2O68A

Crystal structure of haemophilus influenzae q58l mutant fbpa
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
307
structure length
307
Chain Sequence
DITVYNGQHKEAATAVAKAFEQETGIKVTLNSGKSEQLAGQLKEEGDKTPADVFYTELTATFADLSEAGLLAPISEQTIQQTAQKGVPLAPKKDWIALSGRSRVVVYDHTKLSEKDMEKSVLDYATPKWKGKIGYVSTSGAFLEQVVALSKMKGDKVALNWLKGLKENGKLYAKNSVALQAVENGEVPAALINNYYWYNLAKEKGVENLKSRLYFVRHQDPGALVSYSGAAVLKASKNQAEAQKFVDFLASKKGQEALVAARAEYPLRADVVSPFNLEPYEKLEAPVVSATTAQDKEHAIKLIEEAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Iron-utilization periplasmic protein
publication title The role of the synergistic phosphate anion in iron transport by the periplasmic iron-binding protein from Haemophilus influenzae.
pubmed doi rcsb
source organism Haemophilus influenzae
total genus 113
structure length 307
sequence length 307
ec nomenclature
pdb deposition date 2006-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2o68A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2o68A02
4RK9A 4YB7A 2IEEA 1LBBA 1F9BA 3O2AA 1I69A 3S9NC 4F3GA 2DXYA 4ONYA 3ZKLA 1VFEA 1B3FA 5AA4B 2D5WA 2OWSA 2Q88A 3EPEA 5TU0A 3HHFA 1A40A 4I1DA 1B58A 3RPWA 1ZMGA 3KSXA 2NVUB 3WAFA 3O9PA 3CSBA 1B7ZA 3QSLA 4L17A 3MVZA 5AA4A 2I48A 2VGQA 2I0BA 4BDLA 1MQHA 4IO2A 4EF2A 2D21A 3RY3A 1O7TA 2A5SA 1PB7A 3BBRA 3B6QA 2ONKE 4ZS9A 2Z8DA 1LAFE 1B32A 1LGBC 2RCBA 2XXWA 4EUOA 4BDNA 4OFJA 2WKYA 4JSDA 4IY6A 1DTZA 1H44A 1NNTA 2H4IA 5F1QA 3OEMA 3FVGA 2HZLA 2R6GE 1NNPA 4THIA 5KDTB 4PE5B 3TCFA 2UVIA 2PBWA 1PBPA 4R9GA 1ELJA 1Y20A 5CMMA 3RTWB 2IA4A 4NF8B 3VLVA 1O63A 3BFTA 2O51A 3RT8A 4Q30B 1FTKA 1PC3A 2CZLA 4OYVA 3VV5A 1XHYA 2DWJA 4R73A 4OQOA 4U4XA 5KDTA 1YAEA 3B7DA 4KI0E 1B0HA 2DWAA 3H6UA 3B6WA 3DP8A 1GGGA 2AL5A 3UGWA 1XVXA 1NL5A 1H3DA 3PPQA 4R72A 2XD2A 3AXFA 4JBZA 3VLUA 4EDPA 2B3FA 2I3VA 3H3GA 3IOVA 1Y1MA 1NFTA 3MW0A 4G68C 3OO8A 4NE4A 4OESA 3FXRA 4OEVA 1N7WA 4DXCA 4HCWA 3V89B 3JZJA 2REGA 4LZ7A 2NUVA 3CFXA 1MY4A 2ESNA 2X7QA 3H6TA 1QUKA 3W9VA 2CMOA 4U21A 2XX8A 1US5A 3K02A 2DE4A 3SETA 2PT2A 5ICQA 3KJ7A 4N07A 1OLAA 4PFYA 1ZU0A 2OZZA 5I58B 3H7MA 5K2XA 4NF6B 1TT1A 3T66A 3TMGA 2F7AA 5K2YA 3GXAA 2RC7A 1LLSA 3FGSA 4F3PA 4YAHX 2RKMA 4JWYA 1NNFA 1XOCA 2RCAA 3FZVA 4PQJA 3F11A 2Q2AA 1WODA 1N04A 2V93A 3M3FA 5I58A 1JNFA 4NF6A 2ONSA 2Z8FA 1XC1A 2Q89A 3C33A 4KCDA 4R74A 5CBRA 3SEYA 1EZ9A 3IAZA 4K3FA 5JK4A 4H5GA 3FATA 4LUBA 3H4ZA 5EHMA 1QJMA 1B40A 4QFNA 4X1BA 1M5CA 4PETA 3K6XA 1B3LA 1XVYA 3C36A 1YCJA 1JW4A 4KHZE 3IJXB 3KFMA 4F1UA 1OMPA 1GR2A 5ISUA 4QSDA 1SVXB 4ZEFA 3MUQA 5CMKA 3ZKKA 1AL3A 2REJA 5I57B 1SBPA 3ZS6A 2THIA 3TQLA 4AQ4A 2Z22A 1ZLQA 4I9DA 4QF9A 4DCYA 1US4A 1B3GA 5I57A 1JVYA 3THIA 1SDXA 3G3HA 1JVXA 4LQ2A 2Y7WA 3A3UA 3U94A 1MG1A 2P0SA 3PGFA 1OIBA 1AH5A 2DWHA 1LFHA 4NF5B 3K01A 4TLMB 4F3SA 1MRPA 3T22A 2XXXA 2V25A 4TLLB 5TPAB 2HCAA 1VR5A 4Q5TA 3C4MA 1MQGA 1UIVA 1OLCA 2XXTA 4JXIA 5H8NB 3VVDA 4R2FA 1WDNA 2DYXA 4ELPA 3RGYA 3FJMA 4ELRA 4KPTA 1IXCA 3R7XA 2Q8JA 4Q8RA 1MH4A 5TPAA 3S4UA 3K6WA 3K0VA 1WVJA 4NF4B 3TDJA 1URSA 3L6HA 3K1MA 1RYOA 1MY1A 5H8NA 1H43A 1MXUA 2UYFA 3PD8A 3KGCA 4HS7A 1A8EA 5EYFA 3M3LA 4NWCA 1IXIA 5H8SA 4NF4A 3TELA 4RJZA 3ILUB 2O69A 4IO5A 1DOTA 2Q2CA 4MH5A 4O3AA 3BFUA 3G3KA 2YJPA 4RA1A 1URDA 4AB6A 3QYTA 4NTLA 2W7YA 1AMFA 2RINA 3RUMA 3LSXA 5FHNA 3S9MC 2VOZA 3UP9A 1DPEA 3CIJA 4E0XA 4LP2B 4QFKA 4DE8A 3TYHA 5FHMA 4OFOA 3VLWA 1LB9A 1OVTA 1ANFA 4LVQA 4R6YA 2H5YA 5CM6A 4LONB 1I6QA 4X1DA 3S2VA 3C31A 1N0TA 3EN3A 2ABHA 3O6HA 4OFLA 4F3BA 1D3KA 4H6DA 4IY5A 3FIRA 4R75A 3RNNA 4GF8A 2I49A 4QSCA 3LR1A 3JV9A 4DZ1A 5ITOA 1SI0A 3EQ1A 3D4GA 1MXWA 1B5IA 4POWA 4ND9A 1PB8A 1N3WA 1RYXA 4ZEBA 1A55A 5ICTA 3EHTA 1Q1KA 4FAJA 3CI8A 1PBQA 3KZGA 1LAXA 4ZE9A 3FASA 3S9EA 4KQPA 1MY0A 4KYDA 2UVGA 4OETA 3TUSA 2Y7PA 2DSFA 1GTKA 3IK6B 2F6PA 2O6AA 3SERA 1I6BA 4OHNA 4NMYA 4LA9A 3GBBA 1M5BA 2I0CA 2AYSA 4DLDA 1LB8A 2GHAA 3GLBA 5DTBA 4ELOA 4OVJA 4M1VA 5CBSA 5I84A 3TCHA 1BLFA 4ELQA 4BLAA 3VDFA 1P1OA 1Y1ZA 2LAOA 5BUUA 4IO7A 1VFDA 1SQYA 4LATA 3EHSA 3U8QA 4YKJA 3RLFE 3QUFA 1TXFA 3QXMA 4GRKA 1N3XA 3VXBA 1B05A 2OBGA 5J1DA 1TFDA 3IL1B 4QFLA 3OO7A 3KEIA 1MM6A 1FCKA 1MXZA 4IO6A 2E1SA 1R9LA 2XXVA 4U2RA 2R71A 3TAJA 2HAUA 2BJJX 1JW1A 5H8QB 3G3IA 3PUZE 1DPPA 2F6GA 2PT1A 4FECA 3T9XB 2DXRA 4BDMA 1FQDA 1Y3PA 3TODA 1OQHA 1B3HA 1SW4A 4H0WA 1CB6A 2ANJA 1JEVA 5AA1A 3PPOA 5TP9B 1B5JA 3DM0A 2PYYA 3R6UA 5H8QA 4X9TA 1LFIA 1P99A 4NF8A 4UACA 1UTBB 3FJ7A 4AB5A 1A99A 3MBPA 3TEPA 3IORA 1HSJA 3UN6A 1NMUA 2ZNUA 2XD3A 2ZYNA 3CRBA 3OENA 3ECRA 1NH7A 3OSQA 4MLVA 3OEKA 4C1TA 4F2QA 4F22A 1SYIA 3K00A 3TTRA 2F8DA 1UTBA 4P11A 3Q27A 4UA8A 1AIVA 2FA7A 2XXYA 4BDRA 4G8NA 1Y3QA 3IO6A 1R6ZA 4LZ5A 4KYSA 3VFJA 4FORA 4I8CA 3HCQA 1S7YA 4QSEA 3VVEA 4ZEDA 2O84X 2QS3A 1VE4A 3Q25A 1EH3A 4OERA 3A3CA 4IB2A 4QFPA 2I58A 4GL0A 5DEXB 1MS7A 2DVZA 3MQ9A 3U93A 2QRYA 2ZYMA 3H6VA 1BIYA 1UIUA 2I4CA 3HHGA 3PMXA 2DVCA 4HW8A 1URGA 2RF1A 1H76A 3V5AA 5L8DA 4R2BA 2DOJA 3TKDA 1YTVA 5DEXA 2B65A 3TTNA 4H5FA 1ZTYA 3FVNA 3MZBA 2Y7IA 4F19A 5L9SA 1ZBMA 1PB9A 4RYAA 1NKXA 3C34A 3QIMA 3MZ9A 1IUDA 2XXQA 4OENA 3TZAA 4GXSB 5IKBA 3HV1A 3IJOB 4F18A 3FD3A 3TPAA 3WAEA 3FXQA 3V8XB 4R9FA 2ZYOA 2M8CA 3TQWA 5HPQA 5H8FB 4QHQA 2ZYKA 3CFLA 4ZEIA 5IAIA 3IB0A 2UVJA 1GV8A 3OSRA 3OXNA 2NOOA 3OO6A 3T96B 1Q35A 3QAXA 1JW5A 4YMAA 5FHOA 2QJEA 2O68A 4GIZA 2V3QA 4P0GA 5DVIA 5DYHA 2F35A 3T9VA 5H8FA 4DXUA 4LQ5A 5FTIA 3BKIB 3UIFA 4JB7A 4WEPA 4R6HA 4I62A 3JYRA 2QPQA 5L9OA 2VP1A 2O7UA 1Y9UA 1SW2A 2VHAA 1LFGA 1QKBA 4EQ7A 4ZEKA 3MZ1A 1D4NA 3CR9A 1B7HA 5I2KB 2PVUA 1ZJLA 1JEUA 2DS9A 5AA2B 3G3FA 1FQBA 3IR1A 3W9WA 3M8UA 4C0RA 2Z8EA 1II5A 1MDP1 1GVCA 3RN8A 4JWXA 3O29A 1FW0A 3K2DA 4GFRA 5I2KA 3C35A 4GL8A 3TTMA 4NF5A 3EHUA 3DP4A 3PUXE 5AA2A 5HM4B 4YKKA 2AIXA 3M3KA 1FQFA 2ZNTA 1MDQA 3PPPA 4O3CA 3L6GA 1IQ7A 1D9YA 4JDFA 2XX7A 5LOMA 2UXAA 1QUJA 5EHSA 2O7IA 2NWJA 3DP6A 3P7IA 5I2NB 4NWDA 3E4RA 1PEBA 4RY1A 5ELVA 2I3WA 3HO7A 3RTFB 4F2OA 4F29A 2OCUA 1M5DA 3OOAA 4F1YA 1YPNA 4DDDA 4H67A 2X26A 4IO4A 4U1OA 4DXBA 3OELA 5I2NA 1O64A 3CG3A 3E9XA 1LSTA 2AL4A 4BDQA 4KYEA 3PU5A 4EQBA 2F7CA 4OZ9A 1SI1A 4FE8A 2HQ0A 2RC8A 3OMBA 5CMCA 1POY1 3U92A 5ITPA 5FTHA 3H6WA 3VXCA 2XHDA 2F78A 4G77A 5CC2A 3RQTA 2QMWA 4IGRA 4GWOA 1B0LA 3SKPA 4RPNA 4XKRA 5A5XB 1QULA 4X48A 3N5LA 2VD3A 3HPIA 3K1NA 1TWYA 3CSGA 4XKQA 3USDA 4QFOA 2E0SA 3C32A 3PMVA 5AE4A 3E3KA 4M4GA 1MH3A 1ZKBA 5L9MA 5A5XA 2XXRA 3CVGA 3U1OA 3HSTA 4G4PA 3MP8A 1IXHA 4HTGA 1POTA 1P1WA 3MPLA 3MVXA 4FEBA 3HN0A 3PUYE 2DE3A 2PMSA 1B1HA 4O3BA 1B2HA 4ESXA 3PV0E 3LSFB 4ECFA 1ATGA 3MP6A 2QL3A 2FNCA 2R9JA 4U1ZA 4U4SA 3FV2A 1B52A 4ZZAA 1MXVA 3K6VA 1QVSA 3VVFA 1LCTA 1OVBA 5DVFA 5AA3A 1JETA 2I4BA 4R6KA 4RNSA 1HSLA 2P1SA 3VE1B 1A54A 4NEDA 4MFIA 1TFAA 5CI5A 1Z7ME 4OWDA 1MQDA 4QRZA 5H8HB 1D9VA 5CRYA 3MWBA 1LCFA 1N76A 1DSNA 2X7PA 4XIGQ 3D4CA 1DTGA 4YU0A 3I5OA 3QK6A 1MQIA 3K4UA 3LSWA 4PFTA 1DMBA 3G3GA 3KJTA 3IX1A 3O97A 4C1UA 1HSEA 1LAHE 3ODBA 3QUJA 1L5TA 1FTMA 3S9LC 5H8HA 1S50A 5HBCA 4YB5A 1EZPA 3FVKA 3EF7A 4U22A 2DE2A 1R1NA 3O66A 4MLQA 3RT6B 1B4HA 3IB1A 2HZKA 3ZSFA 2F5XA 3CFZA 3KBRA 5JEIA 2O1LA 4G68B 1FQEA 3DELB 4GQOA 2H99A 3UORA 5M2VA 1LBCA 4POXA 3IB2A 5B70A 4GLIA 2QSXA 1P1UA 1VSOA 4ZDMA 1R9QA 1N7XA 3FJGA 1B9JA 3N94A 3TCGA 1EU8A 3IOTA 4JSOA 4G68A 1ZIUA 1M5EA 4YKIA 4EQ9A 2XXHA 5TP9A 1A8FA 4OEUA 1MPDA 4H1XA 2GHBA 4Z7EA 4RK2A 1USYE 3LBSA 5BWJA 4YB6A 4PFWA 2Y7KA 4OMBA 1Y4TA 2V3TA 3MP1A 3W15C 3KOTA 3T9HB 3G7WA 3PD9A 4EXKA 4JWOA 1IIWA 3KSJA 3LC8A 3SEVA 1B7UA 3I3VA 2QS2A 5KCJB 4YKPA 4KD5A 3SESA 3N6UA 4U23A 2QS4A 2V3UA 2Z23A 3KN8A 1UTHB 3MVYA 4F31B 3Q29A 4G8MA 4WXJA 1MPCA 3UK4A 4MF3A 2PX1A 3G3JA 3FV1A 1MPBA 3IOUA 1N84A 2HEUA 3MVWA 5KCJA 5DT6A 3UA8A 1JQFA 5CMBA 1B5HA 1UTHA 3R26A 2O1MA 4LZ8A 1IXGA 2Y84A 5AA2D 2GH9A 2H25A 3Q26A 3PPNA 4ZECA 3PPRA 5DVJA 1XT8A 1MXXA 4H8JA 1Y4CA 2A5TB 1Z7NE 2F34A 3MJNA 3T9UA 4P0IA 2YPNA 2OK2A 1I6AA 1AOVA 2V84A 4MBPA 2DQVA 1P1NA 3C9HA 1PDAA 2ZMBA 1B3EA 2F36A 4N13A 4G2ZA 3ILTB 2QMXA 1SW1A 3IOWA 2F7BA 2OJTA 4WKMA 2GRVA 1MQJA 3TTKA 4GXAA 1Y3NA 2A5TA 2ZXTA 4FEDA 1FTOA 3T93B 1CE2A 3OD7A 1B1XA 2XXPA 1XS5A 2DWIA 1T0KA 2NXOA 2OLBA 3OO9A 1SW5A 4ESWA 4F1VA 3V83A 4H8IA 3FUZA 3KOSA 3KG2A 3SEWA 4YICA 5JTYB 3FVOA 1NNKA 2VD2A 1BKAA 3I6VA 1USYH 4GD5A 1A7LA 1BP5A 1FTJA 3IO4A 5JTYA 3SEXA 1B6HA 4XTCQ 1MM7A 1OQGA 4IO3A 3CG1A 1SYHA 3N6TA 4PP0A 3DLNA 1IZ1A 4BDOA 1FTLA 1FQAA 4YMBA 4G8HA 2H9BA 2ZNSA 3B6TA 4TQUQ 2P2AA 2YLNA 3H06B 2QS1A 4ZE8A 4GOTA 2H98A 4OXVA 5I59B 4TOZA 3H03A 3GBAA 1NH8A 1B51A 4DIGA 1S9TA 3PUWE 4KR5A 3TTLA 4E0WA 3PUVE 3K6UA 1QW0A 3E13X 4OTEA 3PMWA 1MY3A 5I59A 4KFQA 3MAMA 1H45A 1J1NA 4Z0IA 4EF1A 4KCCA 1RKMA 4XXUA 4F39A 2XX9A 3N26A 4RXLA 3LUYA 2HXWA 3K1PA 3LSLA 4ISUA 5F7VA 4DCXA 4PFUA 1UQWA 3Q28A 2HAVA 1EZOA 1QUIA 2XXUA 2Q9TA 2Y7RA 2B3BA 3KN3A 2HFBA 5KZTA 2F97A 3MPKA 2OWTA 3SEUA 3O28A 2D3IA 4N6PA 1IITA 1MY2A 3ONMA 2KLFA 2UYEA 1LAGE 2XXIA 4FJPA 2ONRA 1SD3A 4ZZEA 3U72A 4RPOA 4EXLA 3SDFA 4IGTA 2UVHA 4XKPA 2GFEA 3MC2A 3O6GA 4WEDA 4HCYA 4Q0CA 4H65A 3TFLA 5B7DA 5I56B 1M5FA 2I6EA 1MXYA 3KN7A 4YZZA 1B46A 1KWHA 2RC9A 3A09A 1BTJA 3GZGA 4GVOA 2G93A 2ALUA 1IEJA 2G29A 2FYIA 4FATA 5I56A 4FIMA 1FQCA 2DP8A 3O6IA 4XKNA 1QKAA 3FXUA 1P1QA 1B4ZA
chains in the Genus database with same CATH superfamily
4RK9A 4N4UA 4YB7A 2IEEA 1LBBA 1INPA 1YYZA 1F9BA 4JVIA 3O2AA 1FPJA 1I69A 3S9NC 1JP4A 4F3GA 2DXYA 4N91A 4ONYA 3ZKLA 1VFEA 1B3FA 5AA4B 2D5WA 5EQ8A 2OWSA 2Q88A 3EPEA 5TU0A 3HHFA 1A40A 4I1DA 1B58A 3RPWA 1LBWA 1ZMGA 3KSXA 2NVUB 3WAFA 3O9PA 3CSBA 1NUXA 1B7ZA 3QSLA 4L17A 3MVZA 5AA4A 2I48A 2VGQA 2I0BA 4BDLA 1MQHA 4IO2A 4EF2A 2D21A 3RY3A 1O7TA 1PB7A 2A5SA 3BBRA 4XF5A 3B6QA 1IMAA 2ONKE 2OWZA 4ZS9A 2Z8DA 1LAFE 2VPOA 1B32A 3IFAA 1LGBC 2RCBA 2XXWA 4EUOA 4BDNA 4OFJA 2WKYA 4JSDA 4IY6A 1DTZA 1H44A 1NNTA 2OX3A 2H4IA 5F1QA 3OEMA 3FVGA 2HZLA 2R6GE 1NNPA 2F3DA 4THIA 5KDTB 4PE5B 3TCFA 2UVIA 2PBWA 1PBPA 4R9GA 1ELJA 1Y20A 5CMMA 1FRPA 3RTWB 2IA4A 4NF8B 3VLVA 1O63A 3BFTA 2O51A 3RT8A 4Q30B 1FTKA 1PC3A 2CZLA 4OYVA 3VV5A 1XHYA 2DWJA 4R73A 3B8BA 2XWIA 4OQOA 4NF0A 4U4XA 5KDTA 4PFIA 1YAEA 2CEXA 3B7DA 4KI0E 1B0HA 2DWAA 3H6UA 3B6WA 3DP8A 1GGGA 2AL5A 3UGWA 1XVXA 1NL5A 4PAFA 4OA4A 1H3DA 3PPQA 4R72A 2XD2A 3AXFA 4JBZA 3VLUA 4EDPA 2B3FA 2I3VA 3H3GA 3IOVA 1Y1MA 1NFTA 3MW0A 2B4LA 4HE2A 3KC0A 4G68C 4XEQA 3OO8A 4NE4A 4OESA 3FXRA 4OEVA 1N7WA 4DXCA 2FIXA 4HCWA 3V89B 3JZJA 1RDZA 2REGA 4LZ7A 4P1EA 2NUVA 3CFXA 1MY4A 2ESNA 2X7QA 3H6TA 1QUKA 3W9VA 2CMOA 4U21A 2XX8A 1US5A 3K02A 2DE4A 1BK4A 3SETA 2PT2A 1FBEA 5ICQA 3KJ7A 4N07A 1OLAA 5EYHA 4PFYA 1ZU0A 2OZZA 5I58B 3H7MA 5K2XA 3EKIA 4NF6B 1TT1A 3T66A 3TMGA 2F7AA 5K2YA 3GXAA 2RC7A 4PFRA 2QVRA 1LLSA 3FGSA 4F3PA 4YAHX 4GWZA 2RKMA 4JWYA 1NNFA 1XOCA 2RCAA 3FZVA 4PQJA 3F11A 2Q2AA 2CEYA 1WODA 1N04A 2V93A 3M3FA 5I58A 1JNFA 4NF6A 2ONSA 2Z8FA 5FBPA 1XC1A 2Q89A 3C33A 4KCDA 4R74A 5CBRA 3SEYA 1NV5A 1EZ9A 3IAZA 4K3FA 4JVCA 4N8GA 5JK4A 4H5GA 3FATA 4LUBA 3H4ZA 5EHMA 1QJMA 1B40A 4QFNA 4X1BA 4OVTA 1FTAA 1IMCA 1M5CA 4PETA 4OVRA 3K6XA 1B3LA 1XVYA 2CZHA 2Y5LA 4NGUA 1YZ0A 3D1RA 3C36A 1YCJA 1JW4A 4KHZE 3IJXB 3KFMA 4F1UA 1OMPA 1GR2A 5ISUA 3ROJA 4QSDA 1SVXB 4ZEFA 3MUQA 5CMKA 3ZKKA 1AL3A 2REJA 5I57B 1SBPA 4NHBA 3ZS6A 2THIA 3TQLA 3U65A 4AQ4A 2Z22A 1ZLQA 4I9DA 4QF9A 4DCYA 1US4A 1B3GA 5I57A 5T3JA 1JVYA 3THIA 1SDXA 3G3HA 1JVXA 4LQ2A 4GX4A 1LBXA 2Y7WA 3A3UA 3U94A 1MG1A 2P0SA 3PGFA 1FPKA 1OIBA 1AH5A 2DWHA 1NUWA 1LFHA 2WX9A 4NF5B 3K01A 4TLMB 4F3SA 1MRPA 3T22A 2XXXA 2V25A 4TLLB 2FBPA 5TPAB 2HCAA 1KZ8A 1VR5A 4Q5TA 3C4MA 1MQGA 1UIVA 1OLCA 2XXTA 4JXIA 5H8NB 3VVDA 4R2FA 1WDNA 2DYXA 4PF6A 4ELPA 3RGYA 3QMFA 3FJMA 4ELRA 4KPTA 5LTCA 1YXIA 1IXCA 2WBDA 3HFUA 3R7XA 2Q8JA 4Q8RA 1MH4A 5TPAA 3S4UA 3K6WA 3K0VA 1WVJA 4NF4B 1NUYA 2PCRA 3TDJA 1URSA 3L6HA 3K1MA 1RYOA 1MY1A 5H8NA 1H43A 1MXUA 2UYFA 3PD8A 3KGCA 4HS7A 1A8EA 3LV0A 3M3LA 2VT5A 5EYFA 4NWCA 1IXIA 1NV0A 3GYYA 5H8SA 3KBZA 4NF4A 3TELA 1K9ZA 4RJZA 3ILUB 2O69A 4NX1A 4IO5A 2HPGA 1DOTA 2Q2CA 4MH5A 4O3AA 3BFUA 3G3KA 1IMBA 2YJPA 4RA1A 1URDA 4AB6A 3QYTA 4NTLA 2W7YA 1AMFA 2RINA 3RUMA 3LSXA 2XWVA 5FHNA 3S9MC 2VOZA 4JVDA 3UP9A 5ET5A 1DPEA 3CIJA 4E0XA 4LP2B 4QFKA 4HXVA 2CZKA 4DE8A 3TYHA 5FHMA 4OFOA 3VLWA 1LB9A 1OVTA 1ANFA 4LVQA 4R6YA 2H5YA 3A29A 5CM6A 3CHGA 4LONB 4PAIA 1I6QA 4X1DA 3S2VA 3C31A 1FBCA 1N0TA 3EN3A 2ABHA 3O6HA 4OFLA 5LDZA 4F3BA 1D3KA 4H6DA 4X04A 4IY5A 4GWYA 3FIRA 4R75A 3RNNA 2R8TA 4GF8A 4DI3D 2I49A 1EYJA 4QSCA 1FPIA 3LR1A 3JV9A 4GBVA 4DZ1A 5ITOA 1SI0A 3EQ1A 3D4GA 1MXWA 1B5IA 4POWA 4ND9A 1PB8A 1N3WA 1RYXA 4ZEBA 1A55A 5ICTA 3EHTA 1Q1KA 4GX6A 2PFYA 4P9KA 3B50A 4FAJA 3CI8A 1PBQA 3KZGA 1LAXA 4ZE9A 3FASA 3S9EA 4KQPA 1MY0A 4KYDA 1FBDA 2UVGA 4OETA 3TUSA 2Y7PA 2DSFA 1GTKA 3IK6B 2F6PA 1CNQA 2O6AA 3SERA 4LN5A 1I6BA 4OHNA 4NMYA 4LA9A 3GBBA 1M5BA 2I0CA 2AYSA 4DLDA 1LB8A 2GHAA 3GLBA 4OVPA 5DTBA 4ELOA 4OVJA 4M1VA 5CBSA 5I84A 3TCHA 1BLFA 4ELQA 4BLAA 3VDFA 2JJKA 4NN3A 1P1OA 1Y1ZA 2LAOA 5BUUA 4IO7A 1VFDA 1FPEA 1SQYA 4LATA 3EHSA 3U8QA 4YKJA 3RLFE 3QUFA 1TXFA 2QVVA 2XWOA 3QXMA 4GRKA 3PTYA 1N3XA 3VXBA 1B05A 2OBGA 5J1DA 1TFDA 3IL1B 1IMDA 1KA0A 4QFLA 3OO7A 3KEIA 1MM6A 1FCKA 1MXZA 1QGXA 5EQ7A 4IO6A 2E1SA 1IMEA 1R9LA 4GWXA 2XXVA 4U2RA 2R71A 3TAJA 5ET8A 2KQZA 2HAUA 2BJJX 1JW1A 5H8QB 3G3IA 3PUZE 4AS5A 1DPPA 4MHFA 1EYIA 2F6GA 2PT1A 2HHMA 4FECA 3T9XB 2DXRA 4BDMA 1FQDA 1Y3PA 3TODA 1OQHA 1B3HA 1SW4A 4H0WA 1CB6A 2ANJA 1JEVA 1KA1A 5AA1A 3PPOA 5TP9B 1B5JA 3DM0A 2PYYA 3R6UA 5H8QA 2KR0A 4X9TA 1XI6A 4PDHA 1LFIA 1P99A 4NF8A 1FJ6A 4UACA 1UTBB 3FJ7A 4AB5A 1A99A 3MBPA 3TEPA 2ZZXA 3IORA 1HSJA 3UN6A 1NMUA 2ZNUA 2XD3A 2ZYNA 5IZZA 1RDXA 3CRBA 3OENA 3ECRA 1NH7A 3OSQA 4MLVA 4O7IA 3OEKA 4C1TA 4F2QA 4F22A 1SYIA 3K00A 3TTRA 4I40A 2Q74A 2F8DA 5EQ9A 1UTBA 4PBHA 4P11A 5A5LA 3Q27A 4UA8A 1AIVA 2FA7A 2XXYA 4BDRA 4MMPA 4G8NA 1Y3QA 3IO6A 1R6ZA 4LZ5A 4P3LA 4KYSA 3VFJA 4FORA 4I8CA 3HCQA 4MNIA 2FHYA 4N17A 1FJ9A 1S7YA 4QSEA 3VVEA 4ZEDA 2O84X 2QS3A 1VE4A 3Q25A 1EH3A 4OERA 1FBFA 1VDWA 4HE0A 3A3CA 4IB2A 1LEVA 4QFPA 2I58A 4GL0A 2WYKA 5DEXB 1MS7A 2DVZA 3MQ9A 3U93A 2QRYA 2ZYMA 3H6VA 1BIYA 4NAPA 1UIUA 2I4CA 3HHGA 3PMXA 4O8MA 2DVCA 4HW8A 1URGA 2RF1A 1H76A 5L8DA 3V5AA 4R2BA 2DOJA 3TKDA 1YTVA 5DEXA 2B65A 3TTNA 4H5FA 4MIJA 1ZTYA 3FVNA 3MZBA 2Y7IA 1SPIA 4F19A 5L9SA 1ZBMA 1PB9A 4RYAA 1NKXA 4KXPA 3C34A 3QIMA 3MZ9A 1IUDA 2XXQA 4OENA 3TZAA 2F3BA 4GXSB 2FVZA 5IKBA 3HV1A 3IJOB 4F18A 3FD3A 3TPAA 3WAEA 3FXQA 3V8XB 4R9FA 2ZYOA 2M8CA 3TQWA 5HPQA 5H8FB 4QHQA 1G0IA 2ZYKA 3CFLA 4ZEIA 5IAIA 3IB0A 2UVJA 1GV8A 3OSRA 3OXNA 2NOOA 3OO6A 3T96B 1Q35A 5IZ3B 3QAXA 1JW5A 4YMAA 5FHOA 3MYUA 2QJEA 2O68A 4GIZA 2V3QA 4P0GA 5DVIA 5DYHA 2F35A 3T9VA 5H8FA 4DXUA 4LQ5A 5FTIA 3BKIB 3UIFA 4JB7A 1FSAA 4WEPA 4R6HA 4I62A 3JYRA 2QPQA 5IZ3A 5L9OA 2VP1A 2O7UA 1Y9UA 1SW2A 2VHAA 1LFGA 1QKBA 4EQ7A 5I5PA 3ISPA 4ZEKA 4N8YA 3MZ1A 1D4NA 3CR9A 1B7HA 5I2KB 2PVUA 4PGNA 1ZJLA 4GX3A 1JEUA 2DS9A 5AA2B 3G3FA 1FQBA 3IR1A 3W9WA 3M8UA 4C0RA 2Z8EA 1II5A 1MDP1 1GVCA 3RN8A 4JWXA 3O29A 1FW0A 3K2DA 4GFRA 5I2KA 3C35A 4GL8A 3TTMA 4NF5A 3EHUA 3DP4A 3PUXE 5AA2A 5HM4B 4YKKA 2AIXA 3M3KA 1FQFA 2ZNTA 1IMFA 1MDQA 3PPPA 5IGAA 4O3CA 3L6GA 1IQ7A 1D9YA 4JDFA 4GBWA 2XX7A 5LOMA 1NV7A 2UXAA 1QUJA 5EHSA 4P47A 2O7IA 2NWJA 3DP6A 3P7IA 5I2NB 4NWDA 3E4RA 1PEBA 2B4MA 4PGPA 4RY1A 5ELVA 2I3WA 3HO7A 3RTFB 4F2OA 4F29A 1FPGA 2OCUA 1M5DA 3OOAA 4F1YA 4P8BA 1YPNA 4DDDA 4H67A 2X26A 4IO4A 4U1OA 4DXBA 2CZIA 3OELA 5I2NA 1O64A 3CG3A 3E9XA 2GQ1A 1LSTA 2AL4A 4BDQA 4KYEA 3PU5A 4EQBA 2F7CA 4OZ9A 1SI1A 4FE8A 2HQ0A 2RC8A 3OMBA 5CMCA 1POY1 3U92A 5ITPA 5FTHA 3H6WA 3VXCA 2MKZA 2XHDA 2F78A 4G77A 5CC2A 4MNCA 3RQTA 2QMWA 4IGRA 1NV1A 4GWOA 1B0LA 3SKPA 4RPNA 4XKRA 3FBPA 5IZ1A 5A5XB 1QULA 4X48A 3N5LA 2VD3A 3HPIA 3K1NA 1TWYA 1DBZA 3CSGA 4XKQA 3USDA 4QFOA 4P56A 2E0SA 3C32A 3PMVA 5AE4A 5J16A 3E3KA 4M4GA 1MH3A 1ZKBA 5L9MA 2XA5A 5A5XA 2XXRA 3CVGA 3U1OA 3HSTA 4G4PA 3MP8A 1IXHA 2WBBA 4HTGA 1POTA 1P1WA 3MPLA 3MVXA 4O94A 1FPFA 4FEBA 3HN0A 3PUYE 2DE3A 2PMSA 1B1HA 4O3BA 1B2HA 4HE1A 4ESXA 3PV0E 3LSFB 4ECFA 1ATGA 3MP6A 2QL3A 2FNCA 2ZZWA 2R9JA 4U1ZA 4U4SA 3FV2A 1B52A 4ZZAA 2V4CA 1MXVA 3K6VA 1QVSA 3VVFA 4PBQA 1EYKA 1LCTA 1OVBA 5DVFA 5AA3A 4H46A 1NUZA 1JETA 4PFBA 2I4BA 4R6KA 4RNSA 1HSLA 3T1BA 2P1SA 3VE1B 1A54A 4G61A 4NEDA 4MFIA 1TFAA 5CI5A 1Z7ME 2QFLA 4OWDA 3E78A 1MQDA 1DCUA 2Y5KA 4QRZA 1D9VA 5CRYA 5H8HB 3MWBA 1LCFA 4MX6A 1N76A 1DSNA 2X7PA 4XIGQ 3D4CA 1DTGA 4YU0A 3I5OA 3QK6A 1MQIA 3K4UA 3LSWA 4PFTA 1DMBA 3G3GA 3KJTA 3IX1A 3O97A 4C1UA 1HSEA 1LAHE 3ODBA 3QUJA 1L5TA 1FTMA 3S9LC 5H8HA 1S50A 5HBCA 4YB5A 1EZPA 3FVKA 3EF7A 4IR8A 4U22A 2DE2A 1R1NA 3O66A 4MLQA 3RT6B 4N6DA 1B4HA 3IB1A 2HZKA 3ZSFA 2F5XA 3CFZA 3KBRA 3KC1A 5JEIA 2O1LA 4G68B 1FQEA 4P1LA 3DELB 4GQOA 2H99A 3UORA 5M2VA 1LBCA 4POXA 3IB2A 5B70A 4GLIA 2QSXA 4UABA 4NQ8A 1P1UA 1VSOA 1D9QA 4ZDMA 1R9QA 1AWBA 1N7XA 3FJGA 1B9JA 3N94A 3TCGA 1EU8A 3IOTA 4JSOA 4G68A 1ZIUA 1M5EA 4H45A 4YKIA 4EQ9A 2PFZA 1NV3A 2XXHA 5IM2A 3SZPA 5TP9A 2XXKA 1A8FA 4OEUA 1MPDA 1FPLA 4H1XA 2GHBA 4GWUA 4Z7EA 4RK2A 1USYE 3LBSA 5F24A 5BWJA 4YB6A 4PFWA 2Y7KA 4OMBA 1Y4TA 2V3TA 3MP1A 3W15C 3KOTA 3T9HB 3G7WA 3PD9A 4EXKA 4JWOA 1IIWA 3E79A 3KSJA 3LC8A 1B7UA 3SEVA 2L5VA 3I3VA 2QS2A 5KCJB 4YKPA 4KD5A 3SESA 3N6UA 4U23A 2QS4A 2V3UA 2Z23A 3KN8A 1UTHB 3MVYA 4F31B 3Q29A 4G8MA 4WXJA 1MPCA 3UK4A 4MF3A 2PX1A 3G3JA 3FV1A 1MPBA 3IOUA 1N84A 2HEUA 3MVWA 5KCJA 5DT6A 3UA8A 1JQFA 5CMBA 1B5HA 1UTHA 3R26A 2O1MA 4LZ8A 1IXGA 2Y84A 5AA2D 2GH9A 2H25A 3Q26A 4N81A 3PPNA 4ZECA 4MJOA 3PPRA 5DVJA 2FIEA 1XT8A 1MXXA 4H8JA 4MNPA 1Y4CA 2A5TB 1Z7NE 2F34A 4PCDA 3MJNA 3T9UA 1DK4A 4P0IA 2YPNA 2OK2A 1I6AA 1AOVA 2V84A 4MBPA 2DQVA 1FBHA 1P1NA 2ZZVA 5ET7A 3RPLB 3C9HA 1PDAA 2ZMBA 1B3EA 2F36A 4N13A 4G2ZA 4QXDA 3ILTB 2QMXA 1SW1A 3IOWA 2F7BA 2OJTA 4WKMA 2XWKA 2GRVA 5ESYA 1MQJA 3BIHA 3TTKA 4GXAA 1G0HA 1Y3NA 2A5TA 2ZXTA 2BJIA 4N15A 3LUZA 4FEDA 1FTOA 1NI9A 3T93B 1CE2A 3OD7A 3RPLA 1B1XA 2XXPA 1XS5A 2DWIA 1T0KA 2NXOA 2OLBA 3OO9A 4N6KA 2HXRA 1SW5A 4ESWA 4F1VA 5I7IA 3V83A 4XFEA 2WYPA 4H8IA 3FUZA 3KOSA 3KG2A 3SEWA 4YICA 5JTYB 3FVOA 4GWSA 4OANA 1NNKA 2VD2A 1BKAA 3I6VA 1USYH 4GD5A 1LBYA 4PF8A 1A7LA 1NV2A 1BP5A 1FTJA 3IO4A 5JTYA 5ET6A 3SEXA 1B6HA 4NG7A 4XTCQ 1MM7A 1FPDA 1OQGA 4IO3A 3CG1A 4PAKA 1SYHA 3N6TA 4PP0A 3DLNA 1IZ1A 4BDOA 1FTLA 1FQAA 4PDDA 4YMBA 4MCOA 4G8HA 2H9BA 2ZNSA 3B6TA 4TQUQ 2P2AA 2YLNA 3H06B 2QS1A 2VPNA 5EYGA 4ZE8A 4GOTA 1Q9DA 3IFCA 2H98A 4OXVA 2DDKA 4GWWA 4O7MA 5I59B 4TOZA 3H03A 4PTKA 3GBAA 1NH8A 1B51A 4DIGA 1S9TA 2P3VA 3PUWE 4KR5A 2WEFA 1RDYA 3TTLA 4E0WA 3PUVE 2Q8MA 3K6UA 1QW0A 3E13X 4FBPA 4OTEA 3PMWA 4MEVA 1MY3A 5I59A 4KFQA 3MAMA 4DI4B 1H45A 4I3EA 1J1NA 3FXBA 4Z0IA 4EF1A 4KCCA 1RKMA 4MAGA 4XXUA 4F39A 2QVUA 2XX9A 3N26A 4RXLA 3LUYA 1FBGA 2HXWA 1NV6A 3K1PA 3LSLA 4ISUA 4OVSA 5F7VA 4DCXA 4PFUA 1UQWA 3Q28A 2HAVA 1EZOA 3BIGA 1QUIA 2XXUA 2Q9TA 2Y7RA 1LBZA 2B3BA 3KN3A 2HFBA 5KZTA 2F97A 3MPKA 2P3NA 2OWTA 4QBAA 3SEUA 3O28A 4PE3A 2D3IA 4N6PA 1IITA 4X8RA 1MY2A 3ONMA 2KLFA 2UYEA 1LBVA 1LAGE 2XXIA 4FJPA 2ONRA 1SD3A 5EQAA 4ZZEA 3U72A 4PC9A 4RPOA 4EXLA 3SDFA 3T0JA 4IGTA 3NOHA 2UVHA 4XKPA 2GFEA 1NV4A 3MC2A 3O6GA 4WEDA 4HCYA 4Q0CA 4H65A 3TFLA 5B7DA 3MSTA 5I56B 1M5FA 2I6EA 1MXYA 3RYDA 3KN7A 1K9YA 4OVQA 4YZZA 1B46A 5DW8A 1KWHA 2RC9A 3A09A 1BTJA 3GZGA 4GVOA 2G93A 5I3SA 2ALUA 1IEJA 4I3YA 4AS4A 1FBPA 2G29A 2FYIA 4FATA 5I56A 1FPBA 4FIMA 1FQCA 2DP8A 3O6IA 4XKNA 1QKAA 3FXUA 1P1QA 1B4ZA
chains in the Genus database with same CATH topology
4RK9A 4YB7A 2IEEA 1LBBA 1F9BA 3O2AA 1I69A 3S9NC 4F3GA 2DXYA 4ONYA 3ZKLA 1VFEA 1B3FA 5AA4B 2D5WA 2OWSA 2Q88A 3EPEA 5TU0A 3HHFA 1A40A 4I1DA 1B58A 3RPWA 1ZMGA 3KSXA 2NVUB 3WAFA 3O9PA 3CSBA 1B7ZA 3QSLA 4L17A 3MVZA 5AA4A 2I48A 2VGQA 2I0BA 4BDLA 1MQHA 4IO2A 4EF2A 2D21A 3RY3A 1O7TA 2A5SA 1PB7A 3BBRA 3B6QA 2ONKE 4ZS9A 2Z8DA 1LAFE 1B32A 1LGBC 2RCBA 2XXWA 4EUOA 4BDNA 4OFJA 2WKYA 4JSDA 4IY6A 1DTZA 1H44A 1NNTA 2H4IA 5F1QA 3OEMA 3FVGA 2HZLA 2R6GE 1NNPA 4THIA 5KDTB 4PE5B 3TCFA 2UVIA 2PBWA 1PBPA 4R9GA 1ELJA 1Y20A 5CMMA 3RTWB 2IA4A 4NF8B 3VLVA 1O63A 3BFTA 2O51A 3RT8A 4Q30B 1FTKA 1PC3A 2CZLA 4OYVA 3VV5A 1XHYA 2DWJA 4R73A 4OQOA 4U4XA 5KDTA 1YAEA 3B7DA 4KI0E 1B0HA 2DWAA 3H6UA 3B6WA 3DP8A 1GGGA 2AL5A 3UGWA 1XVXA 1NL5A 1H3DA 3PPQA 4R72A 2XD2A 3AXFA 4JBZA 3VLUA 4EDPA 2B3FA 2I3VA 3H3GA 3IOVA 1Y1MA 1NFTA 3MW0A 4G68C 3OO8A 4NE4A 4OESA 3FXRA 4OEVA 1N7WA 4DXCA 4HCWA 3V89B 3JZJA 2REGA 4LZ7A 2NUVA 3CFXA 1MY4A 2ESNA 2X7QA 3H6TA 1QUKA 3W9VA 2CMOA 4U21A 2XX8A 1US5A 3K02A 2DE4A 3SETA 2PT2A 5ICQA 3KJ7A 4N07A 1OLAA 4PFYA 1ZU0A 2OZZA 5I58B 3H7MA 5K2XA 4NF6B 1TT1A 3T66A 3TMGA 2F7AA 5K2YA 3GXAA 2RC7A 1LLSA 3FGSA 4F3PA 4YAHX 2RKMA 4JWYA 1NNFA 1XOCA 2RCAA 3FZVA 4PQJA 3F11A 2Q2AA 1WODA 1N04A 2V93A 3M3FA 5I58A 1JNFA 4NF6A 2ONSA 2Z8FA 1XC1A 2Q89A 3C33A 4KCDA 4R74A 5CBRA 3SEYA 1EZ9A 3IAZA 4K3FA 5JK4A 4H5GA 3FATA 4LUBA 3H4ZA 5EHMA 1QJMA 1B40A 4QFNA 4X1BA 1M5CA 4PETA 3K6XA 1B3LA 1XVYA 3C36A 1YCJA 1JW4A 4KHZE 3IJXB 3KFMA 4F1UA 1OMPA 1GR2A 5ISUA 4QSDA 1SVXB 4ZEFA 3MUQA 5CMKA 3ZKKA 1AL3A 2REJA 5I57B 1SBPA 3ZS6A 2THIA 3TQLA 4AQ4A 2Z22A 1ZLQA 4I9DA 4QF9A 4DCYA 1US4A 1B3GA 5I57A 1JVYA 3THIA 1SDXA 3G3HA 1JVXA 4LQ2A 2Y7WA 3A3UA 3U94A 1MG1A 2P0SA 3PGFA 1OIBA 1AH5A 2DWHA 1LFHA 4NF5B 3K01A 4TLMB 4F3SA 1MRPA 3T22A 2XXXA 2V25A 4TLLB 5TPAB 2HCAA 1VR5A 4Q5TA 3C4MA 1MQGA 1UIVA 1OLCA 2XXTA 4JXIA 5H8NB 3VVDA 4R2FA 1WDNA 2DYXA 4ELPA 3RGYA 3FJMA 4ELRA 4KPTA 1IXCA 3R7XA 2Q8JA 4Q8RA 1MH4A 5TPAA 3S4UA 3K6WA 3K0VA 1WVJA 4NF4B 3TDJA 1URSA 3L6HA 3K1MA 1RYOA 1MY1A 5H8NA 1H43A 1MXUA 2UYFA 3PD8A 3KGCA 4HS7A 1A8EA 5EYFA 3M3LA 4NWCA 1IXIA 5H8SA 4NF4A 3TELA 4RJZA 3ILUB 2O69A 4IO5A 1DOTA 2Q2CA 4MH5A 4O3AA 3BFUA 3G3KA 2YJPA 4RA1A 1URDA 4AB6A 3QYTA 4NTLA 2W7YA 1AMFA 2RINA 3RUMA 3LSXA 5FHNA 3S9MC 2VOZA 3UP9A 1DPEA 3CIJA 4E0XA 4LP2B 4QFKA 4DE8A 3TYHA 5FHMA 4OFOA 3VLWA 1LB9A 1OVTA 1ANFA 4LVQA 4R6YA 2H5YA 5CM6A 4LONB 1I6QA 4X1DA 3S2VA 3C31A 1N0TA 3EN3A 2ABHA 3O6HA 4OFLA 4F3BA 1D3KA 4H6DA 4IY5A 3FIRA 4R75A 3RNNA 4GF8A 2I49A 4QSCA 3LR1A 3JV9A 4DZ1A 5ITOA 1SI0A 3EQ1A 3D4GA 1MXWA 1B5IA 4POWA 4ND9A 1PB8A 1N3WA 1RYXA 4ZEBA 1A55A 5ICTA 3EHTA 1Q1KA 4FAJA 3CI8A 1PBQA 3KZGA 1LAXA 4ZE9A 3FASA 3S9EA 4KQPA 1MY0A 4KYDA 2UVGA 4OETA 3TUSA 2Y7PA 2DSFA 1GTKA 3IK6B 2F6PA 2O6AA 3SERA 1I6BA 4OHNA 4NMYA 4LA9A 3GBBA 1M5BA 2I0CA 2AYSA 4DLDA 1LB8A 2GHAA 3GLBA 5DTBA 4ELOA 4OVJA 4M1VA 5CBSA 5I84A 3TCHA 1BLFA 4ELQA 4BLAA 3VDFA 1P1OA 1Y1ZA 2LAOA 5BUUA 4IO7A 1VFDA 1SQYA 4LATA 3EHSA 3U8QA 4YKJA 3RLFE 3QUFA 1TXFA 3QXMA 4GRKA 1N3XA 3VXBA 1B05A 2OBGA 5J1DA 1TFDA 3IL1B 4QFLA 3OO7A 3KEIA 1MM6A 1FCKA 1MXZA 4IO6A 2E1SA 1R9LA 2XXVA 4U2RA 2R71A 3TAJA 2HAUA 2BJJX 1JW1A 5H8QB 3G3IA 3PUZE 1DPPA 2F6GA 2PT1A 4FECA 3T9XB 2DXRA 4BDMA 1FQDA 1Y3PA 3TODA 1OQHA 1B3HA 1SW4A 4H0WA 1CB6A 2ANJA 1JEVA 5AA1A 3PPOA 5TP9B 1B5JA 3DM0A 2PYYA 3R6UA 5H8QA 4X9TA 1LFIA 1P99A 4NF8A 4UACA 1UTBB 3FJ7A 4AB5A 1A99A 3MBPA 3TEPA 3IORA 1HSJA 3UN6A 1NMUA 2ZNUA 2XD3A 2ZYNA 3CRBA 3OENA 3ECRA 1NH7A 3OSQA 4MLVA 3OEKA 4C1TA 4F2QA 4F22A 1SYIA 3K00A 3TTRA 2F8DA 1UTBA 4P11A 3Q27A 4UA8A 1AIVA 2FA7A 2XXYA 4BDRA 4G8NA 1Y3QA 3IO6A 1R6ZA 4LZ5A 4KYSA 3VFJA 4FORA 4I8CA 3HCQA 1S7YA 4QSEA 3VVEA 4ZEDA 2O84X 2QS3A 1VE4A 3Q25A 1EH3A 4OERA 3A3CA 4IB2A 4QFPA 2I58A 4GL0A 5DEXB 1MS7A 2DVZA 3MQ9A 3U93A 2QRYA 2ZYMA 3H6VA 1BIYA 1UIUA 2I4CA 3HHGA 3PMXA 2DVCA 4HW8A 1URGA 2RF1A 1H76A 3V5AA 5L8DA 4R2BA 2DOJA 3TKDA 1YTVA 5DEXA 2B65A 3TTNA 4H5FA 1ZTYA 3FVNA 3MZBA 2Y7IA 4F19A 5L9SA 1ZBMA 1PB9A 4RYAA 1NKXA 3C34A 3QIMA 3MZ9A 1IUDA 2XXQA 4OENA 3TZAA 4GXSB 5IKBA 3HV1A 3IJOB 4F18A 3FD3A 3TPAA 3WAEA 3FXQA 3V8XB 4R9FA 2ZYOA 2M8CA 3TQWA 5HPQA 5H8FB 4QHQA 2ZYKA 3CFLA 4ZEIA 5IAIA 3IB0A 2UVJA 1GV8A 3OSRA 3OXNA 2NOOA 3OO6A 3T96B 1Q35A 3QAXA 1JW5A 4YMAA 5FHOA 2QJEA 2O68A 4GIZA 2V3QA 4P0GA 5DVIA 5DYHA 2F35A 3T9VA 5H8FA 4DXUA 4LQ5A 5FTIA 3BKIB 3UIFA 4JB7A 4WEPA 4R6HA 4I62A 3JYRA 2QPQA 5L9OA 2VP1A 2O7UA 1Y9UA 1SW2A 2VHAA 1LFGA 1QKBA 4EQ7A 4ZEKA 3MZ1A 1D4NA 3CR9A 1B7HA 5I2KB 2PVUA 1ZJLA 1JEUA 2DS9A 5AA2B 3G3FA 1FQBA 3IR1A 3W9WA 3M8UA 4C0RA 2Z8EA 1II5A 1MDP1 1GVCA 3RN8A 4JWXA 3O29A 1FW0A 3K2DA 4GFRA 5I2KA 3C35A 4GL8A 3TTMA 4NF5A 3EHUA 3DP4A 3PUXE 5AA2A 5HM4B 4YKKA 2AIXA 3M3KA 1FQFA 2ZNTA 1MDQA 3PPPA 4O3CA 3L6GA 1IQ7A 1D9YA 4JDFA 2XX7A 5LOMA 2UXAA 1QUJA 5EHSA 2O7IA 2NWJA 3DP6A 3P7IA 5I2NB 4NWDA 3E4RA 1PEBA 4RY1A 5ELVA 2I3WA 3HO7A 3RTFB 4F2OA 4F29A 2OCUA 1M5DA 3OOAA 4F1YA 1YPNA 4DDDA 4H67A 2X26A 4IO4A 4U1OA 4DXBA 3OELA 5I2NA 1O64A 3CG3A 3E9XA 1LSTA 2AL4A 4BDQA 4KYEA 3PU5A 4EQBA 2F7CA 4OZ9A 1SI1A 4FE8A 2HQ0A 2RC8A 3OMBA 5CMCA 1POY1 3U92A 5ITPA 5FTHA 3H6WA 3VXCA 2XHDA 2F78A 4G77A 5CC2A 3RQTA 2QMWA 4IGRA 4GWOA 1B0LA 3SKPA 4RPNA 4XKRA 5A5XB 1QULA 4X48A 3N5LA 2VD3A 3HPIA 3K1NA 1TWYA 3CSGA 4XKQA 3USDA 4QFOA 2E0SA 3C32A 3PMVA 5AE4A 3E3KA 4M4GA 1MH3A 1ZKBA 5L9MA 5A5XA 2XXRA 3CVGA 3U1OA 3HSTA 4G4PA 3MP8A 1IXHA 4HTGA 1POTA 1P1WA 3MPLA 3MVXA 4FEBA 3HN0A 3PUYE 2DE3A 2PMSA 1B1HA 4O3BA 1B2HA 4ESXA 3PV0E 3LSFB 4ECFA 1ATGA 3MP6A 2QL3A 2FNCA 2R9JA 4U1ZA 4U4SA 3FV2A 1B52A 4ZZAA 1MXVA 3K6VA 1QVSA 3VVFA 1LCTA 1OVBA 5DVFA 5AA3A 1JETA 2I4BA 4R6KA 4RNSA 1HSLA 2P1SA 3VE1B 1A54A 4NEDA 4MFIA 1TFAA 5CI5A 1Z7ME 4OWDA 1MQDA 4QRZA 5H8HB 1D9VA 5CRYA 3MWBA 1LCFA 1N76A 1DSNA 2X7PA 4XIGQ 3D4CA 1DTGA 4YU0A 3I5OA 3QK6A 1MQIA 3K4UA 3LSWA 4PFTA 1DMBA 3G3GA 3KJTA 3IX1A 3O97A 4C1UA 1HSEA 1LAHE 3ODBA 3QUJA 1L5TA 1FTMA 3S9LC 5H8HA 1S50A 5HBCA 4YB5A 1EZPA 3FVKA 3EF7A 4U22A 2DE2A 1R1NA 3O66A 4MLQA 3RT6B 1B4HA 3IB1A 2HZKA 3ZSFA 2F5XA 3CFZA 3KBRA 5JEIA 2O1LA 4G68B 1FQEA 3DELB 4GQOA 2H99A 3UORA 5M2VA 1LBCA 4POXA 3IB2A 5B70A 4GLIA 2QSXA 1P1UA 1VSOA 4ZDMA 1R9QA 1N7XA 3FJGA 1B9JA 3N94A 3TCGA 1EU8A 3IOTA 4JSOA 4G68A 1ZIUA 1M5EA 4YKIA 4EQ9A 2XXHA 5TP9A 1A8FA 4OEUA 1MPDA 4H1XA 2GHBA 4Z7EA 4RK2A 1USYE 3LBSA 5BWJA 4YB6A 4PFWA 2Y7KA 4OMBA 1Y4TA 2V3TA 3MP1A 3W15C 3KOTA 3T9HB 3G7WA 3PD9A 4EXKA 4JWOA 1IIWA 3KSJA 3LC8A 3SEVA 1B7UA 3I3VA 2QS2A 5KCJB 4YKPA 4KD5A 3SESA 3N6UA 4U23A 2QS4A 2V3UA 2Z23A 3KN8A 1UTHB 3MVYA 4F31B 3Q29A 4G8MA 4WXJA 1MPCA 3UK4A 4MF3A 2PX1A 3G3JA 3FV1A 1MPBA 3IOUA 1N84A 2HEUA 3MVWA 5KCJA 5DT6A 3UA8A 1JQFA 5CMBA 1B5HA 1UTHA 3R26A 2O1MA 4LZ8A 1IXGA 2Y84A 5AA2D 2GH9A 2H25A 3Q26A 3PPNA 4ZECA 3PPRA 5DVJA 1XT8A 1MXXA 4H8JA 1Y4CA 2A5TB 1Z7NE 2F34A 3MJNA 3T9UA 4P0IA 2YPNA 2OK2A 1I6AA 1AOVA 2V84A 4MBPA 2DQVA 1P1NA 3C9HA 1PDAA 2ZMBA 1B3EA 2F36A 4N13A 4G2ZA 3ILTB 2QMXA 1SW1A 3IOWA 2F7BA 2OJTA 4WKMA 2GRVA 1MQJA 3TTKA 4GXAA 1Y3NA 2A5TA 2ZXTA 4FEDA 1FTOA 3T93B 1CE2A 3OD7A 1B1XA 2XXPA 1XS5A 2DWIA 1T0KA 2NXOA 2OLBA 3OO9A 1SW5A 4ESWA 4F1VA 3V83A 4H8IA 3FUZA 3KOSA 3KG2A 3SEWA 4YICA 5JTYB 3FVOA 1NNKA 2VD2A 1BKAA 3I6VA 1USYH 4GD5A 1A7LA 1BP5A 1FTJA 3IO4A 5JTYA 3SEXA 1B6HA 4XTCQ 1MM7A 1OQGA 4IO3A 3CG1A 1SYHA 3N6TA 4PP0A 3DLNA 1IZ1A 4BDOA 1FTLA 1FQAA 4YMBA 4G8HA 2H9BA 2ZNSA 3B6TA 4TQUQ 2P2AA 2YLNA 3H06B 2QS1A 4ZE8A 4GOTA 2H98A 4OXVA 5I59B 4TOZA 3H03A 3GBAA 1NH8A 1B51A 4DIGA 1S9TA 3PUWE 4KR5A 3TTLA 4E0WA 3PUVE 3K6UA 1QW0A 3E13X 4OTEA 3PMWA 1MY3A 5I59A 4KFQA 3MAMA 1H45A 1J1NA 4Z0IA 4EF1A 4KCCA 1RKMA 4XXUA 4F39A 2XX9A 3N26A 4RXLA 3LUYA 2HXWA 3K1PA 3LSLA 4ISUA 5F7VA 4DCXA 4PFUA 1UQWA 3Q28A 2HAVA 1EZOA 1QUIA 2XXUA 2Q9TA 2Y7RA 2B3BA 3KN3A 2HFBA 5KZTA 2F97A 3MPKA 2OWTA 3SEUA 3O28A 2D3IA 4N6PA 1IITA 1MY2A 3ONMA 2KLFA 2UYEA 1LAGE 2XXIA 4FJPA 2ONRA 1SD3A 4ZZEA 3U72A 4RPOA 4EXLA 3SDFA 4IGTA 2UVHA 4XKPA 2GFEA 3MC2A 3O6GA 4WEDA 4HCYA 4Q0CA 4H65A 3TFLA 5B7DA 5I56B 1M5FA 2I6EA 1MXYA 3KN7A 4YZZA 1B46A 1KWHA 2RC9A 3A09A 1BTJA 3GZGA 4GVOA 2G93A 2ALUA 1IEJA 2G29A 2FYIA 4FATA 5I56A 4FIMA 1FQCA 2DP8A 3O6IA 4XKNA 1QKAA 3FXUA 1P1QA 1B4ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RK9 A;  4YB7 A;  2IEE A;  1LBB A;  1F9B A;  3O2A A;  1I69 A;  3S9N C;  4F3G A;  2DXY A;  4ONY A;  3ZKL A;  1VFE A;  1B3F A;  5AA4 B;  2D5W A;  2OWS A;  2Q88 A;  3EPE A;  5TU0 A;  3HHF A;  1A40 A;  4I1D A;  1B58 A;  3RPW A;  1ZMG A;  3KSX A;  2NVU B;  3WAF A;  3O9P A;  3CSB A;  1B7Z A;  3QSL A;  4L17 A;  3MVZ A;  5AA4 A;  2I48 A;  2VGQ A;  2I0B A;  4BDL A;  1MQH A;  4IO2 A;  4EF2 A;  2D21 A;  3RY3 A;  1O7T A;  2A5S A;  1PB7 A;  3BBR A;  3B6Q A;  2ONK E;  4ZS9 A;  2Z8D A;  1LAF E;  1B32 A;  1LGB C;  2RCB A;  2XXW A;  4EUO A;  4BDN A;  4OFJ A;  2WKY A;  4JSD A;  4IY6 A;  1DTZ A;  1H44 A;  1NNT A;  2H4I A;  5F1Q A;  3OEM A;  3FVG A;  2HZL A;  2R6G E;  1NNP A;  4THI A;  5KDT B;  4PE5 B;  3TCF A;  2UVI A;  2PBW A;  1PBP A;  4R9G A;  1ELJ A;  1Y20 A;  5CMM A;  3RTW B;  2IA4 A;  4NF8 B;  3VLV A;  1O63 A;  3BFT A;  2O51 A;  3RT8 A;  4Q30 B;  1FTK A;  1PC3 A;  2CZL A;  4OYV A;  3VV5 A;  1XHY A;  2DWJ A;  4R73 A;  4OQO A;  4U4X A;  5KDT A;  1YAE A;  3B7D A;  4KI0 E;  1B0H A;  2DWA A;  3H6U A;  3B6W A;  3DP8 A;  1GGG A;  2AL5 A;  3UGW A;  1XVX A;  1NL5 A;  1H3D A;  3PPQ A;  4R72 A;  2XD2 A;  3AXF A;  4JBZ A;  3VLU A;  4EDP A;  2B3F A;  2I3V A;  3H3G A;  3IOV A;  1Y1M A;  1NFT A;  3MW0 A;  4G68 C;  3OO8 A;  4NE4 A;  4OES A;  3FXR A;  4OEV A;  1N7W A;  4DXC A;  4HCW A;  3V89 B;  3JZJ A;  2REG A;  4LZ7 A;  2NUV A;  3CFX A;  1MY4 A;  2ESN A;  2X7Q A;  3H6T A;  1QUK A;  3W9V A;  2CMO A;  4U21 A;  2XX8 A;  1US5 A;  3K02 A;  2DE4 A;  3SET A;  2PT2 A;  5ICQ A;  3KJ7 A;  4N07 A;  1OLA A;  4PFY A;  1ZU0 A;  2OZZ A;  5I58 B;  3H7M A;  5K2X A;  4NF6 B;  1TT1 A;  3T66 A;  3TMG A;  2F7A A;  5K2Y A;  3GXA A;  2RC7 A;  1LLS A;  3FGS A;  4F3P A;  4YAH X;  2RKM A;  4JWY A;  1NNF A;  1XOC A;  2RCA A;  3FZV A;  4PQJ A;  3F11 A;  2Q2A A;  1WOD A;  1N04 A;  2V93 A;  3M3F A;  5I58 A;  1JNF A;  4NF6 A;  2ONS A;  2Z8F A;  1XC1 A;  2Q89 A;  3C33 A;  4KCD A;  4R74 A;  5CBR A;  3SEY A;  1EZ9 A;  3IAZ A;  4K3F A;  5JK4 A;  4H5G A;  3FAT A;  4LUB A;  3H4Z A;  5EHM A;  1QJM A;  1B40 A;  4QFN A;  4X1B A;  1M5C A;  4PET A;  3K6X A;  1B3L A;  1XVY A;  3C36 A;  1YCJ A;  1JW4 A;  4KHZ E;  3IJX B;  3KFM A;  4F1U A;  1OMP A;  1GR2 A;  5ISU A;  4QSD A;  1SVX B;  4ZEF A;  3MUQ A;  5CMK A;  3ZKK A;  1AL3 A;  2REJ A;  5I57 B;  1SBP A;  3ZS6 A;  2THI A;  3TQL A;  4AQ4 A;  2Z22 A;  1ZLQ A;  4I9D A;  4QF9 A;  4DCY A;  1US4 A;  1B3G A;  5I57 A;  1JVY A;  3THI A;  1SDX A;  3G3H A;  1JVX A;  4LQ2 A;  2Y7W A;  3A3U A;  3U94 A;  1MG1 A;  2P0S A;  3PGF A;  1OIB A;  1AH5 A;  2DWH A;  1LFH A;  4NF5 B;  3K01 A;  4TLM B;  4F3S A;  1MRP A;  3T22 A;  2XXX A;  2V25 A;  4TLL B;  5TPA B;  2HCA A;  1VR5 A;  4Q5T A;  3C4M A;  1MQG A;  1UIV A;  1OLC A;  2XXT A;  4JXI A;  5H8N B;  3VVD A;  4R2F A;  1WDN A;  2DYX A;  4ELP A;  3RGY A;  3FJM A;  4ELR A;  4KPT A;  1IXC A;  3R7X A;  2Q8J A;  4Q8R A;  1MH4 A;  5TPA A;  3S4U A;  3K6W A;  3K0V A;  1WVJ A;  4NF4 B;  3TDJ A;  1URS A;  3L6H A;  3K1M A;  1RYO A;  1MY1 A;  5H8N A;  1H43 A;  1MXU A;  2UYF A;  3PD8 A;  3KGC A;  4HS7 A;  1A8E A;  5EYF A;  3M3L A;  4NWC A;  1IXI A;  5H8S A;  4NF4 A;  3TEL A;  4RJZ A;  3ILU B;  2O69 A;  4IO5 A;  1DOT A;  2Q2C A;  4MH5 A;  4O3A A;  3BFU A;  3G3K A;  2YJP A;  4RA1 A;  1URD A;  4AB6 A;  3QYT A;  4NTL A;  2W7Y A;  1AMF A;  2RIN A;  3RUM A;  3LSX A;  5FHN A;  3S9M C;  2VOZ A;  3UP9 A;  1DPE A;  3CIJ A;  4E0X A;  4LP2 B;  4QFK A;  4DE8 A;  3TYH A;  5FHM A;  4OFO A;  3VLW A;  1LB9 A;  1OVT A;  1ANF A;  4LVQ A;  4R6Y A;  2H5Y A;  5CM6 A;  4LON B;  1I6Q A;  4X1D A;  3S2V A;  3C31 A;  1N0T A;  3EN3 A;  2ABH A;  3O6H A;  4OFL A;  4F3B A;  1D3K A;  4H6D A;  4IY5 A;  3FIR A;  4R75 A;  3RNN A;  4GF8 A;  2I49 A;  4QSC A;  3LR1 A;  3JV9 A;  4DZ1 A;  5ITO A;  1SI0 A;  3EQ1 A;  3D4G A;  1MXW A;  1B5I A;  4POW A;  4ND9 A;  1PB8 A;  1N3W A;  1RYX A;  4ZEB A;  1A55 A;  5ICT A;  3EHT A;  1Q1K A;  4FAJ A;  3CI8 A;  1PBQ A;  3KZG A;  1LAX A;  4ZE9 A;  3FAS A;  3S9E A;  4KQP A;  1MY0 A;  4KYD A;  2UVG A;  4OET A;  3TUS A;  2Y7P A;  2DSF A;  1GTK A;  3IK6 B;  2F6P A;  2O6A A;  3SER A;  1I6B A;  4OHN A;  4NMY A;  4LA9 A;  3GBB A;  1M5B A;  2I0C A;  2AYS A;  4DLD A;  1LB8 A;  2GHA A;  3GLB A;  5DTB A;  4ELO A;  4OVJ A;  4M1V A;  5CBS A;  5I84 A;  3TCH A;  1BLF A;  4ELQ A;  4BLA A;  3VDF A;  1P1O A;  1Y1Z A;  2LAO A;  5BUU A;  4IO7 A;  1VFD A;  1SQY A;  4LAT A;  3EHS A;  3U8Q A;  4YKJ A;  3RLF E;  3QUF A;  1TXF A;  3QXM A;  4GRK A;  1N3X A;  3VXB A;  1B05 A;  2OBG A;  5J1D A;  1TFD A;  3IL1 B;  4QFL A;  3OO7 A;  3KEI A;  1MM6 A;  1FCK A;  1MXZ A;  4IO6 A;  2E1S A;  1R9L A;  2XXV A;  4U2R A;  2R71 A;  3TAJ A;  2HAU A;  2BJJ X;  1JW1 A;  5H8Q B;  3G3I A;  3PUZ E;  1DPP A;  2F6G A;  2PT1 A;  4FEC A;  3T9X B;  2DXR A;  4BDM A;  1FQD A;  1Y3P A;  3TOD A;  1OQH A;  1B3H A;  1SW4 A;  4H0W A;  1CB6 A;  2ANJ A;  1JEV A;  5AA1 A;  3PPO A;  5TP9 B;  1B5J A;  3DM0 A;  2PYY A;  3R6U A;  5H8Q A;  4X9T A;  1LFI A;  1P99 A;  4NF8 A;  4UAC A;  1UTB B;  3FJ7 A;  4AB5 A;  1A99 A;  3MBP A;  3TEP A;  3IOR A;  1HSJ A;  3UN6 A;  1NMU A;  2ZNU A;  2XD3 A;  2ZYN A;  3CRB A;  3OEN A;  3ECR A;  1NH7 A;  3OSQ A;  4MLV A;  3OEK A;  4C1T A;  4F2Q A;  4F22 A;  1SYI A;  3K00 A;  3TTR A;  2F8D A;  1UTB A;  4P11 A;  3Q27 A;  4UA8 A;  1AIV A;  2FA7 A;  2XXY A;  4BDR A;  4G8N A;  1Y3Q A;  3IO6 A;  1R6Z A;  4LZ5 A;  4KYS A;  3VFJ A;  4FOR A;  4I8C A;  3HCQ A;  1S7Y A;  4QSE A;  3VVE A;  4ZED A;  2O84 X;  2QS3 A;  1VE4 A;  3Q25 A;  1EH3 A;  4OER A;  3A3C A;  4IB2 A;  4QFP A;  2I58 A;  4GL0 A;  5DEX B;  1MS7 A;  2DVZ A;  3MQ9 A;  3U93 A;  2QRY A;  2ZYM A;  3H6V A;  1BIY A;  1UIU A;  2I4C A;  3HHG A;  3PMX A;  2DVC A;  4HW8 A;  1URG A;  2RF1 A;  1H76 A;  3V5A A;  5L8D A;  4R2B A;  2DOJ A;  3TKD A;  1YTV A;  5DEX A;  2B65 A;  3TTN A;  4H5F A;  1ZTY A;  3FVN A;  3MZB A;  2Y7I A;  4F19 A;  5L9S A;  1ZBM A;  1PB9 A;  4RYA A;  1NKX A;  3C34 A;  3QIM A;  3MZ9 A;  1IUD A;  2XXQ A;  4OEN A;  3TZA A;  4GXS B;  5IKB A;  3HV1 A;  3IJO B;  4F18 A;  3FD3 A;  3TPA A;  3WAE A;  3FXQ A;  3V8X B;  4R9F A;  2ZYO A;  2M8C A;  3TQW A;  5HPQ A;  5H8F B;  4QHQ A;  2ZYK A;  3CFL A;  4ZEI A;  5IAI A;  3IB0 A;  2UVJ A;  1GV8 A;  3OSR A;  3OXN A;  2NOO A;  3OO6 A;  3T96 B;  1Q35 A;  3QAX A;  1JW5 A;  4YMA A;  5FHO A;  2QJE A;  2O68 A;  4GIZ A;  2V3Q A;  4P0G A;  5DVI A;  5DYH A;  2F35 A;  3T9V A;  5H8F A;  4DXU A;  4LQ5 A;  5FTI A;  3BKI B;  3UIF A;  4JB7 A;  4WEP A;  4R6H A;  4I62 A;  3JYR A;  2QPQ A;  5L9O A;  2VP1 A;  2O7U A;  1Y9U A;  1SW2 A;  2VHA A;  1LFG A;  1QKB A;  4EQ7 A;  4ZEK A;  3MZ1 A;  1D4N A;  3CR9 A;  1B7H A;  5I2K B;  2PVU A;  1ZJL A;  1JEU A;  2DS9 A;  5AA2 B;  3G3F A;  1FQB A;  3IR1 A;  3W9W A;  3M8U A;  4C0R A;  2Z8E A;  1II5 A;  1MDP 1;  1GVC A;  3RN8 A;  4JWX A;  3O29 A;  1FW0 A;  3K2D A;  4GFR A;  5I2K A;  3C35 A;  4GL8 A;  3TTM A;  4NF5 A;  3EHU A;  3DP4 A;  3PUX E;  5AA2 A;  5HM4 B;  4YKK A;  2AIX A;  3M3K A;  1FQF A;  2ZNT A;  1MDQ A;  3PPP A;  4O3C A;  3L6G A;  1IQ7 A;  1D9Y A;  4JDF A;  2XX7 A;  5LOM A;  2UXA A;  1QUJ A;  5EHS A;  2O7I A;  2NWJ A;  3DP6 A;  3P7I A;  5I2N B;  4NWD A;  3E4R A;  1PEB A;  4RY1 A;  5ELV A;  2I3W A;  3HO7 A;  3RTF B;  4F2O A;  4F29 A;  2OCU A;  1M5D A;  3OOA A;  4F1Y A;  1YPN A;  4DDD A;  4H67 A;  2X26 A;  4IO4 A;  4U1O A;  4DXB A;  3OEL A;  5I2N A;  1O64 A;  3CG3 A;  3E9X A;  1LST A;  2AL4 A;  4BDQ A;  4KYE A;  3PU5 A;  4EQB A;  2F7C A;  4OZ9 A;  1SI1 A;  4FE8 A;  2HQ0 A;  2RC8 A;  3OMB A;  5CMC A;  1POY 1;  3U92 A;  5ITP A;  5FTH A;  3H6W A;  3VXC A;  2XHD A;  2F78 A;  4G77 A;  5CC2 A;  3RQT A;  2QMW A;  4IGR A;  4GWO A;  1B0L A;  3SKP A;  4RPN A;  4XKR A;  5A5X B;  1QUL A;  4X48 A;  3N5L A;  2VD3 A;  3HPI A;  3K1N A;  1TWY A;  3CSG A;  4XKQ A;  3USD A;  4QFO A;  2E0S A;  3C32 A;  3PMV A;  5AE4 A;  3E3K A;  4M4G A;  1MH3 A;  1ZKB A;  5L9M A;  5A5X A;  2XXR A;  3CVG A;  3U1O A;  3HST A;  4G4P A;  3MP8 A;  1IXH A;  4HTG A;  1POT A;  1P1W A;  3MPL A;  3MVX A;  4FEB A;  3HN0 A;  3PUY E;  2DE3 A;  2PMS A;  1B1H A;  4O3B A;  1B2H A;  4ESX A;  3PV0 E;  3LSF B;  4ECF A;  1ATG A;  3MP6 A;  2QL3 A;  2FNC A;  2R9J A;  4U1Z A;  4U4S A;  3FV2 A;  1B52 A;  4ZZA A;  1MXV A;  3K6V A;  1QVS A;  3VVF A;  1LCT A;  1OVB A;  5DVF A;  5AA3 A;  1JET A;  2I4B A;  4R6K A;  4RNS A;  1HSL A;  2P1S A;  3VE1 B;  1A54 A;  4NED A;  4MFI A;  1TFA A;  5CI5 A;  1Z7M E;  4OWD A;  1MQD A;  4QRZ A;  5H8H B;  1D9V A;  5CRY A;  3MWB A;  1LCF A;  1N76 A;  1DSN A;  2X7P A;  4XIG Q;  3D4C A;  1DTG A;  4YU0 A;  3I5O A;  3QK6 A;  1MQI A;  3K4U A;  3LSW A;  4PFT A;  1DMB A;  3G3G A;  3KJT A;  3IX1 A;  3O97 A;  4C1U A;  1HSE A;  1LAH E;  3ODB A;  3QUJ A;  1L5T A;  1FTM A;  3S9L C;  5H8H A;  1S50 A;  5HBC A;  4YB5 A;  1EZP A;  3FVK A;  3EF7 A;  4U22 A;  2DE2 A;  1R1N A;  3O66 A;  4MLQ A;  3RT6 B;  1B4H A;  3IB1 A;  2HZK A;  3ZSF A;  2F5X A;  3CFZ A;  3KBR A;  5JEI A;  2O1L A;  4G68 B;  1FQE A;  3DEL B;  4GQO A;  2H99 A;  3UOR A;  5M2V A;  1LBC A;  4POX A;  3IB2 A;  5B70 A;  4GLI A;  2QSX A;  1P1U A;  1VSO A;  4ZDM A;  1R9Q A;  1N7X A;  3FJG A;  1B9J A;  3N94 A;  3TCG A;  1EU8 A;  3IOT A;  4JSO A;  4G68 A;  1ZIU A;  1M5E A;  4YKI A;  4EQ9 A;  2XXH A;  5TP9 A;  1A8F A;  4OEU A;  1MPD A;  4H1X A;  2GHB A;  4Z7E A;  4RK2 A;  1USY E;  3LBS A;  5BWJ A;  4YB6 A;  4PFW A;  2Y7K A;  4OMB A;  1Y4T A;  2V3T A;  3MP1 A;  3W15 C;  3KOT A;  3T9H B;  3G7W A;  3PD9 A;  4EXK A;  4JWO A;  1IIW A;  3KSJ A;  3LC8 A;  3SEV A;  1B7U A;  3I3V A;  2QS2 A;  5KCJ B;  4YKP A;  4KD5 A;  3SES A;  3N6U A;  4U23 A;  2QS4 A;  2V3U A;  2Z23 A;  3KN8 A;  1UTH B;  3MVY A;  4F31 B;  3Q29 A;  4G8M A;  4WXJ A;  1MPC A;  3UK4 A;  4MF3 A;  2PX1 A;  3G3J A;  3FV1 A;  1MPB A;  3IOU A;  1N84 A;  2HEU A;  3MVW A;  5KCJ A;  5DT6 A;  3UA8 A;  1JQF A;  5CMB A;  1B5H A;  1UTH A;  3R26 A;  2O1M A;  4LZ8 A;  1IXG A;  2Y84 A;  5AA2 D;  2GH9 A;  2H25 A;  3Q26 A;  3PPN A;  4ZEC A;  3PPR A;  5DVJ A;  1XT8 A;  1MXX A;  4H8J A;  1Y4C A;  2A5T B;  1Z7N E;  2F34 A;  3MJN A;  3T9U A;  4P0I A;  2YPN A;  2OK2 A;  1I6A A;  1AOV A;  2V84 A;  4MBP A;  2DQV A;  1P1N A;  3C9H A;  1PDA A;  2ZMB A;  1B3E A;  2F36 A;  4N13 A;  4G2Z A;  3ILT B;  2QMX A;  1SW1 A;  3IOW A;  2F7B A;  2OJT A;  4WKM A;  2GRV A;  1MQJ A;  3TTK A;  4GXA A;  1Y3N A;  2A5T A;  2ZXT A;  4FED A;  1FTO A;  3T93 B;  1CE2 A;  3OD7 A;  1B1X A;  2XXP A;  1XS5 A;  2DWI A;  1T0K A;  2NXO A;  2OLB A;  3OO9 A;  1SW5 A;  4ESW A;  4F1V A;  3V83 A;  4H8I A;  3FUZ A;  3KOS A;  3KG2 A;  3SEW A;  4YIC A;  5JTY B;  3FVO A;  1NNK A;  2VD2 A;  1BKA A;  3I6V A;  1USY H;  4GD5 A;  1A7L A;  1BP5 A;  1FTJ A;  3IO4 A;  5JTY A;  3SEX A;  1B6H A;  4XTC Q;  1MM7 A;  1OQG A;  4IO3 A;  3CG1 A;  1SYH A;  3N6T A;  4PP0 A;  3DLN A;  1IZ1 A;  4BDO A;  1FTL A;  1FQA A;  4YMB A;  4G8H A;  2H9B A;  2ZNS A;  3B6T A;  4TQU Q;  2P2A A;  2YLN A;  3H06 B;  2QS1 A;  4ZE8 A;  4GOT A;  2H98 A;  4OXV A;  5I59 B;  4TOZ A;  3H03 A;  3GBA A;  1NH8 A;  1B51 A;  4DIG A;  1S9T A;  3PUW E;  4KR5 A;  3TTL A;  4E0W A;  3PUV E;  3K6U A;  1QW0 A;  3E13 X;  4OTE A;  3PMW A;  1MY3 A;  5I59 A;  4KFQ A;  3MAM A;  1H45 A;  1J1N A;  4Z0I A;  4EF1 A;  4KCC A;  1RKM A;  4XXU A;  4F39 A;  2XX9 A;  3N26 A;  4RXL A;  3LUY A;  2HXW A;  3K1P A;  3LSL A;  4ISU A;  5F7V A;  4DCX A;  4PFU A;  1UQW A;  3Q28 A;  2HAV A;  1EZO A;  1QUI A;  2XXU A;  2Q9T A;  2Y7R A;  2B3B A;  3KN3 A;  2HFB A;  5KZT A;  2F97 A;  3MPK A;  2OWT A;  3SEU A;  3O28 A;  2D3I A;  4N6P A;  1IIT A;  1MY2 A;  3ONM A;  2KLF A;  2UYE A;  1LAG E;  2XXI A;  4FJP A;  2ONR A;  1SD3 A;  4ZZE A;  3U72 A;  4RPO A;  4EXL A;  3SDF A;  4IGT A;  2UVH A;  4XKP A;  2GFE A;  3MC2 A;  3O6G A;  4WED A;  4HCY A;  4Q0C A;  4H65 A;  3TFL A;  5B7D A;  5I56 B;  1M5F A;  2I6E A;  1MXY A;  3KN7 A;  4YZZ A;  1B46 A;  1KWH A;  2RC9 A;  3A09 A;  1BTJ A;  3GZG A;  4GVO A;  2G93 A;  2ALU A;  1IEJ A;  2G29 A;  2FYI A;  4FAT A;  5I56 A;  4FIM A;  1FQC A;  2DP8 A;  3O6I A;  4XKN A;  1QKA A;  3FXU A;  1P1Q A;  1B4Z A; 
#chains in the Genus database with same CATH topology
 4RK9 A;  4N4U A;  4YB7 A;  2IEE A;  1LBB A;  1INP A;  1YYZ A;  1F9B A;  4JVI A;  3O2A A;  1FPJ A;  1I69 A;  3S9N C;  1JP4 A;  4F3G A;  2DXY A;  4N91 A;  4ONY A;  3ZKL A;  1VFE A;  1B3F A;  5AA4 B;  2D5W A;  5EQ8 A;  2OWS A;  2Q88 A;  3EPE A;  5TU0 A;  3HHF A;  1A40 A;  4I1D A;  1B58 A;  3RPW A;  1LBW A;  1ZMG A;  3KSX A;  2NVU B;  3WAF A;  3O9P A;  3CSB A;  1NUX A;  1B7Z A;  3QSL A;  4L17 A;  3MVZ A;  5AA4 A;  2I48 A;  2VGQ A;  2I0B A;  4BDL A;  1MQH A;  4IO2 A;  4EF2 A;  2D21 A;  3RY3 A;  1O7T A;  1PB7 A;  2A5S A;  3BBR A;  4XF5 A;  3B6Q A;  1IMA A;  2ONK E;  2OWZ A;  4ZS9 A;  2Z8D A;  1LAF E;  2VPO A;  1B32 A;  3IFA A;  1LGB C;  2RCB A;  2XXW A;  4EUO A;  4BDN A;  4OFJ A;  2WKY A;  4JSD A;  4IY6 A;  1DTZ A;  1H44 A;  1NNT A;  2OX3 A;  2H4I A;  5F1Q A;  3OEM A;  3FVG A;  2HZL A;  2R6G E;  1NNP A;  2F3D A;  4THI A;  5KDT B;  4PE5 B;  3TCF A;  2UVI A;  2PBW A;  1PBP A;  4R9G A;  1ELJ A;  1Y20 A;  5CMM A;  1FRP A;  3RTW B;  2IA4 A;  4NF8 B;  3VLV A;  1O63 A;  3BFT A;  2O51 A;  3RT8 A;  4Q30 B;  1FTK A;  1PC3 A;  2CZL A;  4OYV A;  3VV5 A;  1XHY A;  2DWJ A;  4R73 A;  3B8B A;  2XWI A;  4OQO A;  4NF0 A;  4U4X A;  5KDT A;  4PFI A;  1YAE A;  2CEX A;  3B7D A;  4KI0 E;  1B0H A;  2DWA A;  3H6U A;  3B6W A;  3DP8 A;  1GGG A;  2AL5 A;  3UGW A;  1XVX A;  1NL5 A;  4PAF A;  4OA4 A;  1H3D A;  3PPQ A;  4R72 A;  2XD2 A;  3AXF A;  4JBZ A;  3VLU A;  4EDP A;  2B3F A;  2I3V A;  3H3G A;  3IOV A;  1Y1M A;  1NFT A;  3MW0 A;  2B4L A;  4HE2 A;  3KC0 A;  4G68 C;  4XEQ A;  3OO8 A;  4NE4 A;  4OES A;  3FXR A;  4OEV A;  1N7W A;  4DXC A;  2FIX A;  4HCW A;  3V89 B;  3JZJ A;  1RDZ A;  2REG A;  4LZ7 A;  4P1E A;  2NUV A;  3CFX A;  1MY4 A;  2ESN A;  2X7Q A;  3H6T A;  1QUK A;  3W9V A;  2CMO A;  4U21 A;  2XX8 A;  1US5 A;  3K02 A;  2DE4 A;  1BK4 A;  3SET A;  2PT2 A;  1FBE A;  5ICQ A;  3KJ7 A;  4N07 A;  1OLA A;  5EYH A;  4PFY A;  1ZU0 A;  2OZZ A;  5I58 B;  3H7M A;  5K2X A;  3EKI A;  4NF6 B;  1TT1 A;  3T66 A;  3TMG A;  2F7A A;  5K2Y A;  3GXA A;  2RC7 A;  4PFR A;  2QVR A;  1LLS A;  3FGS A;  4F3P A;  4YAH X;  4GWZ A;  2RKM A;  4JWY A;  1NNF A;  1XOC A;  2RCA A;  3FZV A;  4PQJ A;  3F11 A;  2Q2A A;  2CEY A;  1WOD A;  1N04 A;  2V93 A;  3M3F A;  5I58 A;  1JNF A;  4NF6 A;  2ONS A;  2Z8F A;  5FBP A;  1XC1 A;  2Q89 A;  3C33 A;  4KCD A;  4R74 A;  5CBR A;  3SEY A;  1NV5 A;  1EZ9 A;  3IAZ A;  4K3F A;  4JVC A;  4N8G A;  5JK4 A;  4H5G A;  3FAT A;  4LUB A;  3H4Z A;  5EHM A;  1QJM A;  1B40 A;  4QFN A;  4X1B A;  4OVT A;  1FTA A;  1IMC A;  1M5C A;  4PET A;  4OVR A;  3K6X A;  1B3L A;  1XVY A;  2CZH A;  2Y5L A;  4NGU A;  1YZ0 A;  3D1R A;  3C36 A;  1YCJ A;  1JW4 A;  4KHZ E;  3IJX B;  3KFM A;  4F1U A;  1OMP A;  1GR2 A;  5ISU A;  3ROJ A;  4QSD A;  1SVX B;  4ZEF A;  3MUQ A;  5CMK A;  3ZKK A;  1AL3 A;  2REJ A;  5I57 B;  1SBP A;  4NHB A;  3ZS6 A;  2THI A;  3TQL A;  3U65 A;  4AQ4 A;  2Z22 A;  1ZLQ A;  4I9D A;  4QF9 A;  4DCY A;  1US4 A;  1B3G A;  5I57 A;  5T3J A;  1JVY A;  3THI A;  1SDX A;  3G3H A;  1JVX A;  4LQ2 A;  4GX4 A;  1LBX A;  2Y7W A;  3A3U A;  3U94 A;  1MG1 A;  2P0S A;  3PGF A;  1FPK A;  1OIB A;  1AH5 A;  2DWH A;  1NUW A;  1LFH A;  2WX9 A;  4NF5 B;  3K01 A;  4TLM B;  4F3S A;  1MRP A;  3T22 A;  2XXX A;  2V25 A;  4TLL B;  2FBP A;  5TPA B;  2HCA A;  1KZ8 A;  1VR5 A;  4Q5T A;  3C4M A;  1MQG A;  1UIV A;  1OLC A;  2XXT A;  4JXI A;  5H8N B;  3VVD A;  4R2F A;  1WDN A;  2DYX A;  4PF6 A;  4ELP A;  3RGY A;  3QMF A;  3FJM A;  4ELR A;  4KPT A;  5LTC A;  1YXI A;  1IXC A;  2WBD A;  3HFU A;  3R7X A;  2Q8J A;  4Q8R A;  1MH4 A;  5TPA A;  3S4U A;  3K6W A;  3K0V A;  1WVJ A;  4NF4 B;  1NUY A;  2PCR A;  3TDJ A;  1URS A;  3L6H A;  3K1M A;  1RYO A;  1MY1 A;  5H8N A;  1H43 A;  1MXU A;  2UYF A;  3PD8 A;  3KGC A;  4HS7 A;  1A8E A;  3LV0 A;  3M3L A;  2VT5 A;  5EYF A;  4NWC A;  1IXI A;  1NV0 A;  3GYY A;  5H8S A;  3KBZ A;  4NF4 A;  3TEL A;  1K9Z A;  4RJZ A;  3ILU B;  2O69 A;  4NX1 A;  4IO5 A;  2HPG A;  1DOT A;  2Q2C A;  4MH5 A;  4O3A A;  3BFU A;  3G3K A;  1IMB A;  2YJP A;  4RA1 A;  1URD A;  4AB6 A;  3QYT A;  4NTL A;  2W7Y A;  1AMF A;  2RIN A;  3RUM A;  3LSX A;  2XWV A;  5FHN A;  3S9M C;  2VOZ A;  4JVD A;  3UP9 A;  5ET5 A;  1DPE A;  3CIJ A;  4E0X A;  4LP2 B;  4QFK A;  4HXV A;  2CZK A;  4DE8 A;  3TYH A;  5FHM A;  4OFO A;  3VLW A;  1LB9 A;  1OVT A;  1ANF A;  4LVQ A;  4R6Y A;  2H5Y A;  3A29 A;  5CM6 A;  3CHG A;  4LON B;  4PAI A;  1I6Q A;  4X1D A;  3S2V A;  3C31 A;  1FBC A;  1N0T A;  3EN3 A;  2ABH A;  3O6H A;  4OFL A;  5LDZ A;  4F3B A;  1D3K A;  4H6D A;  4X04 A;  4IY5 A;  4GWY A;  3FIR A;  4R75 A;  3RNN A;  2R8T A;  4GF8 A;  4DI3 D;  2I49 A;  1EYJ A;  4QSC A;  1FPI A;  3LR1 A;  3JV9 A;  4GBV A;  4DZ1 A;  5ITO A;  1SI0 A;  3EQ1 A;  3D4G A;  1MXW A;  1B5I A;  4POW A;  4ND9 A;  1PB8 A;  1N3W A;  1RYX A;  4ZEB A;  1A55 A;  5ICT A;  3EHT A;  1Q1K A;  4GX6 A;  2PFY A;  4P9K A;  3B50 A;  4FAJ A;  3CI8 A;  1PBQ A;  3KZG A;  1LAX A;  4ZE9 A;  3FAS A;  3S9E A;  4KQP A;  1MY0 A;  4KYD A;  1FBD A;  2UVG A;  4OET A;  3TUS A;  2Y7P A;  2DSF A;  1GTK A;  3IK6 B;  2F6P A;  1CNQ A;  2O6A A;  3SER A;  4LN5 A;  1I6B A;  4OHN A;  4NMY A;  4LA9 A;  3GBB A;  1M5B A;  2I0C A;  2AYS A;  4DLD A;  1LB8 A;  2GHA A;  3GLB A;  4OVP A;  5DTB A;  4ELO A;  4OVJ A;  4M1V A;  5CBS A;  5I84 A;  3TCH A;  1BLF A;  4ELQ A;  4BLA A;  3VDF A;  2JJK A;  4NN3 A;  1P1O A;  1Y1Z A;  2LAO A;  5BUU A;  4IO7 A;  1VFD A;  1FPE A;  1SQY A;  4LAT A;  3EHS A;  3U8Q A;  4YKJ A;  3RLF E;  3QUF A;  1TXF A;  2QVV A;  2XWO A;  3QXM A;  4GRK A;  3PTY A;  1N3X A;  3VXB A;  1B05 A;  2OBG A;  5J1D A;  1TFD A;  3IL1 B;  1IMD A;  1KA0 A;  4QFL A;  3OO7 A;  3KEI A;  1MM6 A;  1FCK A;  1MXZ A;  1QGX A;  5EQ7 A;  4IO6 A;  2E1S A;  1IME A;  1R9L A;  4GWX A;  2XXV A;  4U2R A;  2R71 A;  3TAJ A;  5ET8 A;  2KQZ A;  2HAU A;  2BJJ X;  1JW1 A;  5H8Q B;  3G3I A;  3PUZ E;  4AS5 A;  1DPP A;  4MHF A;  1EYI A;  2F6G A;  2PT1 A;  2HHM A;  4FEC A;  3T9X B;  2DXR A;  4BDM A;  1FQD A;  1Y3P A;  3TOD A;  1OQH A;  1B3H A;  1SW4 A;  4H0W A;  1CB6 A;  2ANJ A;  1JEV A;  1KA1 A;  5AA1 A;  3PPO A;  5TP9 B;  1B5J A;  3DM0 A;  2PYY A;  3R6U A;  5H8Q A;  2KR0 A;  4X9T A;  1XI6 A;  4PDH A;  1LFI A;  1P99 A;  4NF8 A;  1FJ6 A;  4UAC A;  1UTB B;  3FJ7 A;  4AB5 A;  1A99 A;  3MBP A;  3TEP A;  2ZZX A;  3IOR A;  1HSJ A;  3UN6 A;  1NMU A;  2ZNU A;  2XD3 A;  2ZYN A;  5IZZ A;  1RDX A;  3CRB A;  3OEN A;  3ECR A;  1NH7 A;  3OSQ A;  4MLV A;  4O7I A;  3OEK A;  4C1T A;  4F2Q A;  4F22 A;  1SYI A;  3K00 A;  3TTR A;  4I40 A;  2Q74 A;  2F8D A;  5EQ9 A;  1UTB A;  4PBH A;  4P11 A;  5A5L A;  3Q27 A;  4UA8 A;  1AIV A;  2FA7 A;  2XXY A;  4BDR A;  4MMP A;  4G8N A;  1Y3Q A;  3IO6 A;  1R6Z A;  4LZ5 A;  4P3L A;  4KYS A;  3VFJ A;  4FOR A;  4I8C A;  3HCQ A;  4MNI A;  2FHY A;  4N17 A;  1FJ9 A;  1S7Y A;  4QSE A;  3VVE A;  4ZED A;  2O84 X;  2QS3 A;  1VE4 A;  3Q25 A;  1EH3 A;  4OER A;  1FBF A;  1VDW A;  4HE0 A;  3A3C A;  4IB2 A;  1LEV A;  4QFP A;  2I58 A;  4GL0 A;  2WYK A;  5DEX B;  1MS7 A;  2DVZ A;  3MQ9 A;  3U93 A;  2QRY A;  2ZYM A;  3H6V A;  1BIY A;  4NAP A;  1UIU A;  2I4C A;  3HHG A;  3PMX A;  4O8M A;  2DVC A;  4HW8 A;  1URG A;  2RF1 A;  1H76 A;  5L8D A;  3V5A A;  4R2B A;  2DOJ A;  3TKD A;  1YTV A;  5DEX A;  2B65 A;  3TTN A;  4H5F A;  4MIJ A;  1ZTY A;  3FVN A;  3MZB A;  2Y7I A;  1SPI A;  4F19 A;  5L9S A;  1ZBM A;  1PB9 A;  4RYA A;  1NKX A;  4KXP A;  3C34 A;  3QIM A;  3MZ9 A;  1IUD A;  2XXQ A;  4OEN A;  3TZA A;  2F3B A;  4GXS B;  2FVZ A;  5IKB A;  3HV1 A;  3IJO B;  4F18 A;  3FD3 A;  3TPA A;  3WAE A;  3FXQ A;  3V8X B;  4R9F A;  2ZYO A;  2M8C A;  3TQW A;  5HPQ A;  5H8F B;  4QHQ A;  1G0I A;  2ZYK A;  3CFL A;  4ZEI A;  5IAI A;  3IB0 A;  2UVJ A;  1GV8 A;  3OSR A;  3OXN A;  2NOO A;  3OO6 A;  3T96 B;  1Q35 A;  5IZ3 B;  3QAX A;  1JW5 A;  4YMA A;  5FHO A;  3MYU A;  2QJE A;  2O68 A;  4GIZ A;  2V3Q A;  4P0G A;  5DVI A;  5DYH A;  2F35 A;  3T9V A;  5H8F A;  4DXU A;  4LQ5 A;  5FTI A;  3BKI B;  3UIF A;  4JB7 A;  1FSA A;  4WEP A;  4R6H A;  4I62 A;  3JYR A;  2QPQ A;  5IZ3 A;  5L9O A;  2VP1 A;  2O7U A;  1Y9U A;  1SW2 A;  2VHA A;  1LFG A;  1QKB A;  4EQ7 A;  5I5P A;  3ISP A;  4ZEK A;  4N8Y A;  3MZ1 A;  1D4N A;  3CR9 A;  1B7H A;  5I2K B;  2PVU A;  4PGN A;  1ZJL A;  4GX3 A;  1JEU A;  2DS9 A;  5AA2 B;  3G3F A;  1FQB A;  3IR1 A;  3W9W A;  3M8U A;  4C0R A;  2Z8E A;  1II5 A;  1MDP 1;  1GVC A;  3RN8 A;  4JWX A;  3O29 A;  1FW0 A;  3K2D A;  4GFR A;  5I2K A;  3C35 A;  4GL8 A;  3TTM A;  4NF5 A;  3EHU A;  3DP4 A;  3PUX E;  5AA2 A;  5HM4 B;  4YKK A;  2AIX A;  3M3K A;  1FQF A;  2ZNT A;  1IMF A;  1MDQ A;  3PPP A;  5IGA A;  4O3C A;  3L6G A;  1IQ7 A;  1D9Y A;  4JDF A;  4GBW A;  2XX7 A;  5LOM A;  1NV7 A;  2UXA A;  1QUJ A;  5EHS A;  4P47 A;  2O7I A;  2NWJ A;  3DP6 A;  3P7I A;  5I2N B;  4NWD A;  3E4R A;  1PEB A;  2B4M A;  4PGP A;  4RY1 A;  5ELV A;  2I3W A;  3HO7 A;  3RTF B;  4F2O A;  4F29 A;  1FPG A;  2OCU A;  1M5D A;  3OOA A;  4F1Y A;  4P8B A;  1YPN A;  4DDD A;  4H67 A;  2X26 A;  4IO4 A;  4U1O A;  4DXB A;  2CZI A;  3OEL A;  5I2N A;  1O64 A;  3CG3 A;  3E9X A;  2GQ1 A;  1LST A;  2AL4 A;  4BDQ A;  4KYE A;  3PU5 A;  4EQB A;  2F7C A;  4OZ9 A;  1SI1 A;  4FE8 A;  2HQ0 A;  2RC8 A;  3OMB A;  5CMC A;  1POY 1;  3U92 A;  5ITP A;  5FTH A;  3H6W A;  3VXC A;  2MKZ A;  2XHD A;  2F78 A;  4G77 A;  5CC2 A;  4MNC A;  3RQT A;  2QMW A;  4IGR A;  1NV1 A;  4GWO A;  1B0L A;  3SKP A;  4RPN A;  4XKR A;  3FBP A;  5IZ1 A;  5A5X B;  1QUL A;  4X48 A;  3N5L A;  2VD3 A;  3HPI A;  3K1N A;  1TWY A;  1DBZ A;  3CSG A;  4XKQ A;  3USD A;  4QFO A;  4P56 A;  2E0S A;  3C32 A;  3PMV A;  5AE4 A;  5J16 A;  3E3K A;  4M4G A;  1MH3 A;  1ZKB A;  5L9M A;  2XA5 A;  5A5X A;  2XXR A;  3CVG A;  3U1O A;  3HST A;  4G4P A;  3MP8 A;  1IXH A;  2WBB A;  4HTG A;  1POT A;  1P1W A;  3MPL A;  3MVX A;  4O94 A;  1FPF A;  4FEB A;  3HN0 A;  3PUY E;  2DE3 A;  2PMS A;  1B1H A;  4O3B A;  1B2H A;  4HE1 A;  4ESX A;  3PV0 E;  3LSF B;  4ECF A;  1ATG A;  3MP6 A;  2QL3 A;  2FNC A;  2ZZW A;  2R9J A;  4U1Z A;  4U4S A;  3FV2 A;  1B52 A;  4ZZA A;  2V4C A;  1MXV A;  3K6V A;  1QVS A;  3VVF A;  4PBQ A;  1EYK A;  1LCT A;  1OVB A;  5DVF A;  5AA3 A;  4H46 A;  1NUZ A;  1JET A;  4PFB A;  2I4B A;  4R6K A;  4RNS A;  1HSL A;  3T1B A;  2P1S A;  3VE1 B;  1A54 A;  4G61 A;  4NED A;  4MFI A;  1TFA A;  5CI5 A;  1Z7M E;  2QFL A;  4OWD A;  3E78 A;  1MQD A;  1DCU A;  2Y5K A;  4QRZ A;  1D9V A;  5CRY A;  5H8H B;  3MWB A;  1LCF A;  4MX6 A;  1N76 A;  1DSN A;  2X7P A;  4XIG Q;  3D4C A;  1DTG A;  4YU0 A;  3I5O A;  3QK6 A;  1MQI A;  3K4U A;  3LSW A;  4PFT A;  1DMB A;  3G3G A;  3KJT A;  3IX1 A;  3O97 A;  4C1U A;  1HSE A;  1LAH E;  3ODB A;  3QUJ A;  1L5T A;  1FTM A;  3S9L C;  5H8H A;  1S50 A;  5HBC A;  4YB5 A;  1EZP A;  3FVK A;  3EF7 A;  4IR8 A;  4U22 A;  2DE2 A;  1R1N A;  3O66 A;  4MLQ A;  3RT6 B;  4N6D A;  1B4H A;  3IB1 A;  2HZK A;  3ZSF A;  2F5X A;  3CFZ A;  3KBR A;  3KC1 A;  5JEI A;  2O1L A;  4G68 B;  1FQE A;  4P1L A;  3DEL B;  4GQO A;  2H99 A;  3UOR A;  5M2V A;  1LBC A;  4POX A;  3IB2 A;  5B70 A;  4GLI A;  2QSX A;  4UAB A;  4NQ8 A;  1P1U A;  1VSO A;  1D9Q A;  4ZDM A;  1R9Q A;  1AWB A;  1N7X A;  3FJG A;  1B9J A;  3N94 A;  3TCG A;  1EU8 A;  3IOT A;  4JSO A;  4G68 A;  1ZIU A;  1M5E A;  4H45 A;  4YKI A;  4EQ9 A;  2PFZ A;  1NV3 A;  2XXH A;  5IM2 A;  3SZP A;  5TP9 A;  2XXK A;  1A8F A;  4OEU A;  1MPD A;  1FPL A;  4H1X A;  2GHB A;  4GWU A;  4Z7E A;  4RK2 A;  1USY E;  3LBS A;  5F24 A;  5BWJ A;  4YB6 A;  4PFW A;  2Y7K A;  4OMB A;  1Y4T A;  2V3T A;  3MP1 A;  3W15 C;  3KOT A;  3T9H B;  3G7W A;  3PD9 A;  4EXK A;  4JWO A;  1IIW A;  3E79 A;  3KSJ A;  3LC8 A;  1B7U A;  3SEV A;  2L5V A;  3I3V A;  2QS2 A;  5KCJ B;  4YKP A;  4KD5 A;  3SES A;  3N6U A;  4U23 A;  2QS4 A;  2V3U A;  2Z23 A;  3KN8 A;  1UTH B;  3MVY A;  4F31 B;  3Q29 A;  4G8M A;  4WXJ A;  1MPC A;  3UK4 A;  4MF3 A;  2PX1 A;  3G3J A;  3FV1 A;  1MPB A;  3IOU A;  1N84 A;  2HEU A;  3MVW A;  5KCJ A;  5DT6 A;  3UA8 A;  1JQF A;  5CMB A;  1B5H A;  1UTH A;  3R26 A;  2O1M A;  4LZ8 A;  1IXG A;  2Y84 A;  5AA2 D;  2GH9 A;  2H25 A;  3Q26 A;  4N81 A;  3PPN A;  4ZEC A;  4MJO A;  3PPR A;  5DVJ A;  2FIE A;  1XT8 A;  1MXX A;  4H8J A;  4MNP A;  1Y4C A;  2A5T B;  1Z7N E;  2F34 A;  4PCD A;  3MJN A;  3T9U A;  1DK4 A;  4P0I A;  2YPN A;  2OK2 A;  1I6A A;  1AOV A;  2V84 A;  4MBP A;  2DQV A;  1FBH A;  1P1N A;  2ZZV A;  5ET7 A;  3RPL B;  3C9H A;  1PDA A;  2ZMB A;  1B3E A;  2F36 A;  4N13 A;  4G2Z A;  4QXD A;  3ILT B;  2QMX A;  1SW1 A;  3IOW A;  2F7B A;  2OJT A;  4WKM A;  2XWK A;  2GRV A;  5ESY A;  1MQJ A;  3BIH A;  3TTK A;  4GXA A;  1G0H A;  1Y3N A;  2A5T A;  2ZXT A;  2BJI A;  4N15 A;  3LUZ A;  4FED A;  1FTO A;  1NI9 A;  3T93 B;  1CE2 A;  3OD7 A;  3RPL A;  1B1X A;  2XXP A;  1XS5 A;  2DWI A;  1T0K A;  2NXO A;  2OLB A;  3OO9 A;  4N6K A;  2HXR A;  1SW5 A;  4ESW A;  4F1V A;  5I7I A;  3V83 A;  4XFE A;  2WYP A;  4H8I A;  3FUZ A;  3KOS A;  3KG2 A;  3SEW A;  4YIC A;  5JTY B;  3FVO A;  4GWS A;  4OAN A;  1NNK A;  2VD2 A;  1BKA A;  3I6V A;  1USY H;  4GD5 A;  1LBY A;  4PF8 A;  1A7L A;  1NV2 A;  1BP5 A;  1FTJ A;  3IO4 A;  5JTY A;  5ET6 A;  3SEX A;  1B6H A;  4NG7 A;  4XTC Q;  1MM7 A;  1FPD A;  1OQG A;  4IO3 A;  3CG1 A;  4PAK A;  1SYH A;  3N6T A;  4PP0 A;  3DLN A;  1IZ1 A;  4BDO A;  1FTL A;  1FQA A;  4PDD A;  4YMB A;  4MCO A;  4G8H A;  2H9B A;  2ZNS A;  3B6T A;  4TQU Q;  2P2A A;  2YLN A;  3H06 B;  2QS1 A;  2VPN A;  5EYG A;  4ZE8 A;  4GOT A;  1Q9D A;  3IFC A;  2H98 A;  4OXV A;  2DDK A;  4GWW A;  4O7M A;  5I59 B;  4TOZ A;  3H03 A;  4PTK A;  3GBA A;  1NH8 A;  1B51 A;  4DIG A;  1S9T A;  2P3V A;  3PUW E;  4KR5 A;  2WEF A;  1RDY A;  3TTL A;  4E0W A;  3PUV E;  2Q8M A;  3K6U A;  1QW0 A;  3E13 X;  4FBP A;  4OTE A;  3PMW A;  4MEV A;  1MY3 A;  5I59 A;  4KFQ A;  3MAM A;  4DI4 B;  1H45 A;  4I3E A;  1J1N A;  3FXB A;  4Z0I A;  4EF1 A;  4KCC A;  1RKM A;  4MAG A;  4XXU A;  4F39 A;  2QVU A;  2XX9 A;  3N26 A;  4RXL A;  3LUY A;  1FBG A;  2HXW A;  1NV6 A;  3K1P A;  3LSL A;  4ISU A;  4OVS A;  5F7V A;  4DCX A;  4PFU A;  1UQW A;  3Q28 A;  2HAV A;  1EZO A;  3BIG A;  1QUI A;  2XXU A;  2Q9T A;  2Y7R A;  1LBZ A;  2B3B A;  3KN3 A;  2HFB A;  5KZT A;  2F97 A;  3MPK A;  2P3N A;  2OWT A;  4QBA A;  3SEU A;  3O28 A;  4PE3 A;  2D3I A;  4N6P A;  1IIT A;  4X8R A;  1MY2 A;  3ONM A;  2KLF A;  2UYE A;  1LBV A;  1LAG E;  2XXI A;  4FJP A;  2ONR A;  1SD3 A;  5EQA A;  4ZZE A;  3U72 A;  4PC9 A;  4RPO A;  4EXL A;  3SDF A;  3T0J A;  4IGT A;  3NOH A;  2UVH A;  4XKP A;  2GFE A;  1NV4 A;  3MC2 A;  3O6G A;  4WED A;  4HCY A;  4Q0C A;  4H65 A;  3TFL A;  5B7D A;  3MST A;  5I56 B;  1M5F A;  2I6E A;  1MXY A;  3RYD A;  3KN7 A;  1K9Y A;  4OVQ A;  4YZZ A;  1B46 A;  5DW8 A;  1KWH A;  2RC9 A;  3A09 A;  1BTJ A;  3GZG A;  4GVO A;  2G93 A;  5I3S A;  2ALU A;  1IEJ A;  4I3Y A;  4AS4 A;  1FBP A;  2G29 A;  2FYI A;  4FAT A;  5I56 A;  1FPB A;  4FIM A;  1FQC A;  2DP8 A;  3O6I A;  4XKN A;  1QKA A;  3FXU A;  1P1Q A;  1B4Z A; 
#chains in the Genus database with same CATH homology
 4RK9 A;  4YB7 A;  2IEE A;  1LBB A;  1F9B A;  3O2A A;  1I69 A;  3S9N C;  4F3G A;  2DXY A;  4ONY A;  3ZKL A;  1VFE A;  1B3F A;  5AA4 B;  2D5W A;  2OWS A;  2Q88 A;  3EPE A;  5TU0 A;  3HHF A;  1A40 A;  4I1D A;  1B58 A;  3RPW A;  1ZMG A;  3KSX A;  2NVU B;  3WAF A;  3O9P A;  3CSB A;  1B7Z A;  3QSL A;  4L17 A;  3MVZ A;  5AA4 A;  2I48 A;  2VGQ A;  2I0B A;  4BDL A;  1MQH A;  4IO2 A;  4EF2 A;  2D21 A;  3RY3 A;  1O7T A;  2A5S A;  1PB7 A;  3BBR A;  3B6Q A;  2ONK E;  4ZS9 A;  2Z8D A;  1LAF E;  1B32 A;  1LGB C;  2RCB A;  2XXW A;  4EUO A;  4BDN A;  4OFJ A;  2WKY A;  4JSD A;  4IY6 A;  1DTZ A;  1H44 A;  1NNT A;  2H4I A;  5F1Q A;  3OEM A;  3FVG A;  2HZL A;  2R6G E;  1NNP A;  4THI A;  5KDT B;  4PE5 B;  3TCF A;  2UVI A;  2PBW A;  1PBP A;  4R9G A;  1ELJ A;  1Y20 A;  5CMM A;  3RTW B;  2IA4 A;  4NF8 B;  3VLV A;  1O63 A;  3BFT A;  2O51 A;  3RT8 A;  4Q30 B;  1FTK A;  1PC3 A;  2CZL A;  4OYV A;  3VV5 A;  1XHY A;  2DWJ A;  4R73 A;  4OQO A;  4U4X A;  5KDT A;  1YAE A;  3B7D A;  4KI0 E;  1B0H A;  2DWA A;  3H6U A;  3B6W A;  3DP8 A;  1GGG A;  2AL5 A;  3UGW A;  1XVX A;  1NL5 A;  1H3D A;  3PPQ A;  4R72 A;  2XD2 A;  3AXF A;  4JBZ A;  3VLU A;  4EDP A;  2B3F A;  2I3V A;  3H3G A;  3IOV A;  1Y1M A;  1NFT A;  3MW0 A;  4G68 C;  3OO8 A;  4NE4 A;  4OES A;  3FXR A;  4OEV A;  1N7W A;  4DXC A;  4HCW A;  3V89 B;  3JZJ A;  2REG A;  4LZ7 A;  2NUV A;  3CFX A;  1MY4 A;  2ESN A;  2X7Q A;  3H6T A;  1QUK A;  3W9V A;  2CMO A;  4U21 A;  2XX8 A;  1US5 A;  3K02 A;  2DE4 A;  3SET A;  2PT2 A;  5ICQ A;  3KJ7 A;  4N07 A;  1OLA A;  4PFY A;  1ZU0 A;  2OZZ A;  5I58 B;  3H7M A;  5K2X A;  4NF6 B;  1TT1 A;  3T66 A;  3TMG A;  2F7A A;  5K2Y A;  3GXA A;  2RC7 A;  1LLS A;  3FGS A;  4F3P A;  4YAH X;  2RKM A;  4JWY A;  1NNF A;  1XOC A;  2RCA A;  3FZV A;  4PQJ A;  3F11 A;  2Q2A A;  1WOD A;  1N04 A;  2V93 A;  3M3F A;  5I58 A;  1JNF A;  4NF6 A;  2ONS A;  2Z8F A;  1XC1 A;  2Q89 A;  3C33 A;  4KCD A;  4R74 A;  5CBR A;  3SEY A;  1EZ9 A;  3IAZ A;  4K3F A;  5JK4 A;  4H5G A;  3FAT A;  4LUB A;  3H4Z A;  5EHM A;  1QJM A;  1B40 A;  4QFN A;  4X1B A;  1M5C A;  4PET A;  3K6X A;  1B3L A;  1XVY A;  3C36 A;  1YCJ A;  1JW4 A;  4KHZ E;  3IJX B;  3KFM A;  4F1U A;  1OMP A;  1GR2 A;  5ISU A;  4QSD A;  1SVX B;  4ZEF A;  3MUQ A;  5CMK A;  3ZKK A;  1AL3 A;  2REJ A;  5I57 B;  1SBP A;  3ZS6 A;  2THI A;  3TQL A;  4AQ4 A;  2Z22 A;  1ZLQ A;  4I9D A;  4QF9 A;  4DCY A;  1US4 A;  1B3G A;  5I57 A;  1JVY A;  3THI A;  1SDX A;  3G3H A;  1JVX A;  4LQ2 A;  2Y7W A;  3A3U A;  3U94 A;  1MG1 A;  2P0S A;  3PGF A;  1OIB A;  1AH5 A;  2DWH A;  1LFH A;  4NF5 B;  3K01 A;  4TLM B;  4F3S A;  1MRP A;  3T22 A;  2XXX A;  2V25 A;  4TLL B;  5TPA B;  2HCA A;  1VR5 A;  4Q5T A;  3C4M A;  1MQG A;  1UIV A;  1OLC A;  2XXT A;  4JXI A;  5H8N B;  3VVD A;  4R2F A;  1WDN A;  2DYX A;  4ELP A;  3RGY A;  3FJM A;  4ELR A;  4KPT A;  1IXC A;  3R7X A;  2Q8J A;  4Q8R A;  1MH4 A;  5TPA A;  3S4U A;  3K6W A;  3K0V A;  1WVJ A;  4NF4 B;  3TDJ A;  1URS A;  3L6H A;  3K1M A;  1RYO A;  1MY1 A;  5H8N A;  1H43 A;  1MXU A;  2UYF A;  3PD8 A;  3KGC A;  4HS7 A;  1A8E A;  5EYF A;  3M3L A;  4NWC A;  1IXI A;  5H8S A;  4NF4 A;  3TEL A;  4RJZ A;  3ILU B;  2O69 A;  4IO5 A;  1DOT A;  2Q2C A;  4MH5 A;  4O3A A;  3BFU A;  3G3K A;  2YJP A;  4RA1 A;  1URD A;  4AB6 A;  3QYT A;  4NTL A;  2W7Y A;  1AMF A;  2RIN A;  3RUM A;  3LSX A;  5FHN A;  3S9M C;  2VOZ A;  3UP9 A;  1DPE A;  3CIJ A;  4E0X A;  4LP2 B;  4QFK A;  4DE8 A;  3TYH A;  5FHM A;  4OFO A;  3VLW A;  1LB9 A;  1OVT A;  1ANF A;  4LVQ A;  4R6Y A;  2H5Y A;  5CM6 A;  4LON B;  1I6Q A;  4X1D A;  3S2V A;  3C31 A;  1N0T A;  3EN3 A;  2ABH A;  3O6H A;  4OFL A;  4F3B A;  1D3K A;  4H6D A;  4IY5 A;  3FIR A;  4R75 A;  3RNN A;  4GF8 A;  2I49 A;  4QSC A;  3LR1 A;  3JV9 A;  4DZ1 A;  5ITO A;  1SI0 A;  3EQ1 A;  3D4G A;  1MXW A;  1B5I A;  4POW A;  4ND9 A;  1PB8 A;  1N3W A;  1RYX A;  4ZEB A;  1A55 A;  5ICT A;  3EHT A;  1Q1K A;  4FAJ A;  3CI8 A;  1PBQ A;  3KZG A;  1LAX A;  4ZE9 A;  3FAS A;  3S9E A;  4KQP A;  1MY0 A;  4KYD A;  2UVG A;  4OET A;  3TUS A;  2Y7P A;  2DSF A;  1GTK A;  3IK6 B;  2F6P A;  2O6A A;  3SER A;  1I6B A;  4OHN A;  4NMY A;  4LA9 A;  3GBB A;  1M5B A;  2I0C A;  2AYS A;  4DLD A;  1LB8 A;  2GHA A;  3GLB A;  5DTB A;  4ELO A;  4OVJ A;  4M1V A;  5CBS A;  5I84 A;  3TCH A;  1BLF A;  4ELQ A;  4BLA A;  3VDF A;  1P1O A;  1Y1Z A;  2LAO A;  5BUU A;  4IO7 A;  1VFD A;  1SQY A;  4LAT A;  3EHS A;  3U8Q A;  4YKJ A;  3RLF E;  3QUF A;  1TXF A;  3QXM A;  4GRK A;  1N3X A;  3VXB A;  1B05 A;  2OBG A;  5J1D A;  1TFD A;  3IL1 B;  4QFL A;  3OO7 A;  3KEI A;  1MM6 A;  1FCK A;  1MXZ A;  4IO6 A;  2E1S A;  1R9L A;  2XXV A;  4U2R A;  2R71 A;  3TAJ A;  2HAU A;  2BJJ X;  1JW1 A;  5H8Q B;  3G3I A;  3PUZ E;  1DPP A;  2F6G A;  2PT1 A;  4FEC A;  3T9X B;  2DXR A;  4BDM A;  1FQD A;  1Y3P A;  3TOD A;  1OQH A;  1B3H A;  1SW4 A;  4H0W A;  1CB6 A;  2ANJ A;  1JEV A;  5AA1 A;  3PPO A;  5TP9 B;  1B5J A;  3DM0 A;  2PYY A;  3R6U A;  5H8Q A;  4X9T A;  1LFI A;  1P99 A;  4NF8 A;  4UAC A;  1UTB B;  3FJ7 A;  4AB5 A;  1A99 A;  3MBP A;  3TEP A;  3IOR A;  1HSJ A;  3UN6 A;  1NMU A;  2ZNU A;  2XD3 A;  2ZYN A;  3CRB A;  3OEN A;  3ECR A;  1NH7 A;  3OSQ A;  4MLV A;  3OEK A;  4C1T A;  4F2Q A;  4F22 A;  1SYI A;  3K00 A;  3TTR A;  2F8D A;  1UTB A;  4P11 A;  3Q27 A;  4UA8 A;  1AIV A;  2FA7 A;  2XXY A;  4BDR A;  4G8N A;  1Y3Q A;  3IO6 A;  1R6Z A;  4LZ5 A;  4KYS A;  3VFJ A;  4FOR A;  4I8C A;  3HCQ A;  1S7Y A;  4QSE A;  3VVE A;  4ZED A;  2O84 X;  2QS3 A;  1VE4 A;  3Q25 A;  1EH3 A;  4OER A;  3A3C A;  4IB2 A;  4QFP A;  2I58 A;  4GL0 A;  5DEX B;  1MS7 A;  2DVZ A;  3MQ9 A;  3U93 A;  2QRY A;  2ZYM A;  3H6V A;  1BIY A;  1UIU A;  2I4C A;  3HHG A;  3PMX A;  2DVC A;  4HW8 A;  1URG A;  2RF1 A;  1H76 A;  3V5A A;  5L8D A;  4R2B A;  2DOJ A;  3TKD A;  1YTV A;  5DEX A;  2B65 A;  3TTN A;  4H5F A;  1ZTY A;  3FVN A;  3MZB A;  2Y7I A;  4F19 A;  5L9S A;  1ZBM A;  1PB9 A;  4RYA A;  1NKX A;  3C34 A;  3QIM A;  3MZ9 A;  1IUD A;  2XXQ A;  4OEN A;  3TZA A;  4GXS B;  5IKB A;  3HV1 A;  3IJO B;  4F18 A;  3FD3 A;  3TPA A;  3WAE A;  3FXQ A;  3V8X B;  4R9F A;  2ZYO A;  2M8C A;  3TQW A;  5HPQ A;  5H8F B;  4QHQ A;  2ZYK A;  3CFL A;  4ZEI A;  5IAI A;  3IB0 A;  2UVJ A;  1GV8 A;  3OSR A;  3OXN A;  2NOO A;  3OO6 A;  3T96 B;  1Q35 A;  3QAX A;  1JW5 A;  4YMA A;  5FHO A;  2QJE A;  2O68 A;  4GIZ A;  2V3Q A;  4P0G A;  5DVI A;  5DYH A;  2F35 A;  3T9V A;  5H8F A;  4DXU A;  4LQ5 A;  5FTI A;  3BKI B;  3UIF A;  4JB7 A;  4WEP A;  4R6H A;  4I62 A;  3JYR A;  2QPQ A;  5L9O A;  2VP1 A;  2O7U A;  1Y9U A;  1SW2 A;  2VHA A;  1LFG A;  1QKB A;  4EQ7 A;  4ZEK A;  3MZ1 A;  1D4N A;  3CR9 A;  1B7H A;  5I2K B;  2PVU A;  1ZJL A;  1JEU A;  2DS9 A;  5AA2 B;  3G3F A;  1FQB A;  3IR1 A;  3W9W A;  3M8U A;  4C0R A;  2Z8E A;  1II5 A;  1MDP 1;  1GVC A;  3RN8 A;  4JWX A;  3O29 A;  1FW0 A;  3K2D A;  4GFR A;  5I2K A;  3C35 A;  4GL8 A;  3TTM A;  4NF5 A;  3EHU A;  3DP4 A;  3PUX E;  5AA2 A;  5HM4 B;  4YKK A;  2AIX A;  3M3K A;  1FQF A;  2ZNT A;  1MDQ A;  3PPP A;  4O3C A;  3L6G A;  1IQ7 A;  1D9Y A;  4JDF A;  2XX7 A;  5LOM A;  2UXA A;  1QUJ A;  5EHS A;  2O7I A;  2NWJ A;  3DP6 A;  3P7I A;  5I2N B;  4NWD A;  3E4R A;  1PEB A;  4RY1 A;  5ELV A;  2I3W A;  3HO7 A;  3RTF B;  4F2O A;  4F29 A;  2OCU A;  1M5D A;  3OOA A;  4F1Y A;  1YPN A;  4DDD A;  4H67 A;  2X26 A;  4IO4 A;  4U1O A;  4DXB A;  3OEL A;  5I2N A;  1O64 A;  3CG3 A;  3E9X A;  1LST A;  2AL4 A;  4BDQ A;  4KYE A;  3PU5 A;  4EQB A;  2F7C A;  4OZ9 A;  1SI1 A;  4FE8 A;  2HQ0 A;  2RC8 A;  3OMB A;  5CMC A;  1POY 1;  3U92 A;  5ITP A;  5FTH A;  3H6W A;  3VXC A;  2XHD A;  2F78 A;  4G77 A;  5CC2 A;  3RQT A;  2QMW A;  4IGR A;  4GWO A;  1B0L A;  3SKP A;  4RPN A;  4XKR A;  5A5X B;  1QUL A;  4X48 A;  3N5L A;  2VD3 A;  3HPI A;  3K1N A;  1TWY A;  3CSG A;  4XKQ A;  3USD A;  4QFO A;  2E0S A;  3C32 A;  3PMV A;  5AE4 A;  3E3K A;  4M4G A;  1MH3 A;  1ZKB A;  5L9M A;  5A5X A;  2XXR A;  3CVG A;  3U1O A;  3HST A;  4G4P A;  3MP8 A;  1IXH A;  4HTG A;  1POT A;  1P1W A;  3MPL A;  3MVX A;  4FEB A;  3HN0 A;  3PUY E;  2DE3 A;  2PMS A;  1B1H A;  4O3B A;  1B2H A;  4ESX A;  3PV0 E;  3LSF B;  4ECF A;  1ATG A;  3MP6 A;  2QL3 A;  2FNC A;  2R9J A;  4U1Z A;  4U4S A;  3FV2 A;  1B52 A;  4ZZA A;  1MXV A;  3K6V A;  1QVS A;  3VVF A;  1LCT A;  1OVB A;  5DVF A;  5AA3 A;  1JET A;  2I4B A;  4R6K A;  4RNS A;  1HSL A;  2P1S A;  3VE1 B;  1A54 A;  4NED A;  4MFI A;  1TFA A;  5CI5 A;  1Z7M E;  4OWD A;  1MQD A;  4QRZ A;  5H8H B;  1D9V A;  5CRY A;  3MWB A;  1LCF A;  1N76 A;  1DSN A;  2X7P A;  4XIG Q;  3D4C A;  1DTG A;  4YU0 A;  3I5O A;  3QK6 A;  1MQI A;  3K4U A;  3LSW A;  4PFT A;  1DMB A;  3G3G A;  3KJT A;  3IX1 A;  3O97 A;  4C1U A;  1HSE A;  1LAH E;  3ODB A;  3QUJ A;  1L5T A;  1FTM A;  3S9L C;  5H8H A;  1S50 A;  5HBC A;  4YB5 A;  1EZP A;  3FVK A;  3EF7 A;  4U22 A;  2DE2 A;  1R1N A;  3O66 A;  4MLQ A;  3RT6 B;  1B4H A;  3IB1 A;  2HZK A;  3ZSF A;  2F5X A;  3CFZ A;  3KBR A;  5JEI A;  2O1L A;  4G68 B;  1FQE A;  3DEL B;  4GQO A;  2H99 A;  3UOR A;  5M2V A;  1LBC A;  4POX A;  3IB2 A;  5B70 A;  4GLI A;  2QSX A;  1P1U A;  1VSO A;  4ZDM A;  1R9Q A;  1N7X A;  3FJG A;  1B9J A;  3N94 A;  3TCG A;  1EU8 A;  3IOT A;  4JSO A;  4G68 A;  1ZIU A;  1M5E A;  4YKI A;  4EQ9 A;  2XXH A;  5TP9 A;  1A8F A;  4OEU A;  1MPD A;  4H1X A;  2GHB A;  4Z7E A;  4RK2 A;  1USY E;  3LBS A;  5BWJ A;  4YB6 A;  4PFW A;  2Y7K A;  4OMB A;  1Y4T A;  2V3T A;  3MP1 A;  3W15 C;  3KOT A;  3T9H B;  3G7W A;  3PD9 A;  4EXK A;  4JWO A;  1IIW A;  3KSJ A;  3LC8 A;  3SEV A;  1B7U A;  3I3V A;  2QS2 A;  5KCJ B;  4YKP A;  4KD5 A;  3SES A;  3N6U A;  4U23 A;  2QS4 A;  2V3U A;  2Z23 A;  3KN8 A;  1UTH B;  3MVY A;  4F31 B;  3Q29 A;  4G8M A;  4WXJ A;  1MPC A;  3UK4 A;  4MF3 A;  2PX1 A;  3G3J A;  3FV1 A;  1MPB A;  3IOU A;  1N84 A;  2HEU A;  3MVW A;  5KCJ A;  5DT6 A;  3UA8 A;  1JQF A;  5CMB A;  1B5H A;  1UTH A;  3R26 A;  2O1M A;  4LZ8 A;  1IXG A;  2Y84 A;  5AA2 D;  2GH9 A;  2H25 A;  3Q26 A;  3PPN A;  4ZEC A;  3PPR A;  5DVJ A;  1XT8 A;  1MXX A;  4H8J A;  1Y4C A;  2A5T B;  1Z7N E;  2F34 A;  3MJN A;  3T9U A;  4P0I A;  2YPN A;  2OK2 A;  1I6A A;  1AOV A;  2V84 A;  4MBP A;  2DQV A;  1P1N A;  3C9H A;  1PDA A;  2ZMB A;  1B3E A;  2F36 A;  4N13 A;  4G2Z A;  3ILT B;  2QMX A;  1SW1 A;  3IOW A;  2F7B A;  2OJT A;  4WKM A;  2GRV A;  1MQJ A;  3TTK A;  4GXA A;  1Y3N A;  2A5T A;  2ZXT A;  4FED A;  1FTO A;  3T93 B;  1CE2 A;  3OD7 A;  1B1X A;  2XXP A;  1XS5 A;  2DWI A;  1T0K A;  2NXO A;  2OLB A;  3OO9 A;  1SW5 A;  4ESW A;  4F1V A;  3V83 A;  4H8I A;  3FUZ A;  3KOS A;  3KG2 A;  3SEW A;  4YIC A;  5JTY B;  3FVO A;  1NNK A;  2VD2 A;  1BKA A;  3I6V A;  1USY H;  4GD5 A;  1A7L A;  1BP5 A;  1FTJ A;  3IO4 A;  5JTY A;  3SEX A;  1B6H A;  4XTC Q;  1MM7 A;  1OQG A;  4IO3 A;  3CG1 A;  1SYH A;  3N6T A;  4PP0 A;  3DLN A;  1IZ1 A;  4BDO A;  1FTL A;  1FQA A;  4YMB A;  4G8H A;  2H9B A;  2ZNS A;  3B6T A;  4TQU Q;  2P2A A;  2YLN A;  3H06 B;  2QS1 A;  4ZE8 A;  4GOT A;  2H98 A;  4OXV A;  5I59 B;  4TOZ A;  3H03 A;  3GBA A;  1NH8 A;  1B51 A;  4DIG A;  1S9T A;  3PUW E;  4KR5 A;  3TTL A;  4E0W A;  3PUV E;  3K6U A;  1QW0 A;  3E13 X;  4OTE A;  3PMW A;  1MY3 A;  5I59 A;  4KFQ A;  3MAM A;  1H45 A;  1J1N A;  4Z0I A;  4EF1 A;  4KCC A;  1RKM A;  4XXU A;  4F39 A;  2XX9 A;  3N26 A;  4RXL A;  3LUY A;  2HXW A;  3K1P A;  3LSL A;  4ISU A;  5F7V A;  4DCX A;  4PFU A;  1UQW A;  3Q28 A;  2HAV A;  1EZO A;  1QUI A;  2XXU A;  2Q9T A;  2Y7R A;  2B3B A;  3KN3 A;  2HFB A;  5KZT A;  2F97 A;  3MPK A;  2OWT A;  3SEU A;  3O28 A;  2D3I A;  4N6P A;  1IIT A;  1MY2 A;  3ONM A;  2KLF A;  2UYE A;  1LAG E;  2XXI A;  4FJP A;  2ONR A;  1SD3 A;  4ZZE A;  3U72 A;  4RPO A;  4EXL A;  3SDF A;  4IGT A;  2UVH A;  4XKP A;  2GFE A;  3MC2 A;  3O6G A;  4WED A;  4HCY A;  4Q0C A;  4H65 A;  3TFL A;  5B7D A;  5I56 B;  1M5F A;  2I6E A;  1MXY A;  3KN7 A;  4YZZ A;  1B46 A;  1KWH A;  2RC9 A;  3A09 A;  1BTJ A;  3GZG A;  4GVO A;  2G93 A;  2ALU A;  1IEJ A;  2G29 A;  2FYI A;  4FAT A;  5I56 A;  4FIM A;  1FQC A;  2DP8 A;  3O6I A;  4XKN A;  1QKA A;  3FXU A;  1P1Q A;  1B4Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...