4ND9A

The putative substrate binding domain of abc-type transporter from agrobacterium tumefaciens in open conformation
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
280
structure length
280
Chain Sequence
AQVVVSSKIDTEGGVLGNIILAVLNQNKIETTDRIQLGATPVVRKAITAGEIDIYPEYTGNAAFFFSKADDPLWKDAAKGYEEAKTLDYDANKIVWLAPSPANNTWAIALRKDVADKNNLKTLSDFGKYVAGGGTVVLAASSEFVNSAAALPAFQTTYGFTMKPDQLITLSGGDTAATIAAAANQTNNANAAMVYGTDGGIAPSGLVVLEDDKHVQPVYQPAPIIREEVLKKHPNIEELLKPVFEKLDLATLQDLNARVQVGGEQAKTVAMDFLTKNGFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ABC transporter, substrate binding protein (Proline/glycine/
publication title The putative substrate binding domain of ABC-type transporter from Agrobacterium tumefaciens in open conformation
rcsb
source organism Agrobacterium fabrum
molecule tags Transport protein
total genus 96
structure length 280
sequence length 280
ec nomenclature
pdb deposition date 2013-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04069 OpuAC Substrate binding domain of ABC-type glycine betaine transport system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4nd9A01
3.40.190.120 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Osmoprotection protein (prox); domain 2 4nd9A02
3TTKA 1FQDA 3OEMA 3IO4A 3B6QA 3HO7A 4OXVA 3PD8A 4OFJA 2VOZA 1B58A 3MWBA 5FHOA 1NKXA 3C32A 3IAZA 5B7DA 3O28A 1JQFA 1QULA 3O97A 3MZ1A 5I56B 4JBZA 4GXAA 1LBCA 1SVXB 2Z8FA 4TLMB 3IL1B 3IJOB 4NF8A 4GOTA 4F39A 4BDRA 2ZXTA 3TCGA 4N07A 2HZKA 1MS7A 1EH3A 1DTGA 1SW2A 1FQFA 1TWYA 4Q5TA 3ILTB 4L17A 3LR1A 5KDTA 2O84X 1IUDA 4G68B 4F2QA 3IOUA 1UIUA 2KLFA 4PFTA 4U2RA 3QUJA 4ELQA 5I58A 3FJ7A 4KYSA 3IO6A 4I1DA 4H67A 1YTVA 4QHQA 1MM7A 1I6BA 4QF9A 3S9NC 2Z8DA 2THIA 3PV0E 3RT8A 3OMBA 2O6AA 2PVUA 3ZKLA 1M5FA 4DCYA 2O68A 3JYRA 4XKPA 4N13A 1NH8A 5CMMA 2QL3A 2H25A 2I3WA 2E1SA 2QMWA 1LB8A 1H43A 2ZMBA 5I59B 1B9JA 4EF1A 1B40A 3T96B 2H9BA 1VSOA 2UYFA 1M5BA 4FORA 4YKIA 1URGA 4IO5A 3KOTA 3PPRA 4O3AA 1ZLQA 4GL0A 5CMCA 3RN8A 3K02A 3OO6A 5CRYA 3HHFA 3OENA 4LZ8A 1B4ZA 3MP6A 4XTCQ 5ITOA 4DDDA 3G3GA 2FNCA 4OFOA 1B3LA 4UA8A 2D21A 1USYE 1AOVA 3RNNA 5TP9A 3IX1A 3CG1A 1XC1A 4DCXA 1B6HA 1A8EA 1OLCA 3FZVA 5IKBA 1UTHB 2XXHA 2B3BA 4WXJA 3F11A 2IA4A 4M4GA 4LZ7A 4LQ5A 1TFDA 3L6HA 4ZEFA 1AH5A 5B70A 2DS9A 3S9MC 4BDNA 1J1NA 3IOWA 2OJTA 3PMVA 1D9VA 3OSQA 3H7MA 4ZECA 1Y9UA 1LAHE 4THIA 2XXPA 1JVYA 3CSGA 3HPIA 1ZKBA 3GZGA 3Q29A 5DVIA 4POXA 3OXNA 1B52A 4ZZEA 4GIZA 5I56A 4OHNA 4R2BA 3O9PA 4U22A 2ZNSA 3TODA 5K2XA 1FTMA 1MQJA 1YAEA 3VXBA 3QYTA 4QFOA 4EDPA 4C0RA 5CI5A 3QXMA 3TELA 4F3BA 2RINA 3RTWB 1PBQA 3T9VA 1DPEA 4QFKA 1FQEA 2DWAA 3C34A 2ZYNA 2D3IA 2Q8JA 4IO7A 3B6WA 3IB0A 4LVQA 2O7IA 1O64A 3EPEA 2DYXA 1OQHA 3R26A 1P1QA 4H8IA 2F35A 1FW0A 3RY3A 1HSLA 2OWSA 1S9TA 3C35A 3C4MA 2ANJA 3MP8A 3U93A 3BBRA 3HHGA 4TLLB 3T9HB 3E9XA 4QRZA 4PETA 1OVTA 3U1OA 4BLAA 1POY1 1MXXA 4EF2A 4R9FA 5ITPA 3TTMA 4WEPA 4Q0CA 3M3KA 5DVFA 1MQHA 3K00A 4FEDA 3DP8A 1B1HA 5M2VA 3SEVA 4PE5B 1QVSA 3K0VA 2F5XA 3FUZA 3TQLA 3KN7A 3H6VA 4YKKA 4F22A 3D4GA 3GLBA 2P2AA 1A8FA 2NWJA 2F34A 2V93A 1UQWA 3P7IA 4F3GA 3TEPA 1A7LA 1USYH 4ELPA 1XVXA 4KQPA 3RTFB 2Y7RA 4I9DA 1RYXA 1MY2A 3ECRA 3RQTA 4QFNA 2B3FA 1MXUA 4G68C 4PP0A 5FHNA 4UACA 3FATA 2DWJA 3H6UA 2XX7A 4H65A 3TTNA 2I48A 1WDNA 2AL4A 3IB1A 2XX8A 4U4XA 3I5OA 2F6PA 3K1MA 4KYDA 1IITA 1N0TA 3VFJA 1DMBA 2I0BA 3RGYA 1H45A 1FTKA 3I3VA 4MH5A 2VP1A 5TPAB 1Q35A 2Y7KA 3H4ZA 2DXYA 4F29A 1DPPA 1QUIA 1I6QA 1Y3NA 2HQ0A 2V3TA 4ND9A 3MZ9A 3H6WA 5I57A 1OLAA 4RA1A 3TTRA 1NFTA 2QMXA 4FJPA 4EQ9A 1UTBB 1FTLA 2PYYA 2NVUB 3PD9A 1MPBA 3FV2A 2ONRA 1F9BA 3E3KA 3CSBA 3DP4A 2F97A 1LAFE 4KPTA 3K01A 5I2NB 1SD3A 2AIXA 4GFRA 4HCYA 4YB6A 5K2YA 1SI1A 3W15C 3G7WA 3AXFA 4HCWA 2O1LA 1B3FA 2HEUA 3C9HA 2NUVA 4IGTA 3FD3A 2XXWA 3KFMA 4POWA 2I3VA 2V3UA 2Z8EA 4DXBA 2RCAA 3MQ9A 3W9VA 3R6UA 3IK6B 3PUVE 1ATGA 3IJXB 5EHMA 3USDA 1AIVA 3JV9A 2F7CA 3QK6A 5AA2D 3CVGA 3T22A 3O6IA 3IOTA 3LUYA 2HFBA 3T66A 1GTKA 5AE4A 1EZPA 1ZTYA 4G4PA 3PPPA 4YKPA 1Y1MA 2NOOA 3QAXA 1Y4CA 3GXAA 1RKMA 4FAJA 3MZBA 2PBWA 5CC2A 3TAJA 4K3FA 5H8HB 2GHAA 4KR5A 3RUMA 4MLVA 3LSWA 3G3KA 4WEDA 4IY6A 3TPAA 5I2KA 3UP9A 4JWYA 5ICTA 3K1PA 4F2OA 1IXCA 1LFGA 1A40A 2PX1A 4I62A 1MPCA 3RPWA 3GBAA 2Q2AA 4IO2A 1N04A 1OVBA 1O63A 2DVZA 2QS2A 4G8HA 1R1NA 1M5CA 5I84A 4FECA 4R6YA 1OQGA 2GH9A 2R9JA 1NNTA 5CM6A 3BKIB 2M8CA 1L5TA 1B7UA 3UA8A 2RKMA 2I0CA 1Y1ZA 2B65A 1FQAA 1RYOA 4DXCA 3SKPA 4JWXA 3VVDA 2GHBA 1PB8A 1EU8A 2OBGA 1I6AA 5L9MA 2Y7IA 4AQ4A 3HN0A 4RY1A 3PUYE 3K6XA 2YPNA 3MC2A 2RC8A 2I58A 1SW1A 4MBPA 5HPQA 1MXWA 1PB7A 1IXGA 2HXWA 1MM6A 2X7QA 5L9OA 3PPNA 2Q2CA 5H8FB 5H8QB 4RNSA 1QKBA 4Q8RA 1ZIUA 3VLWA 2H98A 4AB5A 4ZEIA 5ICQA 5DYHA 4QSDA 1BTJA 3PMXA 4ELOA 3EN3A 4ESWA 3FXQA 5EYFA 3R7XA 3BFUA 3SEWA 3H6TA 3CFLA 1IXHA 3A09A 2DSFA 2G29A 1LLSA 3CFXA 2GFEA 3OELA 4OYVA 4KFQA 4R6KA 3SESA 1B5HA 3PUXE 2I4CA 4Z0IA 3UORA 4F1UA 1II5A 2VHAA 2IEEA 4H5GA 4F3SA 3E13X 3IR1A 1Y20A 3FXUA 4HS7A 5JTYA 2XHDA 1N84A 1P1UA 4RJZA 3DLNA 1VE4A 3FVKA 5JK4A 4KCCA 3TQWA 4GVOA 1NH7A 3S2VA 4ZE9A 3SDFA 1LAXA 1OMPA 1Y4TA 1A54A 1EZOA 4ONYA 2XXVA 1FTJA 2ZYKA 5L8DA 5H8NA 1XVYA 2XXIA 3K2DA 3MVXA 4F1VA 4KCDA 2AYSA 4JSDA 4H0WA 1URDA 2Q9TA 3VVEA 3FIRA 4LZ5A 2D5WA 1SW4A 2QS4A 3OOAA 4LATA 3N26A 4NTLA 3TDJA 1IEJA 1DTZA 4RXLA 1QUKA 3KZGA 5H8HA 3ZS6A 4JDFA 2ABHA 4GLIA 4YMAA 3PUWE 1JW1A 1PC3A 1XOCA 4NF5B 1Z7ME 2O69A 5AA2B 3QSLA 3THIA 4PFUA 1TT1A 1JETA 1AL3A 4G68A 3V8XB 2UVHA 3MP1A 2HAUA 3VLUA 5KCJB 5ELVA 2VGQA 1B46A 5CMKA 3TMGA 1MDQA 2YLNA 4DLDA 1B7HA 4C1TA 1N7WA 5LOMA 3OO8A 1N3XA 3C36A 3VLVA 4QSEA 5F1QA 1D4NA 1B05A 4F3PA 1QKAA 4OETA 1QJMA 4F19A 2PT2A 4R72A 2W7YA 1LBBA 5I59A 4XKNA 3U72A 5DT6A 1MY3A 4YICA 2V84A 3VDFA 4U21A 1S7YA 4F18A 2QPQA 1MY4A 5EHSA 3M3LA 5H8FA 5H8QA 2P1SA 3MVWA 3RLFE 2QSXA 2UVIA 3KEIA 3N94A 5JEIA 4P0IA 1FCKA 4OWDA 3T9XB 1MY1A 4KHZE 5HM4B 3FJMA 2ZYOA 3DELB 1Z7NE 1A55A 3SEUA 4DXUA 1IZ1A 1BKAA 4F1YA 4JSOA 1SI0A 2OCUA 1Q1KA 4MLQA 1GGGA 1R9LA 1UTHA 2ZNTA 3K4UA 1NNKA 1KWHA 4IO6A 4YAHX 3D4CA 4H1XA 3IB2A 5DEXB 4GL8A 4TQUQ 3U8QA 4G8NA 3V89B 1B4HA 1ZJLA 1M5DA 1CB6A 2F7AA 3PU5A 1JVXA 1B5IA 4R75A 2UVGA 3B7DA 2OLBA 2NXOA 4LONB 4OQOA 3VE1B 2UXAA 3ONMA 1BLFA 3MW0A 3UGWA 4XIGQ 3VV5A 5AA3A 1LFHA 1B3GA 5FTHA 2Z22A 4R9GA 3MBPA 1LGBC 5BUUA 3QUFA 3KG2A 5F7VA 4YB7A 3EQ1A 5TU0A 4NF5A 1MY0A 4U23A 5AA2A 2FYIA 2OWTA 4YKJA 4IO3A 3K6UA 3W9WA 4OERA 4H6DA 2XXUA 2ONSA 4XKQA 2ONKE 3PPQA 1SDXA 1B2HA 5A5XB 4MF3A 4LP2B 1M5EA 5KCJA 4ECFA 3ILUB 4BDOA 4XXUA 3E4RA 4O3BA 1Y3QA 3T93B 1R9QA 3TKDA 1NNPA 1B0HA 2F78A 3LSXA 1LB9A 3DP6A 3TCHA 3KN3A 1SBPA 3K1NA 3S9LC 4MFIA 1LFIA 3CI8A 4H5FA 3H03A 1P1WA 1PB9A 4FEBA 5CBRA 1UIVA 2LAOA 4OEVA 3Q26A 1YCJA 1XHYA 2YJPA 2A5SA 4IGRA 1GR2A 3H3GA 3FVGA 1SW5A 4RK9A 2F7BA 4KI0E 1NMUA 2O51A 3IOVA 2Y7PA 1BIYA 4JB7A 3CIJA 4GQOA 4OTEA 3Q27A 1URSA 1QUJA 5DVJA 3MPKA 2V25A 3FASA 2XD2A 2XXRA 1AMFA 1PBPA 5DTBA 3UK4A 3PGFA 1FQCA 1MPDA 4ZE8A 1SQYA 4I8CA 2I49A 4OESA 3KSJA 5DEXA 4FATA 4FIMA 1H76A 2F36A 4Q30B 1ZU0A 4IB2A 2RC7A 1P1OA 2X7PA 2O1MA 1QW0A 3IORA 2Z23A 5TPAA 2HAVA 4GWOA 2H5YA 3TCFA 3V5AA 3L6GA 4NF6B 3K6VA 3M8UA 3EHSA 5HBCA 5H8SA 4P0GA 4X48A 4NWDA 1MXZA 4OEUA 2DWHA 3KSXA 1MDP1 4HTGA 4NEDA 4M1VA 1NNFA 5J1DA 3FVOA 1B0LA 4G8MA 1LAGE 2UYEA 2UVJA 5ISUA 3O66A 4E0XA 1UTBA 4N6PA 4WKMA 2Q89A 4JWOA 3KOSA 3ZKKA 2XXTA 4ISUA 1H3DA 2X26A 3SETA 3WAFA 2CMOA 4AB6A 1IIWA 5I2NA 3VVFA 4QFPA 3T9UA 1S50A 1TFAA 3V83A 1WVJA 1MQIA 5AA4B 3N6TA 3O6HA 3FXRA 4H8JA 2XXQA 4YMBA 4X1BA 5A5XA 2QS1A 2DWIA 1WODA 1MXVA 2RC9A 1D3KA 3KN8A 4ELRA 1JNFA 1DOTA 3TZAA 2VD2A 1US4A 4EUOA 3H06B 2REJA 4RPOA 5BWJA 1HSEA 2XX9A 1B3HA 1MH4A 3O2AA 3G3HA 4G2ZA 1MXYA 3ZSFA 4R6HA 3M3FA 4GXSB 3EHUA 2Y84A 4OVJA 3K6WA 4KYEA 3VXCA 1YPNA 4DZ1A 3EF7A 2A5TB 4QFLA 4BDMA 1PEBA 4NE4A 4NF4B 5CMBA 5I57B 2DQVA 3CR9A 3CRBA 4R2FA 3HSTA 3DM0A 3UIFA 5FHMA 2DVCA 5IAIA 5L9SA 4GRKA 2DP8A 4PQJA 3Q25A 3B6TA 4IO4A 2AL5A 3O29A 1B5JA 2DOJA 1P99A 3OO7A 4RK2A 2G93A 4JXIA 5CBSA 1B3EA 3A3UA 3UN6A 3KBRA 4ZEBA 3GBBA 3C31A 5FTIA 3N6UA 2OZZA 4U1ZA 4LQ2A 3G3FA 2O7UA 3KGCA 3KJTA 1N76A 3EHTA 3N5LA 3TUSA 1HSJA 1JEVA 2QS3A 1MRPA 4DE8A 4ZEDA 3MUQA 4Z7EA 3OEKA 3S9EA 2PMSA 2REGA 4EXKA 1B51A 4OMBA 4EXLA 2H4IA 3PUZE 4XKRA 4ZS9A 1POTA 2HZLA 3HV1A 1BP5A 4QSCA 1ANFA 4R73A 1FTOA 4BDLA 4F31B 4NF6A 4KD5A 2DE3A 2Y7WA 1JW5A 1P1NA 5KZTA 1T0KA 3PPOA 4LA9A 2H99A 4NF8B 3I6VA 1IQ7A 3G3IA 1N7XA 4P11A 3RT6B 3S4UA 2CZLA 3SEYA 4PFYA 2DE2A 1Y3PA 2HCAA 4OENA 5I2KB 3C33A 1EZ9A 2WKYA 4NMYA 3SEXA 4RYAA 4GF8A 5KDTB 4RPNA 4X1DA 4DIGA 3LBSA 2RCBA 4BDQA 4YU0A 3FVNA 2R71A 3OSRA 4U4SA 2VD3A 3A3CA 5I58B 1VFEA 1PDAA 3U94A 2ZYMA 3KJ7A 1MQGA 1GV8A 1ZMGA 1VR5A 3CFZA 5AA4A 1B1XA 2QRYA 2P0SA 2QJEA 3FGSA 1O7TA 4LUBA 1FQBA 1A99A 3O6GA 1LCFA 2XXXA 5AA1A 1LSTA 4EQ7A 4U1OA 2FA7A 4YZZA 1MQDA 1I69A 3QIMA 4EQBA 2F6GA 4FE8A 4OFLA 3OD7A 3CG3A 4G77A 2BJJX 2RF1A 1B32A 3LSFB 3ODBA 3MAMA 1SYHA 2A5TA 1R6ZA 3WAEA 2OK2A 3OO9A 2DE4A 4TOZA 4NF4A 1OIBA 1IXIA 4NWCA 3LC8A 4ZZAA 2ESNA 4C1UA 1JEUA 1ZBMA 3BFTA 5TP9B 3G3JA 3TFLA 3SERA 2F8DA 4ZDMA 2ZNUA 2E0SA 3U92A 2ALUA 1XT8A 3JZJA 1B7ZA 3HCQA 1MH3A 3FV1A 3MPLA 1GVCA 1ELJA 3Q28A 2Q88A 2V3QA 3LSLA 4ZEKA 4PFWA 3TYHA 3MJNA 1VFDA 2XXYA 1D9YA 1LCTA 4IY5A 5JTYB 1N3WA 3MVZA 4GD5A 4O3CA 1JW4A 4E0WA 4X9TA 4HW8A 2I6EA 2DXRA 1SYIA 2PT1A 3PMWA 1MG1A 4OZ9A 2R6GE 1XS5A 1US5A 5H8NB 4ESXA 4YB5A 3MVYA 1TXFA 2XD3A 1DSNA 4R74A 3FJGA 1H44A 2GRVA 1CE2A 3TTLA 2I4BA 1NL5A
chains in the Genus database with same CATH superfamily
3TTKA 1FQDA 3OEMA 3IO4A 3B6QA 3HO7A 4OXVA 3PD8A 1FJ9A 4OFJA 2VOZA 1B58A 3MWBA 5FHOA 1NKXA 3C32A 3IAZA 5B7DA 3O28A 1JQFA 1QULA 3O97A 3MZ1A 5I56B 4JBZA 4GXAA 1LBCA 1SVXB 2Z8FA 1EYIA 4TLMB 3IL1B 3IJOB 1FBDA 4NF0A 4NF8A 4GOTA 4NGUA 4F39A 4BDRA 2ZXTA 3TCGA 4PF8A 4NQ8A 4N07A 2HZKA 1MS7A 5I7IA 1DTGA 1EH3A 1SW2A 1FQFA 1TWYA 4Q5TA 3ILTB 4L17A 3LR1A 5KDTA 4X8RA 2O84X 1IUDA 4G68B 4F2QA 3IOUA 1UIUA 2FIXA 2KLFA 4PFTA 4U2RA 3QUJA 4ELQA 5I58A 2XWKA 2FIEA 3FJ7A 4KYSA 3IO6A 4I1DA 4H67A 1YTVA 4QHQA 1MM7A 1I6BA 2KR0A 4QF9A 3S9NC 2Z8DA 2THIA 3PV0E 4XF5A 1FBCA 3RT8A 5ET7A 3OMBA 1KZ8A 2O6AA 2PVUA 3ZKLA 1M5FA 4DCYA 1FPGA 2O68A 3JYRA 4XKPA 4N13A 1NH8A 5CMMA 1LBYA 2QL3A 2H25A 4GX6A 2I3WA 2E1SA 2QMWA 1LB8A 1H43A 2ZMBA 5I59B 1B9JA 4EF1A 3T1BA 1B40A 3T96B 2H9BA 1VSOA 2UYFA 1M5BA 4N91A 4FORA 4YKIA 1URGA 4IO5A 3KOTA 3PPRA 4O3AA 1ZLQA 4GL0A 5CMCA 3RN8A 3K02A 3OO6A 5CRYA 4O7MA 1FPLA 3HHFA 2HHMA 3OENA 4LZ8A 1B4ZA 5IGAA 3MP6A 4XTCQ 5ITOA 4P47A 4DDDA 3G3GA 2FNCA 4OFOA 4NX1A 1B3LA 4N8YA 4UA8A 2D21A 1USYE 3KC1A 1AOVA 3RNNA 5TP9A 1IMFA 3IX1A 3CG1A 1XC1A 4DCXA 1B6HA 1FBPA 1A8EA 1OLCA 4PGPA 3FZVA 5IKBA 1UTHB 2XXHA 2B3BA 4WXJA 3F11A 2IA4A 4M4GA 4LZ7A 4LQ5A 1TFDA 1FBHA 3L6HA 4ZEFA 2Q74A 1AH5A 5B70A 2DS9A 3S9MC 4BDNA 1J1NA 2HPGA 3IOWA 2OJTA 3PMVA 1D9VA 3OSQA 3H7MA 4ZECA 1Y9UA 1LAHE 4THIA 2CZIA 1FPEA 2XXPA 1JVYA 3CSGA 3HPIA 1ZKBA 2WBBA 3GZGA 4MJOA 3Q29A 4OVRA 5DVIA 1EYKA 1IMCA 4POXA 1FJ6A 3OXNA 4NG7A 1B52A 4I3YA 4LN5A 4ZZEA 5IZZA 4GIZA 5I56A 4OHNA 4R2BA 3O9PA 5EQ7A 4GWZA 4U22A 2ZNSA 3TODA 2Y5LA 5K2XA 2B4MA 1FTMA 1MQJA 1YAEA 2DDKA 3VXBA 3QYTA 4QFOA 4EDPA 2PFZA 4C0RA 5CI5A 3QXMA 3TELA 4F3BA 2RINA 3RTWB 1PBQA 3T9VA 4OVPA 1DPEA 4QFKA 1FQEA 2DWAA 1NV4A 3C34A 2ZYNA 4GX4A 2D3IA 2Q8JA 4P8BA 4IR8A 4IO7A 2QVRA 3B6WA 3IB0A 4PTKA 1FRPA 4LVQA 2O7IA 1O64A 3EPEA 2DYXA 1OQHA 3R26A 1P1QA 4H8IA 2F35A 1FW0A 3RY3A 2CEYA 4N6DA 1HSLA 2OWSA 1S9TA 3C35A 3C4MA 2ANJA 3MP8A 2B4LA 5EQ9A 3U93A 3BBRA 3HHGA 4TLLB 2OWZA 3T9HB 3E9XA 4QRZA 4PCDA 4PETA 1OVTA 3U1OA 4BLAA 1POY1 1MXXA 4I40A 4HE1A 4EF2A 4R9FA 5ITPA 3TTMA 4WEPA 4Q0CA 3M3KA 5DVFA 1MQHA 3K00A 4FEDA 1DCUA 3DP8A 1B1HA 5M2VA 3SEVA 4PE5B 1QVSA 3K0VA 2F5XA 3FUZA 1IMAA 3TQLA 3KN7A 3H6VA 4YKKA 4F22A 1YYZA 2PFYA 3D4GA 3GLBA 1CNQA 2P2AA 2VPNA 1A8FA 1KA0A 4NHBA 2NWJA 2F34A 2V93A 1UQWA 3P7IA 4F3GA 3TEPA 1A7LA 1USYH 4ELPA 1XVXA 4KQPA 3RTFB 2Y7RA 4I9DA 4DI4B 1RYXA 5EYGA 1MY2A 3ECRA 1NV7A 3RQTA 4QFNA 2B3FA 3HFUA 1MXUA 4G68C 4PP0A 4OANA 5FHNA 4UACA 3FATA 2DWJA 1BK4A 4JVDA 4H46A 1AWBA 3H6UA 2XX7A 4H65A 3TTNA 2I48A 1G0HA 1WDNA 2AL4A 3IB1A 2XX8A 4U4XA 3I5OA 2F6PA 3K1MA 4KYDA 1IITA 1N0TA 3VFJA 1DMBA 2I0BA 3RGYA 1H45A 1FTKA 4PFRA 3I3VA 4MH5A 2VP1A 5TPAB 1Q35A 2Y7KA 3H4ZA 2DXYA 4F29A 1DPPA 1QUIA 1I6QA 1Y3NA 2HQ0A 2V3TA 4ND9A 3MZ9A 3H6WA 5I57A 4OVQA 1OLAA 4RA1A 3TTRA 1NFTA 2QMXA 4FJPA 4EQ9A 1UTBB 1FTLA 2PYYA 2NVUB 4PFIA 3PD9A 1MPBA 3FV2A 2ONRA 1F9BA 3E3KA 5DW8A 3CSBA 3DP4A 2F97A 1LAFE 4KPTA 3BIGA 3K01A 5I2NB 1SD3A 2AIXA 4GFRA 4HCYA 5IZ3A 3E79A 4YB6A 5K2YA 1SI1A 5IM2A 3W15C 3G7WA 3AXFA 4HCWA 2O1LA 1B3FA 2HEUA 3C9HA 2NUVA 4IGTA 3FD3A 2XXWA 3KFMA 4POWA 2I3VA 1G0IA 2V3UA 2Z8EA 4DXBA 2RCAA 3MQ9A 2WEFA 3W9VA 3R6UA 3IK6B 3PUVE 1ATGA 3IJXB 5FBPA 5EHMA 3USDA 4MNCA 1AIVA 3JV9A 1LEVA 2F7CA 3QK6A 5AA2D 4PAFA 3CVGA 3T22A 3O6IA 3IOTA 3LUYA 2HFBA 3T66A 1GTKA 3LV0A 5AE4A 1EZPA 1ZTYA 1NV0A 4G4PA 3PPPA 4YKPA 1Y1MA 2NOOA 3QAXA 1Y4CA 3GXAA 1RKMA 1EYJA 4FAJA 3MZBA 2PBWA 5CC2A 3TAJA 4K3FA 5H8HB 2GHAA 4KR5A 3RUMA 1NV6A 4MLVA 4PBQA 2Y5KA 3LSWA 1NV5A 3RYDA 3G3KA 4WEDA 4IY6A 1FPDA 3TPAA 5I2KA 3UP9A 4JWYA 5ICTA 3K1PA 4F2OA 1IXCA 1LFGA 1A40A 4OA4A 2PX1A 4I62A 1MPCA 3RPWA 3GBAA 2Q2AA 4IO2A 1N04A 3BIHA 1OVBA 2QVUA 1O63A 2DVZA 2QS2A 4G8HA 1R1NA 1M5CA 5I84A 4FECA 4R6YA 1OQGA 4N6KA 2GH9A 2R9JA 1NNTA 5CM6A 5I5PA 3BKIB 2JJKA 2M8CA 1L5TA 1B7UA 3EKIA 3UA8A 2RKMA 2I0CA 1Y1ZA 2B65A 1FQAA 1RYOA 4DXCA 3SKPA 3CHGA 4JWXA 2GHBA 3VVDA 1PB8A 1EU8A 2OBGA 5EQAA 1I6AA 1FPBA 5L9MA 2Y7IA 4AQ4A 4MX6A 3HN0A 4RY1A 3PUYE 3K6XA 2YPNA 1FPJA 2CZKA 3MC2A 5EYHA 5IZ1A 2RC8A 2I58A 1SW1A 4MBPA 5F24A 5HPQA 1MXWA 1PB7A 1IXGA 2HXWA 1MM6A 2X7QA 5A5LA 5L9OA 3PPNA 2Q2CA 5H8FB 5ET5A 5H8QB 4RNSA 1QKBA 4Q8RA 1ZIUA 3VLWA 2H98A 4AB5A 1VDWA 4ZEIA 5ICQA 5DYHA 4QSDA 4AS5A 1BTJA 2PCRA 3PMXA 4ELOA 3EN3A 4ESWA 3FXQA 5EYFA 3R7XA 3BFUA 3SEWA 3H6TA 3CFLA 1IXHA 3A09A 2DSFA 2G29A 1LLSA 3CFXA 2GFEA 3OELA 4OYVA 4KFQA 4R6KA 3SESA 1B5HA 3PUXE 2I4CA 4Z0IA 3UORA 4F1UA 1II5A 2VHAA 2IEEA 4H5GA 4F3SA 1IMBA 1FPFA 1SPIA 3E13X 3IR1A 1Y20A 3FXUA 4HS7A 5JTYA 2XHDA 2VT5A 1N84A 1P1UA 1IMDA 4RJZA 3DLNA 1VE4A 3FVKA 4NN3A 5JK4A 4KCCA 3TQWA 2VPOA 4GVOA 1NH7A 3S2VA 4ZE9A 3SDFA 1LAXA 1OMPA 1DK4A 1Y4TA 1A54A 1EZOA 4ONYA 2XXVA 1FTJA 2ZYKA 5L8DA 5H8NA 1XVYA 2XXIA 3K2DA 3MVXA 4F1VA 4PBHA 4KCDA 4DI3D 2AYSA 4JSDA 2KQZA 4H0WA 1URDA 2Q9TA 3VVEA 4LZ5A 3FIRA 2D5WA 1SW4A 2QS4A 3OOAA 4LATA 3N26A 4QXDA 4NTLA 3TDJA 1IEJA 1FTAA 1DTZA 4RXLA 1QUKA 3KZGA 5H8HA 3ZS6A 3SZPA 4JDFA 1JP4A 1K9YA 2ABHA 3B8BA 4GLIA 2QFLA 4YMAA 3PUWE 1JW1A 1PC3A 1XOCA 4NF5B 1Z7ME 2O69A 5AA2B 3QSLA 4MIJA 2WYPA 3THIA 4PFUA 1TT1A 1JETA 4P1LA 1AL3A 4G68A 3V8XB 2UVHA 3MP1A 2HAUA 3VLUA 5KCJB 2V4CA 5ELVA 2VGQA 4N4UA 2XWVA 1FSAA 1B46A 5CMKA 3TMGA 1MDQA 2XWOA 2YLNA 4DLDA 1B7HA 4C1TA 1N7WA 5LOMA 3OO8A 1N3XA 3C36A 3VLVA 4QSEA 1XI6A 5F1QA 1D4NA 1B05A 1Q9DA 2F3DA 4F3PA 1QKAA 4OETA 1QJMA 4F19A 4PE3A 2PT2A 4R72A 1LBXA 2W7YA 1LBBA 5I59A 4XKNA 3U72A 5DT6A 1MY3A 4YICA 2V84A 4P3LA 4U21A 1S7YA 3VDFA 4F18A 2QPQA 1MY4A 4GWSA 3M3LA 5EHSA 4OVSA 5H8FA 5H8QA 2P1SA 3MVWA 1YZ0A 3RLFE 2QSXA 2UVIA 3KEIA 3N94A 5JEIA 4P0IA 1FCKA 4OWDA 3T9XB 1MY1A 4KHZE 5HM4B 3FJMA 2ZYOA 2WX9A 3DELB 1Z7NE 1A55A 4N17A 3SEUA 4DXUA 1IZ1A 1BKAA 4F1YA 4JSOA 1NUWA 1SI0A 2OCUA 1Q1KA 1FBGA 4MLQA 1GGGA 1R9LA 1UTHA 2ZNTA 3K4UA 1NNKA 1KWHA 4IO6A 4YAHX 3D4CA 4H1XA 3IB2A 5DEXB 4GL8A 4TQUQ 1QGXA 1LBWA 3U8QA 4G8NA 3E78A 3V89B 1B4HA 1ZJLA 1M5DA 1CB6A 3KC0A 2F7AA 3PU5A 1JVXA 3A29A 1B5IA 4P1EA 4R75A 2UVGA 3B7DA 2OLBA 2OX3A 2NXOA 4LONB 4OQOA 4G61A 3VE1B 2UXAA 3ONMA 4GWYA 1BLFA 4PF6A 3MW0A 3UGWA 4XIGQ 3VV5A 5AA3A 1LFHA 1B3GA 5FTHA 5LDZA 2Z22A 4HXVA 4R9GA 3MBPA 1LGBC 5BUUA 3QUFA 1NV3A 3KG2A 5F7VA 4YB7A 3EQ1A 5TU0A 4NF5A 4FBPA 1MY0A 4U23A 1YXIA 5AA2A 2FYIA 2OWTA 4YKJA 4IO3A 3K6UA 3W9WA 5T3JA 4OERA 4H6DA 2XXUA 2ONSA 4XKQA 2ONKE 3PPQA 1SDXA 1B2HA 5A5XB 4I3EA 2CZHA 4GWUA 4MF3A 4LP2B 1M5EA 5KCJA 4ECFA 3ILUB 4BDOA 5ESYA 4XXUA 3E4RA 5LTCA 4O3BA 1Y3QA 3T93B 1R9QA 3TKDA 1NNPA 1B0HA 2F78A 3LSXA 1LB9A 3DP6A 3TCHA 3KN3A 1SBPA 2P3VA 3K1NA 1NUZA 3S9LC 4MFIA 3T0JA 1LFIA 3NOHA 3CI8A 4H5FA 3H03A 1P1WA 1PB9A 4FEBA 5CBRA 1UIVA 2LAOA 4O7IA 4OEVA 3Q26A 1FPKA 1YCJA 1XHYA 4N81A 2YJPA 2A5SA 4IGRA 4HE0A 1GR2A 1KA1A 3H3GA 3FVGA 5EQ8A 1SW5A 4RK9A 2F7BA 4KI0E 1NMUA 1NUYA 2O51A 3IOVA 2Y7PA 1BIYA 4JB7A 2MKZA 3CIJA 5ET8A 4GQOA 4OTEA 3Q27A 1URSA 1QUJA 5DVJA 3MPKA 2V25A 3FASA 2XD2A 2XXRA 1AMFA 1PBPA 1NUXA 5DTBA 3UK4A 3PGFA 1FQCA 1MPDA 4ZE8A 1SQYA 4I8CA 4KXPA 2I49A 4OESA 3KSJA 5DEXA 4FATA 4FIMA 1H76A 2F36A 4Q30B 2ZZWA 1ZU0A 4IB2A 2RC7A 2F3BA 1P1OA 2X7PA 2O1MA 2CEXA 1QW0A 3IORA 2Z23A 1FBEA 2HAVA 5TPAA 4GWOA 1RDYA 2H5YA 3TCFA 2FVZA 3V5AA 3L6GA 4NF6B 4GBVA 3K6VA 3M8UA 4MMPA 3EHSA 5HBCA 5H8SA 4P0GA 3MYUA 4X48A 4NWDA 1MXZA 3KBZA 4OEUA 1DBZA 2DWHA 4NEDA 3KSXA 1MDP1 4HTGA 2XWIA 4M1VA 1NNFA 5J1DA 4UABA 3FVOA 1B0LA 2FBPA 4G8MA 1LAGE 2UYEA 2UVJA 5ISUA 3O66A 2Q8MA 4E0XA 1UTBA 4N6PA 4WKMA 2WYKA 2Q89A 4JWOA 3KOSA 3ZKKA 2XXTA 4ISUA 1H3DA 2X26A 3SETA 3WAFA 1RDZA 2CMOA 4AB6A 4AS4A 4MNPA 1IIWA 4PGNA 5I2NA 3VVFA 4QFPA 3T9UA 1S50A 1TFAA 1NV1A 3V83A 1WVJA 1MQIA 5AA4B 1IMEA 3N6TA 3O6HA 4N8GA 4PC9A 1NI9A 3FXRA 4H8JA 2XXQA 4YMBA 4H45A 4X1BA 5A5XA 3IFCA 2QS1A 2DWIA 1WODA 2QVVA 1MXVA 2RC9A 1D3KA 3KN8A 4ELRA 1JNFA 2GQ1A 1DOTA 3TZAA 2VD2A 1US4A 2L5VA 4EUOA 3H06B 2REJA 4RPOA 5BWJA 1HSEA 2XX9A 1B3HA 1MH4A 3O2AA 3G3HA 4G2ZA 1MXYA 3ZSFA 4R6HA 3M3FA 4GXSB 3EHUA 3MSTA 1LBVA 2Y84A 4OVJA 3K6WA 4KYEA 3VXCA 1YPNA 4DZ1A 3FXBA 3U65A 3EF7A 2A5TB 4QFLA 4BDMA 1PEBA 4NE4A 4NF4B 5CMBA 5I57B 2DQVA 2ZZXA 3CR9A 3CRBA 4R2FA 3HSTA 1FBFA 1INPA 3DM0A 3UIFA 5FHMA 2DVCA 5IAIA 5L9SA 2HXRA 4GRKA 2DP8A 4PQJA 3Q25A 3B6TA 4IO4A 2AL5A 3O29A 1B5JA 2DOJA 1D9QA 1P99A 3OO7A 4GX3A 2G93A 4JXIA 1LBZA 4RK2A 5CBSA 1B3EA 3A3UA 3UN6A 2XXKA 3KBRA 5IZ3B 4ZEBA 3GBBA 4O94A 3C31A 5FTIA 3N6UA 2OZZA 4PAIA 4U1ZA 4LQ2A 3G3FA 2O7UA 3KGCA 3KJTA 3RPLB 1N76A 4PAKA 3EHTA 3N5LA 4PFBA 3TUSA 1HSJA 1JEVA 2QS3A 1MRPA 4DE8A 4ZEDA 3MUQA 4Z7EA 3OEKA 3S9EA 2PMSA 1K9ZA 2REGA 4EXKA 1B51A 4OMBA 4EXLA 2H4IA 4OVTA 3PUZE 4XKRA 4ZS9A 1POTA 2HZLA 3HV1A 4JVIA 1BP5A 4QSCA 1ANFA 4R73A 1FTOA 4BDLA 4F31B 4NF6A 4KD5A 3IFAA 4QBAA 2DE3A 2Y7WA 1JW5A 4XFEA 1P1NA 5KZTA 1T0KA 3PPOA 2WBDA 4LA9A 2H99A 4NF8B 3I6VA 1IQ7A 3G3IA 1N7XA 4P11A 3RT6B 3S4UA 2CZLA 3SEYA 4PFYA 2DE2A 1Y3PA 2HCAA 4OENA 5I2KB 3C33A 1EZ9A 1RDXA 2WKYA 4NMYA 3SEXA 4RYAA 3D1RA 4GF8A 5KDTB 4RPNA 4X1DA 3LUZA 3LBSA 4DIGA 2RCBA 4BDQA 4YU0A 3FVNA 2R71A 3OSRA 4U4SA 2VD3A 3A3CA 5I58B 1VFEA 1PDAA 3U94A 2ZYMA 3KJ7A 1MQGA 1GV8A 2XA5A 1ZMGA 2BJIA 1VR5A 3CFZA 4PDDA 1B1XA 2QRYA 5AA4A 3FBPA 2P0SA 2QJEA 3FGSA 4GBWA 1O7TA 4LUBA 1FQBA 1A99A 3O6GA 4N15A 1LCFA 2XXXA 4MAGA 4PDHA 5AA1A 1LSTA 4EQ7A 4U1OA 2FA7A 4X04A 4YZZA 1MQDA 1I69A 3QIMA 5ET6A 4EQBA 2F6GA 3B50A 4FE8A 2FHYA 4OFLA 3OD7A 4P56A 4MNIA 3CG3A 2R8TA 4G77A 2BJJX 4O8MA 2RF1A 1B32A 3LSFB 5J16A 3ODBA 3MAMA 4HE2A 3GYYA 5I3SA 1SYHA 2A5TA 1R6ZA 3WAEA 2OK2A 3OO9A 3PTYA 2DE4A 4TOZA 4NAPA 4NF4A 1OIBA 1IXIA 4NWCA 3ISPA 3LC8A 4XEQA 4ZZAA 2ESNA 4C1UA 1JEUA 1ZBMA 3BFTA 4MCOA 5TP9B 3G3JA 3TFLA 4GWXA 3SERA 2F8DA 4ZDMA 4P9KA 2ZNUA 4JVCA 2E0SA 3U92A 2ALUA 1XT8A 3JZJA 1B7ZA 3HCQA 1MH3A 3FV1A 3MPLA 2P3NA 4MEVA 1GVCA 1ELJA 3Q28A 2Q88A 2V3QA 3LSLA 4ZEKA 1FPIA 4PFWA 2ZZVA 3TYHA 3MJNA 1VFDA 2XXYA 1D9YA 1LCTA 4IY5A 5JTYB 1N3WA 4GWWA 4MHFA 3MVZA 4GD5A 4O3CA 1JW4A 4E0WA 4X9TA 4HW8A 3RPLA 2I6EA 2DXRA 1SYIA 2PT1A 1NV2A 3PMWA 1MG1A 4OZ9A 2R6GE 1XS5A 3QMFA 1US5A 5H8NB 4ESXA 4YB5A 3MVYA 1TXFA 2XD3A 1DSNA 4R74A 3ROJA 3FJGA 1H44A 2GRVA 1CE2A 3TTLA 2I4BA 1NL5A
chains in the Genus database with same CATH topology
3TTKA 1FQDA 3OEMA 3IO4A 3B6QA 3HO7A 4OXVA 3PD8A 4OFJA 2VOZA 1B58A 3MWBA 5FHOA 1NKXA 3C32A 3IAZA 5B7DA 3O28A 1JQFA 1QULA 3O97A 3MZ1A 5I56B 4JBZA 4GXAA 1LBCA 1SVXB 2Z8FA 4TLMB 3IL1B 3IJOB 4NF8A 4GOTA 4F39A 4BDRA 2ZXTA 3TCGA 4N07A 2HZKA 1MS7A 1EH3A 1DTGA 1SW2A 1FQFA 1TWYA 4Q5TA 3ILTB 4L17A 3LR1A 5KDTA 2O84X 1IUDA 4G68B 4F2QA 3IOUA 1UIUA 2KLFA 4PFTA 4U2RA 3QUJA 4ELQA 5I58A 3FJ7A 4KYSA 3IO6A 4I1DA 4H67A 1YTVA 4QHQA 1MM7A 1I6BA 4QF9A 3S9NC 2Z8DA 2THIA 3PV0E 3RT8A 3OMBA 2O6AA 2PVUA 3ZKLA 1M5FA 4DCYA 2O68A 3JYRA 4XKPA 4N13A 1NH8A 5CMMA 2QL3A 2H25A 2I3WA 2E1SA 2QMWA 1LB8A 1H43A 2ZMBA 5I59B 1B9JA 4EF1A 1B40A 3T96B 2H9BA 1VSOA 2UYFA 1M5BA 4FORA 4YKIA 1URGA 4IO5A 3KOTA 3PPRA 4O3AA 1ZLQA 4GL0A 5CMCA 3RN8A 3K02A 3OO6A 5CRYA 3HHFA 3OENA 4LZ8A 1B4ZA 3MP6A 4XTCQ 5ITOA 4DDDA 3G3GA 2FNCA 4OFOA 1B3LA 4UA8A 2D21A 1USYE 1AOVA 3RNNA 5TP9A 3IX1A 3CG1A 1XC1A 4DCXA 1B6HA 1A8EA 1OLCA 3FZVA 5IKBA 1UTHB 2XXHA 2B3BA 4WXJA 3F11A 2IA4A 4M4GA 4LZ7A 4LQ5A 1TFDA 3L6HA 4ZEFA 1AH5A 5B70A 2DS9A 3S9MC 4BDNA 1J1NA 3IOWA 2OJTA 3PMVA 1D9VA 3OSQA 3H7MA 4ZECA 1Y9UA 1LAHE 4THIA 2XXPA 1JVYA 3CSGA 3HPIA 1ZKBA 3GZGA 3Q29A 5DVIA 4POXA 3OXNA 1B52A 4ZZEA 4GIZA 5I56A 4OHNA 4R2BA 3O9PA 4U22A 2ZNSA 3TODA 5K2XA 1FTMA 1MQJA 1YAEA 3VXBA 3QYTA 4QFOA 4EDPA 4C0RA 5CI5A 3QXMA 3TELA 4F3BA 2RINA 3RTWB 1PBQA 3T9VA 1DPEA 4QFKA 1FQEA 2DWAA 3C34A 2ZYNA 2D3IA 2Q8JA 4IO7A 3B6WA 3IB0A 4LVQA 2O7IA 1O64A 3EPEA 2DYXA 1OQHA 3R26A 1P1QA 4H8IA 2F35A 1FW0A 3RY3A 1HSLA 2OWSA 1S9TA 3C35A 3C4MA 2ANJA 3MP8A 3U93A 3BBRA 3HHGA 4TLLB 3T9HB 3E9XA 4QRZA 4PETA 1OVTA 3U1OA 4BLAA 1POY1 1MXXA 4EF2A 4R9FA 5ITPA 3TTMA 4WEPA 4Q0CA 3M3KA 5DVFA 1MQHA 3K00A 4FEDA 3DP8A 1B1HA 5M2VA 3SEVA 4PE5B 1QVSA 3K0VA 2F5XA 3FUZA 3TQLA 3KN7A 3H6VA 4YKKA 4F22A 3D4GA 3GLBA 2P2AA 1A8FA 2NWJA 2F34A 2V93A 1UQWA 3P7IA 4F3GA 3TEPA 1A7LA 1USYH 4ELPA 1XVXA 4KQPA 3RTFB 2Y7RA 4I9DA 1RYXA 1MY2A 3ECRA 3RQTA 4QFNA 2B3FA 1MXUA 4G68C 4PP0A 5FHNA 4UACA 3FATA 2DWJA 3H6UA 2XX7A 4H65A 3TTNA 2I48A 1WDNA 2AL4A 3IB1A 2XX8A 4U4XA 3I5OA 2F6PA 3K1MA 4KYDA 1IITA 1N0TA 3VFJA 1DMBA 2I0BA 3RGYA 1H45A 1FTKA 3I3VA 4MH5A 2VP1A 5TPAB 1Q35A 2Y7KA 3H4ZA 2DXYA 4F29A 1DPPA 1QUIA 1I6QA 1Y3NA 2HQ0A 2V3TA 4ND9A 3MZ9A 3H6WA 5I57A 1OLAA 4RA1A 3TTRA 1NFTA 2QMXA 4FJPA 4EQ9A 1UTBB 1FTLA 2PYYA 2NVUB 3PD9A 1MPBA 3FV2A 2ONRA 1F9BA 3E3KA 3CSBA 3DP4A 2F97A 1LAFE 4KPTA 3K01A 5I2NB 1SD3A 2AIXA 4GFRA 4HCYA 4YB6A 5K2YA 1SI1A 3W15C 3G7WA 3AXFA 4HCWA 2O1LA 1B3FA 2HEUA 3C9HA 2NUVA 4IGTA 3FD3A 2XXWA 3KFMA 4POWA 2I3VA 2V3UA 2Z8EA 4DXBA 2RCAA 3MQ9A 3W9VA 3R6UA 3IK6B 3PUVE 1ATGA 3IJXB 5EHMA 3USDA 1AIVA 3JV9A 2F7CA 3QK6A 5AA2D 3CVGA 3T22A 3O6IA 3IOTA 3LUYA 2HFBA 3T66A 1GTKA 5AE4A 1EZPA 1ZTYA 4G4PA 3PPPA 4YKPA 1Y1MA 2NOOA 3QAXA 1Y4CA 3GXAA 1RKMA 4FAJA 3MZBA 2PBWA 5CC2A 3TAJA 4K3FA 5H8HB 2GHAA 4KR5A 3RUMA 4MLVA 3LSWA 3G3KA 4WEDA 4IY6A 3TPAA 5I2KA 3UP9A 4JWYA 5ICTA 3K1PA 4F2OA 1IXCA 1LFGA 1A40A 2PX1A 4I62A 1MPCA 3RPWA 3GBAA 2Q2AA 4IO2A 1N04A 1OVBA 1O63A 2DVZA 2QS2A 4G8HA 1R1NA 1M5CA 5I84A 4FECA 4R6YA 1OQGA 2GH9A 2R9JA 1NNTA 5CM6A 3BKIB 2M8CA 1L5TA 1B7UA 3UA8A 2RKMA 2I0CA 1Y1ZA 2B65A 1FQAA 1RYOA 4DXCA 3SKPA 4JWXA 3VVDA 2GHBA 1PB8A 1EU8A 2OBGA 1I6AA 5L9MA 2Y7IA 4AQ4A 3HN0A 4RY1A 3PUYE 3K6XA 2YPNA 3MC2A 2RC8A 2I58A 1SW1A 4MBPA 5HPQA 1MXWA 1PB7A 1IXGA 2HXWA 1MM6A 2X7QA 5L9OA 3PPNA 2Q2CA 5H8FB 5H8QB 4RNSA 1QKBA 4Q8RA 1ZIUA 3VLWA 2H98A 4AB5A 4ZEIA 5ICQA 5DYHA 4QSDA 1BTJA 3PMXA 4ELOA 3EN3A 4ESWA 3FXQA 5EYFA 3R7XA 3BFUA 3SEWA 3H6TA 3CFLA 1IXHA 3A09A 2DSFA 2G29A 1LLSA 3CFXA 2GFEA 3OELA 4OYVA 4KFQA 4R6KA 3SESA 1B5HA 3PUXE 2I4CA 4Z0IA 3UORA 4F1UA 1II5A 2VHAA 2IEEA 4H5GA 4F3SA 3E13X 3IR1A 1Y20A 3FXUA 4HS7A 5JTYA 2XHDA 1N84A 1P1UA 4RJZA 3DLNA 1VE4A 3FVKA 5JK4A 4KCCA 3TQWA 4GVOA 1NH7A 3S2VA 4ZE9A 3SDFA 1LAXA 1OMPA 1Y4TA 1A54A 1EZOA 4ONYA 2XXVA 1FTJA 2ZYKA 5L8DA 5H8NA 1XVYA 2XXIA 3K2DA 3MVXA 4F1VA 4KCDA 2AYSA 4JSDA 4H0WA 1URDA 2Q9TA 3VVEA 3FIRA 4LZ5A 2D5WA 1SW4A 2QS4A 3OOAA 4LATA 3N26A 4NTLA 3TDJA 1IEJA 1DTZA 4RXLA 1QUKA 3KZGA 5H8HA 3ZS6A 4JDFA 2ABHA 4GLIA 4YMAA 3PUWE 1JW1A 1PC3A 1XOCA 4NF5B 1Z7ME 2O69A 5AA2B 3QSLA 3THIA 4PFUA 1TT1A 1JETA 1AL3A 4G68A 3V8XB 2UVHA 3MP1A 2HAUA 3VLUA 5KCJB 5ELVA 2VGQA 1B46A 5CMKA 3TMGA 1MDQA 2YLNA 4DLDA 1B7HA 4C1TA 1N7WA 5LOMA 3OO8A 1N3XA 3C36A 3VLVA 4QSEA 5F1QA 1D4NA 1B05A 4F3PA 1QKAA 4OETA 1QJMA 4F19A 2PT2A 4R72A 2W7YA 1LBBA 5I59A 4XKNA 3U72A 5DT6A 1MY3A 4YICA 2V84A 3VDFA 4U21A 1S7YA 4F18A 2QPQA 1MY4A 5EHSA 3M3LA 5H8FA 5H8QA 2P1SA 3MVWA 3RLFE 2QSXA 2UVIA 3KEIA 3N94A 5JEIA 4P0IA 1FCKA 4OWDA 3T9XB 1MY1A 4KHZE 5HM4B 3FJMA 2ZYOA 3DELB 1Z7NE 1A55A 3SEUA 4DXUA 1IZ1A 1BKAA 4F1YA 4JSOA 1SI0A 2OCUA 1Q1KA 4MLQA 1GGGA 1R9LA 1UTHA 2ZNTA 3K4UA 1NNKA 1KWHA 4IO6A 4YAHX 3D4CA 4H1XA 3IB2A 5DEXB 4GL8A 4TQUQ 3U8QA 4G8NA 3V89B 1B4HA 1ZJLA 1M5DA 1CB6A 2F7AA 3PU5A 1JVXA 1B5IA 4R75A 2UVGA 3B7DA 2OLBA 2NXOA 4LONB 4OQOA 3VE1B 2UXAA 3ONMA 1BLFA 3MW0A 3UGWA 4XIGQ 3VV5A 5AA3A 1LFHA 1B3GA 5FTHA 2Z22A 4R9GA 3MBPA 1LGBC 5BUUA 3QUFA 3KG2A 5F7VA 4YB7A 3EQ1A 5TU0A 4NF5A 1MY0A 4U23A 5AA2A 2FYIA 2OWTA 4YKJA 4IO3A 3K6UA 3W9WA 4OERA 4H6DA 2XXUA 2ONSA 4XKQA 2ONKE 3PPQA 1SDXA 1B2HA 5A5XB 4MF3A 4LP2B 1M5EA 5KCJA 4ECFA 3ILUB 4BDOA 4XXUA 3E4RA 4O3BA 1Y3QA 3T93B 1R9QA 3TKDA 1NNPA 1B0HA 2F78A 3LSXA 1LB9A 3DP6A 3TCHA 3KN3A 1SBPA 3K1NA 3S9LC 4MFIA 1LFIA 3CI8A 4H5FA 3H03A 1P1WA 1PB9A 4FEBA 5CBRA 1UIVA 2LAOA 4OEVA 3Q26A 1YCJA 1XHYA 2YJPA 2A5SA 4IGRA 1GR2A 3H3GA 3FVGA 1SW5A 4RK9A 2F7BA 4KI0E 1NMUA 2O51A 3IOVA 2Y7PA 1BIYA 4JB7A 3CIJA 4GQOA 4OTEA 3Q27A 1URSA 1QUJA 5DVJA 3MPKA 2V25A 3FASA 2XD2A 2XXRA 1AMFA 1PBPA 5DTBA 3UK4A 3PGFA 1FQCA 1MPDA 4ZE8A 1SQYA 4I8CA 2I49A 4OESA 3KSJA 5DEXA 4FATA 4FIMA 1H76A 2F36A 4Q30B 1ZU0A 4IB2A 2RC7A 1P1OA 2X7PA 2O1MA 1QW0A 3IORA 2Z23A 5TPAA 2HAVA 4GWOA 2H5YA 3TCFA 3V5AA 3L6GA 4NF6B 3K6VA 3M8UA 3EHSA 5HBCA 5H8SA 4P0GA 4X48A 4NWDA 1MXZA 4OEUA 2DWHA 3KSXA 1MDP1 4HTGA 4NEDA 4M1VA 1NNFA 5J1DA 3FVOA 1B0LA 4G8MA 1LAGE 2UYEA 2UVJA 5ISUA 3O66A 4E0XA 1UTBA 4N6PA 4WKMA 2Q89A 4JWOA 3KOSA 3ZKKA 2XXTA 4ISUA 1H3DA 2X26A 3SETA 3WAFA 2CMOA 4AB6A 1IIWA 5I2NA 3VVFA 4QFPA 3T9UA 1S50A 1TFAA 3V83A 1WVJA 1MQIA 5AA4B 3N6TA 3O6HA 3FXRA 4H8JA 2XXQA 4YMBA 4X1BA 5A5XA 2QS1A 2DWIA 1WODA 1MXVA 2RC9A 1D3KA 3KN8A 4ELRA 1JNFA 1DOTA 3TZAA 2VD2A 1US4A 4EUOA 3H06B 2REJA 4RPOA 5BWJA 1HSEA 2XX9A 1B3HA 1MH4A 3O2AA 3G3HA 4G2ZA 1MXYA 3ZSFA 4R6HA 3M3FA 4GXSB 3EHUA 2Y84A 4OVJA 3K6WA 4KYEA 3VXCA 1YPNA 4DZ1A 3EF7A 2A5TB 4QFLA 4BDMA 1PEBA 4NE4A 4NF4B 5CMBA 5I57B 2DQVA 3CR9A 3CRBA 4R2FA 3HSTA 3DM0A 3UIFA 5FHMA 2DVCA 5IAIA 5L9SA 4GRKA 2DP8A 4PQJA 3Q25A 3B6TA 4IO4A 2AL5A 3O29A 1B5JA 2DOJA 1P99A 3OO7A 4RK2A 2G93A 4JXIA 5CBSA 1B3EA 3A3UA 3UN6A 3KBRA 4ZEBA 3GBBA 3C31A 5FTIA 3N6UA 2OZZA 4U1ZA 4LQ2A 3G3FA 2O7UA 3KGCA 3KJTA 1N76A 3EHTA 3N5LA 3TUSA 1HSJA 1JEVA 2QS3A 1MRPA 4DE8A 4ZEDA 3MUQA 4Z7EA 3OEKA 3S9EA 2PMSA 2REGA 4EXKA 1B51A 4OMBA 4EXLA 2H4IA 3PUZE 4XKRA 4ZS9A 1POTA 2HZLA 3HV1A 1BP5A 4QSCA 1ANFA 4R73A 1FTOA 4BDLA 4F31B 4NF6A 4KD5A 2DE3A 2Y7WA 1JW5A 1P1NA 5KZTA 1T0KA 3PPOA 4LA9A 2H99A 4NF8B 3I6VA 1IQ7A 3G3IA 1N7XA 4P11A 3RT6B 3S4UA 2CZLA 3SEYA 4PFYA 2DE2A 1Y3PA 2HCAA 4OENA 5I2KB 3C33A 1EZ9A 2WKYA 4NMYA 3SEXA 4RYAA 4GF8A 5KDTB 4RPNA 4X1DA 4DIGA 3LBSA 2RCBA 4BDQA 4YU0A 3FVNA 2R71A 3OSRA 4U4SA 2VD3A 3A3CA 5I58B 1VFEA 1PDAA 3U94A 2ZYMA 3KJ7A 1MQGA 1GV8A 1ZMGA 1VR5A 3CFZA 5AA4A 1B1XA 2QRYA 2P0SA 2QJEA 3FGSA 1O7TA 4LUBA 1FQBA 1A99A 3O6GA 1LCFA 2XXXA 5AA1A 1LSTA 4EQ7A 4U1OA 2FA7A 4YZZA 1MQDA 1I69A 3QIMA 4EQBA 2F6GA 4FE8A 4OFLA 3OD7A 3CG3A 4G77A 2BJJX 2RF1A 1B32A 3LSFB 3ODBA 3MAMA 1SYHA 2A5TA 1R6ZA 3WAEA 2OK2A 3OO9A 2DE4A 4TOZA 4NF4A 1OIBA 1IXIA 4NWCA 3LC8A 4ZZAA 2ESNA 4C1UA 1JEUA 1ZBMA 3BFTA 5TP9B 3G3JA 3TFLA 3SERA 2F8DA 4ZDMA 2ZNUA 2E0SA 3U92A 2ALUA 1XT8A 3JZJA 1B7ZA 3HCQA 1MH3A 3FV1A 3MPLA 1GVCA 1ELJA 3Q28A 2Q88A 2V3QA 3LSLA 4ZEKA 4PFWA 3TYHA 3MJNA 1VFDA 2XXYA 1D9YA 1LCTA 4IY5A 5JTYB 1N3WA 3MVZA 4GD5A 4O3CA 1JW4A 4E0WA 4X9TA 4HW8A 2I6EA 2DXRA 1SYIA 2PT1A 3PMWA 1MG1A 4OZ9A 2R6GE 1XS5A 1US5A 5H8NB 4ESXA 4YB5A 3MVYA 1TXFA 2XD3A 1DSNA 4R74A 3FJGA 1H44A 2GRVA 1CE2A 3TTLA 2I4BA 1NL5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TTK A;  1FQD A;  3OEM A;  3IO4 A;  3B6Q A;  3HO7 A;  4OXV A;  3PD8 A;  4OFJ A;  2VOZ A;  1B58 A;  3MWB A;  5FHO A;  1NKX A;  3C32 A;  3IAZ A;  5B7D A;  3O28 A;  1JQF A;  1QUL A;  3O97 A;  3MZ1 A;  5I56 B;  4JBZ A;  4GXA A;  1LBC A;  1SVX B;  2Z8F A;  4TLM B;  3IL1 B;  3IJO B;  4NF8 A;  4GOT A;  4F39 A;  4BDR A;  2ZXT A;  3TCG A;  4N07 A;  2HZK A;  1MS7 A;  1EH3 A;  1DTG A;  1SW2 A;  1FQF A;  1TWY A;  4Q5T A;  3ILT B;  4L17 A;  3LR1 A;  5KDT A;  2O84 X;  1IUD A;  4G68 B;  4F2Q A;  3IOU A;  1UIU A;  2KLF A;  4PFT A;  4U2R A;  3QUJ A;  4ELQ A;  5I58 A;  3FJ7 A;  4KYS A;  3IO6 A;  4I1D A;  4H67 A;  1YTV A;  4QHQ A;  1MM7 A;  1I6B A;  4QF9 A;  3S9N C;  2Z8D A;  2THI A;  3PV0 E;  3RT8 A;  3OMB A;  2O6A A;  2PVU A;  3ZKL A;  1M5F A;  4DCY A;  2O68 A;  3JYR A;  4XKP A;  4N13 A;  1NH8 A;  5CMM A;  2QL3 A;  2H25 A;  2I3W A;  2E1S A;  2QMW A;  1LB8 A;  1H43 A;  2ZMB A;  5I59 B;  1B9J A;  4EF1 A;  1B40 A;  3T96 B;  2H9B A;  1VSO A;  2UYF A;  1M5B A;  4FOR A;  4YKI A;  1URG A;  4IO5 A;  3KOT A;  3PPR A;  4O3A A;  1ZLQ A;  4GL0 A;  5CMC A;  3RN8 A;  3K02 A;  3OO6 A;  5CRY A;  3HHF A;  3OEN A;  4LZ8 A;  1B4Z A;  3MP6 A;  4XTC Q;  5ITO A;  4DDD A;  3G3G A;  2FNC A;  4OFO A;  1B3L A;  4UA8 A;  2D21 A;  1USY E;  1AOV A;  3RNN A;  5TP9 A;  3IX1 A;  3CG1 A;  1XC1 A;  4DCX A;  1B6H A;  1A8E A;  1OLC A;  3FZV A;  5IKB A;  1UTH B;  2XXH A;  2B3B A;  4WXJ A;  3F11 A;  2IA4 A;  4M4G A;  4LZ7 A;  4LQ5 A;  1TFD A;  3L6H A;  4ZEF A;  1AH5 A;  5B70 A;  2DS9 A;  3S9M C;  4BDN A;  1J1N A;  3IOW A;  2OJT A;  3PMV A;  1D9V A;  3OSQ A;  3H7M A;  4ZEC A;  1Y9U A;  1LAH E;  4THI A;  2XXP A;  1JVY A;  3CSG A;  3HPI A;  1ZKB A;  3GZG A;  3Q29 A;  5DVI A;  4POX A;  3OXN A;  1B52 A;  4ZZE A;  4GIZ A;  5I56 A;  4OHN A;  4R2B A;  3O9P A;  4U22 A;  2ZNS A;  3TOD A;  5K2X A;  1FTM A;  1MQJ A;  1YAE A;  3VXB A;  3QYT A;  4QFO A;  4EDP A;  4C0R A;  5CI5 A;  3QXM A;  3TEL A;  4F3B A;  2RIN A;  3RTW B;  1PBQ A;  3T9V A;  1DPE A;  4QFK A;  1FQE A;  2DWA A;  3C34 A;  2ZYN A;  2D3I A;  2Q8J A;  4IO7 A;  3B6W A;  3IB0 A;  4LVQ A;  2O7I A;  1O64 A;  3EPE A;  2DYX A;  1OQH A;  3R26 A;  1P1Q A;  4H8I A;  2F35 A;  1FW0 A;  3RY3 A;  1HSL A;  2OWS A;  1S9T A;  3C35 A;  3C4M A;  2ANJ A;  3MP8 A;  3U93 A;  3BBR A;  3HHG A;  4TLL B;  3T9H B;  3E9X A;  4QRZ A;  4PET A;  1OVT A;  3U1O A;  4BLA A;  1POY 1;  1MXX A;  4EF2 A;  4R9F A;  5ITP A;  3TTM A;  4WEP A;  4Q0C A;  3M3K A;  5DVF A;  1MQH A;  3K00 A;  4FED A;  3DP8 A;  1B1H A;  5M2V A;  3SEV A;  4PE5 B;  1QVS A;  3K0V A;  2F5X A;  3FUZ A;  3TQL A;  3KN7 A;  3H6V A;  4YKK A;  4F22 A;  3D4G A;  3GLB A;  2P2A A;  1A8F A;  2NWJ A;  2F34 A;  2V93 A;  1UQW A;  3P7I A;  4F3G A;  3TEP A;  1A7L A;  1USY H;  4ELP A;  1XVX A;  4KQP A;  3RTF B;  2Y7R A;  4I9D A;  1RYX A;  1MY2 A;  3ECR A;  3RQT A;  4QFN A;  2B3F A;  1MXU A;  4G68 C;  4PP0 A;  5FHN A;  4UAC A;  3FAT A;  2DWJ A;  3H6U A;  2XX7 A;  4H65 A;  3TTN A;  2I48 A;  1WDN A;  2AL4 A;  3IB1 A;  2XX8 A;  4U4X A;  3I5O A;  2F6P A;  3K1M A;  4KYD A;  1IIT A;  1N0T A;  3VFJ A;  1DMB A;  2I0B A;  3RGY A;  1H45 A;  1FTK A;  3I3V A;  4MH5 A;  2VP1 A;  5TPA B;  1Q35 A;  2Y7K A;  3H4Z A;  2DXY A;  4F29 A;  1DPP A;  1QUI A;  1I6Q A;  1Y3N A;  2HQ0 A;  2V3T A;  4ND9 A;  3MZ9 A;  3H6W A;  5I57 A;  1OLA A;  4RA1 A;  3TTR A;  1NFT A;  2QMX A;  4FJP A;  4EQ9 A;  1UTB B;  1FTL A;  2PYY A;  2NVU B;  3PD9 A;  1MPB A;  3FV2 A;  2ONR A;  1F9B A;  3E3K A;  3CSB A;  3DP4 A;  2F97 A;  1LAF E;  4KPT A;  3K01 A;  5I2N B;  1SD3 A;  2AIX A;  4GFR A;  4HCY A;  4YB6 A;  5K2Y A;  1SI1 A;  3W15 C;  3G7W A;  3AXF A;  4HCW A;  2O1L A;  1B3F A;  2HEU A;  3C9H A;  2NUV A;  4IGT A;  3FD3 A;  2XXW A;  3KFM A;  4POW A;  2I3V A;  2V3U A;  2Z8E A;  4DXB A;  2RCA A;  3MQ9 A;  3W9V A;  3R6U A;  3IK6 B;  3PUV E;  1ATG A;  3IJX B;  5EHM A;  3USD A;  1AIV A;  3JV9 A;  2F7C A;  3QK6 A;  5AA2 D;  3CVG A;  3T22 A;  3O6I A;  3IOT A;  3LUY A;  2HFB A;  3T66 A;  1GTK A;  5AE4 A;  1EZP A;  1ZTY A;  4G4P A;  3PPP A;  4YKP A;  1Y1M A;  2NOO A;  3QAX A;  1Y4C A;  3GXA A;  1RKM A;  4FAJ A;  3MZB A;  2PBW A;  5CC2 A;  3TAJ A;  4K3F A;  5H8H B;  2GHA A;  4KR5 A;  3RUM A;  4MLV A;  3LSW A;  3G3K A;  4WED A;  4IY6 A;  3TPA A;  5I2K A;  3UP9 A;  4JWY A;  5ICT A;  3K1P A;  4F2O A;  1IXC A;  1LFG A;  1A40 A;  2PX1 A;  4I62 A;  1MPC A;  3RPW A;  3GBA A;  2Q2A A;  4IO2 A;  1N04 A;  1OVB A;  1O63 A;  2DVZ A;  2QS2 A;  4G8H A;  1R1N A;  1M5C A;  5I84 A;  4FEC A;  4R6Y A;  1OQG A;  2GH9 A;  2R9J A;  1NNT A;  5CM6 A;  3BKI B;  2M8C A;  1L5T A;  1B7U A;  3UA8 A;  2RKM A;  2I0C A;  1Y1Z A;  2B65 A;  1FQA A;  1RYO A;  4DXC A;  3SKP A;  4JWX A;  3VVD A;  2GHB A;  1PB8 A;  1EU8 A;  2OBG A;  1I6A A;  5L9M A;  2Y7I A;  4AQ4 A;  3HN0 A;  4RY1 A;  3PUY E;  3K6X A;  2YPN A;  3MC2 A;  2RC8 A;  2I58 A;  1SW1 A;  4MBP A;  5HPQ A;  1MXW A;  1PB7 A;  1IXG A;  2HXW A;  1MM6 A;  2X7Q A;  5L9O A;  3PPN A;  2Q2C A;  5H8F B;  5H8Q B;  4RNS A;  1QKB A;  4Q8R A;  1ZIU A;  3VLW A;  2H98 A;  4AB5 A;  4ZEI A;  5ICQ A;  5DYH A;  4QSD A;  1BTJ A;  3PMX A;  4ELO A;  3EN3 A;  4ESW A;  3FXQ A;  5EYF A;  3R7X A;  3BFU A;  3SEW A;  3H6T A;  3CFL A;  1IXH A;  3A09 A;  2DSF A;  2G29 A;  1LLS A;  3CFX A;  2GFE A;  3OEL A;  4OYV A;  4KFQ A;  4R6K A;  3SES A;  1B5H A;  3PUX E;  2I4C A;  4Z0I A;  3UOR A;  4F1U A;  1II5 A;  2VHA A;  2IEE A;  4H5G A;  4F3S A;  3E13 X;  3IR1 A;  1Y20 A;  3FXU A;  4HS7 A;  5JTY A;  2XHD A;  1N84 A;  1P1U A;  4RJZ A;  3DLN A;  1VE4 A;  3FVK A;  5JK4 A;  4KCC A;  3TQW A;  4GVO A;  1NH7 A;  3S2V A;  4ZE9 A;  3SDF A;  1LAX A;  1OMP A;  1Y4T A;  1A54 A;  1EZO A;  4ONY A;  2XXV A;  1FTJ A;  2ZYK A;  5L8D A;  5H8N A;  1XVY A;  2XXI A;  3K2D A;  3MVX A;  4F1V A;  4KCD A;  2AYS A;  4JSD A;  4H0W A;  1URD A;  2Q9T A;  3VVE A;  3FIR A;  4LZ5 A;  2D5W A;  1SW4 A;  2QS4 A;  3OOA A;  4LAT A;  3N26 A;  4NTL A;  3TDJ A;  1IEJ A;  1DTZ A;  4RXL A;  1QUK A;  3KZG A;  5H8H A;  3ZS6 A;  4JDF A;  2ABH A;  4GLI A;  4YMA A;  3PUW E;  1JW1 A;  1PC3 A;  1XOC A;  4NF5 B;  1Z7M E;  2O69 A;  5AA2 B;  3QSL A;  3THI A;  4PFU A;  1TT1 A;  1JET A;  1AL3 A;  4G68 A;  3V8X B;  2UVH A;  3MP1 A;  2HAU A;  3VLU A;  5KCJ B;  5ELV A;  2VGQ A;  1B46 A;  5CMK A;  3TMG A;  1MDQ A;  2YLN A;  4DLD A;  1B7H A;  4C1T A;  1N7W A;  5LOM A;  3OO8 A;  1N3X A;  3C36 A;  3VLV A;  4QSE A;  5F1Q A;  1D4N A;  1B05 A;  4F3P A;  1QKA A;  4OET A;  1QJM A;  4F19 A;  2PT2 A;  4R72 A;  2W7Y A;  1LBB A;  5I59 A;  4XKN A;  3U72 A;  5DT6 A;  1MY3 A;  4YIC A;  2V84 A;  3VDF A;  4U21 A;  1S7Y A;  4F18 A;  2QPQ A;  1MY4 A;  5EHS A;  3M3L A;  5H8F A;  5H8Q A;  2P1S A;  3MVW A;  3RLF E;  2QSX A;  2UVI A;  3KEI A;  3N94 A;  5JEI A;  4P0I A;  1FCK A;  4OWD A;  3T9X B;  1MY1 A;  4KHZ E;  5HM4 B;  3FJM A;  2ZYO A;  3DEL B;  1Z7N E;  1A55 A;  3SEU A;  4DXU A;  1IZ1 A;  1BKA A;  4F1Y A;  4JSO A;  1SI0 A;  2OCU A;  1Q1K A;  4MLQ A;  1GGG A;  1R9L A;  1UTH A;  2ZNT A;  3K4U A;  1NNK A;  1KWH A;  4IO6 A;  4YAH X;  3D4C A;  4H1X A;  3IB2 A;  5DEX B;  4GL8 A;  4TQU Q;  3U8Q A;  4G8N A;  3V89 B;  1B4H A;  1ZJL A;  1M5D A;  1CB6 A;  2F7A A;  3PU5 A;  1JVX A;  1B5I A;  4R75 A;  2UVG A;  3B7D A;  2OLB A;  2NXO A;  4LON B;  4OQO A;  3VE1 B;  2UXA A;  3ONM A;  1BLF A;  3MW0 A;  3UGW A;  4XIG Q;  3VV5 A;  5AA3 A;  1LFH A;  1B3G A;  5FTH A;  2Z22 A;  4R9G A;  3MBP A;  1LGB C;  5BUU A;  3QUF A;  3KG2 A;  5F7V A;  4YB7 A;  3EQ1 A;  5TU0 A;  4NF5 A;  1MY0 A;  4U23 A;  5AA2 A;  2FYI A;  2OWT A;  4YKJ A;  4IO3 A;  3K6U A;  3W9W A;  4OER A;  4H6D A;  2XXU A;  2ONS A;  4XKQ A;  2ONK E;  3PPQ A;  1SDX A;  1B2H A;  5A5X B;  4MF3 A;  4LP2 B;  1M5E A;  5KCJ A;  4ECF A;  3ILU B;  4BDO A;  4XXU A;  3E4R A;  4O3B A;  1Y3Q A;  3T93 B;  1R9Q A;  3TKD A;  1NNP A;  1B0H A;  2F78 A;  3LSX A;  1LB9 A;  3DP6 A;  3TCH A;  3KN3 A;  1SBP A;  3K1N A;  3S9L C;  4MFI A;  1LFI A;  3CI8 A;  4H5F A;  3H03 A;  1P1W A;  1PB9 A;  4FEB A;  5CBR A;  1UIV A;  2LAO A;  4OEV A;  3Q26 A;  1YCJ A;  1XHY A;  2YJP A;  2A5S A;  4IGR A;  1GR2 A;  3H3G A;  3FVG A;  1SW5 A;  4RK9 A;  2F7B A;  4KI0 E;  1NMU A;  2O51 A;  3IOV A;  2Y7P A;  1BIY A;  4JB7 A;  3CIJ A;  4GQO A;  4OTE A;  3Q27 A;  1URS A;  1QUJ A;  5DVJ A;  3MPK A;  2V25 A;  3FAS A;  2XD2 A;  2XXR A;  1AMF A;  1PBP A;  5DTB A;  3UK4 A;  3PGF A;  1FQC A;  1MPD A;  4ZE8 A;  1SQY A;  4I8C A;  2I49 A;  4OES A;  3KSJ A;  5DEX A;  4FAT A;  4FIM A;  1H76 A;  2F36 A;  4Q30 B;  1ZU0 A;  4IB2 A;  2RC7 A;  1P1O A;  2X7P A;  2O1M A;  1QW0 A;  3IOR A;  2Z23 A;  5TPA A;  2HAV A;  4GWO A;  2H5Y A;  3TCF A;  3V5A A;  3L6G A;  4NF6 B;  3K6V A;  3M8U A;  3EHS A;  5HBC A;  5H8S A;  4P0G A;  4X48 A;  4NWD A;  1MXZ A;  4OEU A;  2DWH A;  3KSX A;  1MDP 1;  4HTG A;  4NED A;  4M1V A;  1NNF A;  5J1D A;  3FVO A;  1B0L A;  4G8M A;  1LAG E;  2UYE A;  2UVJ A;  5ISU A;  3O66 A;  4E0X A;  1UTB A;  4N6P A;  4WKM A;  2Q89 A;  4JWO A;  3KOS A;  3ZKK A;  2XXT A;  4ISU A;  1H3D A;  2X26 A;  3SET A;  3WAF A;  2CMO A;  4AB6 A;  1IIW A;  5I2N A;  3VVF A;  4QFP A;  3T9U A;  1S50 A;  1TFA A;  3V83 A;  1WVJ A;  1MQI A;  5AA4 B;  3N6T A;  3O6H A;  3FXR A;  4H8J A;  2XXQ A;  4YMB A;  4X1B A;  5A5X A;  2QS1 A;  2DWI A;  1WOD A;  1MXV A;  2RC9 A;  1D3K A;  3KN8 A;  4ELR A;  1JNF A;  1DOT A;  3TZA A;  2VD2 A;  1US4 A;  4EUO A;  3H06 B;  2REJ A;  4RPO A;  5BWJ A;  1HSE A;  2XX9 A;  1B3H A;  1MH4 A;  3O2A A;  3G3H A;  4G2Z A;  1MXY A;  3ZSF A;  4R6H A;  3M3F A;  4GXS B;  3EHU A;  2Y84 A;  4OVJ A;  3K6W A;  4KYE A;  3VXC A;  1YPN A;  4DZ1 A;  3EF7 A;  2A5T B;  4QFL A;  4BDM A;  1PEB A;  4NE4 A;  4NF4 B;  5CMB A;  5I57 B;  2DQV A;  3CR9 A;  3CRB A;  4R2F A;  3HST A;  3DM0 A;  3UIF A;  5FHM A;  2DVC A;  5IAI A;  5L9S A;  4GRK A;  2DP8 A;  4PQJ A;  3Q25 A;  3B6T A;  4IO4 A;  2AL5 A;  3O29 A;  1B5J A;  2DOJ A;  1P99 A;  3OO7 A;  4RK2 A;  2G93 A;  4JXI A;  5CBS A;  1B3E A;  3A3U A;  3UN6 A;  3KBR A;  4ZEB A;  3GBB A;  3C31 A;  5FTI A;  3N6U A;  2OZZ A;  4U1Z A;  4LQ2 A;  3G3F A;  2O7U A;  3KGC A;  3KJT A;  1N76 A;  3EHT A;  3N5L A;  3TUS A;  1HSJ A;  1JEV A;  2QS3 A;  1MRP A;  4DE8 A;  4ZED A;  3MUQ A;  4Z7E A;  3OEK A;  3S9E A;  2PMS A;  2REG A;  4EXK A;  1B51 A;  4OMB A;  4EXL A;  2H4I A;  3PUZ E;  4XKR A;  4ZS9 A;  1POT A;  2HZL A;  3HV1 A;  1BP5 A;  4QSC A;  1ANF A;  4R73 A;  1FTO A;  4BDL A;  4F31 B;  4NF6 A;  4KD5 A;  2DE3 A;  2Y7W A;  1JW5 A;  1P1N A;  5KZT A;  1T0K A;  3PPO A;  4LA9 A;  2H99 A;  4NF8 B;  3I6V A;  1IQ7 A;  3G3I A;  1N7X A;  4P11 A;  3RT6 B;  3S4U A;  2CZL A;  3SEY A;  4PFY A;  2DE2 A;  1Y3P A;  2HCA A;  4OEN A;  5I2K B;  3C33 A;  1EZ9 A;  2WKY A;  4NMY A;  3SEX A;  4RYA A;  4GF8 A;  5KDT B;  4RPN A;  4X1D A;  4DIG A;  3LBS A;  2RCB A;  4BDQ A;  4YU0 A;  3FVN A;  2R71 A;  3OSR A;  4U4S A;  2VD3 A;  3A3C A;  5I58 B;  1VFE A;  1PDA A;  3U94 A;  2ZYM A;  3KJ7 A;  1MQG A;  1GV8 A;  1ZMG A;  1VR5 A;  3CFZ A;  5AA4 A;  1B1X A;  2QRY A;  2P0S A;  2QJE A;  3FGS A;  1O7T A;  4LUB A;  1FQB A;  1A99 A;  3O6G A;  1LCF A;  2XXX A;  5AA1 A;  1LST A;  4EQ7 A;  4U1O A;  2FA7 A;  4YZZ A;  1MQD A;  1I69 A;  3QIM A;  4EQB A;  2F6G A;  4FE8 A;  4OFL A;  3OD7 A;  3CG3 A;  4G77 A;  2BJJ X;  2RF1 A;  1B32 A;  3LSF B;  3ODB A;  3MAM A;  1SYH A;  2A5T A;  1R6Z A;  3WAE A;  2OK2 A;  3OO9 A;  2DE4 A;  4TOZ A;  4NF4 A;  1OIB A;  1IXI A;  4NWC A;  3LC8 A;  4ZZA A;  2ESN A;  4C1U A;  1JEU A;  1ZBM A;  3BFT A;  5TP9 B;  3G3J A;  3TFL A;  3SER A;  2F8D A;  4ZDM A;  2ZNU A;  2E0S A;  3U92 A;  2ALU A;  1XT8 A;  3JZJ A;  1B7Z A;  3HCQ A;  1MH3 A;  3FV1 A;  3MPL A;  1GVC A;  1ELJ A;  3Q28 A;  2Q88 A;  2V3Q A;  3LSL A;  4ZEK A;  4PFW A;  3TYH A;  3MJN A;  1VFD A;  2XXY A;  1D9Y A;  1LCT A;  4IY5 A;  5JTY B;  1N3W A;  3MVZ A;  4GD5 A;  4O3C A;  1JW4 A;  4E0W A;  4X9T A;  4HW8 A;  2I6E A;  2DXR A;  1SYI A;  2PT1 A;  3PMW A;  1MG1 A;  4OZ9 A;  2R6G E;  1XS5 A;  1US5 A;  5H8N B;  4ESX A;  4YB5 A;  3MVY A;  1TXF A;  2XD3 A;  1DSN A;  4R74 A;  3FJG A;  1H44 A;  2GRV A;  1CE2 A;  3TTL A;  2I4B A;  1NL5 A; 
#chains in the Genus database with same CATH topology
 3TTK A;  1FQD A;  3OEM A;  3IO4 A;  3B6Q A;  3HO7 A;  4OXV A;  3PD8 A;  1FJ9 A;  4OFJ A;  2VOZ A;  1B58 A;  3MWB A;  5FHO A;  1NKX A;  3C32 A;  3IAZ A;  5B7D A;  3O28 A;  1JQF A;  1QUL A;  3O97 A;  3MZ1 A;  5I56 B;  4JBZ A;  4GXA A;  1LBC A;  1SVX B;  2Z8F A;  1EYI A;  4TLM B;  3IL1 B;  3IJO B;  1FBD A;  4NF0 A;  4NF8 A;  4GOT A;  4NGU A;  4F39 A;  4BDR A;  2ZXT A;  3TCG A;  4PF8 A;  4NQ8 A;  4N07 A;  2HZK A;  1MS7 A;  5I7I A;  1DTG A;  1EH3 A;  1SW2 A;  1FQF A;  1TWY A;  4Q5T A;  3ILT B;  4L17 A;  3LR1 A;  5KDT A;  4X8R A;  2O84 X;  1IUD A;  4G68 B;  4F2Q A;  3IOU A;  1UIU A;  2FIX A;  2KLF A;  4PFT A;  4U2R A;  3QUJ A;  4ELQ A;  5I58 A;  2XWK A;  2FIE A;  3FJ7 A;  4KYS A;  3IO6 A;  4I1D A;  4H67 A;  1YTV A;  4QHQ A;  1MM7 A;  1I6B A;  2KR0 A;  4QF9 A;  3S9N C;  2Z8D A;  2THI A;  3PV0 E;  4XF5 A;  1FBC A;  3RT8 A;  5ET7 A;  3OMB A;  1KZ8 A;  2O6A A;  2PVU A;  3ZKL A;  1M5F A;  4DCY A;  1FPG A;  2O68 A;  3JYR A;  4XKP A;  4N13 A;  1NH8 A;  5CMM A;  1LBY A;  2QL3 A;  2H25 A;  4GX6 A;  2I3W A;  2E1S A;  2QMW A;  1LB8 A;  1H43 A;  2ZMB A;  5I59 B;  1B9J A;  4EF1 A;  3T1B A;  1B40 A;  3T96 B;  2H9B A;  1VSO A;  2UYF A;  1M5B A;  4N91 A;  4FOR A;  4YKI A;  1URG A;  4IO5 A;  3KOT A;  3PPR A;  4O3A A;  1ZLQ A;  4GL0 A;  5CMC A;  3RN8 A;  3K02 A;  3OO6 A;  5CRY A;  4O7M A;  1FPL A;  3HHF A;  2HHM A;  3OEN A;  4LZ8 A;  1B4Z A;  5IGA A;  3MP6 A;  4XTC Q;  5ITO A;  4P47 A;  4DDD A;  3G3G A;  2FNC A;  4OFO A;  4NX1 A;  1B3L A;  4N8Y A;  4UA8 A;  2D21 A;  1USY E;  3KC1 A;  1AOV A;  3RNN A;  5TP9 A;  1IMF A;  3IX1 A;  3CG1 A;  1XC1 A;  4DCX A;  1B6H A;  1FBP A;  1A8E A;  1OLC A;  4PGP A;  3FZV A;  5IKB A;  1UTH B;  2XXH A;  2B3B A;  4WXJ A;  3F11 A;  2IA4 A;  4M4G A;  4LZ7 A;  4LQ5 A;  1TFD A;  1FBH A;  3L6H A;  4ZEF A;  2Q74 A;  1AH5 A;  5B70 A;  2DS9 A;  3S9M C;  4BDN A;  1J1N A;  2HPG A;  3IOW A;  2OJT A;  3PMV A;  1D9V A;  3OSQ A;  3H7M A;  4ZEC A;  1Y9U A;  1LAH E;  4THI A;  2CZI A;  1FPE A;  2XXP A;  1JVY A;  3CSG A;  3HPI A;  1ZKB A;  2WBB A;  3GZG A;  4MJO A;  3Q29 A;  4OVR A;  5DVI A;  1EYK A;  1IMC A;  4POX A;  1FJ6 A;  3OXN A;  4NG7 A;  1B52 A;  4I3Y A;  4LN5 A;  4ZZE A;  5IZZ A;  4GIZ A;  5I56 A;  4OHN A;  4R2B A;  3O9P A;  5EQ7 A;  4GWZ A;  4U22 A;  2ZNS A;  3TOD A;  2Y5L A;  5K2X A;  2B4M A;  1FTM A;  1MQJ A;  1YAE A;  2DDK A;  3VXB A;  3QYT A;  4QFO A;  4EDP A;  2PFZ A;  4C0R A;  5CI5 A;  3QXM A;  3TEL A;  4F3B A;  2RIN A;  3RTW B;  1PBQ A;  3T9V A;  4OVP A;  1DPE A;  4QFK A;  1FQE A;  2DWA A;  1NV4 A;  3C34 A;  2ZYN A;  4GX4 A;  2D3I A;  2Q8J A;  4P8B A;  4IR8 A;  4IO7 A;  2QVR A;  3B6W A;  3IB0 A;  4PTK A;  1FRP A;  4LVQ A;  2O7I A;  1O64 A;  3EPE A;  2DYX A;  1OQH A;  3R26 A;  1P1Q A;  4H8I A;  2F35 A;  1FW0 A;  3RY3 A;  2CEY A;  4N6D A;  1HSL A;  2OWS A;  1S9T A;  3C35 A;  3C4M A;  2ANJ A;  3MP8 A;  2B4L A;  5EQ9 A;  3U93 A;  3BBR A;  3HHG A;  4TLL B;  2OWZ A;  3T9H B;  3E9X A;  4QRZ A;  4PCD A;  4PET A;  1OVT A;  3U1O A;  4BLA A;  1POY 1;  1MXX A;  4I40 A;  4HE1 A;  4EF2 A;  4R9F A;  5ITP A;  3TTM A;  4WEP A;  4Q0C A;  3M3K A;  5DVF A;  1MQH A;  3K00 A;  4FED A;  1DCU A;  3DP8 A;  1B1H A;  5M2V A;  3SEV A;  4PE5 B;  1QVS A;  3K0V A;  2F5X A;  3FUZ A;  1IMA A;  3TQL A;  3KN7 A;  3H6V A;  4YKK A;  4F22 A;  1YYZ A;  2PFY A;  3D4G A;  3GLB A;  1CNQ A;  2P2A A;  2VPN A;  1A8F A;  1KA0 A;  4NHB A;  2NWJ A;  2F34 A;  2V93 A;  1UQW A;  3P7I A;  4F3G A;  3TEP A;  1A7L A;  1USY H;  4ELP A;  1XVX A;  4KQP A;  3RTF B;  2Y7R A;  4I9D A;  4DI4 B;  1RYX A;  5EYG A;  1MY2 A;  3ECR A;  1NV7 A;  3RQT A;  4QFN A;  2B3F A;  3HFU A;  1MXU A;  4G68 C;  4PP0 A;  4OAN A;  5FHN A;  4UAC A;  3FAT A;  2DWJ A;  1BK4 A;  4JVD A;  4H46 A;  1AWB A;  3H6U A;  2XX7 A;  4H65 A;  3TTN A;  2I48 A;  1G0H A;  1WDN A;  2AL4 A;  3IB1 A;  2XX8 A;  4U4X A;  3I5O A;  2F6P A;  3K1M A;  4KYD A;  1IIT A;  1N0T A;  3VFJ A;  1DMB A;  2I0B A;  3RGY A;  1H45 A;  1FTK A;  4PFR A;  3I3V A;  4MH5 A;  2VP1 A;  5TPA B;  1Q35 A;  2Y7K A;  3H4Z A;  2DXY A;  4F29 A;  1DPP A;  1QUI A;  1I6Q A;  1Y3N A;  2HQ0 A;  2V3T A;  4ND9 A;  3MZ9 A;  3H6W A;  5I57 A;  4OVQ A;  1OLA A;  4RA1 A;  3TTR A;  1NFT A;  2QMX A;  4FJP A;  4EQ9 A;  1UTB B;  1FTL A;  2PYY A;  2NVU B;  4PFI A;  3PD9 A;  1MPB A;  3FV2 A;  2ONR A;  1F9B A;  3E3K A;  5DW8 A;  3CSB A;  3DP4 A;  2F97 A;  1LAF E;  4KPT A;  3BIG A;  3K01 A;  5I2N B;  1SD3 A;  2AIX A;  4GFR A;  4HCY A;  5IZ3 A;  3E79 A;  4YB6 A;  5K2Y A;  1SI1 A;  5IM2 A;  3W15 C;  3G7W A;  3AXF A;  4HCW A;  2O1L A;  1B3F A;  2HEU A;  3C9H A;  2NUV A;  4IGT A;  3FD3 A;  2XXW A;  3KFM A;  4POW A;  2I3V A;  1G0I A;  2V3U A;  2Z8E A;  4DXB A;  2RCA A;  3MQ9 A;  2WEF A;  3W9V A;  3R6U A;  3IK6 B;  3PUV E;  1ATG A;  3IJX B;  5FBP A;  5EHM A;  3USD A;  4MNC A;  1AIV A;  3JV9 A;  1LEV A;  2F7C A;  3QK6 A;  5AA2 D;  4PAF A;  3CVG A;  3T22 A;  3O6I A;  3IOT A;  3LUY A;  2HFB A;  3T66 A;  1GTK A;  3LV0 A;  5AE4 A;  1EZP A;  1ZTY A;  1NV0 A;  4G4P A;  3PPP A;  4YKP A;  1Y1M A;  2NOO A;  3QAX A;  1Y4C A;  3GXA A;  1RKM A;  1EYJ A;  4FAJ A;  3MZB A;  2PBW A;  5CC2 A;  3TAJ A;  4K3F A;  5H8H B;  2GHA A;  4KR5 A;  3RUM A;  1NV6 A;  4MLV A;  4PBQ A;  2Y5K A;  3LSW A;  1NV5 A;  3RYD A;  3G3K A;  4WED A;  4IY6 A;  1FPD A;  3TPA A;  5I2K A;  3UP9 A;  4JWY A;  5ICT A;  3K1P A;  4F2O A;  1IXC A;  1LFG A;  1A40 A;  4OA4 A;  2PX1 A;  4I62 A;  1MPC A;  3RPW A;  3GBA A;  2Q2A A;  4IO2 A;  1N04 A;  3BIH A;  1OVB A;  2QVU A;  1O63 A;  2DVZ A;  2QS2 A;  4G8H A;  1R1N A;  1M5C A;  5I84 A;  4FEC A;  4R6Y A;  1OQG A;  4N6K A;  2GH9 A;  2R9J A;  1NNT A;  5CM6 A;  5I5P A;  3BKI B;  2JJK A;  2M8C A;  1L5T A;  1B7U A;  3EKI A;  3UA8 A;  2RKM A;  2I0C A;  1Y1Z A;  2B65 A;  1FQA A;  1RYO A;  4DXC A;  3SKP A;  3CHG A;  4JWX A;  2GHB A;  3VVD A;  1PB8 A;  1EU8 A;  2OBG A;  5EQA A;  1I6A A;  1FPB A;  5L9M A;  2Y7I A;  4AQ4 A;  4MX6 A;  3HN0 A;  4RY1 A;  3PUY E;  3K6X A;  2YPN A;  1FPJ A;  2CZK A;  3MC2 A;  5EYH A;  5IZ1 A;  2RC8 A;  2I58 A;  1SW1 A;  4MBP A;  5F24 A;  5HPQ A;  1MXW A;  1PB7 A;  1IXG A;  2HXW A;  1MM6 A;  2X7Q A;  5A5L A;  5L9O A;  3PPN A;  2Q2C A;  5H8F B;  5ET5 A;  5H8Q B;  4RNS A;  1QKB A;  4Q8R A;  1ZIU A;  3VLW A;  2H98 A;  4AB5 A;  1VDW A;  4ZEI A;  5ICQ A;  5DYH A;  4QSD A;  4AS5 A;  1BTJ A;  2PCR A;  3PMX A;  4ELO A;  3EN3 A;  4ESW A;  3FXQ A;  5EYF A;  3R7X A;  3BFU A;  3SEW A;  3H6T A;  3CFL A;  1IXH A;  3A09 A;  2DSF A;  2G29 A;  1LLS A;  3CFX A;  2GFE A;  3OEL A;  4OYV A;  4KFQ A;  4R6K A;  3SES A;  1B5H A;  3PUX E;  2I4C A;  4Z0I A;  3UOR A;  4F1U A;  1II5 A;  2VHA A;  2IEE A;  4H5G A;  4F3S A;  1IMB A;  1FPF A;  1SPI A;  3E13 X;  3IR1 A;  1Y20 A;  3FXU A;  4HS7 A;  5JTY A;  2XHD A;  2VT5 A;  1N84 A;  1P1U A;  1IMD A;  4RJZ A;  3DLN A;  1VE4 A;  3FVK A;  4NN3 A;  5JK4 A;  4KCC A;  3TQW A;  2VPO A;  4GVO A;  1NH7 A;  3S2V A;  4ZE9 A;  3SDF A;  1LAX A;  1OMP A;  1DK4 A;  1Y4T A;  1A54 A;  1EZO A;  4ONY A;  2XXV A;  1FTJ A;  2ZYK A;  5L8D A;  5H8N A;  1XVY A;  2XXI A;  3K2D A;  3MVX A;  4F1V A;  4PBH A;  4KCD A;  4DI3 D;  2AYS A;  4JSD A;  2KQZ A;  4H0W A;  1URD A;  2Q9T A;  3VVE A;  4LZ5 A;  3FIR A;  2D5W A;  1SW4 A;  2QS4 A;  3OOA A;  4LAT A;  3N26 A;  4QXD A;  4NTL A;  3TDJ A;  1IEJ A;  1FTA A;  1DTZ A;  4RXL A;  1QUK A;  3KZG A;  5H8H A;  3ZS6 A;  3SZP A;  4JDF A;  1JP4 A;  1K9Y A;  2ABH A;  3B8B A;  4GLI A;  2QFL A;  4YMA A;  3PUW E;  1JW1 A;  1PC3 A;  1XOC A;  4NF5 B;  1Z7M E;  2O69 A;  5AA2 B;  3QSL A;  4MIJ A;  2WYP A;  3THI A;  4PFU A;  1TT1 A;  1JET A;  4P1L A;  1AL3 A;  4G68 A;  3V8X B;  2UVH A;  3MP1 A;  2HAU A;  3VLU A;  5KCJ B;  2V4C A;  5ELV A;  2VGQ A;  4N4U A;  2XWV A;  1FSA A;  1B46 A;  5CMK A;  3TMG A;  1MDQ A;  2XWO A;  2YLN A;  4DLD A;  1B7H A;  4C1T A;  1N7W A;  5LOM A;  3OO8 A;  1N3X A;  3C36 A;  3VLV A;  4QSE A;  1XI6 A;  5F1Q A;  1D4N A;  1B05 A;  1Q9D A;  2F3D A;  4F3P A;  1QKA A;  4OET A;  1QJM A;  4F19 A;  4PE3 A;  2PT2 A;  4R72 A;  1LBX A;  2W7Y A;  1LBB A;  5I59 A;  4XKN A;  3U72 A;  5DT6 A;  1MY3 A;  4YIC A;  2V84 A;  4P3L A;  4U21 A;  1S7Y A;  3VDF A;  4F18 A;  2QPQ A;  1MY4 A;  4GWS A;  3M3L A;  5EHS A;  4OVS A;  5H8F A;  5H8Q A;  2P1S A;  3MVW A;  1YZ0 A;  3RLF E;  2QSX A;  2UVI A;  3KEI A;  3N94 A;  5JEI A;  4P0I A;  1FCK A;  4OWD A;  3T9X B;  1MY1 A;  4KHZ E;  5HM4 B;  3FJM A;  2ZYO A;  2WX9 A;  3DEL B;  1Z7N E;  1A55 A;  4N17 A;  3SEU A;  4DXU A;  1IZ1 A;  1BKA A;  4F1Y A;  4JSO A;  1NUW A;  1SI0 A;  2OCU A;  1Q1K A;  1FBG A;  4MLQ A;  1GGG A;  1R9L A;  1UTH A;  2ZNT A;  3K4U A;  1NNK A;  1KWH A;  4IO6 A;  4YAH X;  3D4C A;  4H1X A;  3IB2 A;  5DEX B;  4GL8 A;  4TQU Q;  1QGX A;  1LBW A;  3U8Q A;  4G8N A;  3E78 A;  3V89 B;  1B4H A;  1ZJL A;  1M5D A;  1CB6 A;  3KC0 A;  2F7A A;  3PU5 A;  1JVX A;  3A29 A;  1B5I A;  4P1E A;  4R75 A;  2UVG A;  3B7D A;  2OLB A;  2OX3 A;  2NXO A;  4LON B;  4OQO A;  4G61 A;  3VE1 B;  2UXA A;  3ONM A;  4GWY A;  1BLF A;  4PF6 A;  3MW0 A;  3UGW A;  4XIG Q;  3VV5 A;  5AA3 A;  1LFH A;  1B3G A;  5FTH A;  5LDZ A;  2Z22 A;  4HXV A;  4R9G A;  3MBP A;  1LGB C;  5BUU A;  3QUF A;  1NV3 A;  3KG2 A;  5F7V A;  4YB7 A;  3EQ1 A;  5TU0 A;  4NF5 A;  4FBP A;  1MY0 A;  4U23 A;  1YXI A;  5AA2 A;  2FYI A;  2OWT A;  4YKJ A;  4IO3 A;  3K6U A;  3W9W A;  5T3J A;  4OER A;  4H6D A;  2XXU A;  2ONS A;  4XKQ A;  2ONK E;  3PPQ A;  1SDX A;  1B2H A;  5A5X B;  4I3E A;  2CZH A;  4GWU A;  4MF3 A;  4LP2 B;  1M5E A;  5KCJ A;  4ECF A;  3ILU B;  4BDO A;  5ESY A;  4XXU A;  3E4R A;  5LTC A;  4O3B A;  1Y3Q A;  3T93 B;  1R9Q A;  3TKD A;  1NNP A;  1B0H A;  2F78 A;  3LSX A;  1LB9 A;  3DP6 A;  3TCH A;  3KN3 A;  1SBP A;  2P3V A;  3K1N A;  1NUZ A;  3S9L C;  4MFI A;  3T0J A;  1LFI A;  3NOH A;  3CI8 A;  4H5F A;  3H03 A;  1P1W A;  1PB9 A;  4FEB A;  5CBR A;  1UIV A;  2LAO A;  4O7I A;  4OEV A;  3Q26 A;  1FPK A;  1YCJ A;  1XHY A;  4N81 A;  2YJP A;  2A5S A;  4IGR A;  4HE0 A;  1GR2 A;  1KA1 A;  3H3G A;  3FVG A;  5EQ8 A;  1SW5 A;  4RK9 A;  2F7B A;  4KI0 E;  1NMU A;  1NUY A;  2O51 A;  3IOV A;  2Y7P A;  1BIY A;  4JB7 A;  2MKZ A;  3CIJ A;  5ET8 A;  4GQO A;  4OTE A;  3Q27 A;  1URS A;  1QUJ A;  5DVJ A;  3MPK A;  2V25 A;  3FAS A;  2XD2 A;  2XXR A;  1AMF A;  1PBP A;  1NUX A;  5DTB A;  3UK4 A;  3PGF A;  1FQC A;  1MPD A;  4ZE8 A;  1SQY A;  4I8C A;  4KXP A;  2I49 A;  4OES A;  3KSJ A;  5DEX A;  4FAT A;  4FIM A;  1H76 A;  2F36 A;  4Q30 B;  2ZZW A;  1ZU0 A;  4IB2 A;  2RC7 A;  2F3B A;  1P1O A;  2X7P A;  2O1M A;  2CEX A;  1QW0 A;  3IOR A;  2Z23 A;  1FBE A;  2HAV A;  5TPA A;  4GWO A;  1RDY A;  2H5Y A;  3TCF A;  2FVZ A;  3V5A A;  3L6G A;  4NF6 B;  4GBV A;  3K6V A;  3M8U A;  4MMP A;  3EHS A;  5HBC A;  5H8S A;  4P0G A;  3MYU A;  4X48 A;  4NWD A;  1MXZ A;  3KBZ A;  4OEU A;  1DBZ A;  2DWH A;  4NED A;  3KSX A;  1MDP 1;  4HTG A;  2XWI A;  4M1V A;  1NNF A;  5J1D A;  4UAB A;  3FVO A;  1B0L A;  2FBP A;  4G8M A;  1LAG E;  2UYE A;  2UVJ A;  5ISU A;  3O66 A;  2Q8M A;  4E0X A;  1UTB A;  4N6P A;  4WKM A;  2WYK A;  2Q89 A;  4JWO A;  3KOS A;  3ZKK A;  2XXT A;  4ISU A;  1H3D A;  2X26 A;  3SET A;  3WAF A;  1RDZ A;  2CMO A;  4AB6 A;  4AS4 A;  4MNP A;  1IIW A;  4PGN A;  5I2N A;  3VVF A;  4QFP A;  3T9U A;  1S50 A;  1TFA A;  1NV1 A;  3V83 A;  1WVJ A;  1MQI A;  5AA4 B;  1IME A;  3N6T A;  3O6H A;  4N8G A;  4PC9 A;  1NI9 A;  3FXR A;  4H8J A;  2XXQ A;  4YMB A;  4H45 A;  4X1B A;  5A5X A;  3IFC A;  2QS1 A;  2DWI A;  1WOD A;  2QVV A;  1MXV A;  2RC9 A;  1D3K A;  3KN8 A;  4ELR A;  1JNF A;  2GQ1 A;  1DOT A;  3TZA A;  2VD2 A;  1US4 A;  2L5V A;  4EUO A;  3H06 B;  2REJ A;  4RPO A;  5BWJ A;  1HSE A;  2XX9 A;  1B3H A;  1MH4 A;  3O2A A;  3G3H A;  4G2Z A;  1MXY A;  3ZSF A;  4R6H A;  3M3F A;  4GXS B;  3EHU A;  3MST A;  1LBV A;  2Y84 A;  4OVJ A;  3K6W A;  4KYE A;  3VXC A;  1YPN A;  4DZ1 A;  3FXB A;  3U65 A;  3EF7 A;  2A5T B;  4QFL A;  4BDM A;  1PEB A;  4NE4 A;  4NF4 B;  5CMB A;  5I57 B;  2DQV A;  2ZZX A;  3CR9 A;  3CRB A;  4R2F A;  3HST A;  1FBF A;  1INP A;  3DM0 A;  3UIF A;  5FHM A;  2DVC A;  5IAI A;  5L9S A;  2HXR A;  4GRK A;  2DP8 A;  4PQJ A;  3Q25 A;  3B6T A;  4IO4 A;  2AL5 A;  3O29 A;  1B5J A;  2DOJ A;  1D9Q A;  1P99 A;  3OO7 A;  4GX3 A;  2G93 A;  4JXI A;  1LBZ A;  4RK2 A;  5CBS A;  1B3E A;  3A3U A;  3UN6 A;  2XXK A;  3KBR A;  5IZ3 B;  4ZEB A;  3GBB A;  4O94 A;  3C31 A;  5FTI A;  3N6U A;  2OZZ A;  4PAI A;  4U1Z A;  4LQ2 A;  3G3F A;  2O7U A;  3KGC A;  3KJT A;  3RPL B;  1N76 A;  4PAK A;  3EHT A;  3N5L A;  4PFB A;  3TUS A;  1HSJ A;  1JEV A;  2QS3 A;  1MRP A;  4DE8 A;  4ZED A;  3MUQ A;  4Z7E A;  3OEK A;  3S9E A;  2PMS A;  1K9Z A;  2REG A;  4EXK A;  1B51 A;  4OMB A;  4EXL A;  2H4I A;  4OVT A;  3PUZ E;  4XKR A;  4ZS9 A;  1POT A;  2HZL A;  3HV1 A;  4JVI A;  1BP5 A;  4QSC A;  1ANF A;  4R73 A;  1FTO A;  4BDL A;  4F31 B;  4NF6 A;  4KD5 A;  3IFA A;  4QBA A;  2DE3 A;  2Y7W A;  1JW5 A;  4XFE A;  1P1N A;  5KZT A;  1T0K A;  3PPO A;  2WBD A;  4LA9 A;  2H99 A;  4NF8 B;  3I6V A;  1IQ7 A;  3G3I A;  1N7X A;  4P11 A;  3RT6 B;  3S4U A;  2CZL A;  3SEY A;  4PFY A;  2DE2 A;  1Y3P A;  2HCA A;  4OEN A;  5I2K B;  3C33 A;  1EZ9 A;  1RDX A;  2WKY A;  4NMY A;  3SEX A;  4RYA A;  3D1R A;  4GF8 A;  5KDT B;  4RPN A;  4X1D A;  3LUZ A;  3LBS A;  4DIG A;  2RCB A;  4BDQ A;  4YU0 A;  3FVN A;  2R71 A;  3OSR A;  4U4S A;  2VD3 A;  3A3C A;  5I58 B;  1VFE A;  1PDA A;  3U94 A;  2ZYM A;  3KJ7 A;  1MQG A;  1GV8 A;  2XA5 A;  1ZMG A;  2BJI A;  1VR5 A;  3CFZ A;  4PDD A;  1B1X A;  2QRY A;  5AA4 A;  3FBP A;  2P0S A;  2QJE A;  3FGS A;  4GBW A;  1O7T A;  4LUB A;  1FQB A;  1A99 A;  3O6G A;  4N15 A;  1LCF A;  2XXX A;  4MAG A;  4PDH A;  5AA1 A;  1LST A;  4EQ7 A;  4U1O A;  2FA7 A;  4X04 A;  4YZZ A;  1MQD A;  1I69 A;  3QIM A;  5ET6 A;  4EQB A;  2F6G A;  3B50 A;  4FE8 A;  2FHY A;  4OFL A;  3OD7 A;  4P56 A;  4MNI A;  3CG3 A;  2R8T A;  4G77 A;  2BJJ X;  4O8M A;  2RF1 A;  1B32 A;  3LSF B;  5J16 A;  3ODB A;  3MAM A;  4HE2 A;  3GYY A;  5I3S A;  1SYH A;  2A5T A;  1R6Z A;  3WAE A;  2OK2 A;  3OO9 A;  3PTY A;  2DE4 A;  4TOZ A;  4NAP A;  4NF4 A;  1OIB A;  1IXI A;  4NWC A;  3ISP A;  3LC8 A;  4XEQ A;  4ZZA A;  2ESN A;  4C1U A;  1JEU A;  1ZBM A;  3BFT A;  4MCO A;  5TP9 B;  3G3J A;  3TFL A;  4GWX A;  3SER A;  2F8D A;  4ZDM A;  4P9K A;  2ZNU A;  4JVC A;  2E0S A;  3U92 A;  2ALU A;  1XT8 A;  3JZJ A;  1B7Z A;  3HCQ A;  1MH3 A;  3FV1 A;  3MPL A;  2P3N A;  4MEV A;  1GVC A;  1ELJ A;  3Q28 A;  2Q88 A;  2V3Q A;  3LSL A;  4ZEK A;  1FPI A;  4PFW A;  2ZZV A;  3TYH A;  3MJN A;  1VFD A;  2XXY A;  1D9Y A;  1LCT A;  4IY5 A;  5JTY B;  1N3W A;  4GWW A;  4MHF A;  3MVZ A;  4GD5 A;  4O3C A;  1JW4 A;  4E0W A;  4X9T A;  4HW8 A;  3RPL A;  2I6E A;  2DXR A;  1SYI A;  2PT1 A;  1NV2 A;  3PMW A;  1MG1 A;  4OZ9 A;  2R6G E;  1XS5 A;  3QMF A;  1US5 A;  5H8N B;  4ESX A;  4YB5 A;  3MVY A;  1TXF A;  2XD3 A;  1DSN A;  4R74 A;  3ROJ A;  3FJG A;  1H44 A;  2GRV A;  1CE2 A;  3TTL A;  2I4B A;  1NL5 A; 
#chains in the Genus database with same CATH homology
 3TTK A;  1FQD A;  3OEM A;  3IO4 A;  3B6Q A;  3HO7 A;  4OXV A;  3PD8 A;  4OFJ A;  2VOZ A;  1B58 A;  3MWB A;  5FHO A;  1NKX A;  3C32 A;  3IAZ A;  5B7D A;  3O28 A;  1JQF A;  1QUL A;  3O97 A;  3MZ1 A;  5I56 B;  4JBZ A;  4GXA A;  1LBC A;  1SVX B;  2Z8F A;  4TLM B;  3IL1 B;  3IJO B;  4NF8 A;  4GOT A;  4F39 A;  4BDR A;  2ZXT A;  3TCG A;  4N07 A;  2HZK A;  1MS7 A;  1EH3 A;  1DTG A;  1SW2 A;  1FQF A;  1TWY A;  4Q5T A;  3ILT B;  4L17 A;  3LR1 A;  5KDT A;  2O84 X;  1IUD A;  4G68 B;  4F2Q A;  3IOU A;  1UIU A;  2KLF A;  4PFT A;  4U2R A;  3QUJ A;  4ELQ A;  5I58 A;  3FJ7 A;  4KYS A;  3IO6 A;  4I1D A;  4H67 A;  1YTV A;  4QHQ A;  1MM7 A;  1I6B A;  4QF9 A;  3S9N C;  2Z8D A;  2THI A;  3PV0 E;  3RT8 A;  3OMB A;  2O6A A;  2PVU A;  3ZKL A;  1M5F A;  4DCY A;  2O68 A;  3JYR A;  4XKP A;  4N13 A;  1NH8 A;  5CMM A;  2QL3 A;  2H25 A;  2I3W A;  2E1S A;  2QMW A;  1LB8 A;  1H43 A;  2ZMB A;  5I59 B;  1B9J A;  4EF1 A;  1B40 A;  3T96 B;  2H9B A;  1VSO A;  2UYF A;  1M5B A;  4FOR A;  4YKI A;  1URG A;  4IO5 A;  3KOT A;  3PPR A;  4O3A A;  1ZLQ A;  4GL0 A;  5CMC A;  3RN8 A;  3K02 A;  3OO6 A;  5CRY A;  3HHF A;  3OEN A;  4LZ8 A;  1B4Z A;  3MP6 A;  4XTC Q;  5ITO A;  4DDD A;  3G3G A;  2FNC A;  4OFO A;  1B3L A;  4UA8 A;  2D21 A;  1USY E;  1AOV A;  3RNN A;  5TP9 A;  3IX1 A;  3CG1 A;  1XC1 A;  4DCX A;  1B6H A;  1A8E A;  1OLC A;  3FZV A;  5IKB A;  1UTH B;  2XXH A;  2B3B A;  4WXJ A;  3F11 A;  2IA4 A;  4M4G A;  4LZ7 A;  4LQ5 A;  1TFD A;  3L6H A;  4ZEF A;  1AH5 A;  5B70 A;  2DS9 A;  3S9M C;  4BDN A;  1J1N A;  3IOW A;  2OJT A;  3PMV A;  1D9V A;  3OSQ A;  3H7M A;  4ZEC A;  1Y9U A;  1LAH E;  4THI A;  2XXP A;  1JVY A;  3CSG A;  3HPI A;  1ZKB A;  3GZG A;  3Q29 A;  5DVI A;  4POX A;  3OXN A;  1B52 A;  4ZZE A;  4GIZ A;  5I56 A;  4OHN A;  4R2B A;  3O9P A;  4U22 A;  2ZNS A;  3TOD A;  5K2X A;  1FTM A;  1MQJ A;  1YAE A;  3VXB A;  3QYT A;  4QFO A;  4EDP A;  4C0R A;  5CI5 A;  3QXM A;  3TEL A;  4F3B A;  2RIN A;  3RTW B;  1PBQ A;  3T9V A;  1DPE A;  4QFK A;  1FQE A;  2DWA A;  3C34 A;  2ZYN A;  2D3I A;  2Q8J A;  4IO7 A;  3B6W A;  3IB0 A;  4LVQ A;  2O7I A;  1O64 A;  3EPE A;  2DYX A;  1OQH A;  3R26 A;  1P1Q A;  4H8I A;  2F35 A;  1FW0 A;  3RY3 A;  1HSL A;  2OWS A;  1S9T A;  3C35 A;  3C4M A;  2ANJ A;  3MP8 A;  3U93 A;  3BBR A;  3HHG A;  4TLL B;  3T9H B;  3E9X A;  4QRZ A;  4PET A;  1OVT A;  3U1O A;  4BLA A;  1POY 1;  1MXX A;  4EF2 A;  4R9F A;  5ITP A;  3TTM A;  4WEP A;  4Q0C A;  3M3K A;  5DVF A;  1MQH A;  3K00 A;  4FED A;  3DP8 A;  1B1H A;  5M2V A;  3SEV A;  4PE5 B;  1QVS A;  3K0V A;  2F5X A;  3FUZ A;  3TQL A;  3KN7 A;  3H6V A;  4YKK A;  4F22 A;  3D4G A;  3GLB A;  2P2A A;  1A8F A;  2NWJ A;  2F34 A;  2V93 A;  1UQW A;  3P7I A;  4F3G A;  3TEP A;  1A7L A;  1USY H;  4ELP A;  1XVX A;  4KQP A;  3RTF B;  2Y7R A;  4I9D A;  1RYX A;  1MY2 A;  3ECR A;  3RQT A;  4QFN A;  2B3F A;  1MXU A;  4G68 C;  4PP0 A;  5FHN A;  4UAC A;  3FAT A;  2DWJ A;  3H6U A;  2XX7 A;  4H65 A;  3TTN A;  2I48 A;  1WDN A;  2AL4 A;  3IB1 A;  2XX8 A;  4U4X A;  3I5O A;  2F6P A;  3K1M A;  4KYD A;  1IIT A;  1N0T A;  3VFJ A;  1DMB A;  2I0B A;  3RGY A;  1H45 A;  1FTK A;  3I3V A;  4MH5 A;  2VP1 A;  5TPA B;  1Q35 A;  2Y7K A;  3H4Z A;  2DXY A;  4F29 A;  1DPP A;  1QUI A;  1I6Q A;  1Y3N A;  2HQ0 A;  2V3T A;  4ND9 A;  3MZ9 A;  3H6W A;  5I57 A;  1OLA A;  4RA1 A;  3TTR A;  1NFT A;  2QMX A;  4FJP A;  4EQ9 A;  1UTB B;  1FTL A;  2PYY A;  2NVU B;  3PD9 A;  1MPB A;  3FV2 A;  2ONR A;  1F9B A;  3E3K A;  3CSB A;  3DP4 A;  2F97 A;  1LAF E;  4KPT A;  3K01 A;  5I2N B;  1SD3 A;  2AIX A;  4GFR A;  4HCY A;  4YB6 A;  5K2Y A;  1SI1 A;  3W15 C;  3G7W A;  3AXF A;  4HCW A;  2O1L A;  1B3F A;  2HEU A;  3C9H A;  2NUV A;  4IGT A;  3FD3 A;  2XXW A;  3KFM A;  4POW A;  2I3V A;  2V3U A;  2Z8E A;  4DXB A;  2RCA A;  3MQ9 A;  3W9V A;  3R6U A;  3IK6 B;  3PUV E;  1ATG A;  3IJX B;  5EHM A;  3USD A;  1AIV A;  3JV9 A;  2F7C A;  3QK6 A;  5AA2 D;  3CVG A;  3T22 A;  3O6I A;  3IOT A;  3LUY A;  2HFB A;  3T66 A;  1GTK A;  5AE4 A;  1EZP A;  1ZTY A;  4G4P A;  3PPP A;  4YKP A;  1Y1M A;  2NOO A;  3QAX A;  1Y4C A;  3GXA A;  1RKM A;  4FAJ A;  3MZB A;  2PBW A;  5CC2 A;  3TAJ A;  4K3F A;  5H8H B;  2GHA A;  4KR5 A;  3RUM A;  4MLV A;  3LSW A;  3G3K A;  4WED A;  4IY6 A;  3TPA A;  5I2K A;  3UP9 A;  4JWY A;  5ICT A;  3K1P A;  4F2O A;  1IXC A;  1LFG A;  1A40 A;  2PX1 A;  4I62 A;  1MPC A;  3RPW A;  3GBA A;  2Q2A A;  4IO2 A;  1N04 A;  1OVB A;  1O63 A;  2DVZ A;  2QS2 A;  4G8H A;  1R1N A;  1M5C A;  5I84 A;  4FEC A;  4R6Y A;  1OQG A;  2GH9 A;  2R9J A;  1NNT A;  5CM6 A;  3BKI B;  2M8C A;  1L5T A;  1B7U A;  3UA8 A;  2RKM A;  2I0C A;  1Y1Z A;  2B65 A;  1FQA A;  1RYO A;  4DXC A;  3SKP A;  4JWX A;  3VVD A;  2GHB A;  1PB8 A;  1EU8 A;  2OBG A;  1I6A A;  5L9M A;  2Y7I A;  4AQ4 A;  3HN0 A;  4RY1 A;  3PUY E;  3K6X A;  2YPN A;  3MC2 A;  2RC8 A;  2I58 A;  1SW1 A;  4MBP A;  5HPQ A;  1MXW A;  1PB7 A;  1IXG A;  2HXW A;  1MM6 A;  2X7Q A;  5L9O A;  3PPN A;  2Q2C A;  5H8F B;  5H8Q B;  4RNS A;  1QKB A;  4Q8R A;  1ZIU A;  3VLW A;  2H98 A;  4AB5 A;  4ZEI A;  5ICQ A;  5DYH A;  4QSD A;  1BTJ A;  3PMX A;  4ELO A;  3EN3 A;  4ESW A;  3FXQ A;  5EYF A;  3R7X A;  3BFU A;  3SEW A;  3H6T A;  3CFL A;  1IXH A;  3A09 A;  2DSF A;  2G29 A;  1LLS A;  3CFX A;  2GFE A;  3OEL A;  4OYV A;  4KFQ A;  4R6K A;  3SES A;  1B5H A;  3PUX E;  2I4C A;  4Z0I A;  3UOR A;  4F1U A;  1II5 A;  2VHA A;  2IEE A;  4H5G A;  4F3S A;  3E13 X;  3IR1 A;  1Y20 A;  3FXU A;  4HS7 A;  5JTY A;  2XHD A;  1N84 A;  1P1U A;  4RJZ A;  3DLN A;  1VE4 A;  3FVK A;  5JK4 A;  4KCC A;  3TQW A;  4GVO A;  1NH7 A;  3S2V A;  4ZE9 A;  3SDF A;  1LAX A;  1OMP A;  1Y4T A;  1A54 A;  1EZO A;  4ONY A;  2XXV A;  1FTJ A;  2ZYK A;  5L8D A;  5H8N A;  1XVY A;  2XXI A;  3K2D A;  3MVX A;  4F1V A;  4KCD A;  2AYS A;  4JSD A;  4H0W A;  1URD A;  2Q9T A;  3VVE A;  3FIR A;  4LZ5 A;  2D5W A;  1SW4 A;  2QS4 A;  3OOA A;  4LAT A;  3N26 A;  4NTL A;  3TDJ A;  1IEJ A;  1DTZ A;  4RXL A;  1QUK A;  3KZG A;  5H8H A;  3ZS6 A;  4JDF A;  2ABH A;  4GLI A;  4YMA A;  3PUW E;  1JW1 A;  1PC3 A;  1XOC A;  4NF5 B;  1Z7M E;  2O69 A;  5AA2 B;  3QSL A;  3THI A;  4PFU A;  1TT1 A;  1JET A;  1AL3 A;  4G68 A;  3V8X B;  2UVH A;  3MP1 A;  2HAU A;  3VLU A;  5KCJ B;  5ELV A;  2VGQ A;  1B46 A;  5CMK A;  3TMG A;  1MDQ A;  2YLN A;  4DLD A;  1B7H A;  4C1T A;  1N7W A;  5LOM A;  3OO8 A;  1N3X A;  3C36 A;  3VLV A;  4QSE A;  5F1Q A;  1D4N A;  1B05 A;  4F3P A;  1QKA A;  4OET A;  1QJM A;  4F19 A;  2PT2 A;  4R72 A;  2W7Y A;  1LBB A;  5I59 A;  4XKN A;  3U72 A;  5DT6 A;  1MY3 A;  4YIC A;  2V84 A;  3VDF A;  4U21 A;  1S7Y A;  4F18 A;  2QPQ A;  1MY4 A;  5EHS A;  3M3L A;  5H8F A;  5H8Q A;  2P1S A;  3MVW A;  3RLF E;  2QSX A;  2UVI A;  3KEI A;  3N94 A;  5JEI A;  4P0I A;  1FCK A;  4OWD A;  3T9X B;  1MY1 A;  4KHZ E;  5HM4 B;  3FJM A;  2ZYO A;  3DEL B;  1Z7N E;  1A55 A;  3SEU A;  4DXU A;  1IZ1 A;  1BKA A;  4F1Y A;  4JSO A;  1SI0 A;  2OCU A;  1Q1K A;  4MLQ A;  1GGG A;  1R9L A;  1UTH A;  2ZNT A;  3K4U A;  1NNK A;  1KWH A;  4IO6 A;  4YAH X;  3D4C A;  4H1X A;  3IB2 A;  5DEX B;  4GL8 A;  4TQU Q;  3U8Q A;  4G8N A;  3V89 B;  1B4H A;  1ZJL A;  1M5D A;  1CB6 A;  2F7A A;  3PU5 A;  1JVX A;  1B5I A;  4R75 A;  2UVG A;  3B7D A;  2OLB A;  2NXO A;  4LON B;  4OQO A;  3VE1 B;  2UXA A;  3ONM A;  1BLF A;  3MW0 A;  3UGW A;  4XIG Q;  3VV5 A;  5AA3 A;  1LFH A;  1B3G A;  5FTH A;  2Z22 A;  4R9G A;  3MBP A;  1LGB C;  5BUU A;  3QUF A;  3KG2 A;  5F7V A;  4YB7 A;  3EQ1 A;  5TU0 A;  4NF5 A;  1MY0 A;  4U23 A;  5AA2 A;  2FYI A;  2OWT A;  4YKJ A;  4IO3 A;  3K6U A;  3W9W A;  4OER A;  4H6D A;  2XXU A;  2ONS A;  4XKQ A;  2ONK E;  3PPQ A;  1SDX A;  1B2H A;  5A5X B;  4MF3 A;  4LP2 B;  1M5E A;  5KCJ A;  4ECF A;  3ILU B;  4BDO A;  4XXU A;  3E4R A;  4O3B A;  1Y3Q A;  3T93 B;  1R9Q A;  3TKD A;  1NNP A;  1B0H A;  2F78 A;  3LSX A;  1LB9 A;  3DP6 A;  3TCH A;  3KN3 A;  1SBP A;  3K1N A;  3S9L C;  4MFI A;  1LFI A;  3CI8 A;  4H5F A;  3H03 A;  1P1W A;  1PB9 A;  4FEB A;  5CBR A;  1UIV A;  2LAO A;  4OEV A;  3Q26 A;  1YCJ A;  1XHY A;  2YJP A;  2A5S A;  4IGR A;  1GR2 A;  3H3G A;  3FVG A;  1SW5 A;  4RK9 A;  2F7B A;  4KI0 E;  1NMU A;  2O51 A;  3IOV A;  2Y7P A;  1BIY A;  4JB7 A;  3CIJ A;  4GQO A;  4OTE A;  3Q27 A;  1URS A;  1QUJ A;  5DVJ A;  3MPK A;  2V25 A;  3FAS A;  2XD2 A;  2XXR A;  1AMF A;  1PBP A;  5DTB A;  3UK4 A;  3PGF A;  1FQC A;  1MPD A;  4ZE8 A;  1SQY A;  4I8C A;  2I49 A;  4OES A;  3KSJ A;  5DEX A;  4FAT A;  4FIM A;  1H76 A;  2F36 A;  4Q30 B;  1ZU0 A;  4IB2 A;  2RC7 A;  1P1O A;  2X7P A;  2O1M A;  1QW0 A;  3IOR A;  2Z23 A;  5TPA A;  2HAV A;  4GWO A;  2H5Y A;  3TCF A;  3V5A A;  3L6G A;  4NF6 B;  3K6V A;  3M8U A;  3EHS A;  5HBC A;  5H8S A;  4P0G A;  4X48 A;  4NWD A;  1MXZ A;  4OEU A;  2DWH A;  3KSX A;  1MDP 1;  4HTG A;  4NED A;  4M1V A;  1NNF A;  5J1D A;  3FVO A;  1B0L A;  4G8M A;  1LAG E;  2UYE A;  2UVJ A;  5ISU A;  3O66 A;  4E0X A;  1UTB A;  4N6P A;  4WKM A;  2Q89 A;  4JWO A;  3KOS A;  3ZKK A;  2XXT A;  4ISU A;  1H3D A;  2X26 A;  3SET A;  3WAF A;  2CMO A;  4AB6 A;  1IIW A;  5I2N A;  3VVF A;  4QFP A;  3T9U A;  1S50 A;  1TFA A;  3V83 A;  1WVJ A;  1MQI A;  5AA4 B;  3N6T A;  3O6H A;  3FXR A;  4H8J A;  2XXQ A;  4YMB A;  4X1B A;  5A5X A;  2QS1 A;  2DWI A;  1WOD A;  1MXV A;  2RC9 A;  1D3K A;  3KN8 A;  4ELR A;  1JNF A;  1DOT A;  3TZA A;  2VD2 A;  1US4 A;  4EUO A;  3H06 B;  2REJ A;  4RPO A;  5BWJ A;  1HSE A;  2XX9 A;  1B3H A;  1MH4 A;  3O2A A;  3G3H A;  4G2Z A;  1MXY A;  3ZSF A;  4R6H A;  3M3F A;  4GXS B;  3EHU A;  2Y84 A;  4OVJ A;  3K6W A;  4KYE A;  3VXC A;  1YPN A;  4DZ1 A;  3EF7 A;  2A5T B;  4QFL A;  4BDM A;  1PEB A;  4NE4 A;  4NF4 B;  5CMB A;  5I57 B;  2DQV A;  3CR9 A;  3CRB A;  4R2F A;  3HST A;  3DM0 A;  3UIF A;  5FHM A;  2DVC A;  5IAI A;  5L9S A;  4GRK A;  2DP8 A;  4PQJ A;  3Q25 A;  3B6T A;  4IO4 A;  2AL5 A;  3O29 A;  1B5J A;  2DOJ A;  1P99 A;  3OO7 A;  4RK2 A;  2G93 A;  4JXI A;  5CBS A;  1B3E A;  3A3U A;  3UN6 A;  3KBR A;  4ZEB A;  3GBB A;  3C31 A;  5FTI A;  3N6U A;  2OZZ A;  4U1Z A;  4LQ2 A;  3G3F A;  2O7U A;  3KGC A;  3KJT A;  1N76 A;  3EHT A;  3N5L A;  3TUS A;  1HSJ A;  1JEV A;  2QS3 A;  1MRP A;  4DE8 A;  4ZED A;  3MUQ A;  4Z7E A;  3OEK A;  3S9E A;  2PMS A;  2REG A;  4EXK A;  1B51 A;  4OMB A;  4EXL A;  2H4I A;  3PUZ E;  4XKR A;  4ZS9 A;  1POT A;  2HZL A;  3HV1 A;  1BP5 A;  4QSC A;  1ANF A;  4R73 A;  1FTO A;  4BDL A;  4F31 B;  4NF6 A;  4KD5 A;  2DE3 A;  2Y7W A;  1JW5 A;  1P1N A;  5KZT A;  1T0K A;  3PPO A;  4LA9 A;  2H99 A;  4NF8 B;  3I6V A;  1IQ7 A;  3G3I A;  1N7X A;  4P11 A;  3RT6 B;  3S4U A;  2CZL A;  3SEY A;  4PFY A;  2DE2 A;  1Y3P A;  2HCA A;  4OEN A;  5I2K B;  3C33 A;  1EZ9 A;  2WKY A;  4NMY A;  3SEX A;  4RYA A;  4GF8 A;  5KDT B;  4RPN A;  4X1D A;  4DIG A;  3LBS A;  2RCB A;  4BDQ A;  4YU0 A;  3FVN A;  2R71 A;  3OSR A;  4U4S A;  2VD3 A;  3A3C A;  5I58 B;  1VFE A;  1PDA A;  3U94 A;  2ZYM A;  3KJ7 A;  1MQG A;  1GV8 A;  1ZMG A;  1VR5 A;  3CFZ A;  5AA4 A;  1B1X A;  2QRY A;  2P0S A;  2QJE A;  3FGS A;  1O7T A;  4LUB A;  1FQB A;  1A99 A;  3O6G A;  1LCF A;  2XXX A;  5AA1 A;  1LST A;  4EQ7 A;  4U1O A;  2FA7 A;  4YZZ A;  1MQD A;  1I69 A;  3QIM A;  4EQB A;  2F6G A;  4FE8 A;  4OFL A;  3OD7 A;  3CG3 A;  4G77 A;  2BJJ X;  2RF1 A;  1B32 A;  3LSF B;  3ODB A;  3MAM A;  1SYH A;  2A5T A;  1R6Z A;  3WAE A;  2OK2 A;  3OO9 A;  2DE4 A;  4TOZ A;  4NF4 A;  1OIB A;  1IXI A;  4NWC A;  3LC8 A;  4ZZA A;  2ESN A;  4C1U A;  1JEU A;  1ZBM A;  3BFT A;  5TP9 B;  3G3J A;  3TFL A;  3SER A;  2F8D A;  4ZDM A;  2ZNU A;  2E0S A;  3U92 A;  2ALU A;  1XT8 A;  3JZJ A;  1B7Z A;  3HCQ A;  1MH3 A;  3FV1 A;  3MPL A;  1GVC A;  1ELJ A;  3Q28 A;  2Q88 A;  2V3Q A;  3LSL A;  4ZEK A;  4PFW A;  3TYH A;  3MJN A;  1VFD A;  2XXY A;  1D9Y A;  1LCT A;  4IY5 A;  5JTY B;  1N3W A;  3MVZ A;  4GD5 A;  4O3C A;  1JW4 A;  4E0W A;  4X9T A;  4HW8 A;  2I6E A;  2DXR A;  1SYI A;  2PT1 A;  3PMW A;  1MG1 A;  4OZ9 A;  2R6G E;  1XS5 A;  1US5 A;  5H8N B;  4ESX A;  4YB5 A;  3MVY A;  1TXF A;  2XD3 A;  1DSN A;  4R74 A;  3FJG A;  1H44 A;  2GRV A;  1CE2 A;  3TTL A;  2I4B A;  1NL5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...