4ND9A

The putative substrate binding domain of abc-type transporter from agrobacterium tumefaciens in open conformation
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
280
structure length
280
Chain Sequence
AQVVVSSKIDTEGGVLGNIILAVLNQNKIETTDRIQLGATPVVRKAITAGEIDIYPEYTGNAAFFFSKADDPLWKDAAKGYEEAKTLDYDANKIVWLAPSPANNTWAIALRKDVADKNNLKTLSDFGKYVAGGGTVVLAASSEFVNSAAALPAFQTTYGFTMKPDQLITLSGGDTAATIAAAANQTNNANAAMVYGTDGGIAPSGLVVLEDDKHVQPVYQPAPIIREEVLKKHPNIEELLKPVFEKLDLATLQDLNARVQVGGEQAKTVAMDFLTKNGFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords ABC transporter, substrate binding protein (Proline/glycine/
publication title The putative substrate binding domain of ABC-type transporter from Agrobacterium tumefaciens in open conformation
rcsb
source organism Agrobacterium fabrum
total genus 96
structure length 280
sequence length 280
ec nomenclature
pdb deposition date 2013-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04069 OpuAC Substrate binding domain of ABC-type glycine betaine transport system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4nd9A01
3.40.190.120 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Osmoprotection protein (prox); domain 2 4nd9A02
3PV0E 3TZAA 3RLFE 2CZLA 1UQWA 4HS7A 4TLMB 4DE8A 3T9XB 1PB7A 3CRBA 3V5AA 3G3FA 3IB0A 1GV8A 4PFTA 4C1TA 2PT1A 2DXRA 1IEJA 1VE4A 4ZDMA 1JETA 2DS9A 3IJOB 3HCQA 1Z7ME 5EHMA 5DEXB 2NUVA 1BTJA 1UTBB 5A5XA 1B0LA 2X7QA 1D9VA 3K6WA 1NKXA 3A3UA 1H3DA 3MUQA 3V83A 3O6HA 1M5BA 2IEEA 3MZBA 3THIA 1FTLA 4Z7EA 1OMPA 1FQBA 2UYEA 1A99A 4OEVA 1B05A 2DVCA 2ZNTA 4LQ2A 5DVJA 3VE1B 2RC8A 3BKIB 4R73A 3S2VA 3L6HA 3O66A 3B6TA 2O68A 5AA3A 4NF8B 3M3KA 4U4XA 1Q35A 1B58A 3S9LC 2OJTA 5H8HA 5DYHA 4ZZAA 4Q5TA 3PUYE 1DOTA 3HSTA 5L9OA 2Y7PA 1BIYA 3N94A 3FVKA 1TWYA 4H1XA 1D9YA 2F34A 4EF1A 3CR9A 2O6AA 2I48A 1MPBA 2ZYKA 4L17A 3SEYA 1JNFA 3KG2A 4TQUQ 1PB8A 4DCXA 1Y9UA 4G68B 3RQTA 5FHOA 2YJPA 2QPQA 5M2VA 3R7XA 3MPLA 2QS2A 4ZE8A 2UVJA 5I57B 3OD7A 4H67A 1FW0A 3IK6B 1IXHA 1N7WA 3N6TA 3IOWA 3KGCA 4UACA 1JVXA 1DSNA 1XOCA 4EF2A 4H0WA 5H8QA 3FJMA 1OLAA 1B1XA 4LONB 2UYFA 3JZJA 2DYXA 2Y84A 1KWHA 1UTHA 3UIFA 4U23A 3FJGA 1URSA 1M5DA 2B65A 2DWAA 5I59A 3TAJA 4WEDA 3CG1A 3T96B 1EZOA 1MDP1 1JW5A 4OVJA 2P2AA 1Y3NA 3A09A 3IO6A 1TFDA 2RKMA 4YMBA 1YCJA 2CMOA 2IA4A 5ICQA 2QMXA 1MY4A 3OO7A 3G3JA 1DTGA 3C34A 3IO4A 4G77A 1N84A 1MDQA 3G3HA 2YPNA 2D5WA 2O69A 3T9UA 4K3FA 4Z0IA 1AOVA 3H03A 4POWA 3D4GA 2E0SA 5K2XA 4OESA 4BDNA 2NVUB 3IX1A 2W7YA 5I2NA 5I2KA 4QFNA 5DT6A 4RJZA 2XX8A 3VVEA 4OERA 3BFUA 4R2FA 3G3KA 3KSXA 1Y4CA 3H7MA 3QUJA 5AA4A 4EQ9A 4YZZA 1EZ9A 1NNFA 4R75A 1I6BA 5L9SA 3G3GA 1MG1A 3ZSFA 5L9MA 4U1OA 3FIRA 1N76A 2GHBA 3DP6A 1AL3A 1IXIA 3MZ1A 1LGBC 4NTLA 3PUXE 1N3WA 1PDAA 2Z8FA 1J1NA 4LA9A 1JVYA 4RXLA 4DIGA 3IR1A 3EHTA 2XXPA 3C33A 2XXQA 4LVQA 1PC3A 2XXHA 1B3LA 2O51A 4EQBA 4KHZE 4H5GA 5ISUA 1SYIA 4KCCA 4QRZA 3ECRA 4H65A 4ELOA 5LOMA 4RA1A 1SW1A 1GR2A 4AB5A 4OFLA 1ZKBA 4XKQA 4OENA 3S9NC 3SERA 4RNSA 4R9FA 2Q8JA 1LBCA 1LCTA 2VOZA 3OOAA 4PFWA 1LB8A 1HSEA 1S7YA 1MQJA 1A54A 4KQPA 4ISUA 4NF4B 1B51A 4YMAA 4GFRA 3SETA 1CB6A 4PE5B 3WAFA 2F36A 4BDLA 4KI0E 1H44A 5CC2A 2QRYA 3E9XA 3MP8A 4QFKA 4YKJA 1YAEA 1SBPA 1NNTA 4R6KA 2ALUA 2OBGA 2X7PA 3PU5A 3M8UA 2PVUA 3FXUA 1BKAA 4FECA 1RYXA 4PETA 3V89B 5TPAA 4KYSA 2Y7IA 3KOSA 3K6UA 4XKRA 3TMGA 1B40A 4ZEFA 4ZEBA 4LATA 4YB5A 1WVJA 2Y7WA 2NOOA 3TPAA 2M8CA 3VDFA 5IKBA 1ZJLA 3K4UA 1MXYA 4GL0A 5BUUA 3FASA 4DCYA 3H6UA 4F1YA 1JEVA 1MXUA 1NNKA 4OMBA 3TDJA 4G8HA 4QFLA 2Q89A 5CMCA 5CI5A 5ELVA 1O64A 1B1HA 2Z8DA 3HPIA 4JWXA 4NMYA 3CFZA 1B4ZA 3PPPA 2HQ0A 4G8MA 3ZKLA 1QJMA 1QUJA 2ZYNA 1TXFA 2KLFA 1AMFA 3PD9A 1IZ1A 4KFQA 5AA1A 1MS7A 4HCWA 3KOTA 3MW0A 4C1UA 2ANJA 4IO3A 4NF6B 1B7UA 1MQHA 4NEDA 1B52A 1UIVA 3HV1A 1QUIA 4JDFA 2BJJX 3O28A 1R9LA 3N26A 3M3LA 2VHAA 4RYAA 4DXCA 4WKMA 4ZEDA 1MPCA 1SW5A 4F2OA 1VR5A 4MBPA 1NMUA 4NWDA 4NF5A 4JWOA 2DOJA 4BDRA 3PPOA 1R6ZA 3W15C 2R71A 3B6QA 2THIA 3IOTA 2V3QA 4F19A 1NFTA 5I58A 4E0WA 2ZYOA 1FQAA 4MLVA 1AIVA 4IO6A 1POTA 1SDXA 4WXJA 3IOUA 5CMMA 2RC9A 4F29A 3O6IA 1BP5A 1P1OA 4JXIA 4OYVA 2RF1A 5K2YA 1LFIA 3OO9A 5HM4B 4GL8A 3PMVA 1LB9A 3OELA 3AXFA 3Q25A 4YKIA 1ANFA 3Q26A 1P99A 2RC7A 3PUVE 1LLSA 3TELA 5AA2B 3ILUB 5F7VA 1MY1A 4IGTA 3B7DA 3C35A 4X48A 4ND9A 4TLLB 3DLNA 1A8FA 4QFOA 4NWCA 2XD2A 5TP9A 2NWJA 4FEBA 2QL3A 1ZBMA 1MY3A 2WKYA 2ZMBA 3G7WA 3FJ7A 5I56B 1B32A 2AL5A 1MH4A 3IAZA 4R6HA 3UN6A 1JW4A 1FQFA 3SKPA 3MZ9A 3ZKKA 4DXUA 3EF7A 2DE3A 4U4SA 5DVIA 3DELB 3KSJA 3HHFA 3KJ7A 3LR1A 2GHAA 1OIBA 2H98A 2HEUA 2QS4A 3OEKA 4R74A 2QSXA 4EXLA 1MY0A 3DM0A 3UA8A 1P1QA 3ILTB 3K1NA 5JTYA 4YICA 2AL4A 2I4BA 2Q9TA 3UORA 1LCFA 4P0GA 2A5TB 3KN8A 3RT8A 4BDQA 3RT6B 1TT1A 3WAEA 1OQHA 4IO2A 4QSDA 1P1NA 2DE4A 3N5LA 2I49A 3PUWE 5CM6A 3PMXA 4UA8A 3QSLA 1FTMA 1MQDA 2F6GA 1R9QA 5HBCA 5FTIA 1S9TA 5F1QA 3OENA 3H3GA 4FJPA 2F35A 1I69A 5H8FB 2XXYA 1ZLQA 2Q2CA 3KEIA 4H8JA 4TOZA 1LAHE 4XTCQ 5ITOA 3TEPA 3JV9A 4GVOA 4OQOA 1Y3QA 2V3UA 3KN3A 2O7UA 3HO7A 5KCJA 2RCBA 1POY1 3PMWA 3U1OA 4MF3A 1FTOA 2PT2A 3SEWA 2XXRA 3LUYA 1A40A 1MM7A 1NH8A 3VXBA 2ONSA 5EYFA 3U94A 4F1UA 3D4CA 5H8NB 3MP6A 4JWYA 1B9JA 3MBPA 3FXQA 3K1PA 4POXA 3B6WA 4AB6A 2DSFA 2F7CA 1S50A 1B6HA 3QUFA 4KPTA 1CE2A 3FVGA 1IQ7A 2Q2AA 5FHNA 2FA7A 3I6VA 2ESNA 2ZXTA 3T9HB 3O9PA 3TTRA 4ESWA 2XXTA 1NL5A 1URDA 4GRKA 3C9HA 3DP8A 2AYSA 2F7BA 3T22A 4BDMA 1DTZA 3CSBA 4X9TA 4F18A 3KZGA 4FEDA 3IORA 1YTVA 5A5XB 3ZS6A 3IOVA 1B3GA 1PB9A 2QMWA 3H6WA 1LSTA 4ELRA 1XS5A 1SI0A 1QKAA 3H6VA 4LP2B 4MFIA 4Q8RA 3SEVA 3P7IA 3W9VA 3S9MC 4LUBA 4DXBA 3ODBA 2GFEA 2G93A 3LSWA 3FUZA 1D3KA 2Z23A 4ZEIA 1WDNA 3FVOA 3E3KA 2OWTA 1A7LA 4OTEA 3GBBA 3RNNA 5CMKA 2O1LA 5DEXA 1P1WA 3H4ZA 4GWOA 1UTBA 3U93A 1MXWA 4QHQA 1EU8A 3Q28A 2DP8A 2ZNUA 5BWJA 3RPWA 1XT8A 4KYDA 1AH5A 3O97A 1N7XA 1JEUA 1MXVA 5B70A 1PBPA 2I3VA 2QS3A 3EHSA 4XKPA 5JEIA 1N3XA 1US5A 4H8IA 4NF8A 1H43A 4U22A 4ONYA 1B3HA 3SESA 1FTKA 2H99A 2XXXA 3K6XA 2Z22A 3C4MA 1LAGE 1B3EA 3VLUA 1MPDA 2O7IA 4KYEA 4Q0CA 4DDDA 5H8QB 1B7ZA 3T9VA 4YAHX 3O29A 3OMBA 1N0TA 4OZ9A 4EXKA 3PPNA 1FCKA 2Y7RA 2I3WA 4U1ZA 2ONRA 1UTHB 1FTJA 4U21A 1JW1A 2HZKA 3MWBA 4WEPA 4EUOA 2OZZA 3RY3A 2I0BA 3K0VA 3EQ1A 3H06B 4FATA 3U72A 5I59B 2A5TA 3FVNA 4G68A 3OXNA 4AQ4A 2XXUA 4EQ7A 5I57A 3IL1B 2H25A 3CG3A 4THIA 3K1MA 4F2QA 4I62A 3I5OA 1JQFA 1PBQA 4HTGA 5KDTB 5DTBA 3K6VA 1US4A 4O3BA 2HAUA 3VV5A 4GXAA 1I6AA 4P0IA 4JSOA 4XIGQ 1SVXB 3F11A 1II5A 1B5JA 4YB7A 5I2NB 5I2KB 4RY1A 3RGYA 1MXZA 3TQWA 2LAOA 2ZNSA 3LBSA 3CI8A 5B7DA 3CVGA 4N6PA 5AA4B 2O1MA 1OVBA 4GF8A 4I9DA 4R2BA 1DMBA 2D3IA 3IB2A 3QK6A 4BDOA 4G8NA 1USYE 3TQLA 4YB6A 5H8NA 4DLDA 3BFTA 3FV2A 4RPOA 1VSOA 3O6GA 5CBSA 2R9JA 1YPNA 3R6UA 1Y3PA 3C32A 3M3FA 1VFEA 3FATA 4M1VA 2QS1A 1P1UA 3GXAA 3OO8A 1DPPA 1FQEA 2HCAA 4R72A 3TKDA 3T66A 2Q88A 3USDA 1QUKA 4IO5A 4YU0A 3LSXA 4N07A 4MLQA 2ZYMA 3UP9A 1MQIA 3C31A 4F3SA 4GIZA 4G68C 3N6UA 3E13X 3GZGA 3VLVA 3KBRA 3LSLA 2HAVA 1URGA 4ESXA 3PGFA 4IGRA 5TPAB 3TTMA 1M5FA 3EN3A 1O63A 4JBZA 1VFDA 1Q1KA 2REJA 3O2AA 5JK4A 3U8QA 1F9BA 3PD8A 3OO6A 4NF4A 2PX1A 1M5CA 1ATGA 1PEBA 5I84A 3MAMA 1ELJA 3JYRA 3RUMA 3I3VA 3QXMA 4Q30B 2F6PA 5FTHA 2F5XA 2XHDA 3FV1A 4OXVA 1QW0A 2DE2A 3HHGA 3K2DA 4F3GA 2B3FA 3FXRA 1B0HA 2OCUA 2FYIA 2UVIA 1B2HA 1SQYA 3H6TA 4HCYA 4RK9A 2V84A 2I0CA 3W9WA 2YLNA 2UXAA 1ZMGA 3KN7A 1LAXA 4YKKA 2I58A 3SDFA 1NH7A 2NXOA 2FNCA 2ABHA 3UGWA 3MJNA 3TTLA 4G4PA 3TODA 3FD3A 3VXCA 4FORA 4ZECA 3SEUA 1WODA 4ZZEA 5H8SA 2DWJA 5ICTA 2DXYA 4GD5A 2P0SA 3CIJA 2VP1A 1MH3A 4IO7A 4R6YA 1M5EA 4NF5B 3S9EA 4NE4A 3TTNA 4OWDA 1XVYA 4U2RA 4ZE9A 4EDPA 5TU0A 2GH9A 5KDTA 2R6GE 2QJEA 3ONMA 4KR5A 2B3BA 1LAFE 2I4CA 4GQOA 4OHNA 4PP0A 5I58B 4NF6A 3HN0A 2XD3A 1ZTYA 4JB7A 2Z8EA 1H45A 3LSFB 2X26A 4F3PA 1GGGA 2V93A 1QULA 3C36A 5CRYA 1A55A 3RN8A 4M4GA 4FE8A 4PQJA 1B7HA 5IAIA 3OEMA 2XX7A 4OETA 1IUDA 3MPKA 4LZ8A 4QSCA 1T0KA 1HSLA 3RTWB 2DQVA 2HZLA 3MVXA 1LBBA 3VVFA 5AA2D 1FQCA 1UIUA 3PPRA 3FGSA 1I6QA 2PBWA 5KZTA 1OVTA 1GTKA 2GRVA 2V25A 5AE4A 2ONKE 4IB2A 3SEXA 4XKNA 4F1VA 3MVYA 4F3BA 1RYOA 3GBAA 4YKPA 4E0XA 3BBRA 2HFBA 5TP9B 2I6EA 4FIMA 2XXWA 3TCHA 3E4RA 4ZEKA 2OLBA 4X1BA 3QIMA 1IITA 3FZVA 1FQDA 4O3AA 3OSQA 4I8CA 4LZ5A 4OFOA 2Y7KA 1A8EA 4XXUA 2F97A 2PMSA 2H9BA 3K01A 5H8HB 1EH3A 4HW8A 5AA2A 1Y20A 2O84X 1XVXA 2G29A 4PFYA 2DVZA 5HPQA 1ZU0A 3TUSA 2RINA 1HSJA 1MRPA 2VGQA 3EHUA 3Q29A 3CSGA 2V3TA 3A3CA 3QYTA 2E1SA 4PFUA 2F8DA 4KCDA 2A5SA 1SW4A 4IY5A 4O3CA 5JTYB 2UVGA 1H76A 4LQ5A 5EHSA 3TYHA 1LFGA 2VD3A 3QAXA 4QF9A 2D21A 1SI1A 3Q27A 5I56A 1L5TA 4X1DA 3U92A 4I1DA 2OWSA 5DVFA 5FHMA 3TFLA 4H6DA 1ZIUA 4KD5A 4C0RA 3PPQA 1B46A 4MH5A 2H5YA 4QSEA 4GOTA 4F22A 1O7TA 1DPEA 1RKMA 4ECFA 1TFAA 3RTFB 3MC2A 4JSDA 2XX9A 1R1NA 1N04A 4RK2A 4F31B 3R26A 3PUZE 1B3FA 3IJXB 4DZ1A 4ZS9A 2PYYA 3S4UA 5CMBA 2AIXA 4GXSB 4IY6A 3TTKA 2F7AA 5ITPA 2XXIA 2UVHA 1IXCA 3G3IA 1Y1ZA 2F78A 3VLWA 3CFXA 1MM6A 3V8XB 5KCJB 3IB1A 4FAJA 5J1DA 1QKBA 4IO4A 2OK2A 4H5FA 2DWHA 3K00A 1MQGA 4R9GA 3LC8A 3CFLA 3KFMA 3UK4A 4BLAA 1Y1MA 1OQGA 1D4NA 4LZ7A 5H8FA 1B5IA 2DWIA 4ELQA 1IXGA 1USYH 1BLFA 1B5HA 4P11A 3EPEA 4G2ZA 4N13A 1EZPA 3VVDA 2XXVA 3OSRA 1IIWA 3TCFA 2REGA 1Z7NE 3GLBA 1B4HA 2RCAA 5CBRA 2HXWA 4OFJA 1XC1A 3VFJA 2VD2A 3DP4A 1MXXA 4RPNA 1NNPA 1XHYA 1LFHA 1SYHA 1GVCA 1QVSA 3T93B 3MVWA 2H4IA 3MQ9A 1OLCA 4QFPA 3KJTA 4OEUA 5L8DA 3L6GA 1SD3A 4F39A 1MY2A 2P1SA 4ELPA 3MP1A 4GLIA 1SW2A 1Y4TA 3K02A 3TCGA 3MVZA
chains in the Genus database with same CATH superfamily
3PV0E 3TZAA 3RLFE 2CZLA 1UQWA 4HS7A 4TLMB 4DE8A 3T9XB 2GQ1A 1PB7A 2WYKA 1NI9A 3CRBA 3V5AA 3G3FA 3IB0A 1FBPA 1GV8A 4NX1A 4PFTA 4C1TA 2PT1A 2DXRA 4GX6A 1IEJA 1VE4A 4ZDMA 4PDDA 1JETA 2DS9A 4P8BA 3IJOB 3HCQA 1Z7ME 5EHMA 4KXPA 5DEXB 2NUVA 1BTJA 1UTBB 5A5XA 1B0LA 4P3LA 2X7QA 1D9VA 3K6WA 1NKXA 3A3UA 1H3DA 3MUQA 3V83A 3O6HA 1M5BA 2IEEA 3MZBA 3THIA 1FTLA 4Z7EA 1G0IA 1OMPA 1FQBA 2UYEA 2Q74A 1A99A 4OEVA 1B05A 2DVCA 4NN3A 2ZNTA 4LQ2A 4XFEA 5DVJA 3VE1B 2RC8A 3BKIB 4R73A 3S2VA 3L6HA 4MMPA 2F3DA 3O66A 3B6TA 2O68A 5AA3A 4NF8B 3M3KA 4U4XA 1Q35A 4GWWA 1B58A 3S9LC 5IM2A 2OJTA 5H8HA 5DYHA 2Y5KA 4ZZAA 4Q5TA 3PUYE 1DOTA 3HSTA 5L9OA 2Y7PA 1BIYA 3N94A 3FVKA 4HXVA 1TWYA 4H1XA 1RDYA 3E78A 1D9YA 2F34A 4EF1A 3CR9A 2O6AA 2XA5A 4OVPA 2I48A 1MPBA 2ZYKA 1QGXA 4L17A 2FVZA 3SEYA 1JNFA 3KG2A 4TQUQ 5ET8A 1PB8A 4DCXA 1Y9UA 4G68B 3RQTA 5FHOA 1EYIA 2YJPA 4G61A 2QPQA 5M2VA 5EQ9A 3R7XA 1YYZA 3MPLA 4P56A 2QS2A 4ZE8A 2UVJA 5I57B 3OD7A 4H67A 1FW0A 3IK6B 1IXHA 1N7WA 3N6TA 2OWZA 3IOWA 3KGCA 4UACA 1JVXA 1DSNA 1XOCA 4EF2A 4H0WA 5H8QA 3FJMA 1OLAA 4O94A 1B1XA 4LONB 2UYFA 3JZJA 2DYXA 2Y84A 1KWHA 1UTHA 3UIFA 4U23A 2VT5A 3FJGA 1URSA 1M5DA 2B65A 1FRPA 1KA1A 2DWAA 5I59A 3TAJA 4WEDA 3CG1A 3T96B 1EZOA 1MDP1 4I3EA 1JW5A 4OVJA 2P2AA 1Y3NA 3A09A 3IO6A 1TFDA 2RKMA 3GYYA 4YMBA 1YCJA 2CMOA 4PGNA 2IA4A 5ICQA 2QMXA 1FPEA 1MY4A 3OO7A 3G3JA 1DTGA 3C34A 3IO4A 4G77A 1N84A 1MDQA 3G3HA 2YPNA 2D5WA 2O69A 3T9UA 4K3FA 4Z0IA 2R8TA 1AOVA 2KQZA 3IFAA 2WEFA 3H03A 4POWA 3D4GA 2E0SA 2HXRA 5K2XA 4OESA 4BDNA 2NVUB 3IX1A 1KZ8A 2W7YA 5I2NA 5I2KA 4QFNA 5DT6A 4RJZA 2XX8A 3VVEA 1FTAA 4OERA 1G0HA 3BFUA 3CHGA 2DDKA 4R2FA 3G3KA 2JJKA 3KSXA 1Y4CA 3H7MA 3QUJA 5AA4A 4EQ9A 4YZZA 1EZ9A 4HE2A 1NNFA 4R75A 1I6BA 5L9SA 3G3GA 1MG1A 3ZSFA 2PFZA 5L9MA 1FPGA 4U1OA 3FIRA 1N76A 2GHBA 3DP6A 1AL3A 1IXIA 3MZ1A 1LGBC 1DCUA 4MNPA 3A29A 4NTLA 3PUXE 1N3WA 1PDAA 2Z8FA 1J1NA 4NG7A 4LA9A 1JVYA 4RXLA 4DIGA 3IR1A 3EHTA 2XXPA 3C33A 2XXQA 2P3NA 4LVQA 1PC3A 2XXHA 1B3LA 1LBXA 2P3VA 4LN5A 2O51A 4EQBA 4KHZE 4H5GA 5ISUA 1SYIA 4KCCA 1IMEA 4QRZA 3ECRA 3BIHA 4H65A 4ELOA 5LOMA 4RA1A 1SW1A 1GR2A 4AB5A 4OFLA 1ZKBA 4XKQA 4OENA 3S9NC 3SERA 4RNSA 4R9FA 2Q8JA 1LBCA 1LCTA 2VOZA 3OOAA 4PFWA 1LB8A 1HSEA 1S7YA 1MQJA 1A54A 4KQPA 4O7IA 5IZ3A 2ZZVA 4ISUA 4NF4B 1B51A 1NUZA 4YMAA 4GFRA 3SETA 1CB6A 4PE5B 3WAFA 2F36A 3MSTA 4BDLA 2HHMA 4KI0E 1H44A 5CC2A 5T3JA 2QRYA 3E9XA 4PC9A 4PF8A 3MP8A 4QFKA 4YKJA 1YAEA 1SBPA 1NNTA 4R6KA 2ALUA 4JVDA 2OBGA 2X7PA 3PU5A 3M8UA 2PVUA 2KR0A 3FXUA 2WBDA 1BKAA 5ET7A 4FECA 1RYXA 4PETA 4N17A 3V89B 5TPAA 2PCRA 2MKZA 4KYSA 1FPKA 2Y7IA 4PBQA 3KOSA 3K6UA 1VDWA 4XKRA 3TMGA 1B40A 4ZEFA 4ZEBA 4LATA 4YB5A 1WVJA 2Y7WA 2NOOA 3TPAA 2M8CA 3VDFA 5IKBA 1ZJLA 3K4UA 1MXYA 4GL0A 4UABA 5BUUA 5FBPA 1FBEA 3FASA 4DCYA 3H6UA 1LBYA 4F1YA 1JEVA 1MXUA 1NNKA 3PTYA 4OMBA 3EKIA 3TDJA 4G8HA 4QFLA 2Q89A 5CMCA 5CI5A 5ELVA 1O64A 1B1HA 5ESYA 2Z8DA 1YZ0A 3B8BA 3HPIA 4JWXA 4JVIA 4NMYA 2FIEA 3CFZA 1B4ZA 1LBWA 3PPPA 2HQ0A 4G8MA 3ZKLA 1QJMA 1QUJA 4GX4A 2ZYNA 1TXFA 3RPLB 2KLFA 1AMFA 3PD9A 4PFRA 1IZ1A 4KFQA 5F24A 5AA1A 1MS7A 4HCWA 5ET6A 3KOTA 3MW0A 4C1UA 2ANJA 4IO3A 1LEVA 4NF6B 1B7UA 1MQHA 4NEDA 4GWZA 1B52A 1UIVA 3HV1A 1QUIA 4JDFA 3T0JA 3ROJA 2BJJX 3O28A 4N15A 1R9LA 3N26A 3M3LA 2VHAA 4RYAA 4DXCA 4MHFA 4WKMA 4ZEDA 1MPCA 1SW5A 4F2OA 1VR5A 4MBPA 1NMUA 4NWDA 4NF5A 4JWOA 4OVQA 5I3SA 2DOJA 4BDRA 3PPOA 1R6ZA 3W15C 2ZZXA 2R71A 3B6QA 1BK4A 1Q9DA 2THIA 3IOTA 2QVRA 2V3QA 4F19A 1NFTA 5I58A 4E0WA 2ZYOA 4QBAA 1FJ6A 1FQAA 4MLVA 1IMAA 4H46A 4PFIA 1AIVA 4IO6A 1POTA 1SDXA 4WXJA 3IOUA 5CMMA 2RC9A 4F29A 3O6IA 1BP5A 1P1OA 4JXIA 4OYVA 4OANA 2RF1A 5K2YA 1LFIA 3OO9A 5HM4B 4GL8A 3PMVA 1LB9A 1LBZA 3OELA 3AXFA 3Q25A 4YKIA 4AS5A 1NV5A 1ANFA 3Q26A 2WX9A 1P99A 2RC7A 3PUVE 1LLSA 3TELA 5AA2B 4I3YA 3ILUB 5F7VA 4HE0A 1MY1A 4IGTA 2HPGA 3B7DA 3C35A 4X48A 4MIJA 4ND9A 4TLLB 3DLNA 1A8FA 4QFOA 4NWCA 2XD2A 5TP9A 2NWJA 4FEBA 2QL3A 4QXDA 1ZBMA 1MY3A 2WKYA 2ZMBA 3G7WA 3FJ7A 1NV7A 5I56B 1B32A 2AL5A 5DW8A 1MH4A 3IAZA 4R6HA 3B50A 3UN6A 1JW4A 4IR8A 1FQFA 3SKPA 3MZ9A 3U65A 2XWOA 3ZKKA 4DXUA 3EF7A 2DE3A 4U4SA 5DVIA 3DELB 3KSJA 3HHFA 3KJ7A 3LR1A 2GHAA 1OIBA 2H98A 2HEUA 2QS4A 3OEKA 4R74A 2QSXA 4EXLA 1MY0A 3DM0A 3UA8A 1P1QA 3ILTB 3K1NA 5JTYA 4YICA 4N4UA 2AL4A 2I4BA 2Q9TA 3UORA 1LCFA 4P0GA 2A5TB 3KN8A 3RT8A 4BDQA 3RT6B 1TT1A 3WAEA 1OQHA 4GWYA 4IO2A 4QSDA 1P1NA 2DE4A 3N5LA 2I49A 5EQAA 3PUWE 5CM6A 5I7IA 3PMXA 4UA8A 3QSLA 1FTMA 1MQDA 2F6GA 1R9QA 4X04A 5HBCA 5FTIA 1S9TA 2V4CA 5F1QA 1YXIA 3OENA 3H3GA 4FJPA 2F35A 1I69A 5H8FB 5A5LA 2XXYA 1ZLQA 1FBFA 1FBCA 2Q2CA 3KEIA 3QMFA 4H8JA 4P1LA 2CZKA 3KBZA 4TOZA 1LAHE 4XTCQ 5ITOA 1NV2A 3TEPA 3JV9A 4GVOA 4OQOA 1Y3QA 2PFYA 2V3UA 3KN3A 2O7UA 3HO7A 4NGUA 5KCJA 4PGPA 2RCBA 1POY1 3PMWA 3U1OA 4MF3A 3T1BA 1FTOA 2PT2A 3SEWA 2XXRA 3LUYA 1A40A 1MM7A 1NH8A 2XWVA 3VXBA 2ONSA 5EYFA 3U94A 4F1UA 3D4CA 5H8NB 3MP6A 4JWYA 1B9JA 3MBPA 3FXQA 1FJ9A 3K1PA 4POXA 3B6WA 4AB6A 4XEQA 2DSFA 2F7CA 1S50A 4HE1A 1B6HA 3QUFA 4KPTA 1CE2A 3FVGA 1IQ7A 2Q2AA 5FHNA 2FA7A 3I6VA 2ESNA 2ZXTA 3T9HB 3O9PA 3TTRA 1NV0A 4ESWA 2XXTA 1NL5A 1URDA 4GRKA 3LUZA 3C9HA 3DP8A 2AYSA 2F7BA 3T22A 4BDMA 1DTZA 3CSBA 4X9TA 4F18A 3KZGA 4FEDA 3IORA 1YTVA 5A5XB 3ZS6A 3IOVA 5LDZA 1B3GA 1IMCA 1PB9A 2QMWA 3H6WA 1LSTA 4N8YA 2XWKA 4ELRA 1XS5A 1SI0A 1QKAA 3H6VA 4LP2B 4MFIA 1NV3A 4Q8RA 3SEVA 3P7IA 3W9VA 3S9MC 4LUBA 4DXBA 3ODBA 1FSAA 2GFEA 1NUXA 4GWSA 2FIXA 2G93A 4MNCA 3LSWA 3FUZA 1D3KA 2Z23A 4ZEIA 1WDNA 3FVOA 3E3KA 2OWTA 1A7LA 4OTEA 3GBBA 4P1EA 3RNNA 4PAKA 5CMKA 2O1LA 5DEXA 1P1WA 3H4ZA 4GWOA 1UTBA 3U93A 1MXWA 4QHQA 4H45A 1EU8A 3Q28A 2DP8A 2ZNUA 5BWJA 3RPWA 1XT8A 4KYDA 1XI6A 1DBZA 1AH5A 3O97A 1N7XA 1JEUA 5IZZA 1MXVA 5B70A 1PBPA 2I3VA 4N8GA 2QS3A 3EHSA 4XKPA 5JEIA 1FBHA 1N3XA 1US5A 4H8IA 4NF8A 1H43A 4U22A 4ONYA 1B3HA 3SESA 1FTKA 3SZPA 2H99A 2XXXA 3K6XA 1NUWA 4PAFA 2Z22A 3C4MA 1LBVA 4NF0A 1LAGE 4MX6A 1B3EA 3VLUA 1MPDA 2O7IA 4KYEA 4Q0CA 1NV4A 4DDDA 5H8QB 1B7ZA 3T9VA 4YAHX 3O29A 3OMBA 1N0TA 4OZ9A 4EXKA 3PPNA 1FCKA 2Y7RA 2I3WA 4U1ZA 4N91A 2ONRA 1UTHB 1FTJA 4U21A 1JW1A 2HZKA 3MWBA 4WEPA 4EUOA 2OZZA 3RY3A 1RDZA 2I0BA 3K0VA 3EQ1A 3H06B 4FATA 3U72A 5I59B 2A5TA 3FVNA 1FPJA 4G68A 3OXNA 2WBBA 4AQ4A 2XXUA 4EQ7A 5I57A 3ISPA 3IL1B 2H25A 3CG3A 4THIA 3K1MA 4F2QA 4I62A 3I5OA 4JVCA 1FPIA 1JQFA 1PBQA 4HTGA 2FBPA 5KDTB 5DTBA 1K9ZA 3K6VA 1US4A 5IZ1A 4OVSA 4O3BA 2HAUA 3VV5A 4GXAA 4NHBA 1CNQA 4GWUA 1I6AA 4PE3A 4P0IA 4JSOA 4XIGQ 1SVXB 3F11A 1II5A 1B5JA 4YB7A 5I2NB 5I2KB 4RY1A 3RGYA 1NUYA 1MXZA 3TQWA 2LAOA 2ZNSA 3LBSA 3CI8A 5B7DA 3CVGA 2CEYA 4N6PA 5AA4B 2O1MA 1OVBA 4GF8A 4I9DA 4R2BA 1DMBA 2D3IA 5J16A 3IB2A 3QK6A 4BDOA 4G8NA 4NQ8A 1AWBA 1USYE 3TQLA 4YB6A 2XXKA 5H8NA 1JP4A 4DLDA 3BFTA 3FV2A 4RPOA 2CZHA 3KC0A 1VSOA 3O6GA 5CBSA 4OA4A 2R9JA 1YPNA 3R6UA 1Y3PA 3C32A 3M3FA 1VFEA 4P9KA 4O8MA 3FATA 4OVRA 4M1VA 2QS1A 1P1UA 3GXAA 3OO8A 1DPPA 1FQEA 2HCAA 4XF5A 1EYKA 4R72A 3TKDA 3T66A 3KC1A 4I40A 2Q88A 3USDA 3RYDA 5ET5A 1QUKA 4IO5A 4YU0A 5IZ3B 3LSXA 4N07A 4MLQA 2ZYMA 3UP9A 1MQIA 4GBWA 3C31A 4F3SA 4P47A 4DI3D 4GIZA 1SPIA 2Y5LA 4G68C 3N6UA 3E13X 3GZGA 3VLVA 3KBRA 4N6KA 3LSLA 2HAVA 1URGA 4ESXA 3PGFA 4IGRA 1FPDA 5TPAB 3TTMA 3LV0A 1M5FA 3HFUA 3EN3A 1O63A 4PTKA 4JBZA 2L5VA 1VFDA 1Q1KA 2REJA 3O2AA 5JK4A 3U8QA 1F9BA 3PD8A 3OO6A 4MNIA 4NF4A 4MAGA 4GX3A 2PX1A 1M5CA 1ATGA 1PEBA 5I84A 3MAMA 1ELJA 3JYRA 3RUMA 3I3VA 3QXMA 4Q30B 2F6PA 5FTHA 4MCOA 2F5XA 2XHDA 2XWIA 3FV1A 4OXVA 1QW0A 2DE2A 3HHGA 2VPOA 3K2DA 1IMDA 1K9YA 4F3GA 2B3FA 3FXRA 1B0HA 2OCUA 2FYIA 2UVIA 1B2HA 1SQYA 3H6TA 4HCYA 4RK9A 2V84A 2I0CA 4MJOA 3D1RA 3W9WA 2YLNA 2UXAA 4DI4B 1ZMGA 3BIGA 3KN7A 1LAXA 5EQ8A 4YKKA 2I58A 3SDFA 1NH7A 2NXOA 2FNCA 2ABHA 3UGWA 3MJNA 3TTLA 4G4PA 3TODA 3FXBA 3FD3A 3VXCA 4FORA 4PAIA 4ZECA 3SEUA 1WODA 1NV6A 4PF6A 4ZZEA 5H8SA 2DWJA 5ICTA 2DXYA 4GD5A 2P0SA 3CIJA 2VP1A 1MH3A 4IO7A 4R6YA 1M5EA 4NF5B 1IMBA 3S9EA 4NE4A 3TTNA 4OWDA 1XVYA 4U2RA 3RPLA 4ZE9A 4EDPA 5TU0A 2GH9A 5KDTA 2R6GE 2QJEA 3ONMA 4KR5A 2B3BA 1LAFE 2I4CA 4GQOA 4OHNA 4PP0A 5I58B 4NF6A 3HN0A 2XD3A 1ZTYA 5EYHA 4JB7A 2Z8EA 3NOHA 1H45A 3LSFB 2X26A 4F3PA 1GGGA 2V93A 1QULA 3C36A 5CRYA 1A55A 3IFCA 3RN8A 4M4GA 4FE8A 4PQJA 4AS4A 1B7HA 5IAIA 3OEMA 2XX7A 4OETA 1IUDA 3MPKA 4LZ8A 4QSCA 1T0KA 1HSLA 3RTWB 2DQVA 2HZLA 3MVXA 1LBBA 3VVFA 5EQ7A 5AA2D 1FQCA 1UIUA 3PPRA 3FGSA 1I6QA 2PBWA 5KZTA 1OVTA 1GTKA 2GRVA 2V25A 5AE4A 4PBHA 2ONKE 4IB2A 3SEXA 4XKNA 4F1VA 3MVYA 4F3BA 1RYOA 3GBAA 4YKPA 4E0XA 4N81A 3BBRA 3E79A 2HFBA 5TP9B 2I6EA 4FIMA 2XXWA 3TCHA 3E4RA 1FBGA 4ZEKA 2OLBA 3MYUA 4X1BA 3QIMA 1IITA 3FZVA 2Q8MA 1FQDA 4O3AA 5I5PA 1INPA 3OSQA 4I8CA 4LZ5A 4OFOA 2Y7KA 1A8EA 2B4LA 4XXUA 2F97A 2PMSA 2H9BA 4MEVA 3K01A 5H8HB 1EH3A 4HW8A 5AA2A 1Y20A 2O84X 1XVXA 1NV1A 2G29A 1RDXA 2DVZA 4PFYA 5HPQA 1ZU0A 1FBDA 3TUSA 2RINA 1HSJA 1MRPA 1EYJA 2VGQA 3EHUA 3Q29A 2CEXA 3CSGA 2QVVA 2V3TA 3A3CA 3QYTA 2E1SA 4PFUA 2F8DA 4KCDA 2A5SA 1SW4A 4IY5A 4O3CA 4PCDA 2UVGA 5JTYB 1DK4A 1H76A 4LQ5A 2F3BA 4GBVA 5EHSA 3TYHA 1LFGA 1KA0A 2VD3A 3QAXA 4QF9A 2D21A 1SI1A 1FPFA 1FPLA 2B4MA 3Q27A 5I56A 2BJIA 1L5TA 4X1DA 3U92A 4I1DA 2OWSA 5DVFA 5FHMA 3TFLA 4H6DA 1ZIUA 1IMFA 4X8RA 4KD5A 4C0RA 3PPQA 1B46A 4MH5A 2H5YA 4QSEA 4GOTA 4F22A 4PDHA 1O7TA 1DPEA 1RKMA 4ECFA 1TFAA 3RTFB 3MC2A 4JSDA 2XX9A 1R1NA 1N04A 2VPNA 4GWXA 4RK2A 4F31B 3R26A 3PUZE 1B3FA 3IJXB 4DZ1A 4ZS9A 2PYYA 3S4UA 5CMBA 2AIXA 4GXSB 4IY6A 3TTKA 2F7AA 5ITPA 2XXIA 2UVHA 1IXCA 3G3IA 1Y1ZA 2QVUA 5LTCA 1FPBA 2FHYA 2OX3A 2WYPA 2F78A 4OVTA 3VLWA 3CFXA 1MM6A 3V8XB 5KCJB 3IB1A 4FAJA 5J1DA 1QKBA 2CZIA 4IO4A 2OK2A 4H5FA 2DWHA 3K00A 1MQGA 4R9GA 3LC8A 4N6DA 3CFLA 3KFMA 3UK4A 4BLAA 1Y1MA 1OQGA 1D4NA 4LZ7A 5H8FA 1B5IA 4FBPA 2DWIA 4PFBA 4ELQA 1IXGA 2ZZWA 1USYH 1BLFA 1B5HA 4P11A 3EPEA 1D9QA 3FBPA 4G2ZA 4N13A 1EZPA 3VVDA 2XXVA 3OSRA 1IIWA 4O7MA 3TCFA 2REGA 4NAPA 1Z7NE 3GLBA 1B4HA 2RCAA 5CBRA 2HXWA 4OFJA 1XC1A 3VFJA 2VD2A 3DP4A 1MXXA 4RPNA 1NNPA 1XHYA 1LFHA 1SYHA 1GVCA 1QVSA 3T93B 3MVWA 2H4IA 5IGAA 3MQ9A 1OLCA 4QFPA 3KJTA 4OEUA 5L8DA 3L6GA 1SD3A 4F39A 1MY2A 2P1SA 4ELPA 3MP1A 4GLIA 5EYGA 2QFLA 1SW2A 1Y4TA 3K02A 3TCGA 3MVZA
chains in the Genus database with same CATH topology
3PV0E 3TZAA 3RLFE 2CZLA 1UQWA 4HS7A 4TLMB 4DE8A 3T9XB 1PB7A 3CRBA 3V5AA 3G3FA 3IB0A 1GV8A 4PFTA 4C1TA 2PT1A 2DXRA 1IEJA 1VE4A 4ZDMA 1JETA 2DS9A 3IJOB 3HCQA 1Z7ME 5EHMA 5DEXB 2NUVA 1BTJA 1UTBB 5A5XA 1B0LA 2X7QA 1D9VA 3K6WA 1NKXA 3A3UA 1H3DA 3MUQA 3V83A 3O6HA 1M5BA 2IEEA 3MZBA 3THIA 1FTLA 4Z7EA 1OMPA 1FQBA 2UYEA 1A99A 4OEVA 1B05A 2DVCA 2ZNTA 4LQ2A 5DVJA 3VE1B 2RC8A 3BKIB 4R73A 3S2VA 3L6HA 3O66A 3B6TA 2O68A 5AA3A 4NF8B 3M3KA 4U4XA 1Q35A 1B58A 3S9LC 2OJTA 5H8HA 5DYHA 4ZZAA 4Q5TA 3PUYE 1DOTA 3HSTA 5L9OA 2Y7PA 1BIYA 3N94A 3FVKA 1TWYA 4H1XA 1D9YA 2F34A 4EF1A 3CR9A 2O6AA 2I48A 1MPBA 2ZYKA 4L17A 3SEYA 1JNFA 3KG2A 4TQUQ 1PB8A 4DCXA 1Y9UA 4G68B 3RQTA 5FHOA 2YJPA 2QPQA 5M2VA 3R7XA 3MPLA 2QS2A 4ZE8A 2UVJA 5I57B 3OD7A 4H67A 1FW0A 3IK6B 1IXHA 1N7WA 3N6TA 3IOWA 3KGCA 4UACA 1JVXA 1DSNA 1XOCA 4EF2A 4H0WA 5H8QA 3FJMA 1OLAA 1B1XA 4LONB 2UYFA 3JZJA 2DYXA 2Y84A 1KWHA 1UTHA 3UIFA 4U23A 3FJGA 1URSA 1M5DA 2B65A 2DWAA 5I59A 3TAJA 4WEDA 3CG1A 3T96B 1EZOA 1MDP1 1JW5A 4OVJA 2P2AA 1Y3NA 3A09A 3IO6A 1TFDA 2RKMA 4YMBA 1YCJA 2CMOA 2IA4A 5ICQA 2QMXA 1MY4A 3OO7A 3G3JA 1DTGA 3C34A 3IO4A 4G77A 1N84A 1MDQA 3G3HA 2YPNA 2D5WA 2O69A 3T9UA 4K3FA 4Z0IA 1AOVA 3H03A 4POWA 3D4GA 2E0SA 5K2XA 4OESA 4BDNA 2NVUB 3IX1A 2W7YA 5I2NA 5I2KA 4QFNA 5DT6A 4RJZA 2XX8A 3VVEA 4OERA 3BFUA 4R2FA 3G3KA 3KSXA 1Y4CA 3H7MA 3QUJA 5AA4A 4EQ9A 4YZZA 1EZ9A 1NNFA 4R75A 1I6BA 5L9SA 3G3GA 1MG1A 3ZSFA 5L9MA 4U1OA 3FIRA 1N76A 2GHBA 3DP6A 1AL3A 1IXIA 3MZ1A 1LGBC 4NTLA 3PUXE 1N3WA 1PDAA 2Z8FA 1J1NA 4LA9A 1JVYA 4RXLA 4DIGA 3IR1A 3EHTA 2XXPA 3C33A 2XXQA 4LVQA 1PC3A 2XXHA 1B3LA 2O51A 4EQBA 4KHZE 4H5GA 5ISUA 1SYIA 4KCCA 4QRZA 3ECRA 4H65A 4ELOA 5LOMA 4RA1A 1SW1A 1GR2A 4AB5A 4OFLA 1ZKBA 4XKQA 4OENA 3S9NC 3SERA 4RNSA 4R9FA 2Q8JA 1LBCA 1LCTA 2VOZA 3OOAA 4PFWA 1LB8A 1HSEA 1S7YA 1MQJA 1A54A 4KQPA 4ISUA 4NF4B 1B51A 4YMAA 4GFRA 3SETA 1CB6A 4PE5B 3WAFA 2F36A 4BDLA 4KI0E 1H44A 5CC2A 2QRYA 3E9XA 3MP8A 4QFKA 4YKJA 1YAEA 1SBPA 1NNTA 4R6KA 2ALUA 2OBGA 2X7PA 3PU5A 3M8UA 2PVUA 3FXUA 1BKAA 4FECA 1RYXA 4PETA 3V89B 5TPAA 4KYSA 2Y7IA 3KOSA 3K6UA 4XKRA 3TMGA 1B40A 4ZEFA 4ZEBA 4LATA 4YB5A 1WVJA 2Y7WA 2NOOA 3TPAA 2M8CA 3VDFA 5IKBA 1ZJLA 3K4UA 1MXYA 4GL0A 5BUUA 3FASA 4DCYA 3H6UA 4F1YA 1JEVA 1MXUA 1NNKA 4OMBA 3TDJA 4G8HA 4QFLA 2Q89A 5CMCA 5CI5A 5ELVA 1O64A 1B1HA 2Z8DA 3HPIA 4JWXA 4NMYA 3CFZA 1B4ZA 3PPPA 2HQ0A 4G8MA 3ZKLA 1QJMA 1QUJA 2ZYNA 1TXFA 2KLFA 1AMFA 3PD9A 1IZ1A 4KFQA 5AA1A 1MS7A 4HCWA 3KOTA 3MW0A 4C1UA 2ANJA 4IO3A 4NF6B 1B7UA 1MQHA 4NEDA 1B52A 1UIVA 3HV1A 1QUIA 4JDFA 2BJJX 3O28A 1R9LA 3N26A 3M3LA 2VHAA 4RYAA 4DXCA 4WKMA 4ZEDA 1MPCA 1SW5A 4F2OA 1VR5A 4MBPA 1NMUA 4NWDA 4NF5A 4JWOA 2DOJA 4BDRA 3PPOA 1R6ZA 3W15C 2R71A 3B6QA 2THIA 3IOTA 2V3QA 4F19A 1NFTA 5I58A 4E0WA 2ZYOA 1FQAA 4MLVA 1AIVA 4IO6A 1POTA 1SDXA 4WXJA 3IOUA 5CMMA 2RC9A 4F29A 3O6IA 1BP5A 1P1OA 4JXIA 4OYVA 2RF1A 5K2YA 1LFIA 3OO9A 5HM4B 4GL8A 3PMVA 1LB9A 3OELA 3AXFA 3Q25A 4YKIA 1ANFA 3Q26A 1P99A 2RC7A 3PUVE 1LLSA 3TELA 5AA2B 3ILUB 5F7VA 1MY1A 4IGTA 3B7DA 3C35A 4X48A 4ND9A 4TLLB 3DLNA 1A8FA 4QFOA 4NWCA 2XD2A 5TP9A 2NWJA 4FEBA 2QL3A 1ZBMA 1MY3A 2WKYA 2ZMBA 3G7WA 3FJ7A 5I56B 1B32A 2AL5A 1MH4A 3IAZA 4R6HA 3UN6A 1JW4A 1FQFA 3SKPA 3MZ9A 3ZKKA 4DXUA 3EF7A 2DE3A 4U4SA 5DVIA 3DELB 3KSJA 3HHFA 3KJ7A 3LR1A 2GHAA 1OIBA 2H98A 2HEUA 2QS4A 3OEKA 4R74A 2QSXA 4EXLA 1MY0A 3DM0A 3UA8A 1P1QA 3ILTB 3K1NA 5JTYA 4YICA 2AL4A 2I4BA 2Q9TA 3UORA 1LCFA 4P0GA 2A5TB 3KN8A 3RT8A 4BDQA 3RT6B 1TT1A 3WAEA 1OQHA 4IO2A 4QSDA 1P1NA 2DE4A 3N5LA 2I49A 3PUWE 5CM6A 3PMXA 4UA8A 3QSLA 1FTMA 1MQDA 2F6GA 1R9QA 5HBCA 5FTIA 1S9TA 5F1QA 3OENA 3H3GA 4FJPA 2F35A 1I69A 5H8FB 2XXYA 1ZLQA 2Q2CA 3KEIA 4H8JA 4TOZA 1LAHE 4XTCQ 5ITOA 3TEPA 3JV9A 4GVOA 4OQOA 1Y3QA 2V3UA 3KN3A 2O7UA 3HO7A 5KCJA 2RCBA 1POY1 3PMWA 3U1OA 4MF3A 1FTOA 2PT2A 3SEWA 2XXRA 3LUYA 1A40A 1MM7A 1NH8A 3VXBA 2ONSA 5EYFA 3U94A 4F1UA 3D4CA 5H8NB 3MP6A 4JWYA 1B9JA 3MBPA 3FXQA 3K1PA 4POXA 3B6WA 4AB6A 2DSFA 2F7CA 1S50A 1B6HA 3QUFA 4KPTA 1CE2A 3FVGA 1IQ7A 2Q2AA 5FHNA 2FA7A 3I6VA 2ESNA 2ZXTA 3T9HB 3O9PA 3TTRA 4ESWA 2XXTA 1NL5A 1URDA 4GRKA 3C9HA 3DP8A 2AYSA 2F7BA 3T22A 4BDMA 1DTZA 3CSBA 4X9TA 4F18A 3KZGA 4FEDA 3IORA 1YTVA 5A5XB 3ZS6A 3IOVA 1B3GA 1PB9A 2QMWA 3H6WA 1LSTA 4ELRA 1XS5A 1SI0A 1QKAA 3H6VA 4LP2B 4MFIA 4Q8RA 3SEVA 3P7IA 3W9VA 3S9MC 4LUBA 4DXBA 3ODBA 2GFEA 2G93A 3LSWA 3FUZA 1D3KA 2Z23A 4ZEIA 1WDNA 3FVOA 3E3KA 2OWTA 1A7LA 4OTEA 3GBBA 3RNNA 5CMKA 2O1LA 5DEXA 1P1WA 3H4ZA 4GWOA 1UTBA 3U93A 1MXWA 4QHQA 1EU8A 3Q28A 2DP8A 2ZNUA 5BWJA 3RPWA 1XT8A 4KYDA 1AH5A 3O97A 1N7XA 1JEUA 1MXVA 5B70A 1PBPA 2I3VA 2QS3A 3EHSA 4XKPA 5JEIA 1N3XA 1US5A 4H8IA 4NF8A 1H43A 4U22A 4ONYA 1B3HA 3SESA 1FTKA 2H99A 2XXXA 3K6XA 2Z22A 3C4MA 1LAGE 1B3EA 3VLUA 1MPDA 2O7IA 4KYEA 4Q0CA 4DDDA 5H8QB 1B7ZA 3T9VA 4YAHX 3O29A 3OMBA 1N0TA 4OZ9A 4EXKA 3PPNA 1FCKA 2Y7RA 2I3WA 4U1ZA 2ONRA 1UTHB 1FTJA 4U21A 1JW1A 2HZKA 3MWBA 4WEPA 4EUOA 2OZZA 3RY3A 2I0BA 3K0VA 3EQ1A 3H06B 4FATA 3U72A 5I59B 2A5TA 3FVNA 4G68A 3OXNA 4AQ4A 2XXUA 4EQ7A 5I57A 3IL1B 2H25A 3CG3A 4THIA 3K1MA 4F2QA 4I62A 3I5OA 1JQFA 1PBQA 4HTGA 5KDTB 5DTBA 3K6VA 1US4A 4O3BA 2HAUA 3VV5A 4GXAA 1I6AA 4P0IA 4JSOA 4XIGQ 1SVXB 3F11A 1II5A 1B5JA 4YB7A 5I2NB 5I2KB 4RY1A 3RGYA 1MXZA 3TQWA 2LAOA 2ZNSA 3LBSA 3CI8A 5B7DA 3CVGA 4N6PA 5AA4B 2O1MA 1OVBA 4GF8A 4I9DA 4R2BA 1DMBA 2D3IA 3IB2A 3QK6A 4BDOA 4G8NA 1USYE 3TQLA 4YB6A 5H8NA 4DLDA 3BFTA 3FV2A 4RPOA 1VSOA 3O6GA 5CBSA 2R9JA 1YPNA 3R6UA 1Y3PA 3C32A 3M3FA 1VFEA 3FATA 4M1VA 2QS1A 1P1UA 3GXAA 3OO8A 1DPPA 1FQEA 2HCAA 4R72A 3TKDA 3T66A 2Q88A 3USDA 1QUKA 4IO5A 4YU0A 3LSXA 4N07A 4MLQA 2ZYMA 3UP9A 1MQIA 3C31A 4F3SA 4GIZA 4G68C 3N6UA 3E13X 3GZGA 3VLVA 3KBRA 3LSLA 2HAVA 1URGA 4ESXA 3PGFA 4IGRA 5TPAB 3TTMA 1M5FA 3EN3A 1O63A 4JBZA 1VFDA 1Q1KA 2REJA 3O2AA 5JK4A 3U8QA 1F9BA 3PD8A 3OO6A 4NF4A 2PX1A 1M5CA 1ATGA 1PEBA 5I84A 3MAMA 1ELJA 3JYRA 3RUMA 3I3VA 3QXMA 4Q30B 2F6PA 5FTHA 2F5XA 2XHDA 3FV1A 4OXVA 1QW0A 2DE2A 3HHGA 3K2DA 4F3GA 2B3FA 3FXRA 1B0HA 2OCUA 2FYIA 2UVIA 1B2HA 1SQYA 3H6TA 4HCYA 4RK9A 2V84A 2I0CA 3W9WA 2YLNA 2UXAA 1ZMGA 3KN7A 1LAXA 4YKKA 2I58A 3SDFA 1NH7A 2NXOA 2FNCA 2ABHA 3UGWA 3MJNA 3TTLA 4G4PA 3TODA 3FD3A 3VXCA 4FORA 4ZECA 3SEUA 1WODA 4ZZEA 5H8SA 2DWJA 5ICTA 2DXYA 4GD5A 2P0SA 3CIJA 2VP1A 1MH3A 4IO7A 4R6YA 1M5EA 4NF5B 3S9EA 4NE4A 3TTNA 4OWDA 1XVYA 4U2RA 4ZE9A 4EDPA 5TU0A 2GH9A 5KDTA 2R6GE 2QJEA 3ONMA 4KR5A 2B3BA 1LAFE 2I4CA 4GQOA 4OHNA 4PP0A 5I58B 4NF6A 3HN0A 2XD3A 1ZTYA 4JB7A 2Z8EA 1H45A 3LSFB 2X26A 4F3PA 1GGGA 2V93A 1QULA 3C36A 5CRYA 1A55A 3RN8A 4M4GA 4FE8A 4PQJA 1B7HA 5IAIA 3OEMA 2XX7A 4OETA 1IUDA 3MPKA 4LZ8A 4QSCA 1T0KA 1HSLA 3RTWB 2DQVA 2HZLA 3MVXA 1LBBA 3VVFA 5AA2D 1FQCA 1UIUA 3PPRA 3FGSA 1I6QA 2PBWA 5KZTA 1OVTA 1GTKA 2GRVA 2V25A 5AE4A 2ONKE 4IB2A 3SEXA 4XKNA 4F1VA 3MVYA 4F3BA 1RYOA 3GBAA 4YKPA 4E0XA 3BBRA 2HFBA 5TP9B 2I6EA 4FIMA 2XXWA 3TCHA 3E4RA 4ZEKA 2OLBA 4X1BA 3QIMA 1IITA 3FZVA 1FQDA 4O3AA 3OSQA 4I8CA 4LZ5A 4OFOA 2Y7KA 1A8EA 4XXUA 2F97A 2PMSA 2H9BA 3K01A 5H8HB 1EH3A 4HW8A 5AA2A 1Y20A 2O84X 1XVXA 2G29A 4PFYA 2DVZA 5HPQA 1ZU0A 3TUSA 2RINA 1HSJA 1MRPA 2VGQA 3EHUA 3Q29A 3CSGA 2V3TA 3A3CA 3QYTA 2E1SA 4PFUA 2F8DA 4KCDA 2A5SA 1SW4A 4IY5A 4O3CA 5JTYB 2UVGA 1H76A 4LQ5A 5EHSA 3TYHA 1LFGA 2VD3A 3QAXA 4QF9A 2D21A 1SI1A 3Q27A 5I56A 1L5TA 4X1DA 3U92A 4I1DA 2OWSA 5DVFA 5FHMA 3TFLA 4H6DA 1ZIUA 4KD5A 4C0RA 3PPQA 1B46A 4MH5A 2H5YA 4QSEA 4GOTA 4F22A 1O7TA 1DPEA 1RKMA 4ECFA 1TFAA 3RTFB 3MC2A 4JSDA 2XX9A 1R1NA 1N04A 4RK2A 4F31B 3R26A 3PUZE 1B3FA 3IJXB 4DZ1A 4ZS9A 2PYYA 3S4UA 5CMBA 2AIXA 4GXSB 4IY6A 3TTKA 2F7AA 5ITPA 2XXIA 2UVHA 1IXCA 3G3IA 1Y1ZA 2F78A 3VLWA 3CFXA 1MM6A 3V8XB 5KCJB 3IB1A 4FAJA 5J1DA 1QKBA 4IO4A 2OK2A 4H5FA 2DWHA 3K00A 1MQGA 4R9GA 3LC8A 3CFLA 3KFMA 3UK4A 4BLAA 1Y1MA 1OQGA 1D4NA 4LZ7A 5H8FA 1B5IA 2DWIA 4ELQA 1IXGA 1USYH 1BLFA 1B5HA 4P11A 3EPEA 4G2ZA 4N13A 1EZPA 3VVDA 2XXVA 3OSRA 1IIWA 3TCFA 2REGA 1Z7NE 3GLBA 1B4HA 2RCAA 5CBRA 2HXWA 4OFJA 1XC1A 3VFJA 2VD2A 3DP4A 1MXXA 4RPNA 1NNPA 1XHYA 1LFHA 1SYHA 1GVCA 1QVSA 3T93B 3MVWA 2H4IA 3MQ9A 1OLCA 4QFPA 3KJTA 4OEUA 5L8DA 3L6GA 1SD3A 4F39A 1MY2A 2P1SA 4ELPA 3MP1A 4GLIA 1SW2A 1Y4TA 3K02A 3TCGA 3MVZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PV0 E;  3TZA A;  3RLF E;  2CZL A;  1UQW A;  4HS7 A;  4TLM B;  4DE8 A;  3T9X B;  1PB7 A;  3CRB A;  3V5A A;  3G3F A;  3IB0 A;  1GV8 A;  4PFT A;  4C1T A;  2PT1 A;  2DXR A;  1IEJ A;  1VE4 A;  4ZDM A;  1JET A;  2DS9 A;  3IJO B;  3HCQ A;  1Z7M E;  5EHM A;  5DEX B;  2NUV A;  1BTJ A;  1UTB B;  5A5X A;  1B0L A;  2X7Q A;  1D9V A;  3K6W A;  1NKX A;  3A3U A;  1H3D A;  3MUQ A;  3V83 A;  3O6H A;  1M5B A;  2IEE A;  3MZB A;  3THI A;  1FTL A;  4Z7E A;  1OMP A;  1FQB A;  2UYE A;  1A99 A;  4OEV A;  1B05 A;  2DVC A;  2ZNT A;  4LQ2 A;  5DVJ A;  3VE1 B;  2RC8 A;  3BKI B;  4R73 A;  3S2V A;  3L6H A;  3O66 A;  3B6T A;  2O68 A;  5AA3 A;  4NF8 B;  3M3K A;  4U4X A;  1Q35 A;  1B58 A;  3S9L C;  2OJT A;  5H8H A;  5DYH A;  4ZZA A;  4Q5T A;  3PUY E;  1DOT A;  3HST A;  5L9O A;  2Y7P A;  1BIY A;  3N94 A;  3FVK A;  1TWY A;  4H1X A;  1D9Y A;  2F34 A;  4EF1 A;  3CR9 A;  2O6A A;  2I48 A;  1MPB A;  2ZYK A;  4L17 A;  3SEY A;  1JNF A;  3KG2 A;  4TQU Q;  1PB8 A;  4DCX A;  1Y9U A;  4G68 B;  3RQT A;  5FHO A;  2YJP A;  2QPQ A;  5M2V A;  3R7X A;  3MPL A;  2QS2 A;  4ZE8 A;  2UVJ A;  5I57 B;  3OD7 A;  4H67 A;  1FW0 A;  3IK6 B;  1IXH A;  1N7W A;  3N6T A;  3IOW A;  3KGC A;  4UAC A;  1JVX A;  1DSN A;  1XOC A;  4EF2 A;  4H0W A;  5H8Q A;  3FJM A;  1OLA A;  1B1X A;  4LON B;  2UYF A;  3JZJ A;  2DYX A;  2Y84 A;  1KWH A;  1UTH A;  3UIF A;  4U23 A;  3FJG A;  1URS A;  1M5D A;  2B65 A;  2DWA A;  5I59 A;  3TAJ A;  4WED A;  3CG1 A;  3T96 B;  1EZO A;  1MDP 1;  1JW5 A;  4OVJ A;  2P2A A;  1Y3N A;  3A09 A;  3IO6 A;  1TFD A;  2RKM A;  4YMB A;  1YCJ A;  2CMO A;  2IA4 A;  5ICQ A;  2QMX A;  1MY4 A;  3OO7 A;  3G3J A;  1DTG A;  3C34 A;  3IO4 A;  4G77 A;  1N84 A;  1MDQ A;  3G3H A;  2YPN A;  2D5W A;  2O69 A;  3T9U A;  4K3F A;  4Z0I A;  1AOV A;  3H03 A;  4POW A;  3D4G A;  2E0S A;  5K2X A;  4OES A;  4BDN A;  2NVU B;  3IX1 A;  2W7Y A;  5I2N A;  5I2K A;  4QFN A;  5DT6 A;  4RJZ A;  2XX8 A;  3VVE A;  4OER A;  3BFU A;  4R2F A;  3G3K A;  3KSX A;  1Y4C A;  3H7M A;  3QUJ A;  5AA4 A;  4EQ9 A;  4YZZ A;  1EZ9 A;  1NNF A;  4R75 A;  1I6B A;  5L9S A;  3G3G A;  1MG1 A;  3ZSF A;  5L9M A;  4U1O A;  3FIR A;  1N76 A;  2GHB A;  3DP6 A;  1AL3 A;  1IXI A;  3MZ1 A;  1LGB C;  4NTL A;  3PUX E;  1N3W A;  1PDA A;  2Z8F A;  1J1N A;  4LA9 A;  1JVY A;  4RXL A;  4DIG A;  3IR1 A;  3EHT A;  2XXP A;  3C33 A;  2XXQ A;  4LVQ A;  1PC3 A;  2XXH A;  1B3L A;  2O51 A;  4EQB A;  4KHZ E;  4H5G A;  5ISU A;  1SYI A;  4KCC A;  4QRZ A;  3ECR A;  4H65 A;  4ELO A;  5LOM A;  4RA1 A;  1SW1 A;  1GR2 A;  4AB5 A;  4OFL A;  1ZKB A;  4XKQ A;  4OEN A;  3S9N C;  3SER A;  4RNS A;  4R9F A;  2Q8J A;  1LBC A;  1LCT A;  2VOZ A;  3OOA A;  4PFW A;  1LB8 A;  1HSE A;  1S7Y A;  1MQJ A;  1A54 A;  4KQP A;  4ISU A;  4NF4 B;  1B51 A;  4YMA A;  4GFR A;  3SET A;  1CB6 A;  4PE5 B;  3WAF A;  2F36 A;  4BDL A;  4KI0 E;  1H44 A;  5CC2 A;  2QRY A;  3E9X A;  3MP8 A;  4QFK A;  4YKJ A;  1YAE A;  1SBP A;  1NNT A;  4R6K A;  2ALU A;  2OBG A;  2X7P A;  3PU5 A;  3M8U A;  2PVU A;  3FXU A;  1BKA A;  4FEC A;  1RYX A;  4PET A;  3V89 B;  5TPA A;  4KYS A;  2Y7I A;  3KOS A;  3K6U A;  4XKR A;  3TMG A;  1B40 A;  4ZEF A;  4ZEB A;  4LAT A;  4YB5 A;  1WVJ A;  2Y7W A;  2NOO A;  3TPA A;  2M8C A;  3VDF A;  5IKB A;  1ZJL A;  3K4U A;  1MXY A;  4GL0 A;  5BUU A;  3FAS A;  4DCY A;  3H6U A;  4F1Y A;  1JEV A;  1MXU A;  1NNK A;  4OMB A;  3TDJ A;  4G8H A;  4QFL A;  2Q89 A;  5CMC A;  5CI5 A;  5ELV A;  1O64 A;  1B1H A;  2Z8D A;  3HPI A;  4JWX A;  4NMY A;  3CFZ A;  1B4Z A;  3PPP A;  2HQ0 A;  4G8M A;  3ZKL A;  1QJM A;  1QUJ A;  2ZYN A;  1TXF A;  2KLF A;  1AMF A;  3PD9 A;  1IZ1 A;  4KFQ A;  5AA1 A;  1MS7 A;  4HCW A;  3KOT A;  3MW0 A;  4C1U A;  2ANJ A;  4IO3 A;  4NF6 B;  1B7U A;  1MQH A;  4NED A;  1B52 A;  1UIV A;  3HV1 A;  1QUI A;  4JDF A;  2BJJ X;  3O28 A;  1R9L A;  3N26 A;  3M3L A;  2VHA A;  4RYA A;  4DXC A;  4WKM A;  4ZED A;  1MPC A;  1SW5 A;  4F2O A;  1VR5 A;  4MBP A;  1NMU A;  4NWD A;  4NF5 A;  4JWO A;  2DOJ A;  4BDR A;  3PPO A;  1R6Z A;  3W15 C;  2R71 A;  3B6Q A;  2THI A;  3IOT A;  2V3Q A;  4F19 A;  1NFT A;  5I58 A;  4E0W A;  2ZYO A;  1FQA A;  4MLV A;  1AIV A;  4IO6 A;  1POT A;  1SDX A;  4WXJ A;  3IOU A;  5CMM A;  2RC9 A;  4F29 A;  3O6I A;  1BP5 A;  1P1O A;  4JXI A;  4OYV A;  2RF1 A;  5K2Y A;  1LFI A;  3OO9 A;  5HM4 B;  4GL8 A;  3PMV A;  1LB9 A;  3OEL A;  3AXF A;  3Q25 A;  4YKI A;  1ANF A;  3Q26 A;  1P99 A;  2RC7 A;  3PUV E;  1LLS A;  3TEL A;  5AA2 B;  3ILU B;  5F7V A;  1MY1 A;  4IGT A;  3B7D A;  3C35 A;  4X48 A;  4ND9 A;  4TLL B;  3DLN A;  1A8F A;  4QFO A;  4NWC A;  2XD2 A;  5TP9 A;  2NWJ A;  4FEB A;  2QL3 A;  1ZBM A;  1MY3 A;  2WKY A;  2ZMB A;  3G7W A;  3FJ7 A;  5I56 B;  1B32 A;  2AL5 A;  1MH4 A;  3IAZ A;  4R6H A;  3UN6 A;  1JW4 A;  1FQF A;  3SKP A;  3MZ9 A;  3ZKK A;  4DXU A;  3EF7 A;  2DE3 A;  4U4S A;  5DVI A;  3DEL B;  3KSJ A;  3HHF A;  3KJ7 A;  3LR1 A;  2GHA A;  1OIB A;  2H98 A;  2HEU A;  2QS4 A;  3OEK A;  4R74 A;  2QSX A;  4EXL A;  1MY0 A;  3DM0 A;  3UA8 A;  1P1Q A;  3ILT B;  3K1N A;  5JTY A;  4YIC A;  2AL4 A;  2I4B A;  2Q9T A;  3UOR A;  1LCF A;  4P0G A;  2A5T B;  3KN8 A;  3RT8 A;  4BDQ A;  3RT6 B;  1TT1 A;  3WAE A;  1OQH A;  4IO2 A;  4QSD A;  1P1N A;  2DE4 A;  3N5L A;  2I49 A;  3PUW E;  5CM6 A;  3PMX A;  4UA8 A;  3QSL A;  1FTM A;  1MQD A;  2F6G A;  1R9Q A;  5HBC A;  5FTI A;  1S9T A;  5F1Q A;  3OEN A;  3H3G A;  4FJP A;  2F35 A;  1I69 A;  5H8F B;  2XXY A;  1ZLQ A;  2Q2C A;  3KEI A;  4H8J A;  4TOZ A;  1LAH E;  4XTC Q;  5ITO A;  3TEP A;  3JV9 A;  4GVO A;  4OQO A;  1Y3Q A;  2V3U A;  3KN3 A;  2O7U A;  3HO7 A;  5KCJ A;  2RCB A;  1POY 1;  3PMW A;  3U1O A;  4MF3 A;  1FTO A;  2PT2 A;  3SEW A;  2XXR A;  3LUY A;  1A40 A;  1MM7 A;  1NH8 A;  3VXB A;  2ONS A;  5EYF A;  3U94 A;  4F1U A;  3D4C A;  5H8N B;  3MP6 A;  4JWY A;  1B9J A;  3MBP A;  3FXQ A;  3K1P A;  4POX A;  3B6W A;  4AB6 A;  2DSF A;  2F7C A;  1S50 A;  1B6H A;  3QUF A;  4KPT A;  1CE2 A;  3FVG A;  1IQ7 A;  2Q2A A;  5FHN A;  2FA7 A;  3I6V A;  2ESN A;  2ZXT A;  3T9H B;  3O9P A;  3TTR A;  4ESW A;  2XXT A;  1NL5 A;  1URD A;  4GRK A;  3C9H A;  3DP8 A;  2AYS A;  2F7B A;  3T22 A;  4BDM A;  1DTZ A;  3CSB A;  4X9T A;  4F18 A;  3KZG A;  4FED A;  3IOR A;  1YTV A;  5A5X B;  3ZS6 A;  3IOV A;  1B3G A;  1PB9 A;  2QMW A;  3H6W A;  1LST A;  4ELR A;  1XS5 A;  1SI0 A;  1QKA A;  3H6V A;  4LP2 B;  4MFI A;  4Q8R A;  3SEV A;  3P7I A;  3W9V A;  3S9M C;  4LUB A;  4DXB A;  3ODB A;  2GFE A;  2G93 A;  3LSW A;  3FUZ A;  1D3K A;  2Z23 A;  4ZEI A;  1WDN A;  3FVO A;  3E3K A;  2OWT A;  1A7L A;  4OTE A;  3GBB A;  3RNN A;  5CMK A;  2O1L A;  5DEX A;  1P1W A;  3H4Z A;  4GWO A;  1UTB A;  3U93 A;  1MXW A;  4QHQ A;  1EU8 A;  3Q28 A;  2DP8 A;  2ZNU A;  5BWJ A;  3RPW A;  1XT8 A;  4KYD A;  1AH5 A;  3O97 A;  1N7X A;  1JEU A;  1MXV A;  5B70 A;  1PBP A;  2I3V A;  2QS3 A;  3EHS A;  4XKP A;  5JEI A;  1N3X A;  1US5 A;  4H8I A;  4NF8 A;  1H43 A;  4U22 A;  4ONY A;  1B3H A;  3SES A;  1FTK A;  2H99 A;  2XXX A;  3K6X A;  2Z22 A;  3C4M A;  1LAG E;  1B3E A;  3VLU A;  1MPD A;  2O7I A;  4KYE A;  4Q0C A;  4DDD A;  5H8Q B;  1B7Z A;  3T9V A;  4YAH X;  3O29 A;  3OMB A;  1N0T A;  4OZ9 A;  4EXK A;  3PPN A;  1FCK A;  2Y7R A;  2I3W A;  4U1Z A;  2ONR A;  1UTH B;  1FTJ A;  4U21 A;  1JW1 A;  2HZK A;  3MWB A;  4WEP A;  4EUO A;  2OZZ A;  3RY3 A;  2I0B A;  3K0V A;  3EQ1 A;  3H06 B;  4FAT A;  3U72 A;  5I59 B;  2A5T A;  3FVN A;  4G68 A;  3OXN A;  4AQ4 A;  2XXU A;  4EQ7 A;  5I57 A;  3IL1 B;  2H25 A;  3CG3 A;  4THI A;  3K1M A;  4F2Q A;  4I62 A;  3I5O A;  1JQF A;  1PBQ A;  4HTG A;  5KDT B;  5DTB A;  3K6V A;  1US4 A;  4O3B A;  2HAU A;  3VV5 A;  4GXA A;  1I6A A;  4P0I A;  4JSO A;  4XIG Q;  1SVX B;  3F11 A;  1II5 A;  1B5J A;  4YB7 A;  5I2N B;  5I2K B;  4RY1 A;  3RGY A;  1MXZ A;  3TQW A;  2LAO A;  2ZNS A;  3LBS A;  3CI8 A;  5B7D A;  3CVG A;  4N6P A;  5AA4 B;  2O1M A;  1OVB A;  4GF8 A;  4I9D A;  4R2B A;  1DMB A;  2D3I A;  3IB2 A;  3QK6 A;  4BDO A;  4G8N A;  1USY E;  3TQL A;  4YB6 A;  5H8N A;  4DLD A;  3BFT A;  3FV2 A;  4RPO A;  1VSO A;  3O6G A;  5CBS A;  2R9J A;  1YPN A;  3R6U A;  1Y3P A;  3C32 A;  3M3F A;  1VFE A;  3FAT A;  4M1V A;  2QS1 A;  1P1U A;  3GXA A;  3OO8 A;  1DPP A;  1FQE A;  2HCA A;  4R72 A;  3TKD A;  3T66 A;  2Q88 A;  3USD A;  1QUK A;  4IO5 A;  4YU0 A;  3LSX A;  4N07 A;  4MLQ A;  2ZYM A;  3UP9 A;  1MQI A;  3C31 A;  4F3S A;  4GIZ A;  4G68 C;  3N6U A;  3E13 X;  3GZG A;  3VLV A;  3KBR A;  3LSL A;  2HAV A;  1URG A;  4ESX A;  3PGF A;  4IGR A;  5TPA B;  3TTM A;  1M5F A;  3EN3 A;  1O63 A;  4JBZ A;  1VFD A;  1Q1K A;  2REJ A;  3O2A A;  5JK4 A;  3U8Q A;  1F9B A;  3PD8 A;  3OO6 A;  4NF4 A;  2PX1 A;  1M5C A;  1ATG A;  1PEB A;  5I84 A;  3MAM A;  1ELJ A;  3JYR A;  3RUM A;  3I3V A;  3QXM A;  4Q30 B;  2F6P A;  5FTH A;  2F5X A;  2XHD A;  3FV1 A;  4OXV A;  1QW0 A;  2DE2 A;  3HHG A;  3K2D A;  4F3G A;  2B3F A;  3FXR A;  1B0H A;  2OCU A;  2FYI A;  2UVI A;  1B2H A;  1SQY A;  3H6T A;  4HCY A;  4RK9 A;  2V84 A;  2I0C A;  3W9W A;  2YLN A;  2UXA A;  1ZMG A;  3KN7 A;  1LAX A;  4YKK A;  2I58 A;  3SDF A;  1NH7 A;  2NXO A;  2FNC A;  2ABH A;  3UGW A;  3MJN A;  3TTL A;  4G4P A;  3TOD A;  3FD3 A;  3VXC A;  4FOR A;  4ZEC A;  3SEU A;  1WOD A;  4ZZE A;  5H8S A;  2DWJ A;  5ICT A;  2DXY A;  4GD5 A;  2P0S A;  3CIJ A;  2VP1 A;  1MH3 A;  4IO7 A;  4R6Y A;  1M5E A;  4NF5 B;  3S9E A;  4NE4 A;  3TTN A;  4OWD A;  1XVY A;  4U2R A;  4ZE9 A;  4EDP A;  5TU0 A;  2GH9 A;  5KDT A;  2R6G E;  2QJE A;  3ONM A;  4KR5 A;  2B3B A;  1LAF E;  2I4C A;  4GQO A;  4OHN A;  4PP0 A;  5I58 B;  4NF6 A;  3HN0 A;  2XD3 A;  1ZTY A;  4JB7 A;  2Z8E A;  1H45 A;  3LSF B;  2X26 A;  4F3P A;  1GGG A;  2V93 A;  1QUL A;  3C36 A;  5CRY A;  1A55 A;  3RN8 A;  4M4G A;  4FE8 A;  4PQJ A;  1B7H A;  5IAI A;  3OEM A;  2XX7 A;  4OET A;  1IUD A;  3MPK A;  4LZ8 A;  4QSC A;  1T0K A;  1HSL A;  3RTW B;  2DQV A;  2HZL A;  3MVX A;  1LBB A;  3VVF A;  5AA2 D;  1FQC A;  1UIU A;  3PPR A;  3FGS A;  1I6Q A;  2PBW A;  5KZT A;  1OVT A;  1GTK A;  2GRV A;  2V25 A;  5AE4 A;  2ONK E;  4IB2 A;  3SEX A;  4XKN A;  4F1V A;  3MVY A;  4F3B A;  1RYO A;  3GBA A;  4YKP A;  4E0X A;  3BBR A;  2HFB A;  5TP9 B;  2I6E A;  4FIM A;  2XXW A;  3TCH A;  3E4R A;  4ZEK A;  2OLB A;  4X1B A;  3QIM A;  1IIT A;  3FZV A;  1FQD A;  4O3A A;  3OSQ A;  4I8C A;  4LZ5 A;  4OFO A;  2Y7K A;  1A8E A;  4XXU A;  2F97 A;  2PMS A;  2H9B A;  3K01 A;  5H8H B;  1EH3 A;  4HW8 A;  5AA2 A;  1Y20 A;  2O84 X;  1XVX A;  2G29 A;  4PFY A;  2DVZ A;  5HPQ A;  1ZU0 A;  3TUS A;  2RIN A;  1HSJ A;  1MRP A;  2VGQ A;  3EHU A;  3Q29 A;  3CSG A;  2V3T A;  3A3C A;  3QYT A;  2E1S A;  4PFU A;  2F8D A;  4KCD A;  2A5S A;  1SW4 A;  4IY5 A;  4O3C A;  5JTY B;  2UVG A;  1H76 A;  4LQ5 A;  5EHS A;  3TYH A;  1LFG A;  2VD3 A;  3QAX A;  4QF9 A;  2D21 A;  1SI1 A;  3Q27 A;  5I56 A;  1L5T A;  4X1D A;  3U92 A;  4I1D A;  2OWS A;  5DVF A;  5FHM A;  3TFL A;  4H6D A;  1ZIU A;  4KD5 A;  4C0R A;  3PPQ A;  1B46 A;  4MH5 A;  2H5Y A;  4QSE A;  4GOT A;  4F22 A;  1O7T A;  1DPE A;  1RKM A;  4ECF A;  1TFA A;  3RTF B;  3MC2 A;  4JSD A;  2XX9 A;  1R1N A;  1N04 A;  4RK2 A;  4F31 B;  3R26 A;  3PUZ E;  1B3F A;  3IJX B;  4DZ1 A;  4ZS9 A;  2PYY A;  3S4U A;  5CMB A;  2AIX A;  4GXS B;  4IY6 A;  3TTK A;  2F7A A;  5ITP A;  2XXI A;  2UVH A;  1IXC A;  3G3I A;  1Y1Z A;  2F78 A;  3VLW A;  3CFX A;  1MM6 A;  3V8X B;  5KCJ B;  3IB1 A;  4FAJ A;  5J1D A;  1QKB A;  4IO4 A;  2OK2 A;  4H5F A;  2DWH A;  3K00 A;  1MQG A;  4R9G A;  3LC8 A;  3CFL A;  3KFM A;  3UK4 A;  4BLA A;  1Y1M A;  1OQG A;  1D4N A;  4LZ7 A;  5H8F A;  1B5I A;  2DWI A;  4ELQ A;  1IXG A;  1USY H;  1BLF A;  1B5H A;  4P11 A;  3EPE A;  4G2Z A;  4N13 A;  1EZP A;  3VVD A;  2XXV A;  3OSR A;  1IIW A;  3TCF A;  2REG A;  1Z7N E;  3GLB A;  1B4H A;  2RCA A;  5CBR A;  2HXW A;  4OFJ A;  1XC1 A;  3VFJ A;  2VD2 A;  3DP4 A;  1MXX A;  4RPN A;  1NNP A;  1XHY A;  1LFH A;  1SYH A;  1GVC A;  1QVS A;  3T93 B;  3MVW A;  2H4I A;  3MQ9 A;  1OLC A;  4QFP A;  3KJT A;  4OEU A;  5L8D A;  3L6G A;  1SD3 A;  4F39 A;  1MY2 A;  2P1S A;  4ELP A;  3MP1 A;  4GLI A;  1SW2 A;  1Y4T A;  3K02 A;  3TCG A;  3MVZ A; 
#chains in the Genus database with same CATH topology
 3PV0 E;  3TZA A;  3RLF E;  2CZL A;  1UQW A;  4HS7 A;  4TLM B;  4DE8 A;  3T9X B;  2GQ1 A;  1PB7 A;  2WYK A;  1NI9 A;  3CRB A;  3V5A A;  3G3F A;  3IB0 A;  1FBP A;  1GV8 A;  4NX1 A;  4PFT A;  4C1T A;  2PT1 A;  2DXR A;  4GX6 A;  1IEJ A;  1VE4 A;  4ZDM A;  4PDD A;  1JET A;  2DS9 A;  4P8B A;  3IJO B;  3HCQ A;  1Z7M E;  5EHM A;  4KXP A;  5DEX B;  2NUV A;  1BTJ A;  1UTB B;  5A5X A;  1B0L A;  4P3L A;  2X7Q A;  1D9V A;  3K6W A;  1NKX A;  3A3U A;  1H3D A;  3MUQ A;  3V83 A;  3O6H A;  1M5B A;  2IEE A;  3MZB A;  3THI A;  1FTL A;  4Z7E A;  1G0I A;  1OMP A;  1FQB A;  2UYE A;  2Q74 A;  1A99 A;  4OEV A;  1B05 A;  2DVC A;  4NN3 A;  2ZNT A;  4LQ2 A;  4XFE A;  5DVJ A;  3VE1 B;  2RC8 A;  3BKI B;  4R73 A;  3S2V A;  3L6H A;  4MMP A;  2F3D A;  3O66 A;  3B6T A;  2O68 A;  5AA3 A;  4NF8 B;  3M3K A;  4U4X A;  1Q35 A;  4GWW A;  1B58 A;  3S9L C;  5IM2 A;  2OJT A;  5H8H A;  5DYH A;  2Y5K A;  4ZZA A;  4Q5T A;  3PUY E;  1DOT A;  3HST A;  5L9O A;  2Y7P A;  1BIY A;  3N94 A;  3FVK A;  4HXV A;  1TWY A;  4H1X A;  1RDY A;  3E78 A;  1D9Y A;  2F34 A;  4EF1 A;  3CR9 A;  2O6A A;  2XA5 A;  4OVP A;  2I48 A;  1MPB A;  2ZYK A;  1QGX A;  4L17 A;  2FVZ A;  3SEY A;  1JNF A;  3KG2 A;  4TQU Q;  5ET8 A;  1PB8 A;  4DCX A;  1Y9U A;  4G68 B;  3RQT A;  5FHO A;  1EYI A;  2YJP A;  4G61 A;  2QPQ A;  5M2V A;  5EQ9 A;  3R7X A;  1YYZ A;  3MPL A;  4P56 A;  2QS2 A;  4ZE8 A;  2UVJ A;  5I57 B;  3OD7 A;  4H67 A;  1FW0 A;  3IK6 B;  1IXH A;  1N7W A;  3N6T A;  2OWZ A;  3IOW A;  3KGC A;  4UAC A;  1JVX A;  1DSN A;  1XOC A;  4EF2 A;  4H0W A;  5H8Q A;  3FJM A;  1OLA A;  4O94 A;  1B1X A;  4LON B;  2UYF A;  3JZJ A;  2DYX A;  2Y84 A;  1KWH A;  1UTH A;  3UIF A;  4U23 A;  2VT5 A;  3FJG A;  1URS A;  1M5D A;  2B65 A;  1FRP A;  1KA1 A;  2DWA A;  5I59 A;  3TAJ A;  4WED A;  3CG1 A;  3T96 B;  1EZO A;  1MDP 1;  4I3E A;  1JW5 A;  4OVJ A;  2P2A A;  1Y3N A;  3A09 A;  3IO6 A;  1TFD A;  2RKM A;  3GYY A;  4YMB A;  1YCJ A;  2CMO A;  4PGN A;  2IA4 A;  5ICQ A;  2QMX A;  1FPE A;  1MY4 A;  3OO7 A;  3G3J A;  1DTG A;  3C34 A;  3IO4 A;  4G77 A;  1N84 A;  1MDQ A;  3G3H A;  2YPN A;  2D5W A;  2O69 A;  3T9U A;  4K3F A;  4Z0I A;  2R8T A;  1AOV A;  2KQZ A;  3IFA A;  2WEF A;  3H03 A;  4POW A;  3D4G A;  2E0S A;  2HXR A;  5K2X A;  4OES A;  4BDN A;  2NVU B;  3IX1 A;  1KZ8 A;  2W7Y A;  5I2N A;  5I2K A;  4QFN A;  5DT6 A;  4RJZ A;  2XX8 A;  3VVE A;  1FTA A;  4OER A;  1G0H A;  3BFU A;  3CHG A;  2DDK A;  4R2F A;  3G3K A;  2JJK A;  3KSX A;  1Y4C A;  3H7M A;  3QUJ A;  5AA4 A;  4EQ9 A;  4YZZ A;  1EZ9 A;  4HE2 A;  1NNF A;  4R75 A;  1I6B A;  5L9S A;  3G3G A;  1MG1 A;  3ZSF A;  2PFZ A;  5L9M A;  1FPG A;  4U1O A;  3FIR A;  1N76 A;  2GHB A;  3DP6 A;  1AL3 A;  1IXI A;  3MZ1 A;  1LGB C;  1DCU A;  4MNP A;  3A29 A;  4NTL A;  3PUX E;  1N3W A;  1PDA A;  2Z8F A;  1J1N A;  4NG7 A;  4LA9 A;  1JVY A;  4RXL A;  4DIG A;  3IR1 A;  3EHT A;  2XXP A;  3C33 A;  2XXQ A;  2P3N A;  4LVQ A;  1PC3 A;  2XXH A;  1B3L A;  1LBX A;  2P3V A;  4LN5 A;  2O51 A;  4EQB A;  4KHZ E;  4H5G A;  5ISU A;  1SYI A;  4KCC A;  1IME A;  4QRZ A;  3ECR A;  3BIH A;  4H65 A;  4ELO A;  5LOM A;  4RA1 A;  1SW1 A;  1GR2 A;  4AB5 A;  4OFL A;  1ZKB A;  4XKQ A;  4OEN A;  3S9N C;  3SER A;  4RNS A;  4R9F A;  2Q8J A;  1LBC A;  1LCT A;  2VOZ A;  3OOA A;  4PFW A;  1LB8 A;  1HSE A;  1S7Y A;  1MQJ A;  1A54 A;  4KQP A;  4O7I A;  5IZ3 A;  2ZZV A;  4ISU A;  4NF4 B;  1B51 A;  1NUZ A;  4YMA A;  4GFR A;  3SET A;  1CB6 A;  4PE5 B;  3WAF A;  2F36 A;  3MST A;  4BDL A;  2HHM A;  4KI0 E;  1H44 A;  5CC2 A;  5T3J A;  2QRY A;  3E9X A;  4PC9 A;  4PF8 A;  3MP8 A;  4QFK A;  4YKJ A;  1YAE A;  1SBP A;  1NNT A;  4R6K A;  2ALU A;  4JVD A;  2OBG A;  2X7P A;  3PU5 A;  3M8U A;  2PVU A;  2KR0 A;  3FXU A;  2WBD A;  1BKA A;  5ET7 A;  4FEC A;  1RYX A;  4PET A;  4N17 A;  3V89 B;  5TPA A;  2PCR A;  2MKZ A;  4KYS A;  1FPK A;  2Y7I A;  4PBQ A;  3KOS A;  3K6U A;  1VDW A;  4XKR A;  3TMG A;  1B40 A;  4ZEF A;  4ZEB A;  4LAT A;  4YB5 A;  1WVJ A;  2Y7W A;  2NOO A;  3TPA A;  2M8C A;  3VDF A;  5IKB A;  1ZJL A;  3K4U A;  1MXY A;  4GL0 A;  4UAB A;  5BUU A;  5FBP A;  1FBE A;  3FAS A;  4DCY A;  3H6U A;  1LBY A;  4F1Y A;  1JEV A;  1MXU A;  1NNK A;  3PTY A;  4OMB A;  3EKI A;  3TDJ A;  4G8H A;  4QFL A;  2Q89 A;  5CMC A;  5CI5 A;  5ELV A;  1O64 A;  1B1H A;  5ESY A;  2Z8D A;  1YZ0 A;  3B8B A;  3HPI A;  4JWX A;  4JVI A;  4NMY A;  2FIE A;  3CFZ A;  1B4Z A;  1LBW A;  3PPP A;  2HQ0 A;  4G8M A;  3ZKL A;  1QJM A;  1QUJ A;  4GX4 A;  2ZYN A;  1TXF A;  3RPL B;  2KLF A;  1AMF A;  3PD9 A;  4PFR A;  1IZ1 A;  4KFQ A;  5F24 A;  5AA1 A;  1MS7 A;  4HCW A;  5ET6 A;  3KOT A;  3MW0 A;  4C1U A;  2ANJ A;  4IO3 A;  1LEV A;  4NF6 B;  1B7U A;  1MQH A;  4NED A;  4GWZ A;  1B52 A;  1UIV A;  3HV1 A;  1QUI A;  4JDF A;  3T0J A;  3ROJ A;  2BJJ X;  3O28 A;  4N15 A;  1R9L A;  3N26 A;  3M3L A;  2VHA A;  4RYA A;  4DXC A;  4MHF A;  4WKM A;  4ZED A;  1MPC A;  1SW5 A;  4F2O A;  1VR5 A;  4MBP A;  1NMU A;  4NWD A;  4NF5 A;  4JWO A;  4OVQ A;  5I3S A;  2DOJ A;  4BDR A;  3PPO A;  1R6Z A;  3W15 C;  2ZZX A;  2R71 A;  3B6Q A;  1BK4 A;  1Q9D A;  2THI A;  3IOT A;  2QVR A;  2V3Q A;  4F19 A;  1NFT A;  5I58 A;  4E0W A;  2ZYO A;  4QBA A;  1FJ6 A;  1FQA A;  4MLV A;  1IMA A;  4H46 A;  4PFI A;  1AIV A;  4IO6 A;  1POT A;  1SDX A;  4WXJ A;  3IOU A;  5CMM A;  2RC9 A;  4F29 A;  3O6I A;  1BP5 A;  1P1O A;  4JXI A;  4OYV A;  4OAN A;  2RF1 A;  5K2Y A;  1LFI A;  3OO9 A;  5HM4 B;  4GL8 A;  3PMV A;  1LB9 A;  1LBZ A;  3OEL A;  3AXF A;  3Q25 A;  4YKI A;  4AS5 A;  1NV5 A;  1ANF A;  3Q26 A;  2WX9 A;  1P99 A;  2RC7 A;  3PUV E;  1LLS A;  3TEL A;  5AA2 B;  4I3Y A;  3ILU B;  5F7V A;  4HE0 A;  1MY1 A;  4IGT A;  2HPG A;  3B7D A;  3C35 A;  4X48 A;  4MIJ A;  4ND9 A;  4TLL B;  3DLN A;  1A8F A;  4QFO A;  4NWC A;  2XD2 A;  5TP9 A;  2NWJ A;  4FEB A;  2QL3 A;  4QXD A;  1ZBM A;  1MY3 A;  2WKY A;  2ZMB A;  3G7W A;  3FJ7 A;  1NV7 A;  5I56 B;  1B32 A;  2AL5 A;  5DW8 A;  1MH4 A;  3IAZ A;  4R6H A;  3B50 A;  3UN6 A;  1JW4 A;  4IR8 A;  1FQF A;  3SKP A;  3MZ9 A;  3U65 A;  2XWO A;  3ZKK A;  4DXU A;  3EF7 A;  2DE3 A;  4U4S A;  5DVI A;  3DEL B;  3KSJ A;  3HHF A;  3KJ7 A;  3LR1 A;  2GHA A;  1OIB A;  2H98 A;  2HEU A;  2QS4 A;  3OEK A;  4R74 A;  2QSX A;  4EXL A;  1MY0 A;  3DM0 A;  3UA8 A;  1P1Q A;  3ILT B;  3K1N A;  5JTY A;  4YIC A;  4N4U A;  2AL4 A;  2I4B A;  2Q9T A;  3UOR A;  1LCF A;  4P0G A;  2A5T B;  3KN8 A;  3RT8 A;  4BDQ A;  3RT6 B;  1TT1 A;  3WAE A;  1OQH A;  4GWY A;  4IO2 A;  4QSD A;  1P1N A;  2DE4 A;  3N5L A;  2I49 A;  5EQA A;  3PUW E;  5CM6 A;  5I7I A;  3PMX A;  4UA8 A;  3QSL A;  1FTM A;  1MQD A;  2F6G A;  1R9Q A;  4X04 A;  5HBC A;  5FTI A;  1S9T A;  2V4C A;  5F1Q A;  1YXI A;  3OEN A;  3H3G A;  4FJP A;  2F35 A;  1I69 A;  5H8F B;  5A5L A;  2XXY A;  1ZLQ A;  1FBF A;  1FBC A;  2Q2C A;  3KEI A;  3QMF A;  4H8J A;  4P1L A;  2CZK A;  3KBZ A;  4TOZ A;  1LAH E;  4XTC Q;  5ITO A;  1NV2 A;  3TEP A;  3JV9 A;  4GVO A;  4OQO A;  1Y3Q A;  2PFY A;  2V3U A;  3KN3 A;  2O7U A;  3HO7 A;  4NGU A;  5KCJ A;  4PGP A;  2RCB A;  1POY 1;  3PMW A;  3U1O A;  4MF3 A;  3T1B A;  1FTO A;  2PT2 A;  3SEW A;  2XXR A;  3LUY A;  1A40 A;  1MM7 A;  1NH8 A;  2XWV A;  3VXB A;  2ONS A;  5EYF A;  3U94 A;  4F1U A;  3D4C A;  5H8N B;  3MP6 A;  4JWY A;  1B9J A;  3MBP A;  3FXQ A;  1FJ9 A;  3K1P A;  4POX A;  3B6W A;  4AB6 A;  4XEQ A;  2DSF A;  2F7C A;  1S50 A;  4HE1 A;  1B6H A;  3QUF A;  4KPT A;  1CE2 A;  3FVG A;  1IQ7 A;  2Q2A A;  5FHN A;  2FA7 A;  3I6V A;  2ESN A;  2ZXT A;  3T9H B;  3O9P A;  3TTR A;  1NV0 A;  4ESW A;  2XXT A;  1NL5 A;  1URD A;  4GRK A;  3LUZ A;  3C9H A;  3DP8 A;  2AYS A;  2F7B A;  3T22 A;  4BDM A;  1DTZ A;  3CSB A;  4X9T A;  4F18 A;  3KZG A;  4FED A;  3IOR A;  1YTV A;  5A5X B;  3ZS6 A;  3IOV A;  5LDZ A;  1B3G A;  1IMC A;  1PB9 A;  2QMW A;  3H6W A;  1LST A;  4N8Y A;  2XWK A;  4ELR A;  1XS5 A;  1SI0 A;  1QKA A;  3H6V A;  4LP2 B;  4MFI A;  1NV3 A;  4Q8R A;  3SEV A;  3P7I A;  3W9V A;  3S9M C;  4LUB A;  4DXB A;  3ODB A;  1FSA A;  2GFE A;  1NUX A;  4GWS A;  2FIX A;  2G93 A;  4MNC A;  3LSW A;  3FUZ A;  1D3K A;  2Z23 A;  4ZEI A;  1WDN A;  3FVO A;  3E3K A;  2OWT A;  1A7L A;  4OTE A;  3GBB A;  4P1E A;  3RNN A;  4PAK A;  5CMK A;  2O1L A;  5DEX A;  1P1W A;  3H4Z A;  4GWO A;  1UTB A;  3U93 A;  1MXW A;  4QHQ A;  4H45 A;  1EU8 A;  3Q28 A;  2DP8 A;  2ZNU A;  5BWJ A;  3RPW A;  1XT8 A;  4KYD A;  1XI6 A;  1DBZ A;  1AH5 A;  3O97 A;  1N7X A;  1JEU A;  5IZZ A;  1MXV A;  5B70 A;  1PBP A;  2I3V A;  4N8G A;  2QS3 A;  3EHS A;  4XKP A;  5JEI A;  1FBH A;  1N3X A;  1US5 A;  4H8I A;  4NF8 A;  1H43 A;  4U22 A;  4ONY A;  1B3H A;  3SES A;  1FTK A;  3SZP A;  2H99 A;  2XXX A;  3K6X A;  1NUW A;  4PAF A;  2Z22 A;  3C4M A;  1LBV A;  4NF0 A;  1LAG E;  4MX6 A;  1B3E A;  3VLU A;  1MPD A;  2O7I A;  4KYE A;  4Q0C A;  1NV4 A;  4DDD A;  5H8Q B;  1B7Z A;  3T9V A;  4YAH X;  3O29 A;  3OMB A;  1N0T A;  4OZ9 A;  4EXK A;  3PPN A;  1FCK A;  2Y7R A;  2I3W A;  4U1Z A;  4N91 A;  2ONR A;  1UTH B;  1FTJ A;  4U21 A;  1JW1 A;  2HZK A;  3MWB A;  4WEP A;  4EUO A;  2OZZ A;  3RY3 A;  1RDZ A;  2I0B A;  3K0V A;  3EQ1 A;  3H06 B;  4FAT A;  3U72 A;  5I59 B;  2A5T A;  3FVN A;  1FPJ A;  4G68 A;  3OXN A;  2WBB A;  4AQ4 A;  2XXU A;  4EQ7 A;  5I57 A;  3ISP A;  3IL1 B;  2H25 A;  3CG3 A;  4THI A;  3K1M A;  4F2Q A;  4I62 A;  3I5O A;  4JVC A;  1FPI A;  1JQF A;  1PBQ A;  4HTG A;  2FBP A;  5KDT B;  5DTB A;  1K9Z A;  3K6V A;  1US4 A;  5IZ1 A;  4OVS A;  4O3B A;  2HAU A;  3VV5 A;  4GXA A;  4NHB A;  1CNQ A;  4GWU A;  1I6A A;  4PE3 A;  4P0I A;  4JSO A;  4XIG Q;  1SVX B;  3F11 A;  1II5 A;  1B5J A;  4YB7 A;  5I2N B;  5I2K B;  4RY1 A;  3RGY A;  1NUY A;  1MXZ A;  3TQW A;  2LAO A;  2ZNS A;  3LBS A;  3CI8 A;  5B7D A;  3CVG A;  2CEY A;  4N6P A;  5AA4 B;  2O1M A;  1OVB A;  4GF8 A;  4I9D A;  4R2B A;  1DMB A;  2D3I A;  5J16 A;  3IB2 A;  3QK6 A;  4BDO A;  4G8N A;  4NQ8 A;  1AWB A;  1USY E;  3TQL A;  4YB6 A;  2XXK A;  5H8N A;  1JP4 A;  4DLD A;  3BFT A;  3FV2 A;  4RPO A;  2CZH A;  3KC0 A;  1VSO A;  3O6G A;  5CBS A;  4OA4 A;  2R9J A;  1YPN A;  3R6U A;  1Y3P A;  3C32 A;  3M3F A;  1VFE A;  4P9K A;  4O8M A;  3FAT A;  4OVR A;  4M1V A;  2QS1 A;  1P1U A;  3GXA A;  3OO8 A;  1DPP A;  1FQE A;  2HCA A;  4XF5 A;  1EYK A;  4R72 A;  3TKD A;  3T66 A;  3KC1 A;  4I40 A;  2Q88 A;  3USD A;  3RYD A;  5ET5 A;  1QUK A;  4IO5 A;  4YU0 A;  5IZ3 B;  3LSX A;  4N07 A;  4MLQ A;  2ZYM A;  3UP9 A;  1MQI A;  4GBW A;  3C31 A;  4F3S A;  4P47 A;  4DI3 D;  4GIZ A;  1SPI A;  2Y5L A;  4G68 C;  3N6U A;  3E13 X;  3GZG A;  3VLV A;  3KBR A;  4N6K A;  3LSL A;  2HAV A;  1URG A;  4ESX A;  3PGF A;  4IGR A;  1FPD A;  5TPA B;  3TTM A;  3LV0 A;  1M5F A;  3HFU A;  3EN3 A;  1O63 A;  4PTK A;  4JBZ A;  2L5V A;  1VFD A;  1Q1K A;  2REJ A;  3O2A A;  5JK4 A;  3U8Q A;  1F9B A;  3PD8 A;  3OO6 A;  4MNI A;  4NF4 A;  4MAG A;  4GX3 A;  2PX1 A;  1M5C A;  1ATG A;  1PEB A;  5I84 A;  3MAM A;  1ELJ A;  3JYR A;  3RUM A;  3I3V A;  3QXM A;  4Q30 B;  2F6P A;  5FTH A;  4MCO A;  2F5X A;  2XHD A;  2XWI A;  3FV1 A;  4OXV A;  1QW0 A;  2DE2 A;  3HHG A;  2VPO A;  3K2D A;  1IMD A;  1K9Y A;  4F3G A;  2B3F A;  3FXR A;  1B0H A;  2OCU A;  2FYI A;  2UVI A;  1B2H A;  1SQY A;  3H6T A;  4HCY A;  4RK9 A;  2V84 A;  2I0C A;  4MJO A;  3D1R A;  3W9W A;  2YLN A;  2UXA A;  4DI4 B;  1ZMG A;  3BIG A;  3KN7 A;  1LAX A;  5EQ8 A;  4YKK A;  2I58 A;  3SDF A;  1NH7 A;  2NXO A;  2FNC A;  2ABH A;  3UGW A;  3MJN A;  3TTL A;  4G4P A;  3TOD A;  3FXB A;  3FD3 A;  3VXC A;  4FOR A;  4PAI A;  4ZEC A;  3SEU A;  1WOD A;  1NV6 A;  4PF6 A;  4ZZE A;  5H8S A;  2DWJ A;  5ICT A;  2DXY A;  4GD5 A;  2P0S A;  3CIJ A;  2VP1 A;  1MH3 A;  4IO7 A;  4R6Y A;  1M5E A;  4NF5 B;  1IMB A;  3S9E A;  4NE4 A;  3TTN A;  4OWD A;  1XVY A;  4U2R A;  3RPL A;  4ZE9 A;  4EDP A;  5TU0 A;  2GH9 A;  5KDT A;  2R6G E;  2QJE A;  3ONM A;  4KR5 A;  2B3B A;  1LAF E;  2I4C A;  4GQO A;  4OHN A;  4PP0 A;  5I58 B;  4NF6 A;  3HN0 A;  2XD3 A;  1ZTY A;  5EYH A;  4JB7 A;  2Z8E A;  3NOH A;  1H45 A;  3LSF B;  2X26 A;  4F3P A;  1GGG A;  2V93 A;  1QUL A;  3C36 A;  5CRY A;  1A55 A;  3IFC A;  3RN8 A;  4M4G A;  4FE8 A;  4PQJ A;  4AS4 A;  1B7H A;  5IAI A;  3OEM A;  2XX7 A;  4OET A;  1IUD A;  3MPK A;  4LZ8 A;  4QSC A;  1T0K A;  1HSL A;  3RTW B;  2DQV A;  2HZL A;  3MVX A;  1LBB A;  3VVF A;  5EQ7 A;  5AA2 D;  1FQC A;  1UIU A;  3PPR A;  3FGS A;  1I6Q A;  2PBW A;  5KZT A;  1OVT A;  1GTK A;  2GRV A;  2V25 A;  5AE4 A;  4PBH A;  2ONK E;  4IB2 A;  3SEX A;  4XKN A;  4F1V A;  3MVY A;  4F3B A;  1RYO A;  3GBA A;  4YKP A;  4E0X A;  4N81 A;  3BBR A;  3E79 A;  2HFB A;  5TP9 B;  2I6E A;  4FIM A;  2XXW A;  3TCH A;  3E4R A;  1FBG A;  4ZEK A;  2OLB A;  3MYU A;  4X1B A;  3QIM A;  1IIT A;  3FZV A;  2Q8M A;  1FQD A;  4O3A A;  5I5P A;  1INP A;  3OSQ A;  4I8C A;  4LZ5 A;  4OFO A;  2Y7K A;  1A8E A;  2B4L A;  4XXU A;  2F97 A;  2PMS A;  2H9B A;  4MEV A;  3K01 A;  5H8H B;  1EH3 A;  4HW8 A;  5AA2 A;  1Y20 A;  2O84 X;  1XVX A;  1NV1 A;  2G29 A;  1RDX A;  2DVZ A;  4PFY A;  5HPQ A;  1ZU0 A;  1FBD A;  3TUS A;  2RIN A;  1HSJ A;  1MRP A;  1EYJ A;  2VGQ A;  3EHU A;  3Q29 A;  2CEX A;  3CSG A;  2QVV A;  2V3T A;  3A3C A;  3QYT A;  2E1S A;  4PFU A;  2F8D A;  4KCD A;  2A5S A;  1SW4 A;  4IY5 A;  4O3C A;  4PCD A;  2UVG A;  5JTY B;  1DK4 A;  1H76 A;  4LQ5 A;  2F3B A;  4GBV A;  5EHS A;  3TYH A;  1LFG A;  1KA0 A;  2VD3 A;  3QAX A;  4QF9 A;  2D21 A;  1SI1 A;  1FPF A;  1FPL A;  2B4M A;  3Q27 A;  5I56 A;  2BJI A;  1L5T A;  4X1D A;  3U92 A;  4I1D A;  2OWS A;  5DVF A;  5FHM A;  3TFL A;  4H6D A;  1ZIU A;  1IMF A;  4X8R A;  4KD5 A;  4C0R A;  3PPQ A;  1B46 A;  4MH5 A;  2H5Y A;  4QSE A;  4GOT A;  4F22 A;  4PDH A;  1O7T A;  1DPE A;  1RKM A;  4ECF A;  1TFA A;  3RTF B;  3MC2 A;  4JSD A;  2XX9 A;  1R1N A;  1N04 A;  2VPN A;  4GWX A;  4RK2 A;  4F31 B;  3R26 A;  3PUZ E;  1B3F A;  3IJX B;  4DZ1 A;  4ZS9 A;  2PYY A;  3S4U A;  5CMB A;  2AIX A;  4GXS B;  4IY6 A;  3TTK A;  2F7A A;  5ITP A;  2XXI A;  2UVH A;  1IXC A;  3G3I A;  1Y1Z A;  2QVU A;  5LTC A;  1FPB A;  2FHY A;  2OX3 A;  2WYP A;  2F78 A;  4OVT A;  3VLW A;  3CFX A;  1MM6 A;  3V8X B;  5KCJ B;  3IB1 A;  4FAJ A;  5J1D A;  1QKB A;  2CZI A;  4IO4 A;  2OK2 A;  4H5F A;  2DWH A;  3K00 A;  1MQG A;  4R9G A;  3LC8 A;  4N6D A;  3CFL A;  3KFM A;  3UK4 A;  4BLA A;  1Y1M A;  1OQG A;  1D4N A;  4LZ7 A;  5H8F A;  1B5I A;  4FBP A;  2DWI A;  4PFB A;  4ELQ A;  1IXG A;  2ZZW A;  1USY H;  1BLF A;  1B5H A;  4P11 A;  3EPE A;  1D9Q A;  3FBP A;  4G2Z A;  4N13 A;  1EZP A;  3VVD A;  2XXV A;  3OSR A;  1IIW A;  4O7M A;  3TCF A;  2REG A;  4NAP A;  1Z7N E;  3GLB A;  1B4H A;  2RCA A;  5CBR A;  2HXW A;  4OFJ A;  1XC1 A;  3VFJ A;  2VD2 A;  3DP4 A;  1MXX A;  4RPN A;  1NNP A;  1XHY A;  1LFH A;  1SYH A;  1GVC A;  1QVS A;  3T93 B;  3MVW A;  2H4I A;  5IGA A;  3MQ9 A;  1OLC A;  4QFP A;  3KJT A;  4OEU A;  5L8D A;  3L6G A;  1SD3 A;  4F39 A;  1MY2 A;  2P1S A;  4ELP A;  3MP1 A;  4GLI A;  5EYG A;  2QFL A;  1SW2 A;  1Y4T A;  3K02 A;  3TCG A;  3MVZ A; 
#chains in the Genus database with same CATH homology
 3PV0 E;  3TZA A;  3RLF E;  2CZL A;  1UQW A;  4HS7 A;  4TLM B;  4DE8 A;  3T9X B;  1PB7 A;  3CRB A;  3V5A A;  3G3F A;  3IB0 A;  1GV8 A;  4PFT A;  4C1T A;  2PT1 A;  2DXR A;  1IEJ A;  1VE4 A;  4ZDM A;  1JET A;  2DS9 A;  3IJO B;  3HCQ A;  1Z7M E;  5EHM A;  5DEX B;  2NUV A;  1BTJ A;  1UTB B;  5A5X A;  1B0L A;  2X7Q A;  1D9V A;  3K6W A;  1NKX A;  3A3U A;  1H3D A;  3MUQ A;  3V83 A;  3O6H A;  1M5B A;  2IEE A;  3MZB A;  3THI A;  1FTL A;  4Z7E A;  1OMP A;  1FQB A;  2UYE A;  1A99 A;  4OEV A;  1B05 A;  2DVC A;  2ZNT A;  4LQ2 A;  5DVJ A;  3VE1 B;  2RC8 A;  3BKI B;  4R73 A;  3S2V A;  3L6H A;  3O66 A;  3B6T A;  2O68 A;  5AA3 A;  4NF8 B;  3M3K A;  4U4X A;  1Q35 A;  1B58 A;  3S9L C;  2OJT A;  5H8H A;  5DYH A;  4ZZA A;  4Q5T A;  3PUY E;  1DOT A;  3HST A;  5L9O A;  2Y7P A;  1BIY A;  3N94 A;  3FVK A;  1TWY A;  4H1X A;  1D9Y A;  2F34 A;  4EF1 A;  3CR9 A;  2O6A A;  2I48 A;  1MPB A;  2ZYK A;  4L17 A;  3SEY A;  1JNF A;  3KG2 A;  4TQU Q;  1PB8 A;  4DCX A;  1Y9U A;  4G68 B;  3RQT A;  5FHO A;  2YJP A;  2QPQ A;  5M2V A;  3R7X A;  3MPL A;  2QS2 A;  4ZE8 A;  2UVJ A;  5I57 B;  3OD7 A;  4H67 A;  1FW0 A;  3IK6 B;  1IXH A;  1N7W A;  3N6T A;  3IOW A;  3KGC A;  4UAC A;  1JVX A;  1DSN A;  1XOC A;  4EF2 A;  4H0W A;  5H8Q A;  3FJM A;  1OLA A;  1B1X A;  4LON B;  2UYF A;  3JZJ A;  2DYX A;  2Y84 A;  1KWH A;  1UTH A;  3UIF A;  4U23 A;  3FJG A;  1URS A;  1M5D A;  2B65 A;  2DWA A;  5I59 A;  3TAJ A;  4WED A;  3CG1 A;  3T96 B;  1EZO A;  1MDP 1;  1JW5 A;  4OVJ A;  2P2A A;  1Y3N A;  3A09 A;  3IO6 A;  1TFD A;  2RKM A;  4YMB A;  1YCJ A;  2CMO A;  2IA4 A;  5ICQ A;  2QMX A;  1MY4 A;  3OO7 A;  3G3J A;  1DTG A;  3C34 A;  3IO4 A;  4G77 A;  1N84 A;  1MDQ A;  3G3H A;  2YPN A;  2D5W A;  2O69 A;  3T9U A;  4K3F A;  4Z0I A;  1AOV A;  3H03 A;  4POW A;  3D4G A;  2E0S A;  5K2X A;  4OES A;  4BDN A;  2NVU B;  3IX1 A;  2W7Y A;  5I2N A;  5I2K A;  4QFN A;  5DT6 A;  4RJZ A;  2XX8 A;  3VVE A;  4OER A;  3BFU A;  4R2F A;  3G3K A;  3KSX A;  1Y4C A;  3H7M A;  3QUJ A;  5AA4 A;  4EQ9 A;  4YZZ A;  1EZ9 A;  1NNF A;  4R75 A;  1I6B A;  5L9S A;  3G3G A;  1MG1 A;  3ZSF A;  5L9M A;  4U1O A;  3FIR A;  1N76 A;  2GHB A;  3DP6 A;  1AL3 A;  1IXI A;  3MZ1 A;  1LGB C;  4NTL A;  3PUX E;  1N3W A;  1PDA A;  2Z8F A;  1J1N A;  4LA9 A;  1JVY A;  4RXL A;  4DIG A;  3IR1 A;  3EHT A;  2XXP A;  3C33 A;  2XXQ A;  4LVQ A;  1PC3 A;  2XXH A;  1B3L A;  2O51 A;  4EQB A;  4KHZ E;  4H5G A;  5ISU A;  1SYI A;  4KCC A;  4QRZ A;  3ECR A;  4H65 A;  4ELO A;  5LOM A;  4RA1 A;  1SW1 A;  1GR2 A;  4AB5 A;  4OFL A;  1ZKB A;  4XKQ A;  4OEN A;  3S9N C;  3SER A;  4RNS A;  4R9F A;  2Q8J A;  1LBC A;  1LCT A;  2VOZ A;  3OOA A;  4PFW A;  1LB8 A;  1HSE A;  1S7Y A;  1MQJ A;  1A54 A;  4KQP A;  4ISU A;  4NF4 B;  1B51 A;  4YMA A;  4GFR A;  3SET A;  1CB6 A;  4PE5 B;  3WAF A;  2F36 A;  4BDL A;  4KI0 E;  1H44 A;  5CC2 A;  2QRY A;  3E9X A;  3MP8 A;  4QFK A;  4YKJ A;  1YAE A;  1SBP A;  1NNT A;  4R6K A;  2ALU A;  2OBG A;  2X7P A;  3PU5 A;  3M8U A;  2PVU A;  3FXU A;  1BKA A;  4FEC A;  1RYX A;  4PET A;  3V89 B;  5TPA A;  4KYS A;  2Y7I A;  3KOS A;  3K6U A;  4XKR A;  3TMG A;  1B40 A;  4ZEF A;  4ZEB A;  4LAT A;  4YB5 A;  1WVJ A;  2Y7W A;  2NOO A;  3TPA A;  2M8C A;  3VDF A;  5IKB A;  1ZJL A;  3K4U A;  1MXY A;  4GL0 A;  5BUU A;  3FAS A;  4DCY A;  3H6U A;  4F1Y A;  1JEV A;  1MXU A;  1NNK A;  4OMB A;  3TDJ A;  4G8H A;  4QFL A;  2Q89 A;  5CMC A;  5CI5 A;  5ELV A;  1O64 A;  1B1H A;  2Z8D A;  3HPI A;  4JWX A;  4NMY A;  3CFZ A;  1B4Z A;  3PPP A;  2HQ0 A;  4G8M A;  3ZKL A;  1QJM A;  1QUJ A;  2ZYN A;  1TXF A;  2KLF A;  1AMF A;  3PD9 A;  1IZ1 A;  4KFQ A;  5AA1 A;  1MS7 A;  4HCW A;  3KOT A;  3MW0 A;  4C1U A;  2ANJ A;  4IO3 A;  4NF6 B;  1B7U A;  1MQH A;  4NED A;  1B52 A;  1UIV A;  3HV1 A;  1QUI A;  4JDF A;  2BJJ X;  3O28 A;  1R9L A;  3N26 A;  3M3L A;  2VHA A;  4RYA A;  4DXC A;  4WKM A;  4ZED A;  1MPC A;  1SW5 A;  4F2O A;  1VR5 A;  4MBP A;  1NMU A;  4NWD A;  4NF5 A;  4JWO A;  2DOJ A;  4BDR A;  3PPO A;  1R6Z A;  3W15 C;  2R71 A;  3B6Q A;  2THI A;  3IOT A;  2V3Q A;  4F19 A;  1NFT A;  5I58 A;  4E0W A;  2ZYO A;  1FQA A;  4MLV A;  1AIV A;  4IO6 A;  1POT A;  1SDX A;  4WXJ A;  3IOU A;  5CMM A;  2RC9 A;  4F29 A;  3O6I A;  1BP5 A;  1P1O A;  4JXI A;  4OYV A;  2RF1 A;  5K2Y A;  1LFI A;  3OO9 A;  5HM4 B;  4GL8 A;  3PMV A;  1LB9 A;  3OEL A;  3AXF A;  3Q25 A;  4YKI A;  1ANF A;  3Q26 A;  1P99 A;  2RC7 A;  3PUV E;  1LLS A;  3TEL A;  5AA2 B;  3ILU B;  5F7V A;  1MY1 A;  4IGT A;  3B7D A;  3C35 A;  4X48 A;  4ND9 A;  4TLL B;  3DLN A;  1A8F A;  4QFO A;  4NWC A;  2XD2 A;  5TP9 A;  2NWJ A;  4FEB A;  2QL3 A;  1ZBM A;  1MY3 A;  2WKY A;  2ZMB A;  3G7W A;  3FJ7 A;  5I56 B;  1B32 A;  2AL5 A;  1MH4 A;  3IAZ A;  4R6H A;  3UN6 A;  1JW4 A;  1FQF A;  3SKP A;  3MZ9 A;  3ZKK A;  4DXU A;  3EF7 A;  2DE3 A;  4U4S A;  5DVI A;  3DEL B;  3KSJ A;  3HHF A;  3KJ7 A;  3LR1 A;  2GHA A;  1OIB A;  2H98 A;  2HEU A;  2QS4 A;  3OEK A;  4R74 A;  2QSX A;  4EXL A;  1MY0 A;  3DM0 A;  3UA8 A;  1P1Q A;  3ILT B;  3K1N A;  5JTY A;  4YIC A;  2AL4 A;  2I4B A;  2Q9T A;  3UOR A;  1LCF A;  4P0G A;  2A5T B;  3KN8 A;  3RT8 A;  4BDQ A;  3RT6 B;  1TT1 A;  3WAE A;  1OQH A;  4IO2 A;  4QSD A;  1P1N A;  2DE4 A;  3N5L A;  2I49 A;  3PUW E;  5CM6 A;  3PMX A;  4UA8 A;  3QSL A;  1FTM A;  1MQD A;  2F6G A;  1R9Q A;  5HBC A;  5FTI A;  1S9T A;  5F1Q A;  3OEN A;  3H3G A;  4FJP A;  2F35 A;  1I69 A;  5H8F B;  2XXY A;  1ZLQ A;  2Q2C A;  3KEI A;  4H8J A;  4TOZ A;  1LAH E;  4XTC Q;  5ITO A;  3TEP A;  3JV9 A;  4GVO A;  4OQO A;  1Y3Q A;  2V3U A;  3KN3 A;  2O7U A;  3HO7 A;  5KCJ A;  2RCB A;  1POY 1;  3PMW A;  3U1O A;  4MF3 A;  1FTO A;  2PT2 A;  3SEW A;  2XXR A;  3LUY A;  1A40 A;  1MM7 A;  1NH8 A;  3VXB A;  2ONS A;  5EYF A;  3U94 A;  4F1U A;  3D4C A;  5H8N B;  3MP6 A;  4JWY A;  1B9J A;  3MBP A;  3FXQ A;  3K1P A;  4POX A;  3B6W A;  4AB6 A;  2DSF A;  2F7C A;  1S50 A;  1B6H A;  3QUF A;  4KPT A;  1CE2 A;  3FVG A;  1IQ7 A;  2Q2A A;  5FHN A;  2FA7 A;  3I6V A;  2ESN A;  2ZXT A;  3T9H B;  3O9P A;  3TTR A;  4ESW A;  2XXT A;  1NL5 A;  1URD A;  4GRK A;  3C9H A;  3DP8 A;  2AYS A;  2F7B A;  3T22 A;  4BDM A;  1DTZ A;  3CSB A;  4X9T A;  4F18 A;  3KZG A;  4FED A;  3IOR A;  1YTV A;  5A5X B;  3ZS6 A;  3IOV A;  1B3G A;  1PB9 A;  2QMW A;  3H6W A;  1LST A;  4ELR A;  1XS5 A;  1SI0 A;  1QKA A;  3H6V A;  4LP2 B;  4MFI A;  4Q8R A;  3SEV A;  3P7I A;  3W9V A;  3S9M C;  4LUB A;  4DXB A;  3ODB A;  2GFE A;  2G93 A;  3LSW A;  3FUZ A;  1D3K A;  2Z23 A;  4ZEI A;  1WDN A;  3FVO A;  3E3K A;  2OWT A;  1A7L A;  4OTE A;  3GBB A;  3RNN A;  5CMK A;  2O1L A;  5DEX A;  1P1W A;  3H4Z A;  4GWO A;  1UTB A;  3U93 A;  1MXW A;  4QHQ A;  1EU8 A;  3Q28 A;  2DP8 A;  2ZNU A;  5BWJ A;  3RPW A;  1XT8 A;  4KYD A;  1AH5 A;  3O97 A;  1N7X A;  1JEU A;  1MXV A;  5B70 A;  1PBP A;  2I3V A;  2QS3 A;  3EHS A;  4XKP A;  5JEI A;  1N3X A;  1US5 A;  4H8I A;  4NF8 A;  1H43 A;  4U22 A;  4ONY A;  1B3H A;  3SES A;  1FTK A;  2H99 A;  2XXX A;  3K6X A;  2Z22 A;  3C4M A;  1LAG E;  1B3E A;  3VLU A;  1MPD A;  2O7I A;  4KYE A;  4Q0C A;  4DDD A;  5H8Q B;  1B7Z A;  3T9V A;  4YAH X;  3O29 A;  3OMB A;  1N0T A;  4OZ9 A;  4EXK A;  3PPN A;  1FCK A;  2Y7R A;  2I3W A;  4U1Z A;  2ONR A;  1UTH B;  1FTJ A;  4U21 A;  1JW1 A;  2HZK A;  3MWB A;  4WEP A;  4EUO A;  2OZZ A;  3RY3 A;  2I0B A;  3K0V A;  3EQ1 A;  3H06 B;  4FAT A;  3U72 A;  5I59 B;  2A5T A;  3FVN A;  4G68 A;  3OXN A;  4AQ4 A;  2XXU A;  4EQ7 A;  5I57 A;  3IL1 B;  2H25 A;  3CG3 A;  4THI A;  3K1M A;  4F2Q A;  4I62 A;  3I5O A;  1JQF A;  1PBQ A;  4HTG A;  5KDT B;  5DTB A;  3K6V A;  1US4 A;  4O3B A;  2HAU A;  3VV5 A;  4GXA A;  1I6A A;  4P0I A;  4JSO A;  4XIG Q;  1SVX B;  3F11 A;  1II5 A;  1B5J A;  4YB7 A;  5I2N B;  5I2K B;  4RY1 A;  3RGY A;  1MXZ A;  3TQW A;  2LAO A;  2ZNS A;  3LBS A;  3CI8 A;  5B7D A;  3CVG A;  4N6P A;  5AA4 B;  2O1M A;  1OVB A;  4GF8 A;  4I9D A;  4R2B A;  1DMB A;  2D3I A;  3IB2 A;  3QK6 A;  4BDO A;  4G8N A;  1USY E;  3TQL A;  4YB6 A;  5H8N A;  4DLD A;  3BFT A;  3FV2 A;  4RPO A;  1VSO A;  3O6G A;  5CBS A;  2R9J A;  1YPN A;  3R6U A;  1Y3P A;  3C32 A;  3M3F A;  1VFE A;  3FAT A;  4M1V A;  2QS1 A;  1P1U A;  3GXA A;  3OO8 A;  1DPP A;  1FQE A;  2HCA A;  4R72 A;  3TKD A;  3T66 A;  2Q88 A;  3USD A;  1QUK A;  4IO5 A;  4YU0 A;  3LSX A;  4N07 A;  4MLQ A;  2ZYM A;  3UP9 A;  1MQI A;  3C31 A;  4F3S A;  4GIZ A;  4G68 C;  3N6U A;  3E13 X;  3GZG A;  3VLV A;  3KBR A;  3LSL A;  2HAV A;  1URG A;  4ESX A;  3PGF A;  4IGR A;  5TPA B;  3TTM A;  1M5F A;  3EN3 A;  1O63 A;  4JBZ A;  1VFD A;  1Q1K A;  2REJ A;  3O2A A;  5JK4 A;  3U8Q A;  1F9B A;  3PD8 A;  3OO6 A;  4NF4 A;  2PX1 A;  1M5C A;  1ATG A;  1PEB A;  5I84 A;  3MAM A;  1ELJ A;  3JYR A;  3RUM A;  3I3V A;  3QXM A;  4Q30 B;  2F6P A;  5FTH A;  2F5X A;  2XHD A;  3FV1 A;  4OXV A;  1QW0 A;  2DE2 A;  3HHG A;  3K2D A;  4F3G A;  2B3F A;  3FXR A;  1B0H A;  2OCU A;  2FYI A;  2UVI A;  1B2H A;  1SQY A;  3H6T A;  4HCY A;  4RK9 A;  2V84 A;  2I0C A;  3W9W A;  2YLN A;  2UXA A;  1ZMG A;  3KN7 A;  1LAX A;  4YKK A;  2I58 A;  3SDF A;  1NH7 A;  2NXO A;  2FNC A;  2ABH A;  3UGW A;  3MJN A;  3TTL A;  4G4P A;  3TOD A;  3FD3 A;  3VXC A;  4FOR A;  4ZEC A;  3SEU A;  1WOD A;  4ZZE A;  5H8S A;  2DWJ A;  5ICT A;  2DXY A;  4GD5 A;  2P0S A;  3CIJ A;  2VP1 A;  1MH3 A;  4IO7 A;  4R6Y A;  1M5E A;  4NF5 B;  3S9E A;  4NE4 A;  3TTN A;  4OWD A;  1XVY A;  4U2R A;  4ZE9 A;  4EDP A;  5TU0 A;  2GH9 A;  5KDT A;  2R6G E;  2QJE A;  3ONM A;  4KR5 A;  2B3B A;  1LAF E;  2I4C A;  4GQO A;  4OHN A;  4PP0 A;  5I58 B;  4NF6 A;  3HN0 A;  2XD3 A;  1ZTY A;  4JB7 A;  2Z8E A;  1H45 A;  3LSF B;  2X26 A;  4F3P A;  1GGG A;  2V93 A;  1QUL A;  3C36 A;  5CRY A;  1A55 A;  3RN8 A;  4M4G A;  4FE8 A;  4PQJ A;  1B7H A;  5IAI A;  3OEM A;  2XX7 A;  4OET A;  1IUD A;  3MPK A;  4LZ8 A;  4QSC A;  1T0K A;  1HSL A;  3RTW B;  2DQV A;  2HZL A;  3MVX A;  1LBB A;  3VVF A;  5AA2 D;  1FQC A;  1UIU A;  3PPR A;  3FGS A;  1I6Q A;  2PBW A;  5KZT A;  1OVT A;  1GTK A;  2GRV A;  2V25 A;  5AE4 A;  2ONK E;  4IB2 A;  3SEX A;  4XKN A;  4F1V A;  3MVY A;  4F3B A;  1RYO A;  3GBA A;  4YKP A;  4E0X A;  3BBR A;  2HFB A;  5TP9 B;  2I6E A;  4FIM A;  2XXW A;  3TCH A;  3E4R A;  4ZEK A;  2OLB A;  4X1B A;  3QIM A;  1IIT A;  3FZV A;  1FQD A;  4O3A A;  3OSQ A;  4I8C A;  4LZ5 A;  4OFO A;  2Y7K A;  1A8E A;  4XXU A;  2F97 A;  2PMS A;  2H9B A;  3K01 A;  5H8H B;  1EH3 A;  4HW8 A;  5AA2 A;  1Y20 A;  2O84 X;  1XVX A;  2G29 A;  4PFY A;  2DVZ A;  5HPQ A;  1ZU0 A;  3TUS A;  2RIN A;  1HSJ A;  1MRP A;  2VGQ A;  3EHU A;  3Q29 A;  3CSG A;  2V3T A;  3A3C A;  3QYT A;  2E1S A;  4PFU A;  2F8D A;  4KCD A;  2A5S A;  1SW4 A;  4IY5 A;  4O3C A;  5JTY B;  2UVG A;  1H76 A;  4LQ5 A;  5EHS A;  3TYH A;  1LFG A;  2VD3 A;  3QAX A;  4QF9 A;  2D21 A;  1SI1 A;  3Q27 A;  5I56 A;  1L5T A;  4X1D A;  3U92 A;  4I1D A;  2OWS A;  5DVF A;  5FHM A;  3TFL A;  4H6D A;  1ZIU A;  4KD5 A;  4C0R A;  3PPQ A;  1B46 A;  4MH5 A;  2H5Y A;  4QSE A;  4GOT A;  4F22 A;  1O7T A;  1DPE A;  1RKM A;  4ECF A;  1TFA A;  3RTF B;  3MC2 A;  4JSD A;  2XX9 A;  1R1N A;  1N04 A;  4RK2 A;  4F31 B;  3R26 A;  3PUZ E;  1B3F A;  3IJX B;  4DZ1 A;  4ZS9 A;  2PYY A;  3S4U A;  5CMB A;  2AIX A;  4GXS B;  4IY6 A;  3TTK A;  2F7A A;  5ITP A;  2XXI A;  2UVH A;  1IXC A;  3G3I A;  1Y1Z A;  2F78 A;  3VLW A;  3CFX A;  1MM6 A;  3V8X B;  5KCJ B;  3IB1 A;  4FAJ A;  5J1D A;  1QKB A;  4IO4 A;  2OK2 A;  4H5F A;  2DWH A;  3K00 A;  1MQG A;  4R9G A;  3LC8 A;  3CFL A;  3KFM A;  3UK4 A;  4BLA A;  1Y1M A;  1OQG A;  1D4N A;  4LZ7 A;  5H8F A;  1B5I A;  2DWI A;  4ELQ A;  1IXG A;  1USY H;  1BLF A;  1B5H A;  4P11 A;  3EPE A;  4G2Z A;  4N13 A;  1EZP A;  3VVD A;  2XXV A;  3OSR A;  1IIW A;  3TCF A;  2REG A;  1Z7N E;  3GLB A;  1B4H A;  2RCA A;  5CBR A;  2HXW A;  4OFJ A;  1XC1 A;  3VFJ A;  2VD2 A;  3DP4 A;  1MXX A;  4RPN A;  1NNP A;  1XHY A;  1LFH A;  1SYH A;  1GVC A;  1QVS A;  3T93 B;  3MVW A;  2H4I A;  3MQ9 A;  1OLC A;  4QFP A;  3KJT A;  4OEU A;  5L8D A;  3L6G A;  1SD3 A;  4F39 A;  1MY2 A;  2P1S A;  4ELP A;  3MP1 A;  4GLI A;  1SW2 A;  1Y4T A;  3K02 A;  3TCG A;  3MVZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...