4ND9A

The putative substrate binding domain of abc-type transporter from agrobacterium tumefaciens in open conformation
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
280
structure length
280
Chain Sequence
AQVVVSSKIDTEGGVLGNIILAVLNQNKIETTDRIQLGATPVVRKAITAGEIDIYPEYTGNAAFFFSKADDPLWKDAAKGYEEAKTLDYDANKIVWLAPSPANNTWAIALRKDVADKNNLKTLSDFGKYVAGGGTVVLAASSEFVNSAAALPAFQTTYGFTMKPDQLITLSGGDTAATIAAAANQTNNANAAMVYGTDGGIAPSGLVVLEDDKHVQPVYQPAPIIREEVLKKHPNIEELLKPVFEKLDLATLQDLNARVQVGGEQAKTVAMDFLTKNGFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The putative substrate binding domain of ABC-type transporter from Agrobacterium tumefaciens in open conformation
rcsb
source organism Agrobacterium fabrum
molecule tags Transport protein
molecule keywords ABC transporter, substrate binding protein (Proline/glycine/
total genus 96
structure length 280
sequence length 280
ec nomenclature
pdb deposition date 2013-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04069 OpuAC Substrate binding domain of ABC-type glycine betaine transport system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4nd9A01
3.40.190.120 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Osmoprotection protein (prox); domain 2 4nd9A02
2QRYA 1B0HA 4I1DA 4JXIA 4YB5A 4G77A 3VE1B 4EF1A 5EHMA 1UTHB 4H65A 3UA8A 3K1PA 1SBPA 2DXRA 3CI8A 3MW0A 4O3BA 3N94A 1MQDA 3H3GA 1B6HA 4H8JA 4R9FA 2OBGA 1M5CA 1MY0A 2DVZA 1Z7NE 2FNCA 3I5OA 3KG2A 1A55A 3ZKKA 4DCYA 5H8QA 3IX1A 4RK9A 4YAHX 3V8XB 2I0BA 4NEDA 1OMPA 5I56B 5DEXB 2XXIA 3AXFA 2NVUB 3RTFB 3USDA 1S50A 5CC2A 3G3HA 4P11A 5H8FA 4ZEDA 2XXXA 2Q88A 3KJ7A 3VVDA 4KFQA 4DIGA 1JW4A 3LSFB 2H98A 2QS4A 1CB6A 2UVGA 4Z0IA 3MZBA 1R6ZA 4I8CA 2DYXA 3LSWA 2PT2A 2ESNA 4HTGA 3OO9A 3R7XA 1RYXA 2IA4A 1P99A 2I48A 2RC8A 3KN8A 1NNPA 4G8NA 4JBZA 4JWOA 2GHAA 3QUJA 1B0LA 1RKMA 3HSTA 1ZBMA 3R6UA 4PE5B 5DEXA 4F1VA 3M3KA 3EF7A 5AA4A 4H6DA 1N76A 2OCUA 3I3VA 3CFXA 5I58A 1B5HA 2NWJA 3FJMA 2I4CA 3RPWA 3O6GA 4IB2A 1XC1A 1IQ7A 3GZGA 4X1BA 3W9WA 4DDDA 1EU8A 5AA2D 5A5XA 1L5TA 1JVYA 1B2HA 2V84A 3C34A 1MM6A 3G3IA 4H8IA 1GGGA 1Y1MA 2H5YA 3HN0A 2OWSA 3OD7A 4IO6A 3ZSFA 3DP4A 3MAMA 4FJPA 4RPOA 4OQOA 3BKIB 4I62A 4MLQA 4R2FA 1MPCA 3EHSA 1XVYA 4ZECA 4F3GA 4RYAA 4LUBA 5BWJA 3E3KA 5F1QA 4C0RA 4NMYA 3U72A 2I49A 1HSEA 2RCAA 4ZZAA 1MXVA 1UTBB 1DMBA 1MXZA 4GXAA 4KPTA 4KYEA 4XKQA 3TFLA 1VFEA 4GFRA 4TQUQ 3A3CA 3CG1A 4RY1A 3CIJA 2Z22A 2F7AA 2ZNSA 3ONMA 1N3WA 4MF3A 4RJZA 3QYTA 3MVXA 3OXNA 3DP8A 3E13X 3PU5A 1DOTA 1MY3A 3D4GA 3O97A 4L17A 1B46A 4FIMA 3TCGA 1WODA 2DWJA 3S9MC 4JDFA 2F5XA 1TFAA 4NWCA 2Y7WA 1R9LA 3KOTA 1O64A 2F34A 1MQHA 2GH9A 4Q0CA 1LSTA 3M3LA 1MY4A 1NNFA 5FHOA 3UP9A 3VVEA 2G93A 3KSXA 2VD3A 3PMVA 5I2KB 1P1WA 3T66A 4ZE8A 4KR5A 1AOVA 1UTBA 3HCQA 2F7BA 4DXBA 2F6PA 4H67A 5I57A 5J1DA 3A09A 1OLCA 3IB0A 3TODA 3MVWA 1B52A 2Q2CA 3VDFA 2ABHA 4EXLA 4QSEA 4ESWA 2THIA 3MVYA 4EDPA 3QUFA 4OMBA 1FTJA 4R6KA 2DWHA 3T9XB 4OEVA 1CE2A 2DWAA 3TYHA 2XXQA 3G7WA 3EN3A 3PD9A 1B4ZA 1IXCA 1Q1KA 3CSGA 1F9BA 2ZXTA 3QSLA 5EYFA 3TCFA 4E0WA 2GFEA 2QMWA 1OIBA 5KCJB 3SESA 3IK6B 4ND9A 2Q9TA 4YKJA 4ZEIA 5KDTA 4PETA 5FHMA 2DS9A 1FTOA 1XHYA 2D21A 2V3UA 4N6PA 1I6AA 2Y7PA 4PFYA 3DELB 1SD3A 2D5WA 1LB8A 4F29A 3OMBA 3H6VA 4OWDA 1ZKBA 4OESA 4IGRA 4F2QA 2DE3A 1M5EA 1N84A 3KSJA 3PUXE 4NF8A 1IXGA 3EHUA 2X7QA 3PUVE 1IXIA 1MDQA 3CG3A 1O63A 3N6TA 3OO8A 1MM7A 4XKNA 4YZZA 4QSDA 2ZYNA 3MBPA 2H25A 1JEUA 1AMFA 3PD8A 4G68A 3PPOA 1Y3NA 1S7YA 2RKMA 1D4NA 4M1VA 2B3FA 4PP0A 4C1TA 3HHFA 3GBAA 3IOUA 2XX7A 4DXCA 5H8NB 3KEIA 1JQFA 1MH3A 3FATA 4U22A 1KWHA 4YU0A 1A8FA 4LONB 4QFLA 1BLFA 1ZLQA 4AB6A 3K0VA 4IO7A 3K02A 3H4ZA 2Q2AA 3C33A 4U1OA 3SEWA 5JK4A 3ILUB 3O28A 1OVBA 3T9UA 3TDJA 2Y84A 1MQIA 2E1SA 4KCDA 5IAIA 2HFBA 2QPQA 1B7ZA 3Q27A 2DE2A 3FV2A 2F97A 4OZ9A 3IO4A 4ZEBA 2HAVA 4G68B 1UIUA 4KQPA 3SKPA 1WDNA 1URDA 2O6AA 1FQDA 2OJTA 3S2VA 3I6VA 1N3XA 1NNKA 4K3FA 4R6HA 3O9PA 5K2YA 3KN7A 3B6WA 1NKXA 5H8FB 4QHQA 4EQ7A 4FORA 5DT6A 4F3PA 5HM4B 4TOZA 1QUKA 2ZNUA 4WKMA 3FVKA 2B65A 5KDTB 3RQTA 4OFJA 3TTNA 1N7WA 3VLWA 2G29A 2I58A 3K1MA 3CR9A 2I6EA 2VHAA 3MQ9A 4R75A 3EHTA 4XKRA 1ELJA 1GV8A 1I69A 2QS3A 1LFIA 4POXA 2QS2A 3IOTA 2RC9A 1B7UA 4YMAA 2O1MA 3LC8A 1A99A 4GXSB 1EH3A 3T9HB 3V83A 3O66A 3Q28A 3RLFE 1II5A 4GD5A 1MY2A 5KZTA 4YB7A 4OEUA 3U1OA 2XHDA 5TP9A 3W9VA 1MXWA 2O1LA 3RT8A 3TTLA 5A5XB 2CZLA 2DWIA 1B1HA 4ECFA 3E9XA 2R71A 1FQEA 3DM0A 1MQGA 1B1XA 1MPDA 4H0WA 2PMSA 1XT8A 5CMMA 4O3CA 4H1XA 1NH7A 4IO4A 1US4A 2RF1A 4YICA 1LFHA 3TUSA 3IO6A 4OTEA 1QVSA 1UQWA 4EUOA 3VLVA 2REGA 4NF5A 1TFDA 4QFKA 2PYYA 4E0XA 1ANFA 5AA2B 1M5DA 3IB2A 2V25A 1SQYA 1FCKA 3FGSA 2GRVA 3DLNA 2NOOA 3B6TA 3FD3A 3L6GA 1YCJA 4GL8A 3U8QA 1OQGA 4QF9A 2DQVA 2UXAA 4UA8A 4NWDA 2X26A 1USYH 3QAXA 4G8MA 5TPAB 4Q5TA 1B05A 4LQ5A 3K6VA 2HZLA 1UTHA 2A5SA 4EQBA 2NUVA 2AL4A 3FUZA 3W15C 2M8CA 4EF2A 5CBSA 5AA2A 3IAZA 5I58B 3HPIA 1SW2A 1MPBA 3TTKA 4G68C 3VV5A 5CBRA 3OEKA 5DVIA 3B6QA 1SI1A 3KGCA 4RA1A 3ZS6A 1GVCA 1IXHA 3M8UA 3SERA 4OERA 3WAFA 2Z8DA 1IIWA 1N7XA 2Z8FA 3K6WA 5H8NA 4AB5A 4WEPA 2D3IA 1MXXA 4Q8RA 3OEMA 1IUDA 2HXWA 3FZVA 2A5TA 5AE4A 4KHZE 1Y1ZA 3TTMA 1B3GA 1ZTYA 2XXTA 3TZAA 3QK6A 2P0SA 5I59B 3H6WA 4LATA 4OYVA 1ATGA 4LA9A 2XXYA 1VE4A 3CSBA 3IL1B 3MPLA 4G4PA 4ZEFA 4IY6A 3B7DA 1MRPA 3U94A 5CMKA 1BIYA 4YMBA 3KN3A 1LCFA 3KFMA 4IY5A 1POY1 1SDXA 4N07A 3ZKLA 4F39A 4C1UA 4PQJA 1FTKA 1H76A 1FTLA 4IO2A 1B3EA 1A40A 1DPPA 4KD5A 3TQLA 2Q8JA 4NF4B 4FEDA 2F8DA 4ELPA 2V3QA 4RK2A 2UVIA 5B70A 4YKPA 3OOAA 2Z23A 1PBPA 4ELQA 3MWBA 1Y3QA 5I59A 5ICQA 2PBWA 3KJTA 2R9JA 1FW0A 2DP8A 4GRKA 4OENA 5KCJA 2VD2A 1IZ1A 2QMXA 4F3SA 5FTHA 4UACA 3H03A 1YTVA 3K4UA 4M4GA 5IKBA 2ONSA 3K01A 3MPKA 3O2AA 5L9OA 1USYE 1UIVA 3MP8A 5H8HA 1B9JA 3MP6A 1ZIUA 2XXHA 3PPNA 3SEYA 4YB6A 3PPQA 1JW1A 1YAEA 3R26A 4G8HA 4F18A 2Q89A 5HBCA 4DXUA 2OZZA 1EZ9A 4LVQA 2DSFA 1OLAA 2I4BA 2ZYMA 3UORA 2XXVA 2HAUA 4F2OA 4KCCA 3FXRA 4HCYA 5ITPA 4FE8A 2ZYKA 3K6XA 4ISUA 4G2ZA 4XIGQ 3S9EA 4GL0A 5EHSA 1XS5A 2O68A 1AIVA 4GLIA 3ODBA 4P0IA 2QS1A 3E4RA 2HCAA 3ECRA 5AA1A 2XD2A 4JWXA 1LFGA 4R9GA 2PVUA 2FA7A 4GQOA 4R74A 4KI0E 2DVCA 3HHGA 3JZJA 4FECA 2X7PA 3PPPA 4U1ZA 1M5BA 3FIRA 3H6TA 3IR1A 4LZ8A 1MXYA 3FJGA 4QFNA 5FTIA 1NNTA 2O84X 4BDQA 5I2KA 5L8DA 4XXUA 4Q30B 4JWYA 3U92A 3VFJA 3K6UA 3SEUA 2Y7KA 1P1NA 3G3GA 5TU0A 5I84A 4BDRA 1A8EA 5I56A 3PGFA 3M3FA 5ICTA 3TCHA 2PT1A 1GR2A 4WXJA 3KBRA 4ESXA 5CM6A 1S9TA 2XXPA 1LAGE 2DXYA 4LQ2A 1TT1A 5BUUA 1B3FA 2NXOA 4KYSA 3RT6B 5LOMA 1POTA 2ONRA 1LGBC 1PB9A 4P0GA 5TP9B 1LAXA 2B3BA 3OO6A 3PV0E 2Y7RA 3MZ9A 4TLMB 4R6YA 3VVFA 2F6GA 1A7LA 1R1NA 2H99A 2O7UA 1SI0A 1D9YA 1QUIA 2O51A 3U93A 3PPRA 1XVXA 2RC7A 3O6HA 4U21A 3SETA 3A3UA 3DP6A 1B4HA 1LBBA 3T93B 4OVJA 2XXUA 3MUQA 3TTRA 1PB7A 1I6QA 1BTJA 2FYIA 4OETA 2P1SA 5HPQA 3L6HA 3OENA 3FXQA 3TELA 1J1NA 1BP5A 1GTKA 1P1OA 1HSLA 4OXVA 5K2XA 4BLAA 4ZE9A 4BDLA 5ISUA 1BKAA 2WKYA 3MVZA 4ZS9A 2OLBA 3GLBA 5TPAA 1EZOA 3PUWE 4GVOA 3UK4A 1FQFA 1QUJA 1LAFE 3FVNA 4U2RA 1PBQA 3C9HA 1P1UA 4LZ7A 2XXRA 4ZZEA 3JV9A 3VXBA 1LLSA 3K2DA 2H9BA 2UYFA 1A54A 1RYOA 5CMCA 1JEVA 1B7HA 4EXKA 1N04A 1URGA 5ITOA 2I3VA 4MFIA 3P7IA 2O7IA 2HZKA 4EQ9A 5FHNA 3PMWA 3OELA 3C35A 3IORA 3OSRA 4U23A 3RNNA 4N13A 1ZMGA 3OO7A 3UIFA 2REJA 3SEVA 3THIA 5DVFA 4O3AA 1VFDA 1FQBA 1DTGA 3Q25A 2V93A 4X1DA 3LSLA 4JSDA 5L9SA 1M5FA 1LAHE 5AA4B 1YPNA 2KLFA 3FASA 3Q26A 4IO5A 4NTLA 2CMOA 2AIXA 2R6GE 2VP1A 1SW1A 1XOCA 1B32A 2YJPA 4GF8A 1FQAA 3CRBA 4QSCA 4RPNA 1P1QA 4Z7EA 3CVGA 3HO7A 3QIMA 1B3LA 3RGYA 3K00A 1B58A 4F22A 1H45A 4F1UA 2ALUA 2V3TA 1PB8A 5CI5A 4ZEKA 2XX9A 4FATA 1IITA 4F3BA 2VGQA 5H8QB 4X48A 1LCTA 1SVXB 4OFOA 4THIA 4AQ4A 4BDNA 1Z7ME 3O29A 3PUZE 1MG1A 1JNFA 1JVXA 1MH4A 1Y4CA 3PMXA 4NF4A 3TQWA 3TEPA 3FV1A 3LSXA 4YKKA 2AYSA 3MZ1A 3PUYE 1PC3A 1B51A 3LBSA 3IB1A 1B3HA 1ZJLA 5I2NB 4PFWA 1PDAA 5JTYA 2Y7IA 4OHNA 1MS7A 2F78A 2VOZA 5CMBA 4QFPA 1NL5A 4JB7A 4KYDA 3JYRA 3H7MA 1DTZA 2YLNA 4DCXA 1HSJA 2UYEA 5H8SA 4X9TA 1NFTA 2ONKE 1URSA 2RCBA 1NH8A 1WVJA 2OWTA 3C4MA 1JW5A 3FVOA 3S9NC 1QKAA 3K1NA 5H8HB 2I3WA 4I9DA 3WAEA 4F1YA 4XTCQ 4MH5A 3T96B 4NF6A 1QKBA 5F7VA 1H43A 1I6BA 4POWA 1QJMA 3KOSA 3D4CA 3MC2A 3N6UA 1H44A 1TWYA 2ZYOA 2I0CA 4GIZA 1AL3A 2UVHA 1VSOA 3N5LA 1D3KA 3Q29A 1US5A 1MDP1 1SW5A 3C36A 3H6UA 4BDOA 2QL3A 4DZ1A 3O6IA 4FEBA 5M2VA 3RN8A 4R73A 3C32A 1B5IA 3IJOB 5CRYA 3SEXA 3VXCA 3TAJA 1VR5A 2HQ0A 3LUYA 3UGWA 4LZ5A 2XD3A 3BFTA 4HS7A 4JSOA 1O7TA 1Y4TA 1N0TA 1Y9UA 2ZMBA 3G3FA 2O69A 4PFUA 1Y20A 1Y3PA 1PEBA 1D9VA 2DOJA 3CFLA 3F11A 4NF8B 2BJJX 4WEDA 3RY3A 4ONYA 4H5GA 4QRZA 1TXFA 4R2BA 2A5TB 3S9LC 3FVGA 1ZU0A 3OSQA 4FAJA 3IOVA 3G3KA 3V5AA 5I57B 5ELVA 4RNSA 3G3JA 1B40A 3BFUA 3UN6A 5JEIA 5DYHA 4HCWA 4H5FA 5L9MA 3RUMA 1Q35A 1MXUA 1MY1A 3GBBA 2QSXA 1MQJA 2F35A 4DLDA 2Z8EA 3ILTB 3S4UA 1FTMA 4YKIA 4ZDMA 2XX8A 3KZGA 4ELRA 4R72A 3FJ7A 1R9QA 4DE8A 1B5JA 3QXMA 4GWOA 3VLUA 1IEJA 1NMUA 3SDFA 4NF6B 5DTBA 2GHBA 1EZPA 2XXWA 4F19A 3H06B 3T9VA 4OFLA 3MP1A 2QJEA 4TLLB 1JETA 2W7YA 2ZNTA 2HEUA 1T0KA 4XKPA 1DSNA 4BDMA 2YPNA 3IJXB 2OK2A 4IGTA 2LAOA 3LR1A 3EQ1A 2H4IA 3EPEA 3TMGA 3TPAA 3V89B 2PX1A 1AH5A 3IOWA 4U4XA 4ELOA 1LB9A 1QULA 3GXAA 3CFZA 2DE4A 2E0SA 4F31B 3BBRA 4MBPA 5DVJA 1H3DA 1SYHA 2RINA 2UVJA 4NF5B 3MJNA 2AL5A 5AA3A 1OVTA 4QFOA 4PFTA 1FQCA 1OQHA 5I2NA 1QW0A 4GOTA 4LP2B 3TKDA 4RXLA 2F7CA 1SW4A 3HV1A 5JTYB 4NE4A 3RTWB 1LBCA 2IEEA 3N26A 4HW8A 1DPEA 3C31A 5B7DA 2P2AA 2ANJA 4IO3A 2F36A 3FXUA 1SYIA 4MLVA 4U4SA 3T22A
chains in the Genus database with same CATH superfamily
1B0HA 4YB5A 4G77A 4H65A 4O3BA 3H3GA 1B6HA 1MY0A 2DVZA 1Z7NE 1NI9A 3ZKKA 4PBQA 5H8QA 4YAHX 1NUZA 3USDA 4P11A 2Q88A 3KJ7A 2ZZVA 4KFQA 4DIGA 4MMPA 4Z0IA 1R6ZA 3LSWA 3VFJA 4RPOA 3KN8A 1RKMA 1K9ZA 4NN3A 1ZBMA 3R6UA 3M3KA 1N76A 3FJMA 2I4CA 1XC1A 3GZGA 2OX3A 5AA2D 1FBGA 3HN0A 2OWSA 4MLQA 4MAGA 1XVYA 1VDWA 1FBHA 3E3KA 4C0RA 4NMYA 2I49A 4ZZAA 4GXAA 1VFEA 4TQUQ 3A3CA 3CIJA 4OVRA 3DP8A 4L17A 1MY3A 3D4GA 1FBFA 4FIMA 2DWJA 2F5XA 1O64A 2F34A 2GH9A 4Q0CA 1LSTA 4O94A 4EXLA 2G93A 3KSXA 4KR5A 2F7BA 2F6PA 3PTYA 4EDPA 3QUFA 4OEVA 3TYHA 1G0IA 3EN3A 1FJ6A 1Q1KA 5DW8A 3SESA 5FHMA 4H46A 2D21A 2V3UA 3DELB 3PUVE 3ROJA 3OO8A 3PD8A 3D1RA 5I7IA 4EF1A 5I3SA 4M1VA 4DXCA 3HHFA 4NGUA 3KEIA 2WX9A 3FATA 1KWHA 4YU0A 4QFLA 4AB6A 1IMBA 1MQIA 4KCDA 5IAIA 3Q27A 3FV2A 4OZ9A 4ZEBA 1UIUA 1WDNA 1FQDA 2OJTA 1FRPA 5H8FB 1FPJA 4QHQA 5HM4B 1FPIA 4XF5A 2B65A 4N6DA 4OFJA 1N7WA 3K1MA 3CR9A 1IMCA 4OVQA 1ELJA 1I69A 2QS3A 3IOTA 4GXSB 1A99A 5KZTA 3W9VA 2L5VA 4N8YA 3E9XA 3DM0A 1MQGA 1B1XA 5CMMA 4O3CA 4IO4A 2RF1A 4YICA 1LFHA 3TUSA 3IO6A 4OVPA 2F3BA 3DLNA 2NOOA 3L6GA 1YCJA 4UA8A 5TPAB 4Q5TA 2MKZA 4LQ5A 3K6VA 2A5SA 3FUZA 5AA2A 5CBRA 3OEKA 5DVIA 3KGCA 4RA1A 3U65A 5EQAA 3WAFA 2HXWA 2A5TA 4KHZE 3TTMA 1IMAA 4PC9A 3QK6A 4N15A 3E79A 4G4PA 1VE4A 3IL1B 5CMKA 1BIYA 1POY1 3ZKLA 4F39A 4C1UA 1B3EA 2F8DA 4ELPA 4YKPA 1PBPA 4ELQA 3MWBA 5ICQA 4GRKA 3B50A 3H03A 3K01A 3O2AA 1USYE 3MP8A 5H8HA 3MP6A 1JW1A 1DBZA 1NV7A 1EZ9A 4LVQA 2O68A 1KA0A 3ODBA 2BJIA 2XD2A 4R74A 4KI0E 4U1ZA 3JZJA 2X7PA 3H6TA 3T0JA 4QXDA 4BDQA 1FBEA 2Y7KA 3GYYA 3G3GA 5I56A 3TCHA 4WXJA 1GR2A 5T3JA 1LAGE 2DXYA 1NUXA 3RT6B 2NXOA 5LOMA 1PB9A 1LAXA 3PV0E 3KBZA 3VVFA 4P1LA 2XWOA 1SI0A 1BK4A 1D9YA 1QUIA 2O51A 4NQ8A 3U93A 3PPRA 4U21A 4O7IA 1PB7A 1BTJA 1LBZA 4ZE9A 1NUWA 2OLBA 1FQFA 3T96B 2XXRA 1RYOA 1N04A 2I3VA 3C35A 3IORA 3RNNA 4N13A 3OO7A 2FVZA 2CEYA 1XI6A 2V93A 5AA4B 2KLFA 2R6GE 4U4XA 1B32A 3CRBA 1P1QA 3QIMA 3RGYA 4GWUA 4F1UA 2XX9A 4F3BA 1LCTA 4BDNA 5EQ9A 4NF4A 3PMXA 3TQWA 2HHMA 1B51A 1DK4A 4JB7A 4KYDA 3JYRA 2UYEA 4X9TA 3NOHA 3FVOA 4MIJA 1QKAA 3ISPA 3MC2A 1H44A 4O8MA 3N5LA 5ESYA 4PTKA 3H6UA 2QL3A 4FEBA 3RN8A 4R73A 1B5IA 3IJOB 5CRYA 3TAJA 4LZ5A 4HS7A 4JSOA 1N0TA 2JJKA 1D9VA 4NF8B 2BJJX 4QRZA 5JEIA 5DYHA 3EKIA 3RUMA 2QSXA 4DLDA 3ILTB 3S4UA 3QXMA 3KC0A 4P56A 1SPIA 4P1EA 2VPNA 3H06B 3MP1A 4TLLB 4IGTA 3V89B 3LR1A 3EPEA 1LEVA 4ELOA 2DE4A 5DVJA 1SYHA 2AL5A 1OVTA 4QFOA 3N26A 4HW8A 2P2AA 4GX6A 2H99A 2F36A 3VE1B 4JXIA 2B4LA 1UTHB 3UA8A 1SBPA 2DXRA 3CI8A 4H8JA 2OBGA 2FNCA 1A55A 3V8XB 4NEDA 1OMPA 5DEXB 1KA1A 1S50A 3G3HA 2XXXA 3LSFB 2WYKA 2PT2A 2IA4A 4G8NA 1NNPA 3QUJA 4N17A 5AA4A 2OCUA 3I3VA 1IMEA 3O6GA 1IQ7A 3W9WA 1EU8A 3SZPA 4H8IA 2H5YA 4PE3A 4OQOA 4I62A 1MPCA 4ZECA 4RYAA 4LUBA 5BWJA 5F1QA 4GX3A 3U72A 1LBXA 1UTBB 1DMBA 4KPTA 4RY1A 3MVXA 4JDFA 1TFAA 1R9LA 2WEFA 3KOTA 1IMDA 3M3LA 1NNFA 1AOVA 1UTBA 4DXBA 1NV0A 3A09A 4NF0A 3MVYA 4OMBA 1FTJA 2DWAA 2XXQA 2R8TA 1IXCA 3CSGA 3TCFA 2CZHA 2QMWA 4YKJA 5EYGA 2D5WA 3OMBA 3H6VA 4IGRA 1M5EA 1IXIA 1MDQA 3N6TA 4QSDA 3MBPA 1JEUA 1FPKA 1S7YA 1D4NA 5IGAA 4GWXA 1BLFA 3BIHA 5J16A 3H4ZA 2Q2AA 3ILUB 3O28A 2E1SA 2HFBA 2F97A 3IO4A 2HXRA 4G68B 3SKPA 3S2VA 3I6VA 1NNKA 4R6HA 5K2YA 3O9PA 5DT6A 4GWWA 5IM2A 2ZZWA 5KDTB 4GX4A 3RQTA 3TTNA 1Q9DA 2I58A 4GWYA 2VHAA 3MQ9A 4R75A 3T9HB 3V83A 3O66A 1II5A 1MY2A 1MXWA 3TTLA 3MSTA 2DWIA 1B1HA 4ECFA 4H0WA 1XT8A 4H1XA 1NH7A 1US4A 4NF5A 5AA2B 1TFDA 2PYYA 2V25A 1K9YA 3B6TA 3U8QA 4GL8A 3LV0A 2DQVA 4EQBA 5I58B 1SW2A 2Q74A 3MYUA 4PF8A 1IXHA 3M8UA 4OERA 1IIWA 4I3YA 3FZVA 5AE4A 1Y1ZA 1B3GA 2Y5KA 4I40A 2P0SA 3H6WA 1ATGA 4LA9A 3MPLA 4ZEFA 1LBYA 1MRPA 1D9QA 4YMBA 3KN3A 1LCFA 3KFMA 4IY5A 4N07A 1FTKA 1H76A 4N6KA 2PBWA 3KJTA 1FW0A 2QMXA 5FTHA 4UACA 1FJ9A 2ONSA 3MPKA 1B9JA 1ZIUA 2XXHA 4G8HA 4DXUA 2DSFA 2I4BA 3UORA 2XXVA 5ET5A 4HE0A 4FE8A 3K6XA 4G2ZA 1AIVA 4P0IA 4HE2A 5AA1A 4R9GA 2FA7A 2QVRA 3FIRA 4GWZA 4Q30B 4JWYA 3U92A 1P1NA 1A8EA 3PGFA 4NX1A 4X04A 5ET7A 2ONRA 2Y7RA 2F6GA 2O7UA 4N81A 1XVXA 3A3UA 1B4HA 1LBBA 4OVJA 3MUQA 3TTRA 2FYIA 1I6QA 4OETA 2P1SA 3OENA 1J1NA 1GTKA 5ISUA 2WKYA 3GLBA 4ZZEA 3JV9A 3K2DA 1JEVA 1B7HA 4EXKA 4MFIA 4EQ9A 3OSRA 4U23A 2REJA 2Q8MA 4O3AA 1VFDA 1DTGA 4X1DA 2KQZA 3HFUA 4PFRA 4O7MA 1LAHE 1YPNA 3FASA 2CMOA 2VP1A 4RPNA 1XOCA 4OVTA 4PGNA 3CVGA 1B3LA 2V3TA 4X48A 1SVXB 4THIA 4AQ4A 3PUZE 3O29A 1JNFA 3TEPA 4YKKA 3PUYE 3IB1A 1B3HA 5IZ3B 2PFYA 5F24A 5I2NB 1PDAA 2Y7IA 4OHNA 1MS7A 4H45A 4DCXA 3H7MA 1DTZA 5H8SA 1URSA 2OWTA 2FIEA 3K1NA 4N8GA 5H8HB 2I3WA 3WAEA 4F1YA 4NF6A 1H43A 4POWA 1TWYA 2ZYOA 2I0CA 1VSOA 3Q29A 3C36A 2FIXA 4DZ1A 3O6IA 5EQ8A 3UGWA 2XD3A 3BFTA 1SYIA 2CEXA 5ET8A 1Y4TA 2ZMBA 4PFUA 1Y20A 5A5LA 1PEBA 4WEDA 2B4MA 4ONYA 1TXFA 2A5TB 5ELVA 4RNSA 1B40A 3UN6A 4HCWA 3GBBA 4HXVA 1MQJA 2Z8EA 1EYIA 1INPA 4ELRA 4DE8A 1R9QA 1B5JA 2XXWA 4XEQA 4OFLA 1IMFA 2W7YA 5IZZA 2YPNA 3TPAA 2H4IA 2PX1A 1H3DA 2RINA 4NF5B 3MJNA 4PFTA 1FQCA 4LP2B 4GOTA 4PBHA 3TKDA 4RXLA 2F7CA 1SW4A 3HV1A 4NE4A 3RTWB 1LBCA 2IEEA 5B7DA 2ANJA 4MLVA 4U4SA 2XWIA 4R9FA 3I5OA 3KG2A 2I0BA 3RYDA 1NV6A 2NVUB 5CC2A 5H8FA 4ZEDA 3VVDA 2H98A 2QS4A 3MZBA 4I8CA 2DYXA 5IZ3A 4G61A 2ESNA 1RYXA 1P99A 2I48A 4JBZA 4QSEA 5CBSA 2GHAA 4PE5B 1B0LA 1NV3A 3HSTA 4F1VA 5LTCA 2DDKA 3CFXA 5I58A 1B5HA 1L5TA 2V84A 3C34A 1MM6A 3ZSFA 4IO6A 3DP4A 3MAMA 3EHSA 4F3GA 2RCAA 1MXZA 4XKQA 3TFLA 1DCUA 3CG1A 2ZNSA 4MF3A 4RJZA 3OXNA 3PU5A 3O97A 3TCGA 1B46A 1WODA 4HE1A 4NWCA 1MQHA 4MNCA 5I2KB 2VD3A 3PMVA 1P1WA 4ZE8A 5I57A 4H67A 1OLCA 3TODA 2Q2CA 2ABHA 4MCOA 4ESWA 4R6KA 3T9XB 2DWHA 3PD9A 1B4ZA 3QSLA 4E0WA 1F9BA 2ZXTA 2GFEA 1OIBA 3T1BA 3IK6B 4ND9A 5KDTA 4PETA 4MEVA 1XHYA 4N6PA 4F29A 1LB8A 1ZKBA 4OESA 2DE3A 3RPLB 3CG3A 4XKNA 4YZZA 4PCDA 2ZYNA 1AMFA 3PPOA 4C1TA 5KCJB 3GBAA 1JQFA 1MH3A 4U22A 1A8FA 4LONB 4P8BA 3K02A 3T9UA 2QPQA 1B7ZA 2DE2A 2HAVA 1URDA 4K3FA 1N3XA 3KN7A 3B6WA 4F3PA 2ZNUA 4WKMA 1NUYA 3FVKA 3VLWA 2VT5A 2I6EA 4GWSA 4XKRA 1GV8A 3EHTA 4POXA 2RC9A 1B7UA 4YMAA 2O1MA 2QVVA 3RLFE 4I3EA 4GD5A 4OEUA 3U1OA 2O1LA 4PDDA 2R71A 2PMSA 2XA5A 2P3VA 1QVSA 4EUOA 2REGA 4E0XA 1M5DA 1LBVA 3IB2A 1FCKA 3FGSA 3FD3A 2UXAA 2X26A 2HZLA 5LDZA 2AL4A 2M8CA 1FPGA 4PAFA 3HPIA 3B6QA 1GVCA 1N7XA 2Z8FA 3K6WA 5H8NA 4AB5A 2D3IA 1MXXA 4Q8RA 1IUDA 1ZTYA 3TZAA 2FBPA 4LATA 4OYVA 3CSBA 5ET6A 3B7DA 1SDXA 4MX6A 1FTLA 4IO2A 1A40A 1DPPA 2Q8JA 2PFZA 4FEDA 2V3QA 2GQ1A 2UVIA 2Z23A 1Y3QA 5I59A 2R9JA 2VD2A 4QBAA 4PGPA 4F3SA 1YTVA 1UIVA 3SEYA 4YB6A 4KXPA 3R26A 2Q89A 4X8RA 2OZZA 2ZYMA 1OLAA 2HAUA 4F2OA 4KCCA 3FXRA 4HCYA 4XIGQ 1FBDA 1XS5A 4N91A 4GQOA 2XXKA 4IR8A 4MHFA 1M5BA 4QFNA 4LZ8A 5FTIA 5I2KA 3FJGA 1NNTA 4XXUA 5I84A 4MNIA 2V4CA 2PT1A 4ESXA 5CM6A 2XXPA 1B3FA 1POTA 4P0GA 1LGBC 5TP9B 1FBCA 4TLMB 4R6YA 1FSAA 1R1NA 4NG7A 2RC7A 3O6HA 1QGXA 3DP6A 2XXUA 1YYZA 3FXQA 3TELA 1HSLA 4BLAA 1BKAA 4ZS9A 5TPAA 3PUWE 4GVOA 3UK4A 1QUJA 3FVNA 4U2RA 4LZ7A 3C9HA 3VXBA 1LLSA 3QMFA 4GBWA 2UYFA 3KC1A 4PDHA 3P7IA 2O7IA 4P47A 3PMWA 3OELA 1AWBA 3UIFA 3THIA 5DVFA 3Q25A 3LSLA 5L9SA 3CHGA 4IO5A 2AIXA 4QSCA 4Z7EA 4F22A 1H45A 4PF6A 1PB8A 5CI5A 2VGQA 4OFOA 1EYJA 1MG1A 4GBVA 1NV2A 1JVXA 1MH4A 1Y4CA 3LSXA 2AYSA 4DI4B 1PC3A 2KR0A 3LBSA 1ZJLA 4OA4A 2VOZA 4QFPA 2YLNA 1RDXA 4JVDA 2RCBA 3S9NC 1JW5A 4I9DA 1I6BA 3KOSA 2UVHA 1D3KA 1MDP1 1SW5A 4PAKA 3SEXA 3LUYA 3G3FA 2ZZXA 1Y3PA 2DOJA 4H5GA 4R2BA 4FAJA 3IOVA 3V5AA 2WBBA 5I57B 3G3JA 3BFUA 3IFAA 5L9MA 4H5FA 4P3LA 1Q35A 4YKIA 4UABA 2XX8A 3KZGA 4NAPA 4R72A 3FJ7A 4GWOA 1NMUA 4NF6B 2GHBA 2QVUA 4F19A 1JETA 1T0KA 2HEUA 1DSNA 4BDMA 3IJXB 2OK2A 3TMGA 3EQ1A 1AH5A 3IOWA 1LB9A 3GXAA 4F31B 3BBRA 4FBPA 4MBPA 5AA3A 5JTYB 1DPEA 3BIGA 5EYFA 3T22A 2QRYA 4I1DA 5EHMA 3K1PA 3MW0A 3N94A 1MQDA 1M5CA 1EYKA 4MNPA 4DCYA 1FPLA 3IX1A 4RK9A 5I56B 2XXIA 3AXFA 5EQ7A 3RTFB 1JW4A 1CB6A 2UVGA 4HTGA 3OO9A 3R7XA 2RC8A 4JWOA 5DEXA 3EF7A 4H6DA 2NWJA 3RPWA 4LN5A 4IB2A 4X1BA 4DDDA 5A5XA 1JVYA 1B2HA 3G3IA 1GGGA 1Y1MA 3OD7A 4FJPA 3BKIB 4R2FA 1HSEA 1MXVA 4KYEA 4GFRA 2Z22A 2F7AA 3ONMA 1N3WA 3QYTA 1FPEA 3E13X 1DOTA 3S9MC 2Y7WA 3VVEA 1MY4A 5FHOA 3T66A 4AS4A 3HCQA 3VDFA 3IB0A 3MVWA 1B52A 4DI3D 2THIA 1CE2A 3G7WA 1LBWA 2Q9TA 4ZEIA 2DS9A 1FTOA 1I6AA 2Y7PA 4PFYA 1SD3A 4AS5A 4OWDA 4F2QA 4NF8A 1N84A 3KSJA 3PUXE 1IXGA 3EHUA 2X7QA 1O63A 1MM7A 2H25A 4G68A 1Y3NA 2RKMA 4PP0A 2B3FA 5H8NB 3IOUA 2XX7A 4JVIA 1ZLQA 3K0VA 4IO7A 3C33A 4U1OA 3SEWA 5JK4A 1OVBA 4XFEA 3TDJA 2Y84A 4KQPA 2O6AA 3FBPA 1NKXA 4EQ7A 4FORA 4PFBA 4TOZA 1QUKA 2VPOA 2CZKA 2G29A 1LFIA 2QS2A 4PFIA 3LC8A 1CNQA 1EH3A 3Q28A 4YB7A 2XHDA 5TP9A 3RT8A 5A5XB 1RDZA 2CZLA 1FQEA 2PCRA 1MPDA 4OVSA 5FBPA 4OTEA 1UQWA 3VLVA 4QFKA 1ANFA 1SQYA 2GRVA 4JVCA 1OQGA 4QF9A 4NWDA 1USYH 3QAXA 4G8MA 1B05A 1UTHA 2NUVA 3W15C 4EF2A 3IAZA 3TTKA 3VV5A 1MPBA 4MJOA 4G68C 1SI1A 3ZS6A 1YXIA 3SERA 2Z8DA 4WEPA 3OEMA 2XXTA 5I59B 2XXYA 4IY6A 3U94A 4PQJA 3TQLA 4KD5A 4NF4B 3IFCA 4RK2A 5IZ1A 5B70A 3OOAA 1KZ8A 2DP8A 4OENA 5KCJA 1IZ1A 3K4UA 4M4GA 5IKBA 1FBPA 4PAIA 5L9OA 3PPNA 3PPQA 1YAEA 4F18A 5HBCA 2QFLA 5ITPA 2ZYKA 4ISUA 3S9EA 4GL0A 5EHSA 1G0HA 4GLIA 2QS1A 3E4RA 2FHYA 2HCAA 3ECRA 4JWXA 1LFGA 2PVUA 5EYHA 2DVCA 3HHGA 3RPLA 4FECA 5J1DA 3PPPA 3IR1A 1MXYA 2O84X 5L8DA 3K6UA 3SEUA 5TU0A 4BDRA 3M3FA 5ICTA 3KBRA 1S9TA 1TT1A 5BUUA 4KYSA 2HPGA 2WBDA 2B3BA 3OO6A 3MZ9A 1A7LA 4P9KA 4N4UA 3SETA 3B8BA 3T93B 5HPQA 3L6HA 1P1OA 1BP5A 5K2XA 4OXVA 4BDLA 3MVZA 1EZOA 1LAFE 1PBQA 1P1UA 2H9BA 1A54A 5CMCA 1URGA 5ITOA 1NV4A 1FPFA 2HZKA 5FHNA 1ZMGA 3SEVA 1FQBA 4JSDA 1M5FA 3Q26A 3UP9A 4NTLA 2YJPA 1SW1A 4GF8A 1FQAA 2P3NA 3HO7A 3LUZA 3K00A 1B58A 1JP4A 2ALUA 4ZEKA 4FATA 1IITA 5H8QB 1Z7ME 2OWZA 2CZIA 3FV1A 3MZ1A 4PFWA 5JTYA 2F78A 5CMBA 1NL5A 1RDYA 2WYPA 2XWKA 2Y5LA 1HSJA 1FPDA 1NFTA 2ONKE 5I5PA 1NH8A 1WVJA 3C4MA 4XTCQ 4MH5A 5F7VA 1QKBA 1QJMA 3D4CA 3N6UA 4GIZA 1AL3A 1US5A 4BDOA 3FXBA 5M2VA 3C32A 3VXCA 1VR5A 2HQ0A 1O7TA 1Y9UA 1NV1A 2O69A 3RY3A 3F11A 3CFLA 4OANA 3S9LC 3FVGA 1ZU0A 3OSQA 3G3KA 4NHBA 1FTAA 1MXUA 1MY1A 1NV5A 2F35A 1FTMA 4ZDMA 3VLUA 1IEJA 3SDFA 5DTBA 1EZPA 3E78A 1FPBA 3T9VA 2QJEA 2ZNTA 4XKPA 2LAOA 1QULA 3CFZA 2E0SA 1YZ0A 2UVJA 3A29A 1OQHA 5I2NA 1QW0A 2XWVA 3C31A 4IO3A 3FXUA 4LQ2A 2F3DA
chains in the Genus database with same CATH topology
2QRYA 1B0HA 4I1DA 4JXIA 4YB5A 4G77A 3VE1B 4EF1A 5EHMA 1UTHB 4H65A 3UA8A 3K1PA 1SBPA 2DXRA 3CI8A 3MW0A 4O3BA 3N94A 1MQDA 3H3GA 1B6HA 4H8JA 4R9FA 2OBGA 1M5CA 1MY0A 2DVZA 1Z7NE 2FNCA 3I5OA 3KG2A 1A55A 3ZKKA 4DCYA 5H8QA 3IX1A 4RK9A 4YAHX 3V8XB 2I0BA 4NEDA 1OMPA 5I56B 5DEXB 2XXIA 3AXFA 2NVUB 3RTFB 3USDA 1S50A 5CC2A 3G3HA 4P11A 5H8FA 4ZEDA 2XXXA 2Q88A 3KJ7A 3VVDA 4KFQA 4DIGA 1JW4A 3LSFB 2H98A 2QS4A 1CB6A 2UVGA 4Z0IA 3MZBA 1R6ZA 4I8CA 2DYXA 3LSWA 2PT2A 2ESNA 4HTGA 3OO9A 3R7XA 1RYXA 2IA4A 1P99A 2I48A 2RC8A 3KN8A 1NNPA 4G8NA 4JBZA 4JWOA 2GHAA 3QUJA 1B0LA 1RKMA 3HSTA 1ZBMA 3R6UA 4PE5B 5DEXA 4F1VA 3M3KA 3EF7A 5AA4A 4H6DA 1N76A 2OCUA 3I3VA 3CFXA 5I58A 1B5HA 2NWJA 3FJMA 2I4CA 3RPWA 3O6GA 4IB2A 1XC1A 1IQ7A 3GZGA 4X1BA 3W9WA 4DDDA 1EU8A 5AA2D 5A5XA 1L5TA 1JVYA 1B2HA 2V84A 3C34A 1MM6A 3G3IA 4H8IA 1GGGA 1Y1MA 2H5YA 3HN0A 2OWSA 3OD7A 4IO6A 3ZSFA 3DP4A 3MAMA 4FJPA 4RPOA 4OQOA 3BKIB 4I62A 4MLQA 4R2FA 1MPCA 3EHSA 1XVYA 4ZECA 4F3GA 4RYAA 4LUBA 5BWJA 3E3KA 5F1QA 4C0RA 4NMYA 3U72A 2I49A 1HSEA 2RCAA 4ZZAA 1MXVA 1UTBB 1DMBA 1MXZA 4GXAA 4KPTA 4KYEA 4XKQA 3TFLA 1VFEA 4GFRA 4TQUQ 3A3CA 3CG1A 4RY1A 3CIJA 2Z22A 2F7AA 2ZNSA 3ONMA 1N3WA 4MF3A 4RJZA 3QYTA 3MVXA 3OXNA 3DP8A 3E13X 3PU5A 1DOTA 1MY3A 3D4GA 3O97A 4L17A 1B46A 4FIMA 3TCGA 1WODA 2DWJA 3S9MC 4JDFA 2F5XA 1TFAA 4NWCA 2Y7WA 1R9LA 3KOTA 1O64A 2F34A 1MQHA 2GH9A 4Q0CA 1LSTA 3M3LA 1MY4A 1NNFA 5FHOA 3UP9A 3VVEA 2G93A 3KSXA 2VD3A 3PMVA 5I2KB 1P1WA 3T66A 4ZE8A 4KR5A 1AOVA 1UTBA 3HCQA 2F7BA 4DXBA 2F6PA 4H67A 5I57A 5J1DA 3A09A 1OLCA 3IB0A 3TODA 3MVWA 1B52A 2Q2CA 3VDFA 2ABHA 4EXLA 4QSEA 4ESWA 2THIA 3MVYA 4EDPA 3QUFA 4OMBA 1FTJA 4R6KA 2DWHA 3T9XB 4OEVA 1CE2A 2DWAA 3TYHA 2XXQA 3G7WA 3EN3A 3PD9A 1B4ZA 1IXCA 1Q1KA 3CSGA 1F9BA 2ZXTA 3QSLA 5EYFA 3TCFA 4E0WA 2GFEA 2QMWA 1OIBA 5KCJB 3SESA 3IK6B 4ND9A 2Q9TA 4YKJA 4ZEIA 5KDTA 4PETA 5FHMA 2DS9A 1FTOA 1XHYA 2D21A 2V3UA 4N6PA 1I6AA 2Y7PA 4PFYA 3DELB 1SD3A 2D5WA 1LB8A 4F29A 3OMBA 3H6VA 4OWDA 1ZKBA 4OESA 4IGRA 4F2QA 2DE3A 1M5EA 1N84A 3KSJA 3PUXE 4NF8A 1IXGA 3EHUA 2X7QA 3PUVE 1IXIA 1MDQA 3CG3A 1O63A 3N6TA 3OO8A 1MM7A 4XKNA 4YZZA 4QSDA 2ZYNA 3MBPA 2H25A 1JEUA 1AMFA 3PD8A 4G68A 3PPOA 1Y3NA 1S7YA 2RKMA 1D4NA 4M1VA 2B3FA 4PP0A 4C1TA 3HHFA 3GBAA 3IOUA 2XX7A 4DXCA 5H8NB 3KEIA 1JQFA 1MH3A 3FATA 4U22A 1KWHA 4YU0A 1A8FA 4LONB 4QFLA 1BLFA 1ZLQA 4AB6A 3K0VA 4IO7A 3K02A 3H4ZA 2Q2AA 3C33A 4U1OA 3SEWA 5JK4A 3ILUB 3O28A 1OVBA 3T9UA 3TDJA 2Y84A 1MQIA 2E1SA 4KCDA 5IAIA 2HFBA 2QPQA 1B7ZA 3Q27A 2DE2A 3FV2A 2F97A 4OZ9A 3IO4A 4ZEBA 2HAVA 4G68B 1UIUA 4KQPA 3SKPA 1WDNA 1URDA 2O6AA 1FQDA 2OJTA 3S2VA 3I6VA 1N3XA 1NNKA 4K3FA 4R6HA 3O9PA 5K2YA 3KN7A 3B6WA 1NKXA 5H8FB 4QHQA 4EQ7A 4FORA 5DT6A 4F3PA 5HM4B 4TOZA 1QUKA 2ZNUA 4WKMA 3FVKA 2B65A 5KDTB 3RQTA 4OFJA 3TTNA 1N7WA 3VLWA 2G29A 2I58A 3K1MA 3CR9A 2I6EA 2VHAA 3MQ9A 4R75A 3EHTA 4XKRA 1ELJA 1GV8A 1I69A 2QS3A 1LFIA 4POXA 2QS2A 3IOTA 2RC9A 1B7UA 4YMAA 2O1MA 3LC8A 1A99A 4GXSB 1EH3A 3T9HB 3V83A 3O66A 3Q28A 3RLFE 1II5A 4GD5A 1MY2A 5KZTA 4YB7A 4OEUA 3U1OA 2XHDA 5TP9A 3W9VA 1MXWA 2O1LA 3RT8A 3TTLA 5A5XB 2CZLA 2DWIA 1B1HA 4ECFA 3E9XA 2R71A 1FQEA 3DM0A 1MQGA 1B1XA 1MPDA 4H0WA 2PMSA 1XT8A 5CMMA 4O3CA 4H1XA 1NH7A 4IO4A 1US4A 2RF1A 4YICA 1LFHA 3TUSA 3IO6A 4OTEA 1QVSA 1UQWA 4EUOA 3VLVA 2REGA 4NF5A 1TFDA 4QFKA 2PYYA 4E0XA 1ANFA 5AA2B 1M5DA 3IB2A 2V25A 1SQYA 1FCKA 3FGSA 2GRVA 3DLNA 2NOOA 3B6TA 3FD3A 3L6GA 1YCJA 4GL8A 3U8QA 1OQGA 4QF9A 2DQVA 2UXAA 4UA8A 4NWDA 2X26A 1USYH 3QAXA 4G8MA 5TPAB 4Q5TA 1B05A 4LQ5A 3K6VA 2HZLA 1UTHA 2A5SA 4EQBA 2NUVA 2AL4A 3FUZA 3W15C 2M8CA 4EF2A 5CBSA 5AA2A 3IAZA 5I58B 3HPIA 1SW2A 1MPBA 3TTKA 4G68C 3VV5A 5CBRA 3OEKA 5DVIA 3B6QA 1SI1A 3KGCA 4RA1A 3ZS6A 1GVCA 1IXHA 3M8UA 3SERA 4OERA 3WAFA 2Z8DA 1IIWA 1N7XA 2Z8FA 3K6WA 5H8NA 4AB5A 4WEPA 2D3IA 1MXXA 4Q8RA 3OEMA 1IUDA 2HXWA 3FZVA 2A5TA 5AE4A 4KHZE 1Y1ZA 3TTMA 1B3GA 1ZTYA 2XXTA 3TZAA 3QK6A 2P0SA 5I59B 3H6WA 4LATA 4OYVA 1ATGA 4LA9A 2XXYA 1VE4A 3CSBA 3IL1B 3MPLA 4G4PA 4ZEFA 4IY6A 3B7DA 1MRPA 3U94A 5CMKA 1BIYA 4YMBA 3KN3A 1LCFA 3KFMA 4IY5A 1POY1 1SDXA 4N07A 3ZKLA 4F39A 4C1UA 4PQJA 1FTKA 1H76A 1FTLA 4IO2A 1B3EA 1A40A 1DPPA 4KD5A 3TQLA 2Q8JA 4NF4B 4FEDA 2F8DA 4ELPA 2V3QA 4RK2A 2UVIA 5B70A 4YKPA 3OOAA 2Z23A 1PBPA 4ELQA 3MWBA 1Y3QA 5I59A 5ICQA 2PBWA 3KJTA 2R9JA 1FW0A 2DP8A 4GRKA 4OENA 5KCJA 2VD2A 1IZ1A 2QMXA 4F3SA 5FTHA 4UACA 3H03A 1YTVA 3K4UA 4M4GA 5IKBA 2ONSA 3K01A 3MPKA 3O2AA 5L9OA 1USYE 1UIVA 3MP8A 5H8HA 1B9JA 3MP6A 1ZIUA 2XXHA 3PPNA 3SEYA 4YB6A 3PPQA 1JW1A 1YAEA 3R26A 4G8HA 4F18A 2Q89A 5HBCA 4DXUA 2OZZA 1EZ9A 4LVQA 2DSFA 1OLAA 2I4BA 2ZYMA 3UORA 2XXVA 2HAUA 4F2OA 4KCCA 3FXRA 4HCYA 5ITPA 4FE8A 2ZYKA 3K6XA 4ISUA 4G2ZA 4XIGQ 3S9EA 4GL0A 5EHSA 1XS5A 2O68A 1AIVA 4GLIA 3ODBA 4P0IA 2QS1A 3E4RA 2HCAA 3ECRA 5AA1A 2XD2A 4JWXA 1LFGA 4R9GA 2PVUA 2FA7A 4GQOA 4R74A 4KI0E 2DVCA 3HHGA 3JZJA 4FECA 2X7PA 3PPPA 4U1ZA 1M5BA 3FIRA 3H6TA 3IR1A 4LZ8A 1MXYA 3FJGA 4QFNA 5FTIA 1NNTA 2O84X 4BDQA 5I2KA 5L8DA 4XXUA 4Q30B 4JWYA 3U92A 3VFJA 3K6UA 3SEUA 2Y7KA 1P1NA 3G3GA 5TU0A 5I84A 4BDRA 1A8EA 5I56A 3PGFA 3M3FA 5ICTA 3TCHA 2PT1A 1GR2A 4WXJA 3KBRA 4ESXA 5CM6A 1S9TA 2XXPA 1LAGE 2DXYA 4LQ2A 1TT1A 5BUUA 1B3FA 2NXOA 4KYSA 3RT6B 5LOMA 1POTA 2ONRA 1LGBC 1PB9A 4P0GA 5TP9B 1LAXA 2B3BA 3OO6A 3PV0E 2Y7RA 3MZ9A 4TLMB 4R6YA 3VVFA 2F6GA 1A7LA 1R1NA 2H99A 2O7UA 1SI0A 1D9YA 1QUIA 2O51A 3U93A 3PPRA 1XVXA 2RC7A 3O6HA 4U21A 3SETA 3A3UA 3DP6A 1B4HA 1LBBA 3T93B 4OVJA 2XXUA 3MUQA 3TTRA 1PB7A 1I6QA 1BTJA 2FYIA 4OETA 2P1SA 5HPQA 3L6HA 3OENA 3FXQA 3TELA 1J1NA 1BP5A 1GTKA 1P1OA 1HSLA 4OXVA 5K2XA 4BLAA 4ZE9A 4BDLA 5ISUA 1BKAA 2WKYA 3MVZA 4ZS9A 2OLBA 3GLBA 5TPAA 1EZOA 3PUWE 4GVOA 3UK4A 1FQFA 1QUJA 1LAFE 3FVNA 4U2RA 1PBQA 3C9HA 1P1UA 4LZ7A 2XXRA 4ZZEA 3JV9A 3VXBA 1LLSA 3K2DA 2H9BA 2UYFA 1A54A 1RYOA 5CMCA 1JEVA 1B7HA 4EXKA 1N04A 1URGA 5ITOA 2I3VA 4MFIA 3P7IA 2O7IA 2HZKA 4EQ9A 5FHNA 3PMWA 3OELA 3C35A 3IORA 3OSRA 4U23A 3RNNA 4N13A 1ZMGA 3OO7A 3UIFA 2REJA 3SEVA 3THIA 5DVFA 4O3AA 1VFDA 1FQBA 1DTGA 3Q25A 2V93A 4X1DA 3LSLA 4JSDA 5L9SA 1M5FA 1LAHE 5AA4B 1YPNA 2KLFA 3FASA 3Q26A 4IO5A 4NTLA 2CMOA 2AIXA 2R6GE 2VP1A 1SW1A 1XOCA 1B32A 2YJPA 4GF8A 1FQAA 3CRBA 4QSCA 4RPNA 1P1QA 4Z7EA 3CVGA 3HO7A 3QIMA 1B3LA 3RGYA 3K00A 1B58A 4F22A 1H45A 4F1UA 2ALUA 2V3TA 1PB8A 5CI5A 4ZEKA 2XX9A 4FATA 1IITA 4F3BA 2VGQA 5H8QB 4X48A 1LCTA 1SVXB 4OFOA 4THIA 4AQ4A 4BDNA 1Z7ME 3O29A 3PUZE 1MG1A 1JNFA 1JVXA 1MH4A 1Y4CA 3PMXA 4NF4A 3TQWA 3TEPA 3FV1A 3LSXA 4YKKA 2AYSA 3MZ1A 3PUYE 1PC3A 1B51A 3LBSA 3IB1A 1B3HA 1ZJLA 5I2NB 4PFWA 1PDAA 5JTYA 2Y7IA 4OHNA 1MS7A 2F78A 2VOZA 5CMBA 4QFPA 1NL5A 4JB7A 4KYDA 3JYRA 3H7MA 1DTZA 2YLNA 4DCXA 1HSJA 2UYEA 5H8SA 4X9TA 1NFTA 2ONKE 1URSA 2RCBA 1NH8A 1WVJA 2OWTA 3C4MA 1JW5A 3FVOA 3S9NC 1QKAA 3K1NA 5H8HB 2I3WA 4I9DA 3WAEA 4F1YA 4XTCQ 4MH5A 3T96B 4NF6A 1QKBA 5F7VA 1H43A 1I6BA 4POWA 1QJMA 3KOSA 3D4CA 3MC2A 3N6UA 1H44A 1TWYA 2ZYOA 2I0CA 4GIZA 1AL3A 2UVHA 1VSOA 3N5LA 1D3KA 3Q29A 1US5A 1MDP1 1SW5A 3C36A 3H6UA 4BDOA 2QL3A 4DZ1A 3O6IA 4FEBA 5M2VA 3RN8A 4R73A 3C32A 1B5IA 3IJOB 5CRYA 3SEXA 3VXCA 3TAJA 1VR5A 2HQ0A 3LUYA 3UGWA 4LZ5A 2XD3A 3BFTA 4HS7A 4JSOA 1O7TA 1Y4TA 1N0TA 1Y9UA 2ZMBA 3G3FA 2O69A 4PFUA 1Y20A 1Y3PA 1PEBA 1D9VA 2DOJA 3CFLA 3F11A 4NF8B 2BJJX 4WEDA 3RY3A 4ONYA 4H5GA 4QRZA 1TXFA 4R2BA 2A5TB 3S9LC 3FVGA 1ZU0A 3OSQA 4FAJA 3IOVA 3G3KA 3V5AA 5I57B 5ELVA 4RNSA 3G3JA 1B40A 3BFUA 3UN6A 5JEIA 5DYHA 4HCWA 4H5FA 5L9MA 3RUMA 1Q35A 1MXUA 1MY1A 3GBBA 2QSXA 1MQJA 2F35A 4DLDA 2Z8EA 3ILTB 3S4UA 1FTMA 4YKIA 4ZDMA 2XX8A 3KZGA 4ELRA 4R72A 3FJ7A 1R9QA 4DE8A 1B5JA 3QXMA 4GWOA 3VLUA 1IEJA 1NMUA 3SDFA 4NF6B 5DTBA 2GHBA 1EZPA 2XXWA 4F19A 3H06B 3T9VA 4OFLA 3MP1A 2QJEA 4TLLB 1JETA 2W7YA 2ZNTA 2HEUA 1T0KA 4XKPA 1DSNA 4BDMA 2YPNA 3IJXB 2OK2A 4IGTA 2LAOA 3LR1A 3EQ1A 2H4IA 3EPEA 3TMGA 3TPAA 3V89B 2PX1A 1AH5A 3IOWA 4U4XA 4ELOA 1LB9A 1QULA 3GXAA 3CFZA 2DE4A 2E0SA 4F31B 3BBRA 4MBPA 5DVJA 1H3DA 1SYHA 2RINA 2UVJA 4NF5B 3MJNA 2AL5A 5AA3A 1OVTA 4QFOA 4PFTA 1FQCA 1OQHA 5I2NA 1QW0A 4GOTA 4LP2B 3TKDA 4RXLA 2F7CA 1SW4A 3HV1A 5JTYB 4NE4A 3RTWB 1LBCA 2IEEA 3N26A 4HW8A 1DPEA 3C31A 5B7DA 2P2AA 2ANJA 4IO3A 2F36A 3FXUA 1SYIA 4MLVA 4U4SA 3T22A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QRY A;  1B0H A;  4I1D A;  4JXI A;  4YB5 A;  4G77 A;  3VE1 B;  4EF1 A;  5EHM A;  1UTH B;  4H65 A;  3UA8 A;  3K1P A;  1SBP A;  2DXR A;  3CI8 A;  3MW0 A;  4O3B A;  3N94 A;  1MQD A;  3H3G A;  1B6H A;  4H8J A;  4R9F A;  2OBG A;  1M5C A;  1MY0 A;  2DVZ A;  1Z7N E;  2FNC A;  3I5O A;  3KG2 A;  1A55 A;  3ZKK A;  4DCY A;  5H8Q A;  3IX1 A;  4RK9 A;  4YAH X;  3V8X B;  2I0B A;  4NED A;  1OMP A;  5I56 B;  5DEX B;  2XXI A;  3AXF A;  2NVU B;  3RTF B;  3USD A;  1S50 A;  5CC2 A;  3G3H A;  4P11 A;  5H8F A;  4ZED A;  2XXX A;  2Q88 A;  3KJ7 A;  3VVD A;  4KFQ A;  4DIG A;  1JW4 A;  3LSF B;  2H98 A;  2QS4 A;  1CB6 A;  2UVG A;  4Z0I A;  3MZB A;  1R6Z A;  4I8C A;  2DYX A;  3LSW A;  2PT2 A;  2ESN A;  4HTG A;  3OO9 A;  3R7X A;  1RYX A;  2IA4 A;  1P99 A;  2I48 A;  2RC8 A;  3KN8 A;  1NNP A;  4G8N A;  4JBZ A;  4JWO A;  2GHA A;  3QUJ A;  1B0L A;  1RKM A;  3HST A;  1ZBM A;  3R6U A;  4PE5 B;  5DEX A;  4F1V A;  3M3K A;  3EF7 A;  5AA4 A;  4H6D A;  1N76 A;  2OCU A;  3I3V A;  3CFX A;  5I58 A;  1B5H A;  2NWJ A;  3FJM A;  2I4C A;  3RPW A;  3O6G A;  4IB2 A;  1XC1 A;  1IQ7 A;  3GZG A;  4X1B A;  3W9W A;  4DDD A;  1EU8 A;  5AA2 D;  5A5X A;  1L5T A;  1JVY A;  1B2H A;  2V84 A;  3C34 A;  1MM6 A;  3G3I A;  4H8I A;  1GGG A;  1Y1M A;  2H5Y A;  3HN0 A;  2OWS A;  3OD7 A;  4IO6 A;  3ZSF A;  3DP4 A;  3MAM A;  4FJP A;  4RPO A;  4OQO A;  3BKI B;  4I62 A;  4MLQ A;  4R2F A;  1MPC A;  3EHS A;  1XVY A;  4ZEC A;  4F3G A;  4RYA A;  4LUB A;  5BWJ A;  3E3K A;  5F1Q A;  4C0R A;  4NMY A;  3U72 A;  2I49 A;  1HSE A;  2RCA A;  4ZZA A;  1MXV A;  1UTB B;  1DMB A;  1MXZ A;  4GXA A;  4KPT A;  4KYE A;  4XKQ A;  3TFL A;  1VFE A;  4GFR A;  4TQU Q;  3A3C A;  3CG1 A;  4RY1 A;  3CIJ A;  2Z22 A;  2F7A A;  2ZNS A;  3ONM A;  1N3W A;  4MF3 A;  4RJZ A;  3QYT A;  3MVX A;  3OXN A;  3DP8 A;  3E13 X;  3PU5 A;  1DOT A;  1MY3 A;  3D4G A;  3O97 A;  4L17 A;  1B46 A;  4FIM A;  3TCG A;  1WOD A;  2DWJ A;  3S9M C;  4JDF A;  2F5X A;  1TFA A;  4NWC A;  2Y7W A;  1R9L A;  3KOT A;  1O64 A;  2F34 A;  1MQH A;  2GH9 A;  4Q0C A;  1LST A;  3M3L A;  1MY4 A;  1NNF A;  5FHO A;  3UP9 A;  3VVE A;  2G93 A;  3KSX A;  2VD3 A;  3PMV A;  5I2K B;  1P1W A;  3T66 A;  4ZE8 A;  4KR5 A;  1AOV A;  1UTB A;  3HCQ A;  2F7B A;  4DXB A;  2F6P A;  4H67 A;  5I57 A;  5J1D A;  3A09 A;  1OLC A;  3IB0 A;  3TOD A;  3MVW A;  1B52 A;  2Q2C A;  3VDF A;  2ABH A;  4EXL A;  4QSE A;  4ESW A;  2THI A;  3MVY A;  4EDP A;  3QUF A;  4OMB A;  1FTJ A;  4R6K A;  2DWH A;  3T9X B;  4OEV A;  1CE2 A;  2DWA A;  3TYH A;  2XXQ A;  3G7W A;  3EN3 A;  3PD9 A;  1B4Z A;  1IXC A;  1Q1K A;  3CSG A;  1F9B A;  2ZXT A;  3QSL A;  5EYF A;  3TCF A;  4E0W A;  2GFE A;  2QMW A;  1OIB A;  5KCJ B;  3SES A;  3IK6 B;  4ND9 A;  2Q9T A;  4YKJ A;  4ZEI A;  5KDT A;  4PET A;  5FHM A;  2DS9 A;  1FTO A;  1XHY A;  2D21 A;  2V3U A;  4N6P A;  1I6A A;  2Y7P A;  4PFY A;  3DEL B;  1SD3 A;  2D5W A;  1LB8 A;  4F29 A;  3OMB A;  3H6V A;  4OWD A;  1ZKB A;  4OES A;  4IGR A;  4F2Q A;  2DE3 A;  1M5E A;  1N84 A;  3KSJ A;  3PUX E;  4NF8 A;  1IXG A;  3EHU A;  2X7Q A;  3PUV E;  1IXI A;  1MDQ A;  3CG3 A;  1O63 A;  3N6T A;  3OO8 A;  1MM7 A;  4XKN A;  4YZZ A;  4QSD A;  2ZYN A;  3MBP A;  2H25 A;  1JEU A;  1AMF A;  3PD8 A;  4G68 A;  3PPO A;  1Y3N A;  1S7Y A;  2RKM A;  1D4N A;  4M1V A;  2B3F A;  4PP0 A;  4C1T A;  3HHF A;  3GBA A;  3IOU A;  2XX7 A;  4DXC A;  5H8N B;  3KEI A;  1JQF A;  1MH3 A;  3FAT A;  4U22 A;  1KWH A;  4YU0 A;  1A8F A;  4LON B;  4QFL A;  1BLF A;  1ZLQ A;  4AB6 A;  3K0V A;  4IO7 A;  3K02 A;  3H4Z A;  2Q2A A;  3C33 A;  4U1O A;  3SEW A;  5JK4 A;  3ILU B;  3O28 A;  1OVB A;  3T9U A;  3TDJ A;  2Y84 A;  1MQI A;  2E1S A;  4KCD A;  5IAI A;  2HFB A;  2QPQ A;  1B7Z A;  3Q27 A;  2DE2 A;  3FV2 A;  2F97 A;  4OZ9 A;  3IO4 A;  4ZEB A;  2HAV A;  4G68 B;  1UIU A;  4KQP A;  3SKP A;  1WDN A;  1URD A;  2O6A A;  1FQD A;  2OJT A;  3S2V A;  3I6V A;  1N3X A;  1NNK A;  4K3F A;  4R6H A;  3O9P A;  5K2Y A;  3KN7 A;  3B6W A;  1NKX A;  5H8F B;  4QHQ A;  4EQ7 A;  4FOR A;  5DT6 A;  4F3P A;  5HM4 B;  4TOZ A;  1QUK A;  2ZNU A;  4WKM A;  3FVK A;  2B65 A;  5KDT B;  3RQT A;  4OFJ A;  3TTN A;  1N7W A;  3VLW A;  2G29 A;  2I58 A;  3K1M A;  3CR9 A;  2I6E A;  2VHA A;  3MQ9 A;  4R75 A;  3EHT A;  4XKR A;  1ELJ A;  1GV8 A;  1I69 A;  2QS3 A;  1LFI A;  4POX A;  2QS2 A;  3IOT A;  2RC9 A;  1B7U A;  4YMA A;  2O1M A;  3LC8 A;  1A99 A;  4GXS B;  1EH3 A;  3T9H B;  3V83 A;  3O66 A;  3Q28 A;  3RLF E;  1II5 A;  4GD5 A;  1MY2 A;  5KZT A;  4YB7 A;  4OEU A;  3U1O A;  2XHD A;  5TP9 A;  3W9V A;  1MXW A;  2O1L A;  3RT8 A;  3TTL A;  5A5X B;  2CZL A;  2DWI A;  1B1H A;  4ECF A;  3E9X A;  2R71 A;  1FQE A;  3DM0 A;  1MQG A;  1B1X A;  1MPD A;  4H0W A;  2PMS A;  1XT8 A;  5CMM A;  4O3C A;  4H1X A;  1NH7 A;  4IO4 A;  1US4 A;  2RF1 A;  4YIC A;  1LFH A;  3TUS A;  3IO6 A;  4OTE A;  1QVS A;  1UQW A;  4EUO A;  3VLV A;  2REG A;  4NF5 A;  1TFD A;  4QFK A;  2PYY A;  4E0X A;  1ANF A;  5AA2 B;  1M5D A;  3IB2 A;  2V25 A;  1SQY A;  1FCK A;  3FGS A;  2GRV A;  3DLN A;  2NOO A;  3B6T A;  3FD3 A;  3L6G A;  1YCJ A;  4GL8 A;  3U8Q A;  1OQG A;  4QF9 A;  2DQV A;  2UXA A;  4UA8 A;  4NWD A;  2X26 A;  1USY H;  3QAX A;  4G8M A;  5TPA B;  4Q5T A;  1B05 A;  4LQ5 A;  3K6V A;  2HZL A;  1UTH A;  2A5S A;  4EQB A;  2NUV A;  2AL4 A;  3FUZ A;  3W15 C;  2M8C A;  4EF2 A;  5CBS A;  5AA2 A;  3IAZ A;  5I58 B;  3HPI A;  1SW2 A;  1MPB A;  3TTK A;  4G68 C;  3VV5 A;  5CBR A;  3OEK A;  5DVI A;  3B6Q A;  1SI1 A;  3KGC A;  4RA1 A;  3ZS6 A;  1GVC A;  1IXH A;  3M8U A;  3SER A;  4OER A;  3WAF A;  2Z8D A;  1IIW A;  1N7X A;  2Z8F A;  3K6W A;  5H8N A;  4AB5 A;  4WEP A;  2D3I A;  1MXX A;  4Q8R A;  3OEM A;  1IUD A;  2HXW A;  3FZV A;  2A5T A;  5AE4 A;  4KHZ E;  1Y1Z A;  3TTM A;  1B3G A;  1ZTY A;  2XXT A;  3TZA A;  3QK6 A;  2P0S A;  5I59 B;  3H6W A;  4LAT A;  4OYV A;  1ATG A;  4LA9 A;  2XXY A;  1VE4 A;  3CSB A;  3IL1 B;  3MPL A;  4G4P A;  4ZEF A;  4IY6 A;  3B7D A;  1MRP A;  3U94 A;  5CMK A;  1BIY A;  4YMB A;  3KN3 A;  1LCF A;  3KFM A;  4IY5 A;  1POY 1;  1SDX A;  4N07 A;  3ZKL A;  4F39 A;  4C1U A;  4PQJ A;  1FTK A;  1H76 A;  1FTL A;  4IO2 A;  1B3E A;  1A40 A;  1DPP A;  4KD5 A;  3TQL A;  2Q8J A;  4NF4 B;  4FED A;  2F8D A;  4ELP A;  2V3Q A;  4RK2 A;  2UVI A;  5B70 A;  4YKP A;  3OOA A;  2Z23 A;  1PBP A;  4ELQ A;  3MWB A;  1Y3Q A;  5I59 A;  5ICQ A;  2PBW A;  3KJT A;  2R9J A;  1FW0 A;  2DP8 A;  4GRK A;  4OEN A;  5KCJ A;  2VD2 A;  1IZ1 A;  2QMX A;  4F3S A;  5FTH A;  4UAC A;  3H03 A;  1YTV A;  3K4U A;  4M4G A;  5IKB A;  2ONS A;  3K01 A;  3MPK A;  3O2A A;  5L9O A;  1USY E;  1UIV A;  3MP8 A;  5H8H A;  1B9J A;  3MP6 A;  1ZIU A;  2XXH A;  3PPN A;  3SEY A;  4YB6 A;  3PPQ A;  1JW1 A;  1YAE A;  3R26 A;  4G8H A;  4F18 A;  2Q89 A;  5HBC A;  4DXU A;  2OZZ A;  1EZ9 A;  4LVQ A;  2DSF A;  1OLA A;  2I4B A;  2ZYM A;  3UOR A;  2XXV A;  2HAU A;  4F2O A;  4KCC A;  3FXR A;  4HCY A;  5ITP A;  4FE8 A;  2ZYK A;  3K6X A;  4ISU A;  4G2Z A;  4XIG Q;  3S9E A;  4GL0 A;  5EHS A;  1XS5 A;  2O68 A;  1AIV A;  4GLI A;  3ODB A;  4P0I A;  2QS1 A;  3E4R A;  2HCA A;  3ECR A;  5AA1 A;  2XD2 A;  4JWX A;  1LFG A;  4R9G A;  2PVU A;  2FA7 A;  4GQO A;  4R74 A;  4KI0 E;  2DVC A;  3HHG A;  3JZJ A;  4FEC A;  2X7P A;  3PPP A;  4U1Z A;  1M5B A;  3FIR A;  3H6T A;  3IR1 A;  4LZ8 A;  1MXY A;  3FJG A;  4QFN A;  5FTI A;  1NNT A;  2O84 X;  4BDQ A;  5I2K A;  5L8D A;  4XXU A;  4Q30 B;  4JWY A;  3U92 A;  3VFJ A;  3K6U A;  3SEU A;  2Y7K A;  1P1N A;  3G3G A;  5TU0 A;  5I84 A;  4BDR A;  1A8E A;  5I56 A;  3PGF A;  3M3F A;  5ICT A;  3TCH A;  2PT1 A;  1GR2 A;  4WXJ A;  3KBR A;  4ESX A;  5CM6 A;  1S9T A;  2XXP A;  1LAG E;  2DXY A;  4LQ2 A;  1TT1 A;  5BUU A;  1B3F A;  2NXO A;  4KYS A;  3RT6 B;  5LOM A;  1POT A;  2ONR A;  1LGB C;  1PB9 A;  4P0G A;  5TP9 B;  1LAX A;  2B3B A;  3OO6 A;  3PV0 E;  2Y7R A;  3MZ9 A;  4TLM B;  4R6Y A;  3VVF A;  2F6G A;  1A7L A;  1R1N A;  2H99 A;  2O7U A;  1SI0 A;  1D9Y A;  1QUI A;  2O51 A;  3U93 A;  3PPR A;  1XVX A;  2RC7 A;  3O6H A;  4U21 A;  3SET A;  3A3U A;  3DP6 A;  1B4H A;  1LBB A;  3T93 B;  4OVJ A;  2XXU A;  3MUQ A;  3TTR A;  1PB7 A;  1I6Q A;  1BTJ A;  2FYI A;  4OET A;  2P1S A;  5HPQ A;  3L6H A;  3OEN A;  3FXQ A;  3TEL A;  1J1N A;  1BP5 A;  1GTK A;  1P1O A;  1HSL A;  4OXV A;  5K2X A;  4BLA A;  4ZE9 A;  4BDL A;  5ISU A;  1BKA A;  2WKY A;  3MVZ A;  4ZS9 A;  2OLB A;  3GLB A;  5TPA A;  1EZO A;  3PUW E;  4GVO A;  3UK4 A;  1FQF A;  1QUJ A;  1LAF E;  3FVN A;  4U2R A;  1PBQ A;  3C9H A;  1P1U A;  4LZ7 A;  2XXR A;  4ZZE A;  3JV9 A;  3VXB A;  1LLS A;  3K2D A;  2H9B A;  2UYF A;  1A54 A;  1RYO A;  5CMC A;  1JEV A;  1B7H A;  4EXK A;  1N04 A;  1URG A;  5ITO A;  2I3V A;  4MFI A;  3P7I A;  2O7I A;  2HZK A;  4EQ9 A;  5FHN A;  3PMW A;  3OEL A;  3C35 A;  3IOR A;  3OSR A;  4U23 A;  3RNN A;  4N13 A;  1ZMG A;  3OO7 A;  3UIF A;  2REJ A;  3SEV A;  3THI A;  5DVF A;  4O3A A;  1VFD A;  1FQB A;  1DTG A;  3Q25 A;  2V93 A;  4X1D A;  3LSL A;  4JSD A;  5L9S A;  1M5F A;  1LAH E;  5AA4 B;  1YPN A;  2KLF A;  3FAS A;  3Q26 A;  4IO5 A;  4NTL A;  2CMO A;  2AIX A;  2R6G E;  2VP1 A;  1SW1 A;  1XOC A;  1B32 A;  2YJP A;  4GF8 A;  1FQA A;  3CRB A;  4QSC A;  4RPN A;  1P1Q A;  4Z7E A;  3CVG A;  3HO7 A;  3QIM A;  1B3L A;  3RGY A;  3K00 A;  1B58 A;  4F22 A;  1H45 A;  4F1U A;  2ALU A;  2V3T A;  1PB8 A;  5CI5 A;  4ZEK A;  2XX9 A;  4FAT A;  1IIT A;  4F3B A;  2VGQ A;  5H8Q B;  4X48 A;  1LCT A;  1SVX B;  4OFO A;  4THI A;  4AQ4 A;  4BDN A;  1Z7M E;  3O29 A;  3PUZ E;  1MG1 A;  1JNF A;  1JVX A;  1MH4 A;  1Y4C A;  3PMX A;  4NF4 A;  3TQW A;  3TEP A;  3FV1 A;  3LSX A;  4YKK A;  2AYS A;  3MZ1 A;  3PUY E;  1PC3 A;  1B51 A;  3LBS A;  3IB1 A;  1B3H A;  1ZJL A;  5I2N B;  4PFW A;  1PDA A;  5JTY A;  2Y7I A;  4OHN A;  1MS7 A;  2F78 A;  2VOZ A;  5CMB A;  4QFP A;  1NL5 A;  4JB7 A;  4KYD A;  3JYR A;  3H7M A;  1DTZ A;  2YLN A;  4DCX A;  1HSJ A;  2UYE A;  5H8S A;  4X9T A;  1NFT A;  2ONK E;  1URS A;  2RCB A;  1NH8 A;  1WVJ A;  2OWT A;  3C4M A;  1JW5 A;  3FVO A;  3S9N C;  1QKA A;  3K1N A;  5H8H B;  2I3W A;  4I9D A;  3WAE A;  4F1Y A;  4XTC Q;  4MH5 A;  3T96 B;  4NF6 A;  1QKB A;  5F7V A;  1H43 A;  1I6B A;  4POW A;  1QJM A;  3KOS A;  3D4C A;  3MC2 A;  3N6U A;  1H44 A;  1TWY A;  2ZYO A;  2I0C A;  4GIZ A;  1AL3 A;  2UVH A;  1VSO A;  3N5L A;  1D3K A;  3Q29 A;  1US5 A;  1MDP 1;  1SW5 A;  3C36 A;  3H6U A;  4BDO A;  2QL3 A;  4DZ1 A;  3O6I A;  4FEB A;  5M2V A;  3RN8 A;  4R73 A;  3C32 A;  1B5I A;  3IJO B;  5CRY A;  3SEX A;  3VXC A;  3TAJ A;  1VR5 A;  2HQ0 A;  3LUY A;  3UGW A;  4LZ5 A;  2XD3 A;  3BFT A;  4HS7 A;  4JSO A;  1O7T A;  1Y4T A;  1N0T A;  1Y9U A;  2ZMB A;  3G3F A;  2O69 A;  4PFU A;  1Y20 A;  1Y3P A;  1PEB A;  1D9V A;  2DOJ A;  3CFL A;  3F11 A;  4NF8 B;  2BJJ X;  4WED A;  3RY3 A;  4ONY A;  4H5G A;  4QRZ A;  1TXF A;  4R2B A;  2A5T B;  3S9L C;  3FVG A;  1ZU0 A;  3OSQ A;  4FAJ A;  3IOV A;  3G3K A;  3V5A A;  5I57 B;  5ELV A;  4RNS A;  3G3J A;  1B40 A;  3BFU A;  3UN6 A;  5JEI A;  5DYH A;  4HCW A;  4H5F A;  5L9M A;  3RUM A;  1Q35 A;  1MXU A;  1MY1 A;  3GBB A;  2QSX A;  1MQJ A;  2F35 A;  4DLD A;  2Z8E A;  3ILT B;  3S4U A;  1FTM A;  4YKI A;  4ZDM A;  2XX8 A;  3KZG A;  4ELR A;  4R72 A;  3FJ7 A;  1R9Q A;  4DE8 A;  1B5J A;  3QXM A;  4GWO A;  3VLU A;  1IEJ A;  1NMU A;  3SDF A;  4NF6 B;  5DTB A;  2GHB A;  1EZP A;  2XXW A;  4F19 A;  3H06 B;  3T9V A;  4OFL A;  3MP1 A;  2QJE A;  4TLL B;  1JET A;  2W7Y A;  2ZNT A;  2HEU A;  1T0K A;  4XKP A;  1DSN A;  4BDM A;  2YPN A;  3IJX B;  2OK2 A;  4IGT A;  2LAO A;  3LR1 A;  3EQ1 A;  2H4I A;  3EPE A;  3TMG A;  3TPA A;  3V89 B;  2PX1 A;  1AH5 A;  3IOW A;  4U4X A;  4ELO A;  1LB9 A;  1QUL A;  3GXA A;  3CFZ A;  2DE4 A;  2E0S A;  4F31 B;  3BBR A;  4MBP A;  5DVJ A;  1H3D A;  1SYH A;  2RIN A;  2UVJ A;  4NF5 B;  3MJN A;  2AL5 A;  5AA3 A;  1OVT A;  4QFO A;  4PFT A;  1FQC A;  1OQH A;  5I2N A;  1QW0 A;  4GOT A;  4LP2 B;  3TKD A;  4RXL A;  2F7C A;  1SW4 A;  3HV1 A;  5JTY B;  4NE4 A;  3RTW B;  1LBC A;  2IEE A;  3N26 A;  4HW8 A;  1DPE A;  3C31 A;  5B7D A;  2P2A A;  2ANJ A;  4IO3 A;  2F36 A;  3FXU A;  1SYI A;  4MLV A;  4U4S A;  3T22 A; 
#chains in the Genus database with same CATH topology
 1B0H A;  4YB5 A;  4G77 A;  4H65 A;  4O3B A;  3H3G A;  1B6H A;  1MY0 A;  2DVZ A;  1Z7N E;  1NI9 A;  3ZKK A;  4PBQ A;  5H8Q A;  4YAH X;  1NUZ A;  3USD A;  4P11 A;  2Q88 A;  3KJ7 A;  2ZZV A;  4KFQ A;  4DIG A;  4MMP A;  4Z0I A;  1R6Z A;  3LSW A;  3VFJ A;  4RPO A;  3KN8 A;  1RKM A;  1K9Z A;  4NN3 A;  1ZBM A;  3R6U A;  3M3K A;  1N76 A;  3FJM A;  2I4C A;  1XC1 A;  3GZG A;  2OX3 A;  5AA2 D;  1FBG A;  3HN0 A;  2OWS A;  4MLQ A;  4MAG A;  1XVY A;  1VDW A;  1FBH A;  3E3K A;  4C0R A;  4NMY A;  2I49 A;  4ZZA A;  4GXA A;  1VFE A;  4TQU Q;  3A3C A;  3CIJ A;  4OVR A;  3DP8 A;  4L17 A;  1MY3 A;  3D4G A;  1FBF A;  4FIM A;  2DWJ A;  2F5X A;  1O64 A;  2F34 A;  2GH9 A;  4Q0C A;  1LST A;  4O94 A;  4EXL A;  2G93 A;  3KSX A;  4KR5 A;  2F7B A;  2F6P A;  3PTY A;  4EDP A;  3QUF A;  4OEV A;  3TYH A;  1G0I A;  3EN3 A;  1FJ6 A;  1Q1K A;  5DW8 A;  3SES A;  5FHM A;  4H46 A;  2D21 A;  2V3U A;  3DEL B;  3PUV E;  3ROJ A;  3OO8 A;  3PD8 A;  3D1R A;  5I7I A;  4EF1 A;  5I3S A;  4M1V A;  4DXC A;  3HHF A;  4NGU A;  3KEI A;  2WX9 A;  3FAT A;  1KWH A;  4YU0 A;  4QFL A;  4AB6 A;  1IMB A;  1MQI A;  4KCD A;  5IAI A;  3Q27 A;  3FV2 A;  4OZ9 A;  4ZEB A;  1UIU A;  1WDN A;  1FQD A;  2OJT A;  1FRP A;  5H8F B;  1FPJ A;  4QHQ A;  5HM4 B;  1FPI A;  4XF5 A;  2B65 A;  4N6D A;  4OFJ A;  1N7W A;  3K1M A;  3CR9 A;  1IMC A;  4OVQ A;  1ELJ A;  1I69 A;  2QS3 A;  3IOT A;  4GXS B;  1A99 A;  5KZT A;  3W9V A;  2L5V A;  4N8Y A;  3E9X A;  3DM0 A;  1MQG A;  1B1X A;  5CMM A;  4O3C A;  4IO4 A;  2RF1 A;  4YIC A;  1LFH A;  3TUS A;  3IO6 A;  4OVP A;  2F3B A;  3DLN A;  2NOO A;  3L6G A;  1YCJ A;  4UA8 A;  5TPA B;  4Q5T A;  2MKZ A;  4LQ5 A;  3K6V A;  2A5S A;  3FUZ A;  5AA2 A;  5CBR A;  3OEK A;  5DVI A;  3KGC A;  4RA1 A;  3U65 A;  5EQA A;  3WAF A;  2HXW A;  2A5T A;  4KHZ E;  3TTM A;  1IMA A;  4PC9 A;  3QK6 A;  4N15 A;  3E79 A;  4G4P A;  1VE4 A;  3IL1 B;  5CMK A;  1BIY A;  1POY 1;  3ZKL A;  4F39 A;  4C1U A;  1B3E A;  2F8D A;  4ELP A;  4YKP A;  1PBP A;  4ELQ A;  3MWB A;  5ICQ A;  4GRK A;  3B50 A;  3H03 A;  3K01 A;  3O2A A;  1USY E;  3MP8 A;  5H8H A;  3MP6 A;  1JW1 A;  1DBZ A;  1NV7 A;  1EZ9 A;  4LVQ A;  2O68 A;  1KA0 A;  3ODB A;  2BJI A;  2XD2 A;  4R74 A;  4KI0 E;  4U1Z A;  3JZJ A;  2X7P A;  3H6T A;  3T0J A;  4QXD A;  4BDQ A;  1FBE A;  2Y7K A;  3GYY A;  3G3G A;  5I56 A;  3TCH A;  4WXJ A;  1GR2 A;  5T3J A;  1LAG E;  2DXY A;  1NUX A;  3RT6 B;  2NXO A;  5LOM A;  1PB9 A;  1LAX A;  3PV0 E;  3KBZ A;  3VVF A;  4P1L A;  2XWO A;  1SI0 A;  1BK4 A;  1D9Y A;  1QUI A;  2O51 A;  4NQ8 A;  3U93 A;  3PPR A;  4U21 A;  4O7I A;  1PB7 A;  1BTJ A;  1LBZ A;  4ZE9 A;  1NUW A;  2OLB A;  1FQF A;  3T96 B;  2XXR A;  1RYO A;  1N04 A;  2I3V A;  3C35 A;  3IOR A;  3RNN A;  4N13 A;  3OO7 A;  2FVZ A;  2CEY A;  1XI6 A;  2V93 A;  5AA4 B;  2KLF A;  2R6G E;  4U4X A;  1B32 A;  3CRB A;  1P1Q A;  3QIM A;  3RGY A;  4GWU A;  4F1U A;  2XX9 A;  4F3B A;  1LCT A;  4BDN A;  5EQ9 A;  4NF4 A;  3PMX A;  3TQW A;  2HHM A;  1B51 A;  1DK4 A;  4JB7 A;  4KYD A;  3JYR A;  2UYE A;  4X9T A;  3NOH A;  3FVO A;  4MIJ A;  1QKA A;  3ISP A;  3MC2 A;  1H44 A;  4O8M A;  3N5L A;  5ESY A;  4PTK A;  3H6U A;  2QL3 A;  4FEB A;  3RN8 A;  4R73 A;  1B5I A;  3IJO B;  5CRY A;  3TAJ A;  4LZ5 A;  4HS7 A;  4JSO A;  1N0T A;  2JJK A;  1D9V A;  4NF8 B;  2BJJ X;  4QRZ A;  5JEI A;  5DYH A;  3EKI A;  3RUM A;  2QSX A;  4DLD A;  3ILT B;  3S4U A;  3QXM A;  3KC0 A;  4P56 A;  1SPI A;  4P1E A;  2VPN A;  3H06 B;  3MP1 A;  4TLL B;  4IGT A;  3V89 B;  3LR1 A;  3EPE A;  1LEV A;  4ELO A;  2DE4 A;  5DVJ A;  1SYH A;  2AL5 A;  1OVT A;  4QFO A;  3N26 A;  4HW8 A;  2P2A A;  4GX6 A;  2H99 A;  2F36 A;  3VE1 B;  4JXI A;  2B4L A;  1UTH B;  3UA8 A;  1SBP A;  2DXR A;  3CI8 A;  4H8J A;  2OBG A;  2FNC A;  1A55 A;  3V8X B;  4NED A;  1OMP A;  5DEX B;  1KA1 A;  1S50 A;  3G3H A;  2XXX A;  3LSF B;  2WYK A;  2PT2 A;  2IA4 A;  4G8N A;  1NNP A;  3QUJ A;  4N17 A;  5AA4 A;  2OCU A;  3I3V A;  1IME A;  3O6G A;  1IQ7 A;  3W9W A;  1EU8 A;  3SZP A;  4H8I A;  2H5Y A;  4PE3 A;  4OQO A;  4I62 A;  1MPC A;  4ZEC A;  4RYA A;  4LUB A;  5BWJ A;  5F1Q A;  4GX3 A;  3U72 A;  1LBX A;  1UTB B;  1DMB A;  4KPT A;  4RY1 A;  3MVX A;  4JDF A;  1TFA A;  1R9L A;  2WEF A;  3KOT A;  1IMD A;  3M3L A;  1NNF A;  1AOV A;  1UTB A;  4DXB A;  1NV0 A;  3A09 A;  4NF0 A;  3MVY A;  4OMB A;  1FTJ A;  2DWA A;  2XXQ A;  2R8T A;  1IXC A;  3CSG A;  3TCF A;  2CZH A;  2QMW A;  4YKJ A;  5EYG A;  2D5W A;  3OMB A;  3H6V A;  4IGR A;  1M5E A;  1IXI A;  1MDQ A;  3N6T A;  4QSD A;  3MBP A;  1JEU A;  1FPK A;  1S7Y A;  1D4N A;  5IGA A;  4GWX A;  1BLF A;  3BIH A;  5J16 A;  3H4Z A;  2Q2A A;  3ILU B;  3O28 A;  2E1S A;  2HFB A;  2F97 A;  3IO4 A;  2HXR A;  4G68 B;  3SKP A;  3S2V A;  3I6V A;  1NNK A;  4R6H A;  5K2Y A;  3O9P A;  5DT6 A;  4GWW A;  5IM2 A;  2ZZW A;  5KDT B;  4GX4 A;  3RQT A;  3TTN A;  1Q9D A;  2I58 A;  4GWY A;  2VHA A;  3MQ9 A;  4R75 A;  3T9H B;  3V83 A;  3O66 A;  1II5 A;  1MY2 A;  1MXW A;  3TTL A;  3MST A;  2DWI A;  1B1H A;  4ECF A;  4H0W A;  1XT8 A;  4H1X A;  1NH7 A;  1US4 A;  4NF5 A;  5AA2 B;  1TFD A;  2PYY A;  2V25 A;  1K9Y A;  3B6T A;  3U8Q A;  4GL8 A;  3LV0 A;  2DQV A;  4EQB A;  5I58 B;  1SW2 A;  2Q74 A;  3MYU A;  4PF8 A;  1IXH A;  3M8U A;  4OER A;  1IIW A;  4I3Y A;  3FZV A;  5AE4 A;  1Y1Z A;  1B3G A;  2Y5K A;  4I40 A;  2P0S A;  3H6W A;  1ATG A;  4LA9 A;  3MPL A;  4ZEF A;  1LBY A;  1MRP A;  1D9Q A;  4YMB A;  3KN3 A;  1LCF A;  3KFM A;  4IY5 A;  4N07 A;  1FTK A;  1H76 A;  4N6K A;  2PBW A;  3KJT A;  1FW0 A;  2QMX A;  5FTH A;  4UAC A;  1FJ9 A;  2ONS A;  3MPK A;  1B9J A;  1ZIU A;  2XXH A;  4G8H A;  4DXU A;  2DSF A;  2I4B A;  3UOR A;  2XXV A;  5ET5 A;  4HE0 A;  4FE8 A;  3K6X A;  4G2Z A;  1AIV A;  4P0I A;  4HE2 A;  5AA1 A;  4R9G A;  2FA7 A;  2QVR A;  3FIR A;  4GWZ A;  4Q30 B;  4JWY A;  3U92 A;  1P1N A;  1A8E A;  3PGF A;  4NX1 A;  4X04 A;  5ET7 A;  2ONR A;  2Y7R A;  2F6G A;  2O7U A;  4N81 A;  1XVX A;  3A3U A;  1B4H A;  1LBB A;  4OVJ A;  3MUQ A;  3TTR A;  2FYI A;  1I6Q A;  4OET A;  2P1S A;  3OEN A;  1J1N A;  1GTK A;  5ISU A;  2WKY A;  3GLB A;  4ZZE A;  3JV9 A;  3K2D A;  1JEV A;  1B7H A;  4EXK A;  4MFI A;  4EQ9 A;  3OSR A;  4U23 A;  2REJ A;  2Q8M A;  4O3A A;  1VFD A;  1DTG A;  4X1D A;  2KQZ A;  3HFU A;  4PFR A;  4O7M A;  1LAH E;  1YPN A;  3FAS A;  2CMO A;  2VP1 A;  4RPN A;  1XOC A;  4OVT A;  4PGN A;  3CVG A;  1B3L A;  2V3T A;  4X48 A;  1SVX B;  4THI A;  4AQ4 A;  3PUZ E;  3O29 A;  1JNF A;  3TEP A;  4YKK A;  3PUY E;  3IB1 A;  1B3H A;  5IZ3 B;  2PFY A;  5F24 A;  5I2N B;  1PDA A;  2Y7I A;  4OHN A;  1MS7 A;  4H45 A;  4DCX A;  3H7M A;  1DTZ A;  5H8S A;  1URS A;  2OWT A;  2FIE A;  3K1N A;  4N8G A;  5H8H B;  2I3W A;  3WAE A;  4F1Y A;  4NF6 A;  1H43 A;  4POW A;  1TWY A;  2ZYO A;  2I0C A;  1VSO A;  3Q29 A;  3C36 A;  2FIX A;  4DZ1 A;  3O6I A;  5EQ8 A;  3UGW A;  2XD3 A;  3BFT A;  1SYI A;  2CEX A;  5ET8 A;  1Y4T A;  2ZMB A;  4PFU A;  1Y20 A;  5A5L A;  1PEB A;  4WED A;  2B4M A;  4ONY A;  1TXF A;  2A5T B;  5ELV A;  4RNS A;  1B40 A;  3UN6 A;  4HCW A;  3GBB A;  4HXV A;  1MQJ A;  2Z8E A;  1EYI A;  1INP A;  4ELR A;  4DE8 A;  1R9Q A;  1B5J A;  2XXW A;  4XEQ A;  4OFL A;  1IMF A;  2W7Y A;  5IZZ A;  2YPN A;  3TPA A;  2H4I A;  2PX1 A;  1H3D A;  2RIN A;  4NF5 B;  3MJN A;  4PFT A;  1FQC A;  4LP2 B;  4GOT A;  4PBH A;  3TKD A;  4RXL A;  2F7C A;  1SW4 A;  3HV1 A;  4NE4 A;  3RTW B;  1LBC A;  2IEE A;  5B7D A;  2ANJ A;  4MLV A;  4U4S A;  2XWI A;  4R9F A;  3I5O A;  3KG2 A;  2I0B A;  3RYD A;  1NV6 A;  2NVU B;  5CC2 A;  5H8F A;  4ZED A;  3VVD A;  2H98 A;  2QS4 A;  3MZB A;  4I8C A;  2DYX A;  5IZ3 A;  4G61 A;  2ESN A;  1RYX A;  1P99 A;  2I48 A;  4JBZ A;  4QSE A;  5CBS A;  2GHA A;  4PE5 B;  1B0L A;  1NV3 A;  3HST A;  4F1V A;  5LTC A;  2DDK A;  3CFX A;  5I58 A;  1B5H A;  1L5T A;  2V84 A;  3C34 A;  1MM6 A;  3ZSF A;  4IO6 A;  3DP4 A;  3MAM A;  3EHS A;  4F3G A;  2RCA A;  1MXZ A;  4XKQ A;  3TFL A;  1DCU A;  3CG1 A;  2ZNS A;  4MF3 A;  4RJZ A;  3OXN A;  3PU5 A;  3O97 A;  3TCG A;  1B46 A;  1WOD A;  4HE1 A;  4NWC A;  1MQH A;  4MNC A;  5I2K B;  2VD3 A;  3PMV A;  1P1W A;  4ZE8 A;  5I57 A;  4H67 A;  1OLC A;  3TOD A;  2Q2C A;  2ABH A;  4MCO A;  4ESW A;  4R6K A;  3T9X B;  2DWH A;  3PD9 A;  1B4Z A;  3QSL A;  4E0W A;  1F9B A;  2ZXT A;  2GFE A;  1OIB A;  3T1B A;  3IK6 B;  4ND9 A;  5KDT A;  4PET A;  4MEV A;  1XHY A;  4N6P A;  4F29 A;  1LB8 A;  1ZKB A;  4OES A;  2DE3 A;  3RPL B;  3CG3 A;  4XKN A;  4YZZ A;  4PCD A;  2ZYN A;  1AMF A;  3PPO A;  4C1T A;  5KCJ B;  3GBA A;  1JQF A;  1MH3 A;  4U22 A;  1A8F A;  4LON B;  4P8B A;  3K02 A;  3T9U A;  2QPQ A;  1B7Z A;  2DE2 A;  2HAV A;  1URD A;  4K3F A;  1N3X A;  3KN7 A;  3B6W A;  4F3P A;  2ZNU A;  4WKM A;  1NUY A;  3FVK A;  3VLW A;  2VT5 A;  2I6E A;  4GWS A;  4XKR A;  1GV8 A;  3EHT A;  4POX A;  2RC9 A;  1B7U A;  4YMA A;  2O1M A;  2QVV A;  3RLF E;  4I3E A;  4GD5 A;  4OEU A;  3U1O A;  2O1L A;  4PDD A;  2R71 A;  2PMS A;  2XA5 A;  2P3V A;  1QVS A;  4EUO A;  2REG A;  4E0X A;  1M5D A;  1LBV A;  3IB2 A;  1FCK A;  3FGS A;  3FD3 A;  2UXA A;  2X26 A;  2HZL A;  5LDZ A;  2AL4 A;  2M8C A;  1FPG A;  4PAF A;  3HPI A;  3B6Q A;  1GVC A;  1N7X A;  2Z8F A;  3K6W A;  5H8N A;  4AB5 A;  2D3I A;  1MXX A;  4Q8R A;  1IUD A;  1ZTY A;  3TZA A;  2FBP A;  4LAT A;  4OYV A;  3CSB A;  5ET6 A;  3B7D A;  1SDX A;  4MX6 A;  1FTL A;  4IO2 A;  1A40 A;  1DPP A;  2Q8J A;  2PFZ A;  4FED A;  2V3Q A;  2GQ1 A;  2UVI A;  2Z23 A;  1Y3Q A;  5I59 A;  2R9J A;  2VD2 A;  4QBA A;  4PGP A;  4F3S A;  1YTV A;  1UIV A;  3SEY A;  4YB6 A;  4KXP A;  3R26 A;  2Q89 A;  4X8R A;  2OZZ A;  2ZYM A;  1OLA A;  2HAU A;  4F2O A;  4KCC A;  3FXR A;  4HCY A;  4XIG Q;  1FBD A;  1XS5 A;  4N91 A;  4GQO A;  2XXK A;  4IR8 A;  4MHF A;  1M5B A;  4QFN A;  4LZ8 A;  5FTI A;  5I2K A;  3FJG A;  1NNT A;  4XXU A;  5I84 A;  4MNI A;  2V4C A;  2PT1 A;  4ESX A;  5CM6 A;  2XXP A;  1B3F A;  1POT A;  4P0G A;  1LGB C;  5TP9 B;  1FBC A;  4TLM B;  4R6Y A;  1FSA A;  1R1N A;  4NG7 A;  2RC7 A;  3O6H A;  1QGX A;  3DP6 A;  2XXU A;  1YYZ A;  3FXQ A;  3TEL A;  1HSL A;  4BLA A;  1BKA A;  4ZS9 A;  5TPA A;  3PUW E;  4GVO A;  3UK4 A;  1QUJ A;  3FVN A;  4U2R A;  4LZ7 A;  3C9H A;  3VXB A;  1LLS A;  3QMF A;  4GBW A;  2UYF A;  3KC1 A;  4PDH A;  3P7I A;  2O7I A;  4P47 A;  3PMW A;  3OEL A;  1AWB A;  3UIF A;  3THI A;  5DVF A;  3Q25 A;  3LSL A;  5L9S A;  3CHG A;  4IO5 A;  2AIX A;  4QSC A;  4Z7E A;  4F22 A;  1H45 A;  4PF6 A;  1PB8 A;  5CI5 A;  2VGQ A;  4OFO A;  1EYJ A;  1MG1 A;  4GBV A;  1NV2 A;  1JVX A;  1MH4 A;  1Y4C A;  3LSX A;  2AYS A;  4DI4 B;  1PC3 A;  2KR0 A;  3LBS A;  1ZJL A;  4OA4 A;  2VOZ A;  4QFP A;  2YLN A;  1RDX A;  4JVD A;  2RCB A;  3S9N C;  1JW5 A;  4I9D A;  1I6B A;  3KOS A;  2UVH A;  1D3K A;  1MDP 1;  1SW5 A;  4PAK A;  3SEX A;  3LUY A;  3G3F A;  2ZZX A;  1Y3P A;  2DOJ A;  4H5G A;  4R2B A;  4FAJ A;  3IOV A;  3V5A A;  2WBB A;  5I57 B;  3G3J A;  3BFU A;  3IFA A;  5L9M A;  4H5F A;  4P3L A;  1Q35 A;  4YKI A;  4UAB A;  2XX8 A;  3KZG A;  4NAP A;  4R72 A;  3FJ7 A;  4GWO A;  1NMU A;  4NF6 B;  2GHB A;  2QVU A;  4F19 A;  1JET A;  1T0K A;  2HEU A;  1DSN A;  4BDM A;  3IJX B;  2OK2 A;  3TMG A;  3EQ1 A;  1AH5 A;  3IOW A;  1LB9 A;  3GXA A;  4F31 B;  3BBR A;  4FBP A;  4MBP A;  5AA3 A;  5JTY B;  1DPE A;  3BIG A;  5EYF A;  3T22 A;  2QRY A;  4I1D A;  5EHM A;  3K1P A;  3MW0 A;  3N94 A;  1MQD A;  1M5C A;  1EYK A;  4MNP A;  4DCY A;  1FPL A;  3IX1 A;  4RK9 A;  5I56 B;  2XXI A;  3AXF A;  5EQ7 A;  3RTF B;  1JW4 A;  1CB6 A;  2UVG A;  4HTG A;  3OO9 A;  3R7X A;  2RC8 A;  4JWO A;  5DEX A;  3EF7 A;  4H6D A;  2NWJ A;  3RPW A;  4LN5 A;  4IB2 A;  4X1B A;  4DDD A;  5A5X A;  1JVY A;  1B2H A;  3G3I A;  1GGG A;  1Y1M A;  3OD7 A;  4FJP A;  3BKI B;  4R2F A;  1HSE A;  1MXV A;  4KYE A;  4GFR A;  2Z22 A;  2F7A A;  3ONM A;  1N3W A;  3QYT A;  1FPE A;  3E13 X;  1DOT A;  3S9M C;  2Y7W A;  3VVE A;  1MY4 A;  5FHO A;  3T66 A;  4AS4 A;  3HCQ A;  3VDF A;  3IB0 A;  3MVW A;  1B52 A;  4DI3 D;  2THI A;  1CE2 A;  3G7W A;  1LBW A;  2Q9T A;  4ZEI A;  2DS9 A;  1FTO A;  1I6A A;  2Y7P A;  4PFY A;  1SD3 A;  4AS5 A;  4OWD A;  4F2Q A;  4NF8 A;  1N84 A;  3KSJ A;  3PUX E;  1IXG A;  3EHU A;  2X7Q A;  1O63 A;  1MM7 A;  2H25 A;  4G68 A;  1Y3N A;  2RKM A;  4PP0 A;  2B3F A;  5H8N B;  3IOU A;  2XX7 A;  4JVI A;  1ZLQ A;  3K0V A;  4IO7 A;  3C33 A;  4U1O A;  3SEW A;  5JK4 A;  1OVB A;  4XFE A;  3TDJ A;  2Y84 A;  4KQP A;  2O6A A;  3FBP A;  1NKX A;  4EQ7 A;  4FOR A;  4PFB A;  4TOZ A;  1QUK A;  2VPO A;  2CZK A;  2G29 A;  1LFI A;  2QS2 A;  4PFI A;  3LC8 A;  1CNQ A;  1EH3 A;  3Q28 A;  4YB7 A;  2XHD A;  5TP9 A;  3RT8 A;  5A5X B;  1RDZ A;  2CZL A;  1FQE A;  2PCR A;  1MPD A;  4OVS A;  5FBP A;  4OTE A;  1UQW A;  3VLV A;  4QFK A;  1ANF A;  1SQY A;  2GRV A;  4JVC A;  1OQG A;  4QF9 A;  4NWD A;  1USY H;  3QAX A;  4G8M A;  1B05 A;  1UTH A;  2NUV A;  3W15 C;  4EF2 A;  3IAZ A;  3TTK A;  3VV5 A;  1MPB A;  4MJO A;  4G68 C;  1SI1 A;  3ZS6 A;  1YXI A;  3SER A;  2Z8D A;  4WEP A;  3OEM A;  2XXT A;  5I59 B;  2XXY A;  4IY6 A;  3U94 A;  4PQJ A;  3TQL A;  4KD5 A;  4NF4 B;  3IFC A;  4RK2 A;  5IZ1 A;  5B70 A;  3OOA A;  1KZ8 A;  2DP8 A;  4OEN A;  5KCJ A;  1IZ1 A;  3K4U A;  4M4G A;  5IKB A;  1FBP A;  4PAI A;  5L9O A;  3PPN A;  3PPQ A;  1YAE A;  4F18 A;  5HBC A;  2QFL A;  5ITP A;  2ZYK A;  4ISU A;  3S9E A;  4GL0 A;  5EHS A;  1G0H A;  4GLI A;  2QS1 A;  3E4R A;  2FHY A;  2HCA A;  3ECR A;  4JWX A;  1LFG A;  2PVU A;  5EYH A;  2DVC A;  3HHG A;  3RPL A;  4FEC A;  5J1D A;  3PPP A;  3IR1 A;  1MXY A;  2O84 X;  5L8D A;  3K6U A;  3SEU A;  5TU0 A;  4BDR A;  3M3F A;  5ICT A;  3KBR A;  1S9T A;  1TT1 A;  5BUU A;  4KYS A;  2HPG A;  2WBD A;  2B3B A;  3OO6 A;  3MZ9 A;  1A7L A;  4P9K A;  4N4U A;  3SET A;  3B8B A;  3T93 B;  5HPQ A;  3L6H A;  1P1O A;  1BP5 A;  5K2X A;  4OXV A;  4BDL A;  3MVZ A;  1EZO A;  1LAF E;  1PBQ A;  1P1U A;  2H9B A;  1A54 A;  5CMC A;  1URG A;  5ITO A;  1NV4 A;  1FPF A;  2HZK A;  5FHN A;  1ZMG A;  3SEV A;  1FQB A;  4JSD A;  1M5F A;  3Q26 A;  3UP9 A;  4NTL A;  2YJP A;  1SW1 A;  4GF8 A;  1FQA A;  2P3N A;  3HO7 A;  3LUZ A;  3K00 A;  1B58 A;  1JP4 A;  2ALU A;  4ZEK A;  4FAT A;  1IIT A;  5H8Q B;  1Z7M E;  2OWZ A;  2CZI A;  3FV1 A;  3MZ1 A;  4PFW A;  5JTY A;  2F78 A;  5CMB A;  1NL5 A;  1RDY A;  2WYP A;  2XWK A;  2Y5L A;  1HSJ A;  1FPD A;  1NFT A;  2ONK E;  5I5P A;  1NH8 A;  1WVJ A;  3C4M A;  4XTC Q;  4MH5 A;  5F7V A;  1QKB A;  1QJM A;  3D4C A;  3N6U A;  4GIZ A;  1AL3 A;  1US5 A;  4BDO A;  3FXB A;  5M2V A;  3C32 A;  3VXC A;  1VR5 A;  2HQ0 A;  1O7T A;  1Y9U A;  1NV1 A;  2O69 A;  3RY3 A;  3F11 A;  3CFL A;  4OAN A;  3S9L C;  3FVG A;  1ZU0 A;  3OSQ A;  3G3K A;  4NHB A;  1FTA A;  1MXU A;  1MY1 A;  1NV5 A;  2F35 A;  1FTM A;  4ZDM A;  3VLU A;  1IEJ A;  3SDF A;  5DTB A;  1EZP A;  3E78 A;  1FPB A;  3T9V A;  2QJE A;  2ZNT A;  4XKP A;  2LAO A;  1QUL A;  3CFZ A;  2E0S A;  1YZ0 A;  2UVJ A;  3A29 A;  1OQH A;  5I2N A;  1QW0 A;  2XWV A;  3C31 A;  4IO3 A;  3FXU A;  4LQ2 A;  2F3D A; 
#chains in the Genus database with same CATH homology
 2QRY A;  1B0H A;  4I1D A;  4JXI A;  4YB5 A;  4G77 A;  3VE1 B;  4EF1 A;  5EHM A;  1UTH B;  4H65 A;  3UA8 A;  3K1P A;  1SBP A;  2DXR A;  3CI8 A;  3MW0 A;  4O3B A;  3N94 A;  1MQD A;  3H3G A;  1B6H A;  4H8J A;  4R9F A;  2OBG A;  1M5C A;  1MY0 A;  2DVZ A;  1Z7N E;  2FNC A;  3I5O A;  3KG2 A;  1A55 A;  3ZKK A;  4DCY A;  5H8Q A;  3IX1 A;  4RK9 A;  4YAH X;  3V8X B;  2I0B A;  4NED A;  1OMP A;  5I56 B;  5DEX B;  2XXI A;  3AXF A;  2NVU B;  3RTF B;  3USD A;  1S50 A;  5CC2 A;  3G3H A;  4P11 A;  5H8F A;  4ZED A;  2XXX A;  2Q88 A;  3KJ7 A;  3VVD A;  4KFQ A;  4DIG A;  1JW4 A;  3LSF B;  2H98 A;  2QS4 A;  1CB6 A;  2UVG A;  4Z0I A;  3MZB A;  1R6Z A;  4I8C A;  2DYX A;  3LSW A;  2PT2 A;  2ESN A;  4HTG A;  3OO9 A;  3R7X A;  1RYX A;  2IA4 A;  1P99 A;  2I48 A;  2RC8 A;  3KN8 A;  1NNP A;  4G8N A;  4JBZ A;  4JWO A;  2GHA A;  3QUJ A;  1B0L A;  1RKM A;  3HST A;  1ZBM A;  3R6U A;  4PE5 B;  5DEX A;  4F1V A;  3M3K A;  3EF7 A;  5AA4 A;  4H6D A;  1N76 A;  2OCU A;  3I3V A;  3CFX A;  5I58 A;  1B5H A;  2NWJ A;  3FJM A;  2I4C A;  3RPW A;  3O6G A;  4IB2 A;  1XC1 A;  1IQ7 A;  3GZG A;  4X1B A;  3W9W A;  4DDD A;  1EU8 A;  5AA2 D;  5A5X A;  1L5T A;  1JVY A;  1B2H A;  2V84 A;  3C34 A;  1MM6 A;  3G3I A;  4H8I A;  1GGG A;  1Y1M A;  2H5Y A;  3HN0 A;  2OWS A;  3OD7 A;  4IO6 A;  3ZSF A;  3DP4 A;  3MAM A;  4FJP A;  4RPO A;  4OQO A;  3BKI B;  4I62 A;  4MLQ A;  4R2F A;  1MPC A;  3EHS A;  1XVY A;  4ZEC A;  4F3G A;  4RYA A;  4LUB A;  5BWJ A;  3E3K A;  5F1Q A;  4C0R A;  4NMY A;  3U72 A;  2I49 A;  1HSE A;  2RCA A;  4ZZA A;  1MXV A;  1UTB B;  1DMB A;  1MXZ A;  4GXA A;  4KPT A;  4KYE A;  4XKQ A;  3TFL A;  1VFE A;  4GFR A;  4TQU Q;  3A3C A;  3CG1 A;  4RY1 A;  3CIJ A;  2Z22 A;  2F7A A;  2ZNS A;  3ONM A;  1N3W A;  4MF3 A;  4RJZ A;  3QYT A;  3MVX A;  3OXN A;  3DP8 A;  3E13 X;  3PU5 A;  1DOT A;  1MY3 A;  3D4G A;  3O97 A;  4L17 A;  1B46 A;  4FIM A;  3TCG A;  1WOD A;  2DWJ A;  3S9M C;  4JDF A;  2F5X A;  1TFA A;  4NWC A;  2Y7W A;  1R9L A;  3KOT A;  1O64 A;  2F34 A;  1MQH A;  2GH9 A;  4Q0C A;  1LST A;  3M3L A;  1MY4 A;  1NNF A;  5FHO A;  3UP9 A;  3VVE A;  2G93 A;  3KSX A;  2VD3 A;  3PMV A;  5I2K B;  1P1W A;  3T66 A;  4ZE8 A;  4KR5 A;  1AOV A;  1UTB A;  3HCQ A;  2F7B A;  4DXB A;  2F6P A;  4H67 A;  5I57 A;  5J1D A;  3A09 A;  1OLC A;  3IB0 A;  3TOD A;  3MVW A;  1B52 A;  2Q2C A;  3VDF A;  2ABH A;  4EXL A;  4QSE A;  4ESW A;  2THI A;  3MVY A;  4EDP A;  3QUF A;  4OMB A;  1FTJ A;  4R6K A;  2DWH A;  3T9X B;  4OEV A;  1CE2 A;  2DWA A;  3TYH A;  2XXQ A;  3G7W A;  3EN3 A;  3PD9 A;  1B4Z A;  1IXC A;  1Q1K A;  3CSG A;  1F9B A;  2ZXT A;  3QSL A;  5EYF A;  3TCF A;  4E0W A;  2GFE A;  2QMW A;  1OIB A;  5KCJ B;  3SES A;  3IK6 B;  4ND9 A;  2Q9T A;  4YKJ A;  4ZEI A;  5KDT A;  4PET A;  5FHM A;  2DS9 A;  1FTO A;  1XHY A;  2D21 A;  2V3U A;  4N6P A;  1I6A A;  2Y7P A;  4PFY A;  3DEL B;  1SD3 A;  2D5W A;  1LB8 A;  4F29 A;  3OMB A;  3H6V A;  4OWD A;  1ZKB A;  4OES A;  4IGR A;  4F2Q A;  2DE3 A;  1M5E A;  1N84 A;  3KSJ A;  3PUX E;  4NF8 A;  1IXG A;  3EHU A;  2X7Q A;  3PUV E;  1IXI A;  1MDQ A;  3CG3 A;  1O63 A;  3N6T A;  3OO8 A;  1MM7 A;  4XKN A;  4YZZ A;  4QSD A;  2ZYN A;  3MBP A;  2H25 A;  1JEU A;  1AMF A;  3PD8 A;  4G68 A;  3PPO A;  1Y3N A;  1S7Y A;  2RKM A;  1D4N A;  4M1V A;  2B3F A;  4PP0 A;  4C1T A;  3HHF A;  3GBA A;  3IOU A;  2XX7 A;  4DXC A;  5H8N B;  3KEI A;  1JQF A;  1MH3 A;  3FAT A;  4U22 A;  1KWH A;  4YU0 A;  1A8F A;  4LON B;  4QFL A;  1BLF A;  1ZLQ A;  4AB6 A;  3K0V A;  4IO7 A;  3K02 A;  3H4Z A;  2Q2A A;  3C33 A;  4U1O A;  3SEW A;  5JK4 A;  3ILU B;  3O28 A;  1OVB A;  3T9U A;  3TDJ A;  2Y84 A;  1MQI A;  2E1S A;  4KCD A;  5IAI A;  2HFB A;  2QPQ A;  1B7Z A;  3Q27 A;  2DE2 A;  3FV2 A;  2F97 A;  4OZ9 A;  3IO4 A;  4ZEB A;  2HAV A;  4G68 B;  1UIU A;  4KQP A;  3SKP A;  1WDN A;  1URD A;  2O6A A;  1FQD A;  2OJT A;  3S2V A;  3I6V A;  1N3X A;  1NNK A;  4K3F A;  4R6H A;  3O9P A;  5K2Y A;  3KN7 A;  3B6W A;  1NKX A;  5H8F B;  4QHQ A;  4EQ7 A;  4FOR A;  5DT6 A;  4F3P A;  5HM4 B;  4TOZ A;  1QUK A;  2ZNU A;  4WKM A;  3FVK A;  2B65 A;  5KDT B;  3RQT A;  4OFJ A;  3TTN A;  1N7W A;  3VLW A;  2G29 A;  2I58 A;  3K1M A;  3CR9 A;  2I6E A;  2VHA A;  3MQ9 A;  4R75 A;  3EHT A;  4XKR A;  1ELJ A;  1GV8 A;  1I69 A;  2QS3 A;  1LFI A;  4POX A;  2QS2 A;  3IOT A;  2RC9 A;  1B7U A;  4YMA A;  2O1M A;  3LC8 A;  1A99 A;  4GXS B;  1EH3 A;  3T9H B;  3V83 A;  3O66 A;  3Q28 A;  3RLF E;  1II5 A;  4GD5 A;  1MY2 A;  5KZT A;  4YB7 A;  4OEU A;  3U1O A;  2XHD A;  5TP9 A;  3W9V A;  1MXW A;  2O1L A;  3RT8 A;  3TTL A;  5A5X B;  2CZL A;  2DWI A;  1B1H A;  4ECF A;  3E9X A;  2R71 A;  1FQE A;  3DM0 A;  1MQG A;  1B1X A;  1MPD A;  4H0W A;  2PMS A;  1XT8 A;  5CMM A;  4O3C A;  4H1X A;  1NH7 A;  4IO4 A;  1US4 A;  2RF1 A;  4YIC A;  1LFH A;  3TUS A;  3IO6 A;  4OTE A;  1QVS A;  1UQW A;  4EUO A;  3VLV A;  2REG A;  4NF5 A;  1TFD A;  4QFK A;  2PYY A;  4E0X A;  1ANF A;  5AA2 B;  1M5D A;  3IB2 A;  2V25 A;  1SQY A;  1FCK A;  3FGS A;  2GRV A;  3DLN A;  2NOO A;  3B6T A;  3FD3 A;  3L6G A;  1YCJ A;  4GL8 A;  3U8Q A;  1OQG A;  4QF9 A;  2DQV A;  2UXA A;  4UA8 A;  4NWD A;  2X26 A;  1USY H;  3QAX A;  4G8M A;  5TPA B;  4Q5T A;  1B05 A;  4LQ5 A;  3K6V A;  2HZL A;  1UTH A;  2A5S A;  4EQB A;  2NUV A;  2AL4 A;  3FUZ A;  3W15 C;  2M8C A;  4EF2 A;  5CBS A;  5AA2 A;  3IAZ A;  5I58 B;  3HPI A;  1SW2 A;  1MPB A;  3TTK A;  4G68 C;  3VV5 A;  5CBR A;  3OEK A;  5DVI A;  3B6Q A;  1SI1 A;  3KGC A;  4RA1 A;  3ZS6 A;  1GVC A;  1IXH A;  3M8U A;  3SER A;  4OER A;  3WAF A;  2Z8D A;  1IIW A;  1N7X A;  2Z8F A;  3K6W A;  5H8N A;  4AB5 A;  4WEP A;  2D3I A;  1MXX A;  4Q8R A;  3OEM A;  1IUD A;  2HXW A;  3FZV A;  2A5T A;  5AE4 A;  4KHZ E;  1Y1Z A;  3TTM A;  1B3G A;  1ZTY A;  2XXT A;  3TZA A;  3QK6 A;  2P0S A;  5I59 B;  3H6W A;  4LAT A;  4OYV A;  1ATG A;  4LA9 A;  2XXY A;  1VE4 A;  3CSB A;  3IL1 B;  3MPL A;  4G4P A;  4ZEF A;  4IY6 A;  3B7D A;  1MRP A;  3U94 A;  5CMK A;  1BIY A;  4YMB A;  3KN3 A;  1LCF A;  3KFM A;  4IY5 A;  1POY 1;  1SDX A;  4N07 A;  3ZKL A;  4F39 A;  4C1U A;  4PQJ A;  1FTK A;  1H76 A;  1FTL A;  4IO2 A;  1B3E A;  1A40 A;  1DPP A;  4KD5 A;  3TQL A;  2Q8J A;  4NF4 B;  4FED A;  2F8D A;  4ELP A;  2V3Q A;  4RK2 A;  2UVI A;  5B70 A;  4YKP A;  3OOA A;  2Z23 A;  1PBP A;  4ELQ A;  3MWB A;  1Y3Q A;  5I59 A;  5ICQ A;  2PBW A;  3KJT A;  2R9J A;  1FW0 A;  2DP8 A;  4GRK A;  4OEN A;  5KCJ A;  2VD2 A;  1IZ1 A;  2QMX A;  4F3S A;  5FTH A;  4UAC A;  3H03 A;  1YTV A;  3K4U A;  4M4G A;  5IKB A;  2ONS A;  3K01 A;  3MPK A;  3O2A A;  5L9O A;  1USY E;  1UIV A;  3MP8 A;  5H8H A;  1B9J A;  3MP6 A;  1ZIU A;  2XXH A;  3PPN A;  3SEY A;  4YB6 A;  3PPQ A;  1JW1 A;  1YAE A;  3R26 A;  4G8H A;  4F18 A;  2Q89 A;  5HBC A;  4DXU A;  2OZZ A;  1EZ9 A;  4LVQ A;  2DSF A;  1OLA A;  2I4B A;  2ZYM A;  3UOR A;  2XXV A;  2HAU A;  4F2O A;  4KCC A;  3FXR A;  4HCY A;  5ITP A;  4FE8 A;  2ZYK A;  3K6X A;  4ISU A;  4G2Z A;  4XIG Q;  3S9E A;  4GL0 A;  5EHS A;  1XS5 A;  2O68 A;  1AIV A;  4GLI A;  3ODB A;  4P0I A;  2QS1 A;  3E4R A;  2HCA A;  3ECR A;  5AA1 A;  2XD2 A;  4JWX A;  1LFG A;  4R9G A;  2PVU A;  2FA7 A;  4GQO A;  4R74 A;  4KI0 E;  2DVC A;  3HHG A;  3JZJ A;  4FEC A;  2X7P A;  3PPP A;  4U1Z A;  1M5B A;  3FIR A;  3H6T A;  3IR1 A;  4LZ8 A;  1MXY A;  3FJG A;  4QFN A;  5FTI A;  1NNT A;  2O84 X;  4BDQ A;  5I2K A;  5L8D A;  4XXU A;  4Q30 B;  4JWY A;  3U92 A;  3VFJ A;  3K6U A;  3SEU A;  2Y7K A;  1P1N A;  3G3G A;  5TU0 A;  5I84 A;  4BDR A;  1A8E A;  5I56 A;  3PGF A;  3M3F A;  5ICT A;  3TCH A;  2PT1 A;  1GR2 A;  4WXJ A;  3KBR A;  4ESX A;  5CM6 A;  1S9T A;  2XXP A;  1LAG E;  2DXY A;  4LQ2 A;  1TT1 A;  5BUU A;  1B3F A;  2NXO A;  4KYS A;  3RT6 B;  5LOM A;  1POT A;  2ONR A;  1LGB C;  1PB9 A;  4P0G A;  5TP9 B;  1LAX A;  2B3B A;  3OO6 A;  3PV0 E;  2Y7R A;  3MZ9 A;  4TLM B;  4R6Y A;  3VVF A;  2F6G A;  1A7L A;  1R1N A;  2H99 A;  2O7U A;  1SI0 A;  1D9Y A;  1QUI A;  2O51 A;  3U93 A;  3PPR A;  1XVX A;  2RC7 A;  3O6H A;  4U21 A;  3SET A;  3A3U A;  3DP6 A;  1B4H A;  1LBB A;  3T93 B;  4OVJ A;  2XXU A;  3MUQ A;  3TTR A;  1PB7 A;  1I6Q A;  1BTJ A;  2FYI A;  4OET A;  2P1S A;  5HPQ A;  3L6H A;  3OEN A;  3FXQ A;  3TEL A;  1J1N A;  1BP5 A;  1GTK A;  1P1O A;  1HSL A;  4OXV A;  5K2X A;  4BLA A;  4ZE9 A;  4BDL A;  5ISU A;  1BKA A;  2WKY A;  3MVZ A;  4ZS9 A;  2OLB A;  3GLB A;  5TPA A;  1EZO A;  3PUW E;  4GVO A;  3UK4 A;  1FQF A;  1QUJ A;  1LAF E;  3FVN A;  4U2R A;  1PBQ A;  3C9H A;  1P1U A;  4LZ7 A;  2XXR A;  4ZZE A;  3JV9 A;  3VXB A;  1LLS A;  3K2D A;  2H9B A;  2UYF A;  1A54 A;  1RYO A;  5CMC A;  1JEV A;  1B7H A;  4EXK A;  1N04 A;  1URG A;  5ITO A;  2I3V A;  4MFI A;  3P7I A;  2O7I A;  2HZK A;  4EQ9 A;  5FHN A;  3PMW A;  3OEL A;  3C35 A;  3IOR A;  3OSR A;  4U23 A;  3RNN A;  4N13 A;  1ZMG A;  3OO7 A;  3UIF A;  2REJ A;  3SEV A;  3THI A;  5DVF A;  4O3A A;  1VFD A;  1FQB A;  1DTG A;  3Q25 A;  2V93 A;  4X1D A;  3LSL A;  4JSD A;  5L9S A;  1M5F A;  1LAH E;  5AA4 B;  1YPN A;  2KLF A;  3FAS A;  3Q26 A;  4IO5 A;  4NTL A;  2CMO A;  2AIX A;  2R6G E;  2VP1 A;  1SW1 A;  1XOC A;  1B32 A;  2YJP A;  4GF8 A;  1FQA A;  3CRB A;  4QSC A;  4RPN A;  1P1Q A;  4Z7E A;  3CVG A;  3HO7 A;  3QIM A;  1B3L A;  3RGY A;  3K00 A;  1B58 A;  4F22 A;  1H45 A;  4F1U A;  2ALU A;  2V3T A;  1PB8 A;  5CI5 A;  4ZEK A;  2XX9 A;  4FAT A;  1IIT A;  4F3B A;  2VGQ A;  5H8Q B;  4X48 A;  1LCT A;  1SVX B;  4OFO A;  4THI A;  4AQ4 A;  4BDN A;  1Z7M E;  3O29 A;  3PUZ E;  1MG1 A;  1JNF A;  1JVX A;  1MH4 A;  1Y4C A;  3PMX A;  4NF4 A;  3TQW A;  3TEP A;  3FV1 A;  3LSX A;  4YKK A;  2AYS A;  3MZ1 A;  3PUY E;  1PC3 A;  1B51 A;  3LBS A;  3IB1 A;  1B3H A;  1ZJL A;  5I2N B;  4PFW A;  1PDA A;  5JTY A;  2Y7I A;  4OHN A;  1MS7 A;  2F78 A;  2VOZ A;  5CMB A;  4QFP A;  1NL5 A;  4JB7 A;  4KYD A;  3JYR A;  3H7M A;  1DTZ A;  2YLN A;  4DCX A;  1HSJ A;  2UYE A;  5H8S A;  4X9T A;  1NFT A;  2ONK E;  1URS A;  2RCB A;  1NH8 A;  1WVJ A;  2OWT A;  3C4M A;  1JW5 A;  3FVO A;  3S9N C;  1QKA A;  3K1N A;  5H8H B;  2I3W A;  4I9D A;  3WAE A;  4F1Y A;  4XTC Q;  4MH5 A;  3T96 B;  4NF6 A;  1QKB A;  5F7V A;  1H43 A;  1I6B A;  4POW A;  1QJM A;  3KOS A;  3D4C A;  3MC2 A;  3N6U A;  1H44 A;  1TWY A;  2ZYO A;  2I0C A;  4GIZ A;  1AL3 A;  2UVH A;  1VSO A;  3N5L A;  1D3K A;  3Q29 A;  1US5 A;  1MDP 1;  1SW5 A;  3C36 A;  3H6U A;  4BDO A;  2QL3 A;  4DZ1 A;  3O6I A;  4FEB A;  5M2V A;  3RN8 A;  4R73 A;  3C32 A;  1B5I A;  3IJO B;  5CRY A;  3SEX A;  3VXC A;  3TAJ A;  1VR5 A;  2HQ0 A;  3LUY A;  3UGW A;  4LZ5 A;  2XD3 A;  3BFT A;  4HS7 A;  4JSO A;  1O7T A;  1Y4T A;  1N0T A;  1Y9U A;  2ZMB A;  3G3F A;  2O69 A;  4PFU A;  1Y20 A;  1Y3P A;  1PEB A;  1D9V A;  2DOJ A;  3CFL A;  3F11 A;  4NF8 B;  2BJJ X;  4WED A;  3RY3 A;  4ONY A;  4H5G A;  4QRZ A;  1TXF A;  4R2B A;  2A5T B;  3S9L C;  3FVG A;  1ZU0 A;  3OSQ A;  4FAJ A;  3IOV A;  3G3K A;  3V5A A;  5I57 B;  5ELV A;  4RNS A;  3G3J A;  1B40 A;  3BFU A;  3UN6 A;  5JEI A;  5DYH A;  4HCW A;  4H5F A;  5L9M A;  3RUM A;  1Q35 A;  1MXU A;  1MY1 A;  3GBB A;  2QSX A;  1MQJ A;  2F35 A;  4DLD A;  2Z8E A;  3ILT B;  3S4U A;  1FTM A;  4YKI A;  4ZDM A;  2XX8 A;  3KZG A;  4ELR A;  4R72 A;  3FJ7 A;  1R9Q A;  4DE8 A;  1B5J A;  3QXM A;  4GWO A;  3VLU A;  1IEJ A;  1NMU A;  3SDF A;  4NF6 B;  5DTB A;  2GHB A;  1EZP A;  2XXW A;  4F19 A;  3H06 B;  3T9V A;  4OFL A;  3MP1 A;  2QJE A;  4TLL B;  1JET A;  2W7Y A;  2ZNT A;  2HEU A;  1T0K A;  4XKP A;  1DSN A;  4BDM A;  2YPN A;  3IJX B;  2OK2 A;  4IGT A;  2LAO A;  3LR1 A;  3EQ1 A;  2H4I A;  3EPE A;  3TMG A;  3TPA A;  3V89 B;  2PX1 A;  1AH5 A;  3IOW A;  4U4X A;  4ELO A;  1LB9 A;  1QUL A;  3GXA A;  3CFZ A;  2DE4 A;  2E0S A;  4F31 B;  3BBR A;  4MBP A;  5DVJ A;  1H3D A;  1SYH A;  2RIN A;  2UVJ A;  4NF5 B;  3MJN A;  2AL5 A;  5AA3 A;  1OVT A;  4QFO A;  4PFT A;  1FQC A;  1OQH A;  5I2N A;  1QW0 A;  4GOT A;  4LP2 B;  3TKD A;  4RXL A;  2F7C A;  1SW4 A;  3HV1 A;  5JTY B;  4NE4 A;  3RTW B;  1LBC A;  2IEE A;  3N26 A;  4HW8 A;  1DPE A;  3C31 A;  5B7D A;  2P2A A;  2ANJ A;  4IO3 A;  2F36 A;  3FXU A;  1SYI A;  4MLV A;  4U4S A;  3T22 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...