1QUIA

Phosphate-binding protein mutant with asp 137 replaced by gly complex with bromine and phosphate
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
321
structure length
321
Chain Sequence
EASLTGAGATFPAPVYAKWADTYQKETGNKVNYQGIGSSGGVKQIIANTVDFGASDAPLSDEKLAQEGLFQFPTVIGGVVLAVNIPGLKSGELVLDGKTLGDIYLGKIKKWDDEAIAKLNPGLKLPSQNIAVVRRAGGSGTSFVFTSYLAKVNEEWKNNVGTGSTVKWPIGLGGKGNDGIAAFVQRLPGAIGYVEYAYAKQNNLAYTKLISADGKPVSPTEENFANAAKGADWSKTFAQDLTNQKGEDAWPITSTTFILIHKDQKKPEQGTEVLKFFDWAYKTGAKQANDLDYASLPDSVVEQVRAAWKTNIKDSSGKPLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Phosphate transport
molecule keywords PHOSPHATE-BINDING PROTEIN
publication title Modulation of a salt link does not affect binding of phosphate to its specific active transport receptor.
pubmed doi rcsb
source organism Escherichia coli
total genus 109
structure length 321
sequence length 321
ec nomenclature
pdb deposition date 1995-11-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1quiA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1quiA02
5JTYA 3OENA 5F7VA 5AA2B 2YJPA 2HAVA 2WKYA 2ZNSA 3IOUA 3H6UA 3FVOA 3IJOB 1JVYA 4WEPA 1OMPA 4F19A 1ATGA 3FVNA 3CVGA 2QMWA 4BDQA 2ANJA 4EQBA 4P0IA 1OLCA 4GXSB 4Z0IA 2VP1A 3U93A 3WAFA 1B5IA 1Y1MA 5LOMA 4Q8RA 3PUVE 2VD2A 2F7BA 3TTKA 1B58A 1QUJA 4ZECA 1M5FA 4F1YA 4M4GA 4OXVA 4XXUA 2THIA 2NVUB 3A3CA 3FIRA 4KYDA 4ZEFA 3G3KA 3THIA 3H4ZA 1WVJA 2V3UA 4U4XA 1RYOA 3K01A 5I59A 2RINA 3KSJA 3TQWA 2Z8DA 4OHNA 4IO2A 5DVJA 2NXOA 2I58A 3K2DA 3LSXA 2OZZA 4DIGA 1PB7A 4PE5B 4YKJA 3A3UA 1FQFA 2F36A 5AA3A 3M3LA 5CMBA 1USYE 3MC2A 3RTFB 3C32A 3VE1B 4LP2B 3RPWA 1ZBMA 4H67A 2UYEA 3ILTB 1ZIUA 4I62A 3CIJA 2QS3A 3O97A 2Q88A 3T22A 4G77A 1LSTA 1EZPA 1JW4A 1MDP1 3KJTA 4OVJA 1Q1KA 3S9NC 3GBBA 1UTBA 1CB6A 4OESA 4F18A 1OQGA 1MDQA 4H1XA 3TFLA 3BKIB 1P1OA 2G93A 3QIMA 3E13X 1AMFA 4QSCA 4FIMA 1GR2A 1D9YA 2P2AA 3IR1A 1JVXA 1LAHE 5L8DA 4IB2A 1JQFA 3PD9A 2PX1A 2OCUA 4OETA 2ZNTA 5AE4A 3FJGA 1H44A 3IB0A 5H8FB 3OXNA 4H6DA 3CG1A 4XKNA 2FNCA 2AIXA 3U92A 2ZMBA 3TDJA 3RNNA 2OLBA 4LVQA 3HPIA 1FQEA 5L9OA 3CSGA 3TPAA 1MXWA 4JWXA 4F39A 5BWJA 5CBRA 3PUWE 1SQYA 3TMGA 1QKAA 4GL8A 1HSLA 1TT1A 2DS9A 3TCGA 3UORA 1IUDA 1M5CA 2RCAA 4U1ZA 3QUFA 1NNTA 3EPEA 1LFHA 4OFJA 3O28A 1I69A 1H45A 3KN8A 2F7CA 4FEDA 4GD5A 4R9GA 1XC1A 3RY3A 3PU5A 2I6EA 3O2AA 3IK6B 4GLIA 1MM6A 2UVIA 3MPLA 4MBPA 4OERA 4LATA 2XX8A 1MXXA 4RYAA 5I57B 5I2KA 3LSWA 3IOVA 3T9VA 1IXHA 3R26A 4L17A 5H8NB 1Y9UA 2F35A 1BIYA 1B9JA 1MXZA 1H43A 3HN0A 2I0CA 3EN3A 1FTMA 2UVGA 3MPKA 4Q0CA 1LAXA 1B1HA 5TP9B 4YICA 4MH5A 4EF1A 1GTKA 1CE2A 5CMMA 4ELRA 1IXIA 3VVFA 3CFXA 1ZJLA 2QJEA 4EUOA 4YB5A 2QS4A 3OMBA 2DVZA 4KYEA 1MY0A 2O68A 4IO3A 2XXPA 4NTLA 2F6GA 3ZSFA 5CI5A 4F3SA 5L9MA 1NKXA 2GRVA 3TEPA 1MQDA 1B7ZA 1LGBC 1UIUA 4OQOA 3KG2A 5ITPA 4HCYA 4KPTA 5KDTB 1P1UA 3LSLA 4E0XA 2AL5A 5FTHA 3CRBA 4QRZA 1A55A 3BFUA 4QFKA 2NWJA 1DOTA 3GBAA 3TYHA 3OO7A 3ECRA 2GFEA 3T66A 4RPOA 4H8JA 3K6XA 3M3FA 4PFUA 4TQUQ 2O1MA 4ZZAA 3E4RA 3PUYE 1DTGA 5KZTA 4KFQA 1MPDA 1NNKA 1Y3PA 1BTJA 2RF1A 2NUVA 3G3GA 3IO6A 4GRKA 5FTIA 1DPPA 1LCFA 5DEXA 2DQVA 3K4UA 4NWDA 2Q2CA 1B46A 3G3IA 4BDOA 3T9HB 3PGFA 4U22A 2B65A 3PPQA 4ND9A 4F31B 2IEEA 2DXRA 2P1SA 3R6UA 2Z8EA 2DSFA 5EHSA 2ALUA 3TTLA 1SVXB 2Q2AA 4R73A 1SI1A 2DE3A 2A5TA 4IO6A 3HO7A 2V25A 4FJPA 4G68C 4Z7EA 1PB9A 3GLBA 4RPNA 3GZGA 4JSOA 5H8HB 3MVZA 4RK2A 4DCYA 4R2FA 1BLFA 3Q29A 5CMCA 3N94A 3O6GA 2XXHA 4NF4A 4YMBA 1MPBA 5AA4A 4HW8A 4QSEA 1VE4A 4OYVA 3CFLA 4TLLB 4BDLA 3KJ7A 3G7WA 3B6QA 1EU8A 2HAUA 3UK4A 3C33A 1R9LA 4YU0A 4DDDA 2DE2A 1MQIA 3N5LA 4POWA 2VOZA 3RT6B 1B4HA 5HPQA 2Y7KA 4KD5A 3VFJA 1YAEA 1MY2A 1JETA 3QSLA 4RA1A 1UIVA 4GL0A 4ZS9A 1MQJA 1B5JA 4QF9A 1MH4A 4U21A 2ZYKA 2PT2A 3W15C 5AA2A 3DLNA 2DOJA 1SYIA 4BLAA 2D21A 2XXRA 2HCAA 4OZ9A 3SEVA 3E3KA 3OELA 1MS7A 3QUJA 1Y3QA 2AL4A 3HV1A 1N0TA 1LCTA 4YAHX 4GFRA 2XD2A 4DCXA 4R74A 3IB1A 4GXAA 1A54A 4IY5A 3TZAA 3FUZA 3FVGA 3KBRA 2FA7A 2I4CA 2RKMA 2XX7A 1OVBA 3ILUB 4R2BA 1POTA 4R6HA 5H8QB 1JW1A 2DWAA 3CFZA 2I49A 3LSFB 1WDNA 2M8CA 3TODA 4YKPA 3N6UA 3OSRA 4LZ8A 2H9BA 4G68B 2CZLA 4I9DA 4F1UA 4YKIA 2VD3A 1BP5A 4DXUA 3MP1A 2GHAA 2RCBA 1D4NA 3IOWA 3K00A 2DVCA 2ONRA 1GVCA 5AA1A 3VLWA 3SERA 4ZDMA 4EXLA 1Y3NA 1I6BA 2FYIA 3GXAA 1H76A 4WKMA 3EQ1A 5ICQA 1SD3A 3K0VA 5FHNA 1MM7A 4U2RA 4IO5A 1P1WA 3PPNA 4NEDA 4RNSA 1R1NA 1B5HA 2REGA 4PETA 1NH7A 3G3HA 3O6HA 2YLNA 1XVYA 3UIFA 3VVDA 3QYTA 2R6GE 3H7MA 4LZ5A 1F9BA 4G2ZA 3VV5A 2ZYNA 1JW5A 3EF7A 4EXKA 3K02A 3FGSA 4N6PA 2CMOA 1FTKA 4HS7A 3KFMA 1MY4A 3T9UA 2D5WA 4TOZA 3H6VA 3TTRA 4I8CA 3S2VA 2ESNA 3H6WA 2XXUA 4AB6A 2XXXA 3JZJA 3VLVA 3TAJA 1SW5A 1P1NA 2XXYA 3QK6A 1O64A 2HZLA 4EQ7A 3Q25A 4F3BA 2REJA 4LUBA 2OBGA 3CSBA 4C1UA 2Q8JA 1QUIA 4ESXA 5TU0A 2UXAA 5DTBA 1N3WA 1B52A 4E0WA 4YB7A 2Q9TA 2F6PA 4R72A 4DLDA 5KCJB 5H8FA 3UGWA 3Q27A 3H06B 2GHBA 2V93A 1AL3A 1MG1A 2A5SA 4FEBA 3A09A 1UTHB 5TPAB 1LBBA 2GH9A 4OMBA 1QVSA 4HTGA 4IO7A 3TELA 1IIWA 3PUXE 2NOOA 3PMWA 1J1NA 3KGCA 3MAMA 3FXUA 4NWCA 2RC7A 4KR5A 4GWOA 2DYXA 2O51A 3ZKLA 1MXVA 5A5XB 1BKAA 1XS5A 3SEUA 1M5BA 4NF8B 3TUSA 3MVWA 3HSTA 5J1DA 2P0SA 1US5A 3OO6A 4F29A 3PPRA 1SI0A 4LQ5A 4QSDA 5I58B 4MFIA 3MVXA 3VXCA 2QPQA 3RT8A 3MZ9A 3ZKKA 3IORA 3T93B 4IY6A 3FZVA 4LONB 1LLSA 3PMVA 2G29A 3RUMA 4RJZA 1NFTA 3C36A 1ANFA 1LAFE 5ITOA 1OQHA 4DE8A 4LQ2A 3OSQA 4ISUA 4X1DA 5I57A 3IO4A 3KOTA 1Y20A 1MH3A 3OO9A 2Y7PA 3KN3A 3G3JA 5H8NA 4OFOA 4NF5B 3UN6A 2DXYA 4WEDA 2V84A 4H65A 5AA2D 1MRPA 2DE4A 3K1PA 1S9TA 1QKBA 5TP9A 3CI8A 2F8DA 1OIBA 1R9QA 4GQOA 4AQ4A 1SW1A 4THIA 3HCQA 1XHYA 1PB8A 4ZZEA 1AOVA 3MVYA 5DVIA 4ZEIA 4XIGQ 2O7IA 4RY1A 3HHGA 3IJXB 1JNFA 3TTMA 2Y7WA 1FQDA 2KLFA 3RQTA 3W9VA 2DWIA 2E0SA 1NH8A 5CMKA 1RYXA 3FXRA 3LUYA 4KHZE 2X7QA 2ZYMA 1D3KA 4NF6B 2R9JA 5M2VA 5KDTA 2Z8FA 2H4IA 4BDMA 1B1XA 4EDPA 2IA4A 4FE8A 4YKKA 4G4PA 2B3BA 3CR9A 3SEYA 5ISUA 1EZOA 3HHFA 4KCDA 1PBPA 2F7AA 3AXFA 4KQPA 4NMYA 4QFOA 1OLAA 4DXBA 1MXUA 2ONKE 3EHSA 3N26A 4OTEA 3PD8A 4MF3A 5K2YA 1A8EA 4JBZA 1LB9A 4ZE8A 4H8IA 1I6AA 2XXWA 2VHAA 4ZE9A 1LFIA 5I56B 4PFTA 1FCKA 3B7DA 3G3FA 3TCHA 3VDFA 1NNFA 1YTVA 3LBSA 4C0RA 1FQCA 3KN7A 1DSNA 1N76A 4POXA 4IGRA 4X48A 3K1NA 2V3TA 3C34A 1Y4TA 2UYFA 1B6HA 2H98A 1IQ7A 1ELJA 4R6KA 3DELB 2F78A 5B70A 2PYYA 4ZEBA 1P99A 1XT8A 4PFYA 5H8HA 3O66A 4C1TA 4ZEDA 3SETA 1IITA 4JXIA 3U94A 1MPCA 2Z22A 4U1OA 4YB6A 1B3HA 3BBRA 3H3GA 2W7YA 3SESA 1B40A 1NL5A 2D3IA 5CBSA 2F34A 4XKRA 4O3BA 1PBQA 3ODBA 2ABHA 4FATA 2BJJX 2OJTA 3QAXA 3SDFA 1B05A 3RLFE 5HM4B 2XXIA 3KZGA 3P7IA 1B7UA 4R75A 1B0LA 2H25A 4PFWA 3B6WA 4H5GA 4X1BA 1A99A 5F1QA 3SKPA 3WAEA 4XKPA 3L6GA 1N7XA 3UA8A 3I5OA 1LFGA 5CM6A 1B4ZA 5JTYB 1B32A 3V8XB 4GIZA 1TFDA 3M3KA 1R6ZA 4OWDA 2HZKA 4BDNA 3H03A 5K2XA 1FQAA 3DM0A 3OD7A 4G8NA 4RXLA 3MP6A 1ZMGA 4Q5TA 1SBPA 3C35A 3FXQA 1IXGA 1FW0A 1QUKA 3KOSA 1DTZA 3KSXA 2HEUA 5ICTA 3D4CA 5IKBA 1YCJA 3O6IA 3UP9A 4GF8A 3F11A 4EF2A 1UQWA 1URSA 4Q30B 1PDAA 1USYH 3QXMA 3CG3A 3K6WA 5H8QA 1KWHA 3O29A 3OO8A 3FJ7A 4H5FA 3C31A 3N6TA 1NMUA 1MY3A 3H6TA 3LR1A 1VR5A 4F2OA 4G68A 3FJMA 3S9EA 1S7YA 1H3DA 4I1DA 3MJNA 2RC8A 1B7HA 3RTWB 1B0HA 3B6TA 1AH5A 4FORA 2XXTA 3VVEA 1PC3A 5I59B 2YPNA 3JV9A 2Z23A 1FTJA 3KEIA 3RN8A 2Y84A 4NE4A 4LZ7A 1RKMA 3U8QA 1B51A 4TLMB 3MZ1A 4GOTA 1A7LA 1NNPA 5JEIA 2I0BA 4PQJA 4ESWA 3OEMA 4P11A 4OEUA 4KCCA 1LB8A 3IL1B 5DVFA 4IO4A 3V83A 1TXFA 1LBCA 4GVOA 2OK2A 1FQBA 2LAOA 2Y7IA 3MP8A 1PEBA 2PMSA 1GGGA 3TTNA 3FD3A 1MQGA 2ZYOA 1JEVA 4EQ9A 4G8MA 1UTBB 3DP8A 3TQLA 1Z7ME 1SYHA 4RK9A 1EH3A 1M5EA 4F2QA 5H8SA 2AYSA 2ONSA 3SEWA 3MUQA 2XXVA 5L9SA 4O3AA 2ZXTA 5B7DA 1O7TA 3C4MA 2V3QA 3O9PA 5DT6A 5DYHA 5KCJA 1QW0A 2DWHA 3U1OA 3FVKA 4LA9A 3Q28A 4HCWA 1UTHA 5TPAA 2ZNUA 4R9FA 4FAJA 1WODA 1N3XA 2HXWA 1M5DA 1B3LA 3IB2A 3L6HA 5HBCA 5A5XA 3EHUA 2XD3A 4NF8A 2OWTA 3PPOA 2UVJA 4UA8A 2HQ0A 1Y4CA 5I58A 1A8FA 1B2HA 4K3FA 4KYSA 1URGA 4WXJA 2PT1A 2H99A 1N84A 1ZU0A 1N04A 1L5TA 2R71A 1B3GA 4XTCQ 3MBPA 2DWJA 4JWOA 4QFPA 4PP0A 4QFNA 3IAZA 4F3PA 3IX1A 1XOCA 1DMBA 4ONYA 3VLUA 5EYFA 2QS1A 1T0KA 1S50A 1ZLQA 3MZBA 1D9VA 5I2KB 3PPPA 3K1MA 4NF5A 1IEJA 2RC9A 3TKDA 4KI0E 5ELVA 1JEUA 1SW4A 2DP8A 1TFAA 4M1VA 4O3CA 2PVUA 2QMXA 3RGYA 2XX9A 1VFDA 3W9WA 4JSDA 3T9XB 4AB5A 1YPNA 1B3EA 3IOTA 4X9TA 4YZZA 3C9HA 5FHOA 1MXYA 4F22A 1I6QA 4DXCA 1ZKBA 4NF6A 3PMXA 3D4GA 2F97A 4F3GA 5JK4A 5I2NB 3VXBA 3OOAA 5CC2A 5I2NA 4QFLA 2F5XA 2VGQA 5IAIA 1GV8A 4JDFA 3PUZE 3FV1A 2QS2A 1Z7NE 3U72A 2X7PA 1URDA 2I4BA 4OEVA 1MY1A 3Q26A 1HSJA 4ZEKA 1SDXA 4DZ1A 5CRYA 3PV0E 3FASA 2O6AA 4N13A 3V89B 4UACA 3BFTA 3S9LC 2O84X 1QULA 1ZTYA 4P0GA 3ONMA 4JWYA 2UVHA 1B3FA 1OVTA 2H5YA 4N07A 4R6YA 1LAGE 5I56A 1VFEA 2OWSA 4JB7A 1N7WA 3EHTA 3MQ9A 1US4A 1A40A 1DPEA 5I84A 3OEKA 3JYRA 5DEXB 4MLVA 3USDA 1EZ9A 3MWBA 3MW0A 3LC8A 3SEXA 4ELOA 2X26A 3E9XA 3K6VA 1FTOA 3T96B 4IGTA 2O7UA 4BDRA 2HFBA 3FATA 3K6UA 4XKQA 2QSXA 3ZS6A 2XHDA 1FTLA 2I48A 3I6VA 2Q89A 3R7XA 4ECFA 2A5TB 2E1SA 4QHQA 2PBWA 1O63A 4OENA 4F1VA 4H0WA 1QJMA 4U4SA 3I3VA 2QL3A 3S9MC 3DP4A 3V5AA 3TCFA 5FHMA 1AIVA 1POY1 2QRYA 4NF4B 2Y7RA 1IZ1A 1MQHA 4MLQA 5AA4B 1Q35A 3DP6A 3FV2A 4FECA 4ELQA 2B3FA 1II5A 2O1LA 3S4UA 4ELPA 1P1QA 1Y1ZA 1XVXA 1TWYA 2I3VA 2XXQA 1VSOA 2O69A 4G8HA 4YMAA 2I3WA 1IXCA 1HSEA 5EHMA 1SW2A 4U23A 5BUUA 4OFLA 3M8UA
chains in the Genus database with same CATH superfamily
5JTYA 3OENA 5F7VA 4O7MA 5AA2B 2YJPA 2HAVA 2WKYA 2ZNSA 3IOUA 3H6UA 1NI9A 3FVOA 3IJOB 1JVYA 4WEPA 1OMPA 4F19A 1ATGA 3FVNA 4MNPA 2CZHA 3CVGA 2QMWA 4BDQA 2ANJA 4EQBA 2CEYA 4P0IA 1OLCA 4GXSB 4Z0IA 2VP1A 4P8BA 3U93A 3WAFA 1B5IA 1Y1MA 5LOMA 4Q8RA 3PUVE 2VD2A 2F7BA 3TTKA 1B58A 1QUJA 4ZECA 1M5FA 4UABA 4F1YA 4O94A 4M4GA 2L5VA 4OXVA 4XXUA 2THIA 2NVUB 3A3CA 3FIRA 4KYDA 4ZEFA 4MNIA 3G3KA 3THIA 3H4ZA 1WVJA 2V3UA 4U4XA 1RYOA 3K01A 2QVVA 4JVIA 5I59A 2RINA 3KSJA 3NOHA 3TQWA 2Z8DA 4OHNA 4IO2A 5DVJA 2NXOA 2I58A 3K2DA 3LSXA 2OZZA 4DIGA 4N6DA 1PB7A 4PE5B 4YKJA 3A3UA 1FQFA 2F36A 2WX9A 5AA3A 3M3LA 4N81A 5CMBA 1USYE 3MC2A 3RTFB 3C32A 3VE1B 4LP2B 3RPWA 1ZBMA 4H67A 4QBAA 2UYEA 3ILTB 1FPLA 1ZIUA 4I62A 4MEVA 3CIJA 2QS3A 1LBXA 3O97A 2Q88A 3T22A 4G77A 1LSTA 1EZPA 1JW4A 3KC1A 1NV4A 3SZPA 1MDP1 3KJTA 4OVJA 1Q1KA 4GWSA 3S9NC 3GBBA 1UTBA 1CB6A 4OESA 1FBFA 4F18A 4PFBA 1OQGA 1FPDA 4GWYA 1MDQA 4H1XA 3TFLA 2R8TA 3BKIB 1P1OA 4N8YA 2G93A 3QIMA 3E13X 4NX1A 1AMFA 4QSCA 4FIMA 1GR2A 1D9YA 2P2AA 3IR1A 1JVXA 1LAHE 3IFAA 5L8DA 3E79A 4IB2A 1JQFA 4PBQA 3PD9A 2PX1A 2OCUA 4OETA 2ZNTA 4I40A 5AE4A 3FJGA 1H44A 4HE2A 3RPLA 1NUZA 3IB0A 5H8FB 3OXNA 4H6DA 3CG1A 4XKNA 5FBPA 2FNCA 2AIXA 3U92A 4OVTA 2ZMBA 3TDJA 3RNNA 2OLBA 4LVQA 1FBDA 3HPIA 1FQEA 5L9OA 3CSGA 3TPAA 1MXWA 4JWXA 4F39A 5BWJA 5CBRA 3PUWE 4X04A 1SQYA 3TMGA 1QKAA 4N8GA 4GL8A 1HSLA 1TT1A 2DS9A 3TCGA 3UORA 1IUDA 1M5CA 2RCAA 3T0JA 4U1ZA 3QUFA 4N15A 1NNTA 4PGPA 3EPEA 1LFHA 3QMFA 4OFJA 3O28A 1I69A 1H45A 3KN8A 3RYDA 2F7CA 4FEDA 4GD5A 1FPFA 4R9GA 1XC1A 3RY3A 3PU5A 2I6EA 3O2AA 3IK6B 4GLIA 1MM6A 1JP4A 2UVIA 3MPLA 4MBPA 4OERA 4LATA 2XX8A 1MXXA 1NV2A 4RYAA 5I57B 5I2KA 3LSWA 3IOVA 3T9VA 1IXHA 3R26A 4L17A 4AS5A 5H8NB 1Y9UA 2F35A 1QGXA 1BIYA 1B9JA 1MXZA 1H43A 3HN0A 2I0CA 3EN3A 1FTMA 2UVGA 3MPKA 4Q0CA 1LAXA 1B1HA 5TP9B 1INPA 5ET6A 4YICA 4MH5A 4EF1A 1GTKA 1CE2A 4P1EA 5CMMA 4ELRA 1IXIA 3VVFA 3CFXA 1AWBA 1ZJLA 2QJEA 5IZ3A 4EUOA 4YB5A 2QS4A 3OMBA 5I5PA 2DVZA 4KYEA 4MMPA 1MY0A 2O68A 4IO3A 2XXPA 4NTLA 2F6GA 4G61A 3ZSFA 5CI5A 4F3SA 5L9MA 1NKXA 2PCRA 2GRVA 3TEPA 1MQDA 1B7ZA 1LGBC 1UIUA 2Q8MA 2VPOA 4N4UA 1VDWA 4OQOA 1KA0A 2FHYA 3KBZA 3KG2A 5ITPA 4HCYA 4P9KA 4NF0A 4KPTA 5KDTB 4N17A 1P1UA 3LSLA 4E0XA 2AL5A 3B50A 5FTHA 3CRBA 4QRZA 1A55A 3BFUA 4QFKA 2NWJA 1DCUA 1DOTA 3GBAA 3TYHA 3OO7A 3ECRA 1NUXA 2GFEA 3T66A 4RPOA 4H8JA 3K6XA 3M3FA 2FIEA 4H46A 4NN3A 4PFUA 4TQUQ 2O1MA 4ZZAA 3E4RA 3PUYE 1DTGA 5KZTA 4KFQA 2JJKA 1MPDA 1NNKA 1Y3PA 4DI4B 1BTJA 2RF1A 2NUVA 3G3GA 3IO6A 4GRKA 5FTIA 1FJ9A 1DPPA 1LCFA 3BIHA 5DEXA 1FPEA 2DQVA 3K4UA 4NWDA 2Q2CA 1B46A 3G3IA 4BDOA 3T9HB 3PGFA 4I3EA 2F3DA 4U22A 2B65A 1LBYA 3PPQA 4ND9A 4F31B 2IEEA 2DXRA 2P1SA 3R6UA 2Z8EA 4HE1A 2DSFA 5EHSA 2ALUA 4NQ8A 3TTLA 1SVXB 2Q2AA 4R73A 1SI1A 2DE3A 2P3VA 2A5TA 4IO6A 3HO7A 2V25A 4FJPA 4G68C 4Z7EA 1PB9A 3GLBA 4RPNA 3GZGA 4JSOA 4MAGA 5IZ1A 5H8HB 3MVZA 4RK2A 4DCYA 4R2FA 1BLFA 3Q29A 5CMCA 1IMCA 3N94A 3O6GA 2XXHA 4GBVA 4NF4A 4YMBA 3EKIA 1MPBA 5AA4A 4HW8A 4QSEA 1VE4A 4OYVA 3CFLA 4TLLB 4BDLA 3KJ7A 3G7WA 3B6QA 4AS4A 2ZZWA 1EU8A 2HAUA 4PTKA 3UK4A 3C33A 1R9LA 4YU0A 4DDDA 2DE2A 1MQIA 4I3YA 3N5LA 4POWA 5LTCA 2VOZA 3RT6B 1B4HA 5HPQA 2Y7KA 4KD5A 3VFJA 1YAEA 1NV6A 1MY2A 1JETA 3QSLA 4RA1A 1UIVA 3KC0A 4GL0A 4ZS9A 1MQJA 1B5JA 4QF9A 1MH4A 4U21A 2ZYKA 2PT2A 3W15C 5AA2A 3DLNA 2DOJA 1SYIA 1DBZA 4BLAA 2D21A 2XXRA 2HCAA 4OZ9A 3SEVA 3E3KA 3OELA 1MS7A 3QUJA 4XFEA 1Y3QA 2AL4A 4MX6A 3HV1A 1N0TA 1LCTA 4YAHX 4GFRA 2XD2A 4DCXA 4R74A 3IB1A 4GXAA 1A54A 4IY5A 5EQ7A 3TZAA 2WBBA 3FUZA 5ESYA 4JVCA 3FVGA 3KBRA 4OA4A 2FA7A 1YXIA 2I4CA 4X8RA 2Y5LA 2RKMA 2XX7A 1OVBA 1IMFA 3ILUB 4R2BA 1POTA 4R6HA 5H8QB 1JW1A 1FPIA 2DWAA 3CFZA 2I49A 3LSFB 3T1BA 1WDNA 4FBPA 2M8CA 3TODA 4YKPA 3N6UA 3OSRA 4LZ8A 2H9BA 4G68B 2CZLA 4I9DA 4F1UA 1IMEA 4YKIA 1RDXA 2XWOA 1LEVA 2VD3A 1BP5A 2XA5A 4DXUA 3MP1A 2GHAA 2RCBA 1D4NA 3IOWA 3K00A 3MSTA 1FPGA 2DVCA 2ONRA 1GVCA 5AA1A 3VLWA 3SERA 4ZDMA 4EXLA 1Y3NA 3FBPA 4P47A 1I6BA 2FYIA 3GXAA 1H76A 1FRPA 4WKMA 3EQ1A 3U65A 5ICQA 1SD3A 3K0VA 5FHNA 1MM7A 4U2RA 4IO5A 1P1WA 3PPNA 1Q9DA 2FBPA 4NEDA 4RNSA 1R1NA 1B5HA 2REGA 4PETA 1NH7A 3G3HA 3O6HA 5LDZA 2YLNA 1XVYA 3UIFA 3VVDA 3QYTA 2R6GE 4KXPA 3H7MA 2XXKA 4LZ5A 1F9BA 4G2ZA 3VV5A 5DW8A 5ET5A 5I7IA 2ZYNA 1JW5A 3EF7A 4EXKA 3K02A 3FGSA 4N6PA 2CEXA 2CMOA 2OWZA 1FTKA 2ZZVA 4HS7A 1NV5A 3KFMA 1MY4A 2P3NA 2WBDA 4OVRA 3T9UA 2D5WA 4TOZA 3H6VA 3TTRA 4I8CA 3S2VA 2ESNA 3H6WA 2XXUA 4AB6A 2XXXA 3JZJA 3VLVA 3TAJA 1SW5A 1P1NA 2XXYA 3QK6A 2Q74A 1O64A 2HZLA 4EQ7A 3Q25A 4F3BA 2REJA 4LUBA 2OBGA 3CSBA 4C1UA 2Q8JA 1QUIA 1FBEA 4ESXA 5TU0A 2UXAA 5DTBA 4LN5A 1N3WA 1B52A 4E0WA 4YB7A 2Q9TA 2F6PA 4R72A 2WYKA 4DI3D 4DLDA 5KCJB 5ET7A 5H8FA 3UGWA 3Q27A 3H06B 2GHBA 2V93A 2WEFA 1AL3A 1MG1A 2A5SA 2PFZA 4FEBA 3A09A 1UTHB 2PFYA 5TPAB 1LBBA 2GH9A 4OMBA 1QVSA 4HTGA 4IO7A 3TELA 1IIWA 5J16A 3FXBA 3PUXE 2NOOA 3PMWA 1J1NA 3KGCA 3MAMA 4P56A 3FXUA 4NWCA 2RC7A 4KR5A 4GWOA 2DYXA 2O51A 3ZKLA 1MXVA 5A5XB 1NV1A 1BKAA 1XS5A 3SEUA 1M5BA 4NF8B 3TUSA 3MVWA 3HSTA 5J1DA 2P0SA 1US5A 3OO6A 4F29A 4O7IA 4MCOA 3PPRA 2BJIA 1SI0A 4LQ5A 4QSDA 5I58B 4MFIA 3MVXA 3VXCA 2QPQA 3RT8A 3MZ9A 3ZKKA 3IORA 3T93B 4IY6A 3FZVA 4LONB 1LLSA 3A29A 3PMVA 1FBHA 2G29A 4RJZA 3RUMA 1NFTA 2CZIA 3C36A 5EQ9A 3ISPA 1ANFA 1LAFE 5ITOA 1OQHA 4DE8A 4LQ2A 3OSQA 4ISUA 4X1DA 5I57A 3IO4A 5F24A 3KOTA 1Y20A 1MH3A 3OO9A 2Y7PA 3KN3A 3G3JA 5H8NA 4PCDA 4OFOA 4NF5B 3UN6A 3MYUA 2DXYA 2GQ1A 2V84A 1SPIA 4WEDA 4H65A 5AA2D 1MRPA 2DE4A 3K1PA 1S9TA 1QKBA 5TP9A 2V4CA 3CI8A 2F8DA 2FIXA 1OIBA 1R9QA 4GQOA 4AQ4A 1SW1A 2F3BA 4THIA 3HCQA 1XHYA 2ZZXA 1PB8A 4ZZEA 1AOVA 3MVYA 5DVIA 4ZEIA 4XIGQ 1FBCA 2O7IA 4RY1A 3HHGA 3IJXB 3ROJA 1JNFA 3TTMA 2Y7WA 1FQDA 2KLFA 2QVUA 3RQTA 3W9VA 2B4MA 2DWIA 4HE0A 2E0SA 1NH8A 5CMKA 1FBGA 1RYXA 4H45A 3FXRA 3LUYA 4KHZE 4OANA 2X7QA 2ZYMA 4PAKA 1D3KA 4GWXA 4NF6B 2R9JA 5M2VA 5KDTA 4GWZA 2HXRA 4PFRA 2Z8FA 1FPBA 2H4IA 4BDMA 1B1XA 4EDPA 3BIGA 2IA4A 4FE8A 4YKKA 4XEQA 5A5LA 3HFUA 4G4PA 2B3BA 3CR9A 3SEYA 5ISUA 1EZOA 4PFIA 3HHFA 4KCDA 1PBPA 2F7AA 3AXFA 4KQPA 4NMYA 4QFOA 1OLAA 4DXBA 1MXUA 1D9QA 2ONKE 3EHSA 3N26A 4OTEA 1G0HA 3PD8A 4MF3A 5K2YA 1A8EA 4JBZA 1LB9A 4ZE8A 4H8IA 1I6AA 2XXWA 2VHAA 1YZ0A 3CHGA 4ZE9A 1LFIA 5I56B 4PFTA 1EYKA 1FCKA 3B7DA 3G3FA 3TCHA 3VDFA 1LBZA 2Y5KA 1NNFA 1YTVA 3LBSA 4C0RA 1FQCA 3KN7A 1DSNA 1N76A 4POXA 4IGRA 4X48A 3K1NA 2V3TA 3C34A 4PE3A 4N91A 5EYGA 1Y4TA 2UYFA 1B6HA 2H98A 1IQ7A 1ELJA 4R6KA 3DELB 2F78A 5B70A 2PYYA 4ZEBA 1P99A 1XT8A 4MJOA 4PFYA 3D1RA 5H8HA 3O66A 4C1TA 4ZEDA 3SETA 4HXVA 1IITA 2CZKA 4JXIA 3U94A 2XWVA 1MPCA 2Z22A 4U1OA 4YB6A 1B3HA 3BBRA 3H3GA 2W7YA 3SESA 4XF5A 1B40A 1XI6A 4MHFA 1NL5A 2D3IA 5CBSA 2F34A 4XKRA 4O3BA 1PBQA 3ODBA 2ABHA 4FATA 4NGUA 2BJJX 2OJTA 3QAXA 3SDFA 1B05A 1NV7A 3RLFE 5HM4B 4P1LA 2XXIA 3KZGA 3P7IA 1K9YA 4O8MA 1B7UA 4R75A 1B0LA 2H25A 4PFWA 3B6WA 4H5GA 4X1BA 1A99A 5F1QA 3SKPA 3WAEA 4XKPA 3L6GA 1N7XA 1BK4A 3UA8A 3I5OA 1NV0A 4PF8A 1LFGA 5CM6A 1B4ZA 5JTYB 1B32A 3V8XB 4GIZA 1TFDA 3M3KA 1R6ZA 4OWDA 2HZKA 2WYPA 4BDNA 3H03A 5K2XA 1FQAA 3DM0A 3OD7A 4G8NA 4RXLA 3MP6A 1ZMGA 4Q5TA 1SBPA 3C35A 3FXQA 1IXGA 1FW0A 1QUKA 3KOSA 1DTZA 3IFCA 3KSXA 2HEUA 5ICTA 3D4CA 5IKBA 1YCJA 3O6IA 3UP9A 4GF8A 3F11A 4EF2A 1UQWA 5IM2A 1URSA 4Q30B 1PDAA 1USYH 3QXMA 3CG3A 4PBHA 3K6WA 5H8QA 1NV3A 1KWHA 1LBWA 3O29A 3OO8A 3FJ7A 4H5FA 3C31A 3N6TA 1NMUA 1MY3A 3H6TA 3LR1A 5EQ8A 1VR5A 4F2OA 4G68A 3FJMA 3S9EA 1S7YA 2FVZA 1H3DA 4I1DA 3MJNA 2RC8A 4GX6A 1B7HA 3RTWB 1B0HA 3B6TA 1AH5A 4FORA 5IGAA 1FSAA 2XXTA 3VVEA 1PC3A 5I59B 2YPNA 3JV9A 2Z23A 1FTJA 3KEIA 3RN8A 2B4LA 2Y84A 4NE4A 4LZ7A 2QVRA 1RKMA 3U8QA 1B51A 4GWUA 4TLMB 3MZ1A 4GOTA 2HHMA 1A7LA 1NNPA 5JEIA 2I0BA 4PQJA 4ESWA 3OEMA 4P11A 4OEUA 4KCCA 1LB8A 3IL1B 4MIJA 5DVFA 5IZZA 4PAFA 4IO4A 3V83A 1TXFA 1LBCA 4GVOA 2OK2A 1FQBA 2LAOA 2Y7IA 3MP8A 1PEBA 2PMSA 1GGGA 3TTNA 3FD3A 1MQGA 2ZYOA 1JEVA 1LBVA 2MKZA 4EQ9A 4G8MA 1UTBB 1YYZA 3DP8A 3TQLA 1Z7ME 1SYHA 4RK9A 1EH3A 1M5EA 4F2QA 5H8SA 2AYSA 4PF6A 2ONSA 3SEWA 2HPGA 3MUQA 4PDHA 2XXVA 5L9SA 4NHBA 4O3AA 2ZXTA 5B7DA 1O7TA 3C4MA 2V3QA 2XWKA 3O9PA 5DT6A 5DYHA 5KCJA 4IR8A 1QW0A 2DWHA 4GX3A 3RPLB 3U1OA 3FVKA 4LA9A 3PTYA 4GX4A 5EYHA 3Q28A 1FPJA 4HCWA 1UTHA 5TPAA 2ZNUA 4R9FA 4FAJA 1WODA 1IMBA 1N3XA 2HXWA 1M5DA 1B3LA 1EYJA 2VT5A 3IB2A 3L6HA 5HBCA 5A5XA 3EHUA 2XD3A 4NF8A 2OWTA 3GYYA 3E78A 1NUWA 3PPOA 2UVJA 4UA8A 2HQ0A 1Y4CA 5I58A 1A8FA 1B2HA 4K3FA 4KYSA 1URGA 4WXJA 2PT1A 5I3SA 2H99A 1FTAA 1N84A 1ZU0A 1N04A 1L5TA 5EQAA 1RDZA 2R71A 1B3GA 4PAIA 4XTCQ 3MBPA 4N6KA 2DWJA 4JWOA 4QFPA 4PP0A 4QFNA 3IAZA 4F3PA 3IX1A 1XOCA 1DMBA 4ONYA 3VLUA 5EYFA 2QS1A 1T0KA 1S50A 1ZLQA 3MZBA 1D9VA 5I2KB 3PPPA 3K1MA 4NF5A 1IEJA 4NG7A 3LV0A 2RC9A 3TKDA 4GWWA 4KI0E 5ELVA 1JEUA 1G0IA 1SW4A 2DP8A 1TFAA 4M1VA 4O3CA 4NAPA 2PVUA 2QMXA 3RGYA 2XX9A 1VFDA 4MNCA 3W9WA 4P3LA 5IZ3B 4JSDA 3T9XB 4AB5A 1YPNA 1B3EA 3IOTA 4X9TA 4YZZA 3C9HA 5FHOA 1MXYA 4F22A 1I6QA 2XWIA 1NUYA 4DXCA 1ZKBA 4NF6A 3PMXA 3D4GA 2F97A 4F3GA 5JK4A 5I2NB 3VXBA 2KQZA 3OOAA 5CC2A 5I2NA 4QFLA 2F5XA 1IMDA 4PGNA 2VGQA 5IAIA 1GV8A 4JDFA 2QFLA 3PUZE 3FV1A 2QS2A 1Z7NE 3U72A 2X7PA 1URDA 2I4BA 4OEVA 1MY1A 3B8BA 3Q26A 2VPNA 4OVSA 1HSJA 4ZEKA 1K9ZA 1SDXA 1FJ6A 4DZ1A 5CRYA 3PV0E 3FASA 2O6AA 4N13A 3V89B 1CNQA 4UACA 3BFTA 3S9LC 2O84X 1QULA 1ZTYA 4P0GA 3ONMA 4JWYA 2UVHA 1B3FA 1OVTA 2H5YA 4N07A 4R6YA 1LAGE 5I56A 1VFEA 2OWSA 4JB7A 1N7WA 3EHTA 3MQ9A 1US4A 1A40A 1DPEA 5I84A 4GBWA 3OEKA 1FPKA 3JYRA 5DEXB 4MLVA 3USDA 1EZ9A 3MWBA 3MW0A 2OX3A 3LC8A 3SEXA 2X26A 3E9XA 4ELOA 5ET8A 3K6VA 1FTOA 3T96B 4IGTA 5T3JA 2O7UA 1IMAA 4BDRA 2HFBA 3FATA 4QXDA 3K6UA 4PDDA 4XKQA 2QSXA 3ZS6A 2XHDA 1FTLA 2I48A 3I6VA 2Q89A 3R7XA 4ECFA 2A5TB 2E1SA 4QHQA 1EYIA 2PBWA 1O63A 4OENA 4F1VA 4H0WA 1QJMA 4U4SA 3I3VA 2DDKA 2QL3A 3S9MC 3DP4A 3V5AA 4JVDA 3TCFA 5FHMA 1AIVA 3LUZA 1POY1 2QRYA 4NF4B 2Y7RA 1IZ1A 1MQHA 4MLQA 5AA4B 1Q35A 3DP6A 3FV2A 4FECA 4ELQA 1KZ8A 2B3FA 1II5A 2O1LA 3S4UA 4PC9A 4ELPA 1P1QA 1Y1ZA 4OVQA 1XVXA 1TWYA 1RDYA 2I3VA 4OVPA 2XXQA 1VSOA 2O69A 4G8HA 4YMAA 2I3WA 1IXCA 1DK4A 1HSEA 5EHMA 1FBPA 1SW2A 1KA1A 4U23A 5BUUA 4OFLA 2KR0A 3M8UA
chains in the Genus database with same CATH topology
5JTYA 3OENA 5F7VA 5AA2B 2YJPA 2HAVA 2WKYA 2ZNSA 3IOUA 3H6UA 3FVOA 3IJOB 1JVYA 4WEPA 1OMPA 4F19A 1ATGA 3FVNA 3CVGA 2QMWA 4BDQA 2ANJA 4EQBA 4P0IA 1OLCA 4GXSB 4Z0IA 2VP1A 3U93A 3WAFA 1B5IA 1Y1MA 5LOMA 4Q8RA 3PUVE 2VD2A 2F7BA 3TTKA 1B58A 1QUJA 4ZECA 1M5FA 4F1YA 4M4GA 4OXVA 4XXUA 2THIA 2NVUB 3A3CA 3FIRA 4KYDA 4ZEFA 3G3KA 3THIA 3H4ZA 1WVJA 2V3UA 4U4XA 1RYOA 3K01A 5I59A 2RINA 3KSJA 3TQWA 2Z8DA 4OHNA 4IO2A 5DVJA 2NXOA 2I58A 3K2DA 3LSXA 2OZZA 4DIGA 1PB7A 4PE5B 4YKJA 3A3UA 1FQFA 2F36A 5AA3A 3M3LA 5CMBA 1USYE 3MC2A 3RTFB 3C32A 3VE1B 4LP2B 3RPWA 1ZBMA 4H67A 2UYEA 3ILTB 1ZIUA 4I62A 3CIJA 2QS3A 3O97A 2Q88A 3T22A 4G77A 1LSTA 1EZPA 1JW4A 1MDP1 3KJTA 4OVJA 1Q1KA 3S9NC 3GBBA 1UTBA 1CB6A 4OESA 4F18A 1OQGA 1MDQA 4H1XA 3TFLA 3BKIB 1P1OA 2G93A 3QIMA 3E13X 1AMFA 4QSCA 4FIMA 1GR2A 1D9YA 2P2AA 3IR1A 1JVXA 1LAHE 5L8DA 4IB2A 1JQFA 3PD9A 2PX1A 2OCUA 4OETA 2ZNTA 5AE4A 3FJGA 1H44A 3IB0A 5H8FB 3OXNA 4H6DA 3CG1A 4XKNA 2FNCA 2AIXA 3U92A 2ZMBA 3TDJA 3RNNA 2OLBA 4LVQA 3HPIA 1FQEA 5L9OA 3CSGA 3TPAA 1MXWA 4JWXA 4F39A 5BWJA 5CBRA 3PUWE 1SQYA 3TMGA 1QKAA 4GL8A 1HSLA 1TT1A 2DS9A 3TCGA 3UORA 1IUDA 1M5CA 2RCAA 4U1ZA 3QUFA 1NNTA 3EPEA 1LFHA 4OFJA 3O28A 1I69A 1H45A 3KN8A 2F7CA 4FEDA 4GD5A 4R9GA 1XC1A 3RY3A 3PU5A 2I6EA 3O2AA 3IK6B 4GLIA 1MM6A 2UVIA 3MPLA 4MBPA 4OERA 4LATA 2XX8A 1MXXA 4RYAA 5I57B 5I2KA 3LSWA 3IOVA 3T9VA 1IXHA 3R26A 4L17A 5H8NB 1Y9UA 2F35A 1BIYA 1B9JA 1MXZA 1H43A 3HN0A 2I0CA 3EN3A 1FTMA 2UVGA 3MPKA 4Q0CA 1LAXA 1B1HA 5TP9B 4YICA 4MH5A 4EF1A 1GTKA 1CE2A 5CMMA 4ELRA 1IXIA 3VVFA 3CFXA 1ZJLA 2QJEA 4EUOA 4YB5A 2QS4A 3OMBA 2DVZA 4KYEA 1MY0A 2O68A 4IO3A 2XXPA 4NTLA 2F6GA 3ZSFA 5CI5A 4F3SA 5L9MA 1NKXA 2GRVA 3TEPA 1MQDA 1B7ZA 1LGBC 1UIUA 4OQOA 3KG2A 5ITPA 4HCYA 4KPTA 5KDTB 1P1UA 3LSLA 4E0XA 2AL5A 5FTHA 3CRBA 4QRZA 1A55A 3BFUA 4QFKA 2NWJA 1DOTA 3GBAA 3TYHA 3OO7A 3ECRA 2GFEA 3T66A 4RPOA 4H8JA 3K6XA 3M3FA 4PFUA 4TQUQ 2O1MA 4ZZAA 3E4RA 3PUYE 1DTGA 5KZTA 4KFQA 1MPDA 1NNKA 1Y3PA 1BTJA 2RF1A 2NUVA 3G3GA 3IO6A 4GRKA 5FTIA 1DPPA 1LCFA 5DEXA 2DQVA 3K4UA 4NWDA 2Q2CA 1B46A 3G3IA 4BDOA 3T9HB 3PGFA 4U22A 2B65A 3PPQA 4ND9A 4F31B 2IEEA 2DXRA 2P1SA 3R6UA 2Z8EA 2DSFA 5EHSA 2ALUA 3TTLA 1SVXB 2Q2AA 4R73A 1SI1A 2DE3A 2A5TA 4IO6A 3HO7A 2V25A 4FJPA 4G68C 4Z7EA 1PB9A 3GLBA 4RPNA 3GZGA 4JSOA 5H8HB 3MVZA 4RK2A 4DCYA 4R2FA 1BLFA 3Q29A 5CMCA 3N94A 3O6GA 2XXHA 4NF4A 4YMBA 1MPBA 5AA4A 4HW8A 4QSEA 1VE4A 4OYVA 3CFLA 4TLLB 4BDLA 3KJ7A 3G7WA 3B6QA 1EU8A 2HAUA 3UK4A 3C33A 1R9LA 4YU0A 4DDDA 2DE2A 1MQIA 3N5LA 4POWA 2VOZA 3RT6B 1B4HA 5HPQA 2Y7KA 4KD5A 3VFJA 1YAEA 1MY2A 1JETA 3QSLA 4RA1A 1UIVA 4GL0A 4ZS9A 1MQJA 1B5JA 4QF9A 1MH4A 4U21A 2ZYKA 2PT2A 3W15C 5AA2A 3DLNA 2DOJA 1SYIA 4BLAA 2D21A 2XXRA 2HCAA 4OZ9A 3SEVA 3E3KA 3OELA 1MS7A 3QUJA 1Y3QA 2AL4A 3HV1A 1N0TA 1LCTA 4YAHX 4GFRA 2XD2A 4DCXA 4R74A 3IB1A 4GXAA 1A54A 4IY5A 3TZAA 3FUZA 3FVGA 3KBRA 2FA7A 2I4CA 2RKMA 2XX7A 1OVBA 3ILUB 4R2BA 1POTA 4R6HA 5H8QB 1JW1A 2DWAA 3CFZA 2I49A 3LSFB 1WDNA 2M8CA 3TODA 4YKPA 3N6UA 3OSRA 4LZ8A 2H9BA 4G68B 2CZLA 4I9DA 4F1UA 4YKIA 2VD3A 1BP5A 4DXUA 3MP1A 2GHAA 2RCBA 1D4NA 3IOWA 3K00A 2DVCA 2ONRA 1GVCA 5AA1A 3VLWA 3SERA 4ZDMA 4EXLA 1Y3NA 1I6BA 2FYIA 3GXAA 1H76A 4WKMA 3EQ1A 5ICQA 1SD3A 3K0VA 5FHNA 1MM7A 4U2RA 4IO5A 1P1WA 3PPNA 4NEDA 4RNSA 1R1NA 1B5HA 2REGA 4PETA 1NH7A 3G3HA 3O6HA 2YLNA 1XVYA 3UIFA 3VVDA 3QYTA 2R6GE 3H7MA 4LZ5A 1F9BA 4G2ZA 3VV5A 2ZYNA 1JW5A 3EF7A 4EXKA 3K02A 3FGSA 4N6PA 2CMOA 1FTKA 4HS7A 3KFMA 1MY4A 3T9UA 2D5WA 4TOZA 3H6VA 3TTRA 4I8CA 3S2VA 2ESNA 3H6WA 2XXUA 4AB6A 2XXXA 3JZJA 3VLVA 3TAJA 1SW5A 1P1NA 2XXYA 3QK6A 1O64A 2HZLA 4EQ7A 3Q25A 4F3BA 2REJA 4LUBA 2OBGA 3CSBA 4C1UA 2Q8JA 1QUIA 4ESXA 5TU0A 2UXAA 5DTBA 1N3WA 1B52A 4E0WA 4YB7A 2Q9TA 2F6PA 4R72A 4DLDA 5KCJB 5H8FA 3UGWA 3Q27A 3H06B 2GHBA 2V93A 1AL3A 1MG1A 2A5SA 4FEBA 3A09A 1UTHB 5TPAB 1LBBA 2GH9A 4OMBA 1QVSA 4HTGA 4IO7A 3TELA 1IIWA 3PUXE 2NOOA 3PMWA 1J1NA 3KGCA 3MAMA 3FXUA 4NWCA 2RC7A 4KR5A 4GWOA 2DYXA 2O51A 3ZKLA 1MXVA 5A5XB 1BKAA 1XS5A 3SEUA 1M5BA 4NF8B 3TUSA 3MVWA 3HSTA 5J1DA 2P0SA 1US5A 3OO6A 4F29A 3PPRA 1SI0A 4LQ5A 4QSDA 5I58B 4MFIA 3MVXA 3VXCA 2QPQA 3RT8A 3MZ9A 3ZKKA 3IORA 3T93B 4IY6A 3FZVA 4LONB 1LLSA 3PMVA 2G29A 3RUMA 4RJZA 1NFTA 3C36A 1ANFA 1LAFE 5ITOA 1OQHA 4DE8A 4LQ2A 3OSQA 4ISUA 4X1DA 5I57A 3IO4A 3KOTA 1Y20A 1MH3A 3OO9A 2Y7PA 3KN3A 3G3JA 5H8NA 4OFOA 4NF5B 3UN6A 2DXYA 4WEDA 2V84A 4H65A 5AA2D 1MRPA 2DE4A 3K1PA 1S9TA 1QKBA 5TP9A 3CI8A 2F8DA 1OIBA 1R9QA 4GQOA 4AQ4A 1SW1A 4THIA 3HCQA 1XHYA 1PB8A 4ZZEA 1AOVA 3MVYA 5DVIA 4ZEIA 4XIGQ 2O7IA 4RY1A 3HHGA 3IJXB 1JNFA 3TTMA 2Y7WA 1FQDA 2KLFA 3RQTA 3W9VA 2DWIA 2E0SA 1NH8A 5CMKA 1RYXA 3FXRA 3LUYA 4KHZE 2X7QA 2ZYMA 1D3KA 4NF6B 2R9JA 5M2VA 5KDTA 2Z8FA 2H4IA 4BDMA 1B1XA 4EDPA 2IA4A 4FE8A 4YKKA 4G4PA 2B3BA 3CR9A 3SEYA 5ISUA 1EZOA 3HHFA 4KCDA 1PBPA 2F7AA 3AXFA 4KQPA 4NMYA 4QFOA 1OLAA 4DXBA 1MXUA 2ONKE 3EHSA 3N26A 4OTEA 3PD8A 4MF3A 5K2YA 1A8EA 4JBZA 1LB9A 4ZE8A 4H8IA 1I6AA 2XXWA 2VHAA 4ZE9A 1LFIA 5I56B 4PFTA 1FCKA 3B7DA 3G3FA 3TCHA 3VDFA 1NNFA 1YTVA 3LBSA 4C0RA 1FQCA 3KN7A 1DSNA 1N76A 4POXA 4IGRA 4X48A 3K1NA 2V3TA 3C34A 1Y4TA 2UYFA 1B6HA 2H98A 1IQ7A 1ELJA 4R6KA 3DELB 2F78A 5B70A 2PYYA 4ZEBA 1P99A 1XT8A 4PFYA 5H8HA 3O66A 4C1TA 4ZEDA 3SETA 1IITA 4JXIA 3U94A 1MPCA 2Z22A 4U1OA 4YB6A 1B3HA 3BBRA 3H3GA 2W7YA 3SESA 1B40A 1NL5A 2D3IA 5CBSA 2F34A 4XKRA 4O3BA 1PBQA 3ODBA 2ABHA 4FATA 2BJJX 2OJTA 3QAXA 3SDFA 1B05A 3RLFE 5HM4B 2XXIA 3KZGA 3P7IA 1B7UA 4R75A 1B0LA 2H25A 4PFWA 3B6WA 4H5GA 4X1BA 1A99A 5F1QA 3SKPA 3WAEA 4XKPA 3L6GA 1N7XA 3UA8A 3I5OA 1LFGA 5CM6A 1B4ZA 5JTYB 1B32A 3V8XB 4GIZA 1TFDA 3M3KA 1R6ZA 4OWDA 2HZKA 4BDNA 3H03A 5K2XA 1FQAA 3DM0A 3OD7A 4G8NA 4RXLA 3MP6A 1ZMGA 4Q5TA 1SBPA 3C35A 3FXQA 1IXGA 1FW0A 1QUKA 3KOSA 1DTZA 3KSXA 2HEUA 5ICTA 3D4CA 5IKBA 1YCJA 3O6IA 3UP9A 4GF8A 3F11A 4EF2A 1UQWA 1URSA 4Q30B 1PDAA 1USYH 3QXMA 3CG3A 3K6WA 5H8QA 1KWHA 3O29A 3OO8A 3FJ7A 4H5FA 3C31A 3N6TA 1NMUA 1MY3A 3H6TA 3LR1A 1VR5A 4F2OA 4G68A 3FJMA 3S9EA 1S7YA 1H3DA 4I1DA 3MJNA 2RC8A 1B7HA 3RTWB 1B0HA 3B6TA 1AH5A 4FORA 2XXTA 3VVEA 1PC3A 5I59B 2YPNA 3JV9A 2Z23A 1FTJA 3KEIA 3RN8A 2Y84A 4NE4A 4LZ7A 1RKMA 3U8QA 1B51A 4TLMB 3MZ1A 4GOTA 1A7LA 1NNPA 5JEIA 2I0BA 4PQJA 4ESWA 3OEMA 4P11A 4OEUA 4KCCA 1LB8A 3IL1B 5DVFA 4IO4A 3V83A 1TXFA 1LBCA 4GVOA 2OK2A 1FQBA 2LAOA 2Y7IA 3MP8A 1PEBA 2PMSA 1GGGA 3TTNA 3FD3A 1MQGA 2ZYOA 1JEVA 4EQ9A 4G8MA 1UTBB 3DP8A 3TQLA 1Z7ME 1SYHA 4RK9A 1EH3A 1M5EA 4F2QA 5H8SA 2AYSA 2ONSA 3SEWA 3MUQA 2XXVA 5L9SA 4O3AA 2ZXTA 5B7DA 1O7TA 3C4MA 2V3QA 3O9PA 5DT6A 5DYHA 5KCJA 1QW0A 2DWHA 3U1OA 3FVKA 4LA9A 3Q28A 4HCWA 1UTHA 5TPAA 2ZNUA 4R9FA 4FAJA 1WODA 1N3XA 2HXWA 1M5DA 1B3LA 3IB2A 3L6HA 5HBCA 5A5XA 3EHUA 2XD3A 4NF8A 2OWTA 3PPOA 2UVJA 4UA8A 2HQ0A 1Y4CA 5I58A 1A8FA 1B2HA 4K3FA 4KYSA 1URGA 4WXJA 2PT1A 2H99A 1N84A 1ZU0A 1N04A 1L5TA 2R71A 1B3GA 4XTCQ 3MBPA 2DWJA 4JWOA 4QFPA 4PP0A 4QFNA 3IAZA 4F3PA 3IX1A 1XOCA 1DMBA 4ONYA 3VLUA 5EYFA 2QS1A 1T0KA 1S50A 1ZLQA 3MZBA 1D9VA 5I2KB 3PPPA 3K1MA 4NF5A 1IEJA 2RC9A 3TKDA 4KI0E 5ELVA 1JEUA 1SW4A 2DP8A 1TFAA 4M1VA 4O3CA 2PVUA 2QMXA 3RGYA 2XX9A 1VFDA 3W9WA 4JSDA 3T9XB 4AB5A 1YPNA 1B3EA 3IOTA 4X9TA 4YZZA 3C9HA 5FHOA 1MXYA 4F22A 1I6QA 4DXCA 1ZKBA 4NF6A 3PMXA 3D4GA 2F97A 4F3GA 5JK4A 5I2NB 3VXBA 3OOAA 5CC2A 5I2NA 4QFLA 2F5XA 2VGQA 5IAIA 1GV8A 4JDFA 3PUZE 3FV1A 2QS2A 1Z7NE 3U72A 2X7PA 1URDA 2I4BA 4OEVA 1MY1A 3Q26A 1HSJA 4ZEKA 1SDXA 4DZ1A 5CRYA 3PV0E 3FASA 2O6AA 4N13A 3V89B 4UACA 3BFTA 3S9LC 2O84X 1QULA 1ZTYA 4P0GA 3ONMA 4JWYA 2UVHA 1B3FA 1OVTA 2H5YA 4N07A 4R6YA 1LAGE 5I56A 1VFEA 2OWSA 4JB7A 1N7WA 3EHTA 3MQ9A 1US4A 1A40A 1DPEA 5I84A 3OEKA 3JYRA 5DEXB 4MLVA 3USDA 1EZ9A 3MWBA 3MW0A 3LC8A 3SEXA 4ELOA 2X26A 3E9XA 3K6VA 1FTOA 3T96B 4IGTA 2O7UA 4BDRA 2HFBA 3FATA 3K6UA 4XKQA 2QSXA 3ZS6A 2XHDA 1FTLA 2I48A 3I6VA 2Q89A 3R7XA 4ECFA 2A5TB 2E1SA 4QHQA 2PBWA 1O63A 4OENA 4F1VA 4H0WA 1QJMA 4U4SA 3I3VA 2QL3A 3S9MC 3DP4A 3V5AA 3TCFA 5FHMA 1AIVA 1POY1 2QRYA 4NF4B 2Y7RA 1IZ1A 1MQHA 4MLQA 5AA4B 1Q35A 3DP6A 3FV2A 4FECA 4ELQA 2B3FA 1II5A 2O1LA 3S4UA 4ELPA 1P1QA 1Y1ZA 1XVXA 1TWYA 2I3VA 2XXQA 1VSOA 2O69A 4G8HA 4YMAA 2I3WA 1IXCA 1HSEA 5EHMA 1SW2A 4U23A 5BUUA 4OFLA 3M8UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JTY A;  3OEN A;  5F7V A;  5AA2 B;  2YJP A;  2HAV A;  2WKY A;  2ZNS A;  3IOU A;  3H6U A;  3FVO A;  3IJO B;  1JVY A;  4WEP A;  1OMP A;  4F19 A;  1ATG A;  3FVN A;  3CVG A;  2QMW A;  4BDQ A;  2ANJ A;  4EQB A;  4P0I A;  1OLC A;  4GXS B;  4Z0I A;  2VP1 A;  3U93 A;  3WAF A;  1B5I A;  1Y1M A;  5LOM A;  4Q8R A;  3PUV E;  2VD2 A;  2F7B A;  3TTK A;  1B58 A;  1QUJ A;  4ZEC A;  1M5F A;  4F1Y A;  4M4G A;  4OXV A;  4XXU A;  2THI A;  2NVU B;  3A3C A;  3FIR A;  4KYD A;  4ZEF A;  3G3K A;  3THI A;  3H4Z A;  1WVJ A;  2V3U A;  4U4X A;  1RYO A;  3K01 A;  5I59 A;  2RIN A;  3KSJ A;  3TQW A;  2Z8D A;  4OHN A;  4IO2 A;  5DVJ A;  2NXO A;  2I58 A;  3K2D A;  3LSX A;  2OZZ A;  4DIG A;  1PB7 A;  4PE5 B;  4YKJ A;  3A3U A;  1FQF A;  2F36 A;  5AA3 A;  3M3L A;  5CMB A;  1USY E;  3MC2 A;  3RTF B;  3C32 A;  3VE1 B;  4LP2 B;  3RPW A;  1ZBM A;  4H67 A;  2UYE A;  3ILT B;  1ZIU A;  4I62 A;  3CIJ A;  2QS3 A;  3O97 A;  2Q88 A;  3T22 A;  4G77 A;  1LST A;  1EZP A;  1JW4 A;  1MDP 1;  3KJT A;  4OVJ A;  1Q1K A;  3S9N C;  3GBB A;  1UTB A;  1CB6 A;  4OES A;  4F18 A;  1OQG A;  1MDQ A;  4H1X A;  3TFL A;  3BKI B;  1P1O A;  2G93 A;  3QIM A;  3E13 X;  1AMF A;  4QSC A;  4FIM A;  1GR2 A;  1D9Y A;  2P2A A;  3IR1 A;  1JVX A;  1LAH E;  5L8D A;  4IB2 A;  1JQF A;  3PD9 A;  2PX1 A;  2OCU A;  4OET A;  2ZNT A;  5AE4 A;  3FJG A;  1H44 A;  3IB0 A;  5H8F B;  3OXN A;  4H6D A;  3CG1 A;  4XKN A;  2FNC A;  2AIX A;  3U92 A;  2ZMB A;  3TDJ A;  3RNN A;  2OLB A;  4LVQ A;  3HPI A;  1FQE A;  5L9O A;  3CSG A;  3TPA A;  1MXW A;  4JWX A;  4F39 A;  5BWJ A;  5CBR A;  3PUW E;  1SQY A;  3TMG A;  1QKA A;  4GL8 A;  1HSL A;  1TT1 A;  2DS9 A;  3TCG A;  3UOR A;  1IUD A;  1M5C A;  2RCA A;  4U1Z A;  3QUF A;  1NNT A;  3EPE A;  1LFH A;  4OFJ A;  3O28 A;  1I69 A;  1H45 A;  3KN8 A;  2F7C A;  4FED A;  4GD5 A;  4R9G A;  1XC1 A;  3RY3 A;  3PU5 A;  2I6E A;  3O2A A;  3IK6 B;  4GLI A;  1MM6 A;  2UVI A;  3MPL A;  4MBP A;  4OER A;  4LAT A;  2XX8 A;  1MXX A;  4RYA A;  5I57 B;  5I2K A;  3LSW A;  3IOV A;  3T9V A;  1IXH A;  3R26 A;  4L17 A;  5H8N B;  1Y9U A;  2F35 A;  1BIY A;  1B9J A;  1MXZ A;  1H43 A;  3HN0 A;  2I0C A;  3EN3 A;  1FTM A;  2UVG A;  3MPK A;  4Q0C A;  1LAX A;  1B1H A;  5TP9 B;  4YIC A;  4MH5 A;  4EF1 A;  1GTK A;  1CE2 A;  5CMM A;  4ELR A;  1IXI A;  3VVF A;  3CFX A;  1ZJL A;  2QJE A;  4EUO A;  4YB5 A;  2QS4 A;  3OMB A;  2DVZ A;  4KYE A;  1MY0 A;  2O68 A;  4IO3 A;  2XXP A;  4NTL A;  2F6G A;  3ZSF A;  5CI5 A;  4F3S A;  5L9M A;  1NKX A;  2GRV A;  3TEP A;  1MQD A;  1B7Z A;  1LGB C;  1UIU A;  4OQO A;  3KG2 A;  5ITP A;  4HCY A;  4KPT A;  5KDT B;  1P1U A;  3LSL A;  4E0X A;  2AL5 A;  5FTH A;  3CRB A;  4QRZ A;  1A55 A;  3BFU A;  4QFK A;  2NWJ A;  1DOT A;  3GBA A;  3TYH A;  3OO7 A;  3ECR A;  2GFE A;  3T66 A;  4RPO A;  4H8J A;  3K6X A;  3M3F A;  4PFU A;  4TQU Q;  2O1M A;  4ZZA A;  3E4R A;  3PUY E;  1DTG A;  5KZT A;  4KFQ A;  1MPD A;  1NNK A;  1Y3P A;  1BTJ A;  2RF1 A;  2NUV A;  3G3G A;  3IO6 A;  4GRK A;  5FTI A;  1DPP A;  1LCF A;  5DEX A;  2DQV A;  3K4U A;  4NWD A;  2Q2C A;  1B46 A;  3G3I A;  4BDO A;  3T9H B;  3PGF A;  4U22 A;  2B65 A;  3PPQ A;  4ND9 A;  4F31 B;  2IEE A;  2DXR A;  2P1S A;  3R6U A;  2Z8E A;  2DSF A;  5EHS A;  2ALU A;  3TTL A;  1SVX B;  2Q2A A;  4R73 A;  1SI1 A;  2DE3 A;  2A5T A;  4IO6 A;  3HO7 A;  2V25 A;  4FJP A;  4G68 C;  4Z7E A;  1PB9 A;  3GLB A;  4RPN A;  3GZG A;  4JSO A;  5H8H B;  3MVZ A;  4RK2 A;  4DCY A;  4R2F A;  1BLF A;  3Q29 A;  5CMC A;  3N94 A;  3O6G A;  2XXH A;  4NF4 A;  4YMB A;  1MPB A;  5AA4 A;  4HW8 A;  4QSE A;  1VE4 A;  4OYV A;  3CFL A;  4TLL B;  4BDL A;  3KJ7 A;  3G7W A;  3B6Q A;  1EU8 A;  2HAU A;  3UK4 A;  3C33 A;  1R9L A;  4YU0 A;  4DDD A;  2DE2 A;  1MQI A;  3N5L A;  4POW A;  2VOZ A;  3RT6 B;  1B4H A;  5HPQ A;  2Y7K A;  4KD5 A;  3VFJ A;  1YAE A;  1MY2 A;  1JET A;  3QSL A;  4RA1 A;  1UIV A;  4GL0 A;  4ZS9 A;  1MQJ A;  1B5J A;  4QF9 A;  1MH4 A;  4U21 A;  2ZYK A;  2PT2 A;  3W15 C;  5AA2 A;  3DLN A;  2DOJ A;  1SYI A;  4BLA A;  2D21 A;  2XXR A;  2HCA A;  4OZ9 A;  3SEV A;  3E3K A;  3OEL A;  1MS7 A;  3QUJ A;  1Y3Q A;  2AL4 A;  3HV1 A;  1N0T A;  1LCT A;  4YAH X;  4GFR A;  2XD2 A;  4DCX A;  4R74 A;  3IB1 A;  4GXA A;  1A54 A;  4IY5 A;  3TZA A;  3FUZ A;  3FVG A;  3KBR A;  2FA7 A;  2I4C A;  2RKM A;  2XX7 A;  1OVB A;  3ILU B;  4R2B A;  1POT A;  4R6H A;  5H8Q B;  1JW1 A;  2DWA A;  3CFZ A;  2I49 A;  3LSF B;  1WDN A;  2M8C A;  3TOD A;  4YKP A;  3N6U A;  3OSR A;  4LZ8 A;  2H9B A;  4G68 B;  2CZL A;  4I9D A;  4F1U A;  4YKI A;  2VD3 A;  1BP5 A;  4DXU A;  3MP1 A;  2GHA A;  2RCB A;  1D4N A;  3IOW A;  3K00 A;  2DVC A;  2ONR A;  1GVC A;  5AA1 A;  3VLW A;  3SER A;  4ZDM A;  4EXL A;  1Y3N A;  1I6B A;  2FYI A;  3GXA A;  1H76 A;  4WKM A;  3EQ1 A;  5ICQ A;  1SD3 A;  3K0V A;  5FHN A;  1MM7 A;  4U2R A;  4IO5 A;  1P1W A;  3PPN A;  4NED A;  4RNS A;  1R1N A;  1B5H A;  2REG A;  4PET A;  1NH7 A;  3G3H A;  3O6H A;  2YLN A;  1XVY A;  3UIF A;  3VVD A;  3QYT A;  2R6G E;  3H7M A;  4LZ5 A;  1F9B A;  4G2Z A;  3VV5 A;  2ZYN A;  1JW5 A;  3EF7 A;  4EXK A;  3K02 A;  3FGS A;  4N6P A;  2CMO A;  1FTK A;  4HS7 A;  3KFM A;  1MY4 A;  3T9U A;  2D5W A;  4TOZ A;  3H6V A;  3TTR A;  4I8C A;  3S2V A;  2ESN A;  3H6W A;  2XXU A;  4AB6 A;  2XXX A;  3JZJ A;  3VLV A;  3TAJ A;  1SW5 A;  1P1N A;  2XXY A;  3QK6 A;  1O64 A;  2HZL A;  4EQ7 A;  3Q25 A;  4F3B A;  2REJ A;  4LUB A;  2OBG A;  3CSB A;  4C1U A;  2Q8J A;  1QUI A;  4ESX A;  5TU0 A;  2UXA A;  5DTB A;  1N3W A;  1B52 A;  4E0W A;  4YB7 A;  2Q9T A;  2F6P A;  4R72 A;  4DLD A;  5KCJ B;  5H8F A;  3UGW A;  3Q27 A;  3H06 B;  2GHB A;  2V93 A;  1AL3 A;  1MG1 A;  2A5S A;  4FEB A;  3A09 A;  1UTH B;  5TPA B;  1LBB A;  2GH9 A;  4OMB A;  1QVS A;  4HTG A;  4IO7 A;  3TEL A;  1IIW A;  3PUX E;  2NOO A;  3PMW A;  1J1N A;  3KGC A;  3MAM A;  3FXU A;  4NWC A;  2RC7 A;  4KR5 A;  4GWO A;  2DYX A;  2O51 A;  3ZKL A;  1MXV A;  5A5X B;  1BKA A;  1XS5 A;  3SEU A;  1M5B A;  4NF8 B;  3TUS A;  3MVW A;  3HST A;  5J1D A;  2P0S A;  1US5 A;  3OO6 A;  4F29 A;  3PPR A;  1SI0 A;  4LQ5 A;  4QSD A;  5I58 B;  4MFI A;  3MVX A;  3VXC A;  2QPQ A;  3RT8 A;  3MZ9 A;  3ZKK A;  3IOR A;  3T93 B;  4IY6 A;  3FZV A;  4LON B;  1LLS A;  3PMV A;  2G29 A;  3RUM A;  4RJZ A;  1NFT A;  3C36 A;  1ANF A;  1LAF E;  5ITO A;  1OQH A;  4DE8 A;  4LQ2 A;  3OSQ A;  4ISU A;  4X1D A;  5I57 A;  3IO4 A;  3KOT A;  1Y20 A;  1MH3 A;  3OO9 A;  2Y7P A;  3KN3 A;  3G3J A;  5H8N A;  4OFO A;  4NF5 B;  3UN6 A;  2DXY A;  4WED A;  2V84 A;  4H65 A;  5AA2 D;  1MRP A;  2DE4 A;  3K1P A;  1S9T A;  1QKB A;  5TP9 A;  3CI8 A;  2F8D A;  1OIB A;  1R9Q A;  4GQO A;  4AQ4 A;  1SW1 A;  4THI A;  3HCQ A;  1XHY A;  1PB8 A;  4ZZE A;  1AOV A;  3MVY A;  5DVI A;  4ZEI A;  4XIG Q;  2O7I A;  4RY1 A;  3HHG A;  3IJX B;  1JNF A;  3TTM A;  2Y7W A;  1FQD A;  2KLF A;  3RQT A;  3W9V A;  2DWI A;  2E0S A;  1NH8 A;  5CMK A;  1RYX A;  3FXR A;  3LUY A;  4KHZ E;  2X7Q A;  2ZYM A;  1D3K A;  4NF6 B;  2R9J A;  5M2V A;  5KDT A;  2Z8F A;  2H4I A;  4BDM A;  1B1X A;  4EDP A;  2IA4 A;  4FE8 A;  4YKK A;  4G4P A;  2B3B A;  3CR9 A;  3SEY A;  5ISU A;  1EZO A;  3HHF A;  4KCD A;  1PBP A;  2F7A A;  3AXF A;  4KQP A;  4NMY A;  4QFO A;  1OLA A;  4DXB A;  1MXU A;  2ONK E;  3EHS A;  3N26 A;  4OTE A;  3PD8 A;  4MF3 A;  5K2Y A;  1A8E A;  4JBZ A;  1LB9 A;  4ZE8 A;  4H8I A;  1I6A A;  2XXW A;  2VHA A;  4ZE9 A;  1LFI A;  5I56 B;  4PFT A;  1FCK A;  3B7D A;  3G3F A;  3TCH A;  3VDF A;  1NNF A;  1YTV A;  3LBS A;  4C0R A;  1FQC A;  3KN7 A;  1DSN A;  1N76 A;  4POX A;  4IGR A;  4X48 A;  3K1N A;  2V3T A;  3C34 A;  1Y4T A;  2UYF A;  1B6H A;  2H98 A;  1IQ7 A;  1ELJ A;  4R6K A;  3DEL B;  2F78 A;  5B70 A;  2PYY A;  4ZEB A;  1P99 A;  1XT8 A;  4PFY A;  5H8H A;  3O66 A;  4C1T A;  4ZED A;  3SET A;  1IIT A;  4JXI A;  3U94 A;  1MPC A;  2Z22 A;  4U1O A;  4YB6 A;  1B3H A;  3BBR A;  3H3G A;  2W7Y A;  3SES A;  1B40 A;  1NL5 A;  2D3I A;  5CBS A;  2F34 A;  4XKR A;  4O3B A;  1PBQ A;  3ODB A;  2ABH A;  4FAT A;  2BJJ X;  2OJT A;  3QAX A;  3SDF A;  1B05 A;  3RLF E;  5HM4 B;  2XXI A;  3KZG A;  3P7I A;  1B7U A;  4R75 A;  1B0L A;  2H25 A;  4PFW A;  3B6W A;  4H5G A;  4X1B A;  1A99 A;  5F1Q A;  3SKP A;  3WAE A;  4XKP A;  3L6G A;  1N7X A;  3UA8 A;  3I5O A;  1LFG A;  5CM6 A;  1B4Z A;  5JTY B;  1B32 A;  3V8X B;  4GIZ A;  1TFD A;  3M3K A;  1R6Z A;  4OWD A;  2HZK A;  4BDN A;  3H03 A;  5K2X A;  1FQA A;  3DM0 A;  3OD7 A;  4G8N A;  4RXL A;  3MP6 A;  1ZMG A;  4Q5T A;  1SBP A;  3C35 A;  3FXQ A;  1IXG A;  1FW0 A;  1QUK A;  3KOS A;  1DTZ A;  3KSX A;  2HEU A;  5ICT A;  3D4C A;  5IKB A;  1YCJ A;  3O6I A;  3UP9 A;  4GF8 A;  3F11 A;  4EF2 A;  1UQW A;  1URS A;  4Q30 B;  1PDA A;  1USY H;  3QXM A;  3CG3 A;  3K6W A;  5H8Q A;  1KWH A;  3O29 A;  3OO8 A;  3FJ7 A;  4H5F A;  3C31 A;  3N6T A;  1NMU A;  1MY3 A;  3H6T A;  3LR1 A;  1VR5 A;  4F2O A;  4G68 A;  3FJM A;  3S9E A;  1S7Y A;  1H3D A;  4I1D A;  3MJN A;  2RC8 A;  1B7H A;  3RTW B;  1B0H A;  3B6T A;  1AH5 A;  4FOR A;  2XXT A;  3VVE A;  1PC3 A;  5I59 B;  2YPN A;  3JV9 A;  2Z23 A;  1FTJ A;  3KEI A;  3RN8 A;  2Y84 A;  4NE4 A;  4LZ7 A;  1RKM A;  3U8Q A;  1B51 A;  4TLM B;  3MZ1 A;  4GOT A;  1A7L A;  1NNP A;  5JEI A;  2I0B A;  4PQJ A;  4ESW A;  3OEM A;  4P11 A;  4OEU A;  4KCC A;  1LB8 A;  3IL1 B;  5DVF A;  4IO4 A;  3V83 A;  1TXF A;  1LBC A;  4GVO A;  2OK2 A;  1FQB A;  2LAO A;  2Y7I A;  3MP8 A;  1PEB A;  2PMS A;  1GGG A;  3TTN A;  3FD3 A;  1MQG A;  2ZYO A;  1JEV A;  4EQ9 A;  4G8M A;  1UTB B;  3DP8 A;  3TQL A;  1Z7M E;  1SYH A;  4RK9 A;  1EH3 A;  1M5E A;  4F2Q A;  5H8S A;  2AYS A;  2ONS A;  3SEW A;  3MUQ A;  2XXV A;  5L9S A;  4O3A A;  2ZXT A;  5B7D A;  1O7T A;  3C4M A;  2V3Q A;  3O9P A;  5DT6 A;  5DYH A;  5KCJ A;  1QW0 A;  2DWH A;  3U1O A;  3FVK A;  4LA9 A;  3Q28 A;  4HCW A;  1UTH A;  5TPA A;  2ZNU A;  4R9F A;  4FAJ A;  1WOD A;  1N3X A;  2HXW A;  1M5D A;  1B3L A;  3IB2 A;  3L6H A;  5HBC A;  5A5X A;  3EHU A;  2XD3 A;  4NF8 A;  2OWT A;  3PPO A;  2UVJ A;  4UA8 A;  2HQ0 A;  1Y4C A;  5I58 A;  1A8F A;  1B2H A;  4K3F A;  4KYS A;  1URG A;  4WXJ A;  2PT1 A;  2H99 A;  1N84 A;  1ZU0 A;  1N04 A;  1L5T A;  2R71 A;  1B3G A;  4XTC Q;  3MBP A;  2DWJ A;  4JWO A;  4QFP A;  4PP0 A;  4QFN A;  3IAZ A;  4F3P A;  3IX1 A;  1XOC A;  1DMB A;  4ONY A;  3VLU A;  5EYF A;  2QS1 A;  1T0K A;  1S50 A;  1ZLQ A;  3MZB A;  1D9V A;  5I2K B;  3PPP A;  3K1M A;  4NF5 A;  1IEJ A;  2RC9 A;  3TKD A;  4KI0 E;  5ELV A;  1JEU A;  1SW4 A;  2DP8 A;  1TFA A;  4M1V A;  4O3C A;  2PVU A;  2QMX A;  3RGY A;  2XX9 A;  1VFD A;  3W9W A;  4JSD A;  3T9X B;  4AB5 A;  1YPN A;  1B3E A;  3IOT A;  4X9T A;  4YZZ A;  3C9H A;  5FHO A;  1MXY A;  4F22 A;  1I6Q A;  4DXC A;  1ZKB A;  4NF6 A;  3PMX A;  3D4G A;  2F97 A;  4F3G A;  5JK4 A;  5I2N B;  3VXB A;  3OOA A;  5CC2 A;  5I2N A;  4QFL A;  2F5X A;  2VGQ A;  5IAI A;  1GV8 A;  4JDF A;  3PUZ E;  3FV1 A;  2QS2 A;  1Z7N E;  3U72 A;  2X7P A;  1URD A;  2I4B A;  4OEV A;  1MY1 A;  3Q26 A;  1HSJ A;  4ZEK A;  1SDX A;  4DZ1 A;  5CRY A;  3PV0 E;  3FAS A;  2O6A A;  4N13 A;  3V89 B;  4UAC A;  3BFT A;  3S9L C;  2O84 X;  1QUL A;  1ZTY A;  4P0G A;  3ONM A;  4JWY A;  2UVH A;  1B3F A;  1OVT A;  2H5Y A;  4N07 A;  4R6Y A;  1LAG E;  5I56 A;  1VFE A;  2OWS A;  4JB7 A;  1N7W A;  3EHT A;  3MQ9 A;  1US4 A;  1A40 A;  1DPE A;  5I84 A;  3OEK A;  3JYR A;  5DEX B;  4MLV A;  3USD A;  1EZ9 A;  3MWB A;  3MW0 A;  3LC8 A;  3SEX A;  4ELO A;  2X26 A;  3E9X A;  3K6V A;  1FTO A;  3T96 B;  4IGT A;  2O7U A;  4BDR A;  2HFB A;  3FAT A;  3K6U A;  4XKQ A;  2QSX A;  3ZS6 A;  2XHD A;  1FTL A;  2I48 A;  3I6V A;  2Q89 A;  3R7X A;  4ECF A;  2A5T B;  2E1S A;  4QHQ A;  2PBW A;  1O63 A;  4OEN A;  4F1V A;  4H0W A;  1QJM A;  4U4S A;  3I3V A;  2QL3 A;  3S9M C;  3DP4 A;  3V5A A;  3TCF A;  5FHM A;  1AIV A;  1POY 1;  2QRY A;  4NF4 B;  2Y7R A;  1IZ1 A;  1MQH A;  4MLQ A;  5AA4 B;  1Q35 A;  3DP6 A;  3FV2 A;  4FEC A;  4ELQ A;  2B3F A;  1II5 A;  2O1L A;  3S4U A;  4ELP A;  1P1Q A;  1Y1Z A;  1XVX A;  1TWY A;  2I3V A;  2XXQ A;  1VSO A;  2O69 A;  4G8H A;  4YMA A;  2I3W A;  1IXC A;  1HSE A;  5EHM A;  1SW2 A;  4U23 A;  5BUU A;  4OFL A;  3M8U A; 
#chains in the Genus database with same CATH topology
 5JTY A;  3OEN A;  5F7V A;  4O7M A;  5AA2 B;  2YJP A;  2HAV A;  2WKY A;  2ZNS A;  3IOU A;  3H6U A;  1NI9 A;  3FVO A;  3IJO B;  1JVY A;  4WEP A;  1OMP A;  4F19 A;  1ATG A;  3FVN A;  4MNP A;  2CZH A;  3CVG A;  2QMW A;  4BDQ A;  2ANJ A;  4EQB A;  2CEY A;  4P0I A;  1OLC A;  4GXS B;  4Z0I A;  2VP1 A;  4P8B A;  3U93 A;  3WAF A;  1B5I A;  1Y1M A;  5LOM A;  4Q8R A;  3PUV E;  2VD2 A;  2F7B A;  3TTK A;  1B58 A;  1QUJ A;  4ZEC A;  1M5F A;  4UAB A;  4F1Y A;  4O94 A;  4M4G A;  2L5V A;  4OXV A;  4XXU A;  2THI A;  2NVU B;  3A3C A;  3FIR A;  4KYD A;  4ZEF A;  4MNI A;  3G3K A;  3THI A;  3H4Z A;  1WVJ A;  2V3U A;  4U4X A;  1RYO A;  3K01 A;  2QVV A;  4JVI A;  5I59 A;  2RIN A;  3KSJ A;  3NOH A;  3TQW A;  2Z8D A;  4OHN A;  4IO2 A;  5DVJ A;  2NXO A;  2I58 A;  3K2D A;  3LSX A;  2OZZ A;  4DIG A;  4N6D A;  1PB7 A;  4PE5 B;  4YKJ A;  3A3U A;  1FQF A;  2F36 A;  2WX9 A;  5AA3 A;  3M3L A;  4N81 A;  5CMB A;  1USY E;  3MC2 A;  3RTF B;  3C32 A;  3VE1 B;  4LP2 B;  3RPW A;  1ZBM A;  4H67 A;  4QBA A;  2UYE A;  3ILT B;  1FPL A;  1ZIU A;  4I62 A;  4MEV A;  3CIJ A;  2QS3 A;  1LBX A;  3O97 A;  2Q88 A;  3T22 A;  4G77 A;  1LST A;  1EZP A;  1JW4 A;  3KC1 A;  1NV4 A;  3SZP A;  1MDP 1;  3KJT A;  4OVJ A;  1Q1K A;  4GWS A;  3S9N C;  3GBB A;  1UTB A;  1CB6 A;  4OES A;  1FBF A;  4F18 A;  4PFB A;  1OQG A;  1FPD A;  4GWY A;  1MDQ A;  4H1X A;  3TFL A;  2R8T A;  3BKI B;  1P1O A;  4N8Y A;  2G93 A;  3QIM A;  3E13 X;  4NX1 A;  1AMF A;  4QSC A;  4FIM A;  1GR2 A;  1D9Y A;  2P2A A;  3IR1 A;  1JVX A;  1LAH E;  3IFA A;  5L8D A;  3E79 A;  4IB2 A;  1JQF A;  4PBQ A;  3PD9 A;  2PX1 A;  2OCU A;  4OET A;  2ZNT A;  4I40 A;  5AE4 A;  3FJG A;  1H44 A;  4HE2 A;  3RPL A;  1NUZ A;  3IB0 A;  5H8F B;  3OXN A;  4H6D A;  3CG1 A;  4XKN A;  5FBP A;  2FNC A;  2AIX A;  3U92 A;  4OVT A;  2ZMB A;  3TDJ A;  3RNN A;  2OLB A;  4LVQ A;  1FBD A;  3HPI A;  1FQE A;  5L9O A;  3CSG A;  3TPA A;  1MXW A;  4JWX A;  4F39 A;  5BWJ A;  5CBR A;  3PUW E;  4X04 A;  1SQY A;  3TMG A;  1QKA A;  4N8G A;  4GL8 A;  1HSL A;  1TT1 A;  2DS9 A;  3TCG A;  3UOR A;  1IUD A;  1M5C A;  2RCA A;  3T0J A;  4U1Z A;  3QUF A;  4N15 A;  1NNT A;  4PGP A;  3EPE A;  1LFH A;  3QMF A;  4OFJ A;  3O28 A;  1I69 A;  1H45 A;  3KN8 A;  3RYD A;  2F7C A;  4FED A;  4GD5 A;  1FPF A;  4R9G A;  1XC1 A;  3RY3 A;  3PU5 A;  2I6E A;  3O2A A;  3IK6 B;  4GLI A;  1MM6 A;  1JP4 A;  2UVI A;  3MPL A;  4MBP A;  4OER A;  4LAT A;  2XX8 A;  1MXX A;  1NV2 A;  4RYA A;  5I57 B;  5I2K A;  3LSW A;  3IOV A;  3T9V A;  1IXH A;  3R26 A;  4L17 A;  4AS5 A;  5H8N B;  1Y9U A;  2F35 A;  1QGX A;  1BIY A;  1B9J A;  1MXZ A;  1H43 A;  3HN0 A;  2I0C A;  3EN3 A;  1FTM A;  2UVG A;  3MPK A;  4Q0C A;  1LAX A;  1B1H A;  5TP9 B;  1INP A;  5ET6 A;  4YIC A;  4MH5 A;  4EF1 A;  1GTK A;  1CE2 A;  4P1E A;  5CMM A;  4ELR A;  1IXI A;  3VVF A;  3CFX A;  1AWB A;  1ZJL A;  2QJE A;  5IZ3 A;  4EUO A;  4YB5 A;  2QS4 A;  3OMB A;  5I5P A;  2DVZ A;  4KYE A;  4MMP A;  1MY0 A;  2O68 A;  4IO3 A;  2XXP A;  4NTL A;  2F6G A;  4G61 A;  3ZSF A;  5CI5 A;  4F3S A;  5L9M A;  1NKX A;  2PCR A;  2GRV A;  3TEP A;  1MQD A;  1B7Z A;  1LGB C;  1UIU A;  2Q8M A;  2VPO A;  4N4U A;  1VDW A;  4OQO A;  1KA0 A;  2FHY A;  3KBZ A;  3KG2 A;  5ITP A;  4HCY A;  4P9K A;  4NF0 A;  4KPT A;  5KDT B;  4N17 A;  1P1U A;  3LSL A;  4E0X A;  2AL5 A;  3B50 A;  5FTH A;  3CRB A;  4QRZ A;  1A55 A;  3BFU A;  4QFK A;  2NWJ A;  1DCU A;  1DOT A;  3GBA A;  3TYH A;  3OO7 A;  3ECR A;  1NUX A;  2GFE A;  3T66 A;  4RPO A;  4H8J A;  3K6X A;  3M3F A;  2FIE A;  4H46 A;  4NN3 A;  4PFU A;  4TQU Q;  2O1M A;  4ZZA A;  3E4R A;  3PUY E;  1DTG A;  5KZT A;  4KFQ A;  2JJK A;  1MPD A;  1NNK A;  1Y3P A;  4DI4 B;  1BTJ A;  2RF1 A;  2NUV A;  3G3G A;  3IO6 A;  4GRK A;  5FTI A;  1FJ9 A;  1DPP A;  1LCF A;  3BIH A;  5DEX A;  1FPE A;  2DQV A;  3K4U A;  4NWD A;  2Q2C A;  1B46 A;  3G3I A;  4BDO A;  3T9H B;  3PGF A;  4I3E A;  2F3D A;  4U22 A;  2B65 A;  1LBY A;  3PPQ A;  4ND9 A;  4F31 B;  2IEE A;  2DXR A;  2P1S A;  3R6U A;  2Z8E A;  4HE1 A;  2DSF A;  5EHS A;  2ALU A;  4NQ8 A;  3TTL A;  1SVX B;  2Q2A A;  4R73 A;  1SI1 A;  2DE3 A;  2P3V A;  2A5T A;  4IO6 A;  3HO7 A;  2V25 A;  4FJP A;  4G68 C;  4Z7E A;  1PB9 A;  3GLB A;  4RPN A;  3GZG A;  4JSO A;  4MAG A;  5IZ1 A;  5H8H B;  3MVZ A;  4RK2 A;  4DCY A;  4R2F A;  1BLF A;  3Q29 A;  5CMC A;  1IMC A;  3N94 A;  3O6G A;  2XXH A;  4GBV A;  4NF4 A;  4YMB A;  3EKI A;  1MPB A;  5AA4 A;  4HW8 A;  4QSE A;  1VE4 A;  4OYV A;  3CFL A;  4TLL B;  4BDL A;  3KJ7 A;  3G7W A;  3B6Q A;  4AS4 A;  2ZZW A;  1EU8 A;  2HAU A;  4PTK A;  3UK4 A;  3C33 A;  1R9L A;  4YU0 A;  4DDD A;  2DE2 A;  1MQI A;  4I3Y A;  3N5L A;  4POW A;  5LTC A;  2VOZ A;  3RT6 B;  1B4H A;  5HPQ A;  2Y7K A;  4KD5 A;  3VFJ A;  1YAE A;  1NV6 A;  1MY2 A;  1JET A;  3QSL A;  4RA1 A;  1UIV A;  3KC0 A;  4GL0 A;  4ZS9 A;  1MQJ A;  1B5J A;  4QF9 A;  1MH4 A;  4U21 A;  2ZYK A;  2PT2 A;  3W15 C;  5AA2 A;  3DLN A;  2DOJ A;  1SYI A;  1DBZ A;  4BLA A;  2D21 A;  2XXR A;  2HCA A;  4OZ9 A;  3SEV A;  3E3K A;  3OEL A;  1MS7 A;  3QUJ A;  4XFE A;  1Y3Q A;  2AL4 A;  4MX6 A;  3HV1 A;  1N0T A;  1LCT A;  4YAH X;  4GFR A;  2XD2 A;  4DCX A;  4R74 A;  3IB1 A;  4GXA A;  1A54 A;  4IY5 A;  5EQ7 A;  3TZA A;  2WBB A;  3FUZ A;  5ESY A;  4JVC A;  3FVG A;  3KBR A;  4OA4 A;  2FA7 A;  1YXI A;  2I4C A;  4X8R A;  2Y5L A;  2RKM A;  2XX7 A;  1OVB A;  1IMF A;  3ILU B;  4R2B A;  1POT A;  4R6H A;  5H8Q B;  1JW1 A;  1FPI A;  2DWA A;  3CFZ A;  2I49 A;  3LSF B;  3T1B A;  1WDN A;  4FBP A;  2M8C A;  3TOD A;  4YKP A;  3N6U A;  3OSR A;  4LZ8 A;  2H9B A;  4G68 B;  2CZL A;  4I9D A;  4F1U A;  1IME A;  4YKI A;  1RDX A;  2XWO A;  1LEV A;  2VD3 A;  1BP5 A;  2XA5 A;  4DXU A;  3MP1 A;  2GHA A;  2RCB A;  1D4N A;  3IOW A;  3K00 A;  3MST A;  1FPG A;  2DVC A;  2ONR A;  1GVC A;  5AA1 A;  3VLW A;  3SER A;  4ZDM A;  4EXL A;  1Y3N A;  3FBP A;  4P47 A;  1I6B A;  2FYI A;  3GXA A;  1H76 A;  1FRP A;  4WKM A;  3EQ1 A;  3U65 A;  5ICQ A;  1SD3 A;  3K0V A;  5FHN A;  1MM7 A;  4U2R A;  4IO5 A;  1P1W A;  3PPN A;  1Q9D A;  2FBP A;  4NED A;  4RNS A;  1R1N A;  1B5H A;  2REG A;  4PET A;  1NH7 A;  3G3H A;  3O6H A;  5LDZ A;  2YLN A;  1XVY A;  3UIF A;  3VVD A;  3QYT A;  2R6G E;  4KXP A;  3H7M A;  2XXK A;  4LZ5 A;  1F9B A;  4G2Z A;  3VV5 A;  5DW8 A;  5ET5 A;  5I7I A;  2ZYN A;  1JW5 A;  3EF7 A;  4EXK A;  3K02 A;  3FGS A;  4N6P A;  2CEX A;  2CMO A;  2OWZ A;  1FTK A;  2ZZV A;  4HS7 A;  1NV5 A;  3KFM A;  1MY4 A;  2P3N A;  2WBD A;  4OVR A;  3T9U A;  2D5W A;  4TOZ A;  3H6V A;  3TTR A;  4I8C A;  3S2V A;  2ESN A;  3H6W A;  2XXU A;  4AB6 A;  2XXX A;  3JZJ A;  3VLV A;  3TAJ A;  1SW5 A;  1P1N A;  2XXY A;  3QK6 A;  2Q74 A;  1O64 A;  2HZL A;  4EQ7 A;  3Q25 A;  4F3B A;  2REJ A;  4LUB A;  2OBG A;  3CSB A;  4C1U A;  2Q8J A;  1QUI A;  1FBE A;  4ESX A;  5TU0 A;  2UXA A;  5DTB A;  4LN5 A;  1N3W A;  1B52 A;  4E0W A;  4YB7 A;  2Q9T A;  2F6P A;  4R72 A;  2WYK A;  4DI3 D;  4DLD A;  5KCJ B;  5ET7 A;  5H8F A;  3UGW A;  3Q27 A;  3H06 B;  2GHB A;  2V93 A;  2WEF A;  1AL3 A;  1MG1 A;  2A5S A;  2PFZ A;  4FEB A;  3A09 A;  1UTH B;  2PFY A;  5TPA B;  1LBB A;  2GH9 A;  4OMB A;  1QVS A;  4HTG A;  4IO7 A;  3TEL A;  1IIW A;  5J16 A;  3FXB A;  3PUX E;  2NOO A;  3PMW A;  1J1N A;  3KGC A;  3MAM A;  4P56 A;  3FXU A;  4NWC A;  2RC7 A;  4KR5 A;  4GWO A;  2DYX A;  2O51 A;  3ZKL A;  1MXV A;  5A5X B;  1NV1 A;  1BKA A;  1XS5 A;  3SEU A;  1M5B A;  4NF8 B;  3TUS A;  3MVW A;  3HST A;  5J1D A;  2P0S A;  1US5 A;  3OO6 A;  4F29 A;  4O7I A;  4MCO A;  3PPR A;  2BJI A;  1SI0 A;  4LQ5 A;  4QSD A;  5I58 B;  4MFI A;  3MVX A;  3VXC A;  2QPQ A;  3RT8 A;  3MZ9 A;  3ZKK A;  3IOR A;  3T93 B;  4IY6 A;  3FZV A;  4LON B;  1LLS A;  3A29 A;  3PMV A;  1FBH A;  2G29 A;  4RJZ A;  3RUM A;  1NFT A;  2CZI A;  3C36 A;  5EQ9 A;  3ISP A;  1ANF A;  1LAF E;  5ITO A;  1OQH A;  4DE8 A;  4LQ2 A;  3OSQ A;  4ISU A;  4X1D A;  5I57 A;  3IO4 A;  5F24 A;  3KOT A;  1Y20 A;  1MH3 A;  3OO9 A;  2Y7P A;  3KN3 A;  3G3J A;  5H8N A;  4PCD A;  4OFO A;  4NF5 B;  3UN6 A;  3MYU A;  2DXY A;  2GQ1 A;  2V84 A;  1SPI A;  4WED A;  4H65 A;  5AA2 D;  1MRP A;  2DE4 A;  3K1P A;  1S9T A;  1QKB A;  5TP9 A;  2V4C A;  3CI8 A;  2F8D A;  2FIX A;  1OIB A;  1R9Q A;  4GQO A;  4AQ4 A;  1SW1 A;  2F3B A;  4THI A;  3HCQ A;  1XHY A;  2ZZX A;  1PB8 A;  4ZZE A;  1AOV A;  3MVY A;  5DVI A;  4ZEI A;  4XIG Q;  1FBC A;  2O7I A;  4RY1 A;  3HHG A;  3IJX B;  3ROJ A;  1JNF A;  3TTM A;  2Y7W A;  1FQD A;  2KLF A;  2QVU A;  3RQT A;  3W9V A;  2B4M A;  2DWI A;  4HE0 A;  2E0S A;  1NH8 A;  5CMK A;  1FBG A;  1RYX A;  4H45 A;  3FXR A;  3LUY A;  4KHZ E;  4OAN A;  2X7Q A;  2ZYM A;  4PAK A;  1D3K A;  4GWX A;  4NF6 B;  2R9J A;  5M2V A;  5KDT A;  4GWZ A;  2HXR A;  4PFR A;  2Z8F A;  1FPB A;  2H4I A;  4BDM A;  1B1X A;  4EDP A;  3BIG A;  2IA4 A;  4FE8 A;  4YKK A;  4XEQ A;  5A5L A;  3HFU A;  4G4P A;  2B3B A;  3CR9 A;  3SEY A;  5ISU A;  1EZO A;  4PFI A;  3HHF A;  4KCD A;  1PBP A;  2F7A A;  3AXF A;  4KQP A;  4NMY A;  4QFO A;  1OLA A;  4DXB A;  1MXU A;  1D9Q A;  2ONK E;  3EHS A;  3N26 A;  4OTE A;  1G0H A;  3PD8 A;  4MF3 A;  5K2Y A;  1A8E A;  4JBZ A;  1LB9 A;  4ZE8 A;  4H8I A;  1I6A A;  2XXW A;  2VHA A;  1YZ0 A;  3CHG A;  4ZE9 A;  1LFI A;  5I56 B;  4PFT A;  1EYK A;  1FCK A;  3B7D A;  3G3F A;  3TCH A;  3VDF A;  1LBZ A;  2Y5K A;  1NNF A;  1YTV A;  3LBS A;  4C0R A;  1FQC A;  3KN7 A;  1DSN A;  1N76 A;  4POX A;  4IGR A;  4X48 A;  3K1N A;  2V3T A;  3C34 A;  4PE3 A;  4N91 A;  5EYG A;  1Y4T A;  2UYF A;  1B6H A;  2H98 A;  1IQ7 A;  1ELJ A;  4R6K A;  3DEL B;  2F78 A;  5B70 A;  2PYY A;  4ZEB A;  1P99 A;  1XT8 A;  4MJO A;  4PFY A;  3D1R A;  5H8H A;  3O66 A;  4C1T A;  4ZED A;  3SET A;  4HXV A;  1IIT A;  2CZK A;  4JXI A;  3U94 A;  2XWV A;  1MPC A;  2Z22 A;  4U1O A;  4YB6 A;  1B3H A;  3BBR A;  3H3G A;  2W7Y A;  3SES A;  4XF5 A;  1B40 A;  1XI6 A;  4MHF A;  1NL5 A;  2D3I A;  5CBS A;  2F34 A;  4XKR A;  4O3B A;  1PBQ A;  3ODB A;  2ABH A;  4FAT A;  4NGU A;  2BJJ X;  2OJT A;  3QAX A;  3SDF A;  1B05 A;  1NV7 A;  3RLF E;  5HM4 B;  4P1L A;  2XXI A;  3KZG A;  3P7I A;  1K9Y A;  4O8M A;  1B7U A;  4R75 A;  1B0L A;  2H25 A;  4PFW A;  3B6W A;  4H5G A;  4X1B A;  1A99 A;  5F1Q A;  3SKP A;  3WAE A;  4XKP A;  3L6G A;  1N7X A;  1BK4 A;  3UA8 A;  3I5O A;  1NV0 A;  4PF8 A;  1LFG A;  5CM6 A;  1B4Z A;  5JTY B;  1B32 A;  3V8X B;  4GIZ A;  1TFD A;  3M3K A;  1R6Z A;  4OWD A;  2HZK A;  2WYP A;  4BDN A;  3H03 A;  5K2X A;  1FQA A;  3DM0 A;  3OD7 A;  4G8N A;  4RXL A;  3MP6 A;  1ZMG A;  4Q5T A;  1SBP A;  3C35 A;  3FXQ A;  1IXG A;  1FW0 A;  1QUK A;  3KOS A;  1DTZ A;  3IFC A;  3KSX A;  2HEU A;  5ICT A;  3D4C A;  5IKB A;  1YCJ A;  3O6I A;  3UP9 A;  4GF8 A;  3F11 A;  4EF2 A;  1UQW A;  5IM2 A;  1URS A;  4Q30 B;  1PDA A;  1USY H;  3QXM A;  3CG3 A;  4PBH A;  3K6W A;  5H8Q A;  1NV3 A;  1KWH A;  1LBW A;  3O29 A;  3OO8 A;  3FJ7 A;  4H5F A;  3C31 A;  3N6T A;  1NMU A;  1MY3 A;  3H6T A;  3LR1 A;  5EQ8 A;  1VR5 A;  4F2O A;  4G68 A;  3FJM A;  3S9E A;  1S7Y A;  2FVZ A;  1H3D A;  4I1D A;  3MJN A;  2RC8 A;  4GX6 A;  1B7H A;  3RTW B;  1B0H A;  3B6T A;  1AH5 A;  4FOR A;  5IGA A;  1FSA A;  2XXT A;  3VVE A;  1PC3 A;  5I59 B;  2YPN A;  3JV9 A;  2Z23 A;  1FTJ A;  3KEI A;  3RN8 A;  2B4L A;  2Y84 A;  4NE4 A;  4LZ7 A;  2QVR A;  1RKM A;  3U8Q A;  1B51 A;  4GWU A;  4TLM B;  3MZ1 A;  4GOT A;  2HHM A;  1A7L A;  1NNP A;  5JEI A;  2I0B A;  4PQJ A;  4ESW A;  3OEM A;  4P11 A;  4OEU A;  4KCC A;  1LB8 A;  3IL1 B;  4MIJ A;  5DVF A;  5IZZ A;  4PAF A;  4IO4 A;  3V83 A;  1TXF A;  1LBC A;  4GVO A;  2OK2 A;  1FQB A;  2LAO A;  2Y7I A;  3MP8 A;  1PEB A;  2PMS A;  1GGG A;  3TTN A;  3FD3 A;  1MQG A;  2ZYO A;  1JEV A;  1LBV A;  2MKZ A;  4EQ9 A;  4G8M A;  1UTB B;  1YYZ A;  3DP8 A;  3TQL A;  1Z7M E;  1SYH A;  4RK9 A;  1EH3 A;  1M5E A;  4F2Q A;  5H8S A;  2AYS A;  4PF6 A;  2ONS A;  3SEW A;  2HPG A;  3MUQ A;  4PDH A;  2XXV A;  5L9S A;  4NHB A;  4O3A A;  2ZXT A;  5B7D A;  1O7T A;  3C4M A;  2V3Q A;  2XWK A;  3O9P A;  5DT6 A;  5DYH A;  5KCJ A;  4IR8 A;  1QW0 A;  2DWH A;  4GX3 A;  3RPL B;  3U1O A;  3FVK A;  4LA9 A;  3PTY A;  4GX4 A;  5EYH A;  3Q28 A;  1FPJ A;  4HCW A;  1UTH A;  5TPA A;  2ZNU A;  4R9F A;  4FAJ A;  1WOD A;  1IMB A;  1N3X A;  2HXW A;  1M5D A;  1B3L A;  1EYJ A;  2VT5 A;  3IB2 A;  3L6H A;  5HBC A;  5A5X A;  3EHU A;  2XD3 A;  4NF8 A;  2OWT A;  3GYY A;  3E78 A;  1NUW A;  3PPO A;  2UVJ A;  4UA8 A;  2HQ0 A;  1Y4C A;  5I58 A;  1A8F A;  1B2H A;  4K3F A;  4KYS A;  1URG A;  4WXJ A;  2PT1 A;  5I3S A;  2H99 A;  1FTA A;  1N84 A;  1ZU0 A;  1N04 A;  1L5T A;  5EQA A;  1RDZ A;  2R71 A;  1B3G A;  4PAI A;  4XTC Q;  3MBP A;  4N6K A;  2DWJ A;  4JWO A;  4QFP A;  4PP0 A;  4QFN A;  3IAZ A;  4F3P A;  3IX1 A;  1XOC A;  1DMB A;  4ONY A;  3VLU A;  5EYF A;  2QS1 A;  1T0K A;  1S50 A;  1ZLQ A;  3MZB A;  1D9V A;  5I2K B;  3PPP A;  3K1M A;  4NF5 A;  1IEJ A;  4NG7 A;  3LV0 A;  2RC9 A;  3TKD A;  4GWW A;  4KI0 E;  5ELV A;  1JEU A;  1G0I A;  1SW4 A;  2DP8 A;  1TFA A;  4M1V A;  4O3C A;  4NAP A;  2PVU A;  2QMX A;  3RGY A;  2XX9 A;  1VFD A;  4MNC A;  3W9W A;  4P3L A;  5IZ3 B;  4JSD A;  3T9X B;  4AB5 A;  1YPN A;  1B3E A;  3IOT A;  4X9T A;  4YZZ A;  3C9H A;  5FHO A;  1MXY A;  4F22 A;  1I6Q A;  2XWI A;  1NUY A;  4DXC A;  1ZKB A;  4NF6 A;  3PMX A;  3D4G A;  2F97 A;  4F3G A;  5JK4 A;  5I2N B;  3VXB A;  2KQZ A;  3OOA A;  5CC2 A;  5I2N A;  4QFL A;  2F5X A;  1IMD A;  4PGN A;  2VGQ A;  5IAI A;  1GV8 A;  4JDF A;  2QFL A;  3PUZ E;  3FV1 A;  2QS2 A;  1Z7N E;  3U72 A;  2X7P A;  1URD A;  2I4B A;  4OEV A;  1MY1 A;  3B8B A;  3Q26 A;  2VPN A;  4OVS A;  1HSJ A;  4ZEK A;  1K9Z A;  1SDX A;  1FJ6 A;  4DZ1 A;  5CRY A;  3PV0 E;  3FAS A;  2O6A A;  4N13 A;  3V89 B;  1CNQ A;  4UAC A;  3BFT A;  3S9L C;  2O84 X;  1QUL A;  1ZTY A;  4P0G A;  3ONM A;  4JWY A;  2UVH A;  1B3F A;  1OVT A;  2H5Y A;  4N07 A;  4R6Y A;  1LAG E;  5I56 A;  1VFE A;  2OWS A;  4JB7 A;  1N7W A;  3EHT A;  3MQ9 A;  1US4 A;  1A40 A;  1DPE A;  5I84 A;  4GBW A;  3OEK A;  1FPK A;  3JYR A;  5DEX B;  4MLV A;  3USD A;  1EZ9 A;  3MWB A;  3MW0 A;  2OX3 A;  3LC8 A;  3SEX A;  2X26 A;  3E9X A;  4ELO A;  5ET8 A;  3K6V A;  1FTO A;  3T96 B;  4IGT A;  5T3J A;  2O7U A;  1IMA A;  4BDR A;  2HFB A;  3FAT A;  4QXD A;  3K6U A;  4PDD A;  4XKQ A;  2QSX A;  3ZS6 A;  2XHD A;  1FTL A;  2I48 A;  3I6V A;  2Q89 A;  3R7X A;  4ECF A;  2A5T B;  2E1S A;  4QHQ A;  1EYI A;  2PBW A;  1O63 A;  4OEN A;  4F1V A;  4H0W A;  1QJM A;  4U4S A;  3I3V A;  2DDK A;  2QL3 A;  3S9M C;  3DP4 A;  3V5A A;  4JVD A;  3TCF A;  5FHM A;  1AIV A;  3LUZ A;  1POY 1;  2QRY A;  4NF4 B;  2Y7R A;  1IZ1 A;  1MQH A;  4MLQ A;  5AA4 B;  1Q35 A;  3DP6 A;  3FV2 A;  4FEC A;  4ELQ A;  1KZ8 A;  2B3F A;  1II5 A;  2O1L A;  3S4U A;  4PC9 A;  4ELP A;  1P1Q A;  1Y1Z A;  4OVQ A;  1XVX A;  1TWY A;  1RDY A;  2I3V A;  4OVP A;  2XXQ A;  1VSO A;  2O69 A;  4G8H A;  4YMA A;  2I3W A;  1IXC A;  1DK4 A;  1HSE A;  5EHM A;  1FBP A;  1SW2 A;  1KA1 A;  4U23 A;  5BUU A;  4OFL A;  2KR0 A;  3M8U A; 
#chains in the Genus database with same CATH homology
 5JTY A;  3OEN A;  5F7V A;  5AA2 B;  2YJP A;  2HAV A;  2WKY A;  2ZNS A;  3IOU A;  3H6U A;  3FVO A;  3IJO B;  1JVY A;  4WEP A;  1OMP A;  4F19 A;  1ATG A;  3FVN A;  3CVG A;  2QMW A;  4BDQ A;  2ANJ A;  4EQB A;  4P0I A;  1OLC A;  4GXS B;  4Z0I A;  2VP1 A;  3U93 A;  3WAF A;  1B5I A;  1Y1M A;  5LOM A;  4Q8R A;  3PUV E;  2VD2 A;  2F7B A;  3TTK A;  1B58 A;  1QUJ A;  4ZEC A;  1M5F A;  4F1Y A;  4M4G A;  4OXV A;  4XXU A;  2THI A;  2NVU B;  3A3C A;  3FIR A;  4KYD A;  4ZEF A;  3G3K A;  3THI A;  3H4Z A;  1WVJ A;  2V3U A;  4U4X A;  1RYO A;  3K01 A;  5I59 A;  2RIN A;  3KSJ A;  3TQW A;  2Z8D A;  4OHN A;  4IO2 A;  5DVJ A;  2NXO A;  2I58 A;  3K2D A;  3LSX A;  2OZZ A;  4DIG A;  1PB7 A;  4PE5 B;  4YKJ A;  3A3U A;  1FQF A;  2F36 A;  5AA3 A;  3M3L A;  5CMB A;  1USY E;  3MC2 A;  3RTF B;  3C32 A;  3VE1 B;  4LP2 B;  3RPW A;  1ZBM A;  4H67 A;  2UYE A;  3ILT B;  1ZIU A;  4I62 A;  3CIJ A;  2QS3 A;  3O97 A;  2Q88 A;  3T22 A;  4G77 A;  1LST A;  1EZP A;  1JW4 A;  1MDP 1;  3KJT A;  4OVJ A;  1Q1K A;  3S9N C;  3GBB A;  1UTB A;  1CB6 A;  4OES A;  4F18 A;  1OQG A;  1MDQ A;  4H1X A;  3TFL A;  3BKI B;  1P1O A;  2G93 A;  3QIM A;  3E13 X;  1AMF A;  4QSC A;  4FIM A;  1GR2 A;  1D9Y A;  2P2A A;  3IR1 A;  1JVX A;  1LAH E;  5L8D A;  4IB2 A;  1JQF A;  3PD9 A;  2PX1 A;  2OCU A;  4OET A;  2ZNT A;  5AE4 A;  3FJG A;  1H44 A;  3IB0 A;  5H8F B;  3OXN A;  4H6D A;  3CG1 A;  4XKN A;  2FNC A;  2AIX A;  3U92 A;  2ZMB A;  3TDJ A;  3RNN A;  2OLB A;  4LVQ A;  3HPI A;  1FQE A;  5L9O A;  3CSG A;  3TPA A;  1MXW A;  4JWX A;  4F39 A;  5BWJ A;  5CBR A;  3PUW E;  1SQY A;  3TMG A;  1QKA A;  4GL8 A;  1HSL A;  1TT1 A;  2DS9 A;  3TCG A;  3UOR A;  1IUD A;  1M5C A;  2RCA A;  4U1Z A;  3QUF A;  1NNT A;  3EPE A;  1LFH A;  4OFJ A;  3O28 A;  1I69 A;  1H45 A;  3KN8 A;  2F7C A;  4FED A;  4GD5 A;  4R9G A;  1XC1 A;  3RY3 A;  3PU5 A;  2I6E A;  3O2A A;  3IK6 B;  4GLI A;  1MM6 A;  2UVI A;  3MPL A;  4MBP A;  4OER A;  4LAT A;  2XX8 A;  1MXX A;  4RYA A;  5I57 B;  5I2K A;  3LSW A;  3IOV A;  3T9V A;  1IXH A;  3R26 A;  4L17 A;  5H8N B;  1Y9U A;  2F35 A;  1BIY A;  1B9J A;  1MXZ A;  1H43 A;  3HN0 A;  2I0C A;  3EN3 A;  1FTM A;  2UVG A;  3MPK A;  4Q0C A;  1LAX A;  1B1H A;  5TP9 B;  4YIC A;  4MH5 A;  4EF1 A;  1GTK A;  1CE2 A;  5CMM A;  4ELR A;  1IXI A;  3VVF A;  3CFX A;  1ZJL A;  2QJE A;  4EUO A;  4YB5 A;  2QS4 A;  3OMB A;  2DVZ A;  4KYE A;  1MY0 A;  2O68 A;  4IO3 A;  2XXP A;  4NTL A;  2F6G A;  3ZSF A;  5CI5 A;  4F3S A;  5L9M A;  1NKX A;  2GRV A;  3TEP A;  1MQD A;  1B7Z A;  1LGB C;  1UIU A;  4OQO A;  3KG2 A;  5ITP A;  4HCY A;  4KPT A;  5KDT B;  1P1U A;  3LSL A;  4E0X A;  2AL5 A;  5FTH A;  3CRB A;  4QRZ A;  1A55 A;  3BFU A;  4QFK A;  2NWJ A;  1DOT A;  3GBA A;  3TYH A;  3OO7 A;  3ECR A;  2GFE A;  3T66 A;  4RPO A;  4H8J A;  3K6X A;  3M3F A;  4PFU A;  4TQU Q;  2O1M A;  4ZZA A;  3E4R A;  3PUY E;  1DTG A;  5KZT A;  4KFQ A;  1MPD A;  1NNK A;  1Y3P A;  1BTJ A;  2RF1 A;  2NUV A;  3G3G A;  3IO6 A;  4GRK A;  5FTI A;  1DPP A;  1LCF A;  5DEX A;  2DQV A;  3K4U A;  4NWD A;  2Q2C A;  1B46 A;  3G3I A;  4BDO A;  3T9H B;  3PGF A;  4U22 A;  2B65 A;  3PPQ A;  4ND9 A;  4F31 B;  2IEE A;  2DXR A;  2P1S A;  3R6U A;  2Z8E A;  2DSF A;  5EHS A;  2ALU A;  3TTL A;  1SVX B;  2Q2A A;  4R73 A;  1SI1 A;  2DE3 A;  2A5T A;  4IO6 A;  3HO7 A;  2V25 A;  4FJP A;  4G68 C;  4Z7E A;  1PB9 A;  3GLB A;  4RPN A;  3GZG A;  4JSO A;  5H8H B;  3MVZ A;  4RK2 A;  4DCY A;  4R2F A;  1BLF A;  3Q29 A;  5CMC A;  3N94 A;  3O6G A;  2XXH A;  4NF4 A;  4YMB A;  1MPB A;  5AA4 A;  4HW8 A;  4QSE A;  1VE4 A;  4OYV A;  3CFL A;  4TLL B;  4BDL A;  3KJ7 A;  3G7W A;  3B6Q A;  1EU8 A;  2HAU A;  3UK4 A;  3C33 A;  1R9L A;  4YU0 A;  4DDD A;  2DE2 A;  1MQI A;  3N5L A;  4POW A;  2VOZ A;  3RT6 B;  1B4H A;  5HPQ A;  2Y7K A;  4KD5 A;  3VFJ A;  1YAE A;  1MY2 A;  1JET A;  3QSL A;  4RA1 A;  1UIV A;  4GL0 A;  4ZS9 A;  1MQJ A;  1B5J A;  4QF9 A;  1MH4 A;  4U21 A;  2ZYK A;  2PT2 A;  3W15 C;  5AA2 A;  3DLN A;  2DOJ A;  1SYI A;  4BLA A;  2D21 A;  2XXR A;  2HCA A;  4OZ9 A;  3SEV A;  3E3K A;  3OEL A;  1MS7 A;  3QUJ A;  1Y3Q A;  2AL4 A;  3HV1 A;  1N0T A;  1LCT A;  4YAH X;  4GFR A;  2XD2 A;  4DCX A;  4R74 A;  3IB1 A;  4GXA A;  1A54 A;  4IY5 A;  3TZA A;  3FUZ A;  3FVG A;  3KBR A;  2FA7 A;  2I4C A;  2RKM A;  2XX7 A;  1OVB A;  3ILU B;  4R2B A;  1POT A;  4R6H A;  5H8Q B;  1JW1 A;  2DWA A;  3CFZ A;  2I49 A;  3LSF B;  1WDN A;  2M8C A;  3TOD A;  4YKP A;  3N6U A;  3OSR A;  4LZ8 A;  2H9B A;  4G68 B;  2CZL A;  4I9D A;  4F1U A;  4YKI A;  2VD3 A;  1BP5 A;  4DXU A;  3MP1 A;  2GHA A;  2RCB A;  1D4N A;  3IOW A;  3K00 A;  2DVC A;  2ONR A;  1GVC A;  5AA1 A;  3VLW A;  3SER A;  4ZDM A;  4EXL A;  1Y3N A;  1I6B A;  2FYI A;  3GXA A;  1H76 A;  4WKM A;  3EQ1 A;  5ICQ A;  1SD3 A;  3K0V A;  5FHN A;  1MM7 A;  4U2R A;  4IO5 A;  1P1W A;  3PPN A;  4NED A;  4RNS A;  1R1N A;  1B5H A;  2REG A;  4PET A;  1NH7 A;  3G3H A;  3O6H A;  2YLN A;  1XVY A;  3UIF A;  3VVD A;  3QYT A;  2R6G E;  3H7M A;  4LZ5 A;  1F9B A;  4G2Z A;  3VV5 A;  2ZYN A;  1JW5 A;  3EF7 A;  4EXK A;  3K02 A;  3FGS A;  4N6P A;  2CMO A;  1FTK A;  4HS7 A;  3KFM A;  1MY4 A;  3T9U A;  2D5W A;  4TOZ A;  3H6V A;  3TTR A;  4I8C A;  3S2V A;  2ESN A;  3H6W A;  2XXU A;  4AB6 A;  2XXX A;  3JZJ A;  3VLV A;  3TAJ A;  1SW5 A;  1P1N A;  2XXY A;  3QK6 A;  1O64 A;  2HZL A;  4EQ7 A;  3Q25 A;  4F3B A;  2REJ A;  4LUB A;  2OBG A;  3CSB A;  4C1U A;  2Q8J A;  1QUI A;  4ESX A;  5TU0 A;  2UXA A;  5DTB A;  1N3W A;  1B52 A;  4E0W A;  4YB7 A;  2Q9T A;  2F6P A;  4R72 A;  4DLD A;  5KCJ B;  5H8F A;  3UGW A;  3Q27 A;  3H06 B;  2GHB A;  2V93 A;  1AL3 A;  1MG1 A;  2A5S A;  4FEB A;  3A09 A;  1UTH B;  5TPA B;  1LBB A;  2GH9 A;  4OMB A;  1QVS A;  4HTG A;  4IO7 A;  3TEL A;  1IIW A;  3PUX E;  2NOO A;  3PMW A;  1J1N A;  3KGC A;  3MAM A;  3FXU A;  4NWC A;  2RC7 A;  4KR5 A;  4GWO A;  2DYX A;  2O51 A;  3ZKL A;  1MXV A;  5A5X B;  1BKA A;  1XS5 A;  3SEU A;  1M5B A;  4NF8 B;  3TUS A;  3MVW A;  3HST A;  5J1D A;  2P0S A;  1US5 A;  3OO6 A;  4F29 A;  3PPR A;  1SI0 A;  4LQ5 A;  4QSD A;  5I58 B;  4MFI A;  3MVX A;  3VXC A;  2QPQ A;  3RT8 A;  3MZ9 A;  3ZKK A;  3IOR A;  3T93 B;  4IY6 A;  3FZV A;  4LON B;  1LLS A;  3PMV A;  2G29 A;  3RUM A;  4RJZ A;  1NFT A;  3C36 A;  1ANF A;  1LAF E;  5ITO A;  1OQH A;  4DE8 A;  4LQ2 A;  3OSQ A;  4ISU A;  4X1D A;  5I57 A;  3IO4 A;  3KOT A;  1Y20 A;  1MH3 A;  3OO9 A;  2Y7P A;  3KN3 A;  3G3J A;  5H8N A;  4OFO A;  4NF5 B;  3UN6 A;  2DXY A;  4WED A;  2V84 A;  4H65 A;  5AA2 D;  1MRP A;  2DE4 A;  3K1P A;  1S9T A;  1QKB A;  5TP9 A;  3CI8 A;  2F8D A;  1OIB A;  1R9Q A;  4GQO A;  4AQ4 A;  1SW1 A;  4THI A;  3HCQ A;  1XHY A;  1PB8 A;  4ZZE A;  1AOV A;  3MVY A;  5DVI A;  4ZEI A;  4XIG Q;  2O7I A;  4RY1 A;  3HHG A;  3IJX B;  1JNF A;  3TTM A;  2Y7W A;  1FQD A;  2KLF A;  3RQT A;  3W9V A;  2DWI A;  2E0S A;  1NH8 A;  5CMK A;  1RYX A;  3FXR A;  3LUY A;  4KHZ E;  2X7Q A;  2ZYM A;  1D3K A;  4NF6 B;  2R9J A;  5M2V A;  5KDT A;  2Z8F A;  2H4I A;  4BDM A;  1B1X A;  4EDP A;  2IA4 A;  4FE8 A;  4YKK A;  4G4P A;  2B3B A;  3CR9 A;  3SEY A;  5ISU A;  1EZO A;  3HHF A;  4KCD A;  1PBP A;  2F7A A;  3AXF A;  4KQP A;  4NMY A;  4QFO A;  1OLA A;  4DXB A;  1MXU A;  2ONK E;  3EHS A;  3N26 A;  4OTE A;  3PD8 A;  4MF3 A;  5K2Y A;  1A8E A;  4JBZ A;  1LB9 A;  4ZE8 A;  4H8I A;  1I6A A;  2XXW A;  2VHA A;  4ZE9 A;  1LFI A;  5I56 B;  4PFT A;  1FCK A;  3B7D A;  3G3F A;  3TCH A;  3VDF A;  1NNF A;  1YTV A;  3LBS A;  4C0R A;  1FQC A;  3KN7 A;  1DSN A;  1N76 A;  4POX A;  4IGR A;  4X48 A;  3K1N A;  2V3T A;  3C34 A;  1Y4T A;  2UYF A;  1B6H A;  2H98 A;  1IQ7 A;  1ELJ A;  4R6K A;  3DEL B;  2F78 A;  5B70 A;  2PYY A;  4ZEB A;  1P99 A;  1XT8 A;  4PFY A;  5H8H A;  3O66 A;  4C1T A;  4ZED A;  3SET A;  1IIT A;  4JXI A;  3U94 A;  1MPC A;  2Z22 A;  4U1O A;  4YB6 A;  1B3H A;  3BBR A;  3H3G A;  2W7Y A;  3SES A;  1B40 A;  1NL5 A;  2D3I A;  5CBS A;  2F34 A;  4XKR A;  4O3B A;  1PBQ A;  3ODB A;  2ABH A;  4FAT A;  2BJJ X;  2OJT A;  3QAX A;  3SDF A;  1B05 A;  3RLF E;  5HM4 B;  2XXI A;  3KZG A;  3P7I A;  1B7U A;  4R75 A;  1B0L A;  2H25 A;  4PFW A;  3B6W A;  4H5G A;  4X1B A;  1A99 A;  5F1Q A;  3SKP A;  3WAE A;  4XKP A;  3L6G A;  1N7X A;  3UA8 A;  3I5O A;  1LFG A;  5CM6 A;  1B4Z A;  5JTY B;  1B32 A;  3V8X B;  4GIZ A;  1TFD A;  3M3K A;  1R6Z A;  4OWD A;  2HZK A;  4BDN A;  3H03 A;  5K2X A;  1FQA A;  3DM0 A;  3OD7 A;  4G8N A;  4RXL A;  3MP6 A;  1ZMG A;  4Q5T A;  1SBP A;  3C35 A;  3FXQ A;  1IXG A;  1FW0 A;  1QUK A;  3KOS A;  1DTZ A;  3KSX A;  2HEU A;  5ICT A;  3D4C A;  5IKB A;  1YCJ A;  3O6I A;  3UP9 A;  4GF8 A;  3F11 A;  4EF2 A;  1UQW A;  1URS A;  4Q30 B;  1PDA A;  1USY H;  3QXM A;  3CG3 A;  3K6W A;  5H8Q A;  1KWH A;  3O29 A;  3OO8 A;  3FJ7 A;  4H5F A;  3C31 A;  3N6T A;  1NMU A;  1MY3 A;  3H6T A;  3LR1 A;  1VR5 A;  4F2O A;  4G68 A;  3FJM A;  3S9E A;  1S7Y A;  1H3D A;  4I1D A;  3MJN A;  2RC8 A;  1B7H A;  3RTW B;  1B0H A;  3B6T A;  1AH5 A;  4FOR A;  2XXT A;  3VVE A;  1PC3 A;  5I59 B;  2YPN A;  3JV9 A;  2Z23 A;  1FTJ A;  3KEI A;  3RN8 A;  2Y84 A;  4NE4 A;  4LZ7 A;  1RKM A;  3U8Q A;  1B51 A;  4TLM B;  3MZ1 A;  4GOT A;  1A7L A;  1NNP A;  5JEI A;  2I0B A;  4PQJ A;  4ESW A;  3OEM A;  4P11 A;  4OEU A;  4KCC A;  1LB8 A;  3IL1 B;  5DVF A;  4IO4 A;  3V83 A;  1TXF A;  1LBC A;  4GVO A;  2OK2 A;  1FQB A;  2LAO A;  2Y7I A;  3MP8 A;  1PEB A;  2PMS A;  1GGG A;  3TTN A;  3FD3 A;  1MQG A;  2ZYO A;  1JEV A;  4EQ9 A;  4G8M A;  1UTB B;  3DP8 A;  3TQL A;  1Z7M E;  1SYH A;  4RK9 A;  1EH3 A;  1M5E A;  4F2Q A;  5H8S A;  2AYS A;  2ONS A;  3SEW A;  3MUQ A;  2XXV A;  5L9S A;  4O3A A;  2ZXT A;  5B7D A;  1O7T A;  3C4M A;  2V3Q A;  3O9P A;  5DT6 A;  5DYH A;  5KCJ A;  1QW0 A;  2DWH A;  3U1O A;  3FVK A;  4LA9 A;  3Q28 A;  4HCW A;  1UTH A;  5TPA A;  2ZNU A;  4R9F A;  4FAJ A;  1WOD A;  1N3X A;  2HXW A;  1M5D A;  1B3L A;  3IB2 A;  3L6H A;  5HBC A;  5A5X A;  3EHU A;  2XD3 A;  4NF8 A;  2OWT A;  3PPO A;  2UVJ A;  4UA8 A;  2HQ0 A;  1Y4C A;  5I58 A;  1A8F A;  1B2H A;  4K3F A;  4KYS A;  1URG A;  4WXJ A;  2PT1 A;  2H99 A;  1N84 A;  1ZU0 A;  1N04 A;  1L5T A;  2R71 A;  1B3G A;  4XTC Q;  3MBP A;  2DWJ A;  4JWO A;  4QFP A;  4PP0 A;  4QFN A;  3IAZ A;  4F3P A;  3IX1 A;  1XOC A;  1DMB A;  4ONY A;  3VLU A;  5EYF A;  2QS1 A;  1T0K A;  1S50 A;  1ZLQ A;  3MZB A;  1D9V A;  5I2K B;  3PPP A;  3K1M A;  4NF5 A;  1IEJ A;  2RC9 A;  3TKD A;  4KI0 E;  5ELV A;  1JEU A;  1SW4 A;  2DP8 A;  1TFA A;  4M1V A;  4O3C A;  2PVU A;  2QMX A;  3RGY A;  2XX9 A;  1VFD A;  3W9W A;  4JSD A;  3T9X B;  4AB5 A;  1YPN A;  1B3E A;  3IOT A;  4X9T A;  4YZZ A;  3C9H A;  5FHO A;  1MXY A;  4F22 A;  1I6Q A;  4DXC A;  1ZKB A;  4NF6 A;  3PMX A;  3D4G A;  2F97 A;  4F3G A;  5JK4 A;  5I2N B;  3VXB A;  3OOA A;  5CC2 A;  5I2N A;  4QFL A;  2F5X A;  2VGQ A;  5IAI A;  1GV8 A;  4JDF A;  3PUZ E;  3FV1 A;  2QS2 A;  1Z7N E;  3U72 A;  2X7P A;  1URD A;  2I4B A;  4OEV A;  1MY1 A;  3Q26 A;  1HSJ A;  4ZEK A;  1SDX A;  4DZ1 A;  5CRY A;  3PV0 E;  3FAS A;  2O6A A;  4N13 A;  3V89 B;  4UAC A;  3BFT A;  3S9L C;  2O84 X;  1QUL A;  1ZTY A;  4P0G A;  3ONM A;  4JWY A;  2UVH A;  1B3F A;  1OVT A;  2H5Y A;  4N07 A;  4R6Y A;  1LAG E;  5I56 A;  1VFE A;  2OWS A;  4JB7 A;  1N7W A;  3EHT A;  3MQ9 A;  1US4 A;  1A40 A;  1DPE A;  5I84 A;  3OEK A;  3JYR A;  5DEX B;  4MLV A;  3USD A;  1EZ9 A;  3MWB A;  3MW0 A;  3LC8 A;  3SEX A;  4ELO A;  2X26 A;  3E9X A;  3K6V A;  1FTO A;  3T96 B;  4IGT A;  2O7U A;  4BDR A;  2HFB A;  3FAT A;  3K6U A;  4XKQ A;  2QSX A;  3ZS6 A;  2XHD A;  1FTL A;  2I48 A;  3I6V A;  2Q89 A;  3R7X A;  4ECF A;  2A5T B;  2E1S A;  4QHQ A;  2PBW A;  1O63 A;  4OEN A;  4F1V A;  4H0W A;  1QJM A;  4U4S A;  3I3V A;  2QL3 A;  3S9M C;  3DP4 A;  3V5A A;  3TCF A;  5FHM A;  1AIV A;  1POY 1;  2QRY A;  4NF4 B;  2Y7R A;  1IZ1 A;  1MQH A;  4MLQ A;  5AA4 B;  1Q35 A;  3DP6 A;  3FV2 A;  4FEC A;  4ELQ A;  2B3F A;  1II5 A;  2O1L A;  3S4U A;  4ELP A;  1P1Q A;  1Y1Z A;  1XVX A;  1TWY A;  2I3V A;  2XXQ A;  1VSO A;  2O69 A;  4G8H A;  4YMA A;  2I3W A;  1IXC A;  1HSE A;  5EHM A;  1SW2 A;  4U23 A;  5BUU A;  4OFL A;  3M8U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...