2O68A

Crystal structure of haemophilus influenzae q58l mutant fbpa
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
307
structure length
307
Chain Sequence
DITVYNGQHKEAATAVAKAFEQETGIKVTLNSGKSEQLAGQLKEEGDKTPADVFYTELTATFADLSEAGLLAPISEQTIQQTAQKGVPLAPKKDWIALSGRSRVVVYDHTKLSEKDMEKSVLDYATPKWKGKIGYVSTSGAFLEQVVALSKMKGDKVALNWLKGLKENGKLYAKNSVALQAVENGEVPAALINNYYWYNLAKEKGVENLKSRLYFVRHQDPGALVSYSGAAVLKASKNQAEAQKFVDFLASKKGQEALVAARAEYPLRADVVSPFNLEPYEKLEAPVVSATTAQDKEHAIKLIEEAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Iron-utilization periplasmic protein
publication title The role of the synergistic phosphate anion in iron transport by the periplasmic iron-binding protein from Haemophilus influenzae.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Metal binding protein
total genus 113
structure length 307
sequence length 307
ec nomenclature
pdb deposition date 2006-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2o68A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2o68A02
3OO6A 5DEXB 1MM6A 4JSDA 2DVCA 4GVOA 4LUBA 2Q9TA 5FTHA 2Y7RA 4HTGA 2Z8FA 4P0GA 2QMWA 3GBBA 4WXJA 1N84A 4QFLA 5FHOA 3DM0A 3V83A 2OK2A 5KDTB 3KZGA 1POY1 4MF3A 4BDNA 3I6VA 1ZJLA 4XIGQ 1DTGA 1Y20A 3A3UA 1QVSA 5DEXA 4WKMA 5CBRA 1GV8A 4FIMA 2V3QA 1JNFA 2F8DA 5DYHA 4EF2A 3SEVA 3S4UA 1B58A 3IK6B 4F22A 5KDTA 2DSFA 3K1NA 4ZS9A 1PEBA 2RCBA 2XXXA 4KYEA 3FXQA 3EN3A 5IAIA 1MG1A 1ANFA 3SEWA 3W9VA 3G7WA 3E9XA 2I49A 4Q8RA 4GOTA 4FAJA 3KBRA 2PBWA 3KSXA 4E0WA 4KHZE 2QPQA 3K01A 3FVOA 3MC2A 2OCUA 4H0WA 4PFYA 1B3LA 3PPRA 5AA4B 2VGQA 3UA8A 4XKPA 2FNCA 3SERA 4OHNA 1CE2A 3U72A 4PFTA 5CMBA 2F7AA 2DXRA 1LFGA 1EH3A 2BJJX 1MY0A 3S9LC 1BKAA 2GRVA 3DP6A 4ZE8A 3FVGA 3PD9A 1NL5A 3IOVA 4QSCA 4DDDA 4OZ9A 1VSOA 3CG3A 1HSLA 3K1PA 2PT1A 5AA4A 5L8DA 4R74A 2X26A 5CI5A 2Y7KA 3MAMA 3C36A 4FEBA 3OO8A 2O7IA 3G3KA 1HSEA 3FIRA 2UYFA 4GFRA 4KCCA 1JW4A 4OXVA 4X48A 3Q26A 3MWBA 1SW4A 3CRBA 1L5TA 2REJA 2Y7PA 4NEDA 4POWA 2ZYKA 4F39A 1LAFE 4OERA 5AA2D 1B3HA 4PETA 1D9YA 2F36A 2XXRA 4TLLB 2XXYA 4XTCQ 4YKIA 5L9OA 4NWCA 1P99A 4RPOA 3OOAA 1GVCA 2VOZA 1DMBA 1S50A 3FXUA 2XXHA 4ZEIA 1LAXA 3PD8A 1PDAA 4DZ1A 3IJXB 1FCKA 4GD5A 4ELRA 2ONKE 4F1YA 2DWHA 2P1SA 3KEIA 1YTVA 5B7DA 2I3WA 4IO5A 3OO7A 1AOVA 4NF8B 4LVQA 2F6GA 1XVXA 1YCJA 3E4RA 3TTRA 4U21A 5DT6A 5H8HB 1FQCA 3RTFB 4Z7EA 1IUDA 4POXA 1OMPA 5L9MA 3BBRA 4OENA 3KGCA 1SVXB 3HV1A 4F18A 2VD3A 2Q89A 4R9FA 3ZKKA 4IO6A 4YB5A 3KOSA 4QFNA 3ILTB 2CMOA 3ODBA 1QUKA 2F78A 4YAHX 5B70A 3QYTA 1H44A 3JYRA 3PPPA 4BDLA 4FORA 1POTA 1LB8A 2HEUA 3IB2A 5H8HA 4TQUQ 1NMUA 2H25A 4R6YA 4EDPA 3QUJA 4GLIA 2NXOA 3TCGA 3HN0A 1YAEA 2NVUB 1MY2A 4IO3A 4GXSB 1A8EA 2I4CA 2X7QA 3SEXA 1IIWA 2GHAA 2UVHA 3H4ZA 1M5EA 1EZ9A 4ZZEA 2KLFA 3O29A 1JVYA 5I2KB 1D4NA 3TAJA 4OEVA 2X7PA 3LSFB 4QFPA 3MQ9A 2V84A 1IQ7A 3FV1A 4Q5TA 2F6PA 4JWYA 3EQ1A 3RY3A 4G68C 2DE2A 3U94A 4LA9A 3CG1A 1SW5A 1AIVA 1TT1A 2QSXA 3G3FA 2F34A 3B6QA 5I2KA 3T66A 1R9QA 4IGRA 1ZKBA 5DVJA 3VVEA 1IXHA 2DP8A 1M5BA 4ZECA 1DTZA 1O7TA 2ZYOA 3CFLA 3MVXA 5K2XA 1ZLQA 1OQGA 1TWYA 5KCJB 1B3EA 4N13A 1JVXA 1R1NA 3T9VA 3MPLA 3L6HA 2Q2CA 4YICA 1MRPA 1AL3A 4XXUA 1LAGE 1NNPA 1Y4CA 2A5TB 2H5YA 2G29A 4QSDA 1BIYA 4F3PA 1MY1A 4OFJA 2I0CA 4I8CA 3S9NC 1B05A 4DCYA 2ZYNA 3OXNA 3O66A 4JWXA 4QFKA 4PFUA 3CVGA 4H6DA 1A7LA 3K00A 3RT8A 5KCJA 5EHMA 1EZPA 2Z23A 1MQIA 1MXWA 3SEUA 5I57B 3PUXE 1ZU0A 2M8CA 1WODA 2A5TA 3EHUA 1KWHA 3M3KA 3KN3A 2ONSA 3S9MC 4OMBA 1FTOA 1II5A 1OLCA 1B9JA 1QUIA 1LCFA 3N26A 4XKQA 4RA1A 1OQHA 3HSTA 4BDRA 3IO6A 4THIA 2PVUA 5I57A 3OEKA 1VR5A 4OWDA 1N0TA 2AIXA 3SETA 1MPBA 4LONB 2ZYMA 1B7ZA 2I58A 3BFUA 1B46A 5H8SA 2PYYA 3TCHA 1OVBA 3MW0A 3WAFA 3PU5A 2QJEA 3C32A 2QS3A 3CSBA 3TFLA 1QW0A 3H6VA 1M5FA 3G3IA 1UIVA 4F2OA 3TTKA 4PP0A 1B5JA 4UACA 4TLMB 3HHFA 1UTHB 4FATA 4JWOA 5JTYB 5FHMA 3FVNA 4NF6B 2HCAA 3F11A 3UIFA 4G8NA 1MXXA 5CRYA 1B32A 3CI8A 1H3DA 3FZVA 3W9WA 5HBCA 2Y7IA 3TMGA 1OVTA 1Q1KA 2DYXA 4NMYA 2YPNA 2XXPA 4M1VA 4P11A 2ABHA 4C1UA 1LFIA 2QS1A 3KFMA 4ONYA 1Y3NA 4RYAA 1QKBA 4LZ8A 3RQTA 3FJGA 2VD2A 2RKMA 1UTHA 2E1SA 4AQ4A 4U2RA 4KYDA 5JTYA 4NF6A 2Z8DA 3MVYA 1QJMA 3FJ7A 5ISUA 3KJTA 2NOOA 1CB6A 3PUVE 3PV0E 1MXUA 1URGA 3IO4A 4NTLA 1FQEA 4GXAA 3PMWA 3OMBA 2AYSA 1MPDA 1USYH 2F7BA 5CMCA 4OYVA 4OESA 3MUQA 4KD5A 3LSLA 4R9GA 2ZXTA 2Q88A 4R6HA 4MLQA 4NF5B 1LLSA 1B7UA 1N3WA 1SBPA 2R9JA 3TTNA 2G93A 2OLBA 1UIUA 3Q25A 4G77A 1GGGA 2XXQA 1MM7A 4FJPA 2XX8A 1RYOA 2XXVA 3OSRA 3PGFA 3SEYA 4F1VA 1DOTA 3U8QA 3IR1A 3LUYA 1P1WA 1N7XA 2D21A 1JEVA 3ZSFA 4DXBA 4F3SA 3C9HA 3EHSA 3VLUA 3KJ7A 4QHQA 4F1UA 2I0BA 3K2DA 4NF5A 1N3XA 1PBPA 4QRZA 1MY3A 1ZTYA 4RK2A 2QL3A 4R6KA 1A8FA 4TOZA 3GZGA 1NNFA 4BDQA 3B6TA 1LGBC 4R2FA 4ESXA 1LCTA 3A09A 4F3GA 1FW0A 5CC2A 3GLBA 2O7UA 4BDOA 2FYIA 2VHAA 3WAEA 3IOUA 3EF7A 3K0VA 3TQLA 1JETA 1NKXA 3USDA 3W15C 4X9TA 2I48A 1XVYA 3VVFA 4IO4A 3KN7A 2I6EA 4IGTA 4RK9A 3MZBA 3PPQA 5J1DA 2IEEA 4LQ2A 1Y1MA 2OJTA 3C4MA 4R2BA 3DP8A 3IL1B 3P7IA 2DWJA 1BP5A 1UTBB 1GTKA 2QS2A 4G8MA 2HFBA 1I6BA 3FD3A 3B6WA 1S7YA 4ELPA 1SYIA 3SDFA 1B3GA 3SKPA 1H43A 3MPKA 1LSTA 3RGYA 1FQBA 3R6UA 3EHTA 3UN6A 1D9VA 3FATA 3VFJA 4QF9A 1ZMGA 1EZOA 2DVZA 1Z7NE 4EF1A 1N7WA 1UTBA 4KI0E 3M3FA 3KOTA 5F1QA 1BTJA 1O63A 3M8UA 3VE1B 2YJPA 1A99A 3LBSA 3TDJA 4H67A 4N6PA 1P1OA 3RTWB 1I69A 2RCAA 3IB0A 1T0KA 3T96B 4XKNA 4DIGA 5ELVA 1JQFA 3E13X 3MZ1A 4RXLA 4LQ5A 1QUJA 1FQDA 1FTLA 2DE3A 4MFIA 3VV5A 4X1BA 1P1QA 3TTLA 5CMMA 3HO7A 1YPNA 2ALUA 5HPQA 3PMVA 2F5XA 2Y7WA 4LATA 3O6GA 3QSLA 5AE4A 1Y3QA 1QULA 1H45A 3N6UA 4M4GA 1VFDA 3MBPA 3DP4A 3VVDA 4IY6A 3LR1A 4ZDMA 5I56B 4PQJA 3R7XA 4LZ7A 1P1NA 1FTKA 2AL5A 5BWJA 1DPEA 3TKDA 3EPEA 4IB2A 4RJZA 3I3VA 1M5CA 1UQWA 3O6IA 3FUZA 2B65A 5FHNA 4C1TA 4H65A 5M2VA 1IEJA 3QIMA 5I59B 2H4IA 1F9BA 1ZIUA 3GXAA 4RPNA 1N04A 1XOCA 5I2NB 3OEMA 4ZE9A 1PB8A 3KN8A 1B6HA 2UVIA 4YB6A 2B3FA 1TXFA 1A40A 3IX1A 5I56A 2GH9A 4EQ9A 4R72A 1Z7ME 3IB1A 3RT6B 1LFHA 2OWTA 3T22A 4F19A 4F2QA 1LAHE 3IORA 2REGA 3M3LA 5I59A 4HW8A 4ZEKA 3G3GA 5I2NA 1Y4TA 4RNSA 1WDNA 4KCDA 5K2YA 4PE5B 3OSQA 5LOMA 3RN8A 3KG2A 4GF8A 3VDFA 1B3FA 3PUYE 3TPAA 3PPNA 3UK4A 3PPOA 4I1DA 5AA1A 1QKAA 2NUVA 3MJNA 1Y1ZA 1FQFA 2UVGA 1JEUA 1NNTA 4U23A 1B40A 1A55A 3THIA 2XD3A 1NNKA 4O3CA 1B5HA 4YKJA 4IY5A 4LP2B 3CR9A 2V93A 3TUSA 2HQ0A 3IAZA 1PBQA 2O51A 3T9XB 4DLDA 4FEDA 3QAXA 1TFAA 2O68A 5ICTA 2O1MA 2R71A 3PUWE 2OZZA 4EQBA 3O9PA 4G68B 3TZAA 3N5LA 1TFDA 2F35A 2P0SA 4Z0IA 3CIJA 1DSNA 5DVIA 3FVKA 3CSGA 3RLFE 2V3TA 3TODA 2O69A 1MH3A 4IO2A 3O28A 5BUUA 5H8NB 2ANJA 3K4UA 2XX7A 3IJOB 3VXCA 3U92A 3MVWA 4N07A 4EUOA 4YKKA 3MP6A 3IOWA 4ZEBA 3OENA 2DQVA 4FE8A 4G68A 1B0LA 3RNNA 3K6VA 2DWAA 2HAUA 4KR5A 1J1NA 4ELQA 1MS7A 2YLNA 3H03A 1IXIA 1WVJA 5HM4B 4JXIA 3SESA 1A54A 1MDP1 5H8NA 1IXGA 4K3FA 3TTMA 1XC1A 1URSA 4NF4B 4H1XA 1B1XA 2ZNTA 5ITOA 2V25A 1B5IA 4X1DA 1I6QA 2VP1A 3MP8A 4IO7A 4KQPA 3D4CA 1MXYA 5KZTA 2Z22A 5H8QB 3C35A 1R6ZA 1B51A 4QSEA 4H8IA 1SW2A 3N94A 2XX9A 2V3UA 1GR2A 3DELB 2PMSA 5IKBA 3R26A 3T9UA 4G8HA 4GRKA 3U1OA 4OETA 2HZKA 5DTBA 3HPIA 2GHBA 3L6GA 3HCQA 4NF4A 4OTEA 1EU8A 1P1UA 3S2VA 1MY4A 3H6TA 3CFZA 1MQJA 1SI1A 2RF1A 3TCFA 4JSOA 4GWOA 5TU0A 1MDQA 4U4XA 5H8QA 1FTMA 1OLAA 4ZEDA 3MVZA 4WEPA 1B0HA 2QS4A 5ITPA 3Q27A 2ZMBA 3TELA 3G3JA 4JDFA 3E3KA 2DXYA 3JV9A 4DXUA 4DXCA 2OBGA 1SDXA 5ICQA 2H98A 4HS7A 2UXAA 4KPTA 3OO9A 4RY1A 1HSJA 4AB6A 1SI0A 4OVJA 1IZ1A 2XXWA 3RPWA 4MBPA 3G3HA 1MQGA 1NH7A 4EXKA 2O84X 2RC8A 5DVFA 4I9DA 3JZJA 1IXCA 1B7HA 5FTIA 3VXBA 4MLVA 1RYXA 5I58B 1XT8A 3ONMA 1S9TA 2Q8JA 5CM6A 1MQHA 5EYFA 1B4ZA 2AL4A 2ONRA 2R6GE 4UA8A 3KSJA 1NH8A 2UVJA 1RKMA 4U1OA 2A5SA 1PC3A 3UP9A 2WKYA 3Q28A 2NWJA 2H99A 3AXFA 4H8JA 2CZLA 1MXVA 4ECFA 4LZ5A 1O64A 4ELOA 3VLVA 2XHDA 4KFQA 3ECRA 3TQWA 3CFXA 1B2HA 5I58A 3D4GA 2ZNSA 2ZNUA 2RINA 3PUZE 3I5OA 3LSWA 3VLWA 3H3GA 1MQDA 3QXMA 2RC7A 1B4HA 1URDA 3T93B 1DPPA 2FA7A 2Q2AA 3FGSA 1JW5A 2DE4A 4ND9A 4O3BA 1OIBA 1AMFA 3V89B 2XXIA 2F7CA 3N6TA 1LBBA 3U93A 4Q0CA 3C33A 4QFOA 2XXTA 3V5AA 2QRYA 3IOTA 4OFOA 3BFTA 4YB7A 1MH4A 2ESNA 2I4BA 3ZKLA 2D3IA 4BDMA 3LSXA 3K02A 4F3BA 3UORA 4GQOA 2I3VA 3B7DA 3DLNA 4L17A 3BKIB 3Q29A 3C31A 2P2AA 4DE8A 1AH5A 2HXWA 5H8FB 4OQOA 2XD2A 3UGWA 3FJMA 4NF8A 4OFLA 2LAOA 2B3BA 5JEIA 5I84A 1ZBMA 4DCXA 5TP9B 1XS5A 4G2ZA 3H6WA 4EQ7A 2RC9A 2PX1A 2HZLA 4BLAA 1USYE 1FQAA 1SD3A 3ILUB 3TEPA 5A5XB 3FASA 4H5FA 5H8FA 4ZZAA 3LC8A 4R75A 5JK4A 3H6UA 3GBAA 4ZEFA 2Y84A 4KYSA 4NE4A 3O6HA 4G4PA 2DS9A 4GIZA 4OEUA 4YMBA 1US5A 2E0SA 5TP9A 3H06B 4JB7A 5EHSA 4NWDA 4MH5A 4O3AA 4EXLA 5A5XA 1MPCA 4HCWA 1M5DA 4F31B 3H7MA 3QK6A 5AA2B 4FECA 4GL8A 1I6AA 5TPAB 3K1MA 2Z8EA 4YMAA 4YU0A 4E0XA 3O2AA 3V8XB 1D3KA 1B52A 4YZZA 2IA4A 5AA3A 1PB7A 1VFEA 3K6XA 3O97A 5F7VA 1LB9A 2W7YA 5AA2A 4HCYA 1Y9UA 1H76A 1VE4A 2DWIA 4PFWA 2O1LA 5TPAA 2D5WA 1N76A 4AB5A 4R73A 5CMKA 4WEDA 4I62A 4JBZA 2THIA 4C0RA 1US4A 1Y3PA 2F97A 3S9EA 2UYEA 3TYHA 4ISUA 2HAVA 4H5GA 1Q35A 1BLFA 4U4SA 2DOJA 1FTJA 2GFEA 3MZ9A 3RUMA 3OD7A 3MP1A 4U22A 3PMXA 2XXUA 4XKRA 4P0IA 4U1ZA 2H9BA 3K6WA 3QUFA 1ELJA 3T9HB 3K6UA 5CBSA 1JW1A 3FV2A 4Q30B 2O6AA 5L9SA 3OELA 1IITA 4ESWA 1SYHA 4F29A 1XHYA 1NFTA 2PT2A 1R9LA 1LBCA 1SW1A 1SQYA 1PB9A 3FXRA 3C34A 1MXZA 3HHGA 1B1HA 2QMXA 2OWSA 3ZS6A 1ATGA 4YKPA 4GL0A 3A3CA
chains in the Genus database with same CATH superfamily
3OO6A 5DEXB 1MM6A 4JSDA 2DVCA 4GVOA 4MJOA 4LUBA 2Q9TA 5FTHA 2Y7RA 4HTGA 2Z8FA 4P0GA 2QMWA 3IFCA 4H46A 3GBBA 4WXJA 1N84A 4QFLA 5FHOA 1XI6A 3DM0A 3V83A 4XEQA 2OK2A 5KDTB 3KZGA 1POY1 3NOHA 4MF3A 4BDNA 3I6VA 1DK4A 1IMAA 1ZJLA 4XIGQ 1DTGA 4GWXA 1Y20A 3A3UA 1IMBA 1QVSA 5DEXA 4WKMA 5CBRA 1GV8A 4FIMA 2V3QA 1JNFA 2F8DA 5DYHA 4EF2A 4PFBA 3SEVA 3S4UA 1B58A 3IK6B 4F22A 4PGNA 5KDTA 2DSFA 4GX3A 3K1NA 4ZS9A 1PEBA 2RCBA 2XXXA 2KR0A 4IR8A 4KYEA 4O7IA 3FXQA 4HE0A 3EN3A 5IAIA 1FBPA 1MG1A 1ANFA 3SEWA 2XWVA 3W9VA 3G7WA 5ET8A 3E9XA 2FIXA 2I49A 4Q8RA 4GOTA 2OWZA 4OANA 4FAJA 3KBRA 2PBWA 3KSXA 4E0WA 4KHZE 2QPQA 3K01A 3FVOA 3MC2A 2OCUA 2Q74A 4H0WA 4PFYA 1B3LA 3PPRA 5AA4B 2VGQA 3UA8A 4XKPA 2FNCA 3SERA 4OHNA 1CE2A 3U72A 4PFTA 5CMBA 2F7AA 2DXRA 1LFGA 4JVCA 1EH3A 2BJJX 1MY0A 1YZ0A 3S9LC 1BKAA 2GRVA 3DP6A 4ZE8A 3T1BA 3FVGA 3PD9A 1NL5A 3IOVA 4QSCA 4DDDA 4OZ9A 1VSOA 3CG3A 3FBPA 1HSLA 3K1PA 2PT1A 5AA4A 5L8DA 4R74A 2HPGA 2X26A 5CI5A 2Y7KA 3MAMA 3C36A 2ZZWA 4FEBA 3OO8A 2O7IA 3G3KA 1HSEA 3FIRA 2UYFA 4GFRA 4KCCA 1JW4A 4OXVA 4X48A 1DBZA 1LEVA 3Q26A 3MWBA 1FBFA 1SW4A 3CRBA 1L5TA 2REJA 2Y7PA 5F24A 4NEDA 4POWA 2ZYKA 4F39A 1LAFE 4OERA 5AA2D 1B3HA 4PETA 1D9YA 2F36A 2XXRA 4TLLB 2XXYA 4XTCQ 4YKIA 5L9OA 1FPGA 4NWCA 1P99A 4RPOA 3OOAA 1GVCA 2VOZA 2P3NA 4QBAA 1DMBA 1S50A 3FXUA 2XXHA 4ZEIA 3HFUA 1LAXA 2VPNA 3PD8A 1PDAA 4DZ1A 3IJXB 1FCKA 4GD5A 4ELRA 2ONKE 4F1YA 2DWHA 1NV1A 2P1SA 3IFAA 3KEIA 1YTVA 5B7DA 2I3WA 4IO5A 3OO7A 1AOVA 3T0JA 4NF8B 4P1LA 4LVQA 2F6GA 1XVXA 1YCJA 2B4MA 3E4RA 3TTRA 2WBBA 4U21A 5DT6A 5H8HB 1FQCA 3RTFB 4Z7EA 1IUDA 4POXA 1OMPA 5L9MA 4NAPA 3BBRA 4OENA 3KGCA 2XA5A 4MAGA 1SVXB 3HV1A 4F18A 2VD3A 2Q89A 4R9FA 3ZKKA 4IO6A 4YB5A 3KOSA 4QFNA 3ILTB 1FPLA 2CMOA 3ODBA 1QUKA 2F78A 4YAHX 5B70A 3QYTA 1H44A 3JYRA 3PPPA 4BDLA 4FORA 2GQ1A 4N8GA 1POTA 1LB8A 2HEUA 3IB2A 5H8HA 4TQUQ 1NMUA 2ZZXA 1FSAA 2H25A 1D9QA 4R6YA 4EDPA 3QUJA 4GLIA 2NXOA 1IMCA 3TCGA 3HN0A 1YAEA 2NVUB 1MY2A 5ET6A 4IO3A 4GXSB 1A8EA 2I4CA 4PAKA 2WX9A 2X7QA 3SEXA 1AWBA 1IIWA 4NF0A 2GHAA 2UVHA 1FRPA 3GYYA 3H4ZA 1M5EA 1EZ9A 4ZZEA 2KLFA 3O29A 1JVYA 5I2KB 1D4NA 5I7IA 4YKPA 3TAJA 4MNIA 2KQZA 4OEVA 2X7PA 3LSFB 4PFRA 4QFPA 4MIJA 3MQ9A 2V84A 1LBYA 1IQ7A 3FV1A 4Q5TA 2F6PA 4JWYA 3EQ1A 3RY3A 4G68C 2DE2A 3U94A 4LA9A 4P47A 3CG1A 1SW5A 1AIVA 1TT1A 2QSXA 3G3FA 2F34A 3EKIA 3B6QA 5I2KA 3T66A 1R9QA 2XXKA 1FPKA 4IGRA 1ZKBA 4OVRA 5DVJA 3VVEA 1IXHA 2QVUA 2DP8A 1M5BA 4ZECA 1DTZA 1O7TA 2ZYOA 3CFLA 3MVXA 5K2XA 1ZLQA 1OQGA 1TWYA 5IZ3B 5KCJB 3B50A 1B3EA 4N13A 1JVXA 1NV4A 1R1NA 3T9VA 3MPLA 3L6HA 2Q2CA 4YICA 1MRPA 2JJKA 1AL3A 4XXUA 1LAGE 1NNPA 4QXDA 1Y4CA 2A5TB 2H5YA 2G29A 4QSDA 1BIYA 4F3PA 1MY1A 4OFJA 2I0CA 4I8CA 3S9NC 1B05A 4DCYA 2ZYNA 3OXNA 3O66A 4PAFA 4JWXA 4QFKA 4PFUA 5EQ9A 3CVGA 4H6DA 1A7LA 2VPOA 3K00A 5IZ3A 3RT8A 5KCJA 4LN5A 5EHMA 1EZPA 2Z23A 1MQIA 1MXWA 3SEUA 5I57B 3PUXE 1ZU0A 2M8CA 1WODA 2A5TA 3EHUA 1KWHA 3M3KA 3KN3A 2ONSA 3S9MC 4OMBA 1FTOA 1II5A 1OLCA 4N8YA 4P9KA 1B9JA 1QUIA 2XWOA 1LCFA 3N26A 4XKQA 4RA1A 2OX3A 1OQHA 3HSTA 4BDRA 3IO6A 4THIA 2PVUA 5I57A 4HE2A 3OEKA 4PC9A 1VR5A 4OVQA 5T3JA 4OWDA 5I5PA 4DI4B 1N0TA 2AIXA 3SETA 1MPBA 4LONB 2QVRA 2ZYMA 1B7ZA 2I58A 3LV0A 3BFUA 1B46A 5H8SA 2PYYA 4HXVA 3TCHA 1OVBA 3MW0A 3WAFA 3PU5A 2QJEA 3C32A 2QS3A 3CSBA 3TFLA 1QW0A 3H6VA 4PTKA 1M5FA 3G3IA 1UIVA 4F2OA 3TTKA 4I40A 4PP0A 1B5JA 4UACA 4TLMB 3HHFA 1UTHB 4FATA 4JWOA 5JTYB 5FHMA 3FVNA 4NF6B 5EYHA 2HCAA 3F11A 3UIFA 3KBZA 4G8NA 1MXXA 5CRYA 1B32A 4N6DA 3B8BA 3CI8A 1H3DA 3FZVA 3W9WA 5HBCA 2Y7IA 3TMGA 1FPIA 1OVTA 1Q1KA 4P3LA 2DYXA 4NMYA 2YPNA 2XXPA 4M1VA 4P11A 2ABHA 4C1UA 1LFIA 2QS1A 2FHYA 3KFMA 4ONYA 1Y3NA 4RYAA 5A5LA 1QKBA 2HHMA 4LZ8A 3RQTA 3FJGA 2VD2A 2RKMA 1UTHA 1G0IA 2E1SA 4AQ4A 4U2RA 4KYDA 5JTYA 4NF6A 2Z8DA 3MVYA 1QJMA 3FJ7A 5ISUA 3KJTA 2NOOA 1CB6A 5ESYA 3PUVE 3PV0E 1MXUA 1URGA 3IO4A 4NTLA 1FQEA 4GXAA 3PMWA 3OMBA 2AYSA 1MPDA 1USYH 2F7BA 5CMCA 1EYIA 4OYVA 4OESA 3MUQA 4KD5A 2CZKA 1IMEA 3LSLA 4I3YA 4R9GA 2ZXTA 2Q88A 4R6HA 4MLQA 4NF5B 1LLSA 1B7UA 1N3WA 1SBPA 4GWSA 2R9JA 3TTNA 2G93A 2OLBA 1UIUA 1KA1A 3Q25A 4G77A 1GGGA 2CEYA 2XXQA 1MM7A 4FJPA 2XWKA 2XX8A 1RYOA 2XXVA 3OSRA 3PGFA 4O8MA 3SEYA 4F1VA 1DOTA 1FBHA 3U8QA 3IR1A 3LUYA 1P1WA 1N7XA 4OVTA 2D21A 1JEVA 3ZSFA 4O94A 4DXBA 4F3SA 3C9HA 3EHSA 3VLUA 1EYJA 3KJ7A 4QHQA 4F1UA 2I0BA 2FVZA 3K2DA 4NF5A 1N3XA 1PBPA 4QRZA 4PF8A 1MY3A 1ZTYA 4RK2A 2QL3A 4R6KA 1A8FA 4TOZA 3GZGA 1NNFA 2WYPA 4BDQA 3B6TA 1LGBC 4R2FA 4ESXA 1LCTA 3A09A 4F3GA 1FW0A 1IMFA 5CC2A 3GLBA 2O7UA 4BDOA 4GWUA 2FYIA 2VHAA 2ZZVA 4N6KA 3WAEA 4P1EA 4JVDA 3IOUA 3EF7A 3K0VA 3TQLA 1JETA 1NKXA 3USDA 3W15C 4X9TA 2I48A 5J16A 1XVYA 2WBDA 4GWYA 3VVFA 4IO4A 3KN7A 1K9YA 2I6EA 4IGTA 4MCOA 4RK9A 3MZBA 3PPQA 5J1DA 2IEEA 4LQ2A 2V4CA 1Y1MA 2OJTA 3C4MA 4R2BA 5IGAA 3DP8A 2CZIA 3IL1B 3P7IA 4OVSA 2DWJA 1BP5A 1UTBB 1GTKA 2QS2A 4G8MA 2HFBA 1I6BA 3FD3A 3B6WA 1S7YA 4ELPA 1SYIA 3SDFA 1B3GA 4N4UA 3D1RA 2PFZA 5IM2A 3SKPA 1H43A 3MPKA 1LSTA 3RGYA 1FQBA 3R6UA 3EHTA 3UN6A 1D9VA 3FATA 4NQ8A 3VFJA 4QF9A 1VDWA 1ZMGA 4FBPA 1EZOA 5FBPA 2DVZA 1Z7NE 4EF1A 1N7WA 3KC0A 1UTBA 4KI0E 3M3FA 4GX6A 3KOTA 4MMPA 5F1QA 1BTJA 4NX1A 4O7MA 1O63A 3M8UA 3VE1B 4P56A 2YJPA 1A99A 3MYUA 3LBSA 3TDJA 4H67A 4N6PA 1P1OA 3RTWB 1I69A 2RCAA 3IB0A 1T0KA 1FPDA 3T96B 4XKNA 4DIGA 5ELVA 1JQFA 3E13X 3MZ1A 4RXLA 4LQ5A 2F3DA 1QUJA 1FQDA 1FTLA 2DE3A 4MFIA 3VV5A 5EQAA 4X1BA 4GBVA 1P1QA 3TTLA 5CMMA 3HO7A 4HE1A 1YPNA 2ALUA 2B4LA 4G61A 4PCDA 5HPQA 1KZ8A 3PMVA 2F5XA 2Y7WA 4LATA 3O6GA 3QSLA 5AE4A 1Y3QA 1QULA 1H45A 3N6UA 4M4GA 4OA4A 1VFDA 3MBPA 3DP4A 3VVDA 4IY6A 3LR1A 4ZDMA 5I56B 4PQJA 3R7XA 4LZ7A 1P1NA 1FTKA 2AL5A 5BWJA 5ET5A 5I3SA 4GWWA 1DPEA 3TKDA 3EPEA 4IB2A 4RJZA 3I3VA 1M5CA 1UQWA 3O6IA 4N17A 3FUZA 2B65A 5FHNA 4C1TA 4H65A 5M2VA 1IEJA 3QIMA 5I59B 2H4IA 4MEVA 1F9BA 1ZIUA 3GXAA 1NV2A 4RPNA 1FPFA 1N04A 1XOCA 5I2NB 4X04A 3OEMA 4ZE9A 1PB8A 3KN8A 1FPBA 1B6HA 2UVIA 4YB6A 2B3FA 1TXFA 1A40A 3IX1A 5I56A 2GH9A 4EQ9A 1FBDA 4R72A 1Z7ME 3IB1A 3RT6B 1LFHA 2OWTA 3T22A 4F19A 4F2QA 1LAHE 4PBHA 3IORA 2P3VA 2REGA 3M3LA 4NHBA 5I59A 4HW8A 4ZEKA 3G3GA 4N81A 2VT5A 1Y4TA 5I2NA 4PF6A 4RNSA 2BJIA 1WDNA 4KCDA 5K2YA 4PE5B 3OSQA 5LOMA 3RN8A 1LBZA 3KG2A 4GF8A 3VDFA 1B3FA 3PUYE 3TPAA 3PPNA 3UK4A 3PPOA 4I1DA 5AA1A 1QKAA 2NUVA 3MJNA 1Y1ZA 1FQFA 2UVGA 1JEUA 1NNTA 4U23A 1B40A 4MHFA 1A55A 2XD3A 3THIA 1NNKA 4O3CA 1B5HA 2DDKA 1NUYA 4YKJA 4IY5A 4LP2B 2CEXA 2CZHA 3CR9A 4H45A 1NV7A 2V93A 2Y5LA 3TUSA 2HQ0A 3IAZA 1NV0A 1PBQA 4PGPA 2O51A 3T9XB 4DLDA 4FEDA 3QAXA 1TFAA 2O68A 5ICTA 2O1MA 2R71A 1NUZA 3PUWE 1RDYA 2OZZA 4EQBA 1CNQA 1FBEA 3O9PA 4G68B 3TZAA 3N5LA 1TFDA 2F35A 2P0SA 4Z0IA 3CIJA 3MSTA 1DSNA 5DVIA 3FVKA 3CSGA 3RLFE 5IZ1A 3A29A 2V3TA 2FBPA 3TODA 2O69A 4MX6A 5ET7A 1MH3A 4PBQA 4IO2A 3O28A 5BUUA 5H8NB 2ANJA 1RDXA 3K4UA 2XX7A 3IJOB 3VXCA 3U92A 3MVWA 4N07A 4I3EA 4EUOA 4YKKA 1IMDA 3MP6A 4MNPA 3IOWA 3ISPA 4ZEBA 3OENA 2DQVA 4FE8A 4G68A 1B0LA 3RNNA 3K6VA 2DWAA 2HAUA 4KR5A 4N91A 1J1NA 4ELQA 1MS7A 2YLNA 3H03A 1IXIA 1NUWA 1WVJA 5HM4B 3E79A 3E78A 4JXIA 3SESA 1A54A 1MDP1 5H8NA 1IXGA 4K3FA 2Y5KA 4MNCA 3TTMA 1XC1A 3PTYA 4OVPA 1URSA 4NF4B 4H1XA 1B1XA 2ZNTA 5ITOA 2V25A 1B5IA 4X1DA 2L5VA 1I6QA 2VP1A 4XF5A 3MP8A 4IO7A 4KQPA 3D4CA 1MXYA 5KZTA 4KXPA 2Z22A 5H8QB 5LTCA 3C35A 1R6ZA 1B51A 4QSEA 4H8IA 1SW2A 3N94A 2XX9A 2V3UA 1GR2A 3DELB 2PMSA 5IKBA 3R26A 4PDDA 3T9UA 4G8HA 4GRKA 3BIGA 3U1OA 4OETA 2HZKA 5DTBA 3HPIA 2GHBA 3L6GA 3HCQA 4NF4A 4OTEA 1EU8A 1P1UA 3S2VA 1MY4A 3H6TA 3CFZA 1MQJA 3FXBA 1SI1A 2RF1A 3TCFA 1RDZA 4JSOA 4GWOA 5TU0A 1MDQA 4U4XA 5H8QA 1FTMA 1OLAA 4ZEDA 3MVZA 4WEPA 1B0HA 2QS4A 5ITPA 3Q27A 2ZMBA 3TELA 3G3JA 4JDFA 3E3KA 2DXYA 3JV9A 4DXUA 4DXCA 2OBGA 1SDXA 5ICQA 2H98A 1KA0A 4HS7A 3CHGA 2UXAA 4KPTA 3OO9A 4RY1A 5EQ8A 4P8BA 1HSJA 5LDZA 4AB6A 1SI0A 3RPLB 4OVJA 1IZ1A 2XXWA 3RPWA 4MBPA 1FJ9A 3G3HA 1MQGA 3QMFA 1NH7A 4EXKA 2O84X 4NGUA 2RC8A 5DVFA 4I9DA 3JZJA 1DCUA 1IXCA 1B7HA 5FTIA 3VXBA 4MLVA 1RYXA 5I58B 1XT8A 3ONMA 1S9TA 2Q8JA 5CM6A 1MQHA 5EYFA 1B4ZA 2AL4A 1NI9A 2ONRA 2R6GE 4UA8A 3KSJA 1NH8A 2UVJA 1RKMA 4U1OA 2A5SA 1LBVA 1PC3A 3UP9A 3RPLA 2WKYA 3Q28A 2NWJA 2H99A 3AXFA 4H8JA 2CZLA 1MXVA 4ECFA 4LZ5A 1FPJA 1O64A 4ELOA 3VLVA 2XHDA 4KFQA 3ECRA 1Q9DA 3TQWA 3CFXA 1B2HA 5I58A 3D4GA 2ZNSA 2ZNUA 2RINA 2QVVA 3PUZE 3I5OA 3LSWA 3VLWA 1QGXA 3H3GA 1MQDA 3QXMA 2Q8MA 2RC7A 1B4HA 1URDA 3T93B 4NG7A 1DPPA 2FA7A 2Q2AA 3U65A 4AS5A 3FGSA 1JW5A 2DE4A 4ND9A 4O3BA 1OIBA 1AMFA 3V89B 2XXIA 2F7CA 3N6TA 1LBBA 3U93A 4Q0CA 3C33A 4QFOA 2XXTA 3V5AA 2QRYA 3IOTA 4OFOA 3ROJA 1FTAA 1G0HA 2WEFA 3BFTA 4YB7A 4AS4A 1MH4A 2ESNA 2I4BA 3ZKLA 2D3IA 4BDMA 3BIHA 1NV3A 3K02A 3LSXA 4F3BA 3UORA 1EYKA 4GQOA 2I3VA 3B7DA 3SZPA 3DLNA 4L17A 4DI3D 3BKIB 3Q29A 3C31A 2P2AA 4DE8A 1AH5A 2HXWA 1LBXA 5H8FB 4OQOA 2XD2A 3UGWA 3FJMA 1NUXA 4NF8A 4OFLA 5DW8A 2LAOA 2B3BA 4JVIA 5JEIA 5I84A 1ZBMA 4DCXA 5TP9B 4PFIA 1XS5A 4G2ZA 3H6WA 4EQ7A 2RC9A 2PX1A 2HZLA 4BLAA 1USYE 4UABA 1FQAA 1SD3A 3ILUB 3TEPA 4GX4A 5A5XB 3FASA 4H5FA 5H8FA 5IZZA 4ZZAA 3LC8A 4R75A 5JK4A 3H6UA 3GBAA 4ZEFA 2Y84A 4KYSA 4PE3A 4NE4A 4GWZA 3O6HA 2PCRA 4G4PA 2DS9A 1INPA 3KC1A 4GIZA 1FBGA 4OEUA 4YMBA 1US5A 2E0SA 5TP9A 3H06B 4JB7A 2R8TA 1SPIA 2F3BA 5EHSA 4NWDA 2XWIA 4MH5A 4O3AA 4EXLA 5A5XA 1FPEA 1MPCA 4HCWA 1M5DA 5EYGA 4F31B 3H7MA 1NV5A 3QK6A 5AA2B 4FECA 3RYDA 4GL8A 1I6AA 1BK4A 5TPAB 3K1MA 2Z8EA 4YMAA 4YU0A 4X8RA 4E0XA 1YYZA 3O2AA 3V8XB 1D3KA 1B52A 4N15A 4YZZA 2IA4A 2WYKA 5AA3A 1PB7A 1VFEA 4NN3A 3K6XA 3O97A 5F7VA 1LB9A 2W7YA 5AA2A 4HCYA 1Y9UA 1H76A 1VE4A 2DWIA 4PFWA 2O1LA 1K9ZA 5TPAA 2D5WA 1N76A 2MKZA 4AB5A 4R73A 5CMKA 4WEDA 4I62A 4JBZA 2THIA 4C0RA 1US4A 1FJ6A 3LUZA 1Y3PA 2F97A 1LBWA 3S9EA 4XFEA 2FIEA 2UYEA 1YXIA 3TYHA 4ISUA 2HAVA 4H5GA 1Q35A 1BLFA 5EQ7A 4U4SA 2DOJA 1FTJA 2GFEA 3MZ9A 3RUMA 3OD7A 3MP1A 4U22A 3PMXA 2XXUA 1NV6A 4XKRA 2HXRA 4P0IA 4U1ZA 2H9BA 3K6WA 3QUFA 1ELJA 3T9HB 3K6UA 5CBSA 1JW1A 3FV2A 4Q30B 4GBWA 2O6AA 5L9SA 3OELA 1IITA 2PFYA 4PDHA 4ESWA 1SYHA 4F29A 1XHYA 1NFTA 2PT2A 1R9LA 1LBCA 1SW1A 1SQYA 1PB9A 3FXRA 3C34A 2QFLA 1MXZA 1FBCA 3HHGA 1B1HA 2QMXA 4PAIA 1JP4A 2OWSA 3ZS6A 1ATGA 4GL0A 3A3CA
chains in the Genus database with same CATH topology
3OO6A 5DEXB 1MM6A 4JSDA 2DVCA 4GVOA 4LUBA 2Q9TA 5FTHA 2Y7RA 4HTGA 2Z8FA 4P0GA 2QMWA 3GBBA 4WXJA 1N84A 4QFLA 5FHOA 3DM0A 3V83A 2OK2A 5KDTB 3KZGA 1POY1 4MF3A 4BDNA 3I6VA 1ZJLA 4XIGQ 1DTGA 1Y20A 3A3UA 1QVSA 5DEXA 4WKMA 5CBRA 1GV8A 4FIMA 2V3QA 1JNFA 2F8DA 5DYHA 4EF2A 3SEVA 3S4UA 1B58A 3IK6B 4F22A 5KDTA 2DSFA 3K1NA 4ZS9A 1PEBA 2RCBA 2XXXA 4KYEA 3FXQA 3EN3A 5IAIA 1MG1A 1ANFA 3SEWA 3W9VA 3G7WA 3E9XA 2I49A 4Q8RA 4GOTA 4FAJA 3KBRA 2PBWA 3KSXA 4E0WA 4KHZE 2QPQA 3K01A 3FVOA 3MC2A 2OCUA 4H0WA 4PFYA 1B3LA 3PPRA 5AA4B 2VGQA 3UA8A 4XKPA 2FNCA 3SERA 4OHNA 1CE2A 3U72A 4PFTA 5CMBA 2F7AA 2DXRA 1LFGA 1EH3A 2BJJX 1MY0A 3S9LC 1BKAA 2GRVA 3DP6A 4ZE8A 3FVGA 3PD9A 1NL5A 3IOVA 4QSCA 4DDDA 4OZ9A 1VSOA 3CG3A 1HSLA 3K1PA 2PT1A 5AA4A 5L8DA 4R74A 2X26A 5CI5A 2Y7KA 3MAMA 3C36A 4FEBA 3OO8A 2O7IA 3G3KA 1HSEA 3FIRA 2UYFA 4GFRA 4KCCA 1JW4A 4OXVA 4X48A 3Q26A 3MWBA 1SW4A 3CRBA 1L5TA 2REJA 2Y7PA 4NEDA 4POWA 2ZYKA 4F39A 1LAFE 4OERA 5AA2D 1B3HA 4PETA 1D9YA 2F36A 2XXRA 4TLLB 2XXYA 4XTCQ 4YKIA 5L9OA 4NWCA 1P99A 4RPOA 3OOAA 1GVCA 2VOZA 1DMBA 1S50A 3FXUA 2XXHA 4ZEIA 1LAXA 3PD8A 1PDAA 4DZ1A 3IJXB 1FCKA 4GD5A 4ELRA 2ONKE 4F1YA 2DWHA 2P1SA 3KEIA 1YTVA 5B7DA 2I3WA 4IO5A 3OO7A 1AOVA 4NF8B 4LVQA 2F6GA 1XVXA 1YCJA 3E4RA 3TTRA 4U21A 5DT6A 5H8HB 1FQCA 3RTFB 4Z7EA 1IUDA 4POXA 1OMPA 5L9MA 3BBRA 4OENA 3KGCA 1SVXB 3HV1A 4F18A 2VD3A 2Q89A 4R9FA 3ZKKA 4IO6A 4YB5A 3KOSA 4QFNA 3ILTB 2CMOA 3ODBA 1QUKA 2F78A 4YAHX 5B70A 3QYTA 1H44A 3JYRA 3PPPA 4BDLA 4FORA 1POTA 1LB8A 2HEUA 3IB2A 5H8HA 4TQUQ 1NMUA 2H25A 4R6YA 4EDPA 3QUJA 4GLIA 2NXOA 3TCGA 3HN0A 1YAEA 2NVUB 1MY2A 4IO3A 4GXSB 1A8EA 2I4CA 2X7QA 3SEXA 1IIWA 2GHAA 2UVHA 3H4ZA 1M5EA 1EZ9A 4ZZEA 2KLFA 3O29A 1JVYA 5I2KB 1D4NA 3TAJA 4OEVA 2X7PA 3LSFB 4QFPA 3MQ9A 2V84A 1IQ7A 3FV1A 4Q5TA 2F6PA 4JWYA 3EQ1A 3RY3A 4G68C 2DE2A 3U94A 4LA9A 3CG1A 1SW5A 1AIVA 1TT1A 2QSXA 3G3FA 2F34A 3B6QA 5I2KA 3T66A 1R9QA 4IGRA 1ZKBA 5DVJA 3VVEA 1IXHA 2DP8A 1M5BA 4ZECA 1DTZA 1O7TA 2ZYOA 3CFLA 3MVXA 5K2XA 1ZLQA 1OQGA 1TWYA 5KCJB 1B3EA 4N13A 1JVXA 1R1NA 3T9VA 3MPLA 3L6HA 2Q2CA 4YICA 1MRPA 1AL3A 4XXUA 1LAGE 1NNPA 1Y4CA 2A5TB 2H5YA 2G29A 4QSDA 1BIYA 4F3PA 1MY1A 4OFJA 2I0CA 4I8CA 3S9NC 1B05A 4DCYA 2ZYNA 3OXNA 3O66A 4JWXA 4QFKA 4PFUA 3CVGA 4H6DA 1A7LA 3K00A 3RT8A 5KCJA 5EHMA 1EZPA 2Z23A 1MQIA 1MXWA 3SEUA 5I57B 3PUXE 1ZU0A 2M8CA 1WODA 2A5TA 3EHUA 1KWHA 3M3KA 3KN3A 2ONSA 3S9MC 4OMBA 1FTOA 1II5A 1OLCA 1B9JA 1QUIA 1LCFA 3N26A 4XKQA 4RA1A 1OQHA 3HSTA 4BDRA 3IO6A 4THIA 2PVUA 5I57A 3OEKA 1VR5A 4OWDA 1N0TA 2AIXA 3SETA 1MPBA 4LONB 2ZYMA 1B7ZA 2I58A 3BFUA 1B46A 5H8SA 2PYYA 3TCHA 1OVBA 3MW0A 3WAFA 3PU5A 2QJEA 3C32A 2QS3A 3CSBA 3TFLA 1QW0A 3H6VA 1M5FA 3G3IA 1UIVA 4F2OA 3TTKA 4PP0A 1B5JA 4UACA 4TLMB 3HHFA 1UTHB 4FATA 4JWOA 5JTYB 5FHMA 3FVNA 4NF6B 2HCAA 3F11A 3UIFA 4G8NA 1MXXA 5CRYA 1B32A 3CI8A 1H3DA 3FZVA 3W9WA 5HBCA 2Y7IA 3TMGA 1OVTA 1Q1KA 2DYXA 4NMYA 2YPNA 2XXPA 4M1VA 4P11A 2ABHA 4C1UA 1LFIA 2QS1A 3KFMA 4ONYA 1Y3NA 4RYAA 1QKBA 4LZ8A 3RQTA 3FJGA 2VD2A 2RKMA 1UTHA 2E1SA 4AQ4A 4U2RA 4KYDA 5JTYA 4NF6A 2Z8DA 3MVYA 1QJMA 3FJ7A 5ISUA 3KJTA 2NOOA 1CB6A 3PUVE 3PV0E 1MXUA 1URGA 3IO4A 4NTLA 1FQEA 4GXAA 3PMWA 3OMBA 2AYSA 1MPDA 1USYH 2F7BA 5CMCA 4OYVA 4OESA 3MUQA 4KD5A 3LSLA 4R9GA 2ZXTA 2Q88A 4R6HA 4MLQA 4NF5B 1LLSA 1B7UA 1N3WA 1SBPA 2R9JA 3TTNA 2G93A 2OLBA 1UIUA 3Q25A 4G77A 1GGGA 2XXQA 1MM7A 4FJPA 2XX8A 1RYOA 2XXVA 3OSRA 3PGFA 3SEYA 4F1VA 1DOTA 3U8QA 3IR1A 3LUYA 1P1WA 1N7XA 2D21A 1JEVA 3ZSFA 4DXBA 4F3SA 3C9HA 3EHSA 3VLUA 3KJ7A 4QHQA 4F1UA 2I0BA 3K2DA 4NF5A 1N3XA 1PBPA 4QRZA 1MY3A 1ZTYA 4RK2A 2QL3A 4R6KA 1A8FA 4TOZA 3GZGA 1NNFA 4BDQA 3B6TA 1LGBC 4R2FA 4ESXA 1LCTA 3A09A 4F3GA 1FW0A 5CC2A 3GLBA 2O7UA 4BDOA 2FYIA 2VHAA 3WAEA 3IOUA 3EF7A 3K0VA 3TQLA 1JETA 1NKXA 3USDA 3W15C 4X9TA 2I48A 1XVYA 3VVFA 4IO4A 3KN7A 2I6EA 4IGTA 4RK9A 3MZBA 3PPQA 5J1DA 2IEEA 4LQ2A 1Y1MA 2OJTA 3C4MA 4R2BA 3DP8A 3IL1B 3P7IA 2DWJA 1BP5A 1UTBB 1GTKA 2QS2A 4G8MA 2HFBA 1I6BA 3FD3A 3B6WA 1S7YA 4ELPA 1SYIA 3SDFA 1B3GA 3SKPA 1H43A 3MPKA 1LSTA 3RGYA 1FQBA 3R6UA 3EHTA 3UN6A 1D9VA 3FATA 3VFJA 4QF9A 1ZMGA 1EZOA 2DVZA 1Z7NE 4EF1A 1N7WA 1UTBA 4KI0E 3M3FA 3KOTA 5F1QA 1BTJA 1O63A 3M8UA 3VE1B 2YJPA 1A99A 3LBSA 3TDJA 4H67A 4N6PA 1P1OA 3RTWB 1I69A 2RCAA 3IB0A 1T0KA 3T96B 4XKNA 4DIGA 5ELVA 1JQFA 3E13X 3MZ1A 4RXLA 4LQ5A 1QUJA 1FQDA 1FTLA 2DE3A 4MFIA 3VV5A 4X1BA 1P1QA 3TTLA 5CMMA 3HO7A 1YPNA 2ALUA 5HPQA 3PMVA 2F5XA 2Y7WA 4LATA 3O6GA 3QSLA 5AE4A 1Y3QA 1QULA 1H45A 3N6UA 4M4GA 1VFDA 3MBPA 3DP4A 3VVDA 4IY6A 3LR1A 4ZDMA 5I56B 4PQJA 3R7XA 4LZ7A 1P1NA 1FTKA 2AL5A 5BWJA 1DPEA 3TKDA 3EPEA 4IB2A 4RJZA 3I3VA 1M5CA 1UQWA 3O6IA 3FUZA 2B65A 5FHNA 4C1TA 4H65A 5M2VA 1IEJA 3QIMA 5I59B 2H4IA 1F9BA 1ZIUA 3GXAA 4RPNA 1N04A 1XOCA 5I2NB 3OEMA 4ZE9A 1PB8A 3KN8A 1B6HA 2UVIA 4YB6A 2B3FA 1TXFA 1A40A 3IX1A 5I56A 2GH9A 4EQ9A 4R72A 1Z7ME 3IB1A 3RT6B 1LFHA 2OWTA 3T22A 4F19A 4F2QA 1LAHE 3IORA 2REGA 3M3LA 5I59A 4HW8A 4ZEKA 3G3GA 5I2NA 1Y4TA 4RNSA 1WDNA 4KCDA 5K2YA 4PE5B 3OSQA 5LOMA 3RN8A 3KG2A 4GF8A 3VDFA 1B3FA 3PUYE 3TPAA 3PPNA 3UK4A 3PPOA 4I1DA 5AA1A 1QKAA 2NUVA 3MJNA 1Y1ZA 1FQFA 2UVGA 1JEUA 1NNTA 4U23A 1B40A 1A55A 3THIA 2XD3A 1NNKA 4O3CA 1B5HA 4YKJA 4IY5A 4LP2B 3CR9A 2V93A 3TUSA 2HQ0A 3IAZA 1PBQA 2O51A 3T9XB 4DLDA 4FEDA 3QAXA 1TFAA 2O68A 5ICTA 2O1MA 2R71A 3PUWE 2OZZA 4EQBA 3O9PA 4G68B 3TZAA 3N5LA 1TFDA 2F35A 2P0SA 4Z0IA 3CIJA 1DSNA 5DVIA 3FVKA 3CSGA 3RLFE 2V3TA 3TODA 2O69A 1MH3A 4IO2A 3O28A 5BUUA 5H8NB 2ANJA 3K4UA 2XX7A 3IJOB 3VXCA 3U92A 3MVWA 4N07A 4EUOA 4YKKA 3MP6A 3IOWA 4ZEBA 3OENA 2DQVA 4FE8A 4G68A 1B0LA 3RNNA 3K6VA 2DWAA 2HAUA 4KR5A 1J1NA 4ELQA 1MS7A 2YLNA 3H03A 1IXIA 1WVJA 5HM4B 4JXIA 3SESA 1A54A 1MDP1 5H8NA 1IXGA 4K3FA 3TTMA 1XC1A 1URSA 4NF4B 4H1XA 1B1XA 2ZNTA 5ITOA 2V25A 1B5IA 4X1DA 1I6QA 2VP1A 3MP8A 4IO7A 4KQPA 3D4CA 1MXYA 5KZTA 2Z22A 5H8QB 3C35A 1R6ZA 1B51A 4QSEA 4H8IA 1SW2A 3N94A 2XX9A 2V3UA 1GR2A 3DELB 2PMSA 5IKBA 3R26A 3T9UA 4G8HA 4GRKA 3U1OA 4OETA 2HZKA 5DTBA 3HPIA 2GHBA 3L6GA 3HCQA 4NF4A 4OTEA 1EU8A 1P1UA 3S2VA 1MY4A 3H6TA 3CFZA 1MQJA 1SI1A 2RF1A 3TCFA 4JSOA 4GWOA 5TU0A 1MDQA 4U4XA 5H8QA 1FTMA 1OLAA 4ZEDA 3MVZA 4WEPA 1B0HA 2QS4A 5ITPA 3Q27A 2ZMBA 3TELA 3G3JA 4JDFA 3E3KA 2DXYA 3JV9A 4DXUA 4DXCA 2OBGA 1SDXA 5ICQA 2H98A 4HS7A 2UXAA 4KPTA 3OO9A 4RY1A 1HSJA 4AB6A 1SI0A 4OVJA 1IZ1A 2XXWA 3RPWA 4MBPA 3G3HA 1MQGA 1NH7A 4EXKA 2O84X 2RC8A 5DVFA 4I9DA 3JZJA 1IXCA 1B7HA 5FTIA 3VXBA 4MLVA 1RYXA 5I58B 1XT8A 3ONMA 1S9TA 2Q8JA 5CM6A 1MQHA 5EYFA 1B4ZA 2AL4A 2ONRA 2R6GE 4UA8A 3KSJA 1NH8A 2UVJA 1RKMA 4U1OA 2A5SA 1PC3A 3UP9A 2WKYA 3Q28A 2NWJA 2H99A 3AXFA 4H8JA 2CZLA 1MXVA 4ECFA 4LZ5A 1O64A 4ELOA 3VLVA 2XHDA 4KFQA 3ECRA 3TQWA 3CFXA 1B2HA 5I58A 3D4GA 2ZNSA 2ZNUA 2RINA 3PUZE 3I5OA 3LSWA 3VLWA 3H3GA 1MQDA 3QXMA 2RC7A 1B4HA 1URDA 3T93B 1DPPA 2FA7A 2Q2AA 3FGSA 1JW5A 2DE4A 4ND9A 4O3BA 1OIBA 1AMFA 3V89B 2XXIA 2F7CA 3N6TA 1LBBA 3U93A 4Q0CA 3C33A 4QFOA 2XXTA 3V5AA 2QRYA 3IOTA 4OFOA 3BFTA 4YB7A 1MH4A 2ESNA 2I4BA 3ZKLA 2D3IA 4BDMA 3LSXA 3K02A 4F3BA 3UORA 4GQOA 2I3VA 3B7DA 3DLNA 4L17A 3BKIB 3Q29A 3C31A 2P2AA 4DE8A 1AH5A 2HXWA 5H8FB 4OQOA 2XD2A 3UGWA 3FJMA 4NF8A 4OFLA 2LAOA 2B3BA 5JEIA 5I84A 1ZBMA 4DCXA 5TP9B 1XS5A 4G2ZA 3H6WA 4EQ7A 2RC9A 2PX1A 2HZLA 4BLAA 1USYE 1FQAA 1SD3A 3ILUB 3TEPA 5A5XB 3FASA 4H5FA 5H8FA 4ZZAA 3LC8A 4R75A 5JK4A 3H6UA 3GBAA 4ZEFA 2Y84A 4KYSA 4NE4A 3O6HA 4G4PA 2DS9A 4GIZA 4OEUA 4YMBA 1US5A 2E0SA 5TP9A 3H06B 4JB7A 5EHSA 4NWDA 4MH5A 4O3AA 4EXLA 5A5XA 1MPCA 4HCWA 1M5DA 4F31B 3H7MA 3QK6A 5AA2B 4FECA 4GL8A 1I6AA 5TPAB 3K1MA 2Z8EA 4YMAA 4YU0A 4E0XA 3O2AA 3V8XB 1D3KA 1B52A 4YZZA 2IA4A 5AA3A 1PB7A 1VFEA 3K6XA 3O97A 5F7VA 1LB9A 2W7YA 5AA2A 4HCYA 1Y9UA 1H76A 1VE4A 2DWIA 4PFWA 2O1LA 5TPAA 2D5WA 1N76A 4AB5A 4R73A 5CMKA 4WEDA 4I62A 4JBZA 2THIA 4C0RA 1US4A 1Y3PA 2F97A 3S9EA 2UYEA 3TYHA 4ISUA 2HAVA 4H5GA 1Q35A 1BLFA 4U4SA 2DOJA 1FTJA 2GFEA 3MZ9A 3RUMA 3OD7A 3MP1A 4U22A 3PMXA 2XXUA 4XKRA 4P0IA 4U1ZA 2H9BA 3K6WA 3QUFA 1ELJA 3T9HB 3K6UA 5CBSA 1JW1A 3FV2A 4Q30B 2O6AA 5L9SA 3OELA 1IITA 4ESWA 1SYHA 4F29A 1XHYA 1NFTA 2PT2A 1R9LA 1LBCA 1SW1A 1SQYA 1PB9A 3FXRA 3C34A 1MXZA 3HHGA 1B1HA 2QMXA 2OWSA 3ZS6A 1ATGA 4YKPA 4GL0A 3A3CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OO6 A;  5DEX B;  1MM6 A;  4JSD A;  2DVC A;  4GVO A;  4LUB A;  2Q9T A;  5FTH A;  2Y7R A;  4HTG A;  2Z8F A;  4P0G A;  2QMW A;  3GBB A;  4WXJ A;  1N84 A;  4QFL A;  5FHO A;  3DM0 A;  3V83 A;  2OK2 A;  5KDT B;  3KZG A;  1POY 1;  4MF3 A;  4BDN A;  3I6V A;  1ZJL A;  4XIG Q;  1DTG A;  1Y20 A;  3A3U A;  1QVS A;  5DEX A;  4WKM A;  5CBR A;  1GV8 A;  4FIM A;  2V3Q A;  1JNF A;  2F8D A;  5DYH A;  4EF2 A;  3SEV A;  3S4U A;  1B58 A;  3IK6 B;  4F22 A;  5KDT A;  2DSF A;  3K1N A;  4ZS9 A;  1PEB A;  2RCB A;  2XXX A;  4KYE A;  3FXQ A;  3EN3 A;  5IAI A;  1MG1 A;  1ANF A;  3SEW A;  3W9V A;  3G7W A;  3E9X A;  2I49 A;  4Q8R A;  4GOT A;  4FAJ A;  3KBR A;  2PBW A;  3KSX A;  4E0W A;  4KHZ E;  2QPQ A;  3K01 A;  3FVO A;  3MC2 A;  2OCU A;  4H0W A;  4PFY A;  1B3L A;  3PPR A;  5AA4 B;  2VGQ A;  3UA8 A;  4XKP A;  2FNC A;  3SER A;  4OHN A;  1CE2 A;  3U72 A;  4PFT A;  5CMB A;  2F7A A;  2DXR A;  1LFG A;  1EH3 A;  2BJJ X;  1MY0 A;  3S9L C;  1BKA A;  2GRV A;  3DP6 A;  4ZE8 A;  3FVG A;  3PD9 A;  1NL5 A;  3IOV A;  4QSC A;  4DDD A;  4OZ9 A;  1VSO A;  3CG3 A;  1HSL A;  3K1P A;  2PT1 A;  5AA4 A;  5L8D A;  4R74 A;  2X26 A;  5CI5 A;  2Y7K A;  3MAM A;  3C36 A;  4FEB A;  3OO8 A;  2O7I A;  3G3K A;  1HSE A;  3FIR A;  2UYF A;  4GFR A;  4KCC A;  1JW4 A;  4OXV A;  4X48 A;  3Q26 A;  3MWB A;  1SW4 A;  3CRB A;  1L5T A;  2REJ A;  2Y7P A;  4NED A;  4POW A;  2ZYK A;  4F39 A;  1LAF E;  4OER A;  5AA2 D;  1B3H A;  4PET A;  1D9Y A;  2F36 A;  2XXR A;  4TLL B;  2XXY A;  4XTC Q;  4YKI A;  5L9O A;  4NWC A;  1P99 A;  4RPO A;  3OOA A;  1GVC A;  2VOZ A;  1DMB A;  1S50 A;  3FXU A;  2XXH A;  4ZEI A;  1LAX A;  3PD8 A;  1PDA A;  4DZ1 A;  3IJX B;  1FCK A;  4GD5 A;  4ELR A;  2ONK E;  4F1Y A;  2DWH A;  2P1S A;  3KEI A;  1YTV A;  5B7D A;  2I3W A;  4IO5 A;  3OO7 A;  1AOV A;  4NF8 B;  4LVQ A;  2F6G A;  1XVX A;  1YCJ A;  3E4R A;  3TTR A;  4U21 A;  5DT6 A;  5H8H B;  1FQC A;  3RTF B;  4Z7E A;  1IUD A;  4POX A;  1OMP A;  5L9M A;  3BBR A;  4OEN A;  3KGC A;  1SVX B;  3HV1 A;  4F18 A;  2VD3 A;  2Q89 A;  4R9F A;  3ZKK A;  4IO6 A;  4YB5 A;  3KOS A;  4QFN A;  3ILT B;  2CMO A;  3ODB A;  1QUK A;  2F78 A;  4YAH X;  5B70 A;  3QYT A;  1H44 A;  3JYR A;  3PPP A;  4BDL A;  4FOR A;  1POT A;  1LB8 A;  2HEU A;  3IB2 A;  5H8H A;  4TQU Q;  1NMU A;  2H25 A;  4R6Y A;  4EDP A;  3QUJ A;  4GLI A;  2NXO A;  3TCG A;  3HN0 A;  1YAE A;  2NVU B;  1MY2 A;  4IO3 A;  4GXS B;  1A8E A;  2I4C A;  2X7Q A;  3SEX A;  1IIW A;  2GHA A;  2UVH A;  3H4Z A;  1M5E A;  1EZ9 A;  4ZZE A;  2KLF A;  3O29 A;  1JVY A;  5I2K B;  1D4N A;  3TAJ A;  4OEV A;  2X7P A;  3LSF B;  4QFP A;  3MQ9 A;  2V84 A;  1IQ7 A;  3FV1 A;  4Q5T A;  2F6P A;  4JWY A;  3EQ1 A;  3RY3 A;  4G68 C;  2DE2 A;  3U94 A;  4LA9 A;  3CG1 A;  1SW5 A;  1AIV A;  1TT1 A;  2QSX A;  3G3F A;  2F34 A;  3B6Q A;  5I2K A;  3T66 A;  1R9Q A;  4IGR A;  1ZKB A;  5DVJ A;  3VVE A;  1IXH A;  2DP8 A;  1M5B A;  4ZEC A;  1DTZ A;  1O7T A;  2ZYO A;  3CFL A;  3MVX A;  5K2X A;  1ZLQ A;  1OQG A;  1TWY A;  5KCJ B;  1B3E A;  4N13 A;  1JVX A;  1R1N A;  3T9V A;  3MPL A;  3L6H A;  2Q2C A;  4YIC A;  1MRP A;  1AL3 A;  4XXU A;  1LAG E;  1NNP A;  1Y4C A;  2A5T B;  2H5Y A;  2G29 A;  4QSD A;  1BIY A;  4F3P A;  1MY1 A;  4OFJ A;  2I0C A;  4I8C A;  3S9N C;  1B05 A;  4DCY A;  2ZYN A;  3OXN A;  3O66 A;  4JWX A;  4QFK A;  4PFU A;  3CVG A;  4H6D A;  1A7L A;  3K00 A;  3RT8 A;  5KCJ A;  5EHM A;  1EZP A;  2Z23 A;  1MQI A;  1MXW A;  3SEU A;  5I57 B;  3PUX E;  1ZU0 A;  2M8C A;  1WOD A;  2A5T A;  3EHU A;  1KWH A;  3M3K A;  3KN3 A;  2ONS A;  3S9M C;  4OMB A;  1FTO A;  1II5 A;  1OLC A;  1B9J A;  1QUI A;  1LCF A;  3N26 A;  4XKQ A;  4RA1 A;  1OQH A;  3HST A;  4BDR A;  3IO6 A;  4THI A;  2PVU A;  5I57 A;  3OEK A;  1VR5 A;  4OWD A;  1N0T A;  2AIX A;  3SET A;  1MPB A;  4LON B;  2ZYM A;  1B7Z A;  2I58 A;  3BFU A;  1B46 A;  5H8S A;  2PYY A;  3TCH A;  1OVB A;  3MW0 A;  3WAF A;  3PU5 A;  2QJE A;  3C32 A;  2QS3 A;  3CSB A;  3TFL A;  1QW0 A;  3H6V A;  1M5F A;  3G3I A;  1UIV A;  4F2O A;  3TTK A;  4PP0 A;  1B5J A;  4UAC A;  4TLM B;  3HHF A;  1UTH B;  4FAT A;  4JWO A;  5JTY B;  5FHM A;  3FVN A;  4NF6 B;  2HCA A;  3F11 A;  3UIF A;  4G8N A;  1MXX A;  5CRY A;  1B32 A;  3CI8 A;  1H3D A;  3FZV A;  3W9W A;  5HBC A;  2Y7I A;  3TMG A;  1OVT A;  1Q1K A;  2DYX A;  4NMY A;  2YPN A;  2XXP A;  4M1V A;  4P11 A;  2ABH A;  4C1U A;  1LFI A;  2QS1 A;  3KFM A;  4ONY A;  1Y3N A;  4RYA A;  1QKB A;  4LZ8 A;  3RQT A;  3FJG A;  2VD2 A;  2RKM A;  1UTH A;  2E1S A;  4AQ4 A;  4U2R A;  4KYD A;  5JTY A;  4NF6 A;  2Z8D A;  3MVY A;  1QJM A;  3FJ7 A;  5ISU A;  3KJT A;  2NOO A;  1CB6 A;  3PUV E;  3PV0 E;  1MXU A;  1URG A;  3IO4 A;  4NTL A;  1FQE A;  4GXA A;  3PMW A;  3OMB A;  2AYS A;  1MPD A;  1USY H;  2F7B A;  5CMC A;  4OYV A;  4OES A;  3MUQ A;  4KD5 A;  3LSL A;  4R9G A;  2ZXT A;  2Q88 A;  4R6H A;  4MLQ A;  4NF5 B;  1LLS A;  1B7U A;  1N3W A;  1SBP A;  2R9J A;  3TTN A;  2G93 A;  2OLB A;  1UIU A;  3Q25 A;  4G77 A;  1GGG A;  2XXQ A;  1MM7 A;  4FJP A;  2XX8 A;  1RYO A;  2XXV A;  3OSR A;  3PGF A;  3SEY A;  4F1V A;  1DOT A;  3U8Q A;  3IR1 A;  3LUY A;  1P1W A;  1N7X A;  2D21 A;  1JEV A;  3ZSF A;  4DXB A;  4F3S A;  3C9H A;  3EHS A;  3VLU A;  3KJ7 A;  4QHQ A;  4F1U A;  2I0B A;  3K2D A;  4NF5 A;  1N3X A;  1PBP A;  4QRZ A;  1MY3 A;  1ZTY A;  4RK2 A;  2QL3 A;  4R6K A;  1A8F A;  4TOZ A;  3GZG A;  1NNF A;  4BDQ A;  3B6T A;  1LGB C;  4R2F A;  4ESX A;  1LCT A;  3A09 A;  4F3G A;  1FW0 A;  5CC2 A;  3GLB A;  2O7U A;  4BDO A;  2FYI A;  2VHA A;  3WAE A;  3IOU A;  3EF7 A;  3K0V A;  3TQL A;  1JET A;  1NKX A;  3USD A;  3W15 C;  4X9T A;  2I48 A;  1XVY A;  3VVF A;  4IO4 A;  3KN7 A;  2I6E A;  4IGT A;  4RK9 A;  3MZB A;  3PPQ A;  5J1D A;  2IEE A;  4LQ2 A;  1Y1M A;  2OJT A;  3C4M A;  4R2B A;  3DP8 A;  3IL1 B;  3P7I A;  2DWJ A;  1BP5 A;  1UTB B;  1GTK A;  2QS2 A;  4G8M A;  2HFB A;  1I6B A;  3FD3 A;  3B6W A;  1S7Y A;  4ELP A;  1SYI A;  3SDF A;  1B3G A;  3SKP A;  1H43 A;  3MPK A;  1LST A;  3RGY A;  1FQB A;  3R6U A;  3EHT A;  3UN6 A;  1D9V A;  3FAT A;  3VFJ A;  4QF9 A;  1ZMG A;  1EZO A;  2DVZ A;  1Z7N E;  4EF1 A;  1N7W A;  1UTB A;  4KI0 E;  3M3F A;  3KOT A;  5F1Q A;  1BTJ A;  1O63 A;  3M8U A;  3VE1 B;  2YJP A;  1A99 A;  3LBS A;  3TDJ A;  4H67 A;  4N6P A;  1P1O A;  3RTW B;  1I69 A;  2RCA A;  3IB0 A;  1T0K A;  3T96 B;  4XKN A;  4DIG A;  5ELV A;  1JQF A;  3E13 X;  3MZ1 A;  4RXL A;  4LQ5 A;  1QUJ A;  1FQD A;  1FTL A;  2DE3 A;  4MFI A;  3VV5 A;  4X1B A;  1P1Q A;  3TTL A;  5CMM A;  3HO7 A;  1YPN A;  2ALU A;  5HPQ A;  3PMV A;  2F5X A;  2Y7W A;  4LAT A;  3O6G A;  3QSL A;  5AE4 A;  1Y3Q A;  1QUL A;  1H45 A;  3N6U A;  4M4G A;  1VFD A;  3MBP A;  3DP4 A;  3VVD A;  4IY6 A;  3LR1 A;  4ZDM A;  5I56 B;  4PQJ A;  3R7X A;  4LZ7 A;  1P1N A;  1FTK A;  2AL5 A;  5BWJ A;  1DPE A;  3TKD A;  3EPE A;  4IB2 A;  4RJZ A;  3I3V A;  1M5C A;  1UQW A;  3O6I A;  3FUZ A;  2B65 A;  5FHN A;  4C1T A;  4H65 A;  5M2V A;  1IEJ A;  3QIM A;  5I59 B;  2H4I A;  1F9B A;  1ZIU A;  3GXA A;  4RPN A;  1N04 A;  1XOC A;  5I2N B;  3OEM A;  4ZE9 A;  1PB8 A;  3KN8 A;  1B6H A;  2UVI A;  4YB6 A;  2B3F A;  1TXF A;  1A40 A;  3IX1 A;  5I56 A;  2GH9 A;  4EQ9 A;  4R72 A;  1Z7M E;  3IB1 A;  3RT6 B;  1LFH A;  2OWT A;  3T22 A;  4F19 A;  4F2Q A;  1LAH E;  3IOR A;  2REG A;  3M3L A;  5I59 A;  4HW8 A;  4ZEK A;  3G3G A;  5I2N A;  1Y4T A;  4RNS A;  1WDN A;  4KCD A;  5K2Y A;  4PE5 B;  3OSQ A;  5LOM A;  3RN8 A;  3KG2 A;  4GF8 A;  3VDF A;  1B3F A;  3PUY E;  3TPA A;  3PPN A;  3UK4 A;  3PPO A;  4I1D A;  5AA1 A;  1QKA A;  2NUV A;  3MJN A;  1Y1Z A;  1FQF A;  2UVG A;  1JEU A;  1NNT A;  4U23 A;  1B40 A;  1A55 A;  3THI A;  2XD3 A;  1NNK A;  4O3C A;  1B5H A;  4YKJ A;  4IY5 A;  4LP2 B;  3CR9 A;  2V93 A;  3TUS A;  2HQ0 A;  3IAZ A;  1PBQ A;  2O51 A;  3T9X B;  4DLD A;  4FED A;  3QAX A;  1TFA A;  2O68 A;  5ICT A;  2O1M A;  2R71 A;  3PUW E;  2OZZ A;  4EQB A;  3O9P A;  4G68 B;  3TZA A;  3N5L A;  1TFD A;  2F35 A;  2P0S A;  4Z0I A;  3CIJ A;  1DSN A;  5DVI A;  3FVK A;  3CSG A;  3RLF E;  2V3T A;  3TOD A;  2O69 A;  1MH3 A;  4IO2 A;  3O28 A;  5BUU A;  5H8N B;  2ANJ A;  3K4U A;  2XX7 A;  3IJO B;  3VXC A;  3U92 A;  3MVW A;  4N07 A;  4EUO A;  4YKK A;  3MP6 A;  3IOW A;  4ZEB A;  3OEN A;  2DQV A;  4FE8 A;  4G68 A;  1B0L A;  3RNN A;  3K6V A;  2DWA A;  2HAU A;  4KR5 A;  1J1N A;  4ELQ A;  1MS7 A;  2YLN A;  3H03 A;  1IXI A;  1WVJ A;  5HM4 B;  4JXI A;  3SES A;  1A54 A;  1MDP 1;  5H8N A;  1IXG A;  4K3F A;  3TTM A;  1XC1 A;  1URS A;  4NF4 B;  4H1X A;  1B1X A;  2ZNT A;  5ITO A;  2V25 A;  1B5I A;  4X1D A;  1I6Q A;  2VP1 A;  3MP8 A;  4IO7 A;  4KQP A;  3D4C A;  1MXY A;  5KZT A;  2Z22 A;  5H8Q B;  3C35 A;  1R6Z A;  1B51 A;  4QSE A;  4H8I A;  1SW2 A;  3N94 A;  2XX9 A;  2V3U A;  1GR2 A;  3DEL B;  2PMS A;  5IKB A;  3R26 A;  3T9U A;  4G8H A;  4GRK A;  3U1O A;  4OET A;  2HZK A;  5DTB A;  3HPI A;  2GHB A;  3L6G A;  3HCQ A;  4NF4 A;  4OTE A;  1EU8 A;  1P1U A;  3S2V A;  1MY4 A;  3H6T A;  3CFZ A;  1MQJ A;  1SI1 A;  2RF1 A;  3TCF A;  4JSO A;  4GWO A;  5TU0 A;  1MDQ A;  4U4X A;  5H8Q A;  1FTM A;  1OLA A;  4ZED A;  3MVZ A;  4WEP A;  1B0H A;  2QS4 A;  5ITP A;  3Q27 A;  2ZMB A;  3TEL A;  3G3J A;  4JDF A;  3E3K A;  2DXY A;  3JV9 A;  4DXU A;  4DXC A;  2OBG A;  1SDX A;  5ICQ A;  2H98 A;  4HS7 A;  2UXA A;  4KPT A;  3OO9 A;  4RY1 A;  1HSJ A;  4AB6 A;  1SI0 A;  4OVJ A;  1IZ1 A;  2XXW A;  3RPW A;  4MBP A;  3G3H A;  1MQG A;  1NH7 A;  4EXK A;  2O84 X;  2RC8 A;  5DVF A;  4I9D A;  3JZJ A;  1IXC A;  1B7H A;  5FTI A;  3VXB A;  4MLV A;  1RYX A;  5I58 B;  1XT8 A;  3ONM A;  1S9T A;  2Q8J A;  5CM6 A;  1MQH A;  5EYF A;  1B4Z A;  2AL4 A;  2ONR A;  2R6G E;  4UA8 A;  3KSJ A;  1NH8 A;  2UVJ A;  1RKM A;  4U1O A;  2A5S A;  1PC3 A;  3UP9 A;  2WKY A;  3Q28 A;  2NWJ A;  2H99 A;  3AXF A;  4H8J A;  2CZL A;  1MXV A;  4ECF A;  4LZ5 A;  1O64 A;  4ELO A;  3VLV A;  2XHD A;  4KFQ A;  3ECR A;  3TQW A;  3CFX A;  1B2H A;  5I58 A;  3D4G A;  2ZNS A;  2ZNU A;  2RIN A;  3PUZ E;  3I5O A;  3LSW A;  3VLW A;  3H3G A;  1MQD A;  3QXM A;  2RC7 A;  1B4H A;  1URD A;  3T93 B;  1DPP A;  2FA7 A;  2Q2A A;  3FGS A;  1JW5 A;  2DE4 A;  4ND9 A;  4O3B A;  1OIB A;  1AMF A;  3V89 B;  2XXI A;  2F7C A;  3N6T A;  1LBB A;  3U93 A;  4Q0C A;  3C33 A;  4QFO A;  2XXT A;  3V5A A;  2QRY A;  3IOT A;  4OFO A;  3BFT A;  4YB7 A;  1MH4 A;  2ESN A;  2I4B A;  3ZKL A;  2D3I A;  4BDM A;  3LSX A;  3K02 A;  4F3B A;  3UOR A;  4GQO A;  2I3V A;  3B7D A;  3DLN A;  4L17 A;  3BKI B;  3Q29 A;  3C31 A;  2P2A A;  4DE8 A;  1AH5 A;  2HXW A;  5H8F B;  4OQO A;  2XD2 A;  3UGW A;  3FJM A;  4NF8 A;  4OFL A;  2LAO A;  2B3B A;  5JEI A;  5I84 A;  1ZBM A;  4DCX A;  5TP9 B;  1XS5 A;  4G2Z A;  3H6W A;  4EQ7 A;  2RC9 A;  2PX1 A;  2HZL A;  4BLA A;  1USY E;  1FQA A;  1SD3 A;  3ILU B;  3TEP A;  5A5X B;  3FAS A;  4H5F A;  5H8F A;  4ZZA A;  3LC8 A;  4R75 A;  5JK4 A;  3H6U A;  3GBA A;  4ZEF A;  2Y84 A;  4KYS A;  4NE4 A;  3O6H A;  4G4P A;  2DS9 A;  4GIZ A;  4OEU A;  4YMB A;  1US5 A;  2E0S A;  5TP9 A;  3H06 B;  4JB7 A;  5EHS A;  4NWD A;  4MH5 A;  4O3A A;  4EXL A;  5A5X A;  1MPC A;  4HCW A;  1M5D A;  4F31 B;  3H7M A;  3QK6 A;  5AA2 B;  4FEC A;  4GL8 A;  1I6A A;  5TPA B;  3K1M A;  2Z8E A;  4YMA A;  4YU0 A;  4E0X A;  3O2A A;  3V8X B;  1D3K A;  1B52 A;  4YZZ A;  2IA4 A;  5AA3 A;  1PB7 A;  1VFE A;  3K6X A;  3O97 A;  5F7V A;  1LB9 A;  2W7Y A;  5AA2 A;  4HCY A;  1Y9U A;  1H76 A;  1VE4 A;  2DWI A;  4PFW A;  2O1L A;  5TPA A;  2D5W A;  1N76 A;  4AB5 A;  4R73 A;  5CMK A;  4WED A;  4I62 A;  4JBZ A;  2THI A;  4C0R A;  1US4 A;  1Y3P A;  2F97 A;  3S9E A;  2UYE A;  3TYH A;  4ISU A;  2HAV A;  4H5G A;  1Q35 A;  1BLF A;  4U4S A;  2DOJ A;  1FTJ A;  2GFE A;  3MZ9 A;  3RUM A;  3OD7 A;  3MP1 A;  4U22 A;  3PMX A;  2XXU A;  4XKR A;  4P0I A;  4U1Z A;  2H9B A;  3K6W A;  3QUF A;  1ELJ A;  3T9H B;  3K6U A;  5CBS A;  1JW1 A;  3FV2 A;  4Q30 B;  2O6A A;  5L9S A;  3OEL A;  1IIT A;  4ESW A;  1SYH A;  4F29 A;  1XHY A;  1NFT A;  2PT2 A;  1R9L A;  1LBC A;  1SW1 A;  1SQY A;  1PB9 A;  3FXR A;  3C34 A;  1MXZ A;  3HHG A;  1B1H A;  2QMX A;  2OWS A;  3ZS6 A;  1ATG A;  4YKP A;  4GL0 A;  3A3C A; 
#chains in the Genus database with same CATH topology
 3OO6 A;  5DEX B;  1MM6 A;  4JSD A;  2DVC A;  4GVO A;  4MJO A;  4LUB A;  2Q9T A;  5FTH A;  2Y7R A;  4HTG A;  2Z8F A;  4P0G A;  2QMW A;  3IFC A;  4H46 A;  3GBB A;  4WXJ A;  1N84 A;  4QFL A;  5FHO A;  1XI6 A;  3DM0 A;  3V83 A;  4XEQ A;  2OK2 A;  5KDT B;  3KZG A;  1POY 1;  3NOH A;  4MF3 A;  4BDN A;  3I6V A;  1DK4 A;  1IMA A;  1ZJL A;  4XIG Q;  1DTG A;  4GWX A;  1Y20 A;  3A3U A;  1IMB A;  1QVS A;  5DEX A;  4WKM A;  5CBR A;  1GV8 A;  4FIM A;  2V3Q A;  1JNF A;  2F8D A;  5DYH A;  4EF2 A;  4PFB A;  3SEV A;  3S4U A;  1B58 A;  3IK6 B;  4F22 A;  4PGN A;  5KDT A;  2DSF A;  4GX3 A;  3K1N A;  4ZS9 A;  1PEB A;  2RCB A;  2XXX A;  2KR0 A;  4IR8 A;  4KYE A;  4O7I A;  3FXQ A;  4HE0 A;  3EN3 A;  5IAI A;  1FBP A;  1MG1 A;  1ANF A;  3SEW A;  2XWV A;  3W9V A;  3G7W A;  5ET8 A;  3E9X A;  2FIX A;  2I49 A;  4Q8R A;  4GOT A;  2OWZ A;  4OAN A;  4FAJ A;  3KBR A;  2PBW A;  3KSX A;  4E0W A;  4KHZ E;  2QPQ A;  3K01 A;  3FVO A;  3MC2 A;  2OCU A;  2Q74 A;  4H0W A;  4PFY A;  1B3L A;  3PPR A;  5AA4 B;  2VGQ A;  3UA8 A;  4XKP A;  2FNC A;  3SER A;  4OHN A;  1CE2 A;  3U72 A;  4PFT A;  5CMB A;  2F7A A;  2DXR A;  1LFG A;  4JVC A;  1EH3 A;  2BJJ X;  1MY0 A;  1YZ0 A;  3S9L C;  1BKA A;  2GRV A;  3DP6 A;  4ZE8 A;  3T1B A;  3FVG A;  3PD9 A;  1NL5 A;  3IOV A;  4QSC A;  4DDD A;  4OZ9 A;  1VSO A;  3CG3 A;  3FBP A;  1HSL A;  3K1P A;  2PT1 A;  5AA4 A;  5L8D A;  4R74 A;  2HPG A;  2X26 A;  5CI5 A;  2Y7K A;  3MAM A;  3C36 A;  2ZZW A;  4FEB A;  3OO8 A;  2O7I A;  3G3K A;  1HSE A;  3FIR A;  2UYF A;  4GFR A;  4KCC A;  1JW4 A;  4OXV A;  4X48 A;  1DBZ A;  1LEV A;  3Q26 A;  3MWB A;  1FBF A;  1SW4 A;  3CRB A;  1L5T A;  2REJ A;  2Y7P A;  5F24 A;  4NED A;  4POW A;  2ZYK A;  4F39 A;  1LAF E;  4OER A;  5AA2 D;  1B3H A;  4PET A;  1D9Y A;  2F36 A;  2XXR A;  4TLL B;  2XXY A;  4XTC Q;  4YKI A;  5L9O A;  1FPG A;  4NWC A;  1P99 A;  4RPO A;  3OOA A;  1GVC A;  2VOZ A;  2P3N A;  4QBA A;  1DMB A;  1S50 A;  3FXU A;  2XXH A;  4ZEI A;  3HFU A;  1LAX A;  2VPN A;  3PD8 A;  1PDA A;  4DZ1 A;  3IJX B;  1FCK A;  4GD5 A;  4ELR A;  2ONK E;  4F1Y A;  2DWH A;  1NV1 A;  2P1S A;  3IFA A;  3KEI A;  1YTV A;  5B7D A;  2I3W A;  4IO5 A;  3OO7 A;  1AOV A;  3T0J A;  4NF8 B;  4P1L A;  4LVQ A;  2F6G A;  1XVX A;  1YCJ A;  2B4M A;  3E4R A;  3TTR A;  2WBB A;  4U21 A;  5DT6 A;  5H8H B;  1FQC A;  3RTF B;  4Z7E A;  1IUD A;  4POX A;  1OMP A;  5L9M A;  4NAP A;  3BBR A;  4OEN A;  3KGC A;  2XA5 A;  4MAG A;  1SVX B;  3HV1 A;  4F18 A;  2VD3 A;  2Q89 A;  4R9F A;  3ZKK A;  4IO6 A;  4YB5 A;  3KOS A;  4QFN A;  3ILT B;  1FPL A;  2CMO A;  3ODB A;  1QUK A;  2F78 A;  4YAH X;  5B70 A;  3QYT A;  1H44 A;  3JYR A;  3PPP A;  4BDL A;  4FOR A;  2GQ1 A;  4N8G A;  1POT A;  1LB8 A;  2HEU A;  3IB2 A;  5H8H A;  4TQU Q;  1NMU A;  2ZZX A;  1FSA A;  2H25 A;  1D9Q A;  4R6Y A;  4EDP A;  3QUJ A;  4GLI A;  2NXO A;  1IMC A;  3TCG A;  3HN0 A;  1YAE A;  2NVU B;  1MY2 A;  5ET6 A;  4IO3 A;  4GXS B;  1A8E A;  2I4C A;  4PAK A;  2WX9 A;  2X7Q A;  3SEX A;  1AWB A;  1IIW A;  4NF0 A;  2GHA A;  2UVH A;  1FRP A;  3GYY A;  3H4Z A;  1M5E A;  1EZ9 A;  4ZZE A;  2KLF A;  3O29 A;  1JVY A;  5I2K B;  1D4N A;  5I7I A;  4YKP A;  3TAJ A;  4MNI A;  2KQZ A;  4OEV A;  2X7P A;  3LSF B;  4PFR A;  4QFP A;  4MIJ A;  3MQ9 A;  2V84 A;  1LBY A;  1IQ7 A;  3FV1 A;  4Q5T A;  2F6P A;  4JWY A;  3EQ1 A;  3RY3 A;  4G68 C;  2DE2 A;  3U94 A;  4LA9 A;  4P47 A;  3CG1 A;  1SW5 A;  1AIV A;  1TT1 A;  2QSX A;  3G3F A;  2F34 A;  3EKI A;  3B6Q A;  5I2K A;  3T66 A;  1R9Q A;  2XXK A;  1FPK A;  4IGR A;  1ZKB A;  4OVR A;  5DVJ A;  3VVE A;  1IXH A;  2QVU A;  2DP8 A;  1M5B A;  4ZEC A;  1DTZ A;  1O7T A;  2ZYO A;  3CFL A;  3MVX A;  5K2X A;  1ZLQ A;  1OQG A;  1TWY A;  5IZ3 B;  5KCJ B;  3B50 A;  1B3E A;  4N13 A;  1JVX A;  1NV4 A;  1R1N A;  3T9V A;  3MPL A;  3L6H A;  2Q2C A;  4YIC A;  1MRP A;  2JJK A;  1AL3 A;  4XXU A;  1LAG E;  1NNP A;  4QXD A;  1Y4C A;  2A5T B;  2H5Y A;  2G29 A;  4QSD A;  1BIY A;  4F3P A;  1MY1 A;  4OFJ A;  2I0C A;  4I8C A;  3S9N C;  1B05 A;  4DCY A;  2ZYN A;  3OXN A;  3O66 A;  4PAF A;  4JWX A;  4QFK A;  4PFU A;  5EQ9 A;  3CVG A;  4H6D A;  1A7L A;  2VPO A;  3K00 A;  5IZ3 A;  3RT8 A;  5KCJ A;  4LN5 A;  5EHM A;  1EZP A;  2Z23 A;  1MQI A;  1MXW A;  3SEU A;  5I57 B;  3PUX E;  1ZU0 A;  2M8C A;  1WOD A;  2A5T A;  3EHU A;  1KWH A;  3M3K A;  3KN3 A;  2ONS A;  3S9M C;  4OMB A;  1FTO A;  1II5 A;  1OLC A;  4N8Y A;  4P9K A;  1B9J A;  1QUI A;  2XWO A;  1LCF A;  3N26 A;  4XKQ A;  4RA1 A;  2OX3 A;  1OQH A;  3HST A;  4BDR A;  3IO6 A;  4THI A;  2PVU A;  5I57 A;  4HE2 A;  3OEK A;  4PC9 A;  1VR5 A;  4OVQ A;  5T3J A;  4OWD A;  5I5P A;  4DI4 B;  1N0T A;  2AIX A;  3SET A;  1MPB A;  4LON B;  2QVR A;  2ZYM A;  1B7Z A;  2I58 A;  3LV0 A;  3BFU A;  1B46 A;  5H8S A;  2PYY A;  4HXV A;  3TCH A;  1OVB A;  3MW0 A;  3WAF A;  3PU5 A;  2QJE A;  3C32 A;  2QS3 A;  3CSB A;  3TFL A;  1QW0 A;  3H6V A;  4PTK A;  1M5F A;  3G3I A;  1UIV A;  4F2O A;  3TTK A;  4I40 A;  4PP0 A;  1B5J A;  4UAC A;  4TLM B;  3HHF A;  1UTH B;  4FAT A;  4JWO A;  5JTY B;  5FHM A;  3FVN A;  4NF6 B;  5EYH A;  2HCA A;  3F11 A;  3UIF A;  3KBZ A;  4G8N A;  1MXX A;  5CRY A;  1B32 A;  4N6D A;  3B8B A;  3CI8 A;  1H3D A;  3FZV A;  3W9W A;  5HBC A;  2Y7I A;  3TMG A;  1FPI A;  1OVT A;  1Q1K A;  4P3L A;  2DYX A;  4NMY A;  2YPN A;  2XXP A;  4M1V A;  4P11 A;  2ABH A;  4C1U A;  1LFI A;  2QS1 A;  2FHY A;  3KFM A;  4ONY A;  1Y3N A;  4RYA A;  5A5L A;  1QKB A;  2HHM A;  4LZ8 A;  3RQT A;  3FJG A;  2VD2 A;  2RKM A;  1UTH A;  1G0I A;  2E1S A;  4AQ4 A;  4U2R A;  4KYD A;  5JTY A;  4NF6 A;  2Z8D A;  3MVY A;  1QJM A;  3FJ7 A;  5ISU A;  3KJT A;  2NOO A;  1CB6 A;  5ESY A;  3PUV E;  3PV0 E;  1MXU A;  1URG A;  3IO4 A;  4NTL A;  1FQE A;  4GXA A;  3PMW A;  3OMB A;  2AYS A;  1MPD A;  1USY H;  2F7B A;  5CMC A;  1EYI A;  4OYV A;  4OES A;  3MUQ A;  4KD5 A;  2CZK A;  1IME A;  3LSL A;  4I3Y A;  4R9G A;  2ZXT A;  2Q88 A;  4R6H A;  4MLQ A;  4NF5 B;  1LLS A;  1B7U A;  1N3W A;  1SBP A;  4GWS A;  2R9J A;  3TTN A;  2G93 A;  2OLB A;  1UIU A;  1KA1 A;  3Q25 A;  4G77 A;  1GGG A;  2CEY A;  2XXQ A;  1MM7 A;  4FJP A;  2XWK A;  2XX8 A;  1RYO A;  2XXV A;  3OSR A;  3PGF A;  4O8M A;  3SEY A;  4F1V A;  1DOT A;  1FBH A;  3U8Q A;  3IR1 A;  3LUY A;  1P1W A;  1N7X A;  4OVT A;  2D21 A;  1JEV A;  3ZSF A;  4O94 A;  4DXB A;  4F3S A;  3C9H A;  3EHS A;  3VLU A;  1EYJ A;  3KJ7 A;  4QHQ A;  4F1U A;  2I0B A;  2FVZ A;  3K2D A;  4NF5 A;  1N3X A;  1PBP A;  4QRZ A;  4PF8 A;  1MY3 A;  1ZTY A;  4RK2 A;  2QL3 A;  4R6K A;  1A8F A;  4TOZ A;  3GZG A;  1NNF A;  2WYP A;  4BDQ A;  3B6T A;  1LGB C;  4R2F A;  4ESX A;  1LCT A;  3A09 A;  4F3G A;  1FW0 A;  1IMF A;  5CC2 A;  3GLB A;  2O7U A;  4BDO A;  4GWU A;  2FYI A;  2VHA A;  2ZZV A;  4N6K A;  3WAE A;  4P1E A;  4JVD A;  3IOU A;  3EF7 A;  3K0V A;  3TQL A;  1JET A;  1NKX A;  3USD A;  3W15 C;  4X9T A;  2I48 A;  5J16 A;  1XVY A;  2WBD A;  4GWY A;  3VVF A;  4IO4 A;  3KN7 A;  1K9Y A;  2I6E A;  4IGT A;  4MCO A;  4RK9 A;  3MZB A;  3PPQ A;  5J1D A;  2IEE A;  4LQ2 A;  2V4C A;  1Y1M A;  2OJT A;  3C4M A;  4R2B A;  5IGA A;  3DP8 A;  2CZI A;  3IL1 B;  3P7I A;  4OVS A;  2DWJ A;  1BP5 A;  1UTB B;  1GTK A;  2QS2 A;  4G8M A;  2HFB A;  1I6B A;  3FD3 A;  3B6W A;  1S7Y A;  4ELP A;  1SYI A;  3SDF A;  1B3G A;  4N4U A;  3D1R A;  2PFZ A;  5IM2 A;  3SKP A;  1H43 A;  3MPK A;  1LST A;  3RGY A;  1FQB A;  3R6U A;  3EHT A;  3UN6 A;  1D9V A;  3FAT A;  4NQ8 A;  3VFJ A;  4QF9 A;  1VDW A;  1ZMG A;  4FBP A;  1EZO A;  5FBP A;  2DVZ A;  1Z7N E;  4EF1 A;  1N7W A;  3KC0 A;  1UTB A;  4KI0 E;  3M3F A;  4GX6 A;  3KOT A;  4MMP A;  5F1Q A;  1BTJ A;  4NX1 A;  4O7M A;  1O63 A;  3M8U A;  3VE1 B;  4P56 A;  2YJP A;  1A99 A;  3MYU A;  3LBS A;  3TDJ A;  4H67 A;  4N6P A;  1P1O A;  3RTW B;  1I69 A;  2RCA A;  3IB0 A;  1T0K A;  1FPD A;  3T96 B;  4XKN A;  4DIG A;  5ELV A;  1JQF A;  3E13 X;  3MZ1 A;  4RXL A;  4LQ5 A;  2F3D A;  1QUJ A;  1FQD A;  1FTL A;  2DE3 A;  4MFI A;  3VV5 A;  5EQA A;  4X1B A;  4GBV A;  1P1Q A;  3TTL A;  5CMM A;  3HO7 A;  4HE1 A;  1YPN A;  2ALU A;  2B4L A;  4G61 A;  4PCD A;  5HPQ A;  1KZ8 A;  3PMV A;  2F5X A;  2Y7W A;  4LAT A;  3O6G A;  3QSL A;  5AE4 A;  1Y3Q A;  1QUL A;  1H45 A;  3N6U A;  4M4G A;  4OA4 A;  1VFD A;  3MBP A;  3DP4 A;  3VVD A;  4IY6 A;  3LR1 A;  4ZDM A;  5I56 B;  4PQJ A;  3R7X A;  4LZ7 A;  1P1N A;  1FTK A;  2AL5 A;  5BWJ A;  5ET5 A;  5I3S A;  4GWW A;  1DPE A;  3TKD A;  3EPE A;  4IB2 A;  4RJZ A;  3I3V A;  1M5C A;  1UQW A;  3O6I A;  4N17 A;  3FUZ A;  2B65 A;  5FHN A;  4C1T A;  4H65 A;  5M2V A;  1IEJ A;  3QIM A;  5I59 B;  2H4I A;  4MEV A;  1F9B A;  1ZIU A;  3GXA A;  1NV2 A;  4RPN A;  1FPF A;  1N04 A;  1XOC A;  5I2N B;  4X04 A;  3OEM A;  4ZE9 A;  1PB8 A;  3KN8 A;  1FPB A;  1B6H A;  2UVI A;  4YB6 A;  2B3F A;  1TXF A;  1A40 A;  3IX1 A;  5I56 A;  2GH9 A;  4EQ9 A;  1FBD A;  4R72 A;  1Z7M E;  3IB1 A;  3RT6 B;  1LFH A;  2OWT A;  3T22 A;  4F19 A;  4F2Q A;  1LAH E;  4PBH A;  3IOR A;  2P3V A;  2REG A;  3M3L A;  4NHB A;  5I59 A;  4HW8 A;  4ZEK A;  3G3G A;  4N81 A;  2VT5 A;  1Y4T A;  5I2N A;  4PF6 A;  4RNS A;  2BJI A;  1WDN A;  4KCD A;  5K2Y A;  4PE5 B;  3OSQ A;  5LOM A;  3RN8 A;  1LBZ A;  3KG2 A;  4GF8 A;  3VDF A;  1B3F A;  3PUY E;  3TPA A;  3PPN A;  3UK4 A;  3PPO A;  4I1D A;  5AA1 A;  1QKA A;  2NUV A;  3MJN A;  1Y1Z A;  1FQF A;  2UVG A;  1JEU A;  1NNT A;  4U23 A;  1B40 A;  4MHF A;  1A55 A;  2XD3 A;  3THI A;  1NNK A;  4O3C A;  1B5H A;  2DDK A;  1NUY A;  4YKJ A;  4IY5 A;  4LP2 B;  2CEX A;  2CZH A;  3CR9 A;  4H45 A;  1NV7 A;  2V93 A;  2Y5L A;  3TUS A;  2HQ0 A;  3IAZ A;  1NV0 A;  1PBQ A;  4PGP A;  2O51 A;  3T9X B;  4DLD A;  4FED A;  3QAX A;  1TFA A;  2O68 A;  5ICT A;  2O1M A;  2R71 A;  1NUZ A;  3PUW E;  1RDY A;  2OZZ A;  4EQB A;  1CNQ A;  1FBE A;  3O9P A;  4G68 B;  3TZA A;  3N5L A;  1TFD A;  2F35 A;  2P0S A;  4Z0I A;  3CIJ A;  3MST A;  1DSN A;  5DVI A;  3FVK A;  3CSG A;  3RLF E;  5IZ1 A;  3A29 A;  2V3T A;  2FBP A;  3TOD A;  2O69 A;  4MX6 A;  5ET7 A;  1MH3 A;  4PBQ A;  4IO2 A;  3O28 A;  5BUU A;  5H8N B;  2ANJ A;  1RDX A;  3K4U A;  2XX7 A;  3IJO B;  3VXC A;  3U92 A;  3MVW A;  4N07 A;  4I3E A;  4EUO A;  4YKK A;  1IMD A;  3MP6 A;  4MNP A;  3IOW A;  3ISP A;  4ZEB A;  3OEN A;  2DQV A;  4FE8 A;  4G68 A;  1B0L A;  3RNN A;  3K6V A;  2DWA A;  2HAU A;  4KR5 A;  4N91 A;  1J1N A;  4ELQ A;  1MS7 A;  2YLN A;  3H03 A;  1IXI A;  1NUW A;  1WVJ A;  5HM4 B;  3E79 A;  3E78 A;  4JXI A;  3SES A;  1A54 A;  1MDP 1;  5H8N A;  1IXG A;  4K3F A;  2Y5K A;  4MNC A;  3TTM A;  1XC1 A;  3PTY A;  4OVP A;  1URS A;  4NF4 B;  4H1X A;  1B1X A;  2ZNT A;  5ITO A;  2V25 A;  1B5I A;  4X1D A;  2L5V A;  1I6Q A;  2VP1 A;  4XF5 A;  3MP8 A;  4IO7 A;  4KQP A;  3D4C A;  1MXY A;  5KZT A;  4KXP A;  2Z22 A;  5H8Q B;  5LTC A;  3C35 A;  1R6Z A;  1B51 A;  4QSE A;  4H8I A;  1SW2 A;  3N94 A;  2XX9 A;  2V3U A;  1GR2 A;  3DEL B;  2PMS A;  5IKB A;  3R26 A;  4PDD A;  3T9U A;  4G8H A;  4GRK A;  3BIG A;  3U1O A;  4OET A;  2HZK A;  5DTB A;  3HPI A;  2GHB A;  3L6G A;  3HCQ A;  4NF4 A;  4OTE A;  1EU8 A;  1P1U A;  3S2V A;  1MY4 A;  3H6T A;  3CFZ A;  1MQJ A;  3FXB A;  1SI1 A;  2RF1 A;  3TCF A;  1RDZ A;  4JSO A;  4GWO A;  5TU0 A;  1MDQ A;  4U4X A;  5H8Q A;  1FTM A;  1OLA A;  4ZED A;  3MVZ A;  4WEP A;  1B0H A;  2QS4 A;  5ITP A;  3Q27 A;  2ZMB A;  3TEL A;  3G3J A;  4JDF A;  3E3K A;  2DXY A;  3JV9 A;  4DXU A;  4DXC A;  2OBG A;  1SDX A;  5ICQ A;  2H98 A;  1KA0 A;  4HS7 A;  3CHG A;  2UXA A;  4KPT A;  3OO9 A;  4RY1 A;  5EQ8 A;  4P8B A;  1HSJ A;  5LDZ A;  4AB6 A;  1SI0 A;  3RPL B;  4OVJ A;  1IZ1 A;  2XXW A;  3RPW A;  4MBP A;  1FJ9 A;  3G3H A;  1MQG A;  3QMF A;  1NH7 A;  4EXK A;  2O84 X;  4NGU A;  2RC8 A;  5DVF A;  4I9D A;  3JZJ A;  1DCU A;  1IXC A;  1B7H A;  5FTI A;  3VXB A;  4MLV A;  1RYX A;  5I58 B;  1XT8 A;  3ONM A;  1S9T A;  2Q8J A;  5CM6 A;  1MQH A;  5EYF A;  1B4Z A;  2AL4 A;  1NI9 A;  2ONR A;  2R6G E;  4UA8 A;  3KSJ A;  1NH8 A;  2UVJ A;  1RKM A;  4U1O A;  2A5S A;  1LBV A;  1PC3 A;  3UP9 A;  3RPL A;  2WKY A;  3Q28 A;  2NWJ A;  2H99 A;  3AXF A;  4H8J A;  2CZL A;  1MXV A;  4ECF A;  4LZ5 A;  1FPJ A;  1O64 A;  4ELO A;  3VLV A;  2XHD A;  4KFQ A;  3ECR A;  1Q9D A;  3TQW A;  3CFX A;  1B2H A;  5I58 A;  3D4G A;  2ZNS A;  2ZNU A;  2RIN A;  2QVV A;  3PUZ E;  3I5O A;  3LSW A;  3VLW A;  1QGX A;  3H3G A;  1MQD A;  3QXM A;  2Q8M A;  2RC7 A;  1B4H A;  1URD A;  3T93 B;  4NG7 A;  1DPP A;  2FA7 A;  2Q2A A;  3U65 A;  4AS5 A;  3FGS A;  1JW5 A;  2DE4 A;  4ND9 A;  4O3B A;  1OIB A;  1AMF A;  3V89 B;  2XXI A;  2F7C A;  3N6T A;  1LBB A;  3U93 A;  4Q0C A;  3C33 A;  4QFO A;  2XXT A;  3V5A A;  2QRY A;  3IOT A;  4OFO A;  3ROJ A;  1FTA A;  1G0H A;  2WEF A;  3BFT A;  4YB7 A;  4AS4 A;  1MH4 A;  2ESN A;  2I4B A;  3ZKL A;  2D3I A;  4BDM A;  3BIH A;  1NV3 A;  3K02 A;  3LSX A;  4F3B A;  3UOR A;  1EYK A;  4GQO A;  2I3V A;  3B7D A;  3SZP A;  3DLN A;  4L17 A;  4DI3 D;  3BKI B;  3Q29 A;  3C31 A;  2P2A A;  4DE8 A;  1AH5 A;  2HXW A;  1LBX A;  5H8F B;  4OQO A;  2XD2 A;  3UGW A;  3FJM A;  1NUX A;  4NF8 A;  4OFL A;  5DW8 A;  2LAO A;  2B3B A;  4JVI A;  5JEI A;  5I84 A;  1ZBM A;  4DCX A;  5TP9 B;  4PFI A;  1XS5 A;  4G2Z A;  3H6W A;  4EQ7 A;  2RC9 A;  2PX1 A;  2HZL A;  4BLA A;  1USY E;  4UAB A;  1FQA A;  1SD3 A;  3ILU B;  3TEP A;  4GX4 A;  5A5X B;  3FAS A;  4H5F A;  5H8F A;  5IZZ A;  4ZZA A;  3LC8 A;  4R75 A;  5JK4 A;  3H6U A;  3GBA A;  4ZEF A;  2Y84 A;  4KYS A;  4PE3 A;  4NE4 A;  4GWZ A;  3O6H A;  2PCR A;  4G4P A;  2DS9 A;  1INP A;  3KC1 A;  4GIZ A;  1FBG A;  4OEU A;  4YMB A;  1US5 A;  2E0S A;  5TP9 A;  3H06 B;  4JB7 A;  2R8T A;  1SPI A;  2F3B A;  5EHS A;  4NWD A;  2XWI A;  4MH5 A;  4O3A A;  4EXL A;  5A5X A;  1FPE A;  1MPC A;  4HCW A;  1M5D A;  5EYG A;  4F31 B;  3H7M A;  1NV5 A;  3QK6 A;  5AA2 B;  4FEC A;  3RYD A;  4GL8 A;  1I6A A;  1BK4 A;  5TPA B;  3K1M A;  2Z8E A;  4YMA A;  4YU0 A;  4X8R A;  4E0X A;  1YYZ A;  3O2A A;  3V8X B;  1D3K A;  1B52 A;  4N15 A;  4YZZ A;  2IA4 A;  2WYK A;  5AA3 A;  1PB7 A;  1VFE A;  4NN3 A;  3K6X A;  3O97 A;  5F7V A;  1LB9 A;  2W7Y A;  5AA2 A;  4HCY A;  1Y9U A;  1H76 A;  1VE4 A;  2DWI A;  4PFW A;  2O1L A;  1K9Z A;  5TPA A;  2D5W A;  1N76 A;  2MKZ A;  4AB5 A;  4R73 A;  5CMK A;  4WED A;  4I62 A;  4JBZ A;  2THI A;  4C0R A;  1US4 A;  1FJ6 A;  3LUZ A;  1Y3P A;  2F97 A;  1LBW A;  3S9E A;  4XFE A;  2FIE A;  2UYE A;  1YXI A;  3TYH A;  4ISU A;  2HAV A;  4H5G A;  1Q35 A;  1BLF A;  5EQ7 A;  4U4S A;  2DOJ A;  1FTJ A;  2GFE A;  3MZ9 A;  3RUM A;  3OD7 A;  3MP1 A;  4U22 A;  3PMX A;  2XXU A;  1NV6 A;  4XKR A;  2HXR A;  4P0I A;  4U1Z A;  2H9B A;  3K6W A;  3QUF A;  1ELJ A;  3T9H B;  3K6U A;  5CBS A;  1JW1 A;  3FV2 A;  4Q30 B;  4GBW A;  2O6A A;  5L9S A;  3OEL A;  1IIT A;  2PFY A;  4PDH A;  4ESW A;  1SYH A;  4F29 A;  1XHY A;  1NFT A;  2PT2 A;  1R9L A;  1LBC A;  1SW1 A;  1SQY A;  1PB9 A;  3FXR A;  3C34 A;  2QFL A;  1MXZ A;  1FBC A;  3HHG A;  1B1H A;  2QMX A;  4PAI A;  1JP4 A;  2OWS A;  3ZS6 A;  1ATG A;  4GL0 A;  3A3C A; 
#chains in the Genus database with same CATH homology
 3OO6 A;  5DEX B;  1MM6 A;  4JSD A;  2DVC A;  4GVO A;  4LUB A;  2Q9T A;  5FTH A;  2Y7R A;  4HTG A;  2Z8F A;  4P0G A;  2QMW A;  3GBB A;  4WXJ A;  1N84 A;  4QFL A;  5FHO A;  3DM0 A;  3V83 A;  2OK2 A;  5KDT B;  3KZG A;  1POY 1;  4MF3 A;  4BDN A;  3I6V A;  1ZJL A;  4XIG Q;  1DTG A;  1Y20 A;  3A3U A;  1QVS A;  5DEX A;  4WKM A;  5CBR A;  1GV8 A;  4FIM A;  2V3Q A;  1JNF A;  2F8D A;  5DYH A;  4EF2 A;  3SEV A;  3S4U A;  1B58 A;  3IK6 B;  4F22 A;  5KDT A;  2DSF A;  3K1N A;  4ZS9 A;  1PEB A;  2RCB A;  2XXX A;  4KYE A;  3FXQ A;  3EN3 A;  5IAI A;  1MG1 A;  1ANF A;  3SEW A;  3W9V A;  3G7W A;  3E9X A;  2I49 A;  4Q8R A;  4GOT A;  4FAJ A;  3KBR A;  2PBW A;  3KSX A;  4E0W A;  4KHZ E;  2QPQ A;  3K01 A;  3FVO A;  3MC2 A;  2OCU A;  4H0W A;  4PFY A;  1B3L A;  3PPR A;  5AA4 B;  2VGQ A;  3UA8 A;  4XKP A;  2FNC A;  3SER A;  4OHN A;  1CE2 A;  3U72 A;  4PFT A;  5CMB A;  2F7A A;  2DXR A;  1LFG A;  1EH3 A;  2BJJ X;  1MY0 A;  3S9L C;  1BKA A;  2GRV A;  3DP6 A;  4ZE8 A;  3FVG A;  3PD9 A;  1NL5 A;  3IOV A;  4QSC A;  4DDD A;  4OZ9 A;  1VSO A;  3CG3 A;  1HSL A;  3K1P A;  2PT1 A;  5AA4 A;  5L8D A;  4R74 A;  2X26 A;  5CI5 A;  2Y7K A;  3MAM A;  3C36 A;  4FEB A;  3OO8 A;  2O7I A;  3G3K A;  1HSE A;  3FIR A;  2UYF A;  4GFR A;  4KCC A;  1JW4 A;  4OXV A;  4X48 A;  3Q26 A;  3MWB A;  1SW4 A;  3CRB A;  1L5T A;  2REJ A;  2Y7P A;  4NED A;  4POW A;  2ZYK A;  4F39 A;  1LAF E;  4OER A;  5AA2 D;  1B3H A;  4PET A;  1D9Y A;  2F36 A;  2XXR A;  4TLL B;  2XXY A;  4XTC Q;  4YKI A;  5L9O A;  4NWC A;  1P99 A;  4RPO A;  3OOA A;  1GVC A;  2VOZ A;  1DMB A;  1S50 A;  3FXU A;  2XXH A;  4ZEI A;  1LAX A;  3PD8 A;  1PDA A;  4DZ1 A;  3IJX B;  1FCK A;  4GD5 A;  4ELR A;  2ONK E;  4F1Y A;  2DWH A;  2P1S A;  3KEI A;  1YTV A;  5B7D A;  2I3W A;  4IO5 A;  3OO7 A;  1AOV A;  4NF8 B;  4LVQ A;  2F6G A;  1XVX A;  1YCJ A;  3E4R A;  3TTR A;  4U21 A;  5DT6 A;  5H8H B;  1FQC A;  3RTF B;  4Z7E A;  1IUD A;  4POX A;  1OMP A;  5L9M A;  3BBR A;  4OEN A;  3KGC A;  1SVX B;  3HV1 A;  4F18 A;  2VD3 A;  2Q89 A;  4R9F A;  3ZKK A;  4IO6 A;  4YB5 A;  3KOS A;  4QFN A;  3ILT B;  2CMO A;  3ODB A;  1QUK A;  2F78 A;  4YAH X;  5B70 A;  3QYT A;  1H44 A;  3JYR A;  3PPP A;  4BDL A;  4FOR A;  1POT A;  1LB8 A;  2HEU A;  3IB2 A;  5H8H A;  4TQU Q;  1NMU A;  2H25 A;  4R6Y A;  4EDP A;  3QUJ A;  4GLI A;  2NXO A;  3TCG A;  3HN0 A;  1YAE A;  2NVU B;  1MY2 A;  4IO3 A;  4GXS B;  1A8E A;  2I4C A;  2X7Q A;  3SEX A;  1IIW A;  2GHA A;  2UVH A;  3H4Z A;  1M5E A;  1EZ9 A;  4ZZE A;  2KLF A;  3O29 A;  1JVY A;  5I2K B;  1D4N A;  3TAJ A;  4OEV A;  2X7P A;  3LSF B;  4QFP A;  3MQ9 A;  2V84 A;  1IQ7 A;  3FV1 A;  4Q5T A;  2F6P A;  4JWY A;  3EQ1 A;  3RY3 A;  4G68 C;  2DE2 A;  3U94 A;  4LA9 A;  3CG1 A;  1SW5 A;  1AIV A;  1TT1 A;  2QSX A;  3G3F A;  2F34 A;  3B6Q A;  5I2K A;  3T66 A;  1R9Q A;  4IGR A;  1ZKB A;  5DVJ A;  3VVE A;  1IXH A;  2DP8 A;  1M5B A;  4ZEC A;  1DTZ A;  1O7T A;  2ZYO A;  3CFL A;  3MVX A;  5K2X A;  1ZLQ A;  1OQG A;  1TWY A;  5KCJ B;  1B3E A;  4N13 A;  1JVX A;  1R1N A;  3T9V A;  3MPL A;  3L6H A;  2Q2C A;  4YIC A;  1MRP A;  1AL3 A;  4XXU A;  1LAG E;  1NNP A;  1Y4C A;  2A5T B;  2H5Y A;  2G29 A;  4QSD A;  1BIY A;  4F3P A;  1MY1 A;  4OFJ A;  2I0C A;  4I8C A;  3S9N C;  1B05 A;  4DCY A;  2ZYN A;  3OXN A;  3O66 A;  4JWX A;  4QFK A;  4PFU A;  3CVG A;  4H6D A;  1A7L A;  3K00 A;  3RT8 A;  5KCJ A;  5EHM A;  1EZP A;  2Z23 A;  1MQI A;  1MXW A;  3SEU A;  5I57 B;  3PUX E;  1ZU0 A;  2M8C A;  1WOD A;  2A5T A;  3EHU A;  1KWH A;  3M3K A;  3KN3 A;  2ONS A;  3S9M C;  4OMB A;  1FTO A;  1II5 A;  1OLC A;  1B9J A;  1QUI A;  1LCF A;  3N26 A;  4XKQ A;  4RA1 A;  1OQH A;  3HST A;  4BDR A;  3IO6 A;  4THI A;  2PVU A;  5I57 A;  3OEK A;  1VR5 A;  4OWD A;  1N0T A;  2AIX A;  3SET A;  1MPB A;  4LON B;  2ZYM A;  1B7Z A;  2I58 A;  3BFU A;  1B46 A;  5H8S A;  2PYY A;  3TCH A;  1OVB A;  3MW0 A;  3WAF A;  3PU5 A;  2QJE A;  3C32 A;  2QS3 A;  3CSB A;  3TFL A;  1QW0 A;  3H6V A;  1M5F A;  3G3I A;  1UIV A;  4F2O A;  3TTK A;  4PP0 A;  1B5J A;  4UAC A;  4TLM B;  3HHF A;  1UTH B;  4FAT A;  4JWO A;  5JTY B;  5FHM A;  3FVN A;  4NF6 B;  2HCA A;  3F11 A;  3UIF A;  4G8N A;  1MXX A;  5CRY A;  1B32 A;  3CI8 A;  1H3D A;  3FZV A;  3W9W A;  5HBC A;  2Y7I A;  3TMG A;  1OVT A;  1Q1K A;  2DYX A;  4NMY A;  2YPN A;  2XXP A;  4M1V A;  4P11 A;  2ABH A;  4C1U A;  1LFI A;  2QS1 A;  3KFM A;  4ONY A;  1Y3N A;  4RYA A;  1QKB A;  4LZ8 A;  3RQT A;  3FJG A;  2VD2 A;  2RKM A;  1UTH A;  2E1S A;  4AQ4 A;  4U2R A;  4KYD A;  5JTY A;  4NF6 A;  2Z8D A;  3MVY A;  1QJM A;  3FJ7 A;  5ISU A;  3KJT A;  2NOO A;  1CB6 A;  3PUV E;  3PV0 E;  1MXU A;  1URG A;  3IO4 A;  4NTL A;  1FQE A;  4GXA A;  3PMW A;  3OMB A;  2AYS A;  1MPD A;  1USY H;  2F7B A;  5CMC A;  4OYV A;  4OES A;  3MUQ A;  4KD5 A;  3LSL A;  4R9G A;  2ZXT A;  2Q88 A;  4R6H A;  4MLQ A;  4NF5 B;  1LLS A;  1B7U A;  1N3W A;  1SBP A;  2R9J A;  3TTN A;  2G93 A;  2OLB A;  1UIU A;  3Q25 A;  4G77 A;  1GGG A;  2XXQ A;  1MM7 A;  4FJP A;  2XX8 A;  1RYO A;  2XXV A;  3OSR A;  3PGF A;  3SEY A;  4F1V A;  1DOT A;  3U8Q A;  3IR1 A;  3LUY A;  1P1W A;  1N7X A;  2D21 A;  1JEV A;  3ZSF A;  4DXB A;  4F3S A;  3C9H A;  3EHS A;  3VLU A;  3KJ7 A;  4QHQ A;  4F1U A;  2I0B A;  3K2D A;  4NF5 A;  1N3X A;  1PBP A;  4QRZ A;  1MY3 A;  1ZTY A;  4RK2 A;  2QL3 A;  4R6K A;  1A8F A;  4TOZ A;  3GZG A;  1NNF A;  4BDQ A;  3B6T A;  1LGB C;  4R2F A;  4ESX A;  1LCT A;  3A09 A;  4F3G A;  1FW0 A;  5CC2 A;  3GLB A;  2O7U A;  4BDO A;  2FYI A;  2VHA A;  3WAE A;  3IOU A;  3EF7 A;  3K0V A;  3TQL A;  1JET A;  1NKX A;  3USD A;  3W15 C;  4X9T A;  2I48 A;  1XVY A;  3VVF A;  4IO4 A;  3KN7 A;  2I6E A;  4IGT A;  4RK9 A;  3MZB A;  3PPQ A;  5J1D A;  2IEE A;  4LQ2 A;  1Y1M A;  2OJT A;  3C4M A;  4R2B A;  3DP8 A;  3IL1 B;  3P7I A;  2DWJ A;  1BP5 A;  1UTB B;  1GTK A;  2QS2 A;  4G8M A;  2HFB A;  1I6B A;  3FD3 A;  3B6W A;  1S7Y A;  4ELP A;  1SYI A;  3SDF A;  1B3G A;  3SKP A;  1H43 A;  3MPK A;  1LST A;  3RGY A;  1FQB A;  3R6U A;  3EHT A;  3UN6 A;  1D9V A;  3FAT A;  3VFJ A;  4QF9 A;  1ZMG A;  1EZO A;  2DVZ A;  1Z7N E;  4EF1 A;  1N7W A;  1UTB A;  4KI0 E;  3M3F A;  3KOT A;  5F1Q A;  1BTJ A;  1O63 A;  3M8U A;  3VE1 B;  2YJP A;  1A99 A;  3LBS A;  3TDJ A;  4H67 A;  4N6P A;  1P1O A;  3RTW B;  1I69 A;  2RCA A;  3IB0 A;  1T0K A;  3T96 B;  4XKN A;  4DIG A;  5ELV A;  1JQF A;  3E13 X;  3MZ1 A;  4RXL A;  4LQ5 A;  1QUJ A;  1FQD A;  1FTL A;  2DE3 A;  4MFI A;  3VV5 A;  4X1B A;  1P1Q A;  3TTL A;  5CMM A;  3HO7 A;  1YPN A;  2ALU A;  5HPQ A;  3PMV A;  2F5X A;  2Y7W A;  4LAT A;  3O6G A;  3QSL A;  5AE4 A;  1Y3Q A;  1QUL A;  1H45 A;  3N6U A;  4M4G A;  1VFD A;  3MBP A;  3DP4 A;  3VVD A;  4IY6 A;  3LR1 A;  4ZDM A;  5I56 B;  4PQJ A;  3R7X A;  4LZ7 A;  1P1N A;  1FTK A;  2AL5 A;  5BWJ A;  1DPE A;  3TKD A;  3EPE A;  4IB2 A;  4RJZ A;  3I3V A;  1M5C A;  1UQW A;  3O6I A;  3FUZ A;  2B65 A;  5FHN A;  4C1T A;  4H65 A;  5M2V A;  1IEJ A;  3QIM A;  5I59 B;  2H4I A;  1F9B A;  1ZIU A;  3GXA A;  4RPN A;  1N04 A;  1XOC A;  5I2N B;  3OEM A;  4ZE9 A;  1PB8 A;  3KN8 A;  1B6H A;  2UVI A;  4YB6 A;  2B3F A;  1TXF A;  1A40 A;  3IX1 A;  5I56 A;  2GH9 A;  4EQ9 A;  4R72 A;  1Z7M E;  3IB1 A;  3RT6 B;  1LFH A;  2OWT A;  3T22 A;  4F19 A;  4F2Q A;  1LAH E;  3IOR A;  2REG A;  3M3L A;  5I59 A;  4HW8 A;  4ZEK A;  3G3G A;  5I2N A;  1Y4T A;  4RNS A;  1WDN A;  4KCD A;  5K2Y A;  4PE5 B;  3OSQ A;  5LOM A;  3RN8 A;  3KG2 A;  4GF8 A;  3VDF A;  1B3F A;  3PUY E;  3TPA A;  3PPN A;  3UK4 A;  3PPO A;  4I1D A;  5AA1 A;  1QKA A;  2NUV A;  3MJN A;  1Y1Z A;  1FQF A;  2UVG A;  1JEU A;  1NNT A;  4U23 A;  1B40 A;  1A55 A;  3THI A;  2XD3 A;  1NNK A;  4O3C A;  1B5H A;  4YKJ A;  4IY5 A;  4LP2 B;  3CR9 A;  2V93 A;  3TUS A;  2HQ0 A;  3IAZ A;  1PBQ A;  2O51 A;  3T9X B;  4DLD A;  4FED A;  3QAX A;  1TFA A;  2O68 A;  5ICT A;  2O1M A;  2R71 A;  3PUW E;  2OZZ A;  4EQB A;  3O9P A;  4G68 B;  3TZA A;  3N5L A;  1TFD A;  2F35 A;  2P0S A;  4Z0I A;  3CIJ A;  1DSN A;  5DVI A;  3FVK A;  3CSG A;  3RLF E;  2V3T A;  3TOD A;  2O69 A;  1MH3 A;  4IO2 A;  3O28 A;  5BUU A;  5H8N B;  2ANJ A;  3K4U A;  2XX7 A;  3IJO B;  3VXC A;  3U92 A;  3MVW A;  4N07 A;  4EUO A;  4YKK A;  3MP6 A;  3IOW A;  4ZEB A;  3OEN A;  2DQV A;  4FE8 A;  4G68 A;  1B0L A;  3RNN A;  3K6V A;  2DWA A;  2HAU A;  4KR5 A;  1J1N A;  4ELQ A;  1MS7 A;  2YLN A;  3H03 A;  1IXI A;  1WVJ A;  5HM4 B;  4JXI A;  3SES A;  1A54 A;  1MDP 1;  5H8N A;  1IXG A;  4K3F A;  3TTM A;  1XC1 A;  1URS A;  4NF4 B;  4H1X A;  1B1X A;  2ZNT A;  5ITO A;  2V25 A;  1B5I A;  4X1D A;  1I6Q A;  2VP1 A;  3MP8 A;  4IO7 A;  4KQP A;  3D4C A;  1MXY A;  5KZT A;  2Z22 A;  5H8Q B;  3C35 A;  1R6Z A;  1B51 A;  4QSE A;  4H8I A;  1SW2 A;  3N94 A;  2XX9 A;  2V3U A;  1GR2 A;  3DEL B;  2PMS A;  5IKB A;  3R26 A;  3T9U A;  4G8H A;  4GRK A;  3U1O A;  4OET A;  2HZK A;  5DTB A;  3HPI A;  2GHB A;  3L6G A;  3HCQ A;  4NF4 A;  4OTE A;  1EU8 A;  1P1U A;  3S2V A;  1MY4 A;  3H6T A;  3CFZ A;  1MQJ A;  1SI1 A;  2RF1 A;  3TCF A;  4JSO A;  4GWO A;  5TU0 A;  1MDQ A;  4U4X A;  5H8Q A;  1FTM A;  1OLA A;  4ZED A;  3MVZ A;  4WEP A;  1B0H A;  2QS4 A;  5ITP A;  3Q27 A;  2ZMB A;  3TEL A;  3G3J A;  4JDF A;  3E3K A;  2DXY A;  3JV9 A;  4DXU A;  4DXC A;  2OBG A;  1SDX A;  5ICQ A;  2H98 A;  4HS7 A;  2UXA A;  4KPT A;  3OO9 A;  4RY1 A;  1HSJ A;  4AB6 A;  1SI0 A;  4OVJ A;  1IZ1 A;  2XXW A;  3RPW A;  4MBP A;  3G3H A;  1MQG A;  1NH7 A;  4EXK A;  2O84 X;  2RC8 A;  5DVF A;  4I9D A;  3JZJ A;  1IXC A;  1B7H A;  5FTI A;  3VXB A;  4MLV A;  1RYX A;  5I58 B;  1XT8 A;  3ONM A;  1S9T A;  2Q8J A;  5CM6 A;  1MQH A;  5EYF A;  1B4Z A;  2AL4 A;  2ONR A;  2R6G E;  4UA8 A;  3KSJ A;  1NH8 A;  2UVJ A;  1RKM A;  4U1O A;  2A5S A;  1PC3 A;  3UP9 A;  2WKY A;  3Q28 A;  2NWJ A;  2H99 A;  3AXF A;  4H8J A;  2CZL A;  1MXV A;  4ECF A;  4LZ5 A;  1O64 A;  4ELO A;  3VLV A;  2XHD A;  4KFQ A;  3ECR A;  3TQW A;  3CFX A;  1B2H A;  5I58 A;  3D4G A;  2ZNS A;  2ZNU A;  2RIN A;  3PUZ E;  3I5O A;  3LSW A;  3VLW A;  3H3G A;  1MQD A;  3QXM A;  2RC7 A;  1B4H A;  1URD A;  3T93 B;  1DPP A;  2FA7 A;  2Q2A A;  3FGS A;  1JW5 A;  2DE4 A;  4ND9 A;  4O3B A;  1OIB A;  1AMF A;  3V89 B;  2XXI A;  2F7C A;  3N6T A;  1LBB A;  3U93 A;  4Q0C A;  3C33 A;  4QFO A;  2XXT A;  3V5A A;  2QRY A;  3IOT A;  4OFO A;  3BFT A;  4YB7 A;  1MH4 A;  2ESN A;  2I4B A;  3ZKL A;  2D3I A;  4BDM A;  3LSX A;  3K02 A;  4F3B A;  3UOR A;  4GQO A;  2I3V A;  3B7D A;  3DLN A;  4L17 A;  3BKI B;  3Q29 A;  3C31 A;  2P2A A;  4DE8 A;  1AH5 A;  2HXW A;  5H8F B;  4OQO A;  2XD2 A;  3UGW A;  3FJM A;  4NF8 A;  4OFL A;  2LAO A;  2B3B A;  5JEI A;  5I84 A;  1ZBM A;  4DCX A;  5TP9 B;  1XS5 A;  4G2Z A;  3H6W A;  4EQ7 A;  2RC9 A;  2PX1 A;  2HZL A;  4BLA A;  1USY E;  1FQA A;  1SD3 A;  3ILU B;  3TEP A;  5A5X B;  3FAS A;  4H5F A;  5H8F A;  4ZZA A;  3LC8 A;  4R75 A;  5JK4 A;  3H6U A;  3GBA A;  4ZEF A;  2Y84 A;  4KYS A;  4NE4 A;  3O6H A;  4G4P A;  2DS9 A;  4GIZ A;  4OEU A;  4YMB A;  1US5 A;  2E0S A;  5TP9 A;  3H06 B;  4JB7 A;  5EHS A;  4NWD A;  4MH5 A;  4O3A A;  4EXL A;  5A5X A;  1MPC A;  4HCW A;  1M5D A;  4F31 B;  3H7M A;  3QK6 A;  5AA2 B;  4FEC A;  4GL8 A;  1I6A A;  5TPA B;  3K1M A;  2Z8E A;  4YMA A;  4YU0 A;  4E0X A;  3O2A A;  3V8X B;  1D3K A;  1B52 A;  4YZZ A;  2IA4 A;  5AA3 A;  1PB7 A;  1VFE A;  3K6X A;  3O97 A;  5F7V A;  1LB9 A;  2W7Y A;  5AA2 A;  4HCY A;  1Y9U A;  1H76 A;  1VE4 A;  2DWI A;  4PFW A;  2O1L A;  5TPA A;  2D5W A;  1N76 A;  4AB5 A;  4R73 A;  5CMK A;  4WED A;  4I62 A;  4JBZ A;  2THI A;  4C0R A;  1US4 A;  1Y3P A;  2F97 A;  3S9E A;  2UYE A;  3TYH A;  4ISU A;  2HAV A;  4H5G A;  1Q35 A;  1BLF A;  4U4S A;  2DOJ A;  1FTJ A;  2GFE A;  3MZ9 A;  3RUM A;  3OD7 A;  3MP1 A;  4U22 A;  3PMX A;  2XXU A;  4XKR A;  4P0I A;  4U1Z A;  2H9B A;  3K6W A;  3QUF A;  1ELJ A;  3T9H B;  3K6U A;  5CBS A;  1JW1 A;  3FV2 A;  4Q30 B;  2O6A A;  5L9S A;  3OEL A;  1IIT A;  4ESW A;  1SYH A;  4F29 A;  1XHY A;  1NFT A;  2PT2 A;  1R9L A;  1LBC A;  1SW1 A;  1SQY A;  1PB9 A;  3FXR A;  3C34 A;  1MXZ A;  3HHG A;  1B1H A;  2QMX A;  2OWS A;  3ZS6 A;  1ATG A;  4YKP A;  4GL0 A;  3A3C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...