1H44 A;  1MDP 1;  2O7U A;  3O66 A;  4Q0C A;  1LBB A;  2ALU A;  2F97 A;  2UVJ A;  2Y7K A;  3SES A;  5I56 A;  2GHA A;  1MM7 A;  1IIT A;  1MG1 A;  1TFA A;  3K1P A;  2Q9T A;  2NXO A;  1Y20 A;  3KFM A;  2DVC A;  3Q29 A;  2AL4 A;  1JVY A;  2FA7 A;  4XKR A;  1P1Q A;  1TWY A;  1ZU0 A;  2DE2 A;  4OMB A;  5EHM A;  3TDJ A;  1NNF A;  1PBP A;  1M5C A;  4POW A;  2O6A A;  2I4B A;  2LAO A;  2P0S A;  3EF7 A;  4HTG A;  2I4C A;  3E9X A;  2IA4 A;  2XHD A;  4KYE A;  1DTZ A;  2RCB A;  1B7H A;  1MPC A;  3LSX A;  4OEU A;  3OO7 A;  1Z7N E;  4FE8 A;  1IIW A;  3LBS A;  1B3H A;  4QFO A;  1VFD A;  3E13 X;  3IO4 A;  3P7I A;  4R2B A;  3VLV A;  4F29 A;  5I84 A;  3OSR A;  1MY3 A;  2IEE A;  4LVQ A;  2Y7R A;  3PU5 A;  2OWT A;  1I6Q A;  4ZS9 A;  3G3J A;  1US5 A;  3ILU B;  4NTL A;  3TZA A;  4EQB A;  1A40 A;  5ITO A;  3DEL B;  5KDT B;  1MQG A;  2H25 A;  5FTH A;  3RPW A;  4QSD A;  3RT8 A;  4MLQ A;  1XVY A;  1FW0 A;  3SEY A;  2I48 A;  3PUY E;  3UIF A;  4KI0 E;  4L17 A;  5H8N A;  4F18 A;  1SYH A;  2RC9 A;  1LAH E;  1MQH A;  4M4G A;  3K6V A;  2XD3 A;  1B7U A;  1B5H A;  2ONS A;  3Q26 A;  1II5 A;  1VFE A;  3KSJ A;  3SEV A;  3V89 B;  3N6U A;  4JSO A;  4Q8R A;  5H8H B;  2F78 A;  1M5F A;  3IL1 B;  3QIM A;  4I9D A;  3OEM A;  2O7I A;  4IGR A;  2B65 A;  2Z22 A;  1ATG A;  2UVI A;  1H45 A;  2F7C A;  4KD5 A;  5EYF A;  4F1V A;  1FQE A;  4DDD A;  4NF4 A;  1B46 A;  1F9B A;  2NUV A;  3L6H A;  4OFO A;  4P0G A;  2QPQ A;  4GQO A;  2GRV A;  2VOZ A;  3SER A;  3VDF A;  4YB5 A;  3MZ9 A;  1R9L A;  3TCG A;  3FJG A;  3TKD A;  1MXU A;  4TQU Q;  1OQH A;  3LSL A;  4G8N A;  4NF8 B;  4POX A;  4FAT A;  4PET A;  1MY1 A;  1DPP A;  4GWO A;  2D3I A;  1MS7 A;  4BDQ A;  2HQ0 A;  2DWI A;  2ZNS A;  3PPO A;  1IUD A;  4QFP A;  3W9W A;  5FTI A;  5HBC A;  4LA9 A;  4U21 A;  1FQF A;  1MDQ A;  4H65 A;  4ONY A;  4ZEF A;  2R9J A;  1LST A;  1MXW A;  1YTV A;  4GL0 A;  5TP9 B;  3Q28 A;  5CBR A;  1SVX B;  2RIN A;  3TEP A;  2DOJ A;  1QKA A;  2PT2 A;  3KSX A;  3M3L A;  4QSC A;  4F1Y A;  2REG A;  3QXM A;  3G3I A;  4LZ7 A;  4HCY A;  3D4G A;  5H8Q B;  1DPE A;  4UA8 A;  3PPQ A;  3TPA A;  4BDR A;  1DOT A;  5I57 A;  3MP1 A;  1NNT A;  1MPD A;  3G3G A;  1LGB C;  2H5Y A;  4LQ2 A;  2F6G A;  2BJJ X;  1SW5 A;  3RT6 B;  4H6D A;  1ZKB A;  1Y9U A;  2F7A A;  2OZZ A;  2Z23 A;  4F3S A;  1A54 A;  1UTH A;  4U4X A;  4TLM B;  1GTK A;  3HPI A;  3WAE A;  2RKM A;  2O1L A;  1PC3 A;  3VVE A;  1FCK A;  3BFT A;  3S9L C;  2X7P A;  3QAX A;  1IXG A;  1FTK A;  3MAM A;  3BBR A;  3G7W A;  3IK6 B;  3TOD A;  4U1O A;  4BDN A;  4R6K A;  4KPT A;  3S9N C;  3TTR A;  4R6Y A;  2XXR A;  1ZIU A;  2HZK A;  2ONK E;  3FVN A;  3GXA A;  1I69 A;  2RF1 A;  3BKI B;  1GV8 A;  3UP9 A;  3T96 B;  1BLF A;  1B4H A;  3H6W A;  4RXL A;  5A5X A;  3T22 A;  3K6X A;  4KYD A;  2OCU A;  1H3D A;  3TCF A;  2OLB A;  1N3X A;  3CFL A;  4EUO A;  1B5I A;  1JEU A;  2B3F A;  2PVU A;  4H0W A;  4DXU A;  3ZSF A;  3GZG A;  3VVD A;  3PPP A;  3OMB A;  4H8I A;  1DMB A;  4F3G A;  1ZJL A;  2H9B A;  4FEB A;  3C9H A;  3TAJ A;  4KYS A;  4YU0 A;  2Y7P A;  2X7Q A;  3KN3 A;  4DE8 A;  4DCX A;  5H8F A;  1B2H A;  1ZTY A;  3JYR A;  4TOZ A;  4XIG Q;  3IJX B;  3QSL A;  1MXV A;  1JNF A;  1OVT A;  2RCA A;  3FV1 A;  3OEK A;  4NF5 A;  5IKB A;  4O3A A;  4FAJ A;  3H06 B;  2RC7 A;  3EPE A;  3OO6 A;  2AL5 A;  2PX1 A;  3CSB A;  1PDA A;  1MRP A;  2XX9 A;  2YJP A;  4ZEC A;  4EXK A;  4ELP A;  3FAS A;  3M3F A;  4IY5 A;  4O3C A;  4UAC A;  3FXU A;  3K02 A;  3K01 A;  3QK6 A;  4X48 A;  2Q2C A;  1PBQ A;  5ISU A;  3PMV A;  4WEP A;  3FD3 A;  4K3F A;  2DE3 A; 
#chains in the Genus database with same CATH topology
 5ICT A;  2HFB A;  1HSL A;  1NV6 A;  4JWX A;  2KLF A;  2FVZ A;  1FQC A;  5I2K A;  1FBP A;  1D9Q A;  4MF3 A;  2ZZV A;  5TP9 A;  4MJO A;  4G68 C;  2WBB A;  2VGQ A;  4RJZ A;  3PV0 E;  1TT1 A;  4C1T A;  1FTL A;  3C4M A;  3MJN A;  1IMF A;  5I59 A;  1S7Y A;  4MAG A;  3BFU A;  3K2D A;  3B8B A;  1Y3N A;  4PAI A;  3VE1 B;  1SD3 A;  4XTC Q;  2Q88 A;  4IY6 A;  1USY E;  3PUW E;  1JEV A;  3T9V A;  2ZXT A;  1UTH B;  4ZZE A;  4PGN A;  4IB2 A;  4FIM A;  5EYG A;  4C0R A;  4NWC A;  3PGF A;  4OVP A;  3H6V A;  1B3G A;  1HSJ A;  2V25 A;  4LON B;  1S50 A;  2XXI A;  1DBZ A;  4O8M A;  3PUV E;  3IJO B;  5DYH A;  1FBF A;  2F35 A;  3IFC A;  1OIB A;  3FJ7 A;  2UYE A;  2ABH A;  4PFW A;  4E0X A;  1ELJ A;  2XXK A;  4F1U A;  2XXU A;  5IAI A;  3IFA A;  1EZO A;  1Q9D A;  4RYA A;  4N81 A;  4AQ4 A;  1FTO A;  5I59 B;  3MP6 A;  3U72 A;  4X9T A;  3T9U A;  4OXV A;  4NF6 B;  4R75 A;  2PBW A;  5AA4 B;  4YB6 A;  4GLI A;  4ZED A;  1N3W A;  4QSE A;  4HW8 A;  1LEV A;  2CZL A;  3A09 A;  5DVF A;  3CG1 A;  1NH7 A;  5FHN A;  4PF6 A;  2ZZX A;  4P1L A;  3E78 A;  5BWJ A;  2XXT A;  3SZP A;  1NI9 A;  3FJM A;  3CFZ A;  1SQY A;  4AB6 A;  4OVT A;  3KC0 A;  4GFR A;  5F24 A;  1MPB A;  2ZYO A;  4U4S A;  1P1O A;  3IAZ A;  3FIR A;  3FVK A;  1B52 A;  4EDP A;  4EQ9 A;  2XXX A;  4JVC A;  3K1N A;  2ZYM A;  3CHG A;  3MBP A;  4EF1 A;  4MIJ A;  2QVU A;  3I3V A;  1O64 A;  3N6T A;  2ZZW A;  2CZK A;  2I0C A;  5BUU A;  4HE1 A;  4WED A;  3UA8 A;  1A7L A;  1R1N A;  1D9Y A;  1Q1K A;  2O84 X;  4MHF A;  3C33 A;  1EU8 A;  3S9M C;  4OZ9 A;  5ET6 A;  3H6U A;  1H76 A;  1B5J A;  3GYY A;  1DSN A;  4QHQ A;  2OX3 A;  4PQJ A;  2R8T A;  5EQ8 A;  1LAG E;  2WYK A;  4LZ8 A;  2QVR A;  2DE4 A;  1CNQ A;  3B6W A;  4DXB A;  3FZV A;  3TMG A;  2V93 A;  1NFT A;  3IOT A;  2I58 A;  1NKX A;  3ZKK A;  2GFE A;  4ISU A;  3T0J A;  3ISP A;  4PFY A;  5CBS A;  2DWJ A;  4HE0 A;  2H98 A;  1CE2 A;  2HEU A;  3HO7 A;  2P3N A;  3H6T A;  4O7M A;  1CB6 A;  1B58 A;  2XWK A;  4DI3 D;  1BIY A;  5DVJ A;  4OES A;  2HXR A;  3IR1 A;  4KR5 A;  5A5X B;  1FPJ A;  5DEX A;  5DW8 A;  1N04 A;  2I49 A;  1FPB A;  3FGS A;  3MST A;  4P0I A;  4FEC A;  1J1N A;  5F1Q A;  4P1E A;  2Z8F A;  3TTK A;  2VP1 A;  3SEU A;  2F7B A;  2PT1 A;  3MWB A;  5I58 A;  3DP6 A;  1OVB A;  1FBC A;  3VVF A;  2Q8M A;  4GWY A;  5H8F B;  3RPL A;  3PPR A;  1IMB A;  4F39 A;  1B9J A;  1N0T A;  1FJ6 A;  1B7Z A;  5LDZ A;  4LP2 B;  1LB9 A;  4HCW A;  3LV0 A;  1H43 A;  3G3K A;  3CRB A;  2DWH A;  3D4C A;  2NVU B;  2DYX A;  3LUY A;  1FTM A;  1Y4T A;  2V3T A;  1PEB A;  4PFI A;  4NF4 B;  1MXX A;  3SEW A;  3TTL A;  2XXQ A;  1URG A;  2O68 A;  3GBA A;  5IZ1 A;  3G3F A;  4DCY A;  1QVS A;  3KJ7 A;  1PB8 A;  2UVJ A;  2Y7K A;  3SES A;  1MG1 A;  2Q9T A;  4DI4 B;  1Y20 A;  1TWY A;  2DE2 A;  2CZI A;  4XF5 A;  4POW A;  2P0S A;  2I4B A;  2LAO A;  2QFL A;  2I4C A;  2XHD A;  2RCB A;  3LSX A;  4OEU A;  3OO7 A;  1Z7N E;  4FE8 A;  3E13 X;  2OWT A;  1BK4 A;  1US5 A;  4NQ8 A;  1A40 A;  4QSD A;  4MLQ A;  4L17 A;  2Y5L A;  1B5H A;  3BIG A;  1IMD A;  3IL1 B;  1FBH A;  2O7I A;  3OEM A;  1FPD A;  1H45 A;  1B46 A;  1F9B A;  4P0G A;  4X04 A;  3SER A;  3VDF A;  3MZ9 A;  2GQ1 A;  4TQU Q;  4P9K A;  1DPP A;  4GWO A;  2D3I A;  2HQ0 A;  1IUD A;  5FTI A;  1MDQ A;  3MYU A;  3B50 A;  4GL0 A;  1SVX B;  1NUX A;  1QKA A;  4HCY A;  1DPE A;  1NUW A;  1DOT A;  1YYZ A;  5ESY A;  5IGA A;  2BJJ X;  1JP4 A;  1ZKB A;  4F3S A;  1UTH A;  4U4X A;  3HPI A;  3WAE A;  5J16 A;  2O1L A;  1FTK A;  3BBR A;  2CEX A;  4U1O A;  3TTR A;  4LN5 A;  4R6Y A;  4NAP A;  3GXA A;  4PF8 A;  3K6X A;  1N3X A;  3T1B A;  1B5I A;  1JEU A;  1QGX A;  4DXU A;  4KYS A;  4YU0 A;  2OWZ A;  2PFY A;  4DE8 A;  3QMF A;  3E79 A;  1ZTY A;  3QSL A;  2WYP A;  3OEK A;  3H06 B;  3EPE A;  2PX1 A;  3CSB A;  1PDA A;  1G0I A;  3K01 A;  4X48 A;  5ISU A;  4OTE A;  3U65 A;  3UN6 A;  2VPN A;  1AH5 A;  3K1M A;  2ONR A;  2F34 A;  2Y7I A;  1HSE A;  1NV4 A;  5KZT A;  4AS4 A;  2WBD A;  1B3F A;  1ZMG A;  1DTG A;  4LAT A;  4PFR A;  3KG2 A;  3C32 A;  2QL3 A;  3PD8 A;  4PE5 B;  1MY0 A;  4GWX A;  2QS2 A;  4OWD A;  1N7W A;  3FXB A;  4F19 A;  1P1N A;  4G8M A;  5CRY A;  1FRP A;  4G77 A;  3CI8 A;  2RC8 A;  1WDN A;  3EN3 A;  3VXB A;  4BLA A;  3FVO A;  4OFJ A;  3B7D A;  3K6W A;  2G93 A;  1JW4 A;  3C36 A;  2Z8E A;  2I0B A;  1SI1 A;  4PAF A;  2R71 A;  4NN3 A;  3SET A;  1QUI A;  1B32 A;  1B51 A;  3PUX E;  4LUB A;  2V4C A;  3TQL A;  1OQG A;  4Q5T A;  4P3L A;  2VD2 A;  4OYV A;  3RLF E;  5CM6 A;  3VXC A;  2UVG A;  2ZYK A;  5JK4 A;  1EYJ A;  3CVG A;  1BKA A;  1QUK A;  2AIX A;  1MH4 A;  3OO8 A;  4AB5 A;  4YAH X;  2D5W A;  4GBV A;  3UGW A;  1SDX A;  4O94 A;  1SW4 A;  1YPN A;  4O7I A;  2QS3 A;  3FXQ A;  3SEX A;  1RKM A;  5JEI A;  2JJK A;  4MCO A;  1RYX A;  1FBG A;  4XXU A;  5AE4 A;  3VLU A;  1LBX A;  4ZEI A;  1LFG A;  2I3W A;  3GBB A;  1JVX A;  1TXF A;  2Y5K A;  2KQZ A;  1JW1 A;  4QBA A;  3Q27 A;  4RK9 A;  1FQD A;  1MQJ A;  3U8Q A;  3MVW A;  1O63 A;  3IB2 A;  1PB9 A;  3H03 A;  5TU0 A;  2VHA A;  1IXC A;  1M5D A;  3H3G A;  3MUQ A;  4BDM A;  1NUZ A;  1MY4 A;  2H4I A;  3DP8 A;  1D4N A;  1EZP A;  5AA4 A;  2UYF A;  5TPA B;  4YMA A;  1QW0 A;  3KJT A;  4OFL A;  4JBZ A;  1XC1 A;  3ODB A;  4N13 A;  1VDW A;  1Q35 A;  1YXI A;  4FOR A;  1AL3 A;  4THI A;  2A5S A;  4LZ5 A;  4MLV A;  4P11 A;  1RYO A;  1XVX A;  4KCC A;  4ZZA A;  5K2X A;  4MH5 A;  5AA2 A;  1GGG A;  3RGY A;  1FQA A;  1LB8 A;  2OBG A;  2P1S A;  3MVZ A;  3HN0 A;  4XKN A;  4KFQ A;  1KWH A;  1AOV A;  2XXP A;  3MPK A;  4F3B A;  2NOO A;  1VE4 A;  4GIZ A;  5F7V A;  1M5E A;  3HST A;  3IX1 A;  3C31 A;  4OEV A;  1FBD A;  4U23 A;  1RDX A;  4IO3 A;  2DP8 A;  3VV5 A;  2ZNT A;  1K9Y A;  4F22 A;  5FHM A;  4NED A;  2Y7W A;  3TQW A;  1MQD A;  3FVG A;  1S9T A;  4C1U A;  3TFL A;  3TUS A;  4XEQ A;  2DQV A;  3L6G A;  4R72 A;  4R9F A;  2DS9 A;  4ZDM A;  3USD A;  4Z0I A;  3MP8 A;  3PUZ E;  3TTN A;  2QS1 A;  3MVX A;  3K6U A;  4PE3 A;  2ESN A;  2OK2 A;  2XWI A;  1POT A;  1WOD A;  4ZEK A;  1DK4 A;  4DZ1 A;  3LSF B;  4RA1 A;  5ET8 A;  4KCD A;  4N07 A;  2OWS A;  2HAV A;  4R2F A;  4U22 A;  4JDF A;  3EHT A;  3FV2 A;  2THI A;  3JZJ A;  3CG3 A;  4GOT A;  5KCJ B;  4X1B A;  4O3B A;  2A5T A;  2PYY A;  2GHB A;  4QF9 A;  4R73 A;  3MZB A;  1A8F A;  4PGP A;  5I3S A;  4N8G A;  1URS A;  4H5G A;  1L5T A;  3KZG A;  4OEN A;  4DLD A;  4F3P A;  5AA1 A;  3JV9 A;  2CMO A;  4JWY A;  3I5O A;  5L9O A;  1NV3 A;  2F3B A;  3MW0 A;  3G3H A;  3HV1 A;  3T93 B;  3BIH A;  4UAB A;  4OVS A;  1Y3P A;  5ET5 A;  2DVZ A;  1N84 A;  1FJ9 A;  1H44 A;  2O7U A;  1IIT A;  1TFA A;  2NXO A;  2AL4 A;  2FA7 A;  3TDJ A;  1P1Q A;  2P3V A;  4PC9 A;  1DTZ A;  1MPC A;  4MNP A;  3LBS A;  4QFO A;  4F29 A;  5I84 A;  2IEE A;  2Y7R A;  5KDT B;  1MQG A;  2H25 A;  3UIF A;  2I48 A;  3PUY E;  5H8N A;  4F18 A;  1SYH A;  2RC9 A;  1LAH E;  4M4G A;  1B7U A;  3N6U A;  3KBZ A;  5EHS A;  2UVI A;  2F7C A;  5EYF A;  5A5L A;  1FQE A;  4DDD A;  4I40 A;  3L6H A;  2GRV A;  2VOZ A;  4YB5 A;  3TKD A;  3FJG A;  1MXU A;  3LSL A;  4NF8 B;  4FAT A;  1MY1 A;  4QFP A;  4H65 A;  4ONY A;  1YTV A;  5TP9 B;  2HPG A;  2REG A;  3QXM A;  5H8Q B;  3D4G A;  4UA8 A;  2PFZ A;  1NNT A;  3RT6 B;  2F7A A;  1GTK A;  3VVE A;  1FCK A;  2X7P A;  1AWB A;  3G7W A;  3IK6 B;  4GWZ A;  4BDN A;  4R6K A;  2XXR A;  1ZIU A;  2BJI A;  3FVN A;  1I69 A;  3BKI B;  1B4H A;  4RXL A;  3T22 A;  4KYD A;  1H3D A;  3CFL A;  4H0W A;  3GZG A;  3VVD A;  3C9H A;  5H8F A;  1B2H A;  4XIG Q;  2WX9 A;  3IJX B;  1MXV A;  3FV1 A;  2RC7 A;  4ZEC A;  2YJP A;  3M3F A;  3PMV A;  3FD3 A;  4N8Y A;  1FBE A;  2QMW A;  4EF2 A;  2ZNU A;  4FED A;  1SYI A;  5CMB A;  4LQ5 A;  1TFD A;  3MZ1 A;  2F36 A;  3T9X B;  1AIV A;  1VSO A;  2YLN A;  1UTB B;  3TEL A;  3ZS6 A;  1D9V A;  2GH9 A;  2FIE A;  1BP5 A;  3IB1 A;  4JVD A;  1YCJ A;  4OHN A;  1PB7 A;  3RQT A;  1B05 A;  3I6V A;  4GWU A;  5TPA A;  1D3K A;  3HCQ A;  5EQA A;  3S4U A;  4NGU A;  4GWS A;  3O6I A;  1GVC A;  3IOU A;  2FYI A;  2O69 A;  2ZMB A;  4XKP A;  2B4M A;  3OD7 A;  4GVO A;  1R6Z A;  5CC2 A;  3LUZ A;  4TLL B;  2DWA A;  2VD3 A;  5EQ7 A;  5EQ9 A;  3V8X B;  1FTA A;  2FHY A;  3FBP A;  4H45 A;  3RPL B;  2ANJ A;  4ECF A;  5M2V A;  2F5X A;  4RPO A;  3W15 C;  4JWO A;  1I6B A;  2QVV A;  3U92 A;  5I2N B;  2D21 A;  3RY3 A;  4QFL A;  4PP0 A;  1BTJ A;  3MPL A;  3O9P A;  3PMX A;  1NNP A;  1OLA A;  4HS7 A;  1NMU A;  3CFX A;  4ND9 A;  3T66 A;  1LAX A;  2I3V A;  3H7M A;  5FHO A;  3KC1 A;  2Q8J A;  5LOM A;  1Y1M A;  1ZLQ A;  5IZ3 B;  5B70 A;  2M8C A;  1B0H A;  3AXF A;  4OER A;  4YKP A;  3ONM A;  5DTB A;  4F2Q A;  1QUL A;  4RNS A;  1RDZ A;  3CIJ A;  2QRY A;  4BDO A;  1MQI A;  4H1X A;  3KOS A;  1YAE A;  5HPQ A;  2PMS A;  1NNK A;  1INP A;  3QYT A;  3IOV A;  5KDT A;  5ICQ A;  2F6P A;  3DP4 A;  3KBR A;  3ECR A;  5H8N B;  2H99 A;  4N17 A;  1ANF A;  1FPG A;  3KN7 A;  3MVY A;  4X8R A;  3UOR A;  3LC8 A;  3THI A;  1A55 A;  3LR1 A;  5K2Y A;  2O51 A;  3T9H B;  3U94 A;  3SKP A;  2O1M A;  3RYD A;  4G68 B;  4MMP A;  3O2A A;  3ZKL A;  1I6A A;  3TTM A;  1XI6 A;  4YKJ A;  2WEF A;  3S2V A;  3VLW A;  2OJT A;  1ZBM A;  2XD2 A;  1XS5 A;  1LAF E;  4N6P A;  1IEJ A;  1MM6 A;  1EYK A;  4GL8 A;  4BDL A;  3CR9 A;  2YPN A;  3R6U A;  4EQ7 A;  1B1X A;  5DT6 A;  4GXS B;  3W9V A;  1OMP A;  3IOR A;  2V3Q A;  1USY H;  1QKB A;  2G29 A;  5CMM A;  1FQB A;  1LLS A;  3E4R A;  4G4P A;  4U2R A;  2FBP A;  1LBW A;  2V84 A;  1WVJ A;  4JXI A;  2E0S A;  2A5T B;  4EXL A;  2Q2A A;  3U93 A;  5J1D A;  3RNN A;  1OLC A;  4GX3 A;  4PFU A;  1UIU A;  3PPN A;  4PDD A;  5KCJ A;  1IZ1 A;  4NF8 A;  4YZZ A;  2QMX A;  3DM0 A;  4IO7 A;  3RUM A;  2HZL A;  1FTJ A;  2DXR A;  3SDF A;  4Q30 B;  4G61 A;  1QJM A;  1EZ9 A;  4GRK A;  4NF0 A;  5EYH A;  4Z7E A;  2B4L A;  3R7X A;  1FPK A;  3PMW A;  4E0W A;  3B6T A;  2CZH A;  1R9Q A;  2HAU A;  3OEL A;  2REJ A;  5L8D A;  4YB7 A;  2X26 A;  1SW1 A;  1UIV A;  1VR5 A;  4NF5 B;  4OA4 A;  4KHZ E;  3O97 A;  4NMY A;  3K0V A;  4OAN A;  3CSG A;  5ELV A;  5JTY A;  1T0K A;  5DVI A;  1P99 A;  5B7D A;  4RPN A;  1LBY A;  1MXZ A;  1POY 1;  3H4Z A;  5FBP A;  3UK4 A;  3PD9 A;  1IXH A;  3OOA A;  3KN8 A;  4YMB A;  2UXA A;  3LSW A;  2XXV A;  3KOT A;  4DIG A;  4GD5 A;  4PBH A;  4M1V A;  4QRZ A;  4WXJ A;  5AA2 B;  3RN8 A;  1UQW A;  3O29 A;  3IB0 A;  2DSF A;  3FUZ A;  5AA2 D;  5I57 B;  3HHF A;  3A29 A;  5L9S A;  4Q0C A;  2F97 A;  1MM7 A;  3K1P A;  4QXD A;  2DVC A;  1JVY A;  4XKR A;  4OMB A;  5EHM A;  1PBP A;  3E9X A;  2IA4 A;  4KYE A;  1K9Z A;  1B3H A;  1VFD A;  3P7I A;  3OSR A;  1MY3 A;  4PAK A;  4ZS9 A;  4EQB A;  3G3J A;  3ILU B;  5ITO A;  3DEL B;  4MX6 A;  3TCF A;  3RPW A;  4XFE A;  4KI0 E;  3SEV A;  4PCD A;  1II5 A;  1VFE A;  2MKZ A;  3KSJ A;  4JSO A;  5H8H B;  2F78 A;  1M5F A;  3QIM A;  4IGR A;  4KD5 A;  4NF4 A;  4OFO A;  2NUV A;  4HE2 A;  4MEV A;  4GBW A;  4AS5 A;  1OQH A;  4G8N A;  4FBP A;  4MNI A;  1MS7 A;  4BDQ A;  3PPO A;  4LA9 A;  1LST A;  1MXW A;  5CBR A;  3Q28 A;  5ET7 A;  2DOJ A;  4QSC A;  3KSX A;  3M3L A;  3PPQ A;  3TPA A;  4BDR A;  5I5P A;  1KZ8 A;  4N15 A;  4KXP A;  4LQ2 A;  4H6D A;  2Z23 A;  1A54 A;  4TLM B;  2L5V A;  1IXG A;  3MAM A;  3TOD A;  1NV2 A;  4KPT A;  2HZK A;  1GV8 A;  5A5X A;  2OCU A;  1RDY A;  2PVU A;  3PPP A;  4H8I A;  1DMB A;  4F3G A;  1ZJL A;  4FEB A;  3TAJ A;  2X7Q A;  4DCX A;  5IKB A;  2RCA A;  2CEY A;  4H46 A;  4FAJ A;  3OO6 A;  1MRP A;  4EXK A;  4ELP A;  4IY5 A;  4I3Y A;  3K02 A;  3QK6 A;  2Q2C A;  1PBQ A;  4WEP A;  4K3F A;  2DE3 A;  3U1O A;  1XOC A;  2QJE A;  4PTK A;  5ITP A;  5CMK A;  4IGT A;  2XX8 A;  1LCT A;  3MQ9 A;  2Y84 A;  5I2N A;  4MBP A;  3TYH A;  3QUJ A;  3OXN A;  1GR2 A;  1QUJ A;  2QS4 A;  2NWJ A;  2XXY A;  2KR0 A;  3RTF B;  3N5L A;  3EQ1 A;  1SW2 A;  5H8H A;  3ILT B;  4ELO A;  4DXC A;  3EHU A;  3OEN A;  2XXH A;  1FPF A;  2F8D A;  2I6E A;  1B1H A;  4PBQ A;  1P1W A;  4YKK A;  4N4U A;  3EHS A;  2Q89 A;  4ESX A;  1Z7M E;  4GF8 A;  1B6H A;  5I2K B;  5H8Q A;  3VFJ A;  2HXW A;  1FSA A;  1LFH A;  5DEX B;  2HHM A;  4F31 B;  1FPI A;  3IOW A;  4I62 A;  3V83 A;  4NE4 A;  4QFN A;  1LBC A;  3N26 A;  3NOH A;  4NWD A;  2E1S A;  4G2Z A;  4R9G A;  3S9E A;  3QUF A;  4JVI A;  3C34 A;  4P8B A;  4NX1 A;  4OET A;  5IZZ A;  5L9M A;  1XT8 A;  3KGC A;  3MC2 A;  4JB7 A;  1NV0 A;  4YIC A;  2R6G E;  1URD A;  2XXW A;  5HM4 B;  4YKI A;  4H5F A;  3RTW B;  2AYS A;  2UVH A;  2PCR A;  1IXI A;  1NUY A;  3OO9 A;  4MFI A;  5CI5 A;  4IO4 A;  4N6K A;  4F2O A;  1JW5 A;  1LCF A;  5H8S A;  2HCA A;  4XKQ A;  4KQP A;  1FPE A;  3HHG A;  4I8C A;  1O7T A;  2F3D A;  4H8J A;  3N94 A;  4WKM A;  3A3C A;  1MY2 A;  1P1U A;  3WAF A;  3K4U A;  3TCH A;  1B3E A;  1B4Z A;  3O6G A;  1NH8 A;  3V5A A;  1N7X A;  3M8U A;  4ZE8 A;  4JSD A;  1NV5 A;  1MXY A;  3Q25 A;  4U1Z A;  1US4 A;  4N6D A;  4R6H A;  4OVJ A;  1EYI A;  4FJP A;  1A8E A;  2QSX A;  3M3K A;  3B6Q A;  3KEI A;  2DDK A;  2WKY A;  2VPO A;  4NF6 A;  4ELR A;  3DLN A;  1M5B A;  4H67 A;  2DXY A;  4GXA A;  1NV1 A;  5I56 B;  2W7Y A;  1Y1Z A;  4OQO A;  1NV7 A;  1Y3Q A;  4HXV A;  1AMF A;  5AA3 A;  4G68 A;  1XHY A;  5CMC A;  3FAT A;  1KA0 A;  1KA1 A;  2P2A A;  4I1D A;  3O28 A;  3IO6 A;  4QFK A;  1G0H A;  4GX6 A;  3GLB A;  5I58 B;  4P56 A;  2ZYN A;  4G8H A;  3C35 A;  4PFB A;  3O6H A;  1EH3 A;  1IME A;  2B3B A;  5JTY B;  1SBP A;  1A99 A;  4N91 A;  1UTB A;  1LFI A;  2V3U A;  4ZE9 A;  4ZEB A;  3K00 A;  1Y4C A;  1B3L A;  4IO5 A;  2FNC A;  2XWV A;  4MNC A;  1JET A;  1MH3 A;  4I3E A;  2XWO A;  1B0L A;  3ROJ A;  4X1D A;  4R74 A;  3F11 A;  5LTC A;  4GX4 A;  3R26 A;  2Z8D A;  4NHB A;  4ELQ A;  1B40 A;  1LBV A;  3E3K A;  2XA5 A;  1FPL A;  3A3U A;  1JQF A;  4RY1 A;  4IO2 A;  4IO6 A;  2XX7 A;  1IQ7 A;  3OSQ A;  1NL5 A;  3FXR A;  4PFT A;  1SI0 A;  1N76 A;  1MDP 1;  3O66 A;  1LBB A;  2ALU A;  5I56 A;  2GHA A;  3KFM A;  3Q29 A;  1ZU0 A;  1NNF A;  1M5C A;  2O6A A;  3EF7 A;  4HTG A;  5T3J A;  4PDH A;  1IMA A;  3EKI A;  1B7H A;  3D1R A;  4GWW A;  1IIW A;  2VT5 A;  3IO4 A;  3VLV A;  4R2B A;  4LVQ A;  3PU5 A;  5I7I A;  1I6Q A;  4NTL A;  3TZA A;  5FTH A;  3SEY A;  3RT8 A;  2FIX A;  1XVY A;  1FW0 A;  1MQH A;  3K6V A;  2XD3 A;  2ONS A;  3Q26 A;  3V89 B;  4Q8R A;  4RK2 A;  4ESW A;  4I9D A;  2B65 A;  2Z22 A;  1ATG A;  4NG7 A;  4F1V A;  2QPQ A;  4GQO A;  1R9L A;  1YZ0 A;  4OVQ A;  3TCG A;  1LBZ A;  4POX A;  4PET A;  2ZNS A;  2DWI A;  3W9W A;  5HBC A;  4U21 A;  4ZEF A;  1FQF A;  2R9J A;  1SPI A;  3TEP A;  2RIN A;  2PT2 A;  4F1Y A;  3G3I A;  4LZ7 A;  5I57 A;  3MP1 A;  1MPD A;  3G3G A;  1LGB C;  2H5Y A;  2F6G A;  1SW5 A;  1Y9U A;  2OZZ A;  3PTY A;  2RKM A;  1PC3 A;  3BFT A;  3S9L C;  3QAX A;  5IZ3 A;  3S9N C;  3HFU A;  4P47 A;  1DCU A;  2ONK E;  3UP9 A;  1IMC A;  2RF1 A;  3T96 B;  1BLF A;  3H6W A;  5IM2 A;  2OLB A;  4EUO A;  2B3F A;  3ZSF A;  3OMB A;  4OVR A;  2H9B A;  2Y7P A;  3KN3 A;  3JYR A;  4TOZ A;  2Q74 A;  1JNF A;  1OVT A;  4IR8 A;  4NF5 A;  4O3A A;  2AL5 A;  2XX9 A;  3FAS A;  4O3C A;  4UAC A;  3FXU A; 
#chains in the Genus database with same CATH homology
 2QMW A;  5ICT A;  2HFB A;  5I59 B;  1HSL A;  4JWX A;  4EF2 A;  2ZNU A;  2KLF A;  3U1O A;  1XOC A;  3UN6 A;  2QJE A;  1AH5 A;  4FED A;  1SYI A;  3K1M A;  1FQC A;  5I2K A;  2ONR A;  5ITP A;  4MF3 A;  5CMB A;  2F34 A;  4LQ5 A;  5TP9 A;  5CMK A;  1TFD A;  2Y7I A;  4IGT A;  2XX8 A;  4ZED A;  1HSE A;  4G68 C;  1LCT A;  5KZT A;  1B3F A;  1ZMG A;  3MZ1 A;  2VGQ A;  1DTG A;  3MQ9 A;  4LAT A;  2Y84 A;  4RJZ A;  5I2N A;  2F36 A;  3PV0 E;  3T9X B;  1TT1 A;  1AIV A;  1VSO A;  4MBP A;  4C1T A;  2YLN A;  3KG2 A;  3TYH A;  3C32 A;  3QUJ A;  3OXN A;  1GR2 A;  1UTB B;  3TEL A;  1QUJ A;  3ZS6 A;  2QL3 A;  1FTL A;  2QS4 A;  3C4M A;  2XXY A;  3PD8 A;  3MJN A;  2NWJ A;  4ESW A;  4PE5 B;  1D9V A;  1MY0 A;  2GH9 A;  2QS2 A;  4OWD A;  3RTF B;  1BP5 A;  5I59 A;  1N7W A;  1S7Y A;  3IB1 A;  3BFU A;  3K2D A;  3N5L A;  1YCJ A;  4OHN A;  1Y3N A;  3EQ1 A;  1SW2 A;  5H8H A;  1PB7 A;  3THI A;  3ILT B;  4ELO A;  3RQT A;  3VE1 B;  4F19 A;  1P1N A;  4DXC A;  1B05 A;  1SD3 A;  3EHU A;  3I6V A;  4G8M A;  4XTC Q;  3OEN A;  2XXH A;  5CRY A;  2Q88 A;  4G77 A;  3CI8 A;  2RC8 A;  4IY6 A;  5TPA A;  1D3K A;  1WDN A;  1USY E;  3EN3 A;  3FVO A;  3VXB A;  2F8D A;  3HCQ A;  3S4U A;  2I6E A;  4BLA A;  4OFJ A;  3B7D A;  1JEV A;  3K6W A;  2G93 A;  3PUW E;  1B1H A;  1JW4 A;  3T9V A;  2ZXT A;  1UTH B;  1P1W A;  3O6I A;  4YKK A;  4ZZE A;  3C36 A;  2Z8E A;  2Q89 A;  3EHS A;  4IB2 A;  1GVC A;  4ESX A;  3IOU A;  4FIM A;  2FYI A;  2O69 A;  1Z7M E;  2I0B A;  1SI1 A;  4NWC A;  3PGF A;  4C0R A;  2ZMB A;  2R71 A;  4GF8 A;  4XKP A;  1B6H A;  3OD7 A;  4GVO A;  1R6Z A;  5I2K B;  4TLL B;  5H8Q A;  3SET A;  5CC2 A;  3VFJ A;  3H6V A;  2DWA A;  1B3G A;  2HXW A;  2VD3 A;  1HSJ A;  1QUI A;  1B32 A;  2V25 A;  1B51 A;  3V8X B;  3PUX E;  4LON B;  1LFH A;  1S50 A;  4LUB A;  2XXI A;  5DEX B;  3TQL A;  1OQG A;  2ANJ A;  3PUV E;  4ECF A;  3IJO B;  4Q5T A;  5DYH A;  5M2V A;  2F5X A;  4RPO A;  2F35 A;  4F31 B;  2VD2 A;  4OYV A;  3RLF E;  1OIB A;  3W15 C;  4JWO A;  3FJ7 A;  5CM6 A;  2UYE A;  3IOW A;  4I62 A;  3VXC A;  2UVG A;  2ZYK A;  2ABH A;  4PFW A;  4E0X A;  5JK4 A;  3V83 A;  3CVG A;  1ELJ A;  1BKA A;  1QUK A;  1I6B A;  4NE4 A;  4F1U A;  2AIX A;  3U92 A;  1MH4 A;  2XXU A;  3OO8 A;  2D21 A;  1LBC A;  4QFN A;  3RY3 A;  3N26 A;  4QFL A;  4AB5 A;  5I2N B;  4NWD A;  4YAH X;  4PP0 A;  2D5W A;  5IAI A;  1BTJ A;  2E1S A;  4G2Z A;  4R9G A;  3S9E A;  4RYA A;  1EZO A;  3UGW A;  3QUF A;  4F2Q A;  1SDX A;  4AQ4 A;  3MPL A;  1SW4 A;  3C34 A;  1NNP A;  1OLA A;  1YPN A;  3O9P A;  3PMX A;  4HS7 A;  4OET A;  1NMU A;  2QS3 A;  1XT8 A;  3CFX A;  4ND9 A;  5L9M A;  3T66 A;  1LAX A;  3KGC A;  3MC2 A;  1FTO A;  3TTK A;  2I3V A;  3FXQ A;  3H7M A;  3MP6 A;  4JB7 A;  5FHO A;  3SEX A;  5HM4 B;  3U72 A;  2Q8J A;  5LOM A;  1RKM A;  1Y1M A;  4X9T A;  5JEI A;  4YIC A;  2R6G E;  1RYX A;  3T9U A;  1URD A;  1ZLQ A;  4OXV A;  4NF6 B;  5B70 A;  2M8C A;  2XXW A;  4XXU A;  4R75 A;  5AE4 A;  1B0H A;  3AXF A;  3VLU A;  4OER A;  2PBW A;  4ZEI A;  5AA4 B;  4YB6 A;  1LFG A;  2I3W A;  4GLI A;  4YKP A;  3ONM A;  3GBB A;  5DTB A;  1JVX A;  1N3W A;  4QSE A;  1TXF A;  4YKI A;  1QUL A;  4H5F A;  4RNS A;  3RTW B;  2CZL A;  3A09 A;  5DVF A;  3CG1 A;  2AYS A;  4HW8 A;  1NH7 A;  3CIJ A;  2UVH A;  2QRY A;  5FHN A;  4BDO A;  1MQI A;  1IXI A;  1JW1 A;  4H1X A;  3KOS A;  1YAE A;  3Q27 A;  4RK9 A;  5HPQ A;  1FQD A;  5BWJ A;  1MQJ A;  2PMS A;  2XXT A;  3OO9 A;  4MFI A;  3U8Q A;  3FJM A;  3MVW A;  1NNK A;  1O63 A;  3IB2 A;  1PB9 A;  3CFZ A;  1SQY A;  3QYT A;  5CI5 A;  3IOV A;  4AB6 A;  3H03 A;  4IO4 A;  5TU0 A;  5KDT A;  5ICQ A;  4F2O A;  1JW5 A;  1LCF A;  2VHA A;  1IXC A;  1M5D A;  4GFR A;  5H8S A;  2F6P A;  3H3G A;  3DP4 A;  1MPB A;  3ECR A;  2ZYO A;  3KBR A;  3MUQ A;  4U4S A;  5H8N B;  1P1O A;  4BDM A;  2H99 A;  3IAZ A;  3FIR A;  3FVK A;  2HCA A;  1MY4 A;  1B52 A;  4EDP A;  1ANF A;  4XKQ A;  2H4I A;  4KQP A;  3KN7 A;  3HHG A;  3DP8 A;  3MVY A;  4I8C A;  4EQ9 A;  1O7T A;  2XXX A;  1D4N A;  3UOR A;  1EZP A;  3LC8 A;  3K1N A;  2UYF A;  4H8J A;  2ZYM A;  3N94 A;  4WKM A;  1A55 A;  3A3C A;  5TPA B;  3LR1 A;  5K2Y A;  3MBP A;  4YMA A;  1QW0 A;  2O51 A;  3T9H B;  4EF1 A;  1MY2 A;  1P1U A;  3KJT A;  4OFL A;  3I3V A;  4JBZ A;  3SKP A;  3K4U A;  3U94 A;  3WAF A;  1XC1 A;  2O1M A;  3TCH A;  3ODB A;  1O64 A;  1B3E A;  1B4Z A;  3N6T A;  4N13 A;  2I0C A;  4G68 B;  3O6G A;  5BUU A;  1Q35 A;  4THI A;  1NH8 A;  1AL3 A;  4FOR A;  3V5A A;  2A5S A;  1N7X A;  4WED A;  3O2A A;  5EHS A;  4LZ5 A;  4MLV A;  3M8U A;  3UA8 A;  1I6A A;  4ZE8 A;  3ZKL A;  4P11 A;  4OTE A;  4JSD A;  1A7L A;  1R1N A;  1D9Y A;  1MXY A;  3TTM A;  1Q1K A;  2O84 X;  3Q25 A;  4YKJ A;  3S2V A;  3VLW A;  2OJT A;  3C33 A;  1ZBM A;  1RYO A;  1EU8 A;  2XD2 A;  4U1Z A;  3S9M C;  1XS5 A;  4OZ9 A;  1LAF E;  1US4 A;  3H6U A;  4N6P A;  1H76 A;  1B5J A;  1IEJ A;  1MM6 A;  1XVX A;  4OVJ A;  4R6H A;  4KCC A;  4ZZA A;  1DSN A;  4GL8 A;  4QHQ A;  4FJP A;  4PQJ A;  5AA4 A;  1A8E A;  2QSX A;  3M3K A;  3CR9 A;  2YPN A;  3R6U A;  5K2X A;  4MH5 A;  4BDL A;  4EQ7 A;  3B6Q A;  1LAG E;  1B1X A;  5DT6 A;  4GXS B;  4LZ8 A;  5AA2 A;  3KEI A;  1GGG A;  3W9V A;  3RGY A;  1FQA A;  1OMP A;  2WKY A;  4RK2 A;  1LB8 A;  2OBG A;  2DE4 A;  2P1S A;  3IOR A;  3HN0 A;  3MVZ A;  4XKN A;  4KFQ A;  2V3Q A;  4NF6 A;  1USY H;  1KWH A;  1QKB A;  2G29 A;  3B6W A;  5CMM A;  3DLN A;  3FZV A;  4DXB A;  4ELR A;  1AOV A;  2XXP A;  3TMG A;  1M5B A;  4H67 A;  3MPK A;  2V93 A;  2DXY A;  1FQB A;  1LLS A;  4F3B A;  2NOO A;  1NFT A;  3E4R A;  4G4P A;  1VE4 A;  3IOT A;  4GXA A;  4U2R A;  2V84 A;  4GIZ A;  5I56 B;  5F7V A;  1M5E A;  2W7Y A;  1WVJ A;  3HST A;  1Y1Z A;  3C31 A;  2I58 A;  2E0S A;  3IX1 A;  1NKX A;  4JXI A;  4OEV A;  4OQO A;  3ZKK A;  1Y3Q A;  4U23 A;  2GFE A;  2A5T B;  4EXL A;  2Q2A A;  3U93 A;  5J1D A;  4ISU A;  3RNN A;  4IO3 A;  1OLC A;  4PFY A;  2DP8 A;  2DWJ A;  2ZNT A;  3VV5 A;  5CBS A;  2H98 A;  1CE2 A;  4PFU A;  1UIU A;  3PPN A;  1AMF A;  2HEU A;  5AA3 A;  5KCJ A;  3HO7 A;  1IZ1 A;  4NF8 A;  4YZZ A;  4G68 A;  1XHY A;  5CMC A;  4F22 A;  5FHM A;  3FAT A;  4NED A;  3H6T A;  2QMX A;  1CB6 A;  1B58 A;  2Y7W A;  3TQW A;  1MQD A;  3DM0 A;  2P2A A;  3FVG A;  4I1D A;  1BIY A;  5DVJ A;  3O28 A;  4IO7 A;  1S9T A;  3IO6 A;  4QFK A;  4C1U A;  4OES A;  3RUM A;  3TFL A;  2HZL A;  3GLB A;  5I58 B;  1FTJ A;  2DXR A;  2DQV A;  3L6G A;  3TUS A;  3IR1 A;  4R72 A;  3SDF A;  4Q30 B;  4R9F A;  2DS9 A;  4ZDM A;  2ZYN A;  4KR5 A;  3USD A;  5A5X B;  5DEX A;  4Z0I A;  1QJM A;  3MP8 A;  4G8H A;  3C35 A;  1N04 A;  3PUZ E;  1EZ9 A;  3TTN A;  2I49 A;  4GRK A;  2QS1 A;  3MVX A;  4Z7E A;  3K6U A;  2ESN A;  2OK2 A;  3O6H A;  3PMW A;  1EH3 A;  3R7X A;  4E0W A;  2B3B A;  1POT A;  1WOD A;  3B6T A;  3FGS A;  4ZEK A;  4P0I A;  1SBP A;  5JTY B;  4DZ1 A;  1R9Q A;  2HAU A;  3LSF B;  1J1N A;  4FEC A;  1A99 A;  3OEL A;  1UTB A;  4RA1 A;  5F1Q A;  2REJ A;  2Z8F A;  1LFI A;  2VP1 A;  4KCD A;  4N07 A;  5L8D A;  2F7B A;  2OWS A;  2PT1 A;  2V3U A;  4YB7 A;  3MWB A;  3SEU A;  2X26 A;  4ZEB A;  2HAV A;  3DP6 A;  3K00 A;  1SW1 A;  4ZE9 A;  1OVB A;  5I58 A;  1Y4C A;  4R2F A;  4U22 A;  4JDF A;  1B3L A;  1UIV A;  3EHT A;  1VR5 A;  2FNC A;  4IO5 A;  4NF5 B;  3VVF A;  1JET A;  2THI A;  3FV2 A;  4KHZ E;  1MH3 A;  5H8F B;  3JZJ A;  3O97 A;  3CG3 A;  4NMY A;  3K0V A;  3PPR A;  4GOT A;  3CSG A;  5ELV A;  5JTY A;  1B0L A;  4F39 A;  1B9J A;  5DVI A;  5KCJ B;  1N0T A;  1P99 A;  1T0K A;  5B7D A;  4RPN A;  1B7Z A;  4X1D A;  1MXZ A;  4LP2 B;  1POY 1;  3H4Z A;  4O3B A;  4X1B A;  1LB9 A;  2A5T A;  2PYY A;  2GHB A;  4QF9 A;  3F11 A;  4HCW A;  4R73 A;  3PD9 A;  1IXH A;  1H43 A;  4R74 A;  3MZB A;  1A8F A;  3G3K A;  3R26 A;  3UK4 A;  3CRB A;  2DWH A;  3OOA A;  2Z8D A;  3KN8 A;  3D4C A;  4YMB A;  2NVU B;  4ELQ A;  1URS A;  4H5G A;  2UXA A;  3LSW A;  2DYX A;  2XXV A;  1B40 A;  1L5T A;  3LUY A;  3KZG A;  4OEN A;  1FTM A;  4DLD A;  3KOT A;  3E3K A;  4F3P A;  5AA1 A;  1Y4T A;  2V3T A;  1PEB A;  3A3U A;  4GD5 A;  1JQF A;  4DIG A;  3JV9 A;  2CMO A;  4RY1 A;  4IO2 A;  4JWY A;  4M1V A;  4QRZ A;  4NF4 B;  3I5O A;  5L9O A;  4WXJ A;  3MW0 A;  4IO6 A;  3G3H A;  3HV1 A;  2XX7 A;  3RN8 A;  3T93 B;  1UQW A;  5AA2 B;  1MXX A;  1IQ7 A;  3OSQ A;  3SEW A;  1NL5 A;  3O29 A;  3TTL A;  3FXR A;  3IB0 A;  2DSF A;  2XXQ A;  1Y3P A;  3FUZ A;  4PFT A;  5AA2 D;  5I57 B;  1URG A;  2O68 A;  3GBA A;  3HHF A;  2DVZ A;  1N84 A;  3G3F A;  5L9S A;  1SI0 A;  1N76 A;  1QVS A;  1PB8 A;  3KJ7 A;  4DCY A;  1H44 A;  1MDP 1;  2O7U A;  3O66 A;  4Q0C A;  1LBB A;  2ALU A;  2F97 A;  2UVJ A;  2Y7K A;  3SES A;  5I56 A;  2GHA A;  1MM7 A;  1IIT A;  1MG1 A;  1TFA A;  3K1P A;  2Q9T A;  2NXO A;  1Y20 A;  3KFM A;  2DVC A;  3Q29 A;  2AL4 A;  1JVY A;  2FA7 A;  4XKR A;  1P1Q A;  1TWY A;  1ZU0 A;  2DE2 A;  4OMB A;  5EHM A;  3TDJ A;  1NNF A;  1PBP A;  1M5C A;  4POW A;  2O6A A;  2I4B A;  2LAO A;  2P0S A;  3EF7 A;  4HTG A;  2I4C A;  3E9X A;  2IA4 A;  2XHD A;  4KYE A;  1DTZ A;  2RCB A;  1B7H A;  1MPC A;  3LSX A;  4OEU A;  3OO7 A;  1Z7N E;  4FE8 A;  1IIW A;  3LBS A;  1B3H A;  4QFO A;  1VFD A;  3E13 X;  3IO4 A;  3P7I A;  4R2B A;  3VLV A;  4F29 A;  5I84 A;  3OSR A;  1MY3 A;  2IEE A;  4LVQ A;  2Y7R A;  3PU5 A;  2OWT A;  1I6Q A;  4ZS9 A;  3G3J A;  1US5 A;  3ILU B;  4NTL A;  3TZA A;  4EQB A;  1A40 A;  5ITO A;  3DEL B;  5KDT B;  1MQG A;  2H25 A;  5FTH A;  3RPW A;  4QSD A;  3RT8 A;  4MLQ A;  1XVY A;  1FW0 A;  3SEY A;  2I48 A;  3PUY E;  3UIF A;  4KI0 E;  4L17 A;  5H8N A;  4F18 A;  1SYH A;  2RC9 A;  1LAH E;  1MQH A;  4M4G A;  3K6V A;  2XD3 A;  1B7U A;  1B5H A;  2ONS A;  3Q26 A;  1II5 A;  1VFE A;  3KSJ A;  3SEV A;  3V89 B;  3N6U A;  4JSO A;  4Q8R A;  5H8H B;  2F78 A;  1M5F A;  3IL1 B;  3QIM A;  4I9D A;  3OEM A;  2O7I A;  4IGR A;  2B65 A;  2Z22 A;  1ATG A;  2UVI A;  1H45 A;  2F7C A;  4KD5 A;  5EYF A;  4F1V A;  1FQE A;  4DDD A;  4NF4 A;  1B46 A;  1F9B A;  2NUV A;  3L6H A;  4OFO A;  4P0G A;  2QPQ A;  4GQO A;  2GRV A;  2VOZ A;  3SER A;  3VDF A;  4YB5 A;  3MZ9 A;  1R9L A;  3TCG A;  3FJG A;  3TKD A;  1MXU A;  4TQU Q;  1OQH A;  3LSL A;  4G8N A;  4NF8 B;  4POX A;  4FAT A;  4PET A;  1MY1 A;  1DPP A;  4GWO A;  2D3I A;  1MS7 A;  4BDQ A;  2HQ0 A;  2DWI A;  2ZNS A;  3PPO A;  1IUD A;  4QFP A;  3W9W A;  5FTI A;  5HBC A;  4LA9 A;  4U21 A;  1FQF A;  1MDQ A;  4H65 A;  4ONY A;  4ZEF A;  2R9J A;  1LST A;  1MXW A;  1YTV A;  4GL0 A;  5TP9 B;  3Q28 A;  5CBR A;  1SVX B;  2RIN A;  3TEP A;  2DOJ A;  1QKA A;  2PT2 A;  3KSX A;  3M3L A;  4QSC A;  4F1Y A;  2REG A;  3QXM A;  3G3I A;  4LZ7 A;  4HCY A;  3D4G A;  5H8Q B;  1DPE A;  4UA8 A;  3PPQ A;  3TPA A;  4BDR A;  1DOT A;  5I57 A;  3MP1 A;  1NNT A;  1MPD A;  3G3G A;  1LGB C;  2H5Y A;  4LQ2 A;  2F6G A;  2BJJ X;  1SW5 A;  3RT6 B;  4H6D A;  1ZKB A;  1Y9U A;  2F7A A;  2OZZ A;  2Z23 A;  4F3S A;  1A54 A;  1UTH A;  4U4X A;  4TLM B;  1GTK A;  3HPI A;  3WAE A;  2RKM A;  2O1L A;  1PC3 A;  3VVE A;  1FCK A;  3BFT A;  3S9L C;  2X7P A;  3QAX A;  1IXG A;  1FTK A;  3MAM A;  3BBR A;  3G7W A;  3IK6 B;  3TOD A;  4U1O A;  4BDN A;  4R6K A;  4KPT A;  3S9N C;  3TTR A;  4R6Y A;  2XXR A;  1ZIU A;  2HZK A;  2ONK E;  3FVN A;  3GXA A;  1I69 A;  2RF1 A;  3BKI B;  1GV8 A;  3UP9 A;  3T96 B;  1BLF A;  1B4H A;  3H6W A;  4RXL A;  5A5X A;  3T22 A;  3K6X A;  4KYD A;  2OCU A;  1H3D A;  3TCF A;  2OLB A;  1N3X A;  3CFL A;  4EUO A;  1B5I A;  1JEU A;  2B3F A;  2PVU A;  4H0W A;  4DXU A;  3ZSF A;  3GZG A;  3VVD A;  3PPP A;  3OMB A;  4H8I A;  1DMB A;  4F3G A;  1ZJL A;  2H9B A;  4FEB A;  3C9H A;  3TAJ A;  4KYS A;  4YU0 A;  2Y7P A;  2X7Q A;  3KN3 A;  4DE8 A;  4DCX A;  5H8F A;  1B2H A;  1ZTY A;  3JYR A;  4TOZ A;  4XIG Q;  3IJX B;  3QSL A;  1MXV A;  1JNF A;  1OVT A;  2RCA A;  3FV1 A;  3OEK A;  4NF5 A;  5IKB A;  4O3A A;  4FAJ A;  3H06 B;  2RC7 A;  3EPE A;  3OO6 A;  2AL5 A;  2PX1 A;  3CSB A;  1PDA A;  1MRP A;  2XX9 A;  2YJP A;  4ZEC A;  4EXK A;  4ELP A;  3FAS A;  3M3F A;  4IY5 A;  4O3C A;  4UAC A;  3FXU A;  3K02 A;  3K01 A;  3QK6 A;  4X48 A;  2Q2C A;  1PBQ A;  5ISU A;  3PMV A;  4WEP A;  3FD3 A;  4K3F A;  2DE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...