3OXNA

The crystal structure of a putative transcriptional regulator from vibrio parahaemolyticus
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
215
structure length
213
Chain Sequence
PQQCDQTFTIATTDYAMQTILPFALPRIYQEAPNVSFNFLPLQHDRLSDQLTYEGADLAICRPTGPVEPLRSEILGRVGVLCLLSKQHPLANQEMSLDDYLSHPHAMIAISDGVKALIEQALIDKPQRKMVLRAYHLEAALAIVLPIIITVPADLAYLVAERYDLVVKPLPFQFTPFDYSMIWHARCEHSPAQEWLRSVVREECSRLIAKRIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Putative transcriptional regulator, LysR family
publication title The crystal structure of a putative transcriptional regulator from Vibrio parahaemolyticus
rcsb
source organism Vibrio parahaemolyticus
total genus 48
structure length 213
sequence length 215
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3oxnA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3oxnA02
3PPNA 3C4MA 1GVCA 3E3KA 5CMMA 3WAFA 3L6GA 1ZMGA 2RCBA 3FVGA 2R6GE 4F3BA 4TLMB 2QMXA 4M4GA 3TTKA 3W9WA 1N7WA 2NWJA 1LLSA 4EUOA 5DT6A 2RC9A 3TTMA 4GL0A 4R9GA 1PB7A 2O1LA 5JEIA 2HAUA 2XXRA 1VSOA 3SEVA 5DTBA 4F31B 2B65A 2Y84A 5KCJB 2AYSA 2AL5A 1EZ9A 2REGA 1HSLA 4H5GA 1QUKA 3EHSA 4N07A 2XD3A 5ICQA 3TTNA 1MQDA 4DLDA 3TODA 2V25A 1N04A 5L9MA 1SYHA 1H45A 3VXBA 2X7QA 1RKMA 4RK9A 1II5A 1ZIUA 4WXJA 3QYTA 4H67A 5TPAA 3KN8A 3RT6B 2QS4A 2UVIA 3OO6A 1PBPA 3BFUA 3TPAA 1OIBA 5FTIA 1DTZA 2VD3A 4DDDA 3RT8A 4YKIA 2KLFA 5AA1A 1GV8A 1ZJLA 3MP6A 1POY1 4JXIA 4OEVA 1B58A 3O66A 4NF4A 4F1VA 3U94A 1TT1A 4MBPA 3K02A 2Z23A 3S9MC 1A55A 3CFZA 3LR1A 1IXHA 3VE1B 1MS7A 4UA8A 2PMSA 4GWOA 2D5WA 3LSXA 4FEDA 2OK2A 3MBPA 1SBPA 2RKMA 5I2NB 1DMBA 3TELA 4IO7A 1R9QA 3KJTA 1BIYA 1B52A 5H8NB 2RCAA 2ZMBA 4QFNA 5KZTA 2QPQA 1BTJA 2O7UA 4ECFA 4OYVA 4ZEDA 2QL3A 2QRYA 2XXYA 4JSOA 3W15C 1B7HA 3ZKKA 3TUSA 4YKKA 4PP0A 3K6XA 2GH9A 3RPWA 2Q2CA 3OXNA 1FCKA 3K2DA 3UK4A 1QULA 3HO7A 3OMBA 1MDP1 3PMXA 4NWDA 1US5A 4KYEA 5A5XA 3H7MA 3EF7A 4OVJA 3C36A 3AXFA 3O9PA 3U8QA 2DWJA 1WDNA 4NF6B 4LP2B 3SEYA 3CG1A 3E4RA 4LZ8A 2GFEA 4C1UA 1AIVA 4JB7A 4KFQA 2XXWA 4BDMA 1MY0A 1LFGA 4HS7A 2O7IA 3M3LA 3DP6A 2ESNA 4ZEIA 3TCFA 2HXWA 4ZZEA 4ZEFA 2I3WA 2F8DA 1MQJA 4R72A 3L6HA 1SQYA 1YAEA 3G3FA 3TDJA 3C33A 4F29A 4AB6A 1IXCA 1I6BA 3FUZA 4KYDA 4GXAA 4EQBA 1B6HA 1O63A 4BDQA 1Z7NE 1FTKA 1LCTA 4RPNA 4F3SA 2VD2A 1B5JA 3HSTA 3PMVA 3GLBA 3PD9A 4YMBA 3KZGA 1YTVA 1N7XA 2CMOA 2ZYKA 4ZEKA 1EH3A 4IO3A 4FORA 2D3IA 3CRBA 3UA8A 4R74A 4GQOA 1URGA 4C1TA 2GRVA 3GZGA 1QKBA 1Y3QA 4C0RA 3O97A 3QXMA 4IB2A 4O3CA 4ELRA 2Q9TA 3C32A 3TCHA 2O68A 3KG2A 1B32A 3B6WA 1MPCA 4FJPA 4NWCA 3MJNA 1ANFA 4I9DA 3FVKA 4LUBA 3MC2A 3MZBA 4KYSA 3V5AA 2Z8EA 2XXIA 4GL8A 3N26A 5I56A 3RTWB 2DVCA 3VFJA 1OQGA 4O3BA 4QFLA 3OELA 5L9SA 5ICTA 5H8FA 1IITA 3C35A 1DTGA 1OVBA 2PT1A 3ILUB 3UGWA 1DSNA 4G8NA 3G7WA 5K2XA 4NTLA 5CBSA 4F2OA 4KHZE 4U1OA 2DE2A 4NF5A 2O84X 3I6VA 2ONRA 1TFDA 2DWIA 2DXRA 2XXQA 3G3GA 1ZLQA 1J1NA 3KJ7A 2O51A 5CC2A 4JDFA 3TEPA 4KI0E 4RPOA 3OEMA 4JBZA 2Q88A 5H8HA 1MG1A 2H25A 2Q8JA 4I62A 1B0LA 1FTJA 2I0CA 2DQVA 1FQBA 5H8QA 1PB8A 1MPBA 1Y3NA 4G4PA 3W9VA 1POTA 2P0SA 2NXOA 4DXBA 2DWHA 2QSXA 3OO8A 1B7UA 4N13A 4ZECA 5FHMA 3UN6A 2VGQA 1MH3A 3S9LC 1VFEA 1NKXA 1B0HA 1S50A 4H5FA 4RXLA 2F78A 2XXVA 2G29A 2I3VA 3MVXA 2X26A 5B70A 2NUVA 5IKBA 2IEEA 2UVJA 4G8MA 4H8JA 2QS3A 1B9JA 4QFPA 4X1DA 5AA2A 3OO7A 3MZ1A 2XXPA 5H8SA 1MM6A 3FATA 2XX8A 4NF8A 1MDQA 1RYOA 3CR9A 5L8DA 3EN3A 5ITPA 3OD7A 3SEXA 4U22A 4G68C 1URSA 5CMCA 3T96B 4XKQA 4GLIA 4XKNA 3QSLA 3R26A 1N76A 3U92A 2P1SA 4YKPA 3F11A 4RK2A 3IB0A 3OSQA 3FVOA 4KQPA 5DVFA 1B40A 1LFIA 1USYH 2ANJA 1QUJA 2YJPA 3JV9A 4X9TA 1BP5A 1Y1ZA 3IO6A 1O7TA 3OSRA 2XXTA 1SD3A 3K4UA 5EHSA 1AL3A 2Q2AA 3FXUA 2O1MA 3SESA 4H8IA 4E0XA 1UTBB 2D21A 3PU5A 1A8EA 1MY2A 4LONB 4RYAA 2Y7PA 1SW1A 3A09A 1D4NA 3M8UA 3BFTA 2G93A 5KCJA 3IR1A 5HBCA 3QUFA 2ZYOA 4F1UA 4MF3A 4H0WA 4OETA 4YB5A 3UP9A 1KWHA 5DVIA 1IXGA 3K6WA 1NH7A 2X7PA 3FXQA 3IOTA 1JVYA 5I2KA 4IGRA 3HHGA 4N6PA 3QAXA 5F1QA 3HN0A 1QVSA 2ZYNA 4ZS9A 3PD8A 1EZOA 2RF1A 4BDLA 1QKAA 2I48A 1WODA 2ABHA 1OMPA 5FTHA 4OTEA 3T9VA 2ALUA 1UIUA 4DZ1A 1P1QA 4QFKA 5I57B 4IO6A 1B51A 1FQDA 5HPQA 4DE8A 1FTOA 2V84A 1MQIA 3FGSA 4H65A 3RLFE 1JEVA 4Q8RA 1PB9A 2F7CA 4G68B 3PGFA 1Y4TA 3GXAA 3C34A 4QRZA 1UTHB 4EXLA 1A7LA 5FHOA 5CM6A 4ND9A 2DP8A 3USDA 1AOVA 5TP9B 3U93A 3VDFA 3B6TA 1VE4A 1MY3A 5I2NA 4ONYA 4HCWA 3FASA 2I58A 5H8NA 1B5IA 1FQFA 3PV0E 1XVXA 3VLVA 3VXCA 1LGBC 1UQWA 2Z8DA 3Q26A 1LSTA 1US4A 1F9BA 4Q30B 1P1NA 2H98A 5CBRA 4TQUQ 4IY6A 2V93A 3TZAA 5JTYA 1IIWA 3IB2A 3V8XB 4Z7EA 3K1PA 3FV1A 3RUMA 3MVYA 3B7DA 2AL4A 3IB1A 3K6VA 4FAJA 4H6DA 1EU8A 2OWTA 4OHNA 2THIA 5I58B 4P11A 1A54A 1SVXB 5AA4A 2Y7KA 3SEWA 1R1NA 4NF6A 3QUJA 1EZPA 1LCFA 3OENA 3V83A 1ELJA 4EF1A 1TFAA 3TQLA 4U1ZA 2I4CA 1Y20A 3O2AA 2DXYA 3OOAA 1IXIA 3T9UA 1QJMA 1A99A 1OLCA 3RN8A 1GR2A 4EDPA 4TOZA 2REJA 1TWYA 5KDTB 1I69A 3O29A 3FJ7A 1MY4A 4AQ4A 2ZNSA 4KCDA 2VOZA 2XXUA 3G3JA 1ZKBA 1CB6A 1B1HA 2QS2A 4ELPA 1B3EA 1WVJA 4LVQA 3FIRA 1PDAA 2FNCA 3H06B 2Y7RA 4R2FA 2OCUA 4F2QA 2Z22A 4QFOA 1Q1KA 1PBQA 2UVGA 4HCYA 3FV2A 5I59B 4F3GA 4QSEA 3MPLA 1L5TA 2GHBA 4G77A 4GIZA 1FQCA 3PPPA 3SEUA 1AH5A 4X48A 3TCGA 2VHAA 3O28A 5DEXB 2YPNA 3MVZA 1B46A 4M1VA 4YB7A 2Z8FA 1USYE 4P0GA 1SDXA 3C9HA 1QW0A 1A8FA 2QMWA 1MXYA 4O3AA 4POXA 4LQ5A 1I6AA 3IL1B 5L9OA 1NL5A 1DPEA 3TTLA 3U72A 3T9XB 1T0KA 3MUQA 4U4SA 4G2ZA 2FYIA 1NNPA 3JYRA 1VFDA 3K6UA 4OQOA 5ISUA 1ATGA 1SI1A 4R75A 2HAVA 3S4UA 1JW5A 4EXKA 2PVUA 3OO9A 2QS1A 1GGGA 2UVHA 1MXXA 2FA7A 4G8HA 4I1DA 2V3QA 3PMWA 1YPNA 4IGTA 2R71A 4NF5B 3O6IA 2M8CA 4ZE8A 4BDOA 5AE4A 1MM7A 2B3BA 1B3LA 3TMGA 1H43A 4DXUA 1D3KA 4IO4A 4FIMA 5H8HB 1HSEA 2RINA 3EQ1A 4RY1A 1H3DA 3CFXA 5J1DA 5H8QB 3CG3A 2HCAA 1P99A 1IQ7A 2Q89A 1R6ZA 4GD5A 2A5TB 2UYEA 4OESA 3IX1A 3K0VA 3MZ9A 1P1WA 2V3UA 2DVZA 3N5LA 3K00A 2ZNTA 1OQHA 5TU0A 5AA2B 1ZBMA 3PUWE 4WKMA 1MH4A 1LBCA 4YZZA 4YU0A 4L17A 3G3KA 3ODBA 3VVEA 3DP8A 4MLQA 4PFTA 4OMBA 1NMUA 4JWOA 2O6AA 3KSXA 3P7IA 4EQ7A 3G3IA 1M5EA 4YKJA 2H99A 4FEBA 1N84A 3GBBA 3RNNA 4ESWA 4GF8A 4PETA 3S2VA 2OBGA 3IJXB 4BLAA 4KPTA 1LAGE 3D4CA 1B1XA 4I8CA 2XD2A 4JWYA 1Q35A 3M3KA 3ECRA 3VVDA 1B3HA 1R9LA 3IORA 2VP1A 2I6EA 2DS9A 1MQHA 1MXUA 1JNFA 3SDFA 3N94A 3U1OA 5JK4A 1SW5A 1NFTA 2F7AA 3RY3A 1Y9UA 1P1OA 3IO4A 4PFUA 3EHUA 4WEPA 4ZEBA 4K3FA 4GOTA 1URDA 1PC3A 4GRKA 5CI5A 3UORA 3HHFA 1OVTA 2Y7WA 3DELB 4ISUA 4LZ5A 2DOJA 2R9JA 2YLNA 3R6UA 3KN7A 2GHAA 1OLAA 1UTBA 2F7BA 2WKYA 1FQEA 5IAIA 2E1SA 3QIMA 4E0WA 3LSLA 2OWSA 2DE3A 1IUDA 2ZNUA 4PFYA 3A3CA 3WAEA 5I2KB 2NVUB 4FATA 1FTMA 4NE4A 2RC8A 2HEUA 5TPAB 4F1YA 5BUUA 4AB5A 3N6TA 5EYFA 3TTRA 3IAZA 3IOVA 2H4IA 4XXUA 4F18A 2I4BA 4ZDMA 4U23A 3ZSFA 3JZJA 1JQFA 4H1XA 3H03A 1ZTYA 1JEUA 2F5XA 3PUVE 3CI8A 4BDRA 4IY5A 4EQ9A 4QF9A 4NF4B 2HFBA 2XX9A 1H76A 1SI0A 5BWJA 1NNKA 5I57A 1A40A 1XHYA 3TFLA 2I49A 3HCQA 4YB6A 2IA4A 1SW4A 4MLVA 2H5YA 1MRPA 2ONKE 2NOOA 5AA2D 2CZLA 4QSCA 4RNSA 2DWAA 4OFOA 3MWBA 4FE8A 4G68A 2OJTA 1UIVA 1B2HA 1Y1MA 2P2AA 1B5HA 3Q27A 1UTHA 2BJJX 3VLUA 2DYXA 4JWXA 4GFRA 3KGCA 4PE5B 2XXHA 4Q0CA 4YICA 5TP9A 3ILTB 3OEKA 2XXXA 4YMAA 2F36A 2PX1A 3A3UA 4YAHX 3RTFB 2O69A 5DVJA 1XT8A 4KR5A 2H9BA 3MP1A 1PEBA 4X1BA 5A5XB 5JTYB 4KD5A 1LB9A 1LAHE 3KN3A 1O64A 3LSWA 4ELQA 4QHQA 1BLFA 3KEIA 3SERA 3MVWA 1SYIA 1NNFA 1MXZA 3ONMA 4OFLA 3KBRA 1S9TA 3PPOA 3TAJA 3K01A 2UYFA 5AA4B 3RGYA 1YCJA 4OENA 2RC7A 4RA1A 1JETA 3VVFA 2ZXTA 3T22A 4DCXA 3CSBA 3LBSA 4XTCQ 4RJZA 5FHNA 5I58A 3KOTA 4LATA 3M3FA 3RQTA 3LUYA 2HQ0A 2Y7IA 4HTGA 3DM0A 1IZ1A 3HPIA 3LC8A 4LA9A 1D9VA 4P0IA 2DE4A 3H6WA 1N0TA 3H6TA 3DLNA 3SKPA 2OZZA 1SW2A 5LOMA 4U4XA 3FD3A 1M5CA 5CMBA 4ZZAA 3FZVA 4MFIA 3EPEA 1LAXA 3PUZE 1CE2A 4OEUA 3CFLA 2A5SA 3T66A 5F7VA 1JVXA 1DOTA 2XX7A 4XIGQ 3Q29A 4XKPA 2QJEA 5KDTA 3PUYE 4PFWA 3K1NA 4F19A 3UIFA 5DYHA 3CVGA 1VR5A 3CSGA 4QSDA 3SETA 4R6YA 1Z7ME 3T93B 1N3XA 3MPKA 1B4ZA 4PQJA 3CIJA 3BKIB 5AA3A 3S9NC 4DXCA 2I0BA 1XS5A 3FVNA 1Y4CA 5I59A 1B4HA 3THIA 1MPDA 3TKDA 4WEDA 1LAFE 4KCCA 3C31A 2ONSA 5DEXA 2F6PA 1GTKA 1LB8A 1AMFA 4UACA 4R9FA 5I56B 3TYHA 3H4ZA 4Z0IA 1MQGA 1MXVA 1B7ZA 3T9HB 1HSJA 1FW0A 1N3WA 4THIA 1JW1A 2V3TA 4U2RA 5B7DA 4OZ9A 5H8FB 3KOSA 3E13X 3VLWA 4OWDA 3G3HA 3E9XA 2B3FA 3D4GA 3O6GA 4JSDA 1QUIA 1XC1A 4LZ7A 4IO2A 3MAMA 3TQWA 1XVYA 3HV1A 1MY1A 3FJGA 1LFHA 2LAOA 4EF2A 2W7YA 4XKRA 1M5DA 3FJMA 3QK6A 4Q5TA 3MP8A 4FECA 1TXFA 2PBWA 3IOUA 5ELVA 3DP4A 3MW0A 3BBRA 2OLBA 3H3GA 5K2YA 4BDNA 1I6QA 5I84A 3O6HA 2HZKA 3LSFB 3I3VA 2E0SA 4OXVA 3FXRA 1M5FA 2AIXA 4DIGA 2PYYA 3MQ9A 2HZLA 4F39A 2F34A 3N6UA 1FQAA 4R73A 3IJOB 1MXWA 1RYXA 3Q28A 1M5BA 3KFMA 3R7XA 2DSFA 3ZS6A 3B6QA 3GBAA 2F97A 1B3GA 1IEJA 4OFJA 1JW4A 4ESXA 1B05A 3PUXE 3S9EA 1H44A 2UXAA 4NEDA 3PPRA 1Y3PA 2A5TA 5ITOA 5CMKA 1S7YA 3I5OA 3IOWA 2XHDA 4ELOA 1LBBA 5EHMA 4NF8B 4ZE9A 3VV5A 4GXSB 4U21A 1NNTA 4DCYA 2F35A 3ZKLA 1BKAA 1FTLA 2PT2A 4GVOA 3V89B 4IO5A 4LQ2A 4F3PA 4TLLB 3Q25A 1B3FA 3H6UA 4R6KA 5HM4B 3H6VA 3EHTA 3IK6B 5CRYA 3PPQA 1DPPA 4OERA 5M2VA 4R2BA 1XOCA 1NH8A 2ZYMA 4R6HA 1P1UA 4POWA 4F22A 4NMYA 1D9YA 2F6GA 1ZU0A 3KSJA 4MH5A 3K1MA 4HW8A
chains in the Genus database with same CATH superfamily
3PPNA 3C4MA 1GVCA 3E3KA 5CMMA 3WAFA 3L6GA 1ZMGA 2RCBA 3FVGA 2R6GE 4F3BA 1G0HA 4TLMB 2QMXA 4M4GA 3TTKA 3W9WA 1N7WA 2NWJA 1LLSA 4EUOA 5DT6A 2RC9A 3TTMA 4GL0A 4R9GA 1PB7A 5EQ7A 3RYDA 2O1LA 5J16A 5JEIA 2HAUA 2XXRA 2JJKA 5IM2A 5IZZA 4P9KA 1VSOA 3SEVA 5DTBA 4F31B 2B65A 4XFEA 2Y84A 4MNIA 2GQ1A 1IMDA 5KCJB 2AYSA 2AL5A 1EZ9A 2REGA 1HSLA 1LEVA 4H5GA 1QUKA 3EHSA 4N07A 2XD3A 5LDZA 5ICQA 3TTNA 1MQDA 4DLDA 4OVTA 3TODA 1FBHA 2V25A 1N04A 5L9MA 1SYHA 1H45A 3VXBA 2X7QA 1RKMA 4RK9A 3RPLB 1II5A 4PDDA 1ZIUA 4IR8A 4NAPA 4WXJA 3QYTA 4H67A 5TPAA 3KN8A 3RT6B 2QS4A 4HE0A 2UVIA 3OO6A 1PBPA 3BFUA 3TPAA 1OIBA 5FTIA 1FBPA 1DTZA 2VD3A 4DDDA 3RT8A 4YKIA 5EQ9A 2KLFA 1LBVA 5AA1A 1LBXA 1GV8A 1ZJLA 1NI9A 3MP6A 2FHYA 3FXBA 4I3YA 1POY1 4JXIA 4OEVA 1B58A 3O66A 4N91A 4NF4A 3U94A 4F1VA 1TT1A 4MBPA 3K02A 2Z23A 3S9MC 1A55A 3CFZA 3LR1A 1IXHA 3VE1B 1MS7A 4GWSA 1D9QA 4UA8A 2PMSA 4GWOA 2D5WA 3LSXA 4FEDA 2OK2A 3MBPA 3SZPA 1SBPA 2RKMA 5I2NB 1DMBA 3TELA 4IO7A 1R9QA 3KJTA 1DK4A 1BIYA 1B52A 5H8NB 2RCAA 2ZMBA 5ESYA 1CNQA 5IZ3A 4QFNA 5KZTA 2QPQA 1BTJA 2O7UA 4ECFA 4OYVA 4ZEDA 2QL3A 2QRYA 2Y5KA 2XXYA 4JSOA 3B8BA 1FTAA 4MCOA 3W15C 1FPIA 2XWVA 4OVQA 1B7HA 3ZKKA 3TUSA 4YKKA 4PP0A 3K6XA 2GH9A 3RPWA 2Q2CA 3OXNA 1FCKA 3K2DA 2WBBA 3UK4A 1QULA 3HO7A 3OMBA 1MDP1 3KC0A 3PMXA 4NWDA 1US5A 4KYEA 5A5XA 3H7MA 3EF7A 2ZZWA 4OVJA 3C36A 2FBPA 3AXFA 3O9PA 3U8QA 2DWJA 1WDNA 4NF6B 1YZ0A 4LP2B 2QVVA 3SEYA 3CG1A 2VPOA 3E4RA 4LZ8A 2GFEA 4C1UA 1AIVA 4JB7A 4KFQA 2XXWA 4BDMA 1MY0A 1LFGA 4HS7A 2O7IA 3M3LA 1NV3A 5IZ1A 1RDXA 3DP6A 2ESNA 4ZEIA 1YYZA 2HXWA 4ZZEA 3TCFA 4ZEFA 2I3WA 3B50A 2F8DA 4P1LA 2PFZA 1MQJA 2QFLA 4PAFA 4R72A 3L6HA 1SQYA 4GX4A 1YAEA 2L5VA 3G3FA 3TDJA 3C33A 4F29A 4AB6A 1IXCA 1I6BA 3FUZA 4KYDA 4GXAA 4EQBA 1B6HA 1O63A 4PGNA 4BDQA 1Z7NE 3LV0A 1FTKA 3D1RA 3KBZA 1LCTA 4RPNA 4F3SA 2XXKA 2VD2A 1B5JA 3HSTA 4HXVA 3PMVA 3GLBA 3PD9A 4YMBA 3KZGA 1YTVA 1N7XA 2CMOA 2ZYKA 1NV6A 4ZEKA 1EH3A 4IO3A 5I7IA 4FORA 2D3IA 3CRBA 3UA8A 4R74A 4GQOA 1URGA 4C1TA 2GRVA 3GZGA 1QKBA 1Y3QA 4C0RA 3O97A 3QXMA 4IB2A 4O3CA 4ELRA 2Q9TA 3C32A 3GYYA 3TCHA 2O68A 3KG2A 1B32A 3B6WA 1MPCA 4FJPA 4NWCA 3MJNA 1ANFA 4I9DA 3FVKA 4LUBA 3MC2A 3MZBA 4KYSA 3V5AA 2Z8EA 2XXIA 4GL8A 3N26A 5I56A 4N8GA 3RTWB 2DVCA 3VFJA 1OQGA 4O3BA 4QFLA 3OELA 5L9SA 5ICTA 5H8FA 4GBWA 1IITA 3C35A 1DTGA 2Y5LA 1OVBA 3CHGA 2PT1A 3ILUB 3UGWA 1DSNA 4G8NA 4PGPA 2B4LA 3G7WA 5K2XA 4NTLA 5CBSA 4F2OA 4KHZE 1FSAA 4U1OA 4DI4B 5T3JA 2DE2A 4NF5A 4NGUA 2O84X 4JVCA 3I6VA 2ONRA 1TFDA 2DWIA 2DXRA 2XXQA 3G3GA 1ZLQA 2WX9A 1J1NA 3KJ7A 2O51A 5CC2A 4JDFA 3TEPA 4KI0E 4RPOA 3OEMA 4JBZA 2Q88A 4PBQA 4OVSA 4N4UA 5H8HA 1MG1A 2H25A 2Q8JA 3PTYA 4I62A 1B0LA 1FTJA 2FVZA 2MKZA 2I0CA 2DQVA 1FQBA 5H8QA 1PB8A 1MPBA 1Y3NA 4G4PA 3W9VA 4UABA 1POTA 2P0SA 4PF6A 2NXOA 4DXBA 2DWHA 2QSXA 3OO8A 1B7UA 4N13A 4ZECA 5FHMA 3UN6A 2VGQA 1MH3A 3S9LC 1VFEA 1NKXA 1B0HA 1S50A 4H5FA 4RXLA 2F78A 2XXVA 1NV0A 2G29A 2I3VA 4NQ8A 3MVXA 2X26A 4P3LA 5B70A 2NUVA 5IKBA 2IEEA 2UVJA 4G8MA 4H8JA 2CZKA 2QS3A 1B9JA 4QFPA 4X1DA 5AA2A 4O7MA 3OO7A 3MZ1A 2XXPA 4FBPA 1MM6A 5H8SA 3FATA 2XX8A 4NF8A 4OVRA 1MDQA 1RYOA 3CR9A 5L8DA 3EN3A 5ITPA 5LTCA 3OD7A 3SEXA 4U22A 4G68C 1URSA 5CMCA 3T96B 4XKQA 2OX3A 4GLIA 4XKNA 3QSLA 3R26A 1N76A 3U92A 2P1SA 4YKPA 3F11A 4RK2A 3IB0A 3OSQA 3FVOA 4KQPA 5DVFA 1B40A 1LFIA 1USYH 3HFUA 5EQAA 4PE3A 2ANJA 1QUJA 2YJPA 3JV9A 1FPJA 4X9TA 4MNPA 1BP5A 1Y1ZA 3IO6A 4NF0A 1VDWA 2F3DA 1O7TA 3OSRA 2XXTA 1SD3A 3K4UA 5EHSA 1AL3A 1INPA 2Q2AA 3FXUA 3IFAA 2O1MA 3SESA 4H8IA 4E0XA 1UTBB 2D21A 3PU5A 1A8EA 1MY2A 4LONB 4GBVA 4O94A 4RYAA 2Y7PA 1SW1A 3A09A 1D4NA 3M8UA 3BFTA 2G93A 5KCJA 3IR1A 5HBCA 3E79A 3QUFA 2VPNA 1EYJA 2CEXA 2ZYOA 2ZZVA 4XF5A 4F1UA 4MF3A 4HE2A 4H0WA 4N8YA 4OETA 4YB5A 3UP9A 1KWHA 5DVIA 1IXGA 4G61A 3K6WA 1NH7A 2X7PA 3FXQA 3IOTA 1JVYA 5I2KA 4IGRA 3HHGA 2WEFA 4N6PA 3QAXA 5F1QA 3HN0A 1QVSA 2ZYNA 5ET5A 4ZS9A 3PD8A 1EZOA 2RF1A 4BDLA 1QKAA 2I48A 1WODA 2ABHA 1OMPA 5FTHA 4OTEA 3T9VA 2ALUA 1FPLA 1UIUA 4DZ1A 1P1QA 4QFKA 5I57B 4IO6A 1B51A 1FQDA 4AS4A 2XWOA 5HPQA 4DE8A 4OANA 1FTOA 2V84A 1MQIA 3FGSA 1NUYA 4H65A 3RLFE 4P47A 1JEVA 4Q8RA 1PB9A 2F7CA 2WBDA 4G68B 5A5LA 3PGFA 1Y4TA 3GXAA 3C34A 4QRZA 1UTHB 4JVDA 4EXLA 1A7LA 5FHOA 5CM6A 4ND9A 2DP8A 3USDA 1AOVA 5TP9B 3U93A 3VDFA 3B6TA 1VE4A 1MY3A 5I2NA 4ONYA 3ISPA 1KZ8A 4HCWA 3FASA 4NG7A 2I58A 3QMFA 5H8NA 5EYHA 1B5IA 1FQFA 3PV0E 1XVXA 3VLVA 3VXCA 1LGBC 1UQWA 5EQ8A 1NUXA 2Z8DA 3FBPA 1LSTA 1US4A 3Q26A 5EYGA 1F9BA 2XWKA 4Q30B 5I5PA 1P1NA 2H98A 5CBRA 4TQUQ 4IY6A 2V93A 3TZAA 5JTYA 1IIWA 3IB2A 3V8XB 4Z7EA 3K1PA 3FV1A 3RUMA 3MVYA 3B7DA 2AL4A 3IB1A 3K6VA 1NV4A 3KC1A 4N15A 4FAJA 4H6DA 1EU8A 4GWWA 2OWTA 4OHNA 2THIA 5I58B 2Q8MA 4P11A 1A54A 1SVXB 5AA4A 2Y7KA 3SEWA 1R1NA 4NF6A 3QUJA 1EZPA 1LCFA 3OENA 3V83A 1DCUA 1ELJA 4EF1A 1TFAA 3TQLA 2CZHA 4U1ZA 2I4CA 1Y20A 3O2AA 4XEQA 4O7IA 2DXYA 3OOAA 1IXIA 3T9UA 1QJMA 1A99A 2FIXA 1OLCA 4NN3A 3RN8A 1GR2A 4EDPA 4TOZA 2REJA 1TWYA 4P1EA 5KDTB 1I69A 3O29A 3FJ7A 1MY4A 4GX6A 4AQ4A 3MYUA 2ZNSA 4KCDA 1IMBA 2VOZA 2XXUA 1K9YA 4PCDA 3G3JA 1ZKBA 1CB6A 1B1HA 2QS2A 4ELPA 1B3EA 1WVJA 4LVQA 3FIRA 1PDAA 2FNCA 3H06B 2Y7RA 4N81A 4R2FA 2OCUA 4F2QA 2Z22A 3ROJA 4QFOA 1Q1KA 1PBQA 2UVGA 4HCYA 3U65A 3FV2A 2PFYA 5I59B 4GWXA 4GWUA 4X04A 4F3GA 4QSEA 3MPLA 4HE1A 1L5TA 2GHBA 4G77A 4GIZA 4PAKA 1FQCA 3PPPA 3SEUA 1AH5A 1RDYA 5ET8A 1FRPA 4X48A 2KQZA 3TCGA 2VHAA 3O28A 5DEXB 2YPNA 3MVZA 1B46A 4M1VA 4YB7A 2Z8FA 1USYE 4P0GA 2QVUA 1SDXA 3C9HA 1QGXA 1QW0A 1A8FA 1LBZA 1MXYA 2QMWA 4O3AA 4POXA 4LQ5A 1I6AA 1NUZA 3IL1B 4O8MA 5L9OA 1NL5A 1DPEA 3TTLA 3U72A 3T9XB 1T0KA 4PFIA 4MEVA 3MUQA 1FPGA 4U4SA 4G2ZA 2FYIA 4PBHA 1NNPA 3JYRA 1FBDA 1VFDA 3K6UA 4OQOA 5ISUA 1ATGA 1SI1A 4R75A 2XA5A 1BK4A 1FJ6A 2HAVA 3S4UA 1JW5A 1LBYA 4EXKA 2PVUA 3OO9A 2QS1A 1GGGA 2UVHA 3E78A 1MXXA 2FA7A 4G8HA 4I1DA 2V3QA 3PMWA 1YPNA 4IGTA 2R71A 4NF5B 3O6IA 2M8CA 4ZE8A 4BDOA 5AE4A 1MM7A 4QXDA 2B4MA 5F24A 2B3BA 1B3LA 3TMGA 1H43A 1FPKA 4DXUA 2HHMA 1D3KA 4IO4A 4FIMA 5H8HB 3IFCA 1HSEA 1LBWA 2RINA 3EQ1A 4RY1A 1H3DA 3CFXA 2FIEA 5J1DA 1AWBA 5H8QB 4PDHA 3CG3A 2CEYA 2HCAA 1P99A 1IQ7A 2Q89A 1R6ZA 4GD5A 4KXPA 2A5TB 2UYEA 4OESA 3IX1A 3K0VA 3MZ9A 1P1WA 2V3UA 2DVZA 1KA0A 3N5LA 3K00A 2ZNTA 1OQHA 5TU0A 5AA2B 1ZBMA 3PUWE 4WKMA 4MHFA 1MH4A 1LBCA 4YZZA 4YU0A 1SPIA 4L17A 3G3KA 3ODBA 3VVEA 2VT5A 3DP8A 4MLQA 4PFTA 4OMBA 1NMUA 4JWOA 2O6AA 2P3NA 1IMCA 3KSXA 3T1BA 4AS5A 3P7IA 4EQ7A 3G3IA 1M5EA 4YKJA 2H99A 4FEBA 1N84A 3GBBA 3RNNA 4ESWA 4GF8A 4PETA 3S2VA 2OBGA 2OWZA 3IJXB 4BLAA 4KPTA 1LAGE 4PF8A 3D4CA 1B1XA 4I8CA 2XD2A 4JWYA 1Q35A 3M3KA 4P56A 3ECRA 3VVDA 1B3HA 1R9LA 3IORA 2VP1A 2I6EA 1RDZA 2DS9A 1MQHA 1MXUA 1JNFA 3SDFA 3N94A 3U1OA 5JK4A 5I3SA 1SW5A 1NFTA 2F7AA 3RY3A 1Y9UA 1P1OA 3IO4A 4PFUA 3EHUA 4WEPA 4ZEBA 4PC9A 4K3FA 4GOTA 1URDA 1PC3A 4GRKA 5CI5A 3UORA 3HHFA 1OVTA 2Y7WA 5DW8A 3DELB 1FBFA 4ISUA 4LZ5A 2DOJA 2R9JA 2YLNA 3R6UA 3KN7A 1IMFA 2GHAA 1OLAA 1UTBA 2F7BA 2WKYA 1FQEA 5IAIA 2CZIA 2E1SA 3QIMA 3T0JA 4E0WA 4MAGA 3LSLA 1IMAA 2OWSA 2DE3A 1IUDA 2ZNUA 4PFYA 3A3CA 3WAEA 5I2KB 2NVUB 1XI6A 4FATA 1FTMA 1FPDA 4NE4A 2RC8A 2HEUA 5TPAB 4F1YA 5BUUA 4AB5A 3N6TA 5EYFA 3RPLA 3TTRA 3IAZA 4GWYA 3IOVA 2H4IA 1EYKA 4XXUA 4F18A 2I4BA 4ZDMA 4PAIA 4U23A 3ZSFA 3JZJA 1JQFA 4H1XA 3H03A 1ZTYA 1JEUA 2F5XA 3PUVE 3CI8A 4BDRA 4JVIA 4IY5A 4EQ9A 4QF9A 4NF4B 2HFBA 2XX9A 1H76A 1SI0A 4H45A 5BWJA 1NNKA 5I57A 1A40A 1XHYA 3TFLA 2I49A 3HCQA 4YB6A 2IA4A 1SW4A 4MLVA 2H5YA 1MRPA 2ONKE 2NOOA 5AA2D 2CZLA 1NUWA 4QSCA 4RNSA 4MX6A 4MIJA 2KR0A 2DWAA 4OFOA 3MWBA 4FE8A 4G68A 2OJTA 1UIVA 1B2HA 5IZ3B 1Y1MA 2P2AA 1B5HA 3Q27A 1UTHA 2BJJX 3VLUA 2DYXA 4JWXA 4GFRA 3KGCA 4PE5B 2XXHA 4Q0CA 4YICA 5TP9A 3ILTB 3BIHA 4PTKA 3OEKA 2XXXA 2XWIA 1FJ9A 1FBCA 4YMAA 2F36A 2PX1A 3A3UA 4YAHX 3RTFB 2O69A 1NV5A 5DVJA 4OVPA 1XT8A 4KR5A 2H9BA 3MP1A 1PEBA 4X1BA 5A5XB 2F3BA 1FBGA 5JTYB 4KD5A 1LB9A 1LAHE 3KN3A 1O64A 3LSWA 4ELQA 4QHQA 1BLFA 3KEIA 3SERA 3MVWA 4GX3A 1SYIA 1K9ZA 1NNFA 1MXZA 3ONMA 4OFLA 3KBRA 1S9TA 3PPOA 3TAJA 3K01A 1FPBA 2UYFA 5AA4B 3RGYA 1YCJA 4OENA 2RC7A 4RA1A 1JETA 3VVFA 2ZXTA 3T22A 1KA1A 4DCXA 3CSBA 3LBSA 4XTCQ 4RJZA 5FHNA 5I58A 3KOTA 4LATA 1JP4A 3M3FA 3RQTA 4N6KA 4QBAA 3LUYA 2HQ0A 2Y7IA 4HTGA 3DM0A 1IZ1A 3HPIA 3LC8A 4LA9A 1D9VA 4P0IA 2DE4A 1FPEA 3H6WA 1N0TA 3H6TA 3DLNA 3SKPA 2OZZA 4H46A 1SW2A 1FPFA 5LOMA 4U4XA 3FD3A 1M5CA 5CMBA 4ZZAA 3FZVA 4MFIA 3EPEA 1LAXA 3PUZE 1CE2A 4OEUA 3CFLA 2A5SA 3T66A 4DI3D 2R8TA 5F7VA 1JVXA 1DOTA 2XX7A 4XIGQ 3Q29A 4XKPA 2QJEA 5KDTA 1IMEA 3PUYE 1EYIA 4GWZA 4I40A 4PFWA 3K1NA 4X8RA 1Q9DA 4F19A 3UIFA 1DBZA 2QVRA 3CVGA 5DYHA 4NHBA 1VR5A 3CSGA 4QSDA 3SETA 4R6YA 1Z7ME 3T93B 1N3XA 3MPKA 1B4ZA 4PQJA 3CIJA 3BKIB 5AA3A 3S9NC 4DXCA 2I0BA 2ZZXA 1XS5A 3FVNA 1Y4CA 4MNCA 5I59A 3A29A 1B4HA 3THIA 1YXIA 1MPDA 3TKDA 4WEDA 1LAFE 4KCCA 3C31A 2ONSA 5DEXA 2F6PA 1GTKA 1LB8A 1AMFA 4UACA 4R9FA 5I56B 3TYHA 3H4ZA 4Z0IA 1MQGA 2DDKA 1MXVA 1B7ZA 3T9HB 1HSJA 1FW0A 1N3WA 4THIA 1JW1A 2V3TA 4U2RA 3MSTA 5B7DA 4OZ9A 5H8FB 3KOSA 3E13X 4MMPA 3VLWA 4OWDA 3G3HA 3E9XA 2B3FA 3D4GA 3O6GA 4JSDA 1QUIA 4P8BA 1XC1A 2V4CA 4LZ7A 3BIGA 1G0IA 4IO2A 3NOHA 5IGAA 3MAMA 3TQWA 1XVYA 3HV1A 1MY1A 3FJGA 1LFHA 2LAOA 4EF2A 2W7YA 4XKRA 1M5DA 3FJMA 3QK6A 4Q5TA 3MP8A 5ET7A 4FECA 2HPGA 1TXFA 2PBWA 2HXRA 4I3EA 2Q74A 3IOUA 5ELVA 3LUZA 3DP4A 3MW0A 3BBRA 2OLBA 3H3GA 5K2YA 4BDNA 1I6QA 5I84A 2WYPA 3O6HA 4N17A 2HZKA 3LSFB 3I3VA 2E0SA 4OXVA 3FXRA 1M5FA 2AIXA 4DIGA 2PYYA 3MQ9A 2HZLA 4F39A 2F34A 3N6UA 1FQAA 4R73A 3IJOB 1MXWA 1RYXA 3Q28A 1M5BA 3KFMA 3R7XA 2DSFA 3ZS6A 3EKIA 3B6QA 3GBAA 2F97A 1B3GA 1IEJA 4OFJA 5FBPA 1JW4A 1B05A 4ESXA 3PUXE 3S9EA 1H44A 2UXAA 4NEDA 2WYKA 3PPRA 1Y3PA 2A5TA 1NV7A 5ITOA 5CMKA 1S7YA 3I5OA 3IOWA 4PFRA 2XHDA 4ELOA 1LBBA 5EHMA 1NV1A 4NF8B 4ZE9A 3VV5A 4GXSB 4U21A 1NNTA 4DCYA 4N6DA 2F35A 3ZKLA 1BKAA 4NX1A 1FTLA 2PT2A 4GVOA 3V89B 1NV2A 4IO5A 4LQ2A 4F3PA 4TLLB 3Q25A 1B3FA 3H6UA 4R6KA 5HM4B 4LN5A 2BJIA 3H6VA 3EHTA 2PCRA 4MJOA 3IK6B 5CRYA 3PPQA 1DPPA 4OERA 5M2VA 4R2BA 4OA4A 1XOCA 1NH8A 2ZYMA 4PFBA 1FBEA 4R6HA 1P1UA 4POWA 5ET6A 4F22A 4NMYA 1D9YA 2F6GA 1ZU0A 3KSJA 4MH5A 2P3VA 3K1MA 4HW8A
chains in the Genus database with same CATH topology
3PPNA 3C4MA 1GVCA 3E3KA 5CMMA 3WAFA 3L6GA 1ZMGA 2RCBA 3FVGA 2R6GE 4F3BA 4TLMB 2QMXA 4M4GA 3TTKA 3W9WA 1N7WA 2NWJA 1LLSA 4EUOA 5DT6A 2RC9A 3TTMA 4GL0A 4R9GA 1PB7A 2O1LA 5JEIA 2HAUA 2XXRA 1VSOA 3SEVA 5DTBA 4F31B 2B65A 2Y84A 5KCJB 2AYSA 2AL5A 1EZ9A 2REGA 1HSLA 4H5GA 1QUKA 3EHSA 4N07A 2XD3A 5ICQA 3TTNA 1MQDA 4DLDA 3TODA 2V25A 1N04A 5L9MA 1SYHA 1H45A 3VXBA 2X7QA 1RKMA 4RK9A 1II5A 1ZIUA 4WXJA 3QYTA 4H67A 5TPAA 3KN8A 3RT6B 2QS4A 2UVIA 3OO6A 1PBPA 3BFUA 3TPAA 1OIBA 5FTIA 1DTZA 2VD3A 4DDDA 3RT8A 4YKIA 2KLFA 5AA1A 1GV8A 1ZJLA 3MP6A 1POY1 4JXIA 4OEVA 1B58A 3O66A 4NF4A 4F1VA 3U94A 1TT1A 4MBPA 3K02A 2Z23A 3S9MC 1A55A 3CFZA 3LR1A 1IXHA 3VE1B 1MS7A 4UA8A 2PMSA 4GWOA 2D5WA 3LSXA 4FEDA 2OK2A 3MBPA 1SBPA 2RKMA 5I2NB 1DMBA 3TELA 4IO7A 1R9QA 3KJTA 1BIYA 1B52A 5H8NB 2RCAA 2ZMBA 4QFNA 5KZTA 2QPQA 1BTJA 2O7UA 4ECFA 4OYVA 4ZEDA 2QL3A 2QRYA 2XXYA 4JSOA 3W15C 1B7HA 3ZKKA 3TUSA 4YKKA 4PP0A 3K6XA 2GH9A 3RPWA 2Q2CA 3OXNA 1FCKA 3K2DA 3UK4A 1QULA 3HO7A 3OMBA 1MDP1 3PMXA 4NWDA 1US5A 4KYEA 5A5XA 3H7MA 3EF7A 4OVJA 3C36A 3AXFA 3O9PA 3U8QA 2DWJA 1WDNA 4NF6B 4LP2B 3SEYA 3CG1A 3E4RA 4LZ8A 2GFEA 4C1UA 1AIVA 4JB7A 4KFQA 2XXWA 4BDMA 1MY0A 1LFGA 4HS7A 2O7IA 3M3LA 3DP6A 2ESNA 4ZEIA 3TCFA 2HXWA 4ZZEA 4ZEFA 2I3WA 2F8DA 1MQJA 4R72A 3L6HA 1SQYA 1YAEA 3G3FA 3TDJA 3C33A 4F29A 4AB6A 1IXCA 1I6BA 3FUZA 4KYDA 4GXAA 4EQBA 1B6HA 1O63A 4BDQA 1Z7NE 1FTKA 1LCTA 4RPNA 4F3SA 2VD2A 1B5JA 3HSTA 3PMVA 3GLBA 3PD9A 4YMBA 3KZGA 1YTVA 1N7XA 2CMOA 2ZYKA 4ZEKA 1EH3A 4IO3A 4FORA 2D3IA 3CRBA 3UA8A 4R74A 4GQOA 1URGA 4C1TA 2GRVA 3GZGA 1QKBA 1Y3QA 4C0RA 3O97A 3QXMA 4IB2A 4O3CA 4ELRA 2Q9TA 3C32A 3TCHA 2O68A 3KG2A 1B32A 3B6WA 1MPCA 4FJPA 4NWCA 3MJNA 1ANFA 4I9DA 3FVKA 4LUBA 3MC2A 3MZBA 4KYSA 3V5AA 2Z8EA 2XXIA 4GL8A 3N26A 5I56A 3RTWB 2DVCA 3VFJA 1OQGA 4O3BA 4QFLA 3OELA 5L9SA 5ICTA 5H8FA 1IITA 3C35A 1DTGA 1OVBA 2PT1A 3ILUB 3UGWA 1DSNA 4G8NA 3G7WA 5K2XA 4NTLA 5CBSA 4F2OA 4KHZE 4U1OA 2DE2A 4NF5A 2O84X 3I6VA 2ONRA 1TFDA 2DWIA 2DXRA 2XXQA 3G3GA 1ZLQA 1J1NA 3KJ7A 2O51A 5CC2A 4JDFA 3TEPA 4KI0E 4RPOA 3OEMA 4JBZA 2Q88A 5H8HA 1MG1A 2H25A 2Q8JA 4I62A 1B0LA 1FTJA 2I0CA 2DQVA 1FQBA 5H8QA 1PB8A 1MPBA 1Y3NA 4G4PA 3W9VA 1POTA 2P0SA 2NXOA 4DXBA 2DWHA 2QSXA 3OO8A 1B7UA 4N13A 4ZECA 5FHMA 3UN6A 2VGQA 1MH3A 3S9LC 1VFEA 1NKXA 1B0HA 1S50A 4H5FA 4RXLA 2F78A 2XXVA 2G29A 2I3VA 3MVXA 2X26A 5B70A 2NUVA 5IKBA 2IEEA 2UVJA 4G8MA 4H8JA 2QS3A 1B9JA 4QFPA 4X1DA 5AA2A 3OO7A 3MZ1A 2XXPA 5H8SA 1MM6A 3FATA 2XX8A 4NF8A 1MDQA 1RYOA 3CR9A 5L8DA 3EN3A 5ITPA 3OD7A 3SEXA 4U22A 4G68C 1URSA 5CMCA 3T96B 4XKQA 4GLIA 4XKNA 3QSLA 3R26A 1N76A 3U92A 2P1SA 4YKPA 3F11A 4RK2A 3IB0A 3OSQA 3FVOA 4KQPA 5DVFA 1B40A 1LFIA 1USYH 2ANJA 1QUJA 2YJPA 3JV9A 4X9TA 1BP5A 1Y1ZA 3IO6A 1O7TA 3OSRA 2XXTA 1SD3A 3K4UA 5EHSA 1AL3A 2Q2AA 3FXUA 2O1MA 3SESA 4H8IA 4E0XA 1UTBB 2D21A 3PU5A 1A8EA 1MY2A 4LONB 4RYAA 2Y7PA 1SW1A 3A09A 1D4NA 3M8UA 3BFTA 2G93A 5KCJA 3IR1A 5HBCA 3QUFA 2ZYOA 4F1UA 4MF3A 4H0WA 4OETA 4YB5A 3UP9A 1KWHA 5DVIA 1IXGA 3K6WA 1NH7A 2X7PA 3FXQA 3IOTA 1JVYA 5I2KA 4IGRA 3HHGA 4N6PA 3QAXA 5F1QA 3HN0A 1QVSA 2ZYNA 4ZS9A 3PD8A 1EZOA 2RF1A 4BDLA 1QKAA 2I48A 1WODA 2ABHA 1OMPA 5FTHA 4OTEA 3T9VA 2ALUA 1UIUA 4DZ1A 1P1QA 4QFKA 5I57B 4IO6A 1B51A 1FQDA 5HPQA 4DE8A 1FTOA 2V84A 1MQIA 3FGSA 4H65A 3RLFE 1JEVA 4Q8RA 1PB9A 2F7CA 4G68B 3PGFA 1Y4TA 3GXAA 3C34A 4QRZA 1UTHB 4EXLA 1A7LA 5FHOA 5CM6A 4ND9A 2DP8A 3USDA 1AOVA 5TP9B 3U93A 3VDFA 3B6TA 1VE4A 1MY3A 5I2NA 4ONYA 4HCWA 3FASA 2I58A 5H8NA 1B5IA 1FQFA 3PV0E 1XVXA 3VLVA 3VXCA 1LGBC 1UQWA 2Z8DA 3Q26A 1LSTA 1US4A 1F9BA 4Q30B 1P1NA 2H98A 5CBRA 4TQUQ 4IY6A 2V93A 3TZAA 5JTYA 1IIWA 3IB2A 3V8XB 4Z7EA 3K1PA 3FV1A 3RUMA 3MVYA 3B7DA 2AL4A 3IB1A 3K6VA 4FAJA 4H6DA 1EU8A 2OWTA 4OHNA 2THIA 5I58B 4P11A 1A54A 1SVXB 5AA4A 2Y7KA 3SEWA 1R1NA 4NF6A 3QUJA 1EZPA 1LCFA 3OENA 3V83A 1ELJA 4EF1A 1TFAA 3TQLA 4U1ZA 2I4CA 1Y20A 3O2AA 2DXYA 3OOAA 1IXIA 3T9UA 1QJMA 1A99A 1OLCA 3RN8A 1GR2A 4EDPA 4TOZA 2REJA 1TWYA 5KDTB 1I69A 3O29A 3FJ7A 1MY4A 4AQ4A 2ZNSA 4KCDA 2VOZA 2XXUA 3G3JA 1ZKBA 1CB6A 1B1HA 2QS2A 4ELPA 1B3EA 1WVJA 4LVQA 3FIRA 1PDAA 2FNCA 3H06B 2Y7RA 4R2FA 2OCUA 4F2QA 2Z22A 4QFOA 1Q1KA 1PBQA 2UVGA 4HCYA 3FV2A 5I59B 4F3GA 4QSEA 3MPLA 1L5TA 2GHBA 4G77A 4GIZA 1FQCA 3PPPA 3SEUA 1AH5A 4X48A 3TCGA 2VHAA 3O28A 5DEXB 2YPNA 3MVZA 1B46A 4M1VA 4YB7A 2Z8FA 1USYE 4P0GA 1SDXA 3C9HA 1QW0A 1A8FA 2QMWA 1MXYA 4O3AA 4POXA 4LQ5A 1I6AA 3IL1B 5L9OA 1NL5A 1DPEA 3TTLA 3U72A 3T9XB 1T0KA 3MUQA 4U4SA 4G2ZA 2FYIA 1NNPA 3JYRA 1VFDA 3K6UA 4OQOA 5ISUA 1ATGA 1SI1A 4R75A 2HAVA 3S4UA 1JW5A 4EXKA 2PVUA 3OO9A 2QS1A 1GGGA 2UVHA 1MXXA 2FA7A 4G8HA 4I1DA 2V3QA 3PMWA 1YPNA 4IGTA 2R71A 4NF5B 3O6IA 2M8CA 4ZE8A 4BDOA 5AE4A 1MM7A 2B3BA 1B3LA 3TMGA 1H43A 4DXUA 1D3KA 4IO4A 4FIMA 5H8HB 1HSEA 2RINA 3EQ1A 4RY1A 1H3DA 3CFXA 5J1DA 5H8QB 3CG3A 2HCAA 1P99A 1IQ7A 2Q89A 1R6ZA 4GD5A 2A5TB 2UYEA 4OESA 3IX1A 3K0VA 3MZ9A 1P1WA 2V3UA 2DVZA 3N5LA 3K00A 2ZNTA 1OQHA 5TU0A 5AA2B 1ZBMA 3PUWE 4WKMA 1MH4A 1LBCA 4YZZA 4YU0A 4L17A 3G3KA 3ODBA 3VVEA 3DP8A 4MLQA 4PFTA 4OMBA 1NMUA 4JWOA 2O6AA 3KSXA 3P7IA 4EQ7A 3G3IA 1M5EA 4YKJA 2H99A 4FEBA 1N84A 3GBBA 3RNNA 4ESWA 4GF8A 4PETA 3S2VA 2OBGA 3IJXB 4BLAA 4KPTA 1LAGE 3D4CA 1B1XA 4I8CA 2XD2A 4JWYA 1Q35A 3M3KA 3ECRA 3VVDA 1B3HA 1R9LA 3IORA 2VP1A 2I6EA 2DS9A 1MQHA 1MXUA 1JNFA 3SDFA 3N94A 3U1OA 5JK4A 1SW5A 1NFTA 2F7AA 3RY3A 1Y9UA 1P1OA 3IO4A 4PFUA 3EHUA 4WEPA 4ZEBA 4K3FA 4GOTA 1URDA 1PC3A 4GRKA 5CI5A 3UORA 3HHFA 1OVTA 2Y7WA 3DELB 4ISUA 4LZ5A 2DOJA 2R9JA 2YLNA 3R6UA 3KN7A 2GHAA 1OLAA 1UTBA 2F7BA 2WKYA 1FQEA 5IAIA 2E1SA 3QIMA 4E0WA 3LSLA 2OWSA 2DE3A 1IUDA 2ZNUA 4PFYA 3A3CA 3WAEA 5I2KB 2NVUB 4FATA 1FTMA 4NE4A 2RC8A 2HEUA 5TPAB 4F1YA 5BUUA 4AB5A 3N6TA 5EYFA 3TTRA 3IAZA 3IOVA 2H4IA 4XXUA 4F18A 2I4BA 4ZDMA 4U23A 3ZSFA 3JZJA 1JQFA 4H1XA 3H03A 1ZTYA 1JEUA 2F5XA 3PUVE 3CI8A 4BDRA 4IY5A 4EQ9A 4QF9A 4NF4B 2HFBA 2XX9A 1H76A 1SI0A 5BWJA 1NNKA 5I57A 1A40A 1XHYA 3TFLA 2I49A 3HCQA 4YB6A 2IA4A 1SW4A 4MLVA 2H5YA 1MRPA 2ONKE 2NOOA 5AA2D 2CZLA 4QSCA 4RNSA 2DWAA 4OFOA 3MWBA 4FE8A 4G68A 2OJTA 1UIVA 1B2HA 1Y1MA 2P2AA 1B5HA 3Q27A 1UTHA 2BJJX 3VLUA 2DYXA 4JWXA 4GFRA 3KGCA 4PE5B 2XXHA 4Q0CA 4YICA 5TP9A 3ILTB 3OEKA 2XXXA 4YMAA 2F36A 2PX1A 3A3UA 4YAHX 3RTFB 2O69A 5DVJA 1XT8A 4KR5A 2H9BA 3MP1A 1PEBA 4X1BA 5A5XB 5JTYB 4KD5A 1LB9A 1LAHE 3KN3A 1O64A 3LSWA 4ELQA 4QHQA 1BLFA 3KEIA 3SERA 3MVWA 1SYIA 1NNFA 1MXZA 3ONMA 4OFLA 3KBRA 1S9TA 3PPOA 3TAJA 3K01A 2UYFA 5AA4B 3RGYA 1YCJA 4OENA 2RC7A 4RA1A 1JETA 3VVFA 2ZXTA 3T22A 4DCXA 3CSBA 3LBSA 4XTCQ 4RJZA 5FHNA 5I58A 3KOTA 4LATA 3M3FA 3RQTA 3LUYA 2HQ0A 2Y7IA 4HTGA 3DM0A 1IZ1A 3HPIA 3LC8A 4LA9A 1D9VA 4P0IA 2DE4A 3H6WA 1N0TA 3H6TA 3DLNA 3SKPA 2OZZA 1SW2A 5LOMA 4U4XA 3FD3A 1M5CA 5CMBA 4ZZAA 3FZVA 4MFIA 3EPEA 1LAXA 3PUZE 1CE2A 4OEUA 3CFLA 2A5SA 3T66A 5F7VA 1JVXA 1DOTA 2XX7A 4XIGQ 3Q29A 4XKPA 2QJEA 5KDTA 3PUYE 4PFWA 3K1NA 4F19A 3UIFA 5DYHA 3CVGA 1VR5A 3CSGA 4QSDA 3SETA 4R6YA 1Z7ME 3T93B 1N3XA 3MPKA 1B4ZA 4PQJA 3CIJA 3BKIB 5AA3A 3S9NC 4DXCA 2I0BA 1XS5A 3FVNA 1Y4CA 5I59A 1B4HA 3THIA 1MPDA 3TKDA 4WEDA 1LAFE 4KCCA 3C31A 2ONSA 5DEXA 2F6PA 1GTKA 1LB8A 1AMFA 4UACA 4R9FA 5I56B 3TYHA 3H4ZA 4Z0IA 1MQGA 1MXVA 1B7ZA 3T9HB 1HSJA 1FW0A 1N3WA 4THIA 1JW1A 2V3TA 4U2RA 5B7DA 4OZ9A 5H8FB 3KOSA 3E13X 3VLWA 4OWDA 3G3HA 3E9XA 2B3FA 3D4GA 3O6GA 4JSDA 1QUIA 1XC1A 4LZ7A 4IO2A 3MAMA 3TQWA 1XVYA 3HV1A 1MY1A 3FJGA 1LFHA 2LAOA 4EF2A 2W7YA 4XKRA 1M5DA 3FJMA 3QK6A 4Q5TA 3MP8A 4FECA 1TXFA 2PBWA 3IOUA 5ELVA 3DP4A 3MW0A 3BBRA 2OLBA 3H3GA 5K2YA 4BDNA 1I6QA 5I84A 3O6HA 2HZKA 3LSFB 3I3VA 2E0SA 4OXVA 3FXRA 1M5FA 2AIXA 4DIGA 2PYYA 3MQ9A 2HZLA 4F39A 2F34A 3N6UA 1FQAA 4R73A 3IJOB 1MXWA 1RYXA 3Q28A 1M5BA 3KFMA 3R7XA 2DSFA 3ZS6A 3B6QA 3GBAA 2F97A 1B3GA 1IEJA 4OFJA 1JW4A 4ESXA 1B05A 3PUXE 3S9EA 1H44A 2UXAA 4NEDA 3PPRA 1Y3PA 2A5TA 5ITOA 5CMKA 1S7YA 3I5OA 3IOWA 2XHDA 4ELOA 1LBBA 5EHMA 4NF8B 4ZE9A 3VV5A 4GXSB 4U21A 1NNTA 4DCYA 2F35A 3ZKLA 1BKAA 1FTLA 2PT2A 4GVOA 3V89B 4IO5A 4LQ2A 4F3PA 4TLLB 3Q25A 1B3FA 3H6UA 4R6KA 5HM4B 3H6VA 3EHTA 3IK6B 5CRYA 3PPQA 1DPPA 4OERA 5M2VA 4R2BA 1XOCA 1NH8A 2ZYMA 4R6HA 1P1UA 4POWA 4F22A 4NMYA 1D9YA 2F6GA 1ZU0A 3KSJA 4MH5A 3K1MA 4HW8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PPN A;  3C4M A;  1GVC A;  3E3K A;  5CMM A;  3WAF A;  3L6G A;  1ZMG A;  2RCB A;  3FVG A;  2R6G E;  4F3B A;  4TLM B;  2QMX A;  4M4G A;  3TTK A;  3W9W A;  1N7W A;  2NWJ A;  1LLS A;  4EUO A;  5DT6 A;  2RC9 A;  3TTM A;  4GL0 A;  4R9G A;  1PB7 A;  2O1L A;  5JEI A;  2HAU A;  2XXR A;  1VSO A;  3SEV A;  5DTB A;  4F31 B;  2B65 A;  2Y84 A;  5KCJ B;  2AYS A;  2AL5 A;  1EZ9 A;  2REG A;  1HSL A;  4H5G A;  1QUK A;  3EHS A;  4N07 A;  2XD3 A;  5ICQ A;  3TTN A;  1MQD A;  4DLD A;  3TOD A;  2V25 A;  1N04 A;  5L9M A;  1SYH A;  1H45 A;  3VXB A;  2X7Q A;  1RKM A;  4RK9 A;  1II5 A;  1ZIU A;  4WXJ A;  3QYT A;  4H67 A;  5TPA A;  3KN8 A;  3RT6 B;  2QS4 A;  2UVI A;  3OO6 A;  1PBP A;  3BFU A;  3TPA A;  1OIB A;  5FTI A;  1DTZ A;  2VD3 A;  4DDD A;  3RT8 A;  4YKI A;  2KLF A;  5AA1 A;  1GV8 A;  1ZJL A;  3MP6 A;  1POY 1;  4JXI A;  4OEV A;  1B58 A;  3O66 A;  4NF4 A;  4F1V A;  3U94 A;  1TT1 A;  4MBP A;  3K02 A;  2Z23 A;  3S9M C;  1A55 A;  3CFZ A;  3LR1 A;  1IXH A;  3VE1 B;  1MS7 A;  4UA8 A;  2PMS A;  4GWO A;  2D5W A;  3LSX A;  4FED A;  2OK2 A;  3MBP A;  1SBP A;  2RKM A;  5I2N B;  1DMB A;  3TEL A;  4IO7 A;  1R9Q A;  3KJT A;  1BIY A;  1B52 A;  5H8N B;  2RCA A;  2ZMB A;  4QFN A;  5KZT A;  2QPQ A;  1BTJ A;  2O7U A;  4ECF A;  4OYV A;  4ZED A;  2QL3 A;  2QRY A;  2XXY A;  4JSO A;  3W15 C;  1B7H A;  3ZKK A;  3TUS A;  4YKK A;  4PP0 A;  3K6X A;  2GH9 A;  3RPW A;  2Q2C A;  3OXN A;  1FCK A;  3K2D A;  3UK4 A;  1QUL A;  3HO7 A;  3OMB A;  1MDP 1;  3PMX A;  4NWD A;  1US5 A;  4KYE A;  5A5X A;  3H7M A;  3EF7 A;  4OVJ A;  3C36 A;  3AXF A;  3O9P A;  3U8Q A;  2DWJ A;  1WDN A;  4NF6 B;  4LP2 B;  3SEY A;  3CG1 A;  3E4R A;  4LZ8 A;  2GFE A;  4C1U A;  1AIV A;  4JB7 A;  4KFQ A;  2XXW A;  4BDM A;  1MY0 A;  1LFG A;  4HS7 A;  2O7I A;  3M3L A;  3DP6 A;  2ESN A;  4ZEI A;  3TCF A;  2HXW A;  4ZZE A;  4ZEF A;  2I3W A;  2F8D A;  1MQJ A;  4R72 A;  3L6H A;  1SQY A;  1YAE A;  3G3F A;  3TDJ A;  3C33 A;  4F29 A;  4AB6 A;  1IXC A;  1I6B A;  3FUZ A;  4KYD A;  4GXA A;  4EQB A;  1B6H A;  1O63 A;  4BDQ A;  1Z7N E;  1FTK A;  1LCT A;  4RPN A;  4F3S A;  2VD2 A;  1B5J A;  3HST A;  3PMV A;  3GLB A;  3PD9 A;  4YMB A;  3KZG A;  1YTV A;  1N7X A;  2CMO A;  2ZYK A;  4ZEK A;  1EH3 A;  4IO3 A;  4FOR A;  2D3I A;  3CRB A;  3UA8 A;  4R74 A;  4GQO A;  1URG A;  4C1T A;  2GRV A;  3GZG A;  1QKB A;  1Y3Q A;  4C0R A;  3O97 A;  3QXM A;  4IB2 A;  4O3C A;  4ELR A;  2Q9T A;  3C32 A;  3TCH A;  2O68 A;  3KG2 A;  1B32 A;  3B6W A;  1MPC A;  4FJP A;  4NWC A;  3MJN A;  1ANF A;  4I9D A;  3FVK A;  4LUB A;  3MC2 A;  3MZB A;  4KYS A;  3V5A A;  2Z8E A;  2XXI A;  4GL8 A;  3N26 A;  5I56 A;  3RTW B;  2DVC A;  3VFJ A;  1OQG A;  4O3B A;  4QFL A;  3OEL A;  5L9S A;  5ICT A;  5H8F A;  1IIT A;  3C35 A;  1DTG A;  1OVB A;  2PT1 A;  3ILU B;  3UGW A;  1DSN A;  4G8N A;  3G7W A;  5K2X A;  4NTL A;  5CBS A;  4F2O A;  4KHZ E;  4U1O A;  2DE2 A;  4NF5 A;  2O84 X;  3I6V A;  2ONR A;  1TFD A;  2DWI A;  2DXR A;  2XXQ A;  3G3G A;  1ZLQ A;  1J1N A;  3KJ7 A;  2O51 A;  5CC2 A;  4JDF A;  3TEP A;  4KI0 E;  4RPO A;  3OEM A;  4JBZ A;  2Q88 A;  5H8H A;  1MG1 A;  2H25 A;  2Q8J A;  4I62 A;  1B0L A;  1FTJ A;  2I0C A;  2DQV A;  1FQB A;  5H8Q A;  1PB8 A;  1MPB A;  1Y3N A;  4G4P A;  3W9V A;  1POT A;  2P0S A;  2NXO A;  4DXB A;  2DWH A;  2QSX A;  3OO8 A;  1B7U A;  4N13 A;  4ZEC A;  5FHM A;  3UN6 A;  2VGQ A;  1MH3 A;  3S9L C;  1VFE A;  1NKX A;  1B0H A;  1S50 A;  4H5F A;  4RXL A;  2F78 A;  2XXV A;  2G29 A;  2I3V A;  3MVX A;  2X26 A;  5B70 A;  2NUV A;  5IKB A;  2IEE A;  2UVJ A;  4G8M A;  4H8J A;  2QS3 A;  1B9J A;  4QFP A;  4X1D A;  5AA2 A;  3OO7 A;  3MZ1 A;  2XXP A;  5H8S A;  1MM6 A;  3FAT A;  2XX8 A;  4NF8 A;  1MDQ A;  1RYO A;  3CR9 A;  5L8D A;  3EN3 A;  5ITP A;  3OD7 A;  3SEX A;  4U22 A;  4G68 C;  1URS A;  5CMC A;  3T96 B;  4XKQ A;  4GLI A;  4XKN A;  3QSL A;  3R26 A;  1N76 A;  3U92 A;  2P1S A;  4YKP A;  3F11 A;  4RK2 A;  3IB0 A;  3OSQ A;  3FVO A;  4KQP A;  5DVF A;  1B40 A;  1LFI A;  1USY H;  2ANJ A;  1QUJ A;  2YJP A;  3JV9 A;  4X9T A;  1BP5 A;  1Y1Z A;  3IO6 A;  1O7T A;  3OSR A;  2XXT A;  1SD3 A;  3K4U A;  5EHS A;  1AL3 A;  2Q2A A;  3FXU A;  2O1M A;  3SES A;  4H8I A;  4E0X A;  1UTB B;  2D21 A;  3PU5 A;  1A8E A;  1MY2 A;  4LON B;  4RYA A;  2Y7P A;  1SW1 A;  3A09 A;  1D4N A;  3M8U A;  3BFT A;  2G93 A;  5KCJ A;  3IR1 A;  5HBC A;  3QUF A;  2ZYO A;  4F1U A;  4MF3 A;  4H0W A;  4OET A;  4YB5 A;  3UP9 A;  1KWH A;  5DVI A;  1IXG A;  3K6W A;  1NH7 A;  2X7P A;  3FXQ A;  3IOT A;  1JVY A;  5I2K A;  4IGR A;  3HHG A;  4N6P A;  3QAX A;  5F1Q A;  3HN0 A;  1QVS A;  2ZYN A;  4ZS9 A;  3PD8 A;  1EZO A;  2RF1 A;  4BDL A;  1QKA A;  2I48 A;  1WOD A;  2ABH A;  1OMP A;  5FTH A;  4OTE A;  3T9V A;  2ALU A;  1UIU A;  4DZ1 A;  1P1Q A;  4QFK A;  5I57 B;  4IO6 A;  1B51 A;  1FQD A;  5HPQ A;  4DE8 A;  1FTO A;  2V84 A;  1MQI A;  3FGS A;  4H65 A;  3RLF E;  1JEV A;  4Q8R A;  1PB9 A;  2F7C A;  4G68 B;  3PGF A;  1Y4T A;  3GXA A;  3C34 A;  4QRZ A;  1UTH B;  4EXL A;  1A7L A;  5FHO A;  5CM6 A;  4ND9 A;  2DP8 A;  3USD A;  1AOV A;  5TP9 B;  3U93 A;  3VDF A;  3B6T A;  1VE4 A;  1MY3 A;  5I2N A;  4ONY A;  4HCW A;  3FAS A;  2I58 A;  5H8N A;  1B5I A;  1FQF A;  3PV0 E;  1XVX A;  3VLV A;  3VXC A;  1LGB C;  1UQW A;  2Z8D A;  3Q26 A;  1LST A;  1US4 A;  1F9B A;  4Q30 B;  1P1N A;  2H98 A;  5CBR A;  4TQU Q;  4IY6 A;  2V93 A;  3TZA A;  5JTY A;  1IIW A;  3IB2 A;  3V8X B;  4Z7E A;  3K1P A;  3FV1 A;  3RUM A;  3MVY A;  3B7D A;  2AL4 A;  3IB1 A;  3K6V A;  4FAJ A;  4H6D A;  1EU8 A;  2OWT A;  4OHN A;  2THI A;  5I58 B;  4P11 A;  1A54 A;  1SVX B;  5AA4 A;  2Y7K A;  3SEW A;  1R1N A;  4NF6 A;  3QUJ A;  1EZP A;  1LCF A;  3OEN A;  3V83 A;  1ELJ A;  4EF1 A;  1TFA A;  3TQL A;  4U1Z A;  2I4C A;  1Y20 A;  3O2A A;  2DXY A;  3OOA A;  1IXI A;  3T9U A;  1QJM A;  1A99 A;  1OLC A;  3RN8 A;  1GR2 A;  4EDP A;  4TOZ A;  2REJ A;  1TWY A;  5KDT B;  1I69 A;  3O29 A;  3FJ7 A;  1MY4 A;  4AQ4 A;  2ZNS A;  4KCD A;  2VOZ A;  2XXU A;  3G3J A;  1ZKB A;  1CB6 A;  1B1H A;  2QS2 A;  4ELP A;  1B3E A;  1WVJ A;  4LVQ A;  3FIR A;  1PDA A;  2FNC A;  3H06 B;  2Y7R A;  4R2F A;  2OCU A;  4F2Q A;  2Z22 A;  4QFO A;  1Q1K A;  1PBQ A;  2UVG A;  4HCY A;  3FV2 A;  5I59 B;  4F3G A;  4QSE A;  3MPL A;  1L5T A;  2GHB A;  4G77 A;  4GIZ A;  1FQC A;  3PPP A;  3SEU A;  1AH5 A;  4X48 A;  3TCG A;  2VHA A;  3O28 A;  5DEX B;  2YPN A;  3MVZ A;  1B46 A;  4M1V A;  4YB7 A;  2Z8F A;  1USY E;  4P0G A;  1SDX A;  3C9H A;  1QW0 A;  1A8F A;  2QMW A;  1MXY A;  4O3A A;  4POX A;  4LQ5 A;  1I6A A;  3IL1 B;  5L9O A;  1NL5 A;  1DPE A;  3TTL A;  3U72 A;  3T9X B;  1T0K A;  3MUQ A;  4U4S A;  4G2Z A;  2FYI A;  1NNP A;  3JYR A;  1VFD A;  3K6U A;  4OQO A;  5ISU A;  1ATG A;  1SI1 A;  4R75 A;  2HAV A;  3S4U A;  1JW5 A;  4EXK A;  2PVU A;  3OO9 A;  2QS1 A;  1GGG A;  2UVH A;  1MXX A;  2FA7 A;  4G8H A;  4I1D A;  2V3Q A;  3PMW A;  1YPN A;  4IGT A;  2R71 A;  4NF5 B;  3O6I A;  2M8C A;  4ZE8 A;  4BDO A;  5AE4 A;  1MM7 A;  2B3B A;  1B3L A;  3TMG A;  1H43 A;  4DXU A;  1D3K A;  4IO4 A;  4FIM A;  5H8H B;  1HSE A;  2RIN A;  3EQ1 A;  4RY1 A;  1H3D A;  3CFX A;  5J1D A;  5H8Q B;  3CG3 A;  2HCA A;  1P99 A;  1IQ7 A;  2Q89 A;  1R6Z A;  4GD5 A;  2A5T B;  2UYE A;  4OES A;  3IX1 A;  3K0V A;  3MZ9 A;  1P1W A;  2V3U A;  2DVZ A;  3N5L A;  3K00 A;  2ZNT A;  1OQH A;  5TU0 A;  5AA2 B;  1ZBM A;  3PUW E;  4WKM A;  1MH4 A;  1LBC A;  4YZZ A;  4YU0 A;  4L17 A;  3G3K A;  3ODB A;  3VVE A;  3DP8 A;  4MLQ A;  4PFT A;  4OMB A;  1NMU A;  4JWO A;  2O6A A;  3KSX A;  3P7I A;  4EQ7 A;  3G3I A;  1M5E A;  4YKJ A;  2H99 A;  4FEB A;  1N84 A;  3GBB A;  3RNN A;  4ESW A;  4GF8 A;  4PET A;  3S2V A;  2OBG A;  3IJX B;  4BLA A;  4KPT A;  1LAG E;  3D4C A;  1B1X A;  4I8C A;  2XD2 A;  4JWY A;  1Q35 A;  3M3K A;  3ECR A;  3VVD A;  1B3H A;  1R9L A;  3IOR A;  2VP1 A;  2I6E A;  2DS9 A;  1MQH A;  1MXU A;  1JNF A;  3SDF A;  3N94 A;  3U1O A;  5JK4 A;  1SW5 A;  1NFT A;  2F7A A;  3RY3 A;  1Y9U A;  1P1O A;  3IO4 A;  4PFU A;  3EHU A;  4WEP A;  4ZEB A;  4K3F A;  4GOT A;  1URD A;  1PC3 A;  4GRK A;  5CI5 A;  3UOR A;  3HHF A;  1OVT A;  2Y7W A;  3DEL B;  4ISU A;  4LZ5 A;  2DOJ A;  2R9J A;  2YLN A;  3R6U A;  3KN7 A;  2GHA A;  1OLA A;  1UTB A;  2F7B A;  2WKY A;  1FQE A;  5IAI A;  2E1S A;  3QIM A;  4E0W A;  3LSL A;  2OWS A;  2DE3 A;  1IUD A;  2ZNU A;  4PFY A;  3A3C A;  3WAE A;  5I2K B;  2NVU B;  4FAT A;  1FTM A;  4NE4 A;  2RC8 A;  2HEU A;  5TPA B;  4F1Y A;  5BUU A;  4AB5 A;  3N6T A;  5EYF A;  3TTR A;  3IAZ A;  3IOV A;  2H4I A;  4XXU A;  4F18 A;  2I4B A;  4ZDM A;  4U23 A;  3ZSF A;  3JZJ A;  1JQF A;  4H1X A;  3H03 A;  1ZTY A;  1JEU A;  2F5X A;  3PUV E;  3CI8 A;  4BDR A;  4IY5 A;  4EQ9 A;  4QF9 A;  4NF4 B;  2HFB A;  2XX9 A;  1H76 A;  1SI0 A;  5BWJ A;  1NNK A;  5I57 A;  1A40 A;  1XHY A;  3TFL A;  2I49 A;  3HCQ A;  4YB6 A;  2IA4 A;  1SW4 A;  4MLV A;  2H5Y A;  1MRP A;  2ONK E;  2NOO A;  5AA2 D;  2CZL A;  4QSC A;  4RNS A;  2DWA A;  4OFO A;  3MWB A;  4FE8 A;  4G68 A;  2OJT A;  1UIV A;  1B2H A;  1Y1M A;  2P2A A;  1B5H A;  3Q27 A;  1UTH A;  2BJJ X;  3VLU A;  2DYX A;  4JWX A;  4GFR A;  3KGC A;  4PE5 B;  2XXH A;  4Q0C A;  4YIC A;  5TP9 A;  3ILT B;  3OEK A;  2XXX A;  4YMA A;  2F36 A;  2PX1 A;  3A3U A;  4YAH X;  3RTF B;  2O69 A;  5DVJ A;  1XT8 A;  4KR5 A;  2H9B A;  3MP1 A;  1PEB A;  4X1B A;  5A5X B;  5JTY B;  4KD5 A;  1LB9 A;  1LAH E;  3KN3 A;  1O64 A;  3LSW A;  4ELQ A;  4QHQ A;  1BLF A;  3KEI A;  3SER A;  3MVW A;  1SYI A;  1NNF A;  1MXZ A;  3ONM A;  4OFL A;  3KBR A;  1S9T A;  3PPO A;  3TAJ A;  3K01 A;  2UYF A;  5AA4 B;  3RGY A;  1YCJ A;  4OEN A;  2RC7 A;  4RA1 A;  1JET A;  3VVF A;  2ZXT A;  3T22 A;  4DCX A;  3CSB A;  3LBS A;  4XTC Q;  4RJZ A;  5FHN A;  5I58 A;  3KOT A;  4LAT A;  3M3F A;  3RQT A;  3LUY A;  2HQ0 A;  2Y7I A;  4HTG A;  3DM0 A;  1IZ1 A;  3HPI A;  3LC8 A;  4LA9 A;  1D9V A;  4P0I A;  2DE4 A;  3H6W A;  1N0T A;  3H6T A;  3DLN A;  3SKP A;  2OZZ A;  1SW2 A;  5LOM A;  4U4X A;  3FD3 A;  1M5C A;  5CMB A;  4ZZA A;  3FZV A;  4MFI A;  3EPE A;  1LAX A;  3PUZ E;  1CE2 A;  4OEU A;  3CFL A;  2A5S A;  3T66 A;  5F7V A;  1JVX A;  1DOT A;  2XX7 A;  4XIG Q;  3Q29 A;  4XKP A;  2QJE A;  5KDT A;  3PUY E;  4PFW A;  3K1N A;  4F19 A;  3UIF A;  5DYH A;  3CVG A;  1VR5 A;  3CSG A;  4QSD A;  3SET A;  4R6Y A;  1Z7M E;  3T93 B;  1N3X A;  3MPK A;  1B4Z A;  4PQJ A;  3CIJ A;  3BKI B;  5AA3 A;  3S9N C;  4DXC A;  2I0B A;  1XS5 A;  3FVN A;  1Y4C A;  5I59 A;  1B4H A;  3THI A;  1MPD A;  3TKD A;  4WED A;  1LAF E;  4KCC A;  3C31 A;  2ONS A;  5DEX A;  2F6P A;  1GTK A;  1LB8 A;  1AMF A;  4UAC A;  4R9F A;  5I56 B;  3TYH A;  3H4Z A;  4Z0I A;  1MQG A;  1MXV A;  1B7Z A;  3T9H B;  1HSJ A;  1FW0 A;  1N3W A;  4THI A;  1JW1 A;  2V3T A;  4U2R A;  5B7D A;  4OZ9 A;  5H8F B;  3KOS A;  3E13 X;  3VLW A;  4OWD A;  3G3H A;  3E9X A;  2B3F A;  3D4G A;  3O6G A;  4JSD A;  1QUI A;  1XC1 A;  4LZ7 A;  4IO2 A;  3MAM A;  3TQW A;  1XVY A;  3HV1 A;  1MY1 A;  3FJG A;  1LFH A;  2LAO A;  4EF2 A;  2W7Y A;  4XKR A;  1M5D A;  3FJM A;  3QK6 A;  4Q5T A;  3MP8 A;  4FEC A;  1TXF A;  2PBW A;  3IOU A;  5ELV A;  3DP4 A;  3MW0 A;  3BBR A;  2OLB A;  3H3G A;  5K2Y A;  4BDN A;  1I6Q A;  5I84 A;  3O6H A;  2HZK A;  3LSF B;  3I3V A;  2E0S A;  4OXV A;  3FXR A;  1M5F A;  2AIX A;  4DIG A;  2PYY A;  3MQ9 A;  2HZL A;  4F39 A;  2F34 A;  3N6U A;  1FQA A;  4R73 A;  3IJO B;  1MXW A;  1RYX A;  3Q28 A;  1M5B A;  3KFM A;  3R7X A;  2DSF A;  3ZS6 A;  3B6Q A;  3GBA A;  2F97 A;  1B3G A;  1IEJ A;  4OFJ A;  1JW4 A;  4ESX A;  1B05 A;  3PUX E;  3S9E A;  1H44 A;  2UXA A;  4NED A;  3PPR A;  1Y3P A;  2A5T A;  5ITO A;  5CMK A;  1S7Y A;  3I5O A;  3IOW A;  2XHD A;  4ELO A;  1LBB A;  5EHM A;  4NF8 B;  4ZE9 A;  3VV5 A;  4GXS B;  4U21 A;  1NNT A;  4DCY A;  2F35 A;  3ZKL A;  1BKA A;  1FTL A;  2PT2 A;  4GVO A;  3V89 B;  4IO5 A;  4LQ2 A;  4F3P A;  4TLL B;  3Q25 A;  1B3F A;  3H6U A;  4R6K A;  5HM4 B;  3H6V A;  3EHT A;  3IK6 B;  5CRY A;  3PPQ A;  1DPP A;  4OER A;  5M2V A;  4R2B A;  1XOC A;  1NH8 A;  2ZYM A;  4R6H A;  1P1U A;  4POW A;  4F22 A;  4NMY A;  1D9Y A;  2F6G A;  1ZU0 A;  3KSJ A;  4MH5 A;  3K1M A;  4HW8 A; 
#chains in the Genus database with same CATH topology
 3PPN A;  3C4M A;  1GVC A;  3E3K A;  5CMM A;  3WAF A;  3L6G A;  1ZMG A;  2RCB A;  3FVG A;  2R6G E;  4F3B A;  1G0H A;  4TLM B;  2QMX A;  4M4G A;  3TTK A;  3W9W A;  1N7W A;  2NWJ A;  1LLS A;  4EUO A;  5DT6 A;  2RC9 A;  3TTM A;  4GL0 A;  4R9G A;  1PB7 A;  5EQ7 A;  3RYD A;  2O1L A;  5J16 A;  5JEI A;  2HAU A;  2XXR A;  2JJK A;  5IM2 A;  5IZZ A;  4P9K A;  1VSO A;  3SEV A;  5DTB A;  4F31 B;  2B65 A;  4XFE A;  2Y84 A;  4MNI A;  2GQ1 A;  1IMD A;  5KCJ B;  2AYS A;  2AL5 A;  1EZ9 A;  2REG A;  1HSL A;  1LEV A;  4H5G A;  1QUK A;  3EHS A;  4N07 A;  2XD3 A;  5LDZ A;  5ICQ A;  3TTN A;  1MQD A;  4DLD A;  4OVT A;  3TOD A;  1FBH A;  2V25 A;  1N04 A;  5L9M A;  1SYH A;  1H45 A;  3VXB A;  2X7Q A;  1RKM A;  4RK9 A;  3RPL B;  1II5 A;  4PDD A;  1ZIU A;  4IR8 A;  4NAP A;  4WXJ A;  3QYT A;  4H67 A;  5TPA A;  3KN8 A;  3RT6 B;  2QS4 A;  4HE0 A;  2UVI A;  3OO6 A;  1PBP A;  3BFU A;  3TPA A;  1OIB A;  5FTI A;  1FBP A;  1DTZ A;  2VD3 A;  4DDD A;  3RT8 A;  4YKI A;  5EQ9 A;  2KLF A;  1LBV A;  5AA1 A;  1LBX A;  1GV8 A;  1ZJL A;  1NI9 A;  3MP6 A;  2FHY A;  3FXB A;  4I3Y A;  1POY 1;  4JXI A;  4OEV A;  1B58 A;  3O66 A;  4N91 A;  4NF4 A;  3U94 A;  4F1V A;  1TT1 A;  4MBP A;  3K02 A;  2Z23 A;  3S9M C;  1A55 A;  3CFZ A;  3LR1 A;  1IXH A;  3VE1 B;  1MS7 A;  4GWS A;  1D9Q A;  4UA8 A;  2PMS A;  4GWO A;  2D5W A;  3LSX A;  4FED A;  2OK2 A;  3MBP A;  3SZP A;  1SBP A;  2RKM A;  5I2N B;  1DMB A;  3TEL A;  4IO7 A;  1R9Q A;  3KJT A;  1DK4 A;  1BIY A;  1B52 A;  5H8N B;  2RCA A;  2ZMB A;  5ESY A;  1CNQ A;  5IZ3 A;  4QFN A;  5KZT A;  2QPQ A;  1BTJ A;  2O7U A;  4ECF A;  4OYV A;  4ZED A;  2QL3 A;  2QRY A;  2Y5K A;  2XXY A;  4JSO A;  3B8B A;  1FTA A;  4MCO A;  3W15 C;  1FPI A;  2XWV A;  4OVQ A;  1B7H A;  3ZKK A;  3TUS A;  4YKK A;  4PP0 A;  3K6X A;  2GH9 A;  3RPW A;  2Q2C A;  3OXN A;  1FCK A;  3K2D A;  2WBB A;  3UK4 A;  1QUL A;  3HO7 A;  3OMB A;  1MDP 1;  3KC0 A;  3PMX A;  4NWD A;  1US5 A;  4KYE A;  5A5X A;  3H7M A;  3EF7 A;  2ZZW A;  4OVJ A;  3C36 A;  2FBP A;  3AXF A;  3O9P A;  3U8Q A;  2DWJ A;  1WDN A;  4NF6 B;  1YZ0 A;  4LP2 B;  2QVV A;  3SEY A;  3CG1 A;  2VPO A;  3E4R A;  4LZ8 A;  2GFE A;  4C1U A;  1AIV A;  4JB7 A;  4KFQ A;  2XXW A;  4BDM A;  1MY0 A;  1LFG A;  4HS7 A;  2O7I A;  3M3L A;  1NV3 A;  5IZ1 A;  1RDX A;  3DP6 A;  2ESN A;  4ZEI A;  1YYZ A;  2HXW A;  4ZZE A;  3TCF A;  4ZEF A;  2I3W A;  3B50 A;  2F8D A;  4P1L A;  2PFZ A;  1MQJ A;  2QFL A;  4PAF A;  4R72 A;  3L6H A;  1SQY A;  4GX4 A;  1YAE A;  2L5V A;  3G3F A;  3TDJ A;  3C33 A;  4F29 A;  4AB6 A;  1IXC A;  1I6B A;  3FUZ A;  4KYD A;  4GXA A;  4EQB A;  1B6H A;  1O63 A;  4PGN A;  4BDQ A;  1Z7N E;  3LV0 A;  1FTK A;  3D1R A;  3KBZ A;  1LCT A;  4RPN A;  4F3S A;  2XXK A;  2VD2 A;  1B5J A;  3HST A;  4HXV A;  3PMV A;  3GLB A;  3PD9 A;  4YMB A;  3KZG A;  1YTV A;  1N7X A;  2CMO A;  2ZYK A;  1NV6 A;  4ZEK A;  1EH3 A;  4IO3 A;  5I7I A;  4FOR A;  2D3I A;  3CRB A;  3UA8 A;  4R74 A;  4GQO A;  1URG A;  4C1T A;  2GRV A;  3GZG A;  1QKB A;  1Y3Q A;  4C0R A;  3O97 A;  3QXM A;  4IB2 A;  4O3C A;  4ELR A;  2Q9T A;  3C32 A;  3GYY A;  3TCH A;  2O68 A;  3KG2 A;  1B32 A;  3B6W A;  1MPC A;  4FJP A;  4NWC A;  3MJN A;  1ANF A;  4I9D A;  3FVK A;  4LUB A;  3MC2 A;  3MZB A;  4KYS A;  3V5A A;  2Z8E A;  2XXI A;  4GL8 A;  3N26 A;  5I56 A;  4N8G A;  3RTW B;  2DVC A;  3VFJ A;  1OQG A;  4O3B A;  4QFL A;  3OEL A;  5L9S A;  5ICT A;  5H8F A;  4GBW A;  1IIT A;  3C35 A;  1DTG A;  2Y5L A;  1OVB A;  3CHG A;  2PT1 A;  3ILU B;  3UGW A;  1DSN A;  4G8N A;  4PGP A;  2B4L A;  3G7W A;  5K2X A;  4NTL A;  5CBS A;  4F2O A;  4KHZ E;  1FSA A;  4U1O A;  4DI4 B;  5T3J A;  2DE2 A;  4NF5 A;  4NGU A;  2O84 X;  4JVC A;  3I6V A;  2ONR A;  1TFD A;  2DWI A;  2DXR A;  2XXQ A;  3G3G A;  1ZLQ A;  2WX9 A;  1J1N A;  3KJ7 A;  2O51 A;  5CC2 A;  4JDF A;  3TEP A;  4KI0 E;  4RPO A;  3OEM A;  4JBZ A;  2Q88 A;  4PBQ A;  4OVS A;  4N4U A;  5H8H A;  1MG1 A;  2H25 A;  2Q8J A;  3PTY A;  4I62 A;  1B0L A;  1FTJ A;  2FVZ A;  2MKZ A;  2I0C A;  2DQV A;  1FQB A;  5H8Q A;  1PB8 A;  1MPB A;  1Y3N A;  4G4P A;  3W9V A;  4UAB A;  1POT A;  2P0S A;  4PF6 A;  2NXO A;  4DXB A;  2DWH A;  2QSX A;  3OO8 A;  1B7U A;  4N13 A;  4ZEC A;  5FHM A;  3UN6 A;  2VGQ A;  1MH3 A;  3S9L C;  1VFE A;  1NKX A;  1B0H A;  1S50 A;  4H5F A;  4RXL A;  2F78 A;  2XXV A;  1NV0 A;  2G29 A;  2I3V A;  4NQ8 A;  3MVX A;  2X26 A;  4P3L A;  5B70 A;  2NUV A;  5IKB A;  2IEE A;  2UVJ A;  4G8M A;  4H8J A;  2CZK A;  2QS3 A;  1B9J A;  4QFP A;  4X1D A;  5AA2 A;  4O7M A;  3OO7 A;  3MZ1 A;  2XXP A;  4FBP A;  1MM6 A;  5H8S A;  3FAT A;  2XX8 A;  4NF8 A;  4OVR A;  1MDQ A;  1RYO A;  3CR9 A;  5L8D A;  3EN3 A;  5ITP A;  5LTC A;  3OD7 A;  3SEX A;  4U22 A;  4G68 C;  1URS A;  5CMC A;  3T96 B;  4XKQ A;  2OX3 A;  4GLI A;  4XKN A;  3QSL A;  3R26 A;  1N76 A;  3U92 A;  2P1S A;  4YKP A;  3F11 A;  4RK2 A;  3IB0 A;  3OSQ A;  3FVO A;  4KQP A;  5DVF A;  1B40 A;  1LFI A;  1USY H;  3HFU A;  5EQA A;  4PE3 A;  2ANJ A;  1QUJ A;  2YJP A;  3JV9 A;  1FPJ A;  4X9T A;  4MNP A;  1BP5 A;  1Y1Z A;  3IO6 A;  4NF0 A;  1VDW A;  2F3D A;  1O7T A;  3OSR A;  2XXT A;  1SD3 A;  3K4U A;  5EHS A;  1AL3 A;  1INP A;  2Q2A A;  3FXU A;  3IFA A;  2O1M A;  3SES A;  4H8I A;  4E0X A;  1UTB B;  2D21 A;  3PU5 A;  1A8E A;  1MY2 A;  4LON B;  4GBV A;  4O94 A;  4RYA A;  2Y7P A;  1SW1 A;  3A09 A;  1D4N A;  3M8U A;  3BFT A;  2G93 A;  5KCJ A;  3IR1 A;  5HBC A;  3E79 A;  3QUF A;  2VPN A;  1EYJ A;  2CEX A;  2ZYO A;  2ZZV A;  4XF5 A;  4F1U A;  4MF3 A;  4HE2 A;  4H0W A;  4N8Y A;  4OET A;  4YB5 A;  3UP9 A;  1KWH A;  5DVI A;  1IXG A;  4G61 A;  3K6W A;  1NH7 A;  2X7P A;  3FXQ A;  3IOT A;  1JVY A;  5I2K A;  4IGR A;  3HHG A;  2WEF A;  4N6P A;  3QAX A;  5F1Q A;  3HN0 A;  1QVS A;  2ZYN A;  5ET5 A;  4ZS9 A;  3PD8 A;  1EZO A;  2RF1 A;  4BDL A;  1QKA A;  2I48 A;  1WOD A;  2ABH A;  1OMP A;  5FTH A;  4OTE A;  3T9V A;  2ALU A;  1FPL A;  1UIU A;  4DZ1 A;  1P1Q A;  4QFK A;  5I57 B;  4IO6 A;  1B51 A;  1FQD A;  4AS4 A;  2XWO A;  5HPQ A;  4DE8 A;  4OAN A;  1FTO A;  2V84 A;  1MQI A;  3FGS A;  1NUY A;  4H65 A;  3RLF E;  4P47 A;  1JEV A;  4Q8R A;  1PB9 A;  2F7C A;  2WBD A;  4G68 B;  5A5L A;  3PGF A;  1Y4T A;  3GXA A;  3C34 A;  4QRZ A;  1UTH B;  4JVD A;  4EXL A;  1A7L A;  5FHO A;  5CM6 A;  4ND9 A;  2DP8 A;  3USD A;  1AOV A;  5TP9 B;  3U93 A;  3VDF A;  3B6T A;  1VE4 A;  1MY3 A;  5I2N A;  4ONY A;  3ISP A;  1KZ8 A;  4HCW A;  3FAS A;  4NG7 A;  2I58 A;  3QMF A;  5H8N A;  5EYH A;  1B5I A;  1FQF A;  3PV0 E;  1XVX A;  3VLV A;  3VXC A;  1LGB C;  1UQW A;  5EQ8 A;  1NUX A;  2Z8D A;  3FBP A;  1LST A;  1US4 A;  3Q26 A;  5EYG A;  1F9B A;  2XWK A;  4Q30 B;  5I5P A;  1P1N A;  2H98 A;  5CBR A;  4TQU Q;  4IY6 A;  2V93 A;  3TZA A;  5JTY A;  1IIW A;  3IB2 A;  3V8X B;  4Z7E A;  3K1P A;  3FV1 A;  3RUM A;  3MVY A;  3B7D A;  2AL4 A;  3IB1 A;  3K6V A;  1NV4 A;  3KC1 A;  4N15 A;  4FAJ A;  4H6D A;  1EU8 A;  4GWW A;  2OWT A;  4OHN A;  2THI A;  5I58 B;  2Q8M A;  4P11 A;  1A54 A;  1SVX B;  5AA4 A;  2Y7K A;  3SEW A;  1R1N A;  4NF6 A;  3QUJ A;  1EZP A;  1LCF A;  3OEN A;  3V83 A;  1DCU A;  1ELJ A;  4EF1 A;  1TFA A;  3TQL A;  2CZH A;  4U1Z A;  2I4C A;  1Y20 A;  3O2A A;  4XEQ A;  4O7I A;  2DXY A;  3OOA A;  1IXI A;  3T9U A;  1QJM A;  1A99 A;  2FIX A;  1OLC A;  4NN3 A;  3RN8 A;  1GR2 A;  4EDP A;  4TOZ A;  2REJ A;  1TWY A;  4P1E A;  5KDT B;  1I69 A;  3O29 A;  3FJ7 A;  1MY4 A;  4GX6 A;  4AQ4 A;  3MYU A;  2ZNS A;  4KCD A;  1IMB A;  2VOZ A;  2XXU A;  1K9Y A;  4PCD A;  3G3J A;  1ZKB A;  1CB6 A;  1B1H A;  2QS2 A;  4ELP A;  1B3E A;  1WVJ A;  4LVQ A;  3FIR A;  1PDA A;  2FNC A;  3H06 B;  2Y7R A;  4N81 A;  4R2F A;  2OCU A;  4F2Q A;  2Z22 A;  3ROJ A;  4QFO A;  1Q1K A;  1PBQ A;  2UVG A;  4HCY A;  3U65 A;  3FV2 A;  2PFY A;  5I59 B;  4GWX A;  4GWU A;  4X04 A;  4F3G A;  4QSE A;  3MPL A;  4HE1 A;  1L5T A;  2GHB A;  4G77 A;  4GIZ A;  4PAK A;  1FQC A;  3PPP A;  3SEU A;  1AH5 A;  1RDY A;  5ET8 A;  1FRP A;  4X48 A;  2KQZ A;  3TCG A;  2VHA A;  3O28 A;  5DEX B;  2YPN A;  3MVZ A;  1B46 A;  4M1V A;  4YB7 A;  2Z8F A;  1USY E;  4P0G A;  2QVU A;  1SDX A;  3C9H A;  1QGX A;  1QW0 A;  1A8F A;  1LBZ A;  1MXY A;  2QMW A;  4O3A A;  4POX A;  4LQ5 A;  1I6A A;  1NUZ A;  3IL1 B;  4O8M A;  5L9O A;  1NL5 A;  1DPE A;  3TTL A;  3U72 A;  3T9X B;  1T0K A;  4PFI A;  4MEV A;  3MUQ A;  1FPG A;  4U4S A;  4G2Z A;  2FYI A;  4PBH A;  1NNP A;  3JYR A;  1FBD A;  1VFD A;  3K6U A;  4OQO A;  5ISU A;  1ATG A;  1SI1 A;  4R75 A;  2XA5 A;  1BK4 A;  1FJ6 A;  2HAV A;  3S4U A;  1JW5 A;  1LBY A;  4EXK A;  2PVU A;  3OO9 A;  2QS1 A;  1GGG A;  2UVH A;  3E78 A;  1MXX A;  2FA7 A;  4G8H A;  4I1D A;  2V3Q A;  3PMW A;  1YPN A;  4IGT A;  2R71 A;  4NF5 B;  3O6I A;  2M8C A;  4ZE8 A;  4BDO A;  5AE4 A;  1MM7 A;  4QXD A;  2B4M A;  5F24 A;  2B3B A;  1B3L A;  3TMG A;  1H43 A;  1FPK A;  4DXU A;  2HHM A;  1D3K A;  4IO4 A;  4FIM A;  5H8H B;  3IFC A;  1HSE A;  1LBW A;  2RIN A;  3EQ1 A;  4RY1 A;  1H3D A;  3CFX A;  2FIE A;  5J1D A;  1AWB A;  5H8Q B;  4PDH A;  3CG3 A;  2CEY A;  2HCA A;  1P99 A;  1IQ7 A;  2Q89 A;  1R6Z A;  4GD5 A;  4KXP A;  2A5T B;  2UYE A;  4OES A;  3IX1 A;  3K0V A;  3MZ9 A;  1P1W A;  2V3U A;  2DVZ A;  1KA0 A;  3N5L A;  3K00 A;  2ZNT A;  1OQH A;  5TU0 A;  5AA2 B;  1ZBM A;  3PUW E;  4WKM A;  4MHF A;  1MH4 A;  1LBC A;  4YZZ A;  4YU0 A;  1SPI A;  4L17 A;  3G3K A;  3ODB A;  3VVE A;  2VT5 A;  3DP8 A;  4MLQ A;  4PFT A;  4OMB A;  1NMU A;  4JWO A;  2O6A A;  2P3N A;  1IMC A;  3KSX A;  3T1B A;  4AS5 A;  3P7I A;  4EQ7 A;  3G3I A;  1M5E A;  4YKJ A;  2H99 A;  4FEB A;  1N84 A;  3GBB A;  3RNN A;  4ESW A;  4GF8 A;  4PET A;  3S2V A;  2OBG A;  2OWZ A;  3IJX B;  4BLA A;  4KPT A;  1LAG E;  4PF8 A;  3D4C A;  1B1X A;  4I8C A;  2XD2 A;  4JWY A;  1Q35 A;  3M3K A;  4P56 A;  3ECR A;  3VVD A;  1B3H A;  1R9L A;  3IOR A;  2VP1 A;  2I6E A;  1RDZ A;  2DS9 A;  1MQH A;  1MXU A;  1JNF A;  3SDF A;  3N94 A;  3U1O A;  5JK4 A;  5I3S A;  1SW5 A;  1NFT A;  2F7A A;  3RY3 A;  1Y9U A;  1P1O A;  3IO4 A;  4PFU A;  3EHU A;  4WEP A;  4ZEB A;  4PC9 A;  4K3F A;  4GOT A;  1URD A;  1PC3 A;  4GRK A;  5CI5 A;  3UOR A;  3HHF A;  1OVT A;  2Y7W A;  5DW8 A;  3DEL B;  1FBF A;  4ISU A;  4LZ5 A;  2DOJ A;  2R9J A;  2YLN A;  3R6U A;  3KN7 A;  1IMF A;  2GHA A;  1OLA A;  1UTB A;  2F7B A;  2WKY A;  1FQE A;  5IAI A;  2CZI A;  2E1S A;  3QIM A;  3T0J A;  4E0W A;  4MAG A;  3LSL A;  1IMA A;  2OWS A;  2DE3 A;  1IUD A;  2ZNU A;  4PFY A;  3A3C A;  3WAE A;  5I2K B;  2NVU B;  1XI6 A;  4FAT A;  1FTM A;  1FPD A;  4NE4 A;  2RC8 A;  2HEU A;  5TPA B;  4F1Y A;  5BUU A;  4AB5 A;  3N6T A;  5EYF A;  3RPL A;  3TTR A;  3IAZ A;  4GWY A;  3IOV A;  2H4I A;  1EYK A;  4XXU A;  4F18 A;  2I4B A;  4ZDM A;  4PAI A;  4U23 A;  3ZSF A;  3JZJ A;  1JQF A;  4H1X A;  3H03 A;  1ZTY A;  1JEU A;  2F5X A;  3PUV E;  3CI8 A;  4BDR A;  4JVI A;  4IY5 A;  4EQ9 A;  4QF9 A;  4NF4 B;  2HFB A;  2XX9 A;  1H76 A;  1SI0 A;  4H45 A;  5BWJ A;  1NNK A;  5I57 A;  1A40 A;  1XHY A;  3TFL A;  2I49 A;  3HCQ A;  4YB6 A;  2IA4 A;  1SW4 A;  4MLV A;  2H5Y A;  1MRP A;  2ONK E;  2NOO A;  5AA2 D;  2CZL A;  1NUW A;  4QSC A;  4RNS A;  4MX6 A;  4MIJ A;  2KR0 A;  2DWA A;  4OFO A;  3MWB A;  4FE8 A;  4G68 A;  2OJT A;  1UIV A;  1B2H A;  5IZ3 B;  1Y1M A;  2P2A A;  1B5H A;  3Q27 A;  1UTH A;  2BJJ X;  3VLU A;  2DYX A;  4JWX A;  4GFR A;  3KGC A;  4PE5 B;  2XXH A;  4Q0C A;  4YIC A;  5TP9 A;  3ILT B;  3BIH A;  4PTK A;  3OEK A;  2XXX A;  2XWI A;  1FJ9 A;  1FBC A;  4YMA A;  2F36 A;  2PX1 A;  3A3U A;  4YAH X;  3RTF B;  2O69 A;  1NV5 A;  5DVJ A;  4OVP A;  1XT8 A;  4KR5 A;  2H9B A;  3MP1 A;  1PEB A;  4X1B A;  5A5X B;  2F3B A;  1FBG A;  5JTY B;  4KD5 A;  1LB9 A;  1LAH E;  3KN3 A;  1O64 A;  3LSW A;  4ELQ A;  4QHQ A;  1BLF A;  3KEI A;  3SER A;  3MVW A;  4GX3 A;  1SYI A;  1K9Z A;  1NNF A;  1MXZ A;  3ONM A;  4OFL A;  3KBR A;  1S9T A;  3PPO A;  3TAJ A;  3K01 A;  1FPB A;  2UYF A;  5AA4 B;  3RGY A;  1YCJ A;  4OEN A;  2RC7 A;  4RA1 A;  1JET A;  3VVF A;  2ZXT A;  3T22 A;  1KA1 A;  4DCX A;  3CSB A;  3LBS A;  4XTC Q;  4RJZ A;  5FHN A;  5I58 A;  3KOT A;  4LAT A;  1JP4 A;  3M3F A;  3RQT A;  4N6K A;  4QBA A;  3LUY A;  2HQ0 A;  2Y7I A;  4HTG A;  3DM0 A;  1IZ1 A;  3HPI A;  3LC8 A;  4LA9 A;  1D9V A;  4P0I A;  2DE4 A;  1FPE A;  3H6W A;  1N0T A;  3H6T A;  3DLN A;  3SKP A;  2OZZ A;  4H46 A;  1SW2 A;  1FPF A;  5LOM A;  4U4X A;  3FD3 A;  1M5C A;  5CMB A;  4ZZA A;  3FZV A;  4MFI A;  3EPE A;  1LAX A;  3PUZ E;  1CE2 A;  4OEU A;  3CFL A;  2A5S A;  3T66 A;  4DI3 D;  2R8T A;  5F7V A;  1JVX A;  1DOT A;  2XX7 A;  4XIG Q;  3Q29 A;  4XKP A;  2QJE A;  5KDT A;  1IME A;  3PUY E;  1EYI A;  4GWZ A;  4I40 A;  4PFW A;  3K1N A;  4X8R A;  1Q9D A;  4F19 A;  3UIF A;  1DBZ A;  2QVR A;  3CVG A;  5DYH A;  4NHB A;  1VR5 A;  3CSG A;  4QSD A;  3SET A;  4R6Y A;  1Z7M E;  3T93 B;  1N3X A;  3MPK A;  1B4Z A;  4PQJ A;  3CIJ A;  3BKI B;  5AA3 A;  3S9N C;  4DXC A;  2I0B A;  2ZZX A;  1XS5 A;  3FVN A;  1Y4C A;  4MNC A;  5I59 A;  3A29 A;  1B4H A;  3THI A;  1YXI A;  1MPD A;  3TKD A;  4WED A;  1LAF E;  4KCC A;  3C31 A;  2ONS A;  5DEX A;  2F6P A;  1GTK A;  1LB8 A;  1AMF A;  4UAC A;  4R9F A;  5I56 B;  3TYH A;  3H4Z A;  4Z0I A;  1MQG A;  2DDK A;  1MXV A;  1B7Z A;  3T9H B;  1HSJ A;  1FW0 A;  1N3W A;  4THI A;  1JW1 A;  2V3T A;  4U2R A;  3MST A;  5B7D A;  4OZ9 A;  5H8F B;  3KOS A;  3E13 X;  4MMP A;  3VLW A;  4OWD A;  3G3H A;  3E9X A;  2B3F A;  3D4G A;  3O6G A;  4JSD A;  1QUI A;  4P8B A;  1XC1 A;  2V4C A;  4LZ7 A;  3BIG A;  1G0I A;  4IO2 A;  3NOH A;  5IGA A;  3MAM A;  3TQW A;  1XVY A;  3HV1 A;  1MY1 A;  3FJG A;  1LFH A;  2LAO A;  4EF2 A;  2W7Y A;  4XKR A;  1M5D A;  3FJM A;  3QK6 A;  4Q5T A;  3MP8 A;  5ET7 A;  4FEC A;  2HPG A;  1TXF A;  2PBW A;  2HXR A;  4I3E A;  2Q74 A;  3IOU A;  5ELV A;  3LUZ A;  3DP4 A;  3MW0 A;  3BBR A;  2OLB A;  3H3G A;  5K2Y A;  4BDN A;  1I6Q A;  5I84 A;  2WYP A;  3O6H A;  4N17 A;  2HZK A;  3LSF B;  3I3V A;  2E0S A;  4OXV A;  3FXR A;  1M5F A;  2AIX A;  4DIG A;  2PYY A;  3MQ9 A;  2HZL A;  4F39 A;  2F34 A;  3N6U A;  1FQA A;  4R73 A;  3IJO B;  1MXW A;  1RYX A;  3Q28 A;  1M5B A;  3KFM A;  3R7X A;  2DSF A;  3ZS6 A;  3EKI A;  3B6Q A;  3GBA A;  2F97 A;  1B3G A;  1IEJ A;  4OFJ A;  5FBP A;  1JW4 A;  1B05 A;  4ESX A;  3PUX E;  3S9E A;  1H44 A;  2UXA A;  4NED A;  2WYK A;  3PPR A;  1Y3P A;  2A5T A;  1NV7 A;  5ITO A;  5CMK A;  1S7Y A;  3I5O A;  3IOW A;  4PFR A;  2XHD A;  4ELO A;  1LBB A;  5EHM A;  1NV1 A;  4NF8 B;  4ZE9 A;  3VV5 A;  4GXS B;  4U21 A;  1NNT A;  4DCY A;  4N6D A;  2F35 A;  3ZKL A;  1BKA A;  4NX1 A;  1FTL A;  2PT2 A;  4GVO A;  3V89 B;  1NV2 A;  4IO5 A;  4LQ2 A;  4F3P A;  4TLL B;  3Q25 A;  1B3F A;  3H6U A;  4R6K A;  5HM4 B;  4LN5 A;  2BJI A;  3H6V A;  3EHT A;  2PCR A;  4MJO A;  3IK6 B;  5CRY A;  3PPQ A;  1DPP A;  4OER A;  5M2V A;  4R2B A;  4OA4 A;  1XOC A;  1NH8 A;  2ZYM A;  4PFB A;  1FBE A;  4R6H A;  1P1U A;  4POW A;  5ET6 A;  4F22 A;  4NMY A;  1D9Y A;  2F6G A;  1ZU0 A;  3KSJ A;  4MH5 A;  2P3V A;  3K1M A;  4HW8 A; 
#chains in the Genus database with same CATH homology
 3PPN A;  3C4M A;  1GVC A;  3E3K A;  5CMM A;  3WAF A;  3L6G A;  1ZMG A;  2RCB A;  3FVG A;  2R6G E;  4F3B A;  4TLM B;  2QMX A;  4M4G A;  3TTK A;  3W9W A;  1N7W A;  2NWJ A;  1LLS A;  4EUO A;  5DT6 A;  2RC9 A;  3TTM A;  4GL0 A;  4R9G A;  1PB7 A;  2O1L A;  5JEI A;  2HAU A;  2XXR A;  1VSO A;  3SEV A;  5DTB A;  4F31 B;  2B65 A;  2Y84 A;  5KCJ B;  2AYS A;  2AL5 A;  1EZ9 A;  2REG A;  1HSL A;  4H5G A;  1QUK A;  3EHS A;  4N07 A;  2XD3 A;  5ICQ A;  3TTN A;  1MQD A;  4DLD A;  3TOD A;  2V25 A;  1N04 A;  5L9M A;  1SYH A;  1H45 A;  3VXB A;  2X7Q A;  1RKM A;  4RK9 A;  1II5 A;  1ZIU A;  4WXJ A;  3QYT A;  4H67 A;  5TPA A;  3KN8 A;  3RT6 B;  2QS4 A;  2UVI A;  3OO6 A;  1PBP A;  3BFU A;  3TPA A;  1OIB A;  5FTI A;  1DTZ A;  2VD3 A;  4DDD A;  3RT8 A;  4YKI A;  2KLF A;  5AA1 A;  1GV8 A;  1ZJL A;  3MP6 A;  1POY 1;  4JXI A;  4OEV A;  1B58 A;  3O66 A;  4NF4 A;  4F1V A;  3U94 A;  1TT1 A;  4MBP A;  3K02 A;  2Z23 A;  3S9M C;  1A55 A;  3CFZ A;  3LR1 A;  1IXH A;  3VE1 B;  1MS7 A;  4UA8 A;  2PMS A;  4GWO A;  2D5W A;  3LSX A;  4FED A;  2OK2 A;  3MBP A;  1SBP A;  2RKM A;  5I2N B;  1DMB A;  3TEL A;  4IO7 A;  1R9Q A;  3KJT A;  1BIY A;  1B52 A;  5H8N B;  2RCA A;  2ZMB A;  4QFN A;  5KZT A;  2QPQ A;  1BTJ A;  2O7U A;  4ECF A;  4OYV A;  4ZED A;  2QL3 A;  2QRY A;  2XXY A;  4JSO A;  3W15 C;  1B7H A;  3ZKK A;  3TUS A;  4YKK A;  4PP0 A;  3K6X A;  2GH9 A;  3RPW A;  2Q2C A;  3OXN A;  1FCK A;  3K2D A;  3UK4 A;  1QUL A;  3HO7 A;  3OMB A;  1MDP 1;  3PMX A;  4NWD A;  1US5 A;  4KYE A;  5A5X A;  3H7M A;  3EF7 A;  4OVJ A;  3C36 A;  3AXF A;  3O9P A;  3U8Q A;  2DWJ A;  1WDN A;  4NF6 B;  4LP2 B;  3SEY A;  3CG1 A;  3E4R A;  4LZ8 A;  2GFE A;  4C1U A;  1AIV A;  4JB7 A;  4KFQ A;  2XXW A;  4BDM A;  1MY0 A;  1LFG A;  4HS7 A;  2O7I A;  3M3L A;  3DP6 A;  2ESN A;  4ZEI A;  3TCF A;  2HXW A;  4ZZE A;  4ZEF A;  2I3W A;  2F8D A;  1MQJ A;  4R72 A;  3L6H A;  1SQY A;  1YAE A;  3G3F A;  3TDJ A;  3C33 A;  4F29 A;  4AB6 A;  1IXC A;  1I6B A;  3FUZ A;  4KYD A;  4GXA A;  4EQB A;  1B6H A;  1O63 A;  4BDQ A;  1Z7N E;  1FTK A;  1LCT A;  4RPN A;  4F3S A;  2VD2 A;  1B5J A;  3HST A;  3PMV A;  3GLB A;  3PD9 A;  4YMB A;  3KZG A;  1YTV A;  1N7X A;  2CMO A;  2ZYK A;  4ZEK A;  1EH3 A;  4IO3 A;  4FOR A;  2D3I A;  3CRB A;  3UA8 A;  4R74 A;  4GQO A;  1URG A;  4C1T A;  2GRV A;  3GZG A;  1QKB A;  1Y3Q A;  4C0R A;  3O97 A;  3QXM A;  4IB2 A;  4O3C A;  4ELR A;  2Q9T A;  3C32 A;  3TCH A;  2O68 A;  3KG2 A;  1B32 A;  3B6W A;  1MPC A;  4FJP A;  4NWC A;  3MJN A;  1ANF A;  4I9D A;  3FVK A;  4LUB A;  3MC2 A;  3MZB A;  4KYS A;  3V5A A;  2Z8E A;  2XXI A;  4GL8 A;  3N26 A;  5I56 A;  3RTW B;  2DVC A;  3VFJ A;  1OQG A;  4O3B A;  4QFL A;  3OEL A;  5L9S A;  5ICT A;  5H8F A;  1IIT A;  3C35 A;  1DTG A;  1OVB A;  2PT1 A;  3ILU B;  3UGW A;  1DSN A;  4G8N A;  3G7W A;  5K2X A;  4NTL A;  5CBS A;  4F2O A;  4KHZ E;  4U1O A;  2DE2 A;  4NF5 A;  2O84 X;  3I6V A;  2ONR A;  1TFD A;  2DWI A;  2DXR A;  2XXQ A;  3G3G A;  1ZLQ A;  1J1N A;  3KJ7 A;  2O51 A;  5CC2 A;  4JDF A;  3TEP A;  4KI0 E;  4RPO A;  3OEM A;  4JBZ A;  2Q88 A;  5H8H A;  1MG1 A;  2H25 A;  2Q8J A;  4I62 A;  1B0L A;  1FTJ A;  2I0C A;  2DQV A;  1FQB A;  5H8Q A;  1PB8 A;  1MPB A;  1Y3N A;  4G4P A;  3W9V A;  1POT A;  2P0S A;  2NXO A;  4DXB A;  2DWH A;  2QSX A;  3OO8 A;  1B7U A;  4N13 A;  4ZEC A;  5FHM A;  3UN6 A;  2VGQ A;  1MH3 A;  3S9L C;  1VFE A;  1NKX A;  1B0H A;  1S50 A;  4H5F A;  4RXL A;  2F78 A;  2XXV A;  2G29 A;  2I3V A;  3MVX A;  2X26 A;  5B70 A;  2NUV A;  5IKB A;  2IEE A;  2UVJ A;  4G8M A;  4H8J A;  2QS3 A;  1B9J A;  4QFP A;  4X1D A;  5AA2 A;  3OO7 A;  3MZ1 A;  2XXP A;  5H8S A;  1MM6 A;  3FAT A;  2XX8 A;  4NF8 A;  1MDQ A;  1RYO A;  3CR9 A;  5L8D A;  3EN3 A;  5ITP A;  3OD7 A;  3SEX A;  4U22 A;  4G68 C;  1URS A;  5CMC A;  3T96 B;  4XKQ A;  4GLI A;  4XKN A;  3QSL A;  3R26 A;  1N76 A;  3U92 A;  2P1S A;  4YKP A;  3F11 A;  4RK2 A;  3IB0 A;  3OSQ A;  3FVO A;  4KQP A;  5DVF A;  1B40 A;  1LFI A;  1USY H;  2ANJ A;  1QUJ A;  2YJP A;  3JV9 A;  4X9T A;  1BP5 A;  1Y1Z A;  3IO6 A;  1O7T A;  3OSR A;  2XXT A;  1SD3 A;  3K4U A;  5EHS A;  1AL3 A;  2Q2A A;  3FXU A;  2O1M A;  3SES A;  4H8I A;  4E0X A;  1UTB B;  2D21 A;  3PU5 A;  1A8E A;  1MY2 A;  4LON B;  4RYA A;  2Y7P A;  1SW1 A;  3A09 A;  1D4N A;  3M8U A;  3BFT A;  2G93 A;  5KCJ A;  3IR1 A;  5HBC A;  3QUF A;  2ZYO A;  4F1U A;  4MF3 A;  4H0W A;  4OET A;  4YB5 A;  3UP9 A;  1KWH A;  5DVI A;  1IXG A;  3K6W A;  1NH7 A;  2X7P A;  3FXQ A;  3IOT A;  1JVY A;  5I2K A;  4IGR A;  3HHG A;  4N6P A;  3QAX A;  5F1Q A;  3HN0 A;  1QVS A;  2ZYN A;  4ZS9 A;  3PD8 A;  1EZO A;  2RF1 A;  4BDL A;  1QKA A;  2I48 A;  1WOD A;  2ABH A;  1OMP A;  5FTH A;  4OTE A;  3T9V A;  2ALU A;  1UIU A;  4DZ1 A;  1P1Q A;  4QFK A;  5I57 B;  4IO6 A;  1B51 A;  1FQD A;  5HPQ A;  4DE8 A;  1FTO A;  2V84 A;  1MQI A;  3FGS A;  4H65 A;  3RLF E;  1JEV A;  4Q8R A;  1PB9 A;  2F7C A;  4G68 B;  3PGF A;  1Y4T A;  3GXA A;  3C34 A;  4QRZ A;  1UTH B;  4EXL A;  1A7L A;  5FHO A;  5CM6 A;  4ND9 A;  2DP8 A;  3USD A;  1AOV A;  5TP9 B;  3U93 A;  3VDF A;  3B6T A;  1VE4 A;  1MY3 A;  5I2N A;  4ONY A;  4HCW A;  3FAS A;  2I58 A;  5H8N A;  1B5I A;  1FQF A;  3PV0 E;  1XVX A;  3VLV A;  3VXC A;  1LGB C;  1UQW A;  2Z8D A;  3Q26 A;  1LST A;  1US4 A;  1F9B A;  4Q30 B;  1P1N A;  2H98 A;  5CBR A;  4TQU Q;  4IY6 A;  2V93 A;  3TZA A;  5JTY A;  1IIW A;  3IB2 A;  3V8X B;  4Z7E A;  3K1P A;  3FV1 A;  3RUM A;  3MVY A;  3B7D A;  2AL4 A;  3IB1 A;  3K6V A;  4FAJ A;  4H6D A;  1EU8 A;  2OWT A;  4OHN A;  2THI A;  5I58 B;  4P11 A;  1A54 A;  1SVX B;  5AA4 A;  2Y7K A;  3SEW A;  1R1N A;  4NF6 A;  3QUJ A;  1EZP A;  1LCF A;  3OEN A;  3V83 A;  1ELJ A;  4EF1 A;  1TFA A;  3TQL A;  4U1Z A;  2I4C A;  1Y20 A;  3O2A A;  2DXY A;  3OOA A;  1IXI A;  3T9U A;  1QJM A;  1A99 A;  1OLC A;  3RN8 A;  1GR2 A;  4EDP A;  4TOZ A;  2REJ A;  1TWY A;  5KDT B;  1I69 A;  3O29 A;  3FJ7 A;  1MY4 A;  4AQ4 A;  2ZNS A;  4KCD A;  2VOZ A;  2XXU A;  3G3J A;  1ZKB A;  1CB6 A;  1B1H A;  2QS2 A;  4ELP A;  1B3E A;  1WVJ A;  4LVQ A;  3FIR A;  1PDA A;  2FNC A;  3H06 B;  2Y7R A;  4R2F A;  2OCU A;  4F2Q A;  2Z22 A;  4QFO A;  1Q1K A;  1PBQ A;  2UVG A;  4HCY A;  3FV2 A;  5I59 B;  4F3G A;  4QSE A;  3MPL A;  1L5T A;  2GHB A;  4G77 A;  4GIZ A;  1FQC A;  3PPP A;  3SEU A;  1AH5 A;  4X48 A;  3TCG A;  2VHA A;  3O28 A;  5DEX B;  2YPN A;  3MVZ A;  1B46 A;  4M1V A;  4YB7 A;  2Z8F A;  1USY E;  4P0G A;  1SDX A;  3C9H A;  1QW0 A;  1A8F A;  2QMW A;  1MXY A;  4O3A A;  4POX A;  4LQ5 A;  1I6A A;  3IL1 B;  5L9O A;  1NL5 A;  1DPE A;  3TTL A;  3U72 A;  3T9X B;  1T0K A;  3MUQ A;  4U4S A;  4G2Z A;  2FYI A;  1NNP A;  3JYR A;  1VFD A;  3K6U A;  4OQO A;  5ISU A;  1ATG A;  1SI1 A;  4R75 A;  2HAV A;  3S4U A;  1JW5 A;  4EXK A;  2PVU A;  3OO9 A;  2QS1 A;  1GGG A;  2UVH A;  1MXX A;  2FA7 A;  4G8H A;  4I1D A;  2V3Q A;  3PMW A;  1YPN A;  4IGT A;  2R71 A;  4NF5 B;  3O6I A;  2M8C A;  4ZE8 A;  4BDO A;  5AE4 A;  1MM7 A;  2B3B A;  1B3L A;  3TMG A;  1H43 A;  4DXU A;  1D3K A;  4IO4 A;  4FIM A;  5H8H B;  1HSE A;  2RIN A;  3EQ1 A;  4RY1 A;  1H3D A;  3CFX A;  5J1D A;  5H8Q B;  3CG3 A;  2HCA A;  1P99 A;  1IQ7 A;  2Q89 A;  1R6Z A;  4GD5 A;  2A5T B;  2UYE A;  4OES A;  3IX1 A;  3K0V A;  3MZ9 A;  1P1W A;  2V3U A;  2DVZ A;  3N5L A;  3K00 A;  2ZNT A;  1OQH A;  5TU0 A;  5AA2 B;  1ZBM A;  3PUW E;  4WKM A;  1MH4 A;  1LBC A;  4YZZ A;  4YU0 A;  4L17 A;  3G3K A;  3ODB A;  3VVE A;  3DP8 A;  4MLQ A;  4PFT A;  4OMB A;  1NMU A;  4JWO A;  2O6A A;  3KSX A;  3P7I A;  4EQ7 A;  3G3I A;  1M5E A;  4YKJ A;  2H99 A;  4FEB A;  1N84 A;  3GBB A;  3RNN A;  4ESW A;  4GF8 A;  4PET A;  3S2V A;  2OBG A;  3IJX B;  4BLA A;  4KPT A;  1LAG E;  3D4C A;  1B1X A;  4I8C A;  2XD2 A;  4JWY A;  1Q35 A;  3M3K A;  3ECR A;  3VVD A;  1B3H A;  1R9L A;  3IOR A;  2VP1 A;  2I6E A;  2DS9 A;  1MQH A;  1MXU A;  1JNF A;  3SDF A;  3N94 A;  3U1O A;  5JK4 A;  1SW5 A;  1NFT A;  2F7A A;  3RY3 A;  1Y9U A;  1P1O A;  3IO4 A;  4PFU A;  3EHU A;  4WEP A;  4ZEB A;  4K3F A;  4GOT A;  1URD A;  1PC3 A;  4GRK A;  5CI5 A;  3UOR A;  3HHF A;  1OVT A;  2Y7W A;  3DEL B;  4ISU A;  4LZ5 A;  2DOJ A;  2R9J A;  2YLN A;  3R6U A;  3KN7 A;  2GHA A;  1OLA A;  1UTB A;  2F7B A;  2WKY A;  1FQE A;  5IAI A;  2E1S A;  3QIM A;  4E0W A;  3LSL A;  2OWS A;  2DE3 A;  1IUD A;  2ZNU A;  4PFY A;  3A3C A;  3WAE A;  5I2K B;  2NVU B;  4FAT A;  1FTM A;  4NE4 A;  2RC8 A;  2HEU A;  5TPA B;  4F1Y A;  5BUU A;  4AB5 A;  3N6T A;  5EYF A;  3TTR A;  3IAZ A;  3IOV A;  2H4I A;  4XXU A;  4F18 A;  2I4B A;  4ZDM A;  4U23 A;  3ZSF A;  3JZJ A;  1JQF A;  4H1X A;  3H03 A;  1ZTY A;  1JEU A;  2F5X A;  3PUV E;  3CI8 A;  4BDR A;  4IY5 A;  4EQ9 A;  4QF9 A;  4NF4 B;  2HFB A;  2XX9 A;  1H76 A;  1SI0 A;  5BWJ A;  1NNK A;  5I57 A;  1A40 A;  1XHY A;  3TFL A;  2I49 A;  3HCQ A;  4YB6 A;  2IA4 A;  1SW4 A;  4MLV A;  2H5Y A;  1MRP A;  2ONK E;  2NOO A;  5AA2 D;  2CZL A;  4QSC A;  4RNS A;  2DWA A;  4OFO A;  3MWB A;  4FE8 A;  4G68 A;  2OJT A;  1UIV A;  1B2H A;  1Y1M A;  2P2A A;  1B5H A;  3Q27 A;  1UTH A;  2BJJ X;  3VLU A;  2DYX A;  4JWX A;  4GFR A;  3KGC A;  4PE5 B;  2XXH A;  4Q0C A;  4YIC A;  5TP9 A;  3ILT B;  3OEK A;  2XXX A;  4YMA A;  2F36 A;  2PX1 A;  3A3U A;  4YAH X;  3RTF B;  2O69 A;  5DVJ A;  1XT8 A;  4KR5 A;  2H9B A;  3MP1 A;  1PEB A;  4X1B A;  5A5X B;  5JTY B;  4KD5 A;  1LB9 A;  1LAH E;  3KN3 A;  1O64 A;  3LSW A;  4ELQ A;  4QHQ A;  1BLF A;  3KEI A;  3SER A;  3MVW A;  1SYI A;  1NNF A;  1MXZ A;  3ONM A;  4OFL A;  3KBR A;  1S9T A;  3PPO A;  3TAJ A;  3K01 A;  2UYF A;  5AA4 B;  3RGY A;  1YCJ A;  4OEN A;  2RC7 A;  4RA1 A;  1JET A;  3VVF A;  2ZXT A;  3T22 A;  4DCX A;  3CSB A;  3LBS A;  4XTC Q;  4RJZ A;  5FHN A;  5I58 A;  3KOT A;  4LAT A;  3M3F A;  3RQT A;  3LUY A;  2HQ0 A;  2Y7I A;  4HTG A;  3DM0 A;  1IZ1 A;  3HPI A;  3LC8 A;  4LA9 A;  1D9V A;  4P0I A;  2DE4 A;  3H6W A;  1N0T A;  3H6T A;  3DLN A;  3SKP A;  2OZZ A;  1SW2 A;  5LOM A;  4U4X A;  3FD3 A;  1M5C A;  5CMB A;  4ZZA A;  3FZV A;  4MFI A;  3EPE A;  1LAX A;  3PUZ E;  1CE2 A;  4OEU A;  3CFL A;  2A5S A;  3T66 A;  5F7V A;  1JVX A;  1DOT A;  2XX7 A;  4XIG Q;  3Q29 A;  4XKP A;  2QJE A;  5KDT A;  3PUY E;  4PFW A;  3K1N A;  4F19 A;  3UIF A;  5DYH A;  3CVG A;  1VR5 A;  3CSG A;  4QSD A;  3SET A;  4R6Y A;  1Z7M E;  3T93 B;  1N3X A;  3MPK A;  1B4Z A;  4PQJ A;  3CIJ A;  3BKI B;  5AA3 A;  3S9N C;  4DXC A;  2I0B A;  1XS5 A;  3FVN A;  1Y4C A;  5I59 A;  1B4H A;  3THI A;  1MPD A;  3TKD A;  4WED A;  1LAF E;  4KCC A;  3C31 A;  2ONS A;  5DEX A;  2F6P A;  1GTK A;  1LB8 A;  1AMF A;  4UAC A;  4R9F A;  5I56 B;  3TYH A;  3H4Z A;  4Z0I A;  1MQG A;  1MXV A;  1B7Z A;  3T9H B;  1HSJ A;  1FW0 A;  1N3W A;  4THI A;  1JW1 A;  2V3T A;  4U2R A;  5B7D A;  4OZ9 A;  5H8F B;  3KOS A;  3E13 X;  3VLW A;  4OWD A;  3G3H A;  3E9X A;  2B3F A;  3D4G A;  3O6G A;  4JSD A;  1QUI A;  1XC1 A;  4LZ7 A;  4IO2 A;  3MAM A;  3TQW A;  1XVY A;  3HV1 A;  1MY1 A;  3FJG A;  1LFH A;  2LAO A;  4EF2 A;  2W7Y A;  4XKR A;  1M5D A;  3FJM A;  3QK6 A;  4Q5T A;  3MP8 A;  4FEC A;  1TXF A;  2PBW A;  3IOU A;  5ELV A;  3DP4 A;  3MW0 A;  3BBR A;  2OLB A;  3H3G A;  5K2Y A;  4BDN A;  1I6Q A;  5I84 A;  3O6H A;  2HZK A;  3LSF B;  3I3V A;  2E0S A;  4OXV A;  3FXR A;  1M5F A;  2AIX A;  4DIG A;  2PYY A;  3MQ9 A;  2HZL A;  4F39 A;  2F34 A;  3N6U A;  1FQA A;  4R73 A;  3IJO B;  1MXW A;  1RYX A;  3Q28 A;  1M5B A;  3KFM A;  3R7X A;  2DSF A;  3ZS6 A;  3B6Q A;  3GBA A;  2F97 A;  1B3G A;  1IEJ A;  4OFJ A;  1JW4 A;  4ESX A;  1B05 A;  3PUX E;  3S9E A;  1H44 A;  2UXA A;  4NED A;  3PPR A;  1Y3P A;  2A5T A;  5ITO A;  5CMK A;  1S7Y A;  3I5O A;  3IOW A;  2XHD A;  4ELO A;  1LBB A;  5EHM A;  4NF8 B;  4ZE9 A;  3VV5 A;  4GXS B;  4U21 A;  1NNT A;  4DCY A;  2F35 A;  3ZKL A;  1BKA A;  1FTL A;  2PT2 A;  4GVO A;  3V89 B;  4IO5 A;  4LQ2 A;  4F3P A;  4TLL B;  3Q25 A;  1B3F A;  3H6U A;  4R6K A;  5HM4 B;  3H6V A;  3EHT A;  3IK6 B;  5CRY A;  3PPQ A;  1DPP A;  4OER A;  5M2V A;  4R2B A;  1XOC A;  1NH8 A;  2ZYM A;  4R6H A;  1P1U A;  4POW A;  4F22 A;  4NMY A;  1D9Y A;  2F6G A;  1ZU0 A;  3KSJ A;  4MH5 A;  3K1M A;  4HW8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...