3OXNA

The crystal structure of a putative transcriptional regulator from vibrio parahaemolyticus
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
215
structure length
213
Chain Sequence
PQQCDQTFTIATTDYAMQTILPFALPRIYQEAPNVSFNFLPLQHDRLSDQLTYEGADLAICRPTGPVEPLRSEILGRVGVLCLLSKQHPLANQEMSLDDYLSHPHAMIAISDGVKALIEQALIDKPQRKMVLRAYHLEAALAIVLPIIITVPADLAYLVAERYDLVVKPLPFQFTPFDYSMIWHARCEHSPAQEWLRSVVREECSRLIAKRIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of a putative transcriptional regulator from Vibrio parahaemolyticus
rcsb
source organism Vibrio parahaemolyticus
molecule tags Transcription regulator
molecule keywords Putative transcriptional regulator, LysR family
total genus 48
structure length 213
sequence length 215
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3oxnA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3oxnA02
1FW0A 3KN3A 3OSRA 1QULA 3Q28A 3QSLA 1O63A 2ZXTA 3PPNA 3PPRA 3LSFB 4BDRA 2I3WA 4IO6A 2NOOA 2QMWA 5CBSA 2ZMBA 2D3IA 4LQ5A 4QFPA 1LFGA 1IITA 3IL1B 4RXLA 4R9GA 4WEDA 3WAFA 1UQWA 4U22A 3SEUA 2HQ0A 3BFUA 3MZBA 3N5LA 1F9BA 1M5BA 3MJNA 4OENA 2QS3A 3OEMA 1FQCA 1R6ZA 3OOAA 2FYIA 4IO3A 3T9VA 4BLAA 4G68C 3K01A 4R2FA 3DP6A 4YAHX 1D9VA 4GXAA 2XX9A 3GZGA 1YTVA 1MXXA 4ESWA 1QKBA 1WODA 3KJTA 4Q0CA 4RNSA 3N6TA 2DXRA 2B3BA 2DQVA 2R9JA 4Z0IA 1LLSA 1M5CA 3FATA 1S7YA 5H8QA 3FIRA 1I6BA 2ZYMA 4G8MA 4OXVA 3TCFA 2UVIA 4ELQA 3S9NC 1IUDA 4Q5TA 4C1TA 1B9JA 4OEUA 1B05A 1P1WA 4M1VA 4G8HA 3UIFA 3W9VA 4IGTA 5CC2A 1UTHA 1YAEA 2Q89A 1NFTA 4I9DA 1R9QA 2OZZA 3JV9A 2NXOA 2P0SA 1EZ9A 4LQ2A 5AA2D 1Y9UA 2QSXA 4RPNA 3OENA 5DTBA 1POTA 3VFJA 1ZJLA 2DP8A 3BFTA 2Y7IA 3C34A 3H4ZA 4GFRA 4RY1A 1LSTA 2HAVA 4PETA 2Y7KA 3TELA 1LFIA 3EHTA 5AA2B 1AH5A 4KYEA 5FTIA 3PUZE 3U93A 1US5A 1B4ZA 3K6XA 3VVDA 3E13X 5BUUA 3PD8A 4U1ZA 5I57A 4IB2A 3QUJA 2XX8A 1MPDA 5I2NA 2FNCA 4YKJA 3UK4A 4FORA 4XTCQ 3S9LC 1B3FA 2O7UA 4NMYA 1MY3A 1B3GA 3MPLA 3OO7A 3ZS6A 4YZZA 4RK2A 5AA3A 2XXYA 3KFMA 3UGWA 5H8FA 3E9XA 4LP2B 5H8NB 5HPQA 3CG3A 2HXWA 3IB0A 1VFEA 3FGSA 3K1MA 3B6TA 3LR1A 4QFNA 4YKKA 3C36A 3OD7A 4JWXA 1BLFA 3RT8A 5IAIA 3SEXA 3FUZA 4ELRA 2DS9A 1MY4A 2UYEA 2O68A 1FQDA 5TPAA 4LZ8A 4EXLA 5A5XA 4ONYA 3UP9A 1Y3PA 2Q8JA 4NWCA 1UTBA 2RF1A 2AIXA 2DVZA 1EU8A 2F7BA 2A5TB 2W7YA 5CRYA 1B51A 1MXVA 3VLWA 4TQUQ 1POY1 3O9PA 2FA7A 4K3FA 1D4NA 4AB6A 3TTMA 4F2QA 1DTZA 4KYDA 3MZ9A 3EHSA 2GRVA 4NF4B 3PPPA 4EF2A 4GXSB 5ISUA 3FXQA 2G93A 2RCAA 2O1LA 1AL3A 1B4HA 3H6VA 4I1DA 4LUBA 4Q30B 4ZEFA 4BDOA 3ILTB 2ZYNA 3TFLA 3CSGA 1P99A 5I58A 3A3CA 2O7IA 3FD3A 5AA4B 2NVUB 1VFDA 4NF8A 4OFLA 1USYE 4KCDA 1XS5A 5KZTA 1UTHB 4TLLB 4U2RA 2H9BA 1FTJA 2PMSA 1PEBA 2QS4A 2O6AA 4KPTA 1JVXA 1Y3NA 2GHBA 3B6WA 3K1NA 2Q2CA 1P1QA 3KSJA 3OELA 3OEKA 2HZKA 3G3HA 3OSQA 3RY3A 4R74A 3K2DA 3LSXA 4OESA 4NF5A 5DYHA 4AB5A 3I6VA 3K00A 3QYTA 4POXA 2I4CA 4X48A 5ITOA 2DWIA 1XVXA 2F8DA 3MVYA 4GL0A 1R9LA 2XXPA 1PB9A 1DMBA 3O6GA 4H5GA 2THIA 2M8CA 1DSNA 4PE5B 2X26A 3FVNA 3PD9A 4U4XA 1SDXA 4X9TA 3RQTA 3PU5A 1OVTA 1LAFE 4G2ZA 4F29A 3SESA 2ALUA 2H25A 1FTOA 3HN0A 3KN7A 1BTJA 3IX1A 1ZMGA 3MP1A 4Q8RA 1VSOA 1NH7A 2F6PA 1R1NA 4NF6B 3CSBA 4HW8A 1FTKA 2F7CA 2P2AA 3P7IA 1N3WA 4H5FA 5JTYB 4DIGA 1SI0A 3TKDA 3VXCA 3S9EA 4OYVA 1UIVA 3MW0A 3DP8A 3PMVA 4LA9A 4LZ7A 4F1VA 2Y7RA 3VXBA 1MQDA 3W15C 1ATGA 1MQHA 1TXFA 1XHYA 2ONKE 4YB6A 1Z7NE 5L8DA 4FAJA 3CFLA 3IO6A 1FQAA 1MXYA 4UACA 3HHGA 1B7ZA 1CE2A 3PPOA 4O3AA 4ECFA 1IZ1A 4JWOA 3N6UA 4GOTA 1A99A 1MY0A 2Y84A 3PUVE 3G3FA 4EXKA 2DYXA 2H4IA 4QSDA 3RUMA 2NUVA 3K6VA 3UA8A 4BDLA 3C4MA 1H76A 1SVXB 1OVBA 4DCXA 4F3GA 4PP0A 4XKRA 3MUQA 5L9SA 2QRYA 4X1DA 3TTNA 3KJ7A 5AA2A 1O64A 3IK6B 2F78A 4R2BA 1MH3A 3CVGA 5FTHA 5EHSA 1LCTA 1SW1A 2Z22A 5I58B 4Z7EA 1MH4A 4IO4A 1D3KA 4KQPA 2Z8DA 1QJMA 1B3HA 4PFYA 4OTEA 4QFOA 5DEXB 4NF8B 4HS7A 2F36A 3CR9A 1A54A 3FJGA 3MBPA 1B0HA 4MFIA 4DXBA 5BWJA 3OO6A 2ZNUA 4PFUA 4C0RA 1FQBA 5KDTB 1URGA 3KN8A 4MLQA 1NH8A 4NTLA 4RYAA 4ZZEA 2HAUA 4RK9A 1MY1A 5CMBA 4ZEDA 1YCJA 2GFEA 3TUSA 2AYSA 2XHDA 4R73A 1JETA 1O7TA 3EHUA 4OEVA 3TCGA 2Z8FA 2VD3A 2H99A 4R72A 1B1HA 4OFJA 3PUYE 1USYH 5K2XA 3VVEA 4N6PA 4OHNA 2DE3A 3MWBA 4P0GA 1LBCA 3TODA 2IEEA 4MH5A 4H8IA 3KEIA 1FTMA 1H43A 1JQFA 1SQYA 1LAHE 5ITPA 3N26A 1Z7ME 4DCYA 3L6HA 4XKNA 2OJTA 4ISUA 4NF6A 5H8HB 5CI5A 1DTGA 1OMPA 4F2OA 5ICQA 3TTRA 1NKXA 3IORA 3RLFE 1B5JA 2RC7A 3C32A 4OFOA 1JEUA 3FASA 4I62A 1SYHA 4NE4A 4ZE9A 3O97A 5JK4A 3V8XB 2V84A 3L6GA 4EUOA 3MVZA 3Q29A 1I6AA 2PVUA 3U92A 3V5AA 1JEVA 4N07A 1HSJA 1P1UA 2XXVA 2F5XA 3CG1A 3F11A 3KBRA 1LGBC 3O28A 2VP1A 4YB5A 2DWJA 4LZ5A 5M2VA 2I3VA 2HEUA 3H7MA 4LVQA 3ONMA 3PMWA 4N13A 1L5TA 2I0BA 4R75A 3TPAA 4QFKA 1XOCA 3FVOA 4TLMB 4DLDA 1NNFA 3RTWB 2O1MA 5B7DA 1S50A 1BP5A 4DDDA 2Q9TA 4EF1A 2YLNA 4G68A 4GVOA 5I56B 1TFDA 3IB1A 3ZKKA 1RYOA 1MPCA 3D4GA 3TDJA 5LOMA 3O66A 1BIYA 5K2YA 3O2AA 4IO5A 1ZIUA 2DVCA 4U21A 3SEYA 3IOVA 2REGA 3H03A 4OWDA 3U94A 1LBBA 1IEJA 1TT1A 2V25A 5TP9B 2RINA 2ZNTA 4LATA 5CBRA 3KG2A 4ND9A 3CFZA 1DOTA 3C31A 4ZEBA 2Z23A 3FJMA 4ZE8A 5HM4B 2XD2A 4YMBA 1IXIA 4OVJA 5CMMA 4DXCA 1M5FA 4YKPA 3E4RA 2Q2AA 4LONB 3CRBA 3HV1A 1H3DA 2I4BA 4F1YA 2YJPA 5KDTA 2F97A 1N7XA 2H5YA 1MXUA 2F34A 4PQJA 2CZLA 4RPOA 4R6KA 5JTYA 2GHAA 1ZTYA 3N94A 5FHMA 4YMAA 1DPPA 4IO7A 4FEDA 4GL8A 2OCUA 3JYRA 1B40A 4H65A 2PT2A 4MLVA 4U23A 2HFBA 3GBBA 2WKYA 3R26A 3V83A 2DE2A 3IB2A 3MZ1A 1A55A 1IXGA 3Q25A 3T96B 5ICTA 1IXCA 1B0LA 3SETA 5H8QB 1N84A 3QK6A 3KOSA 2DWAA 2E0SA 1N7WA 1B32A 2ONRA 2X7QA 1OLAA 4KHZE 3T93B 5L9OA 1MDQA 3FVGA 2G29A 4EQ9A 3H6UA 5TPAB 2XXUA 4H6DA 3K4UA 2ANJA 5FHOA 1JVYA 1FQEA 1NMUA 1KWHA 4FECA 1QUJA 2P1SA 3E3KA 3MPKA 3USDA 4O3CA 1EZOA 1B3EA 2I58A 4BDQA 3OXNA 4QRZA 3TZAA 4KR5A 1XVYA 1PB7A 2DWHA 1N04A 1XC1A 3HPIA 3RPWA 3QIMA 3GLBA 3IO4A 3T66A 3BBRA 1JW4A 1MQIA 4OMBA 2Y7PA 3O6IA 5F7VA 4U1OA 1MQJA 4O3BA 1J1NA 1QUKA 3ZSFA 2HCAA 2ONSA 1LFHA 1GR2A 1GTKA 3PUXE 3SEWA 3AXFA 3W9WA 2Y7WA 3FJ7A 4WEPA 1H45A 2I0CA 5I57B 2RC8A 2HZLA 2ZNSA 3K02A 5I2NB 1I6QA 1D9YA 3C33A 5DVFA 4U4SA 3JZJA 5AA1A 4JSDA 3M3LA 3K6UA 5I59A 3H6TA 3H3GA 2Q88A 2O51A 1AMFA 4FIMA 4YU0A 5TP9A 3R7XA 3M8UA 3RNNA 4ESXA 1NL5A 2UVHA 1UIUA 2PT1A 4KYSA 4PFWA 3U72A 3VV5A 3CFXA 3B7DA 4H1XA 4BDMA 1VE4A 3O29A 1A7LA 3CIJA 2VOZA 4H67A 5DVIA 1JNFA 2AL5A 3ODBA 1H44A 1URSA 1LCFA 3S4UA 3ILUB 4ZECA 1T0KA 2OBGA 3O6HA 2QL3A 3SEVA 4XXUA 1PDAA 2XXHA 3G7WA 4XIGQ 2DSFA 2VHAA 1N76A 1Q1KA 3C35A 3GBAA 3MQ9A 3MVWA 4GF8A 4HCWA 3EF7A 4WXJA 4QSEA 3M3FA 2BJJX 5HBCA 2R71A 3VLVA 2D5WA 2DXYA 2XD3A 1MS7A 2F35A 3CI8A 3FV1A 3HCQA 3HO7A 2XXIA 4R6YA 1EZPA 3I3VA 2PYYA 1SW2A 1TWYA 3MP8A 4P0IA 4GWOA 2B3FA 3OMBA 4RA1A 3QXMA 4FJPA 4JDFA 1MXZA 4R6HA 2E1SA 2A5TA 1ZBMA 4HTGA 3SKPA 3TMGA 5B70A 1ELJA 5L9MA 5I84A 3S2VA 5TU0A 3TEPA 4G4PA 3U8QA 4ELPA 1Y4TA 3MVXA 4NF4A 2O69A 4DXUA 1FTLA 2B65A 4X1BA 4IY6A 2X7PA 4FE8A 5KCJA 1RKMA 1II5A 2XXRA 4YB7A 4NF5B 2LAOA 2QJEA 2ZYKA 3TQLA 1LAXA 4F19A 3TAJA 4GRKA 3LSLA 1MY2A 1VR5A 1CB6A 1B1XA 4XKPA 4YKIA 2ZYOA 1MRPA 2QS2A 2F7AA 3OO8A 4MBPA 4OETA 1QUIA 2V3TA 3FV2A 5CMCA 1N3XA 4GLIA 2XX7A 3IJXB 2QS1A 2I48A 3T22A 4JXIA 4P11A 4TOZA 2QPQA 4PFTA 2QMXA 4QF9A 5I59B 3G3IA 1PBPA 3DLNA 4M4GA 2D21A 3V89B 3HSTA 3IJOB 5CM6A 5I2KA 3OO9A 4KI0E 1I69A 5H8SA 3KGCA 2REJA 1B58A 1ZU0A 4F3SA 4G77A 4EQ7A 3EQ1A 4KFQA 1UTBB 3MP6A 2ABHA 3TTLA 1AOVA 1IQ7A 1SI1A 1YPNA 5DVJA 2VGQA 2OWSA 1OQHA 3KZGA 4QFLA 4WKMA 3T9HB 3LBSA 1FQFA 4ZZAA 1QW0A 3T9XB 1PBQA 1XT8A 4NEDA 2I49A 1Y20A 3PUWE 3D4CA 3A09A 4YICA 1HSLA 4E0XA 1LB8A 3B6QA 3ECRA 1P1NA 2V3QA 1BKAA 3DM0A 3Q27A 5FHNA 3PPQA 1MDP1 1WDNA 1Y4CA 4JSOA 2F6GA 3K1PA 4EQBA 1NNTA 1ANFA 3IOTA 4R9FA 1DPEA 3IOWA 1IXHA 4QSCA 2PX1A 1GVCA 5AA4A 5DT6A 5J1DA 1LB9A 3SERA 4UA8A 2IA4A 2H98A 1NNPA 1SBPA 3H06B 1GGGA 3R6UA 4H8JA 4ZDMA 3THIA 1B5HA 1M5DA 3I5OA 2RKMA 3FXUA 4IY5A 3S9MC 4F1UA 1B7HA 1SW5A 3K6WA 1SD3A 3G3KA 4EDPA 2RCBA 5KCJB 2PBWA 3RN8A 1B7UA 1MM6A 1Q35A 3RTFB 3VDFA 5H8FB 2VD2A 3HHFA 3WAEA 1JW1A 4F18A 1MPBA 2I6EA 1OIBA 2XXQA 3K0VA 3PGFA 4NWDA 1PC3A 3PMXA 1ZKBA 1TFAA 1LAGE 4L17A 3RGYA 3VVFA 5DEXA 1B2HA 1URDA 1GV8A 3TYHA 4ZS9A 3SDFA 3Q26A 3DP4A 1JW5A 4THIA 3UN6A 1A8EA 2GH9A 2UVGA 3IAZA 4F39A 5EYFA 3M3KA 4ZEIA 4IGRA 4ZEKA 3EN3A 3H6WA 1Y3QA 2OWTA 4F22A 4GQOA 1A40A 3MAMA 4DZ1A 5CMKA 3T9UA 5IKBA 1B52A 1RYXA 3G3GA 1SYIA 4FEBA 4OQOA 5I2KB 4F3BA 2DOJA 1PB8A 3A3UA 3FXRA 1MG1A 4DE8A 4JBZA 2UVJA 3IOUA 3EPEA 2O84X 2CMOA 4JWYA 3TTKA 4GD5A 3VE1B 1OLCA 3UORA 4GIZA 3LC8A 4FATA 5H8HA 1A8FA 1MM7A 2XXWA 2A5SA 3FVKA 2OLBA 4OERA 4H0WA 4KCCA 1Y1MA 2NWJA 4AQ4A 4C1UA 1ZLQA 5A5XB 1B3LA 1EH3A 3VLUA 4I8CA 1B5IA 3QUFA 3U1OA 1FCKA 4POWA 1QKAA 1AIVA 4QHQA 2UYFA 2YPNA 4BDNA 3BKIB 3KOTA 2OK2A 1B46A 2V93A 4G68B 3PV0E 5F1QA 4KD5A 3MC2A 3ZKLA 2AL4A 1Y1ZA 1QVSA 5JEIA 1MQGA 4ELOA 3QAXA 3C9HA 4MF3A 4XKQA 3LUYA 1B6HA 2DE4A 2Z8EA 3TQWA 2R6GE 4F31B 5ELVA 3IR1A 2XXXA 2V3UA 4G8NA 4JB7A 1S9TA 3FZVA 4RJZA 2KLFA 4E0WA 1HSEA 1N0TA 1MXWA 5AE4A 3TCHA 5I56A 3KSXA 4IO2A 4F3PA 1M5EA 4OZ9A 2UXAA 3RT6B 1NNKA 1P1OA 1WVJA 3LSWA 2ESNA 5EHMA 1US4A 1IIWA 4HCYA 3DELB 1SW4A 2XXTA 1OQGA 2RC9A 3G3JA 3GXAA 5H8NA
chains in the Genus database with same CATH superfamily
3KN3A 1QULA 4P3LA 3QSLA 1O63A 3PPNA 3PPRA 2I3WA 4IO6A 3LUZA 2ZMBA 2D3IA 3IL1B 3ZS6A 3MJNA 2QS3A 2FYIA 1MXXA 1FTAA 4Q0CA 5IZ1A 4F1YA 1M5CA 1S7YA 3FIRA 1I6BA 4G8MA 2UVIA 1IUDA 4Q5TA 4OEUA 4M1VA 3CHGA 3UIFA 1YAEA 2Q74A 4I9DA 4GX6A 1R9QA 2OZZA 5AA2D 2XWVA 1POTA 3VFJA 1ZJLA 3BFTA 1NUZA 5AA2B 5IZ3A 1US5A 3PD8A 3UK4A 1MY3A 1B3GA 3KFMA 3UGWA 3E9XA 4LP2B 4DI4B 5H8NB 3IB0A 3K1MA 3B6TA 3OD7A 4JWXA 4PC9A 2O68A 5TPAA 4LZ8A 5A5XA 3UP9A 2AIXA 1FPKA 2A5TB 5CRYA 1YZ0A 1MXVA 3O9PA 2CZKA 2P3NA 4F2QA 4KYDA 3MZ9A 3PPPA 4GXSB 2ZZWA 2G93A 2RCAA 4I1DA 4Q30B 4ZEFA 3TFLA 4XFEA 1D9QA 4NF8A 2H9BA 2QS4A 1JVXA 1Y3NA 3B6WA 1DCUA 3K1NA 4X9TA 3G3HA 2I4CA 3MVYA 2CZHA 1R9LA 2KR0A 3PD9A 1SDXA 1NUYA 3HN0A 3KN7A 5ET8A 2QVVA 3MP1A 1R1NA 2Q8MA 4HW8A 1FTKA 1N3WA 4H5FA 5JTYB 1SI0A 1EYJA 4FAJA 4UACA 3HHGA 1B7ZA 4JWOA 3UA8A 2NUVA 4BDLA 4F3GA 4PP0A 4QXDA 3KJ7A 5AA2A 5EHSA 4Z7EA 5DEXB 1B3HA 4PFYA 3V89B 1KZ8A 3FJGA 1B0HA 5KDTB 4RYAA 2HAUA 1MY1A 1FBHA 3TUSA 1O7TA 1B1HA 3VVEA 2IEEA 1FBGA 4ISUA 5ICQA 1RDYA 2RC7A 3V5AA 4N15A 1HSJA 3KBRA 1LGBC 4LZ5A 2F3DA 3ONMA 2CEYA 4DLDA 2F3BA 4DDDA 4EF1A 2YLNA 4G68A 3IB1A 1RYOA 5LOMA 3O66A 1BIYA 1ZIUA 2DVCA 4U21A 3U94A 1IEJA 1TT1A 5IZZA 3KG2A 1DOTA 2QFLA 2XWIA 5CMMA 4YKPA 3E4RA 4LONB 3HV1A 4PQJA 4RPOA 5JTYA 1DPPA 4FEDA 2HFBA 2WKYA 3Q25A 5ICTA 3SETA 1N84A 2E0SA 2X7QA 3FVGA 4EQ9A 4H6DA 1QUJA 2P1SA 3E3KA 3USDA 4PTKA 3QIMA 3GLBA 4O8MA 2Y7PA 4O3BA 1QUKA 2HCAA 1GTKA 1K9ZA 1FBDA 2RC8A 2HZLA 2ZNSA 5I2NB 1DK4A 5DVFA 3K6UA 4FIMA 3VV5A 3CFXA 3B7DA 2VOZA 5DVIA 3ODBA 1H44A 1URSA 1NUXA 1PDAA 2V4CA 2XXHA 2VHAA 1N76A 1Q1KA 3C35A 2D5WA 2XXIA 1G0HA 4PDHA 4XF5A 4P0IA 4GWOA 2B3FA 3TMGA 3SKPA 5L9MA 5I84A 4ELPA 3ROJA 1Y4TA 4NF4A 2X7PA 3T1BA 4MAGA 1MY2A 1FPDA 3FV2A 1N3XA 4GLIA 2I48A 4QF9A 4PFTA 3HSTA 5I2KA 4KI0E 1I69A 3KGCA 1ZU0A 4F3SA 4G77A 4PFIA 4KFQA 1UTBB 2ABHA 1AOVA 2OWZA 3T9HB 3T9XB 1FPEA 4HE1A 3A09A 2V3QA 1BKAA 3DM0A 4JSOA 4EQBA 3K1PA 1NNTA 1ANFA 4I3YA 2IA4A 1SBPA 3R6UA 1B7HA 1SW5A 3K6WA 1SD3A 3G3KA 2RCBA 1FBCA 5H8FB 2VD2A 1JW1A 3K0VA 1ZKBA 4L17A 3RGYA 3TYHA 3Q26A 5EQAA 2GH9A 2UVGA 3IAZA 4ZEIA 1JP4A 4NQ8A 4ZEKA 1Y3QA 4GQOA 4DZ1A 1RYXA 3G3GA 5I2KB 4JVIA 3IOUA 1NV0A 3TTKA 3LC8A 4FATA 4OERA 2OLBA 4C1UA 4AQ4A 1EH3A 5EYGA 4I8CA 1B5IA 3QUFA 3LV0A 4QHQA 1AIVA 4GWSA 3KOTA 2OK2A 1B46A 3PV0E 4PGPA 2AL4A 1Y1ZA 1MQGA 3BIGA 1B6HA 2DE4A 3IR1A 4RJZA 1S9TA 3FZVA 1HSEA 3KC1A 1LBYA 2UXAA 2OX3A 1P1OA 3LSWA 1US4A 3GXAA 2XXTA 3G3JA 3OSRA 3Q28A 1FPGA 2QMWA 5CBSA 1LFGA 4WEDA 4U22A 3N5LA 4IR8A 1F9BA 4OENA 3OEMA 4IO3A 4BLAA 4G68C 3DP6A 4YAHX 2XX9A 5EQ8A 3KJTA 3N6TA 2DXRA 2B3BA 4Z0IA 2R9JA 1B05A 1QGXA 4G8HA 5CC2A 2Q89A 1NFTA 1EZ9A 2QSXA 4RPNA 4G61A 2HAVA 4PETA 1LFIA 1AH5A 3PUZE 3U93A 3E13X 5I57A 2XX8A 2FNCA 4XTCQ 3MPLA 2CEXA 1K9YA 2HXWA 3FGSA 3RT8A 5IAIA 1BLFA 5I3SA 3SEXA 1SPIA 2HPGA 1FQDA 4OANA 2RF1A 1EYKA 2W7YA 1B51A 4TQUQ 1D4NA 4AB6A 1AL3A 1B4HA 4LUBA 4PCDA 2WYPA 3ILTB 2ZYNA 3CSGA 1P99A 3FD3A 5AA4B 1VFDA 4KCDA 1XS5A 2PMSA 1PEBA 4KPTA 2O6AA 2BJIA 2GQ1A 3OSQA 3OELA 3OEKA 2DDKA 4R74A 3QYTA 1XVXA 1PB9A 4U4XA 1DSNA 2X26A 3FVNA 3RQTA 3PU5A 1LAFE 4F29A 2H25A 3KC0A 1BTJA 1VSOA 1NH7A 4NF6B 4DIGA 3VXCA 3S9EA 4OYVA 3PMVA 4LA9A 1MQDA 1LBZA 1MQHA 2HXRA 3IO6A 1FQAA 1MXYA 4P8BA 1CE2A 1MY0A 2DYXA 2H4IA 4QSDA 3K6VA 3C4MA 4DCXA 4JVDA 4XKRA 3MUQA 4R2BA 5IZ3B 3CVGA 5FTHA 1NV2A 1SW1A 1D3KA 4KQPA 4NF8B 4HS7A 3CR9A 1A54A 2CZIA 4DXBA 2XWKA 5BWJA 4C0RA 2P3VA 1URGA 4MLQA 1NH8A 4RK9A 1YCJA 2GFEA 2XHDA 4R73A 1JETA 2Z8FA 2VD3A 2H99A 4OFJA 3PUYE 5K2XA 4OHNA 4H8IA 3N26A 1Z7ME 3L6HA 1LBXA 4XKNA 5H8HB 4NF6A 5CI5A 1DTGA 3TTRA 1B5JA 4N4UA 4NE4A 4ZE9A 2V84A 3U92A 3MYUA 3F11A 2FBPA 2HEUA 2I0BA 1XOCA 3FVOA 4TLMB 1NNFA 2O1MA 1S50A 2Q9TA 5I5PA 5K2YA 1LBBA 2V25A 5CBRA 3CFZA 5HM4B 4YMBA 1IXIA 3FXBA 1M5FA 2I4BA 5KDTA 2F97A 2VT5A 4N6KA 1MXUA 2F34A 2CZLA 2GHAA 3N94A 2OCUA 4H65A 2DE2A 4PBHA 1A55A 1IXGA 1IXCA 1B0LA 2DWAA 5LDZA 3T93B 4KHZE 5L9OA 2G29A 5TPAB 5FHOA 2QVUA 1JVYA 1NMUA 3MPKA 4GWWA 2I58A 4BDQA 4MNCA 1PB7A 2DWHA 1N04A 1XC1A 3IO4A 1JW4A 5F7VA 3FJ7A 4WEPA 2I0CA 4PF8A 1D9YA 4U4SA 2RC9A 3JZJA 4JSDA 4AS5A 5I59A 4ESXA 3R7XA 3M8UA 1NL5A 2UVHA 2FIEA 4BDMA 1VE4A 3CIJA 1JNFA 1LCFA 3S4UA 2DSFA 3GBAA 3MQ9A 4HCWA 4QSEA 3M3FA 2BJJX 2XD3A 1MS7A 3CI8A 4R6YA 1EZPA 1SW2A 4N8GA 4RA1A 4R6HA 1ZBMA 1ELJA 5TU0A 3TEPA 2O69A 1FTLA 4FE8A 2QJEA 2ZYKA 3TQLA 4F19A 3TAJA 3LSLA 1VR5A 1CB6A 2QS2A 3OO8A 4OETA 2V3TA 2XX7A 4JXIA 4TOZA 3G3IA 3DLNA 4NN3A 2D21A 3IJOB 2ZZVA 3MP6A 1SI1A 1OQHA 3KZGA 4WKMA 3LBSA 4NEDA 1Y20A 1LB8A 3ECRA 3TPAA 2F6GA 2VPOA 5J1DA 4ZDMA 1NNPA 3THIA 4FBPA 3I5OA 3S9MC 2PBWA 1B7UA 1Q35A 3VDFA 2I6EA 1LAGE 1B2HA 1URDA 1GV8A 4ZS9A 1IMAA 3DP4A 4THIA 1A8EA 1INPA 1NV4A 4PGNA 3M3KA 4PAIA 4IGRA 3H6WA 5LTCA 4KXPA 1PB8A 4DE8A 3EPEA 4GD5A 1A8FA 4GBWA 3FVKA 2XWOA 1YXIA 1ZLQA 4MJOA 3VLUA 1IMFA 3B50A 1LEVA 4POWA 3BKIB 4G68B 5F1QA 3D1RA 4KD5A 3MC2A 4PFBA 3ZKLA 1FPBA 2KQZA 4ELOA 3QAXA 1DBZA 3C9HA 3LUYA 4F31B 2Z8EA 2XXXA 2V3UA 4G8NA 1MXWA 5I56A 4IO2A 2ESNA 2JJKA 1KA0A 4N6DA 1FBFA 1OQGA 1FJ9A 1FW0A 4P1EA 2ZXTA 2NOOA 4QFPA 1IITA 4RXLA 4R9GA 3WAFA 3SEUA 2HQ0A 3MZBA 4PAFA 4O94A 1FQCA 4PBQA 5ET5A 4GXAA 3GZGA 1QKBA 2WX9A 4RNSA 5H8QA 3ISPA 2ZYMA 4OXVA 4NHBA 1P1WA 4GX3A 3SZPA 1IMEA 4IGTA 1NUWA 1UTHA 1NV5A 2NXOA 2DP8A 2Y7IA 3H4ZA 3TELA 2Y7KA 5FTIA 1B4ZA 4I3EA 4PAKA 4U1ZA 4N17A 5I2NA 4YKJA 2ZZXA 3S9LC 1B3FA 4X8RA 4NMYA 3OO7A 4RK2A 2XXYA 5HPQA 3CG3A 1VFEA 3LR1A 4QFNA 3C36A 5IM2A 4ELRA 4OVQA 1IMDA 4EXLA 4ONYA 1Y3PA 4NWCA 2DVZA 2HHMA 1POY1 2FA7A 1DTZA 3EHSA 2GRVA 4NF4B 5ISUA 3FXQA 4P56A 2O1LA 3A3CA 2NVUB 4OVRA 5EYHA 1USYE 5KZTA 1UTHB 4TLLB 1FTJA 4MIJA 1P1QA 5DYHA 3K2DA 4OESA 1LFHA 4X48A 2DWIA 2F8DA 4OVJA 4P11A 2XXPA 2M8CA 3SESA 1FTOA 2F7CA 2P2AA 3P7IA 3TKDA 4N91A 1UIVA 3MW0A 3DP8A 4F1VA 1TXFA 2ONKE 1Z7NE 5L8DA 3PPOA 4UABA 4ECFA 3N6UA 4GOTA 2Y84A 5L9SA 1MH3A 1LCTA 2Z22A 1MH4A 4QFOA 1QJMA 4OTEA 2F36A 3MBPA 1RDXA 3OO6A 4PFUA 1FQBA 5H8FA 4MNPA 4OEVA 3TCGA 4R72A 1USYH 2DE3A 4P0GA 1LBCA 3TODA 1FTMA 1SQYA 5ITPA 4X04A 5A5LA 2OJTA 1OMPA 4F2OA 3C32A 4OFOA 3FASA 4I62A 1SYHA 3L6GA 4EUOA 1I6AA 2PVUA 1JEVA 2F5XA 2VP1A 2DWJA 5M2VA 4LVQA 3PMWA 5B7DA 5I56B 3ZKKA 1MPCA 3D4GA 3TDJA 3IOVA 3H03A 4LATA 3C31A 4ZEBA 2Z23A 2XD2A 3IFAA 4DXCA 2Q2AA 1H3DA 2YJPA 1ZTYA 5FHMA 4DCYA 3V83A 1B40A 4MEVA 2PT2A 4U23A 3R26A 3IB2A 3T96B 3QK6A 2ONRA 1OLAA 1MDQA 3H6UA 1RDZA 3K4UA 1FQEA 1KWHA 5EQ7A 4FECA 4GX4A 4O3CA 1EZOA 3T0JA 1B3EA 4KR5A 1XVYA 3T66A 3BBRA 1NI9A 4OMBA 4QBAA 4U1OA 1J1NA 3ZSFA 2ONSA 4N8YA 1GR2A 3PUXE 3SEWA 3AXFA 3W9WA 2Y7WA 1H45A 3C33A 3H3GA 2O51A 1AMFA 4YU0A 3RNNA 2VPNA 1UIUA 4PFWA 3U72A 4H1XA 4ZECA 1T0KA 2OBGA 3SEVA 4XXUA 4GF8A 3EF7A 4WXJA 2R71A 2DXYA 3FV1A 3HCQA 3HO7A 5T3JA 2PYYA 3MP8A 1IMCA 1LBWA 3QXMA 4FJPA 4JDFA 1MXZA 2A5TA 5B70A 3E79A 4G4PA 3MVXA 1NV3A 2B65A 4X1BA 4IY6A 1RKMA 1II5A 4YB7A 2LAOA 1LAXA 1CNQA 4HE2A 4XKPA 3HFUA 2F7AA 1NV1A 4MBPA 4PF6A 3IJXB 4DI3D 4GWYA 2QPQA 4O7IA 2QMXA 5I59B 4M4GA 5CM6A 3OO9A 1FBEA 1B58A 3EQ1A 3TTLA 1IQ7A 2VGQA 4QFLA 4ZZAA 2WBBA 3PUWE 3D4CA 1NV6A 4E0XA 3B6QA 3Q27A 1P1NA 4P9KA 3RN8A 1WDNA 4R9FA 1IXHA 1IMBA 2PX1A 1GVCA 1VDWA 2PCRA 4MNIA 1EYIA 4UA8A 2H98A 1GGGA 1B5HA 2RKMA 3FXUA 4IY5A 4F1UA 4GWXA 4EDPA 1MM6A 3RTFB 3HHFA 4F18A 3PGFA 4NWDA 3PMXA 2WBDA 5DEXA 3SDFA 2R8TA 2OWTA 4F22A 1A40A 5CMKA 3T9UA 1B52A 4FEBA 2DOJA 3A3UA 4JBZA 2UVJA 2O84X 2CMOA 4JWYA 3VE1B 1OLCA 4GIZA 1G0IA 4LN5A 1MM7A 2A5SA 4H0WA 2NWJA 4I40A 5A5XB 2FVZA 5I7IA 1FCKA 2UYFA 2FIXA 2YPNA 3BIHA 5DW8A 1QVSA 5JEIA 1FBPA 3TQWA 1YYZA 2R6GE 4JB7A 2KLFA 3TCHA 1FJ6A 4OVPA 4F3PA 4OZ9A 3RT6B 5ESYA 1LBVA 1IIWA 4HCYA 1SW4A 5H8NA 3KBZA 4BDRA 3LSFB 4LQ5A 3E78A 1UQWA 4P47A 3BFUA 4OWDA 1M5BA 3VVDA 1R6ZA 3OOAA 3T9VA 3K01A 1D9VA 1YTVA 4O7MA 4ESWA 1WODA 2DQVA 1LLSA 3FATA 3TCFA 4ELQA 4HXVA 3S9NC 4C1TA 5FBPA 1B9JA 2MKZA 3W9VA 3QMFA 2PFYA 3JV9A 2P0SA 4LQ2A 4GBVA 1Y9UA 3OENA 5DTBA 3C34A 4GFRA 4RY1A 1LSTA 4KYEA 5BUUA 3K6XA 4IB2A 3QUJA 1MPDA 4FORA 2QVRA 2O7UA 5AA3A 4YZZA 4YKKA 1FPLA 4HE0A 3FUZA 2DS9A 1MY4A 2UYEA 2FHYA 3PTYA 3U65A 2Q8JA 1UTBA 3NOHA 1EU8A 2F7BA 3A29A 3VLWA 5ET6A 4K3FA 3TTMA 4EF2A 3H6VA 4BDOA 5F24A 4N81A 5I58A 2O7IA 4OFLA 4U2RA 2GHBA 3TTNA 3KSJA 2Q2CA 3RY3A 2HZKA 5KCJB 3LSXA 4NF5A 4AB5A 3I6VA 3K00A 4POXA 5ITOA 4H5GA 4GL0A 3O6GA 4R2FA 1DMBA 2THIA 4PE5B 1OVTA 4G2ZA 2ALUA 1FPJA 4GWZA 3IFCA 3IX1A 4Q8RA 1ZMGA 2F6PA 1KA1A 3CSBA 4MHFA 1NV7A 4LZ7A 2Y7RA 3W15C 1ATGA 4YB6A 1XHYA 1BK4A 3CFLA 4O3AA 1IZ1A 4MCOA 1A99A 4EXKA 3PUVE 3G3FA 3RUMA 3RPLB 1H76A 1SVXB 1OVBA 2QRYA 4X1DA 4OA4A 1O64A 3IK6B 2F78A 2PFZA 2XXKA 5I58B 4IO4A 2Z8DA 4NAPA 4MFIA 2ZNUA 3KN8A 4ZZEA 3VXBA 4NTLA 4ZEDA 5CMBA 2AYSA 3EHUA 4OVTA 4N6PA 4MMPA 3MWBA 4MH5A 3KEIA 1H43A 1JQFA 1LAHE 1NKXA 3IORA 3RLFE 1JEUA 3O97A 5JK4A 3V8XB 4PE3A 3MVZA 3Q29A 4N07A 1P1UA 2XXVA 3CG1A 3O28A 3RYDA 4YB5A 2I3VA 3H7MA 4N13A 1L5TA 4R75A 4QFKA 4NF0A 3RTWB 1BP5A 4GVOA 1TFDA 3O2AA 4IO5A 3SEYA 2REGA 5TP9B 2RINA 2ZNTA 4NX1A 4ND9A 4ZE8A 3FJMA 4XEQA 3MSTA 4OVSA 3CRBA 3GYYA 2Y5LA 1N7XA 2H5YA 5IGAA 4R6KA 4YMAA 4IO7A 4GL8A 3JYRA 4MLVA 3GBBA 3MZ1A 5H8QB 3KOSA 2WYKA 1N7WA 1B32A 1XI6A 2XXUA 2ANJA 3OXNA 4QRZA 3TZAA 3HPIA 3RPWA 1MQIA 3O6IA 1MQJA 5I57B 3K02A 1I6QA 3EKIA 5AA1A 3M3LA 3H6TA 2Q88A 5TP9A 2PT1A 4KYSA 4JVCA 3O29A 2XA5A 1A7LA 4H67A 2AL5A 4P1LA 3ILUB 1FPIA 3O6HA 2QL3A 3G7WA 4XKQA 4XIGQ 3MVWA 5HBCA 4NGUA 3VLVA 2F35A 4MX6A 3I3VA 1TWYA 3OMBA 2E1SA 4HTGA 3S2VA 3U8QA 4DXUA 4NG7A 5KCJA 2XXRA 4NF5B 4GRKA 2WEFA 1B1XA 4YKIA 2ZYOA 1MRPA 1QUIA 5CMCA 2QS1A 3T22A 1PBPA 2L5VA 5J16A 4PDDA 5H8SA 2REJA 4EQ7A 1Q9DA 1FPFA 1YPNA 5DVJA 2OWSA 1FQFA 1QW0A 1PBQA 1XT8A 2I49A 4YICA 1HSLA 5FHNA 3PPQA 1MDP1 1Y4CA 5EQ9A 3IOTA 1DPEA 3IOWA 4QSCA 5AA4A 5DT6A 1LB9A 3SERA 4H8JA 3H06B 1M5DA 1FSAA 3RPLA 3WAEA 1MPBA 2XXQA 1OIBA 1PC3A 1TFAA 3VVFA 1FRPA 4H46A 1JW5A 3UN6A 4F39A 5EYFA 3EN3A 3MAMA 4H45A 5IKBA 1SYIA 2B4MA 4OQOA 4F3BA 3FXRA 1MG1A 3UORA 5H8HA 2XXWA 5AE4A 4KCCA 1Y1MA 1B3LA 4GWUA 2B4LA 3U1OA 1QKAA 4BDNA 5ET7A 3B8BA 2V93A 2Y5KA 1AWBA 4PFRA 4MF3A 5ELVA 4E0WA 1N0TA 3KSXA 1M5EA 1NNKA 5EHMA 1WVJA 3FBPA 3DELB 3EHTA 4AS4A
chains in the Genus database with same CATH topology
1FW0A 3KN3A 3OSRA 1QULA 3Q28A 3QSLA 1O63A 2ZXTA 3PPNA 3PPRA 3LSFB 4BDRA 2I3WA 4IO6A 2NOOA 2QMWA 5CBSA 2ZMBA 2D3IA 4LQ5A 4QFPA 1LFGA 1IITA 3IL1B 4RXLA 4R9GA 4WEDA 3WAFA 1UQWA 4U22A 3SEUA 2HQ0A 3BFUA 3MZBA 3N5LA 1F9BA 1M5BA 3MJNA 4OENA 2QS3A 3OEMA 1FQCA 1R6ZA 3OOAA 2FYIA 4IO3A 3T9VA 4BLAA 4G68C 3K01A 4R2FA 3DP6A 4YAHX 1D9VA 4GXAA 2XX9A 3GZGA 1YTVA 1MXXA 4ESWA 1QKBA 1WODA 3KJTA 4Q0CA 4RNSA 3N6TA 2DXRA 2B3BA 2DQVA 2R9JA 4Z0IA 1LLSA 1M5CA 3FATA 1S7YA 5H8QA 3FIRA 1I6BA 2ZYMA 4G8MA 4OXVA 3TCFA 2UVIA 4ELQA 3S9NC 1IUDA 4Q5TA 4C1TA 1B9JA 4OEUA 1B05A 1P1WA 4M1VA 4G8HA 3UIFA 3W9VA 4IGTA 5CC2A 1UTHA 1YAEA 2Q89A 1NFTA 4I9DA 1R9QA 2OZZA 3JV9A 2NXOA 2P0SA 1EZ9A 4LQ2A 5AA2D 1Y9UA 2QSXA 4RPNA 3OENA 5DTBA 1POTA 3VFJA 1ZJLA 2DP8A 3BFTA 2Y7IA 3C34A 3H4ZA 4GFRA 4RY1A 1LSTA 2HAVA 4PETA 2Y7KA 3TELA 1LFIA 3EHTA 5AA2B 1AH5A 4KYEA 5FTIA 3PUZE 3U93A 1US5A 1B4ZA 3K6XA 3VVDA 3E13X 5BUUA 3PD8A 4U1ZA 5I57A 4IB2A 3QUJA 2XX8A 1MPDA 5I2NA 2FNCA 4YKJA 3UK4A 4FORA 4XTCQ 3S9LC 1B3FA 2O7UA 4NMYA 1MY3A 1B3GA 3MPLA 3OO7A 3ZS6A 4YZZA 4RK2A 5AA3A 2XXYA 3KFMA 3UGWA 5H8FA 3E9XA 4LP2B 5H8NB 5HPQA 3CG3A 2HXWA 3IB0A 1VFEA 3FGSA 3K1MA 3B6TA 3LR1A 4QFNA 4YKKA 3C36A 3OD7A 4JWXA 1BLFA 3RT8A 5IAIA 3SEXA 3FUZA 4ELRA 2DS9A 1MY4A 2UYEA 2O68A 1FQDA 5TPAA 4LZ8A 4EXLA 5A5XA 4ONYA 3UP9A 1Y3PA 2Q8JA 4NWCA 1UTBA 2RF1A 2AIXA 2DVZA 1EU8A 2F7BA 2A5TB 2W7YA 5CRYA 1B51A 1MXVA 3VLWA 4TQUQ 1POY1 3O9PA 2FA7A 4K3FA 1D4NA 4AB6A 3TTMA 4F2QA 1DTZA 4KYDA 3MZ9A 3EHSA 2GRVA 4NF4B 3PPPA 4EF2A 4GXSB 5ISUA 3FXQA 2G93A 2RCAA 2O1LA 1AL3A 1B4HA 3H6VA 4I1DA 4LUBA 4Q30B 4ZEFA 4BDOA 3ILTB 2ZYNA 3TFLA 3CSGA 1P99A 5I58A 3A3CA 2O7IA 3FD3A 5AA4B 2NVUB 1VFDA 4NF8A 4OFLA 1USYE 4KCDA 1XS5A 5KZTA 1UTHB 4TLLB 4U2RA 2H9BA 1FTJA 2PMSA 1PEBA 2QS4A 2O6AA 4KPTA 1JVXA 1Y3NA 2GHBA 3B6WA 3K1NA 2Q2CA 1P1QA 3KSJA 3OELA 3OEKA 2HZKA 3G3HA 3OSQA 3RY3A 4R74A 3K2DA 3LSXA 4OESA 4NF5A 5DYHA 4AB5A 3I6VA 3K00A 3QYTA 4POXA 2I4CA 4X48A 5ITOA 2DWIA 1XVXA 2F8DA 3MVYA 4GL0A 1R9LA 2XXPA 1PB9A 1DMBA 3O6GA 4H5GA 2THIA 2M8CA 1DSNA 4PE5B 2X26A 3FVNA 3PD9A 4U4XA 1SDXA 4X9TA 3RQTA 3PU5A 1OVTA 1LAFE 4G2ZA 4F29A 3SESA 2ALUA 2H25A 1FTOA 3HN0A 3KN7A 1BTJA 3IX1A 1ZMGA 3MP1A 4Q8RA 1VSOA 1NH7A 2F6PA 1R1NA 4NF6B 3CSBA 4HW8A 1FTKA 2F7CA 2P2AA 3P7IA 1N3WA 4H5FA 5JTYB 4DIGA 1SI0A 3TKDA 3VXCA 3S9EA 4OYVA 1UIVA 3MW0A 3DP8A 3PMVA 4LA9A 4LZ7A 4F1VA 2Y7RA 3VXBA 1MQDA 3W15C 1ATGA 1MQHA 1TXFA 1XHYA 2ONKE 4YB6A 1Z7NE 5L8DA 4FAJA 3CFLA 3IO6A 1FQAA 1MXYA 4UACA 3HHGA 1B7ZA 1CE2A 3PPOA 4O3AA 4ECFA 1IZ1A 4JWOA 3N6UA 4GOTA 1A99A 1MY0A 2Y84A 3PUVE 3G3FA 4EXKA 2DYXA 2H4IA 4QSDA 3RUMA 2NUVA 3K6VA 3UA8A 4BDLA 3C4MA 1H76A 1SVXB 1OVBA 4DCXA 4F3GA 4PP0A 4XKRA 3MUQA 5L9SA 2QRYA 4X1DA 3TTNA 3KJ7A 5AA2A 1O64A 3IK6B 2F78A 4R2BA 1MH3A 3CVGA 5FTHA 5EHSA 1LCTA 1SW1A 2Z22A 5I58B 4Z7EA 1MH4A 4IO4A 1D3KA 4KQPA 2Z8DA 1QJMA 1B3HA 4PFYA 4OTEA 4QFOA 5DEXB 4NF8B 4HS7A 2F36A 3CR9A 1A54A 3FJGA 3MBPA 1B0HA 4MFIA 4DXBA 5BWJA 3OO6A 2ZNUA 4PFUA 4C0RA 1FQBA 5KDTB 1URGA 3KN8A 4MLQA 1NH8A 4NTLA 4RYAA 4ZZEA 2HAUA 4RK9A 1MY1A 5CMBA 4ZEDA 1YCJA 2GFEA 3TUSA 2AYSA 2XHDA 4R73A 1JETA 1O7TA 3EHUA 4OEVA 3TCGA 2Z8FA 2VD3A 2H99A 4R72A 1B1HA 4OFJA 3PUYE 1USYH 5K2XA 3VVEA 4N6PA 4OHNA 2DE3A 3MWBA 4P0GA 1LBCA 3TODA 2IEEA 4MH5A 4H8IA 3KEIA 1FTMA 1H43A 1JQFA 1SQYA 1LAHE 5ITPA 3N26A 1Z7ME 4DCYA 3L6HA 4XKNA 2OJTA 4ISUA 4NF6A 5H8HB 5CI5A 1DTGA 1OMPA 4F2OA 5ICQA 3TTRA 1NKXA 3IORA 3RLFE 1B5JA 2RC7A 3C32A 4OFOA 1JEUA 3FASA 4I62A 1SYHA 4NE4A 4ZE9A 3O97A 5JK4A 3V8XB 2V84A 3L6GA 4EUOA 3MVZA 3Q29A 1I6AA 2PVUA 3U92A 3V5AA 1JEVA 4N07A 1HSJA 1P1UA 2XXVA 2F5XA 3CG1A 3F11A 3KBRA 1LGBC 3O28A 2VP1A 4YB5A 2DWJA 4LZ5A 5M2VA 2I3VA 2HEUA 3H7MA 4LVQA 3ONMA 3PMWA 4N13A 1L5TA 2I0BA 4R75A 3TPAA 4QFKA 1XOCA 3FVOA 4TLMB 4DLDA 1NNFA 3RTWB 2O1MA 5B7DA 1S50A 1BP5A 4DDDA 2Q9TA 4EF1A 2YLNA 4G68A 4GVOA 5I56B 1TFDA 3IB1A 3ZKKA 1RYOA 1MPCA 3D4GA 3TDJA 5LOMA 3O66A 1BIYA 5K2YA 3O2AA 4IO5A 1ZIUA 2DVCA 4U21A 3SEYA 3IOVA 2REGA 3H03A 4OWDA 3U94A 1LBBA 1IEJA 1TT1A 2V25A 5TP9B 2RINA 2ZNTA 4LATA 5CBRA 3KG2A 4ND9A 3CFZA 1DOTA 3C31A 4ZEBA 2Z23A 3FJMA 4ZE8A 5HM4B 2XD2A 4YMBA 1IXIA 4OVJA 5CMMA 4DXCA 1M5FA 4YKPA 3E4RA 2Q2AA 4LONB 3CRBA 3HV1A 1H3DA 2I4BA 4F1YA 2YJPA 5KDTA 2F97A 1N7XA 2H5YA 1MXUA 2F34A 4PQJA 2CZLA 4RPOA 4R6KA 5JTYA 2GHAA 1ZTYA 3N94A 5FHMA 4YMAA 1DPPA 4IO7A 4FEDA 4GL8A 2OCUA 3JYRA 1B40A 4H65A 2PT2A 4MLVA 4U23A 2HFBA 3GBBA 2WKYA 3R26A 3V83A 2DE2A 3IB2A 3MZ1A 1A55A 1IXGA 3Q25A 3T96B 5ICTA 1IXCA 1B0LA 3SETA 5H8QB 1N84A 3QK6A 3KOSA 2DWAA 2E0SA 1N7WA 1B32A 2ONRA 2X7QA 1OLAA 4KHZE 3T93B 5L9OA 1MDQA 3FVGA 2G29A 4EQ9A 3H6UA 5TPAB 2XXUA 4H6DA 3K4UA 2ANJA 5FHOA 1JVYA 1FQEA 1NMUA 1KWHA 4FECA 1QUJA 2P1SA 3E3KA 3MPKA 3USDA 4O3CA 1EZOA 1B3EA 2I58A 4BDQA 3OXNA 4QRZA 3TZAA 4KR5A 1XVYA 1PB7A 2DWHA 1N04A 1XC1A 3HPIA 3RPWA 3QIMA 3GLBA 3IO4A 3T66A 3BBRA 1JW4A 1MQIA 4OMBA 2Y7PA 3O6IA 5F7VA 4U1OA 1MQJA 4O3BA 1J1NA 1QUKA 3ZSFA 2HCAA 2ONSA 1LFHA 1GR2A 1GTKA 3PUXE 3SEWA 3AXFA 3W9WA 2Y7WA 3FJ7A 4WEPA 1H45A 2I0CA 5I57B 2RC8A 2HZLA 2ZNSA 3K02A 5I2NB 1I6QA 1D9YA 3C33A 5DVFA 4U4SA 3JZJA 5AA1A 4JSDA 3M3LA 3K6UA 5I59A 3H6TA 3H3GA 2Q88A 2O51A 1AMFA 4FIMA 4YU0A 5TP9A 3R7XA 3M8UA 3RNNA 4ESXA 1NL5A 2UVHA 1UIUA 2PT1A 4KYSA 4PFWA 3U72A 3VV5A 3CFXA 3B7DA 4H1XA 4BDMA 1VE4A 3O29A 1A7LA 3CIJA 2VOZA 4H67A 5DVIA 1JNFA 2AL5A 3ODBA 1H44A 1URSA 1LCFA 3S4UA 3ILUB 4ZECA 1T0KA 2OBGA 3O6HA 2QL3A 3SEVA 4XXUA 1PDAA 2XXHA 3G7WA 4XIGQ 2DSFA 2VHAA 1N76A 1Q1KA 3C35A 3GBAA 3MQ9A 3MVWA 4GF8A 4HCWA 3EF7A 4WXJA 4QSEA 3M3FA 2BJJX 5HBCA 2R71A 3VLVA 2D5WA 2DXYA 2XD3A 1MS7A 2F35A 3CI8A 3FV1A 3HCQA 3HO7A 2XXIA 4R6YA 1EZPA 3I3VA 2PYYA 1SW2A 1TWYA 3MP8A 4P0IA 4GWOA 2B3FA 3OMBA 4RA1A 3QXMA 4FJPA 4JDFA 1MXZA 4R6HA 2E1SA 2A5TA 1ZBMA 4HTGA 3SKPA 3TMGA 5B70A 1ELJA 5L9MA 5I84A 3S2VA 5TU0A 3TEPA 4G4PA 3U8QA 4ELPA 1Y4TA 3MVXA 4NF4A 2O69A 4DXUA 1FTLA 2B65A 4X1BA 4IY6A 2X7PA 4FE8A 5KCJA 1RKMA 1II5A 2XXRA 4YB7A 4NF5B 2LAOA 2QJEA 2ZYKA 3TQLA 1LAXA 4F19A 3TAJA 4GRKA 3LSLA 1MY2A 1VR5A 1CB6A 1B1XA 4XKPA 4YKIA 2ZYOA 1MRPA 2QS2A 2F7AA 3OO8A 4MBPA 4OETA 1QUIA 2V3TA 3FV2A 5CMCA 1N3XA 4GLIA 2XX7A 3IJXB 2QS1A 2I48A 3T22A 4JXIA 4P11A 4TOZA 2QPQA 4PFTA 2QMXA 4QF9A 5I59B 3G3IA 1PBPA 3DLNA 4M4GA 2D21A 3V89B 3HSTA 3IJOB 5CM6A 5I2KA 3OO9A 4KI0E 1I69A 5H8SA 3KGCA 2REJA 1B58A 1ZU0A 4F3SA 4G77A 4EQ7A 3EQ1A 4KFQA 1UTBB 3MP6A 2ABHA 3TTLA 1AOVA 1IQ7A 1SI1A 1YPNA 5DVJA 2VGQA 2OWSA 1OQHA 3KZGA 4QFLA 4WKMA 3T9HB 3LBSA 1FQFA 4ZZAA 1QW0A 3T9XB 1PBQA 1XT8A 4NEDA 2I49A 1Y20A 3PUWE 3D4CA 3A09A 4YICA 1HSLA 4E0XA 1LB8A 3B6QA 3ECRA 1P1NA 2V3QA 1BKAA 3DM0A 3Q27A 5FHNA 3PPQA 1MDP1 1WDNA 1Y4CA 4JSOA 2F6GA 3K1PA 4EQBA 1NNTA 1ANFA 3IOTA 4R9FA 1DPEA 3IOWA 1IXHA 4QSCA 2PX1A 1GVCA 5AA4A 5DT6A 5J1DA 1LB9A 3SERA 4UA8A 2IA4A 2H98A 1NNPA 1SBPA 3H06B 1GGGA 3R6UA 4H8JA 4ZDMA 3THIA 1B5HA 1M5DA 3I5OA 2RKMA 3FXUA 4IY5A 3S9MC 4F1UA 1B7HA 1SW5A 3K6WA 1SD3A 3G3KA 4EDPA 2RCBA 5KCJB 2PBWA 3RN8A 1B7UA 1MM6A 1Q35A 3RTFB 3VDFA 5H8FB 2VD2A 3HHFA 3WAEA 1JW1A 4F18A 1MPBA 2I6EA 1OIBA 2XXQA 3K0VA 3PGFA 4NWDA 1PC3A 3PMXA 1ZKBA 1TFAA 1LAGE 4L17A 3RGYA 3VVFA 5DEXA 1B2HA 1URDA 1GV8A 3TYHA 4ZS9A 3SDFA 3Q26A 3DP4A 1JW5A 4THIA 3UN6A 1A8EA 2GH9A 2UVGA 3IAZA 4F39A 5EYFA 3M3KA 4ZEIA 4IGRA 4ZEKA 3EN3A 3H6WA 1Y3QA 2OWTA 4F22A 4GQOA 1A40A 3MAMA 4DZ1A 5CMKA 3T9UA 5IKBA 1B52A 1RYXA 3G3GA 1SYIA 4FEBA 4OQOA 5I2KB 4F3BA 2DOJA 1PB8A 3A3UA 3FXRA 1MG1A 4DE8A 4JBZA 2UVJA 3IOUA 3EPEA 2O84X 2CMOA 4JWYA 3TTKA 4GD5A 3VE1B 1OLCA 3UORA 4GIZA 3LC8A 4FATA 5H8HA 1A8FA 1MM7A 2XXWA 2A5SA 3FVKA 2OLBA 4OERA 4H0WA 4KCCA 1Y1MA 2NWJA 4AQ4A 4C1UA 1ZLQA 5A5XB 1B3LA 1EH3A 3VLUA 4I8CA 1B5IA 3QUFA 3U1OA 1FCKA 4POWA 1QKAA 1AIVA 4QHQA 2UYFA 2YPNA 4BDNA 3BKIB 3KOTA 2OK2A 1B46A 2V93A 4G68B 3PV0E 5F1QA 4KD5A 3MC2A 3ZKLA 2AL4A 1Y1ZA 1QVSA 5JEIA 1MQGA 4ELOA 3QAXA 3C9HA 4MF3A 4XKQA 3LUYA 1B6HA 2DE4A 2Z8EA 3TQWA 2R6GE 4F31B 5ELVA 3IR1A 2XXXA 2V3UA 4G8NA 4JB7A 1S9TA 3FZVA 4RJZA 2KLFA 4E0WA 1HSEA 1N0TA 1MXWA 5AE4A 3TCHA 5I56A 3KSXA 4IO2A 4F3PA 1M5EA 4OZ9A 2UXAA 3RT6B 1NNKA 1P1OA 1WVJA 3LSWA 2ESNA 5EHMA 1US4A 1IIWA 4HCYA 3DELB 1SW4A 2XXTA 1OQGA 2RC9A 3G3JA 3GXAA 5H8NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FW0 A;  3KN3 A;  3OSR A;  1QUL A;  3Q28 A;  3QSL A;  1O63 A;  2ZXT A;  3PPN A;  3PPR A;  3LSF B;  4BDR A;  2I3W A;  4IO6 A;  2NOO A;  2QMW A;  5CBS A;  2ZMB A;  2D3I A;  4LQ5 A;  4QFP A;  1LFG A;  1IIT A;  3IL1 B;  4RXL A;  4R9G A;  4WED A;  3WAF A;  1UQW A;  4U22 A;  3SEU A;  2HQ0 A;  3BFU A;  3MZB A;  3N5L A;  1F9B A;  1M5B A;  3MJN A;  4OEN A;  2QS3 A;  3OEM A;  1FQC A;  1R6Z A;  3OOA A;  2FYI A;  4IO3 A;  3T9V A;  4BLA A;  4G68 C;  3K01 A;  4R2F A;  3DP6 A;  4YAH X;  1D9V A;  4GXA A;  2XX9 A;  3GZG A;  1YTV A;  1MXX A;  4ESW A;  1QKB A;  1WOD A;  3KJT A;  4Q0C A;  4RNS A;  3N6T A;  2DXR A;  2B3B A;  2DQV A;  2R9J A;  4Z0I A;  1LLS A;  1M5C A;  3FAT A;  1S7Y A;  5H8Q A;  3FIR A;  1I6B A;  2ZYM A;  4G8M A;  4OXV A;  3TCF A;  2UVI A;  4ELQ A;  3S9N C;  1IUD A;  4Q5T A;  4C1T A;  1B9J A;  4OEU A;  1B05 A;  1P1W A;  4M1V A;  4G8H A;  3UIF A;  3W9V A;  4IGT A;  5CC2 A;  1UTH A;  1YAE A;  2Q89 A;  1NFT A;  4I9D A;  1R9Q A;  2OZZ A;  3JV9 A;  2NXO A;  2P0S A;  1EZ9 A;  4LQ2 A;  5AA2 D;  1Y9U A;  2QSX A;  4RPN A;  3OEN A;  5DTB A;  1POT A;  3VFJ A;  1ZJL A;  2DP8 A;  3BFT A;  2Y7I A;  3C34 A;  3H4Z A;  4GFR A;  4RY1 A;  1LST A;  2HAV A;  4PET A;  2Y7K A;  3TEL A;  1LFI A;  3EHT A;  5AA2 B;  1AH5 A;  4KYE A;  5FTI A;  3PUZ E;  3U93 A;  1US5 A;  1B4Z A;  3K6X A;  3VVD A;  3E13 X;  5BUU A;  3PD8 A;  4U1Z A;  5I57 A;  4IB2 A;  3QUJ A;  2XX8 A;  1MPD A;  5I2N A;  2FNC A;  4YKJ A;  3UK4 A;  4FOR A;  4XTC Q;  3S9L C;  1B3F A;  2O7U A;  4NMY A;  1MY3 A;  1B3G A;  3MPL A;  3OO7 A;  3ZS6 A;  4YZZ A;  4RK2 A;  5AA3 A;  2XXY A;  3KFM A;  3UGW A;  5H8F A;  3E9X A;  4LP2 B;  5H8N B;  5HPQ A;  3CG3 A;  2HXW A;  3IB0 A;  1VFE A;  3FGS A;  3K1M A;  3B6T A;  3LR1 A;  4QFN A;  4YKK A;  3C36 A;  3OD7 A;  4JWX A;  1BLF A;  3RT8 A;  5IAI A;  3SEX A;  3FUZ A;  4ELR A;  2DS9 A;  1MY4 A;  2UYE A;  2O68 A;  1FQD A;  5TPA A;  4LZ8 A;  4EXL A;  5A5X A;  4ONY A;  3UP9 A;  1Y3P A;  2Q8J A;  4NWC A;  1UTB A;  2RF1 A;  2AIX A;  2DVZ A;  1EU8 A;  2F7B A;  2A5T B;  2W7Y A;  5CRY A;  1B51 A;  1MXV A;  3VLW A;  4TQU Q;  1POY 1;  3O9P A;  2FA7 A;  4K3F A;  1D4N A;  4AB6 A;  3TTM A;  4F2Q A;  1DTZ A;  4KYD A;  3MZ9 A;  3EHS A;  2GRV A;  4NF4 B;  3PPP A;  4EF2 A;  4GXS B;  5ISU A;  3FXQ A;  2G93 A;  2RCA A;  2O1L A;  1AL3 A;  1B4H A;  3H6V A;  4I1D A;  4LUB A;  4Q30 B;  4ZEF A;  4BDO A;  3ILT B;  2ZYN A;  3TFL A;  3CSG A;  1P99 A;  5I58 A;  3A3C A;  2O7I A;  3FD3 A;  5AA4 B;  2NVU B;  1VFD A;  4NF8 A;  4OFL A;  1USY E;  4KCD A;  1XS5 A;  5KZT A;  1UTH B;  4TLL B;  4U2R A;  2H9B A;  1FTJ A;  2PMS A;  1PEB A;  2QS4 A;  2O6A A;  4KPT A;  1JVX A;  1Y3N A;  2GHB A;  3B6W A;  3K1N A;  2Q2C A;  1P1Q A;  3KSJ A;  3OEL A;  3OEK A;  2HZK A;  3G3H A;  3OSQ A;  3RY3 A;  4R74 A;  3K2D A;  3LSX A;  4OES A;  4NF5 A;  5DYH A;  4AB5 A;  3I6V A;  3K00 A;  3QYT A;  4POX A;  2I4C A;  4X48 A;  5ITO A;  2DWI A;  1XVX A;  2F8D A;  3MVY A;  4GL0 A;  1R9L A;  2XXP A;  1PB9 A;  1DMB A;  3O6G A;  4H5G A;  2THI A;  2M8C A;  1DSN A;  4PE5 B;  2X26 A;  3FVN A;  3PD9 A;  4U4X A;  1SDX A;  4X9T A;  3RQT A;  3PU5 A;  1OVT A;  1LAF E;  4G2Z A;  4F29 A;  3SES A;  2ALU A;  2H25 A;  1FTO A;  3HN0 A;  3KN7 A;  1BTJ A;  3IX1 A;  1ZMG A;  3MP1 A;  4Q8R A;  1VSO A;  1NH7 A;  2F6P A;  1R1N A;  4NF6 B;  3CSB A;  4HW8 A;  1FTK A;  2F7C A;  2P2A A;  3P7I A;  1N3W A;  4H5F A;  5JTY B;  4DIG A;  1SI0 A;  3TKD A;  3VXC A;  3S9E A;  4OYV A;  1UIV A;  3MW0 A;  3DP8 A;  3PMV A;  4LA9 A;  4LZ7 A;  4F1V A;  2Y7R A;  3VXB A;  1MQD A;  3W15 C;  1ATG A;  1MQH A;  1TXF A;  1XHY A;  2ONK E;  4YB6 A;  1Z7N E;  5L8D A;  4FAJ A;  3CFL A;  3IO6 A;  1FQA A;  1MXY A;  4UAC A;  3HHG A;  1B7Z A;  1CE2 A;  3PPO A;  4O3A A;  4ECF A;  1IZ1 A;  4JWO A;  3N6U A;  4GOT A;  1A99 A;  1MY0 A;  2Y84 A;  3PUV E;  3G3F A;  4EXK A;  2DYX A;  2H4I A;  4QSD A;  3RUM A;  2NUV A;  3K6V A;  3UA8 A;  4BDL A;  3C4M A;  1H76 A;  1SVX B;  1OVB A;  4DCX A;  4F3G A;  4PP0 A;  4XKR A;  3MUQ A;  5L9S A;  2QRY A;  4X1D A;  3TTN A;  3KJ7 A;  5AA2 A;  1O64 A;  3IK6 B;  2F78 A;  4R2B A;  1MH3 A;  3CVG A;  5FTH A;  5EHS A;  1LCT A;  1SW1 A;  2Z22 A;  5I58 B;  4Z7E A;  1MH4 A;  4IO4 A;  1D3K A;  4KQP A;  2Z8D A;  1QJM A;  1B3H A;  4PFY A;  4OTE A;  4QFO A;  5DEX B;  4NF8 B;  4HS7 A;  2F36 A;  3CR9 A;  1A54 A;  3FJG A;  3MBP A;  1B0H A;  4MFI A;  4DXB A;  5BWJ A;  3OO6 A;  2ZNU A;  4PFU A;  4C0R A;  1FQB A;  5KDT B;  1URG A;  3KN8 A;  4MLQ A;  1NH8 A;  4NTL A;  4RYA A;  4ZZE A;  2HAU A;  4RK9 A;  1MY1 A;  5CMB A;  4ZED A;  1YCJ A;  2GFE A;  3TUS A;  2AYS A;  2XHD A;  4R73 A;  1JET A;  1O7T A;  3EHU A;  4OEV A;  3TCG A;  2Z8F A;  2VD3 A;  2H99 A;  4R72 A;  1B1H A;  4OFJ A;  3PUY E;  1USY H;  5K2X A;  3VVE A;  4N6P A;  4OHN A;  2DE3 A;  3MWB A;  4P0G A;  1LBC A;  3TOD A;  2IEE A;  4MH5 A;  4H8I A;  3KEI A;  1FTM A;  1H43 A;  1JQF A;  1SQY A;  1LAH E;  5ITP A;  3N26 A;  1Z7M E;  4DCY A;  3L6H A;  4XKN A;  2OJT A;  4ISU A;  4NF6 A;  5H8H B;  5CI5 A;  1DTG A;  1OMP A;  4F2O A;  5ICQ A;  3TTR A;  1NKX A;  3IOR A;  3RLF E;  1B5J A;  2RC7 A;  3C32 A;  4OFO A;  1JEU A;  3FAS A;  4I62 A;  1SYH A;  4NE4 A;  4ZE9 A;  3O97 A;  5JK4 A;  3V8X B;  2V84 A;  3L6G A;  4EUO A;  3MVZ A;  3Q29 A;  1I6A A;  2PVU A;  3U92 A;  3V5A A;  1JEV A;  4N07 A;  1HSJ A;  1P1U A;  2XXV A;  2F5X A;  3CG1 A;  3F11 A;  3KBR A;  1LGB C;  3O28 A;  2VP1 A;  4YB5 A;  2DWJ A;  4LZ5 A;  5M2V A;  2I3V A;  2HEU A;  3H7M A;  4LVQ A;  3ONM A;  3PMW A;  4N13 A;  1L5T A;  2I0B A;  4R75 A;  3TPA A;  4QFK A;  1XOC A;  3FVO A;  4TLM B;  4DLD A;  1NNF A;  3RTW B;  2O1M A;  5B7D A;  1S50 A;  1BP5 A;  4DDD A;  2Q9T A;  4EF1 A;  2YLN A;  4G68 A;  4GVO A;  5I56 B;  1TFD A;  3IB1 A;  3ZKK A;  1RYO A;  1MPC A;  3D4G A;  3TDJ A;  5LOM A;  3O66 A;  1BIY A;  5K2Y A;  3O2A A;  4IO5 A;  1ZIU A;  2DVC A;  4U21 A;  3SEY A;  3IOV A;  2REG A;  3H03 A;  4OWD A;  3U94 A;  1LBB A;  1IEJ A;  1TT1 A;  2V25 A;  5TP9 B;  2RIN A;  2ZNT A;  4LAT A;  5CBR A;  3KG2 A;  4ND9 A;  3CFZ A;  1DOT A;  3C31 A;  4ZEB A;  2Z23 A;  3FJM A;  4ZE8 A;  5HM4 B;  2XD2 A;  4YMB A;  1IXI A;  4OVJ A;  5CMM A;  4DXC A;  1M5F A;  4YKP A;  3E4R A;  2Q2A A;  4LON B;  3CRB A;  3HV1 A;  1H3D A;  2I4B A;  4F1Y A;  2YJP A;  5KDT A;  2F97 A;  1N7X A;  2H5Y A;  1MXU A;  2F34 A;  4PQJ A;  2CZL A;  4RPO A;  4R6K A;  5JTY A;  2GHA A;  1ZTY A;  3N94 A;  5FHM A;  4YMA A;  1DPP A;  4IO7 A;  4FED A;  4GL8 A;  2OCU A;  3JYR A;  1B40 A;  4H65 A;  2PT2 A;  4MLV A;  4U23 A;  2HFB A;  3GBB A;  2WKY A;  3R26 A;  3V83 A;  2DE2 A;  3IB2 A;  3MZ1 A;  1A55 A;  1IXG A;  3Q25 A;  3T96 B;  5ICT A;  1IXC A;  1B0L A;  3SET A;  5H8Q B;  1N84 A;  3QK6 A;  3KOS A;  2DWA A;  2E0S A;  1N7W A;  1B32 A;  2ONR A;  2X7Q A;  1OLA A;  4KHZ E;  3T93 B;  5L9O A;  1MDQ A;  3FVG A;  2G29 A;  4EQ9 A;  3H6U A;  5TPA B;  2XXU A;  4H6D A;  3K4U A;  2ANJ A;  5FHO A;  1JVY A;  1FQE A;  1NMU A;  1KWH A;  4FEC A;  1QUJ A;  2P1S A;  3E3K A;  3MPK A;  3USD A;  4O3C A;  1EZO A;  1B3E A;  2I58 A;  4BDQ A;  3OXN A;  4QRZ A;  3TZA A;  4KR5 A;  1XVY A;  1PB7 A;  2DWH A;  1N04 A;  1XC1 A;  3HPI A;  3RPW A;  3QIM A;  3GLB A;  3IO4 A;  3T66 A;  3BBR A;  1JW4 A;  1MQI A;  4OMB A;  2Y7P A;  3O6I A;  5F7V A;  4U1O A;  1MQJ A;  4O3B A;  1J1N A;  1QUK A;  3ZSF A;  2HCA A;  2ONS A;  1LFH A;  1GR2 A;  1GTK A;  3PUX E;  3SEW A;  3AXF A;  3W9W A;  2Y7W A;  3FJ7 A;  4WEP A;  1H45 A;  2I0C A;  5I57 B;  2RC8 A;  2HZL A;  2ZNS A;  3K02 A;  5I2N B;  1I6Q A;  1D9Y A;  3C33 A;  5DVF A;  4U4S A;  3JZJ A;  5AA1 A;  4JSD A;  3M3L A;  3K6U A;  5I59 A;  3H6T A;  3H3G A;  2Q88 A;  2O51 A;  1AMF A;  4FIM A;  4YU0 A;  5TP9 A;  3R7X A;  3M8U A;  3RNN A;  4ESX A;  1NL5 A;  2UVH A;  1UIU A;  2PT1 A;  4KYS A;  4PFW A;  3U72 A;  3VV5 A;  3CFX A;  3B7D A;  4H1X A;  4BDM A;  1VE4 A;  3O29 A;  1A7L A;  3CIJ A;  2VOZ A;  4H67 A;  5DVI A;  1JNF A;  2AL5 A;  3ODB A;  1H44 A;  1URS A;  1LCF A;  3S4U A;  3ILU B;  4ZEC A;  1T0K A;  2OBG A;  3O6H A;  2QL3 A;  3SEV A;  4XXU A;  1PDA A;  2XXH A;  3G7W A;  4XIG Q;  2DSF A;  2VHA A;  1N76 A;  1Q1K A;  3C35 A;  3GBA A;  3MQ9 A;  3MVW A;  4GF8 A;  4HCW A;  3EF7 A;  4WXJ A;  4QSE A;  3M3F A;  2BJJ X;  5HBC A;  2R71 A;  3VLV A;  2D5W A;  2DXY A;  2XD3 A;  1MS7 A;  2F35 A;  3CI8 A;  3FV1 A;  3HCQ A;  3HO7 A;  2XXI A;  4R6Y A;  1EZP A;  3I3V A;  2PYY A;  1SW2 A;  1TWY A;  3MP8 A;  4P0I A;  4GWO A;  2B3F A;  3OMB A;  4RA1 A;  3QXM A;  4FJP A;  4JDF A;  1MXZ A;  4R6H A;  2E1S A;  2A5T A;  1ZBM A;  4HTG A;  3SKP A;  3TMG A;  5B70 A;  1ELJ A;  5L9M A;  5I84 A;  3S2V A;  5TU0 A;  3TEP A;  4G4P A;  3U8Q A;  4ELP A;  1Y4T A;  3MVX A;  4NF4 A;  2O69 A;  4DXU A;  1FTL A;  2B65 A;  4X1B A;  4IY6 A;  2X7P A;  4FE8 A;  5KCJ A;  1RKM A;  1II5 A;  2XXR A;  4YB7 A;  4NF5 B;  2LAO A;  2QJE A;  2ZYK A;  3TQL A;  1LAX A;  4F19 A;  3TAJ A;  4GRK A;  3LSL A;  1MY2 A;  1VR5 A;  1CB6 A;  1B1X A;  4XKP A;  4YKI A;  2ZYO A;  1MRP A;  2QS2 A;  2F7A A;  3OO8 A;  4MBP A;  4OET A;  1QUI A;  2V3T A;  3FV2 A;  5CMC A;  1N3X A;  4GLI A;  2XX7 A;  3IJX B;  2QS1 A;  2I48 A;  3T22 A;  4JXI A;  4P11 A;  4TOZ A;  2QPQ A;  4PFT A;  2QMX A;  4QF9 A;  5I59 B;  3G3I A;  1PBP A;  3DLN A;  4M4G A;  2D21 A;  3V89 B;  3HST A;  3IJO B;  5CM6 A;  5I2K A;  3OO9 A;  4KI0 E;  1I69 A;  5H8S A;  3KGC A;  2REJ A;  1B58 A;  1ZU0 A;  4F3S A;  4G77 A;  4EQ7 A;  3EQ1 A;  4KFQ A;  1UTB B;  3MP6 A;  2ABH A;  3TTL A;  1AOV A;  1IQ7 A;  1SI1 A;  1YPN A;  5DVJ A;  2VGQ A;  2OWS A;  1OQH A;  3KZG A;  4QFL A;  4WKM A;  3T9H B;  3LBS A;  1FQF A;  4ZZA A;  1QW0 A;  3T9X B;  1PBQ A;  1XT8 A;  4NED A;  2I49 A;  1Y20 A;  3PUW E;  3D4C A;  3A09 A;  4YIC A;  1HSL A;  4E0X A;  1LB8 A;  3B6Q A;  3ECR A;  1P1N A;  2V3Q A;  1BKA A;  3DM0 A;  3Q27 A;  5FHN A;  3PPQ A;  1MDP 1;  1WDN A;  1Y4C A;  4JSO A;  2F6G A;  3K1P A;  4EQB A;  1NNT A;  1ANF A;  3IOT A;  4R9F A;  1DPE A;  3IOW A;  1IXH A;  4QSC A;  2PX1 A;  1GVC A;  5AA4 A;  5DT6 A;  5J1D A;  1LB9 A;  3SER A;  4UA8 A;  2IA4 A;  2H98 A;  1NNP A;  1SBP A;  3H06 B;  1GGG A;  3R6U A;  4H8J A;  4ZDM A;  3THI A;  1B5H A;  1M5D A;  3I5O A;  2RKM A;  3FXU A;  4IY5 A;  3S9M C;  4F1U A;  1B7H A;  1SW5 A;  3K6W A;  1SD3 A;  3G3K A;  4EDP A;  2RCB A;  5KCJ B;  2PBW A;  3RN8 A;  1B7U A;  1MM6 A;  1Q35 A;  3RTF B;  3VDF A;  5H8F B;  2VD2 A;  3HHF A;  3WAE A;  1JW1 A;  4F18 A;  1MPB A;  2I6E A;  1OIB A;  2XXQ A;  3K0V A;  3PGF A;  4NWD A;  1PC3 A;  3PMX A;  1ZKB A;  1TFA A;  1LAG E;  4L17 A;  3RGY A;  3VVF A;  5DEX A;  1B2H A;  1URD A;  1GV8 A;  3TYH A;  4ZS9 A;  3SDF A;  3Q26 A;  3DP4 A;  1JW5 A;  4THI A;  3UN6 A;  1A8E A;  2GH9 A;  2UVG A;  3IAZ A;  4F39 A;  5EYF A;  3M3K A;  4ZEI A;  4IGR A;  4ZEK A;  3EN3 A;  3H6W A;  1Y3Q A;  2OWT A;  4F22 A;  4GQO A;  1A40 A;  3MAM A;  4DZ1 A;  5CMK A;  3T9U A;  5IKB A;  1B52 A;  1RYX A;  3G3G A;  1SYI A;  4FEB A;  4OQO A;  5I2K B;  4F3B A;  2DOJ A;  1PB8 A;  3A3U A;  3FXR A;  1MG1 A;  4DE8 A;  4JBZ A;  2UVJ A;  3IOU A;  3EPE A;  2O84 X;  2CMO A;  4JWY A;  3TTK A;  4GD5 A;  3VE1 B;  1OLC A;  3UOR A;  4GIZ A;  3LC8 A;  4FAT A;  5H8H A;  1A8F A;  1MM7 A;  2XXW A;  2A5S A;  3FVK A;  2OLB A;  4OER A;  4H0W A;  4KCC A;  1Y1M A;  2NWJ A;  4AQ4 A;  4C1U A;  1ZLQ A;  5A5X B;  1B3L A;  1EH3 A;  3VLU A;  4I8C A;  1B5I A;  3QUF A;  3U1O A;  1FCK A;  4POW A;  1QKA A;  1AIV A;  4QHQ A;  2UYF A;  2YPN A;  4BDN A;  3BKI B;  3KOT A;  2OK2 A;  1B46 A;  2V93 A;  4G68 B;  3PV0 E;  5F1Q A;  4KD5 A;  3MC2 A;  3ZKL A;  2AL4 A;  1Y1Z A;  1QVS A;  5JEI A;  1MQG A;  4ELO A;  3QAX A;  3C9H A;  4MF3 A;  4XKQ A;  3LUY A;  1B6H A;  2DE4 A;  2Z8E A;  3TQW A;  2R6G E;  4F31 B;  5ELV A;  3IR1 A;  2XXX A;  2V3U A;  4G8N A;  4JB7 A;  1S9T A;  3FZV A;  4RJZ A;  2KLF A;  4E0W A;  1HSE A;  1N0T A;  1MXW A;  5AE4 A;  3TCH A;  5I56 A;  3KSX A;  4IO2 A;  4F3P A;  1M5E A;  4OZ9 A;  2UXA A;  3RT6 B;  1NNK A;  1P1O A;  1WVJ A;  3LSW A;  2ESN A;  5EHM A;  1US4 A;  1IIW A;  4HCY A;  3DEL B;  1SW4 A;  2XXT A;  1OQG A;  2RC9 A;  3G3J A;  3GXA A;  5H8N A; 
#chains in the Genus database with same CATH topology
 3KN3 A;  1QUL A;  4P3L A;  3QSL A;  1O63 A;  3PPN A;  3PPR A;  2I3W A;  4IO6 A;  3LUZ A;  2ZMB A;  2D3I A;  3IL1 B;  3ZS6 A;  3MJN A;  2QS3 A;  2FYI A;  1MXX A;  1FTA A;  4Q0C A;  5IZ1 A;  4F1Y A;  1M5C A;  1S7Y A;  3FIR A;  1I6B A;  4G8M A;  2UVI A;  1IUD A;  4Q5T A;  4OEU A;  4M1V A;  3CHG A;  3UIF A;  1YAE A;  2Q74 A;  4I9D A;  4GX6 A;  1R9Q A;  2OZZ A;  5AA2 D;  2XWV A;  1POT A;  3VFJ A;  1ZJL A;  3BFT A;  1NUZ A;  5AA2 B;  5IZ3 A;  1US5 A;  3PD8 A;  3UK4 A;  1MY3 A;  1B3G A;  3KFM A;  3UGW A;  3E9X A;  4LP2 B;  4DI4 B;  5H8N B;  3IB0 A;  3K1M A;  3B6T A;  3OD7 A;  4JWX A;  4PC9 A;  2O68 A;  5TPA A;  4LZ8 A;  5A5X A;  3UP9 A;  2AIX A;  1FPK A;  2A5T B;  5CRY A;  1YZ0 A;  1MXV A;  3O9P A;  2CZK A;  2P3N A;  4F2Q A;  4KYD A;  3MZ9 A;  3PPP A;  4GXS B;  2ZZW A;  2G93 A;  2RCA A;  4I1D A;  4Q30 B;  4ZEF A;  3TFL A;  4XFE A;  1D9Q A;  4NF8 A;  2H9B A;  2QS4 A;  1JVX A;  1Y3N A;  3B6W A;  1DCU A;  3K1N A;  4X9T A;  3G3H A;  2I4C A;  3MVY A;  2CZH A;  1R9L A;  2KR0 A;  3PD9 A;  1SDX A;  1NUY A;  3HN0 A;  3KN7 A;  5ET8 A;  2QVV A;  3MP1 A;  1R1N A;  2Q8M A;  4HW8 A;  1FTK A;  1N3W A;  4H5F A;  5JTY B;  1SI0 A;  1EYJ A;  4FAJ A;  4UAC A;  3HHG A;  1B7Z A;  4JWO A;  3UA8 A;  2NUV A;  4BDL A;  4F3G A;  4PP0 A;  4QXD A;  3KJ7 A;  5AA2 A;  5EHS A;  4Z7E A;  5DEX B;  1B3H A;  4PFY A;  3V89 B;  1KZ8 A;  3FJG A;  1B0H A;  5KDT B;  4RYA A;  2HAU A;  1MY1 A;  1FBH A;  3TUS A;  1O7T A;  1B1H A;  3VVE A;  2IEE A;  1FBG A;  4ISU A;  5ICQ A;  1RDY A;  2RC7 A;  3V5A A;  4N15 A;  1HSJ A;  3KBR A;  1LGB C;  4LZ5 A;  2F3D A;  3ONM A;  2CEY A;  4DLD A;  2F3B A;  4DDD A;  4EF1 A;  2YLN A;  4G68 A;  3IB1 A;  1RYO A;  5LOM A;  3O66 A;  1BIY A;  1ZIU A;  2DVC A;  4U21 A;  3U94 A;  1IEJ A;  1TT1 A;  5IZZ A;  3KG2 A;  1DOT A;  2QFL A;  2XWI A;  5CMM A;  4YKP A;  3E4R A;  4LON B;  3HV1 A;  4PQJ A;  4RPO A;  5JTY A;  1DPP A;  4FED A;  2HFB A;  2WKY A;  3Q25 A;  5ICT A;  3SET A;  1N84 A;  2E0S A;  2X7Q A;  3FVG A;  4EQ9 A;  4H6D A;  1QUJ A;  2P1S A;  3E3K A;  3USD A;  4PTK A;  3QIM A;  3GLB A;  4O8M A;  2Y7P A;  4O3B A;  1QUK A;  2HCA A;  1GTK A;  1K9Z A;  1FBD A;  2RC8 A;  2HZL A;  2ZNS A;  5I2N B;  1DK4 A;  5DVF A;  3K6U A;  4FIM A;  3VV5 A;  3CFX A;  3B7D A;  2VOZ A;  5DVI A;  3ODB A;  1H44 A;  1URS A;  1NUX A;  1PDA A;  2V4C A;  2XXH A;  2VHA A;  1N76 A;  1Q1K A;  3C35 A;  2D5W A;  2XXI A;  1G0H A;  4PDH A;  4XF5 A;  4P0I A;  4GWO A;  2B3F A;  3TMG A;  3SKP A;  5L9M A;  5I84 A;  4ELP A;  3ROJ A;  1Y4T A;  4NF4 A;  2X7P A;  3T1B A;  4MAG A;  1MY2 A;  1FPD A;  3FV2 A;  1N3X A;  4GLI A;  2I48 A;  4QF9 A;  4PFT A;  3HST A;  5I2K A;  4KI0 E;  1I69 A;  3KGC A;  1ZU0 A;  4F3S A;  4G77 A;  4PFI A;  4KFQ A;  1UTB B;  2ABH A;  1AOV A;  2OWZ A;  3T9H B;  3T9X B;  1FPE A;  4HE1 A;  3A09 A;  2V3Q A;  1BKA A;  3DM0 A;  4JSO A;  4EQB A;  3K1P A;  1NNT A;  1ANF A;  4I3Y A;  2IA4 A;  1SBP A;  3R6U A;  1B7H A;  1SW5 A;  3K6W A;  1SD3 A;  3G3K A;  2RCB A;  1FBC A;  5H8F B;  2VD2 A;  1JW1 A;  3K0V A;  1ZKB A;  4L17 A;  3RGY A;  3TYH A;  3Q26 A;  5EQA A;  2GH9 A;  2UVG A;  3IAZ A;  4ZEI A;  1JP4 A;  4NQ8 A;  4ZEK A;  1Y3Q A;  4GQO A;  4DZ1 A;  1RYX A;  3G3G A;  5I2K B;  4JVI A;  3IOU A;  1NV0 A;  3TTK A;  3LC8 A;  4FAT A;  4OER A;  2OLB A;  4C1U A;  4AQ4 A;  1EH3 A;  5EYG A;  4I8C A;  1B5I A;  3QUF A;  3LV0 A;  4QHQ A;  1AIV A;  4GWS A;  3KOT A;  2OK2 A;  1B46 A;  3PV0 E;  4PGP A;  2AL4 A;  1Y1Z A;  1MQG A;  3BIG A;  1B6H A;  2DE4 A;  3IR1 A;  4RJZ A;  1S9T A;  3FZV A;  1HSE A;  3KC1 A;  1LBY A;  2UXA A;  2OX3 A;  1P1O A;  3LSW A;  1US4 A;  3GXA A;  2XXT A;  3G3J A;  3OSR A;  3Q28 A;  1FPG A;  2QMW A;  5CBS A;  1LFG A;  4WED A;  4U22 A;  3N5L A;  4IR8 A;  1F9B A;  4OEN A;  3OEM A;  4IO3 A;  4BLA A;  4G68 C;  3DP6 A;  4YAH X;  2XX9 A;  5EQ8 A;  3KJT A;  3N6T A;  2DXR A;  2B3B A;  4Z0I A;  2R9J A;  1B05 A;  1QGX A;  4G8H A;  5CC2 A;  2Q89 A;  1NFT A;  1EZ9 A;  2QSX A;  4RPN A;  4G61 A;  2HAV A;  4PET A;  1LFI A;  1AH5 A;  3PUZ E;  3U93 A;  3E13 X;  5I57 A;  2XX8 A;  2FNC A;  4XTC Q;  3MPL A;  2CEX A;  1K9Y A;  2HXW A;  3FGS A;  3RT8 A;  5IAI A;  1BLF A;  5I3S A;  3SEX A;  1SPI A;  2HPG A;  1FQD A;  4OAN A;  2RF1 A;  1EYK A;  2W7Y A;  1B51 A;  4TQU Q;  1D4N A;  4AB6 A;  1AL3 A;  1B4H A;  4LUB A;  4PCD A;  2WYP A;  3ILT B;  2ZYN A;  3CSG A;  1P99 A;  3FD3 A;  5AA4 B;  1VFD A;  4KCD A;  1XS5 A;  2PMS A;  1PEB A;  4KPT A;  2O6A A;  2BJI A;  2GQ1 A;  3OSQ A;  3OEL A;  3OEK A;  2DDK A;  4R74 A;  3QYT A;  1XVX A;  1PB9 A;  4U4X A;  1DSN A;  2X26 A;  3FVN A;  3RQT A;  3PU5 A;  1LAF E;  4F29 A;  2H25 A;  3KC0 A;  1BTJ A;  1VSO A;  1NH7 A;  4NF6 B;  4DIG A;  3VXC A;  3S9E A;  4OYV A;  3PMV A;  4LA9 A;  1MQD A;  1LBZ A;  1MQH A;  2HXR A;  3IO6 A;  1FQA A;  1MXY A;  4P8B A;  1CE2 A;  1MY0 A;  2DYX A;  2H4I A;  4QSD A;  3K6V A;  3C4M A;  4DCX A;  4JVD A;  4XKR A;  3MUQ A;  4R2B A;  5IZ3 B;  3CVG A;  5FTH A;  1NV2 A;  1SW1 A;  1D3K A;  4KQP A;  4NF8 B;  4HS7 A;  3CR9 A;  1A54 A;  2CZI A;  4DXB A;  2XWK A;  5BWJ A;  4C0R A;  2P3V A;  1URG A;  4MLQ A;  1NH8 A;  4RK9 A;  1YCJ A;  2GFE A;  2XHD A;  4R73 A;  1JET A;  2Z8F A;  2VD3 A;  2H99 A;  4OFJ A;  3PUY E;  5K2X A;  4OHN A;  4H8I A;  3N26 A;  1Z7M E;  3L6H A;  1LBX A;  4XKN A;  5H8H B;  4NF6 A;  5CI5 A;  1DTG A;  3TTR A;  1B5J A;  4N4U A;  4NE4 A;  4ZE9 A;  2V84 A;  3U92 A;  3MYU A;  3F11 A;  2FBP A;  2HEU A;  2I0B A;  1XOC A;  3FVO A;  4TLM B;  1NNF A;  2O1M A;  1S50 A;  2Q9T A;  5I5P A;  5K2Y A;  1LBB A;  2V25 A;  5CBR A;  3CFZ A;  5HM4 B;  4YMB A;  1IXI A;  3FXB A;  1M5F A;  2I4B A;  5KDT A;  2F97 A;  2VT5 A;  4N6K A;  1MXU A;  2F34 A;  2CZL A;  2GHA A;  3N94 A;  2OCU A;  4H65 A;  2DE2 A;  4PBH A;  1A55 A;  1IXG A;  1IXC A;  1B0L A;  2DWA A;  5LDZ A;  3T93 B;  4KHZ E;  5L9O A;  2G29 A;  5TPA B;  5FHO A;  2QVU A;  1JVY A;  1NMU A;  3MPK A;  4GWW A;  2I58 A;  4BDQ A;  4MNC A;  1PB7 A;  2DWH A;  1N04 A;  1XC1 A;  3IO4 A;  1JW4 A;  5F7V A;  3FJ7 A;  4WEP A;  2I0C A;  4PF8 A;  1D9Y A;  4U4S A;  2RC9 A;  3JZJ A;  4JSD A;  4AS5 A;  5I59 A;  4ESX A;  3R7X A;  3M8U A;  1NL5 A;  2UVH A;  2FIE A;  4BDM A;  1VE4 A;  3CIJ A;  1JNF A;  1LCF A;  3S4U A;  2DSF A;  3GBA A;  3MQ9 A;  4HCW A;  4QSE A;  3M3F A;  2BJJ X;  2XD3 A;  1MS7 A;  3CI8 A;  4R6Y A;  1EZP A;  1SW2 A;  4N8G A;  4RA1 A;  4R6H A;  1ZBM A;  1ELJ A;  5TU0 A;  3TEP A;  2O69 A;  1FTL A;  4FE8 A;  2QJE A;  2ZYK A;  3TQL A;  4F19 A;  3TAJ A;  3LSL A;  1VR5 A;  1CB6 A;  2QS2 A;  3OO8 A;  4OET A;  2V3T A;  2XX7 A;  4JXI A;  4TOZ A;  3G3I A;  3DLN A;  4NN3 A;  2D21 A;  3IJO B;  2ZZV A;  3MP6 A;  1SI1 A;  1OQH A;  3KZG A;  4WKM A;  3LBS A;  4NED A;  1Y20 A;  1LB8 A;  3ECR A;  3TPA A;  2F6G A;  2VPO A;  5J1D A;  4ZDM A;  1NNP A;  3THI A;  4FBP A;  3I5O A;  3S9M C;  2PBW A;  1B7U A;  1Q35 A;  3VDF A;  2I6E A;  1LAG E;  1B2H A;  1URD A;  1GV8 A;  4ZS9 A;  1IMA A;  3DP4 A;  4THI A;  1A8E A;  1INP A;  1NV4 A;  4PGN A;  3M3K A;  4PAI A;  4IGR A;  3H6W A;  5LTC A;  4KXP A;  1PB8 A;  4DE8 A;  3EPE A;  4GD5 A;  1A8F A;  4GBW A;  3FVK A;  2XWO A;  1YXI A;  1ZLQ A;  4MJO A;  3VLU A;  1IMF A;  3B50 A;  1LEV A;  4POW A;  3BKI B;  4G68 B;  5F1Q A;  3D1R A;  4KD5 A;  3MC2 A;  4PFB A;  3ZKL A;  1FPB A;  2KQZ A;  4ELO A;  3QAX A;  1DBZ A;  3C9H A;  3LUY A;  4F31 B;  2Z8E A;  2XXX A;  2V3U A;  4G8N A;  1MXW A;  5I56 A;  4IO2 A;  2ESN A;  2JJK A;  1KA0 A;  4N6D A;  1FBF A;  1OQG A;  1FJ9 A;  1FW0 A;  4P1E A;  2ZXT A;  2NOO A;  4QFP A;  1IIT A;  4RXL A;  4R9G A;  3WAF A;  3SEU A;  2HQ0 A;  3MZB A;  4PAF A;  4O94 A;  1FQC A;  4PBQ A;  5ET5 A;  4GXA A;  3GZG A;  1QKB A;  2WX9 A;  4RNS A;  5H8Q A;  3ISP A;  2ZYM A;  4OXV A;  4NHB A;  1P1W A;  4GX3 A;  3SZP A;  1IME A;  4IGT A;  1NUW A;  1UTH A;  1NV5 A;  2NXO A;  2DP8 A;  2Y7I A;  3H4Z A;  3TEL A;  2Y7K A;  5FTI A;  1B4Z A;  4I3E A;  4PAK A;  4U1Z A;  4N17 A;  5I2N A;  4YKJ A;  2ZZX A;  3S9L C;  1B3F A;  4X8R A;  4NMY A;  3OO7 A;  4RK2 A;  2XXY A;  5HPQ A;  3CG3 A;  1VFE A;  3LR1 A;  4QFN A;  3C36 A;  5IM2 A;  4ELR A;  4OVQ A;  1IMD A;  4EXL A;  4ONY A;  1Y3P A;  4NWC A;  2DVZ A;  2HHM A;  1POY 1;  2FA7 A;  1DTZ A;  3EHS A;  2GRV A;  4NF4 B;  5ISU A;  3FXQ A;  4P56 A;  2O1L A;  3A3C A;  2NVU B;  4OVR A;  5EYH A;  1USY E;  5KZT A;  1UTH B;  4TLL B;  1FTJ A;  4MIJ A;  1P1Q A;  5DYH A;  3K2D A;  4OES A;  1LFH A;  4X48 A;  2DWI A;  2F8D A;  4OVJ A;  4P11 A;  2XXP A;  2M8C A;  3SES A;  1FTO A;  2F7C A;  2P2A A;  3P7I A;  3TKD A;  4N91 A;  1UIV A;  3MW0 A;  3DP8 A;  4F1V A;  1TXF A;  2ONK E;  1Z7N E;  5L8D A;  3PPO A;  4UAB A;  4ECF A;  3N6U A;  4GOT A;  2Y84 A;  5L9S A;  1MH3 A;  1LCT A;  2Z22 A;  1MH4 A;  4QFO A;  1QJM A;  4OTE A;  2F36 A;  3MBP A;  1RDX A;  3OO6 A;  4PFU A;  1FQB A;  5H8F A;  4MNP A;  4OEV A;  3TCG A;  4R72 A;  1USY H;  2DE3 A;  4P0G A;  1LBC A;  3TOD A;  1FTM A;  1SQY A;  5ITP A;  4X04 A;  5A5L A;  2OJT A;  1OMP A;  4F2O A;  3C32 A;  4OFO A;  3FAS A;  4I62 A;  1SYH A;  3L6G A;  4EUO A;  1I6A A;  2PVU A;  1JEV A;  2F5X A;  2VP1 A;  2DWJ A;  5M2V A;  4LVQ A;  3PMW A;  5B7D A;  5I56 B;  3ZKK A;  1MPC A;  3D4G A;  3TDJ A;  3IOV A;  3H03 A;  4LAT A;  3C31 A;  4ZEB A;  2Z23 A;  2XD2 A;  3IFA A;  4DXC A;  2Q2A A;  1H3D A;  2YJP A;  1ZTY A;  5FHM A;  4DCY A;  3V83 A;  1B40 A;  4MEV A;  2PT2 A;  4U23 A;  3R26 A;  3IB2 A;  3T96 B;  3QK6 A;  2ONR A;  1OLA A;  1MDQ A;  3H6U A;  1RDZ A;  3K4U A;  1FQE A;  1KWH A;  5EQ7 A;  4FEC A;  4GX4 A;  4O3C A;  1EZO A;  3T0J A;  1B3E A;  4KR5 A;  1XVY A;  3T66 A;  3BBR A;  1NI9 A;  4OMB A;  4QBA A;  4U1O A;  1J1N A;  3ZSF A;  2ONS A;  4N8Y A;  1GR2 A;  3PUX E;  3SEW A;  3AXF A;  3W9W A;  2Y7W A;  1H45 A;  3C33 A;  3H3G A;  2O51 A;  1AMF A;  4YU0 A;  3RNN A;  2VPN A;  1UIU A;  4PFW A;  3U72 A;  4H1X A;  4ZEC A;  1T0K A;  2OBG A;  3SEV A;  4XXU A;  4GF8 A;  3EF7 A;  4WXJ A;  2R71 A;  2DXY A;  3FV1 A;  3HCQ A;  3HO7 A;  5T3J A;  2PYY A;  3MP8 A;  1IMC A;  1LBW A;  3QXM A;  4FJP A;  4JDF A;  1MXZ A;  2A5T A;  5B70 A;  3E79 A;  4G4P A;  3MVX A;  1NV3 A;  2B65 A;  4X1B A;  4IY6 A;  1RKM A;  1II5 A;  4YB7 A;  2LAO A;  1LAX A;  1CNQ A;  4HE2 A;  4XKP A;  3HFU A;  2F7A A;  1NV1 A;  4MBP A;  4PF6 A;  3IJX B;  4DI3 D;  4GWY A;  2QPQ A;  4O7I A;  2QMX A;  5I59 B;  4M4G A;  5CM6 A;  3OO9 A;  1FBE A;  1B58 A;  3EQ1 A;  3TTL A;  1IQ7 A;  2VGQ A;  4QFL A;  4ZZA A;  2WBB A;  3PUW E;  3D4C A;  1NV6 A;  4E0X A;  3B6Q A;  3Q27 A;  1P1N A;  4P9K A;  3RN8 A;  1WDN A;  4R9F A;  1IXH A;  1IMB A;  2PX1 A;  1GVC A;  1VDW A;  2PCR A;  4MNI A;  1EYI A;  4UA8 A;  2H98 A;  1GGG A;  1B5H A;  2RKM A;  3FXU A;  4IY5 A;  4F1U A;  4GWX A;  4EDP A;  1MM6 A;  3RTF B;  3HHF A;  4F18 A;  3PGF A;  4NWD A;  3PMX A;  2WBD A;  5DEX A;  3SDF A;  2R8T A;  2OWT A;  4F22 A;  1A40 A;  5CMK A;  3T9U A;  1B52 A;  4FEB A;  2DOJ A;  3A3U A;  4JBZ A;  2UVJ A;  2O84 X;  2CMO A;  4JWY A;  3VE1 B;  1OLC A;  4GIZ A;  1G0I A;  4LN5 A;  1MM7 A;  2A5S A;  4H0W A;  2NWJ A;  4I40 A;  5A5X B;  2FVZ A;  5I7I A;  1FCK A;  2UYF A;  2FIX A;  2YPN A;  3BIH A;  5DW8 A;  1QVS A;  5JEI A;  1FBP A;  3TQW A;  1YYZ A;  2R6G E;  4JB7 A;  2KLF A;  3TCH A;  1FJ6 A;  4OVP A;  4F3P A;  4OZ9 A;  3RT6 B;  5ESY A;  1LBV A;  1IIW A;  4HCY A;  1SW4 A;  5H8N A;  3KBZ A;  4BDR A;  3LSF B;  4LQ5 A;  3E78 A;  1UQW A;  4P47 A;  3BFU A;  4OWD A;  1M5B A;  3VVD A;  1R6Z A;  3OOA A;  3T9V A;  3K01 A;  1D9V A;  1YTV A;  4O7M A;  4ESW A;  1WOD A;  2DQV A;  1LLS A;  3FAT A;  3TCF A;  4ELQ A;  4HXV A;  3S9N C;  4C1T A;  5FBP A;  1B9J A;  2MKZ A;  3W9V A;  3QMF A;  2PFY A;  3JV9 A;  2P0S A;  4LQ2 A;  4GBV A;  1Y9U A;  3OEN A;  5DTB A;  3C34 A;  4GFR A;  4RY1 A;  1LST A;  4KYE A;  5BUU A;  3K6X A;  4IB2 A;  3QUJ A;  1MPD A;  4FOR A;  2QVR A;  2O7U A;  5AA3 A;  4YZZ A;  4YKK A;  1FPL A;  4HE0 A;  3FUZ A;  2DS9 A;  1MY4 A;  2UYE A;  2FHY A;  3PTY A;  3U65 A;  2Q8J A;  1UTB A;  3NOH A;  1EU8 A;  2F7B A;  3A29 A;  3VLW A;  5ET6 A;  4K3F A;  3TTM A;  4EF2 A;  3H6V A;  4BDO A;  5F24 A;  4N81 A;  5I58 A;  2O7I A;  4OFL A;  4U2R A;  2GHB A;  3TTN A;  3KSJ A;  2Q2C A;  3RY3 A;  2HZK A;  5KCJ B;  3LSX A;  4NF5 A;  4AB5 A;  3I6V A;  3K00 A;  4POX A;  5ITO A;  4H5G A;  4GL0 A;  3O6G A;  4R2F A;  1DMB A;  2THI A;  4PE5 B;  1OVT A;  4G2Z A;  2ALU A;  1FPJ A;  4GWZ A;  3IFC A;  3IX1 A;  4Q8R A;  1ZMG A;  2F6P A;  1KA1 A;  3CSB A;  4MHF A;  1NV7 A;  4LZ7 A;  2Y7R A;  3W15 C;  1ATG A;  4YB6 A;  1XHY A;  1BK4 A;  3CFL A;  4O3A A;  1IZ1 A;  4MCO A;  1A99 A;  4EXK A;  3PUV E;  3G3F A;  3RUM A;  3RPL B;  1H76 A;  1SVX B;  1OVB A;  2QRY A;  4X1D A;  4OA4 A;  1O64 A;  3IK6 B;  2F78 A;  2PFZ A;  2XXK A;  5I58 B;  4IO4 A;  2Z8D A;  4NAP A;  4MFI A;  2ZNU A;  3KN8 A;  4ZZE A;  3VXB A;  4NTL A;  4ZED A;  5CMB A;  2AYS A;  3EHU A;  4OVT A;  4N6P A;  4MMP A;  3MWB A;  4MH5 A;  3KEI A;  1H43 A;  1JQF A;  1LAH E;  1NKX A;  3IOR A;  3RLF E;  1JEU A;  3O97 A;  5JK4 A;  3V8X B;  4PE3 A;  3MVZ A;  3Q29 A;  4N07 A;  1P1U A;  2XXV A;  3CG1 A;  3O28 A;  3RYD A;  4YB5 A;  2I3V A;  3H7M A;  4N13 A;  1L5T A;  4R75 A;  4QFK A;  4NF0 A;  3RTW B;  1BP5 A;  4GVO A;  1TFD A;  3O2A A;  4IO5 A;  3SEY A;  2REG A;  5TP9 B;  2RIN A;  2ZNT A;  4NX1 A;  4ND9 A;  4ZE8 A;  3FJM A;  4XEQ A;  3MST A;  4OVS A;  3CRB A;  3GYY A;  2Y5L A;  1N7X A;  2H5Y A;  5IGA A;  4R6K A;  4YMA A;  4IO7 A;  4GL8 A;  3JYR A;  4MLV A;  3GBB A;  3MZ1 A;  5H8Q B;  3KOS A;  2WYK A;  1N7W A;  1B32 A;  1XI6 A;  2XXU A;  2ANJ A;  3OXN A;  4QRZ A;  3TZA A;  3HPI A;  3RPW A;  1MQI A;  3O6I A;  1MQJ A;  5I57 B;  3K02 A;  1I6Q A;  3EKI A;  5AA1 A;  3M3L A;  3H6T A;  2Q88 A;  5TP9 A;  2PT1 A;  4KYS A;  4JVC A;  3O29 A;  2XA5 A;  1A7L A;  4H67 A;  2AL5 A;  4P1L A;  3ILU B;  1FPI A;  3O6H A;  2QL3 A;  3G7W A;  4XKQ A;  4XIG Q;  3MVW A;  5HBC A;  4NGU A;  3VLV A;  2F35 A;  4MX6 A;  3I3V A;  1TWY A;  3OMB A;  2E1S A;  4HTG A;  3S2V A;  3U8Q A;  4DXU A;  4NG7 A;  5KCJ A;  2XXR A;  4NF5 B;  4GRK A;  2WEF A;  1B1X A;  4YKI A;  2ZYO A;  1MRP A;  1QUI A;  5CMC A;  2QS1 A;  3T22 A;  1PBP A;  2L5V A;  5J16 A;  4PDD A;  5H8S A;  2REJ A;  4EQ7 A;  1Q9D A;  1FPF A;  1YPN A;  5DVJ A;  2OWS A;  1FQF A;  1QW0 A;  1PBQ A;  1XT8 A;  2I49 A;  4YIC A;  1HSL A;  5FHN A;  3PPQ A;  1MDP 1;  1Y4C A;  5EQ9 A;  3IOT A;  1DPE A;  3IOW A;  4QSC A;  5AA4 A;  5DT6 A;  1LB9 A;  3SER A;  4H8J A;  3H06 B;  1M5D A;  1FSA A;  3RPL A;  3WAE A;  1MPB A;  2XXQ A;  1OIB A;  1PC3 A;  1TFA A;  3VVF A;  1FRP A;  4H46 A;  1JW5 A;  3UN6 A;  4F39 A;  5EYF A;  3EN3 A;  3MAM A;  4H45 A;  5IKB A;  1SYI A;  2B4M A;  4OQO A;  4F3B A;  3FXR A;  1MG1 A;  3UOR A;  5H8H A;  2XXW A;  5AE4 A;  4KCC A;  1Y1M A;  1B3L A;  4GWU A;  2B4L A;  3U1O A;  1QKA A;  4BDN A;  5ET7 A;  3B8B A;  2V93 A;  2Y5K A;  1AWB A;  4PFR A;  4MF3 A;  5ELV A;  4E0W A;  1N0T A;  3KSX A;  1M5E A;  1NNK A;  5EHM A;  1WVJ A;  3FBP A;  3DEL B;  3EHT A;  4AS4 A; 
#chains in the Genus database with same CATH homology
 1FW0 A;  3KN3 A;  3OSR A;  1QUL A;  3Q28 A;  3QSL A;  1O63 A;  2ZXT A;  3PPN A;  3PPR A;  3LSF B;  4BDR A;  2I3W A;  4IO6 A;  2NOO A;  2QMW A;  5CBS A;  2ZMB A;  2D3I A;  4LQ5 A;  4QFP A;  1LFG A;  1IIT A;  3IL1 B;  4RXL A;  4R9G A;  4WED A;  3WAF A;  1UQW A;  4U22 A;  3SEU A;  2HQ0 A;  3BFU A;  3MZB A;  3N5L A;  1F9B A;  1M5B A;  3MJN A;  4OEN A;  2QS3 A;  3OEM A;  1FQC A;  1R6Z A;  3OOA A;  2FYI A;  4IO3 A;  3T9V A;  4BLA A;  4G68 C;  3K01 A;  4R2F A;  3DP6 A;  4YAH X;  1D9V A;  4GXA A;  2XX9 A;  3GZG A;  1YTV A;  1MXX A;  4ESW A;  1QKB A;  1WOD A;  3KJT A;  4Q0C A;  4RNS A;  3N6T A;  2DXR A;  2B3B A;  2DQV A;  2R9J A;  4Z0I A;  1LLS A;  1M5C A;  3FAT A;  1S7Y A;  5H8Q A;  3FIR A;  1I6B A;  2ZYM A;  4G8M A;  4OXV A;  3TCF A;  2UVI A;  4ELQ A;  3S9N C;  1IUD A;  4Q5T A;  4C1T A;  1B9J A;  4OEU A;  1B05 A;  1P1W A;  4M1V A;  4G8H A;  3UIF A;  3W9V A;  4IGT A;  5CC2 A;  1UTH A;  1YAE A;  2Q89 A;  1NFT A;  4I9D A;  1R9Q A;  2OZZ A;  3JV9 A;  2NXO A;  2P0S A;  1EZ9 A;  4LQ2 A;  5AA2 D;  1Y9U A;  2QSX A;  4RPN A;  3OEN A;  5DTB A;  1POT A;  3VFJ A;  1ZJL A;  2DP8 A;  3BFT A;  2Y7I A;  3C34 A;  3H4Z A;  4GFR A;  4RY1 A;  1LST A;  2HAV A;  4PET A;  2Y7K A;  3TEL A;  1LFI A;  3EHT A;  5AA2 B;  1AH5 A;  4KYE A;  5FTI A;  3PUZ E;  3U93 A;  1US5 A;  1B4Z A;  3K6X A;  3VVD A;  3E13 X;  5BUU A;  3PD8 A;  4U1Z A;  5I57 A;  4IB2 A;  3QUJ A;  2XX8 A;  1MPD A;  5I2N A;  2FNC A;  4YKJ A;  3UK4 A;  4FOR A;  4XTC Q;  3S9L C;  1B3F A;  2O7U A;  4NMY A;  1MY3 A;  1B3G A;  3MPL A;  3OO7 A;  3ZS6 A;  4YZZ A;  4RK2 A;  5AA3 A;  2XXY A;  3KFM A;  3UGW A;  5H8F A;  3E9X A;  4LP2 B;  5H8N B;  5HPQ A;  3CG3 A;  2HXW A;  3IB0 A;  1VFE A;  3FGS A;  3K1M A;  3B6T A;  3LR1 A;  4QFN A;  4YKK A;  3C36 A;  3OD7 A;  4JWX A;  1BLF A;  3RT8 A;  5IAI A;  3SEX A;  3FUZ A;  4ELR A;  2DS9 A;  1MY4 A;  2UYE A;  2O68 A;  1FQD A;  5TPA A;  4LZ8 A;  4EXL A;  5A5X A;  4ONY A;  3UP9 A;  1Y3P A;  2Q8J A;  4NWC A;  1UTB A;  2RF1 A;  2AIX A;  2DVZ A;  1EU8 A;  2F7B A;  2A5T B;  2W7Y A;  5CRY A;  1B51 A;  1MXV A;  3VLW A;  4TQU Q;  1POY 1;  3O9P A;  2FA7 A;  4K3F A;  1D4N A;  4AB6 A;  3TTM A;  4F2Q A;  1DTZ A;  4KYD A;  3MZ9 A;  3EHS A;  2GRV A;  4NF4 B;  3PPP A;  4EF2 A;  4GXS B;  5ISU A;  3FXQ A;  2G93 A;  2RCA A;  2O1L A;  1AL3 A;  1B4H A;  3H6V A;  4I1D A;  4LUB A;  4Q30 B;  4ZEF A;  4BDO A;  3ILT B;  2ZYN A;  3TFL A;  3CSG A;  1P99 A;  5I58 A;  3A3C A;  2O7I A;  3FD3 A;  5AA4 B;  2NVU B;  1VFD A;  4NF8 A;  4OFL A;  1USY E;  4KCD A;  1XS5 A;  5KZT A;  1UTH B;  4TLL B;  4U2R A;  2H9B A;  1FTJ A;  2PMS A;  1PEB A;  2QS4 A;  2O6A A;  4KPT A;  1JVX A;  1Y3N A;  2GHB A;  3B6W A;  3K1N A;  2Q2C A;  1P1Q A;  3KSJ A;  3OEL A;  3OEK A;  2HZK A;  3G3H A;  3OSQ A;  3RY3 A;  4R74 A;  3K2D A;  3LSX A;  4OES A;  4NF5 A;  5DYH A;  4AB5 A;  3I6V A;  3K00 A;  3QYT A;  4POX A;  2I4C A;  4X48 A;  5ITO A;  2DWI A;  1XVX A;  2F8D A;  3MVY A;  4GL0 A;  1R9L A;  2XXP A;  1PB9 A;  1DMB A;  3O6G A;  4H5G A;  2THI A;  2M8C A;  1DSN A;  4PE5 B;  2X26 A;  3FVN A;  3PD9 A;  4U4X A;  1SDX A;  4X9T A;  3RQT A;  3PU5 A;  1OVT A;  1LAF E;  4G2Z A;  4F29 A;  3SES A;  2ALU A;  2H25 A;  1FTO A;  3HN0 A;  3KN7 A;  1BTJ A;  3IX1 A;  1ZMG A;  3MP1 A;  4Q8R A;  1VSO A;  1NH7 A;  2F6P A;  1R1N A;  4NF6 B;  3CSB A;  4HW8 A;  1FTK A;  2F7C A;  2P2A A;  3P7I A;  1N3W A;  4H5F A;  5JTY B;  4DIG A;  1SI0 A;  3TKD A;  3VXC A;  3S9E A;  4OYV A;  1UIV A;  3MW0 A;  3DP8 A;  3PMV A;  4LA9 A;  4LZ7 A;  4F1V A;  2Y7R A;  3VXB A;  1MQD A;  3W15 C;  1ATG A;  1MQH A;  1TXF A;  1XHY A;  2ONK E;  4YB6 A;  1Z7N E;  5L8D A;  4FAJ A;  3CFL A;  3IO6 A;  1FQA A;  1MXY A;  4UAC A;  3HHG A;  1B7Z A;  1CE2 A;  3PPO A;  4O3A A;  4ECF A;  1IZ1 A;  4JWO A;  3N6U A;  4GOT A;  1A99 A;  1MY0 A;  2Y84 A;  3PUV E;  3G3F A;  4EXK A;  2DYX A;  2H4I A;  4QSD A;  3RUM A;  2NUV A;  3K6V A;  3UA8 A;  4BDL A;  3C4M A;  1H76 A;  1SVX B;  1OVB A;  4DCX A;  4F3G A;  4PP0 A;  4XKR A;  3MUQ A;  5L9S A;  2QRY A;  4X1D A;  3TTN A;  3KJ7 A;  5AA2 A;  1O64 A;  3IK6 B;  2F78 A;  4R2B A;  1MH3 A;  3CVG A;  5FTH A;  5EHS A;  1LCT A;  1SW1 A;  2Z22 A;  5I58 B;  4Z7E A;  1MH4 A;  4IO4 A;  1D3K A;  4KQP A;  2Z8D A;  1QJM A;  1B3H A;  4PFY A;  4OTE A;  4QFO A;  5DEX B;  4NF8 B;  4HS7 A;  2F36 A;  3CR9 A;  1A54 A;  3FJG A;  3MBP A;  1B0H A;  4MFI A;  4DXB A;  5BWJ A;  3OO6 A;  2ZNU A;  4PFU A;  4C0R A;  1FQB A;  5KDT B;  1URG A;  3KN8 A;  4MLQ A;  1NH8 A;  4NTL A;  4RYA A;  4ZZE A;  2HAU A;  4RK9 A;  1MY1 A;  5CMB A;  4ZED A;  1YCJ A;  2GFE A;  3TUS A;  2AYS A;  2XHD A;  4R73 A;  1JET A;  1O7T A;  3EHU A;  4OEV A;  3TCG A;  2Z8F A;  2VD3 A;  2H99 A;  4R72 A;  1B1H A;  4OFJ A;  3PUY E;  1USY H;  5K2X A;  3VVE A;  4N6P A;  4OHN A;  2DE3 A;  3MWB A;  4P0G A;  1LBC A;  3TOD A;  2IEE A;  4MH5 A;  4H8I A;  3KEI A;  1FTM A;  1H43 A;  1JQF A;  1SQY A;  1LAH E;  5ITP A;  3N26 A;  1Z7M E;  4DCY A;  3L6H A;  4XKN A;  2OJT A;  4ISU A;  4NF6 A;  5H8H B;  5CI5 A;  1DTG A;  1OMP A;  4F2O A;  5ICQ A;  3TTR A;  1NKX A;  3IOR A;  3RLF E;  1B5J A;  2RC7 A;  3C32 A;  4OFO A;  1JEU A;  3FAS A;  4I62 A;  1SYH A;  4NE4 A;  4ZE9 A;  3O97 A;  5JK4 A;  3V8X B;  2V84 A;  3L6G A;  4EUO A;  3MVZ A;  3Q29 A;  1I6A A;  2PVU A;  3U92 A;  3V5A A;  1JEV A;  4N07 A;  1HSJ A;  1P1U A;  2XXV A;  2F5X A;  3CG1 A;  3F11 A;  3KBR A;  1LGB C;  3O28 A;  2VP1 A;  4YB5 A;  2DWJ A;  4LZ5 A;  5M2V A;  2I3V A;  2HEU A;  3H7M A;  4LVQ A;  3ONM A;  3PMW A;  4N13 A;  1L5T A;  2I0B A;  4R75 A;  3TPA A;  4QFK A;  1XOC A;  3FVO A;  4TLM B;  4DLD A;  1NNF A;  3RTW B;  2O1M A;  5B7D A;  1S50 A;  1BP5 A;  4DDD A;  2Q9T A;  4EF1 A;  2YLN A;  4G68 A;  4GVO A;  5I56 B;  1TFD A;  3IB1 A;  3ZKK A;  1RYO A;  1MPC A;  3D4G A;  3TDJ A;  5LOM A;  3O66 A;  1BIY A;  5K2Y A;  3O2A A;  4IO5 A;  1ZIU A;  2DVC A;  4U21 A;  3SEY A;  3IOV A;  2REG A;  3H03 A;  4OWD A;  3U94 A;  1LBB A;  1IEJ A;  1TT1 A;  2V25 A;  5TP9 B;  2RIN A;  2ZNT A;  4LAT A;  5CBR A;  3KG2 A;  4ND9 A;  3CFZ A;  1DOT A;  3C31 A;  4ZEB A;  2Z23 A;  3FJM A;  4ZE8 A;  5HM4 B;  2XD2 A;  4YMB A;  1IXI A;  4OVJ A;  5CMM A;  4DXC A;  1M5F A;  4YKP A;  3E4R A;  2Q2A A;  4LON B;  3CRB A;  3HV1 A;  1H3D A;  2I4B A;  4F1Y A;  2YJP A;  5KDT A;  2F97 A;  1N7X A;  2H5Y A;  1MXU A;  2F34 A;  4PQJ A;  2CZL A;  4RPO A;  4R6K A;  5JTY A;  2GHA A;  1ZTY A;  3N94 A;  5FHM A;  4YMA A;  1DPP A;  4IO7 A;  4FED A;  4GL8 A;  2OCU A;  3JYR A;  1B40 A;  4H65 A;  2PT2 A;  4MLV A;  4U23 A;  2HFB A;  3GBB A;  2WKY A;  3R26 A;  3V83 A;  2DE2 A;  3IB2 A;  3MZ1 A;  1A55 A;  1IXG A;  3Q25 A;  3T96 B;  5ICT A;  1IXC A;  1B0L A;  3SET A;  5H8Q B;  1N84 A;  3QK6 A;  3KOS A;  2DWA A;  2E0S A;  1N7W A;  1B32 A;  2ONR A;  2X7Q A;  1OLA A;  4KHZ E;  3T93 B;  5L9O A;  1MDQ A;  3FVG A;  2G29 A;  4EQ9 A;  3H6U A;  5TPA B;  2XXU A;  4H6D A;  3K4U A;  2ANJ A;  5FHO A;  1JVY A;  1FQE A;  1NMU A;  1KWH A;  4FEC A;  1QUJ A;  2P1S A;  3E3K A;  3MPK A;  3USD A;  4O3C A;  1EZO A;  1B3E A;  2I58 A;  4BDQ A;  3OXN A;  4QRZ A;  3TZA A;  4KR5 A;  1XVY A;  1PB7 A;  2DWH A;  1N04 A;  1XC1 A;  3HPI A;  3RPW A;  3QIM A;  3GLB A;  3IO4 A;  3T66 A;  3BBR A;  1JW4 A;  1MQI A;  4OMB A;  2Y7P A;  3O6I A;  5F7V A;  4U1O A;  1MQJ A;  4O3B A;  1J1N A;  1QUK A;  3ZSF A;  2HCA A;  2ONS A;  1LFH A;  1GR2 A;  1GTK A;  3PUX E;  3SEW A;  3AXF A;  3W9W A;  2Y7W A;  3FJ7 A;  4WEP A;  1H45 A;  2I0C A;  5I57 B;  2RC8 A;  2HZL A;  2ZNS A;  3K02 A;  5I2N B;  1I6Q A;  1D9Y A;  3C33 A;  5DVF A;  4U4S A;  3JZJ A;  5AA1 A;  4JSD A;  3M3L A;  3K6U A;  5I59 A;  3H6T A;  3H3G A;  2Q88 A;  2O51 A;  1AMF A;  4FIM A;  4YU0 A;  5TP9 A;  3R7X A;  3M8U A;  3RNN A;  4ESX A;  1NL5 A;  2UVH A;  1UIU A;  2PT1 A;  4KYS A;  4PFW A;  3U72 A;  3VV5 A;  3CFX A;  3B7D A;  4H1X A;  4BDM A;  1VE4 A;  3O29 A;  1A7L A;  3CIJ A;  2VOZ A;  4H67 A;  5DVI A;  1JNF A;  2AL5 A;  3ODB A;  1H44 A;  1URS A;  1LCF A;  3S4U A;  3ILU B;  4ZEC A;  1T0K A;  2OBG A;  3O6H A;  2QL3 A;  3SEV A;  4XXU A;  1PDA A;  2XXH A;  3G7W A;  4XIG Q;  2DSF A;  2VHA A;  1N76 A;  1Q1K A;  3C35 A;  3GBA A;  3MQ9 A;  3MVW A;  4GF8 A;  4HCW A;  3EF7 A;  4WXJ A;  4QSE A;  3M3F A;  2BJJ X;  5HBC A;  2R71 A;  3VLV A;  2D5W A;  2DXY A;  2XD3 A;  1MS7 A;  2F35 A;  3CI8 A;  3FV1 A;  3HCQ A;  3HO7 A;  2XXI A;  4R6Y A;  1EZP A;  3I3V A;  2PYY A;  1SW2 A;  1TWY A;  3MP8 A;  4P0I A;  4GWO A;  2B3F A;  3OMB A;  4RA1 A;  3QXM A;  4FJP A;  4JDF A;  1MXZ A;  4R6H A;  2E1S A;  2A5T A;  1ZBM A;  4HTG A;  3SKP A;  3TMG A;  5B70 A;  1ELJ A;  5L9M A;  5I84 A;  3S2V A;  5TU0 A;  3TEP A;  4G4P A;  3U8Q A;  4ELP A;  1Y4T A;  3MVX A;  4NF4 A;  2O69 A;  4DXU A;  1FTL A;  2B65 A;  4X1B A;  4IY6 A;  2X7P A;  4FE8 A;  5KCJ A;  1RKM A;  1II5 A;  2XXR A;  4YB7 A;  4NF5 B;  2LAO A;  2QJE A;  2ZYK A;  3TQL A;  1LAX A;  4F19 A;  3TAJ A;  4GRK A;  3LSL A;  1MY2 A;  1VR5 A;  1CB6 A;  1B1X A;  4XKP A;  4YKI A;  2ZYO A;  1MRP A;  2QS2 A;  2F7A A;  3OO8 A;  4MBP A;  4OET A;  1QUI A;  2V3T A;  3FV2 A;  5CMC A;  1N3X A;  4GLI A;  2XX7 A;  3IJX B;  2QS1 A;  2I48 A;  3T22 A;  4JXI A;  4P11 A;  4TOZ A;  2QPQ A;  4PFT A;  2QMX A;  4QF9 A;  5I59 B;  3G3I A;  1PBP A;  3DLN A;  4M4G A;  2D21 A;  3V89 B;  3HST A;  3IJO B;  5CM6 A;  5I2K A;  3OO9 A;  4KI0 E;  1I69 A;  5H8S A;  3KGC A;  2REJ A;  1B58 A;  1ZU0 A;  4F3S A;  4G77 A;  4EQ7 A;  3EQ1 A;  4KFQ A;  1UTB B;  3MP6 A;  2ABH A;  3TTL A;  1AOV A;  1IQ7 A;  1SI1 A;  1YPN A;  5DVJ A;  2VGQ A;  2OWS A;  1OQH A;  3KZG A;  4QFL A;  4WKM A;  3T9H B;  3LBS A;  1FQF A;  4ZZA A;  1QW0 A;  3T9X B;  1PBQ A;  1XT8 A;  4NED A;  2I49 A;  1Y20 A;  3PUW E;  3D4C A;  3A09 A;  4YIC A;  1HSL A;  4E0X A;  1LB8 A;  3B6Q A;  3ECR A;  1P1N A;  2V3Q A;  1BKA A;  3DM0 A;  3Q27 A;  5FHN A;  3PPQ A;  1MDP 1;  1WDN A;  1Y4C A;  4JSO A;  2F6G A;  3K1P A;  4EQB A;  1NNT A;  1ANF A;  3IOT A;  4R9F A;  1DPE A;  3IOW A;  1IXH A;  4QSC A;  2PX1 A;  1GVC A;  5AA4 A;  5DT6 A;  5J1D A;  1LB9 A;  3SER A;  4UA8 A;  2IA4 A;  2H98 A;  1NNP A;  1SBP A;  3H06 B;  1GGG A;  3R6U A;  4H8J A;  4ZDM A;  3THI A;  1B5H A;  1M5D A;  3I5O A;  2RKM A;  3FXU A;  4IY5 A;  3S9M C;  4F1U A;  1B7H A;  1SW5 A;  3K6W A;  1SD3 A;  3G3K A;  4EDP A;  2RCB A;  5KCJ B;  2PBW A;  3RN8 A;  1B7U A;  1MM6 A;  1Q35 A;  3RTF B;  3VDF A;  5H8F B;  2VD2 A;  3HHF A;  3WAE A;  1JW1 A;  4F18 A;  1MPB A;  2I6E A;  1OIB A;  2XXQ A;  3K0V A;  3PGF A;  4NWD A;  1PC3 A;  3PMX A;  1ZKB A;  1TFA A;  1LAG E;  4L17 A;  3RGY A;  3VVF A;  5DEX A;  1B2H A;  1URD A;  1GV8 A;  3TYH A;  4ZS9 A;  3SDF A;  3Q26 A;  3DP4 A;  1JW5 A;  4THI A;  3UN6 A;  1A8E A;  2GH9 A;  2UVG A;  3IAZ A;  4F39 A;  5EYF A;  3M3K A;  4ZEI A;  4IGR A;  4ZEK A;  3EN3 A;  3H6W A;  1Y3Q A;  2OWT A;  4F22 A;  4GQO A;  1A40 A;  3MAM A;  4DZ1 A;  5CMK A;  3T9U A;  5IKB A;  1B52 A;  1RYX A;  3G3G A;  1SYI A;  4FEB A;  4OQO A;  5I2K B;  4F3B A;  2DOJ A;  1PB8 A;  3A3U A;  3FXR A;  1MG1 A;  4DE8 A;  4JBZ A;  2UVJ A;  3IOU A;  3EPE A;  2O84 X;  2CMO A;  4JWY A;  3TTK A;  4GD5 A;  3VE1 B;  1OLC A;  3UOR A;  4GIZ A;  3LC8 A;  4FAT A;  5H8H A;  1A8F A;  1MM7 A;  2XXW A;  2A5S A;  3FVK A;  2OLB A;  4OER A;  4H0W A;  4KCC A;  1Y1M A;  2NWJ A;  4AQ4 A;  4C1U A;  1ZLQ A;  5A5X B;  1B3L A;  1EH3 A;  3VLU A;  4I8C A;  1B5I A;  3QUF A;  3U1O A;  1FCK A;  4POW A;  1QKA A;  1AIV A;  4QHQ A;  2UYF A;  2YPN A;  4BDN A;  3BKI B;  3KOT A;  2OK2 A;  1B46 A;  2V93 A;  4G68 B;  3PV0 E;  5F1Q A;  4KD5 A;  3MC2 A;  3ZKL A;  2AL4 A;  1Y1Z A;  1QVS A;  5JEI A;  1MQG A;  4ELO A;  3QAX A;  3C9H A;  4MF3 A;  4XKQ A;  3LUY A;  1B6H A;  2DE4 A;  2Z8E A;  3TQW A;  2R6G E;  4F31 B;  5ELV A;  3IR1 A;  2XXX A;  2V3U A;  4G8N A;  4JB7 A;  1S9T A;  3FZV A;  4RJZ A;  2KLF A;  4E0W A;  1HSE A;  1N0T A;  1MXW A;  5AE4 A;  3TCH A;  5I56 A;  3KSX A;  4IO2 A;  4F3P A;  1M5E A;  4OZ9 A;  2UXA A;  3RT6 B;  1NNK A;  1P1O A;  1WVJ A;  3LSW A;  2ESN A;  5EHM A;  1US4 A;  1IIW A;  4HCY A;  3DEL B;  1SW4 A;  2XXT A;  1OQG A;  2RC9 A;  3G3J A;  3GXA A;  5H8N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...