5DEXA

Crystal structure of glun1/glun2a nmda receptor agonist binding domains with glycine and antagonist, phenyl-acepc
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
282
structure length
269
Chain Sequence
RLKIVTIHQEPFVYVKPTMSDGTCKEEFTVNGDPVKKVICTGPTVPQCCYGFCIDLLIKLARTMNFTYEVHLVADGKFGTQERVNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKGTRITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSHENGFMEDLDKTWVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamate receptor ionotropic, NMDA 1
publication title Structural basis of subunit selectivity for competitive NMDA receptor antagonists with preference for GluN2A over GluN2B subunits.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein, receptor
total genus 70
structure length 269
sequence length 282
ec nomenclature
pdb deposition date 2015-08-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5dexA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5dexA02
3SDFA 5IAIA 3IO4A 2R6GE 4RJZA 2XX8A 2ZMBA 3B6TA 1NNPA 4E0WA 1IXHA 1N84A 2F5XA 3O29A 3K02A 1A54A 3PU5A 5DTBA 4EXLA 4GVOA 3TMGA 3TTLA 1P1QA 2BJJX 2UVHA 5CMCA 3E9XA 4GRKA 2AL4A 1GR2A 5H8NB 3V8XB 3RN8A 2IEEA 3CFLA 4NMYA 4OENA 1AOVA 3DP4A 4MH5A 3T22A 2VOZA 5B7DA 3GLBA 1B7UA 3M8UA 5A5XB 2V3QA 2AIXA 1LLSA 1ZBMA 2PBWA 2V3TA 1Y3NA 2G29A 4C0RA 1B5IA 4R9FA 4H5GA 1LAHE 4MBPA 2GHAA 5TP9A 4QHQA 2AL5A 1XVYA 4EDPA 2OWTA 3FJGA 1ZKBA 2Q8JA 4C1UA 2PT1A 3O9PA 1IIWA 4F3PA 3O2AA 5EYFA 2PX1A 4P11A 3MVWA 4HCYA 5I59A 5JK4A 4ELQA 1AL3A 1URSA 3LUYA 1FQAA 5ITOA 4DZ1A 4XKQA 4DCYA 4R6HA 3D4GA 1N0TA 4KQPA 1B7ZA 3PGFA 4QSDA 1VR5A 5DVIA 4ONYA 2I48A 1DSNA 4H8IA 3R26A 1B3LA 5CBRA 3KOSA 3FVGA 2HAUA 4YB5A 4ZE9A 2XHDA 4RXLA 2HEUA 2Z8DA 2D5WA 5FTIA 4KCDA 1LFIA 3QUJA 1SW4A 3FV1A 4F1UA 4IO2A 1B52A 4QSEA 2DWIA 4EQBA 3KSXA 3PD9A 1UTBB 2VP1A 1FQDA 4QRZA 1PEBA 3CRBA 4DXBA 4G8HA 3V89B 2X7PA 3RT8A 1N04A 2RC7A 5HM4B 3K1NA 4ZDMA 4HCWA 1UTBA 4BDOA 4N6PA 5TPAB 1YTVA 1B4HA 3SERA 4YMBA 3SETA 4DXCA 1NNKA 3HCQA 1P1WA 3USDA 1R6ZA 1NKXA 2O84X 5JEIA 1D9YA 4JWXA 4OEUA 3K2DA 1UTHB 3MWBA 3CVGA 1CE2A 3GBBA 1FCKA 1FTOA 1FQFA 3IJXB 4X9TA 1OLCA 4DCXA 1UTHA 2H98A 4QSCA 1SDXA 2XXVA 3PV0E 1BIYA 3EHTA 3ZKLA 1NNFA 3PUXE 2QS2A 3TPAA 3W9VA 3TCFA 3IB2A 4GIZA 3MZ1A 5FHOA 2O7UA 3H6TA 3O6GA 2O6AA 4E0XA 3DLNA 1LBCA 4IO3A 3K6WA 3KJ7A 5AA4A 1H43A 2I6EA 1NFTA 2OZZA 3C33A 3IB0A 5FTHA 2F7CA 1OLAA 2I0BA 3R6UA 1MRPA 4XXUA 3N6UA 3LC8A 1LSTA 2I58A 4L17A 5H8FB 3H03A 2DSFA 5H8HA 5ISUA 3M3LA 2GH9A 2XD2A 3TKDA 4R2FA 1FTJA 2I49A 2H4IA 4UA8A 4NF4B 2ZYOA 2Y84A 3H7MA 4F3GA 3RGYA 4NF4A 1FTKA 1O7TA 3OEMA 3P7IA 2XXQA 4IO6A 3IOVA 3GXAA 5KDTA 4YKIA 3WAEA 5DYHA 2ONRA 4ESWA 2F7BA 4NF5A 3MQ9A 1WDNA 1R9QA 3G3HA 2ALUA 3K4UA 4R6YA 2OJTA 3MVYA 4OFJA 3TDJA 5KZTA 1D4NA 1OVBA 3KN8A 5I58B 3DP6A 1R1NA 1SI1A 3MP1A 3A3UA 4G68B 5CM6A 1XHYA 4N07A 4DDDA 3QUFA 2ZYKA 5I2NB 3MAMA 3VVEA 1MY0A 3QSLA 1PB9A 3VXCA 1BTJA 4G68A 2DS9A 4IO4A 4QF9A 5H8QB 2QRYA 4XKRA 1B58A 1LB9A 1D3KA 4U4SA 3SKPA 1LAXA 1XOCA 1JETA 4PP0A 3A3CA 4H1XA 4RK9A 2V3UA 1B05A 1TFAA 2DVZA 4OVJA 4HS7A 4THIA 1Y1MA 4ELRA 3T66A 3TQLA 3B6WA 1MM7A 3EHSA 4JSDA 2F7AA 4RK2A 4M1VA 1ZIUA 1B0HA 2KLFA 4Z0IA 5FHMA 1URGA 3BBRA 5AA2D 2H9BA 4IGTA 1IUDA 4GL8A 2UVIA 2ONKE 3O28A 3Q29A 1VE4A 2QMWA 4QFOA 1H45A 2RF1A 2Z8FA 4NF8A 2Q9TA 3VLUA 2V84A 2ZXTA 1NL5A 1LAFE 2YLNA 1LBBA 2X26A 4JDFA 4F2OA 3VV5A 3VVFA 3KFMA 4NF6B 1Y4TA 3CFZA 1P1NA 1MXXA 4POWA 3RY3A 4UACA 3SEVA 4NE4A 4F3BA 4DLDA 4WKMA 2NOOA 4KI0E 5L9MA 1B51A 1MQHA 1MQIA 1QUJA 4GD5A 2GRVA 4U21A 1QKBA 4YICA 2NWJA 5KCJA 3S9EA 3KOTA 4ZEKA 4BDLA 1B2HA 3C4MA 3IORA 2UXAA 3FXQA 1URDA 4XIGQ 4XTCQ 1NH7A 3UA8A 4ESXA 3FZVA 1A8FA 3N26A 4LQ5A 4N13A 1B3GA 4F19A 4F2QA 1Y3QA 3BFTA 5EHSA 1GTKA 1UIUA 2P0SA 2UYFA 1QUIA 3CFXA 1ZLQA 3TCHA 2CZLA 3H6WA 2XXIA 3BFUA 3ZKKA 4LUBA 4H6DA 1O64A 3Q27A 4IY5A 1QVSA 5CMBA 4QFNA 5TP9B 3QIMA 4QFLA 2NUVA 2QMXA 4ZEDA 5H8SA 3TEPA 3IR1A 4FEBA 2PT2A 5AE4A 2O51A 5I59B 1IXIA 4JSOA 3VLVA 2VHAA 3KBRA 2F35A 2QJEA 1A40A 3DM0A 2VD3A 4O3BA 2DE3A 2XXYA 3PMVA 1KWHA 1A55A 1J1NA 5DEXB 2O1LA 4YB6A 1OVTA 3FIRA 4IO5A 1HSJA 4XKPA 2M8CA 5ELVA 1TWYA 3OD7A 3PPQA 1RYXA 3OEKA 4EF2A 4YKJA 5DEXA 3L6HA 4GL0A 1B4ZA 4F22A 4AQ4A 2B3BA 4NEDA 1MXVA 3OSRA 1N7WA 3CSBA 1MPCA 3PPRA 2DQVA 4BDNA 1QULA 3UK4A 3IOWA 3S2VA 4G68C 3T9UA 3R7XA 3CG1A 4JBZA 4C1TA 1A99A 1JQFA 3U8QA 3A09A 4FAJA 3C32A 3VE1B 3Q28A 1DTGA 3E3KA 3UN6A 4FATA 3MP8A 2DP8A 1EH3A 3RQTA 1JW5A 2DWAA 3TODA 1M5DA 5CBSA 1PB7A 1B5JA 4OZ9A 3GZGA 3G3IA 3C35A 2O69A 1IXCA 4MFIA 1NNTA 4R74A 5I57A 4GQOA 4GF8A 3ECRA 3THIA 3EHUA 2ZYNA 2P1SA 4BDQA 4GOTA 4FECA 1SQYA 4QFKA 1B0LA 1IQ7A 2ABHA 1L5TA 4Q0CA 4H0WA 1B46A 5B70A 3UIFA 2Q2AA 2O7IA 3LBSA 2F34A 3VDFA 1I69A 2UYEA 3C36A 3HV1A 1S9TA 2RC9A 2HZKA 4DXUA 4OFOA 4I9DA 3W9WA 4QFPA 2HFBA 3ONMA 2PMSA 2HAVA 3HHGA 5AA4B 1T0KA 4EUOA 3KN3A 3FASA 5CI5A 3ODBA 1Y4CA 3S9NC 2AYSA 2ZNSA 1TFDA 1LFGA 1OMPA 2XXHA 4ELOA 4OESA 3S4UA 1BLFA 2DWJA 4R9GA 3U92A 3TTMA 5H8HB 2Y7IA 4G8NA 2ZYMA 4F29A 3U1OA 1B40A 1TT1A 3JV9A 5IKBA 5CMMA 2B3FA 1JVYA 3SEUA 1DTZA 4ISUA 3K01A 1P1UA 3I5OA 3S9LC 2RCAA 4U2RA 3BKIB 2Z22A 2Y7KA 1CB6A 5AA2A 1SW2A 2RINA 3OXNA 1OQGA 3Q26A 4LZ5A 3MPKA 3ZSFA 3FVOA 5KDTB 4MLVA 4X1BA 2CMOA 4FE8A 1F9BA 1MDQA 4EXKA 1MPDA 1IXGA 4NF5B 3TAJA 1SI0A 3C9HA 3K00A 1SW1A 3IB1A 3E4RA 3MP6A 4OETA 1M5FA 4F18A 4RYAA 2FYIA 5BUUA 2PVUA 3LSWA 1I6BA 3FJ7A 2FA7A 2F6PA 5CMKA 3IK6B 4OEVA 1US4A 3RLFE 4KCCA 4TOZA 3HN0A 1LGBC 2D3IA 3OSQA 5BWJA 3U93A 5F1QA 1M5EA 4BDMA 1AMFA 4MLQA 1DPEA 3M3FA 3FXRA 3SEXA 4P0GA 1M5BA 5K2XA 3TFLA 4Q5TA 3OO6A 3AXFA 3IAZA 3LSXA 3K6XA 1ZTYA 4IB2A 1N3XA 1HSLA 4KHZE 2DE2A 1Y3PA 4GFRA 2OK2A 1SD3A 2I4CA 4LA9A 4ZEBA 4FEDA 2QSXA 3UORA 1GVCA 3VFJA 1USYH 2X7QA 1B9JA 3UP9A 1ZU0A 5AA3A 1AIVA 2LAOA 3TTRA 2H99A 3MJNA 2Q89A 4RY1A 3H06B 4Z7EA 4PFWA 4H65A 3RT6B 4YAHX 2GFEA 3PUVE 4TQUQ 3EPEA 2A5SA 4KYEA 4PFYA 1FQBA 1Y9UA 2RCBA 3Q25A 4NWDA 3PUYE 4XKNA 5I2KB 1Z7ME 3RTFB 3T93B 3OO8A 3VVDA 3TCGA 1B1HA 3VLWA 4NF8B 3MW0A 1YCJA 1ELJA 5I2KA 1Q35A 1ZMGA 2DWHA 3M3KA 2H5YA 1MY2A 4HTGA 3RPWA 2HCAA 3HSTA 2NXOA 1LCFA 3G7WA 3CI8A 3IO6A 5TU0A 1A8EA 2A5TA 1P99A 2XXUA 3C31A 4LP2B 3OO7A 2P2AA 3C34A 2F6GA 1A7LA 4G77A 4PFUA 3H3GA 1DPPA 5KCJB 3L6GA 4X1DA 2Z8EA 2YPNA 3CR9A 5K2YA 4G4PA 4NWCA 3N6TA 3CG3A 3MBPA 1MXWA 2XXPA 1MM6A 3RUMA 1JEVA 5DVJA 3LSFB 1MQDA 3PMXA 4LVQA 2NVUB 2FNCA 2QPQA 1LCTA 3MC2A 5L9SA 4EQ7A 4JWOA 2VD2A 4G2ZA 1JNFA 2Y7PA 4U22A 5JTYA 4R2BA 3KN7A 4YB7A 4G8MA 2ZNUA 1RKMA 3MPLA 1LAGE 4JWYA 4H5FA 3FJMA 4LATA 4OTEA 4ND9A 3CIJA 4H67A 3VXBA 1PB8A 2G93A 1UQWA 5M2VA 4RA1A 2XXXA 1DOTA 3G3GA 2HXWA 2OLBA 3MUQA 3TTNA 3DP8A 2I4BA 1EU8A 4R73A 4PQJA 4OFLA 4GWOA 3PPOA 1SW5A 2DVCA 1QKAA 3KEIA 4ZEFA 3RNNA 3TTKA 1MDP1 4BDRA 3IL1B 3QYTA 2F97A 4U1OA 4OYVA 4O3AA 3H6VA 1HSEA 4GXAA 5HPQA 3FGSA 5H8NA 4PE5B 1N76A 3HPIA 4GLIA 2XXTA 3I3VA 3MZBA 4RPOA 2UVGA 1DMBA 3OMBA 1SBPA 2F78A 1B1XA 5A5XA 4I62A 3TZAA 2I3VA 4P0IA 2Q2CA 4AB5A 4KFQA 4OWDA 2XX9A 2QS3A 3I6VA 4YKKA 4OXVA 3F11A 4Q30B 1H76A 4R75A 1MS7A 3PMWA 1PBPA 4R72A 3SEWA 1OQHA 4OERA 4PETA 4ZEIA 3U94A 4JXIA 3N94A 3U72A 4M4GA 4KYSA 2XXRA 1QUKA 3FD3A 2XXWA 1QJMA 2YJPA 2I3WA 2DXYA 1NMUA 2W7YA 1N7XA 3FXUA 4POXA 1XT8A 3PPPA 1EZOA 1GGGA 1MY1A 2RC8A 3TQWA 3QAXA 4U1ZA 3HHFA 3B6QA 1WVJA 3JZJA 1MXZA 2Y7RA 3B7DA 1MXYA 4FIMA 5I57B 4DE8A 3JYRA 2D21A 3TYHA 4KPTA 4YZZA 1SYHA 2PYYA 2VGQA 1MH4A 2F36A 4RNSA 3T9XB 4F3SA 5CC2A 1Q1KA 3FVKA 3KJTA 4EF1A 4IO7A 4O3CA 5L8DA 3OENA 2R9JA 1FQEA 4KR5A 1TXFA 4YKPA 3ILUB 2XD3A 4ZECA 1D9VA 2O1MA 3FVNA 5ICQA 4PFTA 1ATGA 4K3FA 3KG2A 3FUZA 4TLLB 3GBAA 5TPAA 1YPNA 1B5HA 2DOJA 3H6UA 1OIBA 2Y7WA 3IOUA 4LZ7A 1ANFA 2OBGA 3PD8A 1PC3A 1B32A 2QS1A 4AB6A 1IITA 3K0VA 1MXUA 4WXJA 4KYDA 1VFEA 3IOTA 4WEDA 4FORA 1BP5A 1MQJA 3PUWE 3UGWA 4I8CA 4WEPA 5ITPA 3KZGA 1POTA 3HO7A 4OMBA 2Z23A 5CRYA 4RPNA 3KGCA 1R9LA 1WODA 2HQ0A 1FTMA 1VFDA 5DT6A 5AA2B 4NTLA 4ZE8A 3FV2A 1II5A 1USYE 1XC1A 2DE4A 2O68A 1O63A 1EZPA 3E13X 1H3DA 2E0SA 1B3EA 2B65A 5HBCA 4F1YA 4F1VA 3V83A 4ECFA 1I6QA 1UIVA 4ZS9A 2UVJA 1MY4A 3O6IA 4U4XA 3MVZA 5H8FA 3V5AA 4F39A 3FATA 2ANJA 4EQ9A 4OHNA 1JW4A 4HW8A 3N5LA 1JW1A 1LB8A 1QW0A 2DXRA 5ICTA 4IY6A 4R6KA 5EHMA 3O66A 4MF3A 5AA1A 4YU0A 3O6HA 1AH5A 3DELB 3EQ1A 2H25A 3G3JA 3S9MC 5F7VA 1MY3A 4KD5A 2R71A 4LZ8A 5L9OA 3WAFA 4ELPA 4I1DA 4ZZEA 1VSOA 1XS5A 5I56B 3RTWB 1IZ1A 2OCUA 1JVXA 5DVFA 2REJA 2V25A 1JEUA 4LQ2A 1PBQA 1XVXA 4ZZAA 1B6HA 3QK6A 5I56A 1SVXB 1FQCA 3O97A 4OQOA 2F8DA 3K1PA 3EF7A 1B3FA 1S7YA 1MPBA 2THIA 3K6UA 3LR1A 1RYOA 1PDAA 3CSGA 1N3WA 5I58A 2DYXA 4DIGA 1H44A 2I0CA 2HZLA 4FJPA 5I2NA 1Z7NE 3OELA 1MQGA 3K6VA 4X48A 4YMAA 2ZNTA 3MVXA 1LFHA 3T9VA 3G3KA 1Y1ZA 1GV8A 5LOMA 5H8QA 3QXMA 3SEYA 1MH3A 4H8JA 1MG1A 4IGRA 4TLMB 4GXSB 3G3FA 3K1MA 3W15C 3IJOB 1NH8A 3SESA 3T96B 2A5TB 2QS4A 3LSLA 3ZS6A 3D4CA 4JB7A 2XX7A 3MZ9A 1B3HA 3T9HB 1POY1 2RKMA 1YAEA 1Y20A 3PUZE 2GHBA 1P1OA 4F31B 1I6AA 1M5CA 3OO9A 2QL3A 2IA4A 1SYIA 2OWSA 3PPNA 2ONSA 5J1DA 3IX1A 1FW0A 3TELA 3OOAA 3EN3A 4BLAA 4U23A 1IEJA 1S50A 1FTLA 2E1SA 4LONB 2WKYA 3H4ZA 1BKAA 2REGA 5FHNA 1B7HA 5I84A 1ZJLA 4NF6A 1US5A 5JTYB 3ILTB 2ESNA 1EZ9A 3KSJA 3TUSA 4Q8RA 2Q88A 2V93A
chains in the Genus database with same CATH superfamily
3SDFA 5IAIA 2B4LA 3IO4A 3IFAA 2R6GE 4RJZA 2XX8A 2ZMBA 3B6TA 1NNPA 4E0WA 1IXHA 1N84A 2F5XA 3O29A 3K02A 1A54A 3PU5A 5DTBA 4EXLA 4GVOA 3TMGA 3TTLA 1P1QA 2BJJX 2UVHA 5CMCA 3E9XA 4GRKA 4PAKA 2AL4A 4P9KA 1GR2A 5H8NB 4AS4A 1LBZA 3V8XB 3RN8A 2IEEA 3CFLA 4NMYA 4OENA 1AOVA 3DP4A 4MH5A 2FIXA 4OA4A 3T22A 2VOZA 5B7DA 3GLBA 1B7UA 5I7IA 1CNQA 3M8UA 5A5XB 2V3QA 2AIXA 1LLSA 1ZBMA 2PBWA 2V3TA 1Y3NA 2G29A 1KA1A 4C0RA 1B5IA 4R9FA 4H5GA 1LAHE 4MBPA 2GHAA 5TP9A 4QHQA 2AL5A 1XVYA 1LBYA 4EDPA 2OWTA 3FJGA 1ZKBA 2Q8JA 4C1UA 2PT1A 3O9PA 1IIWA 4XFEA 4F3PA 3O2AA 1LBWA 5EYFA 2PX1A 4P11A 3MVWA 4HCYA 5I59A 5JK4A 4ELQA 3U65A 4PC9A 4PGPA 5ET5A 1AL3A 1URSA 3LUYA 1FQAA 5ITOA 4DZ1A 3GYYA 4XKQA 1NUZA 4DCYA 4R6HA 3D4GA 1N0TA 4KQPA 1B7ZA 3PGFA 4QSDA 4MMPA 1VR5A 5DVIA 4ONYA 2I48A 1DSNA 4H8IA 3R26A 4N81A 1B3LA 2CZIA 4PGNA 5CBRA 3KOSA 3FVGA 3KC1A 3E79A 2HAUA 4YB5A 4ZE9A 2XHDA 4JVDA 4RXLA 2HEUA 2Z8DA 2OWZA 2D5WA 5FTIA 4KCDA 5IZZA 1LFIA 3QUJA 1SW4A 3FV1A 1NV7A 4F1UA 4IO2A 1B52A 4QSEA 2DWIA 4EQBA 3KSXA 3PD9A 1UTBB 2VP1A 1FQDA 4QRZA 1PEBA 3CRBA 4DXBA 4G8HA 3V89B 2X7PA 3RT8A 1N04A 2RC7A 3QMFA 4MCOA 5HM4B 5IM2A 3K1NA 2L5VA 4ZDMA 4NN3A 4HCWA 1UTBA 4BDOA 4GX4A 4N6PA 5TPAB 1YTVA 1B4HA 3HFUA 3SERA 4YMBA 1DK4A 3SETA 4DXCA 1NNKA 3HCQA 1P1WA 3USDA 1R6ZA 1FPIA 1NKXA 2O84X 5JEIA 4H46A 2ZZVA 1D9YA 4JWXA 1BK4A 4OEUA 3K2DA 1UTHB 3MWBA 3CVGA 1CE2A 3GBBA 1FCKA 1FTOA 1FQFA 3IJXB 4X9TA 2GQ1A 1OLCA 4DCXA 1NUWA 2OX3A 1UTHA 2H98A 4QSCA 1SDXA 2ZZWA 5ET7A 3PV0E 2XXVA 1BIYA 3EHTA 3ZKLA 1NNFA 3PUXE 2QS2A 3TPAA 3MYUA 3W9VA 3TCFA 3IB2A 4PBHA 4GIZA 3MZ1A 4PF6A 2WBDA 5FHOA 2O7UA 3H6TA 1FJ9A 1NV5A 3O6GA 2O6AA 4E0XA 3DLNA 3LV0A 1LBCA 4IO3A 3K6WA 3KJ7A 5AA4A 1H43A 2I6EA 1FBGA 1NFTA 1IMEA 2OZZA 3C33A 3IB0A 5FTHA 2F7CA 1OLAA 2I0BA 3R6UA 1MRPA 4XXUA 4PE3A 4OVRA 3N6UA 3LC8A 1LSTA 2I58A 4L17A 5H8FB 3H03A 1IMCA 2DSFA 5H8HA 5ISUA 3M3LA 2GH9A 2XD2A 3TKDA 4R2FA 1FPDA 1FTJA 2DDKA 2I49A 2H4IA 5ESYA 4UA8A 4NF4B 2ZYOA 2Y84A 4QXDA 3H7MA 4F3GA 5IGAA 4HE2A 1KZ8A 3RGYA 4NF4A 4MAGA 1FTKA 4P56A 1O7TA 3OEMA 4NF0A 3P7IA 2XXQA 4IO6A 3IOVA 3GXAA 5KDTA 4I3EA 4YKIA 3WAEA 5DYHA 1G0IA 2ONRA 4ESWA 1FBEA 4NGUA 2F7BA 4NF5A 3MQ9A 1WDNA 5EYGA 1R9QA 4HE1A 3G3HA 2ALUA 3K4UA 2HHMA 2HPGA 4R6YA 2OJTA 3MVYA 4OFJA 3TDJA 5KZTA 1D4NA 1OVBA 3KN8A 5I58B 3DP6A 1R1NA 1FBPA 1SI1A 3MP1A 3A3UA 4GBWA 4G68B 5CM6A 1XHYA 4N07A 4DDDA 3QUFA 2ZYKA 5I2NB 3MAMA 4OVSA 3VVEA 1MY0A 3QSLA 1PB9A 3VXCA 1BTJA 4PCDA 4G68A 4O7MA 4O94A 2DS9A 4IO4A 4QF9A 5H8QB 2QRYA 4XKRA 1B58A 1LB9A 1D3KA 4U4SA 3SKPA 1LAXA 1INPA 1XOCA 1JETA 4PP0A 2R8TA 3A3CA 4H1XA 4RK9A 2V3UA 1B05A 1TFAA 2DVZA 2FVZA 4IR8A 4OVJA 3B50A 4HS7A 4THIA 3BIHA 3CHGA 1Y1MA 1IMAA 4ELRA 3T66A 2XWIA 3TQLA 3B6WA 1MM7A 3EHSA 4JSDA 4GWYA 2F7AA 4RK2A 4M1VA 1ZIUA 1B0HA 2KLFA 4Z0IA 5FHMA 1URGA 3BBRA 5AA2D 2H9BA 4IGTA 5LDZA 1IUDA 4GL8A 4MEVA 2UVIA 1FPKA 2ONKE 3O28A 3Q29A 1VE4A 2QMWA 4GWZA 4QFOA 1H45A 2RF1A 2Z8FA 4NF8A 2Q9TA 3VLUA 2V84A 2ZXTA 1NL5A 1LAFE 2YLNA 5I5PA 1LBBA 2X26A 4JDFA 4F2OA 3VV5A 3VVFA 2QFLA 1VDWA 3KFMA 4NF6B 4PDHA 1Y4TA 3PTYA 4I3YA 3CFZA 2QVUA 1P1NA 1MXXA 4POWA 1YXIA 3RY3A 4UACA 3SEVA 4NE4A 4F3BA 4DLDA 4WKMA 2NOOA 4KI0E 5L9MA 1B51A 1MQHA 1MQIA 1QUJA 1IMBA 4GD5A 2GRVA 4U21A 1QKBA 2KQZA 4YICA 4QBAA 2NWJA 5KCJA 3S9EA 3E78A 3KOTA 4ZEKA 4BDLA 1B2HA 3C4MA 3IORA 2UXAA 3FXQA 1URDA 4XIGQ 4XTCQ 1NH7A 3RYDA 3UA8A 3MSTA 4ESXA 3FZVA 1A8FA 3N26A 4LQ5A 4GWWA 4DI3D 4N13A 1B3GA 4F19A 4GWUA 4F2QA 1Y3QA 3BFTA 5EHSA 1GTKA 1UIUA 4X04A 2P0SA 2UYFA 1QUIA 3CFXA 1ZLQA 3TCHA 2CZLA 3H6WA 2XXIA 3BFUA 3ZKKA 4LUBA 4H6DA 1O64A 3Q27A 4IY5A 5IZ1A 1QVSA 5CMBA 4QFNA 5TP9B 3QIMA 4QFLA 2NUVA 2QMXA 4ZEDA 5H8SA 3TEPA 3IR1A 4FEBA 2PT2A 3KBZA 5AE4A 2O51A 2CZHA 5I59B 4N8YA 1IXIA 4JSOA 3VLVA 2VHAA 3KBRA 2F35A 2QJEA 5EQ9A 4UABA 1A40A 3DM0A 2VD3A 4O3BA 5LTCA 2DE3A 2XXYA 3PMVA 1KWHA 1A55A 1J1NA 1FBFA 5DEXB 2O1LA 4YB6A 1OVTA 3FIRA 4IO5A 1HSJA 4XKPA 2M8CA 4N91A 5ELVA 1TWYA 1FSAA 3OD7A 3PPQA 1RYXA 3OEKA 4EF2A 4YKJA 5DEXA 3SZPA 3ISPA 3L6HA 4GL0A 1B4ZA 4F22A 4AQ4A 2B3BA 4NEDA 1MXVA 3OSRA 1N7WA 3CSBA 1MPCA 3PPRA 2DQVA 4BDNA 1QULA 3UK4A 1NV0A 3IOWA 3S2VA 4G68C 3T9UA 3R7XA 3CG1A 4AS5A 4JBZA 4C1TA 1A99A 1JQFA 3U8QA 3A09A 4FAJA 4PDDA 3C32A 2B4MA 3VE1B 3Q28A 1DTGA 2MKZA 3E3KA 3EKIA 3UN6A 4FATA 3MP8A 4PBQA 2DP8A 1EH3A 3RQTA 1JW5A 2DWAA 3TODA 1M5DA 3FBPA 5CBSA 3FXBA 1PB7A 1B5JA 4I40A 4OZ9A 3GZGA 3G3IA 3C35A 2O69A 1IXCA 4MFIA 1NNTA 4R74A 5I57A 2VPNA 4N6DA 2ZZXA 4GQOA 4GF8A 2WX9A 3ECRA 3THIA 4PTKA 3EHUA 2ZYNA 1EYIA 2P1SA 4BDQA 4GOTA 4FECA 1SQYA 1IMDA 4QFKA 1B0LA 3T0JA 4PFRA 1IQ7A 2JJKA 2ABHA 1L5TA 4Q0CA 4H0WA 1B46A 5B70A 3UIFA 2Q2AA 2O7IA 3LBSA 2F34A 1FBDA 3VDFA 1I69A 2Y5LA 2UYEA 3C36A 3HV1A 1S9TA 2RC9A 2HZKA 2F3DA 5IZ3A 2HXRA 4DXUA 4OFOA 4I9DA 3W9WA 4QFPA 2HFBA 3ONMA 2PMSA 2HAVA 3HHGA 5AA4B 1T0KA 4EUOA 3KN3A 3FASA 5CI5A 3ODBA 1Y4CA 3S9NC 1NV3A 2AYSA 2ZNSA 1RDYA 1TFDA 1LFGA 1NI9A 1OMPA 2XXHA 4ELOA 4OESA 4PF8A 3S4UA 1BLFA 2DWJA 4R9GA 2Y5KA 3U92A 3TTMA 3B8BA 5H8HB 2Y7IA 4G8NA 2ZYMA 4F29A 3U1OA 1B40A 1TT1A 1K9YA 3JV9A 2WBBA 2Q74A 5IKBA 4KXPA 5CMMA 2B3FA 1JVYA 3SEUA 1DTZA 4ISUA 3K01A 1P1UA 3I5OA 3S9LC 2RCAA 4U2RA 3BKIB 2Z22A 2Y7KA 1CB6A 5AA2A 1SW2A 2RINA 3OXNA 1OQGA 2CEYA 3Q26A 4LZ5A 3MPKA 3ZSFA 3FVOA 5KDTB 4MLVA 4X1BA 2CMOA 4FE8A 5EQ8A 1F9BA 1MDQA 2WEFA 4EXKA 1MPDA 1IXGA 4NF5B 3TAJA 1SI0A 3C9HA 3K00A 1SW1A 3IB1A 3E4RA 3MP6A 4GWSA 4OETA 1M5FA 4F18A 1NV1A 4RYAA 2FYIA 5BUUA 2PVUA 2XWKA 3LSWA 2XA5A 1I6BA 3FJ7A 2FA7A 2F6PA 5CMKA 3T1BA 5FBPA 3IK6B 1SPIA 4OEVA 1US4A 3RLFE 4KCCA 4TOZA 3HN0A 1LGBC 2D3IA 3OSQA 5BWJA 3A29A 3U93A 1NV2A 5F1QA 1M5EA 1FPGA 4BDMA 1AMFA 4MLQA 1DPEA 3M3FA 3FXRA 3SEXA 4P0GA 1M5BA 5K2XA 3TFLA 4Q5TA 4G61A 3OO6A 4MJOA 3AXFA 3IAZA 3LSXA 3K6XA 3BIGA 1ZTYA 4IB2A 1N3XA 1HSLA 4KHZE 4H45A 2DE2A 1Y3PA 4GFRA 2OK2A 1SD3A 2I4CA 4LA9A 4ZEBA 4FEDA 2QSXA 3UORA 1GVCA 3VFJA 1USYH 2X7QA 1B9JA 3UP9A 1NUXA 3NOHA 1ZU0A 5AA3A 1AIVA 2LAOA 3TTRA 2H99A 3MJNA 2Q89A 2QVVA 4RY1A 3H06B 4Z7EA 4PFWA 4H65A 1LEVA 3RT6B 4YAHX 2GFEA 3PUVE 4TQUQ 3EPEA 2A5SA 4KYEA 4PFYA 1FQBA 4P8BA 1Y9UA 4NWDA 2RCBA 3Q25A 4O8MA 3KC0A 3PUYE 4XKNA 1LBXA 5I2KB 1Z7ME 3RTFB 3T93B 3OO8A 1FPLA 3VVDA 4PAFA 3TCGA 1B1HA 3VLWA 4NF8B 3MW0A 1YCJA 1ELJA 5I2KA 1G0HA 1Q35A 4NX1A 1FBHA 1ZMGA 2DWHA 3M3KA 2V4CA 2H5YA 1MY2A 4HTGA 3ROJA 3RPWA 2HCAA 3HSTA 1IMFA 2NXOA 1LCFA 3G7WA 3CI8A 3IO6A 1K9ZA 5TU0A 1A8EA 2A5TA 1P99A 4OVPA 2CEXA 2XXUA 3C31A 4LP2B 4NHBA 3OO7A 4N15A 2P2AA 4MNIA 2FHYA 3C34A 5DW8A 2F6GA 1A7LA 4G77A 4PFUA 3H3GA 1DPPA 3D1RA 5KCJB 3L6GA 1FPEA 4X1DA 2Z8EA 2YPNA 3CR9A 4NG7A 5K2YA 4G4PA 4NWCA 3N6TA 3CG3A 1AWBA 3MBPA 1MXWA 2XXPA 1MM6A 1KA0A 3RUMA 1JEVA 4GWXA 5DVJA 3LSFB 1MQDA 3PMXA 5ET8A 1FJ6A 2P3NA 4LVQA 2NVUB 2FNCA 2BJIA 2QPQA 1LCTA 3MC2A 5L9SA 4EQ7A 4JWOA 2VD2A 1JP4A 4G2ZA 1JNFA 2Y7PA 4U22A 5JTYA 2PFYA 4R2BA 3KN7A 4YB7A 4G8MA 2ZNUA 1RKMA 3MPLA 1NV4A 1LAGE 4JWYA 4H5FA 3FJMA 4LATA 4OTEA 4ND9A 4PFIA 3CIJA 4H67A 3VXBA 1PB8A 2G93A 1D9QA 1UQWA 5M2VA 4RA1A 2XXXA 1DOTA 3G3GA 2KR0A 2HXWA 2OLBA 3MUQA 3TTNA 3DP8A 1DCUA 2XWOA 2I4BA 1EU8A 1FPBA 4R73A 4PQJA 4NAPA 4OFLA 4GWOA 3PPOA 1SW5A 2DVCA 2PFZA 1QKAA 3KEIA 1YYZA 4ZEFA 3RNNA 3TTKA 1MDP1 4BDRA 3IL1B 3QYTA 2F97A 1FPFA 4U1OA 4OYVA 5A5LA 4O3AA 3H6VA 1HSEA 4GXAA 5HPQA 3FGSA 5H8NA 4MHFA 1FPJA 4PE5B 1N76A 3HPIA 4GLIA 2XXTA 3I3VA 3MZBA 4RPOA 2UVGA 1DMBA 3OMBA 1SBPA 2F78A 1B1XA 5A5XA 4I62A 1DBZA 3TZAA 2I3VA 2XWVA 4P0IA 2FBPA 2Q2CA 4AB5A 4KFQA 4OWDA 2XX9A 2QS3A 3I6VA 4YKKA 4OXVA 3F11A 4Q30B 1H76A 4P47A 4R75A 1MS7A 5F24A 3PMWA 1PBPA 4R72A 4JVIA 4XF5A 3SEWA 1OQHA 4OERA 4PETA 4ZEIA 3U94A 4OVQA 4JXIA 4P1LA 3N94A 1NUYA 3U72A 4M4GA 4KYSA 2XXRA 1QUKA 3FD3A 4PAIA 2XXWA 1QJMA 2YJPA 2I3WA 2DXYA 1NMUA 2W7YA 1N7XA 3FXUA 4POXA 1XT8A 3PPPA 1EZOA 1GGGA 1MY1A 2RC8A 2VPOA 1YZ0A 3TQWA 3QAXA 4U1ZA 3HHFA 1FBCA 3B6QA 1WVJA 3JZJA 1MXZA 2Y7RA 3B7DA 1MXYA 4FIMA 5I57B 4DE8A 3LUZA 3JYRA 4O7IA 2D21A 3TYHA 4KPTA 4YZZA 1SYHA 2PYYA 4JVCA 2VGQA 1MH4A 2F36A 4RNSA 3T9XB 4F3SA 5CC2A 1Q1KA 3FVKA 3KJTA 1LBVA 4EF1A 4IO7A 4O3CA 5L8DA 3OENA 2R9JA 2WYKA 1FQEA 4PFBA 4KR5A 1TXFA 4YKPA 3ILUB 2XD3A 4ZECA 1D9VA 2O1MA 3FVNA 5ICQA 4PFTA 1ATGA 4K3FA 5IZ3B 3KG2A 3FUZA 4DI4B 4TLLB 3GBAA 5TPAA 1YPNA 4OANA 1B5HA 2DOJA 3H6UA 3RPLB 1OIBA 2Y7WA 3IOUA 1QGXA 4LZ7A 1ANFA 2OBGA 3PD8A 1PC3A 1B32A 4GBVA 2QS1A 4AB6A 1IITA 4MNCA 3K0VA 3RPLA 1MXUA 4WXJA 4KYDA 1VFEA 4FBPA 3IOTA 4WEDA 4FORA 1BP5A 1MQJA 3PUWE 3UGWA 4I8CA 5EQ7A 4WEPA 5ITPA 3KZGA 1POTA 4X8RA 3HO7A 4OMBA 2Z23A 2Q8MA 1XI6A 4RPNA 5CRYA 3KGCA 1R9LA 1WODA 2HQ0A 1FTMA 2WYPA 1VFDA 5DT6A 5AA2B 4NTLA 4ZE8A 3FV2A 1II5A 1USYE 1XC1A 2DE4A 1FRPA 4XEQA 2O68A 1O63A 1EZPA 3E13X 1H3DA 2E0SA 4MX6A 1B3EA 2B65A 5HBCA 4F1YA 4F1VA 3V83A 3IFCA 4ECFA 1I6QA 2VT5A 5I3SA 1UIVA 4MNPA 4ZS9A 2UVJA 1MY4A 3O6IA 4U4XA 3MVZA 5H8FA 3V5AA 4F39A 3FATA 2ANJA 4EQ9A 4OHNA 1JW4A 4HW8A 5J16A 3N5LA 1JW1A 1LB8A 1QW0A 2DXRA 5ICTA 4IY6A 4R6KA 5EHMA 3O66A 4MF3A 5AA1A 4YU0A 3O6HA 1AH5A 3DELB 3EQ1A 2H25A 3G3JA 3S9MC 5F7VA 2P3VA 1MY3A 4KD5A 4P3LA 2R71A 4LZ8A 5L9OA 3WAFA 4ELPA 4P1EA 4N6KA 4I1DA 4ZZEA 1VSOA 1EYKA 1XS5A 5I56B 1NV6A 3RTWB 1IZ1A 4N8GA 2OCUA 1JVXA 2PCRA 1Q9DA 5DVFA 2REJA 2V25A 1JEUA 1FTAA 4LQ2A 1PBQA 1XVXA 4ZZAA 1B6HA 3QK6A 5I56A 1SVXB 1FQCA 5ET6A 3O97A 4OQOA 1RDXA 2F8DA 3K1PA 3EF7A 1B3FA 1S7YA 1MPBA 2THIA 3K6UA 3LR1A 2QVRA 1RYOA 1PDAA 3CSGA 1N3WA 4N4UA 5I58A 2DYXA 4DIGA 1H44A 5EYHA 2I0CA 2HZLA 5T3JA 4FJPA 4OVTA 5I2NA 2FIEA 1Z7NE 3OELA 1MQGA 3K6VA 4X48A 2F3BA 4YMAA 2ZNTA 3MVXA 1LFHA 3T9VA 3G3KA 1Y1ZA 1GV8A 5LOMA 5H8QA 3QXMA 2XXKA 3SEYA 1MH3A 4H8JA 1MG1A 4HXVA 4NQ8A 4IGRA 4TLMB 4GXSB 3G3FA 3K1MA 4N17A 3W15C 3IJOB 5EQAA 1EYJA 1NH8A 3SESA 3T96B 2A5TB 2QS4A 3LSLA 3ZS6A 3D4CA 4JB7A 2XX7A 3MZ9A 4GX3A 4GX6A 1B3HA 3T9HB 1POY1 2RKMA 1YAEA 1Y20A 3PUZE 4MIJA 2CZKA 2GHBA 1P1OA 4F31B 1I6AA 1M5CA 3OO9A 2QL3A 2IA4A 1SYIA 2OWSA 3PPNA 2ONSA 5J1DA 3IX1A 1RDZA 1FW0A 4LN5A 3TELA 3OOAA 4HE0A 3EN3A 4BLAA 4U23A 1IEJA 1S50A 1FTLA 2E1SA 4LONB 2WKYA 3H4ZA 1BKAA 2REGA 5FHNA 1B7HA 5I84A 1ZJLA 4NF6A 1US5A 5JTYB 3ILTB 2ESNA 1EZ9A 3KSJA 3TUSA 4Q8RA 2Q88A 2V93A
chains in the Genus database with same CATH topology
3SDFA 5IAIA 3IO4A 2R6GE 4RJZA 2XX8A 2ZMBA 3B6TA 1NNPA 4E0WA 1IXHA 1N84A 2F5XA 3O29A 3K02A 1A54A 3PU5A 5DTBA 4EXLA 4GVOA 3TMGA 3TTLA 1P1QA 2BJJX 2UVHA 5CMCA 3E9XA 4GRKA 2AL4A 1GR2A 5H8NB 3V8XB 3RN8A 2IEEA 3CFLA 4NMYA 4OENA 1AOVA 3DP4A 4MH5A 3T22A 2VOZA 5B7DA 3GLBA 1B7UA 3M8UA 5A5XB 2V3QA 2AIXA 1LLSA 1ZBMA 2PBWA 2V3TA 1Y3NA 2G29A 4C0RA 1B5IA 4R9FA 4H5GA 1LAHE 4MBPA 2GHAA 5TP9A 4QHQA 2AL5A 1XVYA 4EDPA 2OWTA 3FJGA 1ZKBA 2Q8JA 4C1UA 2PT1A 3O9PA 1IIWA 4F3PA 3O2AA 5EYFA 2PX1A 4P11A 3MVWA 4HCYA 5I59A 5JK4A 4ELQA 1AL3A 1URSA 3LUYA 1FQAA 5ITOA 4DZ1A 4XKQA 4DCYA 4R6HA 3D4GA 1N0TA 4KQPA 1B7ZA 3PGFA 4QSDA 1VR5A 5DVIA 4ONYA 2I48A 1DSNA 4H8IA 3R26A 1B3LA 5CBRA 3KOSA 3FVGA 2HAUA 4YB5A 4ZE9A 2XHDA 4RXLA 2HEUA 2Z8DA 2D5WA 5FTIA 4KCDA 1LFIA 3QUJA 1SW4A 3FV1A 4F1UA 4IO2A 1B52A 4QSEA 2DWIA 4EQBA 3KSXA 3PD9A 1UTBB 2VP1A 1FQDA 4QRZA 1PEBA 3CRBA 4DXBA 4G8HA 3V89B 2X7PA 3RT8A 1N04A 2RC7A 5HM4B 3K1NA 4ZDMA 4HCWA 1UTBA 4BDOA 4N6PA 5TPAB 1YTVA 1B4HA 3SERA 4YMBA 3SETA 4DXCA 1NNKA 3HCQA 1P1WA 3USDA 1R6ZA 1NKXA 2O84X 5JEIA 1D9YA 4JWXA 4OEUA 3K2DA 1UTHB 3MWBA 3CVGA 1CE2A 3GBBA 1FCKA 1FTOA 1FQFA 3IJXB 4X9TA 1OLCA 4DCXA 1UTHA 2H98A 4QSCA 1SDXA 2XXVA 3PV0E 1BIYA 3EHTA 3ZKLA 1NNFA 3PUXE 2QS2A 3TPAA 3W9VA 3TCFA 3IB2A 4GIZA 3MZ1A 5FHOA 2O7UA 3H6TA 3O6GA 2O6AA 4E0XA 3DLNA 1LBCA 4IO3A 3K6WA 3KJ7A 5AA4A 1H43A 2I6EA 1NFTA 2OZZA 3C33A 3IB0A 5FTHA 2F7CA 1OLAA 2I0BA 3R6UA 1MRPA 4XXUA 3N6UA 3LC8A 1LSTA 2I58A 4L17A 5H8FB 3H03A 2DSFA 5H8HA 5ISUA 3M3LA 2GH9A 2XD2A 3TKDA 4R2FA 1FTJA 2I49A 2H4IA 4UA8A 4NF4B 2ZYOA 2Y84A 3H7MA 4F3GA 3RGYA 4NF4A 1FTKA 1O7TA 3OEMA 3P7IA 2XXQA 4IO6A 3IOVA 3GXAA 5KDTA 4YKIA 3WAEA 5DYHA 2ONRA 4ESWA 2F7BA 4NF5A 3MQ9A 1WDNA 1R9QA 3G3HA 2ALUA 3K4UA 4R6YA 2OJTA 3MVYA 4OFJA 3TDJA 5KZTA 1D4NA 1OVBA 3KN8A 5I58B 3DP6A 1R1NA 1SI1A 3MP1A 3A3UA 4G68B 5CM6A 1XHYA 4N07A 4DDDA 3QUFA 2ZYKA 5I2NB 3MAMA 3VVEA 1MY0A 3QSLA 1PB9A 3VXCA 1BTJA 4G68A 2DS9A 4IO4A 4QF9A 5H8QB 2QRYA 4XKRA 1B58A 1LB9A 1D3KA 4U4SA 3SKPA 1LAXA 1XOCA 1JETA 4PP0A 3A3CA 4H1XA 4RK9A 2V3UA 1B05A 1TFAA 2DVZA 4OVJA 4HS7A 4THIA 1Y1MA 4ELRA 3T66A 3TQLA 3B6WA 1MM7A 3EHSA 4JSDA 2F7AA 4RK2A 4M1VA 1ZIUA 1B0HA 2KLFA 4Z0IA 5FHMA 1URGA 3BBRA 5AA2D 2H9BA 4IGTA 1IUDA 4GL8A 2UVIA 2ONKE 3O28A 3Q29A 1VE4A 2QMWA 4QFOA 1H45A 2RF1A 2Z8FA 4NF8A 2Q9TA 3VLUA 2V84A 2ZXTA 1NL5A 1LAFE 2YLNA 1LBBA 2X26A 4JDFA 4F2OA 3VV5A 3VVFA 3KFMA 4NF6B 1Y4TA 3CFZA 1P1NA 1MXXA 4POWA 3RY3A 4UACA 3SEVA 4NE4A 4F3BA 4DLDA 4WKMA 2NOOA 4KI0E 5L9MA 1B51A 1MQHA 1MQIA 1QUJA 4GD5A 2GRVA 4U21A 1QKBA 4YICA 2NWJA 5KCJA 3S9EA 3KOTA 4ZEKA 4BDLA 1B2HA 3C4MA 3IORA 2UXAA 3FXQA 1URDA 4XIGQ 4XTCQ 1NH7A 3UA8A 4ESXA 3FZVA 1A8FA 3N26A 4LQ5A 4N13A 1B3GA 4F19A 4F2QA 1Y3QA 3BFTA 5EHSA 1GTKA 1UIUA 2P0SA 2UYFA 1QUIA 3CFXA 1ZLQA 3TCHA 2CZLA 3H6WA 2XXIA 3BFUA 3ZKKA 4LUBA 4H6DA 1O64A 3Q27A 4IY5A 1QVSA 5CMBA 4QFNA 5TP9B 3QIMA 4QFLA 2NUVA 2QMXA 4ZEDA 5H8SA 3TEPA 3IR1A 4FEBA 2PT2A 5AE4A 2O51A 5I59B 1IXIA 4JSOA 3VLVA 2VHAA 3KBRA 2F35A 2QJEA 1A40A 3DM0A 2VD3A 4O3BA 2DE3A 2XXYA 3PMVA 1KWHA 1A55A 1J1NA 5DEXB 2O1LA 4YB6A 1OVTA 3FIRA 4IO5A 1HSJA 4XKPA 2M8CA 5ELVA 1TWYA 3OD7A 3PPQA 1RYXA 3OEKA 4EF2A 4YKJA 5DEXA 3L6HA 4GL0A 1B4ZA 4F22A 4AQ4A 2B3BA 4NEDA 1MXVA 3OSRA 1N7WA 3CSBA 1MPCA 3PPRA 2DQVA 4BDNA 1QULA 3UK4A 3IOWA 3S2VA 4G68C 3T9UA 3R7XA 3CG1A 4JBZA 4C1TA 1A99A 1JQFA 3U8QA 3A09A 4FAJA 3C32A 3VE1B 3Q28A 1DTGA 3E3KA 3UN6A 4FATA 3MP8A 2DP8A 1EH3A 3RQTA 1JW5A 2DWAA 3TODA 1M5DA 5CBSA 1PB7A 1B5JA 4OZ9A 3GZGA 3G3IA 3C35A 2O69A 1IXCA 4MFIA 1NNTA 4R74A 5I57A 4GQOA 4GF8A 3ECRA 3THIA 3EHUA 2ZYNA 2P1SA 4BDQA 4GOTA 4FECA 1SQYA 4QFKA 1B0LA 1IQ7A 2ABHA 1L5TA 4Q0CA 4H0WA 1B46A 5B70A 3UIFA 2Q2AA 2O7IA 3LBSA 2F34A 3VDFA 1I69A 2UYEA 3C36A 3HV1A 1S9TA 2RC9A 2HZKA 4DXUA 4OFOA 4I9DA 3W9WA 4QFPA 2HFBA 3ONMA 2PMSA 2HAVA 3HHGA 5AA4B 1T0KA 4EUOA 3KN3A 3FASA 5CI5A 3ODBA 1Y4CA 3S9NC 2AYSA 2ZNSA 1TFDA 1LFGA 1OMPA 2XXHA 4ELOA 4OESA 3S4UA 1BLFA 2DWJA 4R9GA 3U92A 3TTMA 5H8HB 2Y7IA 4G8NA 2ZYMA 4F29A 3U1OA 1B40A 1TT1A 3JV9A 5IKBA 5CMMA 2B3FA 1JVYA 3SEUA 1DTZA 4ISUA 3K01A 1P1UA 3I5OA 3S9LC 2RCAA 4U2RA 3BKIB 2Z22A 2Y7KA 1CB6A 5AA2A 1SW2A 2RINA 3OXNA 1OQGA 3Q26A 4LZ5A 3MPKA 3ZSFA 3FVOA 5KDTB 4MLVA 4X1BA 2CMOA 4FE8A 1F9BA 1MDQA 4EXKA 1MPDA 1IXGA 4NF5B 3TAJA 1SI0A 3C9HA 3K00A 1SW1A 3IB1A 3E4RA 3MP6A 4OETA 1M5FA 4F18A 4RYAA 2FYIA 5BUUA 2PVUA 3LSWA 1I6BA 3FJ7A 2FA7A 2F6PA 5CMKA 3IK6B 4OEVA 1US4A 3RLFE 4KCCA 4TOZA 3HN0A 1LGBC 2D3IA 3OSQA 5BWJA 3U93A 5F1QA 1M5EA 4BDMA 1AMFA 4MLQA 1DPEA 3M3FA 3FXRA 3SEXA 4P0GA 1M5BA 5K2XA 3TFLA 4Q5TA 3OO6A 3AXFA 3IAZA 3LSXA 3K6XA 1ZTYA 4IB2A 1N3XA 1HSLA 4KHZE 2DE2A 1Y3PA 4GFRA 2OK2A 1SD3A 2I4CA 4LA9A 4ZEBA 4FEDA 2QSXA 3UORA 1GVCA 3VFJA 1USYH 2X7QA 1B9JA 3UP9A 1ZU0A 5AA3A 1AIVA 2LAOA 3TTRA 2H99A 3MJNA 2Q89A 4RY1A 3H06B 4Z7EA 4PFWA 4H65A 3RT6B 4YAHX 2GFEA 3PUVE 4TQUQ 3EPEA 2A5SA 4KYEA 4PFYA 1FQBA 1Y9UA 2RCBA 3Q25A 4NWDA 3PUYE 4XKNA 5I2KB 1Z7ME 3RTFB 3T93B 3OO8A 3VVDA 3TCGA 1B1HA 3VLWA 4NF8B 3MW0A 1YCJA 1ELJA 5I2KA 1Q35A 1ZMGA 2DWHA 3M3KA 2H5YA 1MY2A 4HTGA 3RPWA 2HCAA 3HSTA 2NXOA 1LCFA 3G7WA 3CI8A 3IO6A 5TU0A 1A8EA 2A5TA 1P99A 2XXUA 3C31A 4LP2B 3OO7A 2P2AA 3C34A 2F6GA 1A7LA 4G77A 4PFUA 3H3GA 1DPPA 5KCJB 3L6GA 4X1DA 2Z8EA 2YPNA 3CR9A 5K2YA 4G4PA 4NWCA 3N6TA 3CG3A 3MBPA 1MXWA 2XXPA 1MM6A 3RUMA 1JEVA 5DVJA 3LSFB 1MQDA 3PMXA 4LVQA 2NVUB 2FNCA 2QPQA 1LCTA 3MC2A 5L9SA 4EQ7A 4JWOA 2VD2A 4G2ZA 1JNFA 2Y7PA 4U22A 5JTYA 4R2BA 3KN7A 4YB7A 4G8MA 2ZNUA 1RKMA 3MPLA 1LAGE 4JWYA 4H5FA 3FJMA 4LATA 4OTEA 4ND9A 3CIJA 4H67A 3VXBA 1PB8A 2G93A 1UQWA 5M2VA 4RA1A 2XXXA 1DOTA 3G3GA 2HXWA 2OLBA 3MUQA 3TTNA 3DP8A 2I4BA 1EU8A 4R73A 4PQJA 4OFLA 4GWOA 3PPOA 1SW5A 2DVCA 1QKAA 3KEIA 4ZEFA 3RNNA 3TTKA 1MDP1 4BDRA 3IL1B 3QYTA 2F97A 4U1OA 4OYVA 4O3AA 3H6VA 1HSEA 4GXAA 5HPQA 3FGSA 5H8NA 4PE5B 1N76A 3HPIA 4GLIA 2XXTA 3I3VA 3MZBA 4RPOA 2UVGA 1DMBA 3OMBA 1SBPA 2F78A 1B1XA 5A5XA 4I62A 3TZAA 2I3VA 4P0IA 2Q2CA 4AB5A 4KFQA 4OWDA 2XX9A 2QS3A 3I6VA 4YKKA 4OXVA 3F11A 4Q30B 1H76A 4R75A 1MS7A 3PMWA 1PBPA 4R72A 3SEWA 1OQHA 4OERA 4PETA 4ZEIA 3U94A 4JXIA 3N94A 3U72A 4M4GA 4KYSA 2XXRA 1QUKA 3FD3A 2XXWA 1QJMA 2YJPA 2I3WA 2DXYA 1NMUA 2W7YA 1N7XA 3FXUA 4POXA 1XT8A 3PPPA 1EZOA 1GGGA 1MY1A 2RC8A 3TQWA 3QAXA 4U1ZA 3HHFA 3B6QA 1WVJA 3JZJA 1MXZA 2Y7RA 3B7DA 1MXYA 4FIMA 5I57B 4DE8A 3JYRA 2D21A 3TYHA 4KPTA 4YZZA 1SYHA 2PYYA 2VGQA 1MH4A 2F36A 4RNSA 3T9XB 4F3SA 5CC2A 1Q1KA 3FVKA 3KJTA 4EF1A 4IO7A 4O3CA 5L8DA 3OENA 2R9JA 1FQEA 4KR5A 1TXFA 4YKPA 3ILUB 2XD3A 4ZECA 1D9VA 2O1MA 3FVNA 5ICQA 4PFTA 1ATGA 4K3FA 3KG2A 3FUZA 4TLLB 3GBAA 5TPAA 1YPNA 1B5HA 2DOJA 3H6UA 1OIBA 2Y7WA 3IOUA 4LZ7A 1ANFA 2OBGA 3PD8A 1PC3A 1B32A 2QS1A 4AB6A 1IITA 3K0VA 1MXUA 4WXJA 4KYDA 1VFEA 3IOTA 4WEDA 4FORA 1BP5A 1MQJA 3PUWE 3UGWA 4I8CA 4WEPA 5ITPA 3KZGA 1POTA 3HO7A 4OMBA 2Z23A 5CRYA 4RPNA 3KGCA 1R9LA 1WODA 2HQ0A 1FTMA 1VFDA 5DT6A 5AA2B 4NTLA 4ZE8A 3FV2A 1II5A 1USYE 1XC1A 2DE4A 2O68A 1O63A 1EZPA 3E13X 1H3DA 2E0SA 1B3EA 2B65A 5HBCA 4F1YA 4F1VA 3V83A 4ECFA 1I6QA 1UIVA 4ZS9A 2UVJA 1MY4A 3O6IA 4U4XA 3MVZA 5H8FA 3V5AA 4F39A 3FATA 2ANJA 4EQ9A 4OHNA 1JW4A 4HW8A 3N5LA 1JW1A 1LB8A 1QW0A 2DXRA 5ICTA 4IY6A 4R6KA 5EHMA 3O66A 4MF3A 5AA1A 4YU0A 3O6HA 1AH5A 3DELB 3EQ1A 2H25A 3G3JA 3S9MC 5F7VA 1MY3A 4KD5A 2R71A 4LZ8A 5L9OA 3WAFA 4ELPA 4I1DA 4ZZEA 1VSOA 1XS5A 5I56B 3RTWB 1IZ1A 2OCUA 1JVXA 5DVFA 2REJA 2V25A 1JEUA 4LQ2A 1PBQA 1XVXA 4ZZAA 1B6HA 3QK6A 5I56A 1SVXB 1FQCA 3O97A 4OQOA 2F8DA 3K1PA 3EF7A 1B3FA 1S7YA 1MPBA 2THIA 3K6UA 3LR1A 1RYOA 1PDAA 3CSGA 1N3WA 5I58A 2DYXA 4DIGA 1H44A 2I0CA 2HZLA 4FJPA 5I2NA 1Z7NE 3OELA 1MQGA 3K6VA 4X48A 4YMAA 2ZNTA 3MVXA 1LFHA 3T9VA 3G3KA 1Y1ZA 1GV8A 5LOMA 5H8QA 3QXMA 3SEYA 1MH3A 4H8JA 1MG1A 4IGRA 4TLMB 4GXSB 3G3FA 3K1MA 3W15C 3IJOB 1NH8A 3SESA 3T96B 2A5TB 2QS4A 3LSLA 3ZS6A 3D4CA 4JB7A 2XX7A 3MZ9A 1B3HA 3T9HB 1POY1 2RKMA 1YAEA 1Y20A 3PUZE 2GHBA 1P1OA 4F31B 1I6AA 1M5CA 3OO9A 2QL3A 2IA4A 1SYIA 2OWSA 3PPNA 2ONSA 5J1DA 3IX1A 1FW0A 3TELA 3OOAA 3EN3A 4BLAA 4U23A 1IEJA 1S50A 1FTLA 2E1SA 4LONB 2WKYA 3H4ZA 1BKAA 2REGA 5FHNA 1B7HA 5I84A 1ZJLA 4NF6A 1US5A 5JTYB 3ILTB 2ESNA 1EZ9A 3KSJA 3TUSA 4Q8RA 2Q88A 2V93A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SDF A;  5IAI A;  3IO4 A;  2R6G E;  4RJZ A;  2XX8 A;  2ZMB A;  3B6T A;  1NNP A;  4E0W A;  1IXH A;  1N84 A;  2F5X A;  3O29 A;  3K02 A;  1A54 A;  3PU5 A;  5DTB A;  4EXL A;  4GVO A;  3TMG A;  3TTL A;  1P1Q A;  2BJJ X;  2UVH A;  5CMC A;  3E9X A;  4GRK A;  2AL4 A;  1GR2 A;  5H8N B;  3V8X B;  3RN8 A;  2IEE A;  3CFL A;  4NMY A;  4OEN A;  1AOV A;  3DP4 A;  4MH5 A;  3T22 A;  2VOZ A;  5B7D A;  3GLB A;  1B7U A;  3M8U A;  5A5X B;  2V3Q A;  2AIX A;  1LLS A;  1ZBM A;  2PBW A;  2V3T A;  1Y3N A;  2G29 A;  4C0R A;  1B5I A;  4R9F A;  4H5G A;  1LAH E;  4MBP A;  2GHA A;  5TP9 A;  4QHQ A;  2AL5 A;  1XVY A;  4EDP A;  2OWT A;  3FJG A;  1ZKB A;  2Q8J A;  4C1U A;  2PT1 A;  3O9P A;  1IIW A;  4F3P A;  3O2A A;  5EYF A;  2PX1 A;  4P11 A;  3MVW A;  4HCY A;  5I59 A;  5JK4 A;  4ELQ A;  1AL3 A;  1URS A;  3LUY A;  1FQA A;  5ITO A;  4DZ1 A;  4XKQ A;  4DCY A;  4R6H A;  3D4G A;  1N0T A;  4KQP A;  1B7Z A;  3PGF A;  4QSD A;  1VR5 A;  5DVI A;  4ONY A;  2I48 A;  1DSN A;  4H8I A;  3R26 A;  1B3L A;  5CBR A;  3KOS A;  3FVG A;  2HAU A;  4YB5 A;  4ZE9 A;  2XHD A;  4RXL A;  2HEU A;  2Z8D A;  2D5W A;  5FTI A;  4KCD A;  1LFI A;  3QUJ A;  1SW4 A;  3FV1 A;  4F1U A;  4IO2 A;  1B52 A;  4QSE A;  2DWI A;  4EQB A;  3KSX A;  3PD9 A;  1UTB B;  2VP1 A;  1FQD A;  4QRZ A;  1PEB A;  3CRB A;  4DXB A;  4G8H A;  3V89 B;  2X7P A;  3RT8 A;  1N04 A;  2RC7 A;  5HM4 B;  3K1N A;  4ZDM A;  4HCW A;  1UTB A;  4BDO A;  4N6P A;  5TPA B;  1YTV A;  1B4H A;  3SER A;  4YMB A;  3SET A;  4DXC A;  1NNK A;  3HCQ A;  1P1W A;  3USD A;  1R6Z A;  1NKX A;  2O84 X;  5JEI A;  1D9Y A;  4JWX A;  4OEU A;  3K2D A;  1UTH B;  3MWB A;  3CVG A;  1CE2 A;  3GBB A;  1FCK A;  1FTO A;  1FQF A;  3IJX B;  4X9T A;  1OLC A;  4DCX A;  1UTH A;  2H98 A;  4QSC A;  1SDX A;  2XXV A;  3PV0 E;  1BIY A;  3EHT A;  3ZKL A;  1NNF A;  3PUX E;  2QS2 A;  3TPA A;  3W9V A;  3TCF A;  3IB2 A;  4GIZ A;  3MZ1 A;  5FHO A;  2O7U A;  3H6T A;  3O6G A;  2O6A A;  4E0X A;  3DLN A;  1LBC A;  4IO3 A;  3K6W A;  3KJ7 A;  5AA4 A;  1H43 A;  2I6E A;  1NFT A;  2OZZ A;  3C33 A;  3IB0 A;  5FTH A;  2F7C A;  1OLA A;  2I0B A;  3R6U A;  1MRP A;  4XXU A;  3N6U A;  3LC8 A;  1LST A;  2I58 A;  4L17 A;  5H8F B;  3H03 A;  2DSF A;  5H8H A;  5ISU A;  3M3L A;  2GH9 A;  2XD2 A;  3TKD A;  4R2F A;  1FTJ A;  2I49 A;  2H4I A;  4UA8 A;  4NF4 B;  2ZYO A;  2Y84 A;  3H7M A;  4F3G A;  3RGY A;  4NF4 A;  1FTK A;  1O7T A;  3OEM A;  3P7I A;  2XXQ A;  4IO6 A;  3IOV A;  3GXA A;  5KDT A;  4YKI A;  3WAE A;  5DYH A;  2ONR A;  4ESW A;  2F7B A;  4NF5 A;  3MQ9 A;  1WDN A;  1R9Q A;  3G3H A;  2ALU A;  3K4U A;  4R6Y A;  2OJT A;  3MVY A;  4OFJ A;  3TDJ A;  5KZT A;  1D4N A;  1OVB A;  3KN8 A;  5I58 B;  3DP6 A;  1R1N A;  1SI1 A;  3MP1 A;  3A3U A;  4G68 B;  5CM6 A;  1XHY A;  4N07 A;  4DDD A;  3QUF A;  2ZYK A;  5I2N B;  3MAM A;  3VVE A;  1MY0 A;  3QSL A;  1PB9 A;  3VXC A;  1BTJ A;  4G68 A;  2DS9 A;  4IO4 A;  4QF9 A;  5H8Q B;  2QRY A;  4XKR A;  1B58 A;  1LB9 A;  1D3K A;  4U4S A;  3SKP A;  1LAX A;  1XOC A;  1JET A;  4PP0 A;  3A3C A;  4H1X A;  4RK9 A;  2V3U A;  1B05 A;  1TFA A;  2DVZ A;  4OVJ A;  4HS7 A;  4THI A;  1Y1M A;  4ELR A;  3T66 A;  3TQL A;  3B6W A;  1MM7 A;  3EHS A;  4JSD A;  2F7A A;  4RK2 A;  4M1V A;  1ZIU A;  1B0H A;  2KLF A;  4Z0I A;  5FHM A;  1URG A;  3BBR A;  5AA2 D;  2H9B A;  4IGT A;  1IUD A;  4GL8 A;  2UVI A;  2ONK E;  3O28 A;  3Q29 A;  1VE4 A;  2QMW A;  4QFO A;  1H45 A;  2RF1 A;  2Z8F A;  4NF8 A;  2Q9T A;  3VLU A;  2V84 A;  2ZXT A;  1NL5 A;  1LAF E;  2YLN A;  1LBB A;  2X26 A;  4JDF A;  4F2O A;  3VV5 A;  3VVF A;  3KFM A;  4NF6 B;  1Y4T A;  3CFZ A;  1P1N A;  1MXX A;  4POW A;  3RY3 A;  4UAC A;  3SEV A;  4NE4 A;  4F3B A;  4DLD A;  4WKM A;  2NOO A;  4KI0 E;  5L9M A;  1B51 A;  1MQH A;  1MQI A;  1QUJ A;  4GD5 A;  2GRV A;  4U21 A;  1QKB A;  4YIC A;  2NWJ A;  5KCJ A;  3S9E A;  3KOT A;  4ZEK A;  4BDL A;  1B2H A;  3C4M A;  3IOR A;  2UXA A;  3FXQ A;  1URD A;  4XIG Q;  4XTC Q;  1NH7 A;  3UA8 A;  4ESX A;  3FZV A;  1A8F A;  3N26 A;  4LQ5 A;  4N13 A;  1B3G A;  4F19 A;  4F2Q A;  1Y3Q A;  3BFT A;  5EHS A;  1GTK A;  1UIU A;  2P0S A;  2UYF A;  1QUI A;  3CFX A;  1ZLQ A;  3TCH A;  2CZL A;  3H6W A;  2XXI A;  3BFU A;  3ZKK A;  4LUB A;  4H6D A;  1O64 A;  3Q27 A;  4IY5 A;  1QVS A;  5CMB A;  4QFN A;  5TP9 B;  3QIM A;  4QFL A;  2NUV A;  2QMX A;  4ZED A;  5H8S A;  3TEP A;  3IR1 A;  4FEB A;  2PT2 A;  5AE4 A;  2O51 A;  5I59 B;  1IXI A;  4JSO A;  3VLV A;  2VHA A;  3KBR A;  2F35 A;  2QJE A;  1A40 A;  3DM0 A;  2VD3 A;  4O3B A;  2DE3 A;  2XXY A;  3PMV A;  1KWH A;  1A55 A;  1J1N A;  5DEX B;  2O1L A;  4YB6 A;  1OVT A;  3FIR A;  4IO5 A;  1HSJ A;  4XKP A;  2M8C A;  5ELV A;  1TWY A;  3OD7 A;  3PPQ A;  1RYX A;  3OEK A;  4EF2 A;  4YKJ A;  5DEX A;  3L6H A;  4GL0 A;  1B4Z A;  4F22 A;  4AQ4 A;  2B3B A;  4NED A;  1MXV A;  3OSR A;  1N7W A;  3CSB A;  1MPC A;  3PPR A;  2DQV A;  4BDN A;  1QUL A;  3UK4 A;  3IOW A;  3S2V A;  4G68 C;  3T9U A;  3R7X A;  3CG1 A;  4JBZ A;  4C1T A;  1A99 A;  1JQF A;  3U8Q A;  3A09 A;  4FAJ A;  3C32 A;  3VE1 B;  3Q28 A;  1DTG A;  3E3K A;  3UN6 A;  4FAT A;  3MP8 A;  2DP8 A;  1EH3 A;  3RQT A;  1JW5 A;  2DWA A;  3TOD A;  1M5D A;  5CBS A;  1PB7 A;  1B5J A;  4OZ9 A;  3GZG A;  3G3I A;  3C35 A;  2O69 A;  1IXC A;  4MFI A;  1NNT A;  4R74 A;  5I57 A;  4GQO A;  4GF8 A;  3ECR A;  3THI A;  3EHU A;  2ZYN A;  2P1S A;  4BDQ A;  4GOT A;  4FEC A;  1SQY A;  4QFK A;  1B0L A;  1IQ7 A;  2ABH A;  1L5T A;  4Q0C A;  4H0W A;  1B46 A;  5B70 A;  3UIF A;  2Q2A A;  2O7I A;  3LBS A;  2F34 A;  3VDF A;  1I69 A;  2UYE A;  3C36 A;  3HV1 A;  1S9T A;  2RC9 A;  2HZK A;  4DXU A;  4OFO A;  4I9D A;  3W9W A;  4QFP A;  2HFB A;  3ONM A;  2PMS A;  2HAV A;  3HHG A;  5AA4 B;  1T0K A;  4EUO A;  3KN3 A;  3FAS A;  5CI5 A;  3ODB A;  1Y4C A;  3S9N C;  2AYS A;  2ZNS A;  1TFD A;  1LFG A;  1OMP A;  2XXH A;  4ELO A;  4OES A;  3S4U A;  1BLF A;  2DWJ A;  4R9G A;  3U92 A;  3TTM A;  5H8H B;  2Y7I A;  4G8N A;  2ZYM A;  4F29 A;  3U1O A;  1B40 A;  1TT1 A;  3JV9 A;  5IKB A;  5CMM A;  2B3F A;  1JVY A;  3SEU A;  1DTZ A;  4ISU A;  3K01 A;  1P1U A;  3I5O A;  3S9L C;  2RCA A;  4U2R A;  3BKI B;  2Z22 A;  2Y7K A;  1CB6 A;  5AA2 A;  1SW2 A;  2RIN A;  3OXN A;  1OQG A;  3Q26 A;  4LZ5 A;  3MPK A;  3ZSF A;  3FVO A;  5KDT B;  4MLV A;  4X1B A;  2CMO A;  4FE8 A;  1F9B A;  1MDQ A;  4EXK A;  1MPD A;  1IXG A;  4NF5 B;  3TAJ A;  1SI0 A;  3C9H A;  3K00 A;  1SW1 A;  3IB1 A;  3E4R A;  3MP6 A;  4OET A;  1M5F A;  4F18 A;  4RYA A;  2FYI A;  5BUU A;  2PVU A;  3LSW A;  1I6B A;  3FJ7 A;  2FA7 A;  2F6P A;  5CMK A;  3IK6 B;  4OEV A;  1US4 A;  3RLF E;  4KCC A;  4TOZ A;  3HN0 A;  1LGB C;  2D3I A;  3OSQ A;  5BWJ A;  3U93 A;  5F1Q A;  1M5E A;  4BDM A;  1AMF A;  4MLQ A;  1DPE A;  3M3F A;  3FXR A;  3SEX A;  4P0G A;  1M5B A;  5K2X A;  3TFL A;  4Q5T A;  3OO6 A;  3AXF A;  3IAZ A;  3LSX A;  3K6X A;  1ZTY A;  4IB2 A;  1N3X A;  1HSL A;  4KHZ E;  2DE2 A;  1Y3P A;  4GFR A;  2OK2 A;  1SD3 A;  2I4C A;  4LA9 A;  4ZEB A;  4FED A;  2QSX A;  3UOR A;  1GVC A;  3VFJ A;  1USY H;  2X7Q A;  1B9J A;  3UP9 A;  1ZU0 A;  5AA3 A;  1AIV A;  2LAO A;  3TTR A;  2H99 A;  3MJN A;  2Q89 A;  4RY1 A;  3H06 B;  4Z7E A;  4PFW A;  4H65 A;  3RT6 B;  4YAH X;  2GFE A;  3PUV E;  4TQU Q;  3EPE A;  2A5S A;  4KYE A;  4PFY A;  1FQB A;  1Y9U A;  2RCB A;  3Q25 A;  4NWD A;  3PUY E;  4XKN A;  5I2K B;  1Z7M E;  3RTF B;  3T93 B;  3OO8 A;  3VVD A;  3TCG A;  1B1H A;  3VLW A;  4NF8 B;  3MW0 A;  1YCJ A;  1ELJ A;  5I2K A;  1Q35 A;  1ZMG A;  2DWH A;  3M3K A;  2H5Y A;  1MY2 A;  4HTG A;  3RPW A;  2HCA A;  3HST A;  2NXO A;  1LCF A;  3G7W A;  3CI8 A;  3IO6 A;  5TU0 A;  1A8E A;  2A5T A;  1P99 A;  2XXU A;  3C31 A;  4LP2 B;  3OO7 A;  2P2A A;  3C34 A;  2F6G A;  1A7L A;  4G77 A;  4PFU A;  3H3G A;  1DPP A;  5KCJ B;  3L6G A;  4X1D A;  2Z8E A;  2YPN A;  3CR9 A;  5K2Y A;  4G4P A;  4NWC A;  3N6T A;  3CG3 A;  3MBP A;  1MXW A;  2XXP A;  1MM6 A;  3RUM A;  1JEV A;  5DVJ A;  3LSF B;  1MQD A;  3PMX A;  4LVQ A;  2NVU B;  2FNC A;  2QPQ A;  1LCT A;  3MC2 A;  5L9S A;  4EQ7 A;  4JWO A;  2VD2 A;  4G2Z A;  1JNF A;  2Y7P A;  4U22 A;  5JTY A;  4R2B A;  3KN7 A;  4YB7 A;  4G8M A;  2ZNU A;  1RKM A;  3MPL A;  1LAG E;  4JWY A;  4H5F A;  3FJM A;  4LAT A;  4OTE A;  4ND9 A;  3CIJ A;  4H67 A;  3VXB A;  1PB8 A;  2G93 A;  1UQW A;  5M2V A;  4RA1 A;  2XXX A;  1DOT A;  3G3G A;  2HXW A;  2OLB A;  3MUQ A;  3TTN A;  3DP8 A;  2I4B A;  1EU8 A;  4R73 A;  4PQJ A;  4OFL A;  4GWO A;  3PPO A;  1SW5 A;  2DVC A;  1QKA A;  3KEI A;  4ZEF A;  3RNN A;  3TTK A;  1MDP 1;  4BDR A;  3IL1 B;  3QYT A;  2F97 A;  4U1O A;  4OYV A;  4O3A A;  3H6V A;  1HSE A;  4GXA A;  5HPQ A;  3FGS A;  5H8N A;  4PE5 B;  1N76 A;  3HPI A;  4GLI A;  2XXT A;  3I3V A;  3MZB A;  4RPO A;  2UVG A;  1DMB A;  3OMB A;  1SBP A;  2F78 A;  1B1X A;  5A5X A;  4I62 A;  3TZA A;  2I3V A;  4P0I A;  2Q2C A;  4AB5 A;  4KFQ A;  4OWD A;  2XX9 A;  2QS3 A;  3I6V A;  4YKK A;  4OXV A;  3F11 A;  4Q30 B;  1H76 A;  4R75 A;  1MS7 A;  3PMW A;  1PBP A;  4R72 A;  3SEW A;  1OQH A;  4OER A;  4PET A;  4ZEI A;  3U94 A;  4JXI A;  3N94 A;  3U72 A;  4M4G A;  4KYS A;  2XXR A;  1QUK A;  3FD3 A;  2XXW A;  1QJM A;  2YJP A;  2I3W A;  2DXY A;  1NMU A;  2W7Y A;  1N7X A;  3FXU A;  4POX A;  1XT8 A;  3PPP A;  1EZO A;  1GGG A;  1MY1 A;  2RC8 A;  3TQW A;  3QAX A;  4U1Z A;  3HHF A;  3B6Q A;  1WVJ A;  3JZJ A;  1MXZ A;  2Y7R A;  3B7D A;  1MXY A;  4FIM A;  5I57 B;  4DE8 A;  3JYR A;  2D21 A;  3TYH A;  4KPT A;  4YZZ A;  1SYH A;  2PYY A;  2VGQ A;  1MH4 A;  2F36 A;  4RNS A;  3T9X B;  4F3S A;  5CC2 A;  1Q1K A;  3FVK A;  3KJT A;  4EF1 A;  4IO7 A;  4O3C A;  5L8D A;  3OEN A;  2R9J A;  1FQE A;  4KR5 A;  1TXF A;  4YKP A;  3ILU B;  2XD3 A;  4ZEC A;  1D9V A;  2O1M A;  3FVN A;  5ICQ A;  4PFT A;  1ATG A;  4K3F A;  3KG2 A;  3FUZ A;  4TLL B;  3GBA A;  5TPA A;  1YPN A;  1B5H A;  2DOJ A;  3H6U A;  1OIB A;  2Y7W A;  3IOU A;  4LZ7 A;  1ANF A;  2OBG A;  3PD8 A;  1PC3 A;  1B32 A;  2QS1 A;  4AB6 A;  1IIT A;  3K0V A;  1MXU A;  4WXJ A;  4KYD A;  1VFE A;  3IOT A;  4WED A;  4FOR A;  1BP5 A;  1MQJ A;  3PUW E;  3UGW A;  4I8C A;  4WEP A;  5ITP A;  3KZG A;  1POT A;  3HO7 A;  4OMB A;  2Z23 A;  5CRY A;  4RPN A;  3KGC A;  1R9L A;  1WOD A;  2HQ0 A;  1FTM A;  1VFD A;  5DT6 A;  5AA2 B;  4NTL A;  4ZE8 A;  3FV2 A;  1II5 A;  1USY E;  1XC1 A;  2DE4 A;  2O68 A;  1O63 A;  1EZP A;  3E13 X;  1H3D A;  2E0S A;  1B3E A;  2B65 A;  5HBC A;  4F1Y A;  4F1V A;  3V83 A;  4ECF A;  1I6Q A;  1UIV A;  4ZS9 A;  2UVJ A;  1MY4 A;  3O6I A;  4U4X A;  3MVZ A;  5H8F A;  3V5A A;  4F39 A;  3FAT A;  2ANJ A;  4EQ9 A;  4OHN A;  1JW4 A;  4HW8 A;  3N5L A;  1JW1 A;  1LB8 A;  1QW0 A;  2DXR A;  5ICT A;  4IY6 A;  4R6K A;  5EHM A;  3O66 A;  4MF3 A;  5AA1 A;  4YU0 A;  3O6H A;  1AH5 A;  3DEL B;  3EQ1 A;  2H25 A;  3G3J A;  3S9M C;  5F7V A;  1MY3 A;  4KD5 A;  2R71 A;  4LZ8 A;  5L9O A;  3WAF A;  4ELP A;  4I1D A;  4ZZE A;  1VSO A;  1XS5 A;  5I56 B;  3RTW B;  1IZ1 A;  2OCU A;  1JVX A;  5DVF A;  2REJ A;  2V25 A;  1JEU A;  4LQ2 A;  1PBQ A;  1XVX A;  4ZZA A;  1B6H A;  3QK6 A;  5I56 A;  1SVX B;  1FQC A;  3O97 A;  4OQO A;  2F8D A;  3K1P A;  3EF7 A;  1B3F A;  1S7Y A;  1MPB A;  2THI A;  3K6U A;  3LR1 A;  1RYO A;  1PDA A;  3CSG A;  1N3W A;  5I58 A;  2DYX A;  4DIG A;  1H44 A;  2I0C A;  2HZL A;  4FJP A;  5I2N A;  1Z7N E;  3OEL A;  1MQG A;  3K6V A;  4X48 A;  4YMA A;  2ZNT A;  3MVX A;  1LFH A;  3T9V A;  3G3K A;  1Y1Z A;  1GV8 A;  5LOM A;  5H8Q A;  3QXM A;  3SEY A;  1MH3 A;  4H8J A;  1MG1 A;  4IGR A;  4TLM B;  4GXS B;  3G3F A;  3K1M A;  3W15 C;  3IJO B;  1NH8 A;  3SES A;  3T96 B;  2A5T B;  2QS4 A;  3LSL A;  3ZS6 A;  3D4C A;  4JB7 A;  2XX7 A;  3MZ9 A;  1B3H A;  3T9H B;  1POY 1;  2RKM A;  1YAE A;  1Y20 A;  3PUZ E;  2GHB A;  1P1O A;  4F31 B;  1I6A A;  1M5C A;  3OO9 A;  2QL3 A;  2IA4 A;  1SYI A;  2OWS A;  3PPN A;  2ONS A;  5J1D A;  3IX1 A;  1FW0 A;  3TEL A;  3OOA A;  3EN3 A;  4BLA A;  4U23 A;  1IEJ A;  1S50 A;  1FTL A;  2E1S A;  4LON B;  2WKY A;  3H4Z A;  1BKA A;  2REG A;  5FHN A;  1B7H A;  5I84 A;  1ZJL A;  4NF6 A;  1US5 A;  5JTY B;  3ILT B;  2ESN A;  1EZ9 A;  3KSJ A;  3TUS A;  4Q8R A;  2Q88 A;  2V93 A; 
#chains in the Genus database with same CATH topology
 3SDF A;  5IAI A;  2B4L A;  3IO4 A;  3IFA A;  2R6G E;  4RJZ A;  2XX8 A;  2ZMB A;  3B6T A;  1NNP A;  4E0W A;  1IXH A;  1N84 A;  2F5X A;  3O29 A;  3K02 A;  1A54 A;  3PU5 A;  5DTB A;  4EXL A;  4GVO A;  3TMG A;  3TTL A;  1P1Q A;  2BJJ X;  2UVH A;  5CMC A;  3E9X A;  4GRK A;  4PAK A;  2AL4 A;  4P9K A;  1GR2 A;  5H8N B;  4AS4 A;  1LBZ A;  3V8X B;  3RN8 A;  2IEE A;  3CFL A;  4NMY A;  4OEN A;  1AOV A;  3DP4 A;  4MH5 A;  2FIX A;  4OA4 A;  3T22 A;  2VOZ A;  5B7D A;  3GLB A;  1B7U A;  5I7I A;  1CNQ A;  3M8U A;  5A5X B;  2V3Q A;  2AIX A;  1LLS A;  1ZBM A;  2PBW A;  2V3T A;  1Y3N A;  2G29 A;  1KA1 A;  4C0R A;  1B5I A;  4R9F A;  4H5G A;  1LAH E;  4MBP A;  2GHA A;  5TP9 A;  4QHQ A;  2AL5 A;  1XVY A;  1LBY A;  4EDP A;  2OWT A;  3FJG A;  1ZKB A;  2Q8J A;  4C1U A;  2PT1 A;  3O9P A;  1IIW A;  4XFE A;  4F3P A;  3O2A A;  1LBW A;  5EYF A;  2PX1 A;  4P11 A;  3MVW A;  4HCY A;  5I59 A;  5JK4 A;  4ELQ A;  3U65 A;  4PC9 A;  4PGP A;  5ET5 A;  1AL3 A;  1URS A;  3LUY A;  1FQA A;  5ITO A;  4DZ1 A;  3GYY A;  4XKQ A;  1NUZ A;  4DCY A;  4R6H A;  3D4G A;  1N0T A;  4KQP A;  1B7Z A;  3PGF A;  4QSD A;  4MMP A;  1VR5 A;  5DVI A;  4ONY A;  2I48 A;  1DSN A;  4H8I A;  3R26 A;  4N81 A;  1B3L A;  2CZI A;  4PGN A;  5CBR A;  3KOS A;  3FVG A;  3KC1 A;  3E79 A;  2HAU A;  4YB5 A;  4ZE9 A;  2XHD A;  4JVD A;  4RXL A;  2HEU A;  2Z8D A;  2OWZ A;  2D5W A;  5FTI A;  4KCD A;  5IZZ A;  1LFI A;  3QUJ A;  1SW4 A;  3FV1 A;  1NV7 A;  4F1U A;  4IO2 A;  1B52 A;  4QSE A;  2DWI A;  4EQB A;  3KSX A;  3PD9 A;  1UTB B;  2VP1 A;  1FQD A;  4QRZ A;  1PEB A;  3CRB A;  4DXB A;  4G8H A;  3V89 B;  2X7P A;  3RT8 A;  1N04 A;  2RC7 A;  3QMF A;  4MCO A;  5HM4 B;  5IM2 A;  3K1N A;  2L5V A;  4ZDM A;  4NN3 A;  4HCW A;  1UTB A;  4BDO A;  4GX4 A;  4N6P A;  5TPA B;  1YTV A;  1B4H A;  3HFU A;  3SER A;  4YMB A;  1DK4 A;  3SET A;  4DXC A;  1NNK A;  3HCQ A;  1P1W A;  3USD A;  1R6Z A;  1FPI A;  1NKX A;  2O84 X;  5JEI A;  4H46 A;  2ZZV A;  1D9Y A;  4JWX A;  1BK4 A;  4OEU A;  3K2D A;  1UTH B;  3MWB A;  3CVG A;  1CE2 A;  3GBB A;  1FCK A;  1FTO A;  1FQF A;  3IJX B;  4X9T A;  2GQ1 A;  1OLC A;  4DCX A;  1NUW A;  2OX3 A;  1UTH A;  2H98 A;  4QSC A;  1SDX A;  2ZZW A;  5ET7 A;  3PV0 E;  2XXV A;  1BIY A;  3EHT A;  3ZKL A;  1NNF A;  3PUX E;  2QS2 A;  3TPA A;  3MYU A;  3W9V A;  3TCF A;  3IB2 A;  4PBH A;  4GIZ A;  3MZ1 A;  4PF6 A;  2WBD A;  5FHO A;  2O7U A;  3H6T A;  1FJ9 A;  1NV5 A;  3O6G A;  2O6A A;  4E0X A;  3DLN A;  3LV0 A;  1LBC A;  4IO3 A;  3K6W A;  3KJ7 A;  5AA4 A;  1H43 A;  2I6E A;  1FBG A;  1NFT A;  1IME A;  2OZZ A;  3C33 A;  3IB0 A;  5FTH A;  2F7C A;  1OLA A;  2I0B A;  3R6U A;  1MRP A;  4XXU A;  4PE3 A;  4OVR A;  3N6U A;  3LC8 A;  1LST A;  2I58 A;  4L17 A;  5H8F B;  3H03 A;  1IMC A;  2DSF A;  5H8H A;  5ISU A;  3M3L A;  2GH9 A;  2XD2 A;  3TKD A;  4R2F A;  1FPD A;  1FTJ A;  2DDK A;  2I49 A;  2H4I A;  5ESY A;  4UA8 A;  4NF4 B;  2ZYO A;  2Y84 A;  4QXD A;  3H7M A;  4F3G A;  5IGA A;  4HE2 A;  1KZ8 A;  3RGY A;  4NF4 A;  4MAG A;  1FTK A;  4P56 A;  1O7T A;  3OEM A;  4NF0 A;  3P7I A;  2XXQ A;  4IO6 A;  3IOV A;  3GXA A;  5KDT A;  4I3E A;  4YKI A;  3WAE A;  5DYH A;  1G0I A;  2ONR A;  4ESW A;  1FBE A;  4NGU A;  2F7B A;  4NF5 A;  3MQ9 A;  1WDN A;  5EYG A;  1R9Q A;  4HE1 A;  3G3H A;  2ALU A;  3K4U A;  2HHM A;  2HPG A;  4R6Y A;  2OJT A;  3MVY A;  4OFJ A;  3TDJ A;  5KZT A;  1D4N A;  1OVB A;  3KN8 A;  5I58 B;  3DP6 A;  1R1N A;  1FBP A;  1SI1 A;  3MP1 A;  3A3U A;  4GBW A;  4G68 B;  5CM6 A;  1XHY A;  4N07 A;  4DDD A;  3QUF A;  2ZYK A;  5I2N B;  3MAM A;  4OVS A;  3VVE A;  1MY0 A;  3QSL A;  1PB9 A;  3VXC A;  1BTJ A;  4PCD A;  4G68 A;  4O7M A;  4O94 A;  2DS9 A;  4IO4 A;  4QF9 A;  5H8Q B;  2QRY A;  4XKR A;  1B58 A;  1LB9 A;  1D3K A;  4U4S A;  3SKP A;  1LAX A;  1INP A;  1XOC A;  1JET A;  4PP0 A;  2R8T A;  3A3C A;  4H1X A;  4RK9 A;  2V3U A;  1B05 A;  1TFA A;  2DVZ A;  2FVZ A;  4IR8 A;  4OVJ A;  3B50 A;  4HS7 A;  4THI A;  3BIH A;  3CHG A;  1Y1M A;  1IMA A;  4ELR A;  3T66 A;  2XWI A;  3TQL A;  3B6W A;  1MM7 A;  3EHS A;  4JSD A;  4GWY A;  2F7A A;  4RK2 A;  4M1V A;  1ZIU A;  1B0H A;  2KLF A;  4Z0I A;  5FHM A;  1URG A;  3BBR A;  5AA2 D;  2H9B A;  4IGT A;  5LDZ A;  1IUD A;  4GL8 A;  4MEV A;  2UVI A;  1FPK A;  2ONK E;  3O28 A;  3Q29 A;  1VE4 A;  2QMW A;  4GWZ A;  4QFO A;  1H45 A;  2RF1 A;  2Z8F A;  4NF8 A;  2Q9T A;  3VLU A;  2V84 A;  2ZXT A;  1NL5 A;  1LAF E;  2YLN A;  5I5P A;  1LBB A;  2X26 A;  4JDF A;  4F2O A;  3VV5 A;  3VVF A;  2QFL A;  1VDW A;  3KFM A;  4NF6 B;  4PDH A;  1Y4T A;  3PTY A;  4I3Y A;  3CFZ A;  2QVU A;  1P1N A;  1MXX A;  4POW A;  1YXI A;  3RY3 A;  4UAC A;  3SEV A;  4NE4 A;  4F3B A;  4DLD A;  4WKM A;  2NOO A;  4KI0 E;  5L9M A;  1B51 A;  1MQH A;  1MQI A;  1QUJ A;  1IMB A;  4GD5 A;  2GRV A;  4U21 A;  1QKB A;  2KQZ A;  4YIC A;  4QBA A;  2NWJ A;  5KCJ A;  3S9E A;  3E78 A;  3KOT A;  4ZEK A;  4BDL A;  1B2H A;  3C4M A;  3IOR A;  2UXA A;  3FXQ A;  1URD A;  4XIG Q;  4XTC Q;  1NH7 A;  3RYD A;  3UA8 A;  3MST A;  4ESX A;  3FZV A;  1A8F A;  3N26 A;  4LQ5 A;  4GWW A;  4DI3 D;  4N13 A;  1B3G A;  4F19 A;  4GWU A;  4F2Q A;  1Y3Q A;  3BFT A;  5EHS A;  1GTK A;  1UIU A;  4X04 A;  2P0S A;  2UYF A;  1QUI A;  3CFX A;  1ZLQ A;  3TCH A;  2CZL A;  3H6W A;  2XXI A;  3BFU A;  3ZKK A;  4LUB A;  4H6D A;  1O64 A;  3Q27 A;  4IY5 A;  5IZ1 A;  1QVS A;  5CMB A;  4QFN A;  5TP9 B;  3QIM A;  4QFL A;  2NUV A;  2QMX A;  4ZED A;  5H8S A;  3TEP A;  3IR1 A;  4FEB A;  2PT2 A;  3KBZ A;  5AE4 A;  2O51 A;  2CZH A;  5I59 B;  4N8Y A;  1IXI A;  4JSO A;  3VLV A;  2VHA A;  3KBR A;  2F35 A;  2QJE A;  5EQ9 A;  4UAB A;  1A40 A;  3DM0 A;  2VD3 A;  4O3B A;  5LTC A;  2DE3 A;  2XXY A;  3PMV A;  1KWH A;  1A55 A;  1J1N A;  1FBF A;  5DEX B;  2O1L A;  4YB6 A;  1OVT A;  3FIR A;  4IO5 A;  1HSJ A;  4XKP A;  2M8C A;  4N91 A;  5ELV A;  1TWY A;  1FSA A;  3OD7 A;  3PPQ A;  1RYX A;  3OEK A;  4EF2 A;  4YKJ A;  5DEX A;  3SZP A;  3ISP A;  3L6H A;  4GL0 A;  1B4Z A;  4F22 A;  4AQ4 A;  2B3B A;  4NED A;  1MXV A;  3OSR A;  1N7W A;  3CSB A;  1MPC A;  3PPR A;  2DQV A;  4BDN A;  1QUL A;  3UK4 A;  1NV0 A;  3IOW A;  3S2V A;  4G68 C;  3T9U A;  3R7X A;  3CG1 A;  4AS5 A;  4JBZ A;  4C1T A;  1A99 A;  1JQF A;  3U8Q A;  3A09 A;  4FAJ A;  4PDD A;  3C32 A;  2B4M A;  3VE1 B;  3Q28 A;  1DTG A;  2MKZ A;  3E3K A;  3EKI A;  3UN6 A;  4FAT A;  3MP8 A;  4PBQ A;  2DP8 A;  1EH3 A;  3RQT A;  1JW5 A;  2DWA A;  3TOD A;  1M5D A;  3FBP A;  5CBS A;  3FXB A;  1PB7 A;  1B5J A;  4I40 A;  4OZ9 A;  3GZG A;  3G3I A;  3C35 A;  2O69 A;  1IXC A;  4MFI A;  1NNT A;  4R74 A;  5I57 A;  2VPN A;  4N6D A;  2ZZX A;  4GQO A;  4GF8 A;  2WX9 A;  3ECR A;  3THI A;  4PTK A;  3EHU A;  2ZYN A;  1EYI A;  2P1S A;  4BDQ A;  4GOT A;  4FEC A;  1SQY A;  1IMD A;  4QFK A;  1B0L A;  3T0J A;  4PFR A;  1IQ7 A;  2JJK A;  2ABH A;  1L5T A;  4Q0C A;  4H0W A;  1B46 A;  5B70 A;  3UIF A;  2Q2A A;  2O7I A;  3LBS A;  2F34 A;  1FBD A;  3VDF A;  1I69 A;  2Y5L A;  2UYE A;  3C36 A;  3HV1 A;  1S9T A;  2RC9 A;  2HZK A;  2F3D A;  5IZ3 A;  2HXR A;  4DXU A;  4OFO A;  4I9D A;  3W9W A;  4QFP A;  2HFB A;  3ONM A;  2PMS A;  2HAV A;  3HHG A;  5AA4 B;  1T0K A;  4EUO A;  3KN3 A;  3FAS A;  5CI5 A;  3ODB A;  1Y4C A;  3S9N C;  1NV3 A;  2AYS A;  2ZNS A;  1RDY A;  1TFD A;  1LFG A;  1NI9 A;  1OMP A;  2XXH A;  4ELO A;  4OES A;  4PF8 A;  3S4U A;  1BLF A;  2DWJ A;  4R9G A;  2Y5K A;  3U92 A;  3TTM A;  3B8B A;  5H8H B;  2Y7I A;  4G8N A;  2ZYM A;  4F29 A;  3U1O A;  1B40 A;  1TT1 A;  1K9Y A;  3JV9 A;  2WBB A;  2Q74 A;  5IKB A;  4KXP A;  5CMM A;  2B3F A;  1JVY A;  3SEU A;  1DTZ A;  4ISU A;  3K01 A;  1P1U A;  3I5O A;  3S9L C;  2RCA A;  4U2R A;  3BKI B;  2Z22 A;  2Y7K A;  1CB6 A;  5AA2 A;  1SW2 A;  2RIN A;  3OXN A;  1OQG A;  2CEY A;  3Q26 A;  4LZ5 A;  3MPK A;  3ZSF A;  3FVO A;  5KDT B;  4MLV A;  4X1B A;  2CMO A;  4FE8 A;  5EQ8 A;  1F9B A;  1MDQ A;  2WEF A;  4EXK A;  1MPD A;  1IXG A;  4NF5 B;  3TAJ A;  1SI0 A;  3C9H A;  3K00 A;  1SW1 A;  3IB1 A;  3E4R A;  3MP6 A;  4GWS A;  4OET A;  1M5F A;  4F18 A;  1NV1 A;  4RYA A;  2FYI A;  5BUU A;  2PVU A;  2XWK A;  3LSW A;  2XA5 A;  1I6B A;  3FJ7 A;  2FA7 A;  2F6P A;  5CMK A;  3T1B A;  5FBP A;  3IK6 B;  1SPI A;  4OEV A;  1US4 A;  3RLF E;  4KCC A;  4TOZ A;  3HN0 A;  1LGB C;  2D3I A;  3OSQ A;  5BWJ A;  3A29 A;  3U93 A;  1NV2 A;  5F1Q A;  1M5E A;  1FPG A;  4BDM A;  1AMF A;  4MLQ A;  1DPE A;  3M3F A;  3FXR A;  3SEX A;  4P0G A;  1M5B A;  5K2X A;  3TFL A;  4Q5T A;  4G61 A;  3OO6 A;  4MJO A;  3AXF A;  3IAZ A;  3LSX A;  3K6X A;  3BIG A;  1ZTY A;  4IB2 A;  1N3X A;  1HSL A;  4KHZ E;  4H45 A;  2DE2 A;  1Y3P A;  4GFR A;  2OK2 A;  1SD3 A;  2I4C A;  4LA9 A;  4ZEB A;  4FED A;  2QSX A;  3UOR A;  1GVC A;  3VFJ A;  1USY H;  2X7Q A;  1B9J A;  3UP9 A;  1NUX A;  3NOH A;  1ZU0 A;  5AA3 A;  1AIV A;  2LAO A;  3TTR A;  2H99 A;  3MJN A;  2Q89 A;  2QVV A;  4RY1 A;  3H06 B;  4Z7E A;  4PFW A;  4H65 A;  1LEV A;  3RT6 B;  4YAH X;  2GFE A;  3PUV E;  4TQU Q;  3EPE A;  2A5S A;  4KYE A;  4PFY A;  1FQB A;  4P8B A;  1Y9U A;  4NWD A;  2RCB A;  3Q25 A;  4O8M A;  3KC0 A;  3PUY E;  4XKN A;  1LBX A;  5I2K B;  1Z7M E;  3RTF B;  3T93 B;  3OO8 A;  1FPL A;  3VVD A;  4PAF A;  3TCG A;  1B1H A;  3VLW A;  4NF8 B;  3MW0 A;  1YCJ A;  1ELJ A;  5I2K A;  1G0H A;  1Q35 A;  4NX1 A;  1FBH A;  1ZMG A;  2DWH A;  3M3K A;  2V4C A;  2H5Y A;  1MY2 A;  4HTG A;  3ROJ A;  3RPW A;  2HCA A;  3HST A;  1IMF A;  2NXO A;  1LCF A;  3G7W A;  3CI8 A;  3IO6 A;  1K9Z A;  5TU0 A;  1A8E A;  2A5T A;  1P99 A;  4OVP A;  2CEX A;  2XXU A;  3C31 A;  4LP2 B;  4NHB A;  3OO7 A;  4N15 A;  2P2A A;  4MNI A;  2FHY A;  3C34 A;  5DW8 A;  2F6G A;  1A7L A;  4G77 A;  4PFU A;  3H3G A;  1DPP A;  3D1R A;  5KCJ B;  3L6G A;  1FPE A;  4X1D A;  2Z8E A;  2YPN A;  3CR9 A;  4NG7 A;  5K2Y A;  4G4P A;  4NWC A;  3N6T A;  3CG3 A;  1AWB A;  3MBP A;  1MXW A;  2XXP A;  1MM6 A;  1KA0 A;  3RUM A;  1JEV A;  4GWX A;  5DVJ A;  3LSF B;  1MQD A;  3PMX A;  5ET8 A;  1FJ6 A;  2P3N A;  4LVQ A;  2NVU B;  2FNC A;  2BJI A;  2QPQ A;  1LCT A;  3MC2 A;  5L9S A;  4EQ7 A;  4JWO A;  2VD2 A;  1JP4 A;  4G2Z A;  1JNF A;  2Y7P A;  4U22 A;  5JTY A;  2PFY A;  4R2B A;  3KN7 A;  4YB7 A;  4G8M A;  2ZNU A;  1RKM A;  3MPL A;  1NV4 A;  1LAG E;  4JWY A;  4H5F A;  3FJM A;  4LAT A;  4OTE A;  4ND9 A;  4PFI A;  3CIJ A;  4H67 A;  3VXB A;  1PB8 A;  2G93 A;  1D9Q A;  1UQW A;  5M2V A;  4RA1 A;  2XXX A;  1DOT A;  3G3G A;  2KR0 A;  2HXW A;  2OLB A;  3MUQ A;  3TTN A;  3DP8 A;  1DCU A;  2XWO A;  2I4B A;  1EU8 A;  1FPB A;  4R73 A;  4PQJ A;  4NAP A;  4OFL A;  4GWO A;  3PPO A;  1SW5 A;  2DVC A;  2PFZ A;  1QKA A;  3KEI A;  1YYZ A;  4ZEF A;  3RNN A;  3TTK A;  1MDP 1;  4BDR A;  3IL1 B;  3QYT A;  2F97 A;  1FPF A;  4U1O A;  4OYV A;  5A5L A;  4O3A A;  3H6V A;  1HSE A;  4GXA A;  5HPQ A;  3FGS A;  5H8N A;  4MHF A;  1FPJ A;  4PE5 B;  1N76 A;  3HPI A;  4GLI A;  2XXT A;  3I3V A;  3MZB A;  4RPO A;  2UVG A;  1DMB A;  3OMB A;  1SBP A;  2F78 A;  1B1X A;  5A5X A;  4I62 A;  1DBZ A;  3TZA A;  2I3V A;  2XWV A;  4P0I A;  2FBP A;  2Q2C A;  4AB5 A;  4KFQ A;  4OWD A;  2XX9 A;  2QS3 A;  3I6V A;  4YKK A;  4OXV A;  3F11 A;  4Q30 B;  1H76 A;  4P47 A;  4R75 A;  1MS7 A;  5F24 A;  3PMW A;  1PBP A;  4R72 A;  4JVI A;  4XF5 A;  3SEW A;  1OQH A;  4OER A;  4PET A;  4ZEI A;  3U94 A;  4OVQ A;  4JXI A;  4P1L A;  3N94 A;  1NUY A;  3U72 A;  4M4G A;  4KYS A;  2XXR A;  1QUK A;  3FD3 A;  4PAI A;  2XXW A;  1QJM A;  2YJP A;  2I3W A;  2DXY A;  1NMU A;  2W7Y A;  1N7X A;  3FXU A;  4POX A;  1XT8 A;  3PPP A;  1EZO A;  1GGG A;  1MY1 A;  2RC8 A;  2VPO A;  1YZ0 A;  3TQW A;  3QAX A;  4U1Z A;  3HHF A;  1FBC A;  3B6Q A;  1WVJ A;  3JZJ A;  1MXZ A;  2Y7R A;  3B7D A;  1MXY A;  4FIM A;  5I57 B;  4DE8 A;  3LUZ A;  3JYR A;  4O7I A;  2D21 A;  3TYH A;  4KPT A;  4YZZ A;  1SYH A;  2PYY A;  4JVC A;  2VGQ A;  1MH4 A;  2F36 A;  4RNS A;  3T9X B;  4F3S A;  5CC2 A;  1Q1K A;  3FVK A;  3KJT A;  1LBV A;  4EF1 A;  4IO7 A;  4O3C A;  5L8D A;  3OEN A;  2R9J A;  2WYK A;  1FQE A;  4PFB A;  4KR5 A;  1TXF A;  4YKP A;  3ILU B;  2XD3 A;  4ZEC A;  1D9V A;  2O1M A;  3FVN A;  5ICQ A;  4PFT A;  1ATG A;  4K3F A;  5IZ3 B;  3KG2 A;  3FUZ A;  4DI4 B;  4TLL B;  3GBA A;  5TPA A;  1YPN A;  4OAN A;  1B5H A;  2DOJ A;  3H6U A;  3RPL B;  1OIB A;  2Y7W A;  3IOU A;  1QGX A;  4LZ7 A;  1ANF A;  2OBG A;  3PD8 A;  1PC3 A;  1B32 A;  4GBV A;  2QS1 A;  4AB6 A;  1IIT A;  4MNC A;  3K0V A;  3RPL A;  1MXU A;  4WXJ A;  4KYD A;  1VFE A;  4FBP A;  3IOT A;  4WED A;  4FOR A;  1BP5 A;  1MQJ A;  3PUW E;  3UGW A;  4I8C A;  5EQ7 A;  4WEP A;  5ITP A;  3KZG A;  1POT A;  4X8R A;  3HO7 A;  4OMB A;  2Z23 A;  2Q8M A;  1XI6 A;  4RPN A;  5CRY A;  3KGC A;  1R9L A;  1WOD A;  2HQ0 A;  1FTM A;  2WYP A;  1VFD A;  5DT6 A;  5AA2 B;  4NTL A;  4ZE8 A;  3FV2 A;  1II5 A;  1USY E;  1XC1 A;  2DE4 A;  1FRP A;  4XEQ A;  2O68 A;  1O63 A;  1EZP A;  3E13 X;  1H3D A;  2E0S A;  4MX6 A;  1B3E A;  2B65 A;  5HBC A;  4F1Y A;  4F1V A;  3V83 A;  3IFC A;  4ECF A;  1I6Q A;  2VT5 A;  5I3S A;  1UIV A;  4MNP A;  4ZS9 A;  2UVJ A;  1MY4 A;  3O6I A;  4U4X A;  3MVZ A;  5H8F A;  3V5A A;  4F39 A;  3FAT A;  2ANJ A;  4EQ9 A;  4OHN A;  1JW4 A;  4HW8 A;  5J16 A;  3N5L A;  1JW1 A;  1LB8 A;  1QW0 A;  2DXR A;  5ICT A;  4IY6 A;  4R6K A;  5EHM A;  3O66 A;  4MF3 A;  5AA1 A;  4YU0 A;  3O6H A;  1AH5 A;  3DEL B;  3EQ1 A;  2H25 A;  3G3J A;  3S9M C;  5F7V A;  2P3V A;  1MY3 A;  4KD5 A;  4P3L A;  2R71 A;  4LZ8 A;  5L9O A;  3WAF A;  4ELP A;  4P1E A;  4N6K A;  4I1D A;  4ZZE A;  1VSO A;  1EYK A;  1XS5 A;  5I56 B;  1NV6 A;  3RTW B;  1IZ1 A;  4N8G A;  2OCU A;  1JVX A;  2PCR A;  1Q9D A;  5DVF A;  2REJ A;  2V25 A;  1JEU A;  1FTA A;  4LQ2 A;  1PBQ A;  1XVX A;  4ZZA A;  1B6H A;  3QK6 A;  5I56 A;  1SVX B;  1FQC A;  5ET6 A;  3O97 A;  4OQO A;  1RDX A;  2F8D A;  3K1P A;  3EF7 A;  1B3F A;  1S7Y A;  1MPB A;  2THI A;  3K6U A;  3LR1 A;  2QVR A;  1RYO A;  1PDA A;  3CSG A;  1N3W A;  4N4U A;  5I58 A;  2DYX A;  4DIG A;  1H44 A;  5EYH A;  2I0C A;  2HZL A;  5T3J A;  4FJP A;  4OVT A;  5I2N A;  2FIE A;  1Z7N E;  3OEL A;  1MQG A;  3K6V A;  4X48 A;  2F3B A;  4YMA A;  2ZNT A;  3MVX A;  1LFH A;  3T9V A;  3G3K A;  1Y1Z A;  1GV8 A;  5LOM A;  5H8Q A;  3QXM A;  2XXK A;  3SEY A;  1MH3 A;  4H8J A;  1MG1 A;  4HXV A;  4NQ8 A;  4IGR A;  4TLM B;  4GXS B;  3G3F A;  3K1M A;  4N17 A;  3W15 C;  3IJO B;  5EQA A;  1EYJ A;  1NH8 A;  3SES A;  3T96 B;  2A5T B;  2QS4 A;  3LSL A;  3ZS6 A;  3D4C A;  4JB7 A;  2XX7 A;  3MZ9 A;  4GX3 A;  4GX6 A;  1B3H A;  3T9H B;  1POY 1;  2RKM A;  1YAE A;  1Y20 A;  3PUZ E;  4MIJ A;  2CZK A;  2GHB A;  1P1O A;  4F31 B;  1I6A A;  1M5C A;  3OO9 A;  2QL3 A;  2IA4 A;  1SYI A;  2OWS A;  3PPN A;  2ONS A;  5J1D A;  3IX1 A;  1RDZ A;  1FW0 A;  4LN5 A;  3TEL A;  3OOA A;  4HE0 A;  3EN3 A;  4BLA A;  4U23 A;  1IEJ A;  1S50 A;  1FTL A;  2E1S A;  4LON B;  2WKY A;  3H4Z A;  1BKA A;  2REG A;  5FHN A;  1B7H A;  5I84 A;  1ZJL A;  4NF6 A;  1US5 A;  5JTY B;  3ILT B;  2ESN A;  1EZ9 A;  3KSJ A;  3TUS A;  4Q8R A;  2Q88 A;  2V93 A; 
#chains in the Genus database with same CATH homology
 3SDF A;  5IAI A;  3IO4 A;  2R6G E;  4RJZ A;  2XX8 A;  2ZMB A;  3B6T A;  1NNP A;  4E0W A;  1IXH A;  1N84 A;  2F5X A;  3O29 A;  3K02 A;  1A54 A;  3PU5 A;  5DTB A;  4EXL A;  4GVO A;  3TMG A;  3TTL A;  1P1Q A;  2BJJ X;  2UVH A;  5CMC A;  3E9X A;  4GRK A;  2AL4 A;  1GR2 A;  5H8N B;  3V8X B;  3RN8 A;  2IEE A;  3CFL A;  4NMY A;  4OEN A;  1AOV A;  3DP4 A;  4MH5 A;  3T22 A;  2VOZ A;  5B7D A;  3GLB A;  1B7U A;  3M8U A;  5A5X B;  2V3Q A;  2AIX A;  1LLS A;  1ZBM A;  2PBW A;  2V3T A;  1Y3N A;  2G29 A;  4C0R A;  1B5I A;  4R9F A;  4H5G A;  1LAH E;  4MBP A;  2GHA A;  5TP9 A;  4QHQ A;  2AL5 A;  1XVY A;  4EDP A;  2OWT A;  3FJG A;  1ZKB A;  2Q8J A;  4C1U A;  2PT1 A;  3O9P A;  1IIW A;  4F3P A;  3O2A A;  5EYF A;  2PX1 A;  4P11 A;  3MVW A;  4HCY A;  5I59 A;  5JK4 A;  4ELQ A;  1AL3 A;  1URS A;  3LUY A;  1FQA A;  5ITO A;  4DZ1 A;  4XKQ A;  4DCY A;  4R6H A;  3D4G A;  1N0T A;  4KQP A;  1B7Z A;  3PGF A;  4QSD A;  1VR5 A;  5DVI A;  4ONY A;  2I48 A;  1DSN A;  4H8I A;  3R26 A;  1B3L A;  5CBR A;  3KOS A;  3FVG A;  2HAU A;  4YB5 A;  4ZE9 A;  2XHD A;  4RXL A;  2HEU A;  2Z8D A;  2D5W A;  5FTI A;  4KCD A;  1LFI A;  3QUJ A;  1SW4 A;  3FV1 A;  4F1U A;  4IO2 A;  1B52 A;  4QSE A;  2DWI A;  4EQB A;  3KSX A;  3PD9 A;  1UTB B;  2VP1 A;  1FQD A;  4QRZ A;  1PEB A;  3CRB A;  4DXB A;  4G8H A;  3V89 B;  2X7P A;  3RT8 A;  1N04 A;  2RC7 A;  5HM4 B;  3K1N A;  4ZDM A;  4HCW A;  1UTB A;  4BDO A;  4N6P A;  5TPA B;  1YTV A;  1B4H A;  3SER A;  4YMB A;  3SET A;  4DXC A;  1NNK A;  3HCQ A;  1P1W A;  3USD A;  1R6Z A;  1NKX A;  2O84 X;  5JEI A;  1D9Y A;  4JWX A;  4OEU A;  3K2D A;  1UTH B;  3MWB A;  3CVG A;  1CE2 A;  3GBB A;  1FCK A;  1FTO A;  1FQF A;  3IJX B;  4X9T A;  1OLC A;  4DCX A;  1UTH A;  2H98 A;  4QSC A;  1SDX A;  2XXV A;  3PV0 E;  1BIY A;  3EHT A;  3ZKL A;  1NNF A;  3PUX E;  2QS2 A;  3TPA A;  3W9V A;  3TCF A;  3IB2 A;  4GIZ A;  3MZ1 A;  5FHO A;  2O7U A;  3H6T A;  3O6G A;  2O6A A;  4E0X A;  3DLN A;  1LBC A;  4IO3 A;  3K6W A;  3KJ7 A;  5AA4 A;  1H43 A;  2I6E A;  1NFT A;  2OZZ A;  3C33 A;  3IB0 A;  5FTH A;  2F7C A;  1OLA A;  2I0B A;  3R6U A;  1MRP A;  4XXU A;  3N6U A;  3LC8 A;  1LST A;  2I58 A;  4L17 A;  5H8F B;  3H03 A;  2DSF A;  5H8H A;  5ISU A;  3M3L A;  2GH9 A;  2XD2 A;  3TKD A;  4R2F A;  1FTJ A;  2I49 A;  2H4I A;  4UA8 A;  4NF4 B;  2ZYO A;  2Y84 A;  3H7M A;  4F3G A;  3RGY A;  4NF4 A;  1FTK A;  1O7T A;  3OEM A;  3P7I A;  2XXQ A;  4IO6 A;  3IOV A;  3GXA A;  5KDT A;  4YKI A;  3WAE A;  5DYH A;  2ONR A;  4ESW A;  2F7B A;  4NF5 A;  3MQ9 A;  1WDN A;  1R9Q A;  3G3H A;  2ALU A;  3K4U A;  4R6Y A;  2OJT A;  3MVY A;  4OFJ A;  3TDJ A;  5KZT A;  1D4N A;  1OVB A;  3KN8 A;  5I58 B;  3DP6 A;  1R1N A;  1SI1 A;  3MP1 A;  3A3U A;  4G68 B;  5CM6 A;  1XHY A;  4N07 A;  4DDD A;  3QUF A;  2ZYK A;  5I2N B;  3MAM A;  3VVE A;  1MY0 A;  3QSL A;  1PB9 A;  3VXC A;  1BTJ A;  4G68 A;  2DS9 A;  4IO4 A;  4QF9 A;  5H8Q B;  2QRY A;  4XKR A;  1B58 A;  1LB9 A;  1D3K A;  4U4S A;  3SKP A;  1LAX A;  1XOC A;  1JET A;  4PP0 A;  3A3C A;  4H1X A;  4RK9 A;  2V3U A;  1B05 A;  1TFA A;  2DVZ A;  4OVJ A;  4HS7 A;  4THI A;  1Y1M A;  4ELR A;  3T66 A;  3TQL A;  3B6W A;  1MM7 A;  3EHS A;  4JSD A;  2F7A A;  4RK2 A;  4M1V A;  1ZIU A;  1B0H A;  2KLF A;  4Z0I A;  5FHM A;  1URG A;  3BBR A;  5AA2 D;  2H9B A;  4IGT A;  1IUD A;  4GL8 A;  2UVI A;  2ONK E;  3O28 A;  3Q29 A;  1VE4 A;  2QMW A;  4QFO A;  1H45 A;  2RF1 A;  2Z8F A;  4NF8 A;  2Q9T A;  3VLU A;  2V84 A;  2ZXT A;  1NL5 A;  1LAF E;  2YLN A;  1LBB A;  2X26 A;  4JDF A;  4F2O A;  3VV5 A;  3VVF A;  3KFM A;  4NF6 B;  1Y4T A;  3CFZ A;  1P1N A;  1MXX A;  4POW A;  3RY3 A;  4UAC A;  3SEV A;  4NE4 A;  4F3B A;  4DLD A;  4WKM A;  2NOO A;  4KI0 E;  5L9M A;  1B51 A;  1MQH A;  1MQI A;  1QUJ A;  4GD5 A;  2GRV A;  4U21 A;  1QKB A;  4YIC A;  2NWJ A;  5KCJ A;  3S9E A;  3KOT A;  4ZEK A;  4BDL A;  1B2H A;  3C4M A;  3IOR A;  2UXA A;  3FXQ A;  1URD A;  4XIG Q;  4XTC Q;  1NH7 A;  3UA8 A;  4ESX A;  3FZV A;  1A8F A;  3N26 A;  4LQ5 A;  4N13 A;  1B3G A;  4F19 A;  4F2Q A;  1Y3Q A;  3BFT A;  5EHS A;  1GTK A;  1UIU A;  2P0S A;  2UYF A;  1QUI A;  3CFX A;  1ZLQ A;  3TCH A;  2CZL A;  3H6W A;  2XXI A;  3BFU A;  3ZKK A;  4LUB A;  4H6D A;  1O64 A;  3Q27 A;  4IY5 A;  1QVS A;  5CMB A;  4QFN A;  5TP9 B;  3QIM A;  4QFL A;  2NUV A;  2QMX A;  4ZED A;  5H8S A;  3TEP A;  3IR1 A;  4FEB A;  2PT2 A;  5AE4 A;  2O51 A;  5I59 B;  1IXI A;  4JSO A;  3VLV A;  2VHA A;  3KBR A;  2F35 A;  2QJE A;  1A40 A;  3DM0 A;  2VD3 A;  4O3B A;  2DE3 A;  2XXY A;  3PMV A;  1KWH A;  1A55 A;  1J1N A;  5DEX B;  2O1L A;  4YB6 A;  1OVT A;  3FIR A;  4IO5 A;  1HSJ A;  4XKP A;  2M8C A;  5ELV A;  1TWY A;  3OD7 A;  3PPQ A;  1RYX A;  3OEK A;  4EF2 A;  4YKJ A;  5DEX A;  3L6H A;  4GL0 A;  1B4Z A;  4F22 A;  4AQ4 A;  2B3B A;  4NED A;  1MXV A;  3OSR A;  1N7W A;  3CSB A;  1MPC A;  3PPR A;  2DQV A;  4BDN A;  1QUL A;  3UK4 A;  3IOW A;  3S2V A;  4G68 C;  3T9U A;  3R7X A;  3CG1 A;  4JBZ A;  4C1T A;  1A99 A;  1JQF A;  3U8Q A;  3A09 A;  4FAJ A;  3C32 A;  3VE1 B;  3Q28 A;  1DTG A;  3E3K A;  3UN6 A;  4FAT A;  3MP8 A;  2DP8 A;  1EH3 A;  3RQT A;  1JW5 A;  2DWA A;  3TOD A;  1M5D A;  5CBS A;  1PB7 A;  1B5J A;  4OZ9 A;  3GZG A;  3G3I A;  3C35 A;  2O69 A;  1IXC A;  4MFI A;  1NNT A;  4R74 A;  5I57 A;  4GQO A;  4GF8 A;  3ECR A;  3THI A;  3EHU A;  2ZYN A;  2P1S A;  4BDQ A;  4GOT A;  4FEC A;  1SQY A;  4QFK A;  1B0L A;  1IQ7 A;  2ABH A;  1L5T A;  4Q0C A;  4H0W A;  1B46 A;  5B70 A;  3UIF A;  2Q2A A;  2O7I A;  3LBS A;  2F34 A;  3VDF A;  1I69 A;  2UYE A;  3C36 A;  3HV1 A;  1S9T A;  2RC9 A;  2HZK A;  4DXU A;  4OFO A;  4I9D A;  3W9W A;  4QFP A;  2HFB A;  3ONM A;  2PMS A;  2HAV A;  3HHG A;  5AA4 B;  1T0K A;  4EUO A;  3KN3 A;  3FAS A;  5CI5 A;  3ODB A;  1Y4C A;  3S9N C;  2AYS A;  2ZNS A;  1TFD A;  1LFG A;  1OMP A;  2XXH A;  4ELO A;  4OES A;  3S4U A;  1BLF A;  2DWJ A;  4R9G A;  3U92 A;  3TTM A;  5H8H B;  2Y7I A;  4G8N A;  2ZYM A;  4F29 A;  3U1O A;  1B40 A;  1TT1 A;  3JV9 A;  5IKB A;  5CMM A;  2B3F A;  1JVY A;  3SEU A;  1DTZ A;  4ISU A;  3K01 A;  1P1U A;  3I5O A;  3S9L C;  2RCA A;  4U2R A;  3BKI B;  2Z22 A;  2Y7K A;  1CB6 A;  5AA2 A;  1SW2 A;  2RIN A;  3OXN A;  1OQG A;  3Q26 A;  4LZ5 A;  3MPK A;  3ZSF A;  3FVO A;  5KDT B;  4MLV A;  4X1B A;  2CMO A;  4FE8 A;  1F9B A;  1MDQ A;  4EXK A;  1MPD A;  1IXG A;  4NF5 B;  3TAJ A;  1SI0 A;  3C9H A;  3K00 A;  1SW1 A;  3IB1 A;  3E4R A;  3MP6 A;  4OET A;  1M5F A;  4F18 A;  4RYA A;  2FYI A;  5BUU A;  2PVU A;  3LSW A;  1I6B A;  3FJ7 A;  2FA7 A;  2F6P A;  5CMK A;  3IK6 B;  4OEV A;  1US4 A;  3RLF E;  4KCC A;  4TOZ A;  3HN0 A;  1LGB C;  2D3I A;  3OSQ A;  5BWJ A;  3U93 A;  5F1Q A;  1M5E A;  4BDM A;  1AMF A;  4MLQ A;  1DPE A;  3M3F A;  3FXR A;  3SEX A;  4P0G A;  1M5B A;  5K2X A;  3TFL A;  4Q5T A;  3OO6 A;  3AXF A;  3IAZ A;  3LSX A;  3K6X A;  1ZTY A;  4IB2 A;  1N3X A;  1HSL A;  4KHZ E;  2DE2 A;  1Y3P A;  4GFR A;  2OK2 A;  1SD3 A;  2I4C A;  4LA9 A;  4ZEB A;  4FED A;  2QSX A;  3UOR A;  1GVC A;  3VFJ A;  1USY H;  2X7Q A;  1B9J A;  3UP9 A;  1ZU0 A;  5AA3 A;  1AIV A;  2LAO A;  3TTR A;  2H99 A;  3MJN A;  2Q89 A;  4RY1 A;  3H06 B;  4Z7E A;  4PFW A;  4H65 A;  3RT6 B;  4YAH X;  2GFE A;  3PUV E;  4TQU Q;  3EPE A;  2A5S A;  4KYE A;  4PFY A;  1FQB A;  1Y9U A;  2RCB A;  3Q25 A;  4NWD A;  3PUY E;  4XKN A;  5I2K B;  1Z7M E;  3RTF B;  3T93 B;  3OO8 A;  3VVD A;  3TCG A;  1B1H A;  3VLW A;  4NF8 B;  3MW0 A;  1YCJ A;  1ELJ A;  5I2K A;  1Q35 A;  1ZMG A;  2DWH A;  3M3K A;  2H5Y A;  1MY2 A;  4HTG A;  3RPW A;  2HCA A;  3HST A;  2NXO A;  1LCF A;  3G7W A;  3CI8 A;  3IO6 A;  5TU0 A;  1A8E A;  2A5T A;  1P99 A;  2XXU A;  3C31 A;  4LP2 B;  3OO7 A;  2P2A A;  3C34 A;  2F6G A;  1A7L A;  4G77 A;  4PFU A;  3H3G A;  1DPP A;  5KCJ B;  3L6G A;  4X1D A;  2Z8E A;  2YPN A;  3CR9 A;  5K2Y A;  4G4P A;  4NWC A;  3N6T A;  3CG3 A;  3MBP A;  1MXW A;  2XXP A;  1MM6 A;  3RUM A;  1JEV A;  5DVJ A;  3LSF B;  1MQD A;  3PMX A;  4LVQ A;  2NVU B;  2FNC A;  2QPQ A;  1LCT A;  3MC2 A;  5L9S A;  4EQ7 A;  4JWO A;  2VD2 A;  4G2Z A;  1JNF A;  2Y7P A;  4U22 A;  5JTY A;  4R2B A;  3KN7 A;  4YB7 A;  4G8M A;  2ZNU A;  1RKM A;  3MPL A;  1LAG E;  4JWY A;  4H5F A;  3FJM A;  4LAT A;  4OTE A;  4ND9 A;  3CIJ A;  4H67 A;  3VXB A;  1PB8 A;  2G93 A;  1UQW A;  5M2V A;  4RA1 A;  2XXX A;  1DOT A;  3G3G A;  2HXW A;  2OLB A;  3MUQ A;  3TTN A;  3DP8 A;  2I4B A;  1EU8 A;  4R73 A;  4PQJ A;  4OFL A;  4GWO A;  3PPO A;  1SW5 A;  2DVC A;  1QKA A;  3KEI A;  4ZEF A;  3RNN A;  3TTK A;  1MDP 1;  4BDR A;  3IL1 B;  3QYT A;  2F97 A;  4U1O A;  4OYV A;  4O3A A;  3H6V A;  1HSE A;  4GXA A;  5HPQ A;  3FGS A;  5H8N A;  4PE5 B;  1N76 A;  3HPI A;  4GLI A;  2XXT A;  3I3V A;  3MZB A;  4RPO A;  2UVG A;  1DMB A;  3OMB A;  1SBP A;  2F78 A;  1B1X A;  5A5X A;  4I62 A;  3TZA A;  2I3V A;  4P0I A;  2Q2C A;  4AB5 A;  4KFQ A;  4OWD A;  2XX9 A;  2QS3 A;  3I6V A;  4YKK A;  4OXV A;  3F11 A;  4Q30 B;  1H76 A;  4R75 A;  1MS7 A;  3PMW A;  1PBP A;  4R72 A;  3SEW A;  1OQH A;  4OER A;  4PET A;  4ZEI A;  3U94 A;  4JXI A;  3N94 A;  3U72 A;  4M4G A;  4KYS A;  2XXR A;  1QUK A;  3FD3 A;  2XXW A;  1QJM A;  2YJP A;  2I3W A;  2DXY A;  1NMU A;  2W7Y A;  1N7X A;  3FXU A;  4POX A;  1XT8 A;  3PPP A;  1EZO A;  1GGG A;  1MY1 A;  2RC8 A;  3TQW A;  3QAX A;  4U1Z A;  3HHF A;  3B6Q A;  1WVJ A;  3JZJ A;  1MXZ A;  2Y7R A;  3B7D A;  1MXY A;  4FIM A;  5I57 B;  4DE8 A;  3JYR A;  2D21 A;  3TYH A;  4KPT A;  4YZZ A;  1SYH A;  2PYY A;  2VGQ A;  1MH4 A;  2F36 A;  4RNS A;  3T9X B;  4F3S A;  5CC2 A;  1Q1K A;  3FVK A;  3KJT A;  4EF1 A;  4IO7 A;  4O3C A;  5L8D A;  3OEN A;  2R9J A;  1FQE A;  4KR5 A;  1TXF A;  4YKP A;  3ILU B;  2XD3 A;  4ZEC A;  1D9V A;  2O1M A;  3FVN A;  5ICQ A;  4PFT A;  1ATG A;  4K3F A;  3KG2 A;  3FUZ A;  4TLL B;  3GBA A;  5TPA A;  1YPN A;  1B5H A;  2DOJ A;  3H6U A;  1OIB A;  2Y7W A;  3IOU A;  4LZ7 A;  1ANF A;  2OBG A;  3PD8 A;  1PC3 A;  1B32 A;  2QS1 A;  4AB6 A;  1IIT A;  3K0V A;  1MXU A;  4WXJ A;  4KYD A;  1VFE A;  3IOT A;  4WED A;  4FOR A;  1BP5 A;  1MQJ A;  3PUW E;  3UGW A;  4I8C A;  4WEP A;  5ITP A;  3KZG A;  1POT A;  3HO7 A;  4OMB A;  2Z23 A;  5CRY A;  4RPN A;  3KGC A;  1R9L A;  1WOD A;  2HQ0 A;  1FTM A;  1VFD A;  5DT6 A;  5AA2 B;  4NTL A;  4ZE8 A;  3FV2 A;  1II5 A;  1USY E;  1XC1 A;  2DE4 A;  2O68 A;  1O63 A;  1EZP A;  3E13 X;  1H3D A;  2E0S A;  1B3E A;  2B65 A;  5HBC A;  4F1Y A;  4F1V A;  3V83 A;  4ECF A;  1I6Q A;  1UIV A;  4ZS9 A;  2UVJ A;  1MY4 A;  3O6I A;  4U4X A;  3MVZ A;  5H8F A;  3V5A A;  4F39 A;  3FAT A;  2ANJ A;  4EQ9 A;  4OHN A;  1JW4 A;  4HW8 A;  3N5L A;  1JW1 A;  1LB8 A;  1QW0 A;  2DXR A;  5ICT A;  4IY6 A;  4R6K A;  5EHM A;  3O66 A;  4MF3 A;  5AA1 A;  4YU0 A;  3O6H A;  1AH5 A;  3DEL B;  3EQ1 A;  2H25 A;  3G3J A;  3S9M C;  5F7V A;  1MY3 A;  4KD5 A;  2R71 A;  4LZ8 A;  5L9O A;  3WAF A;  4ELP A;  4I1D A;  4ZZE A;  1VSO A;  1XS5 A;  5I56 B;  3RTW B;  1IZ1 A;  2OCU A;  1JVX A;  5DVF A;  2REJ A;  2V25 A;  1JEU A;  4LQ2 A;  1PBQ A;  1XVX A;  4ZZA A;  1B6H A;  3QK6 A;  5I56 A;  1SVX B;  1FQC A;  3O97 A;  4OQO A;  2F8D A;  3K1P A;  3EF7 A;  1B3F A;  1S7Y A;  1MPB A;  2THI A;  3K6U A;  3LR1 A;  1RYO A;  1PDA A;  3CSG A;  1N3W A;  5I58 A;  2DYX A;  4DIG A;  1H44 A;  2I0C A;  2HZL A;  4FJP A;  5I2N A;  1Z7N E;  3OEL A;  1MQG A;  3K6V A;  4X48 A;  4YMA A;  2ZNT A;  3MVX A;  1LFH A;  3T9V A;  3G3K A;  1Y1Z A;  1GV8 A;  5LOM A;  5H8Q A;  3QXM A;  3SEY A;  1MH3 A;  4H8J A;  1MG1 A;  4IGR A;  4TLM B;  4GXS B;  3G3F A;  3K1M A;  3W15 C;  3IJO B;  1NH8 A;  3SES A;  3T96 B;  2A5T B;  2QS4 A;  3LSL A;  3ZS6 A;  3D4C A;  4JB7 A;  2XX7 A;  3MZ9 A;  1B3H A;  3T9H B;  1POY 1;  2RKM A;  1YAE A;  1Y20 A;  3PUZ E;  2GHB A;  1P1O A;  4F31 B;  1I6A A;  1M5C A;  3OO9 A;  2QL3 A;  2IA4 A;  1SYI A;  2OWS A;  3PPN A;  2ONS A;  5J1D A;  3IX1 A;  1FW0 A;  3TEL A;  3OOA A;  3EN3 A;  4BLA A;  4U23 A;  1IEJ A;  1S50 A;  1FTL A;  2E1S A;  4LON B;  2WKY A;  3H4Z A;  1BKA A;  2REG A;  5FHN A;  1B7H A;  5I84 A;  1ZJL A;  4NF6 A;  1US5 A;  5JTY B;  3ILT B;  2ESN A;  1EZ9 A;  3KSJ A;  3TUS A;  4Q8R A;  2Q88 A;  2V93 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...