3B50A

Structure of h. influenzae sialic acid binding protein bound to neu5ac.
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
310
structure length
310
Chain Sequence
ADYDLKFGMNAGTSSNEYKAAEMFAKEVKEKSQGKIEISLYPSSQLGDDRAMLKQLKDGSLDFTFAESARFQLFYPEAAVFALPYVISNYNVAQKALFDTEFGKDLIKKMDKDLGVTLLSQAYNGTRQTTSNRAINSIADMKGLKLRVPNAATNLAYAKYVGASPTPMAFSEVYLALQTNAVDGQENPLAAVQAQKFYEVQKFLAMTNHILNDQLYLVSNETYKELPEDLQKVVKDAAENAAKYHTKLFVDGEKDLVTFFEKQGVKITHPDLVPFKESMKPYYAEFVKQTGQKGESALKQIEAINPKGEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Sialic acid-binding periplasmic protein siaP
publication title Characterization of the N-Acetyl-5-neuraminic Acid-binding Site of the Extracytoplasmic Solute Receptor (SiaP) of Nontypeable Haemophilus influenzae Strain 2019
pubmed doi rcsb
source organism Haemophilus influenzae
total genus 121
structure length 310
sequence length 310
ec nomenclature
pdb deposition date 2007-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 3b50A00
4P47A 4PF8A 2ZZVA 4PAKA 4P1LA 2CEYA 4UABA 4P3LA 2VPOA 4NF0A 4PBQA 4YICA 4P56A 4PGPA 4MEVA 5I5PA 4YZZA 4PGNA 2XXKA 4DI4B 4N6KA 2PFYA 4MNPA 5CM6A 2XA5A 4NX1A 4P1EA 4PC9A 4PF6A 2WX9A 4N8YA 2ZZWA 4OANA 4NAPA 2WYPA 4O7MA 4OVTA 4P9KA 4OVSA 5IGAA 4OVRA 3GYYA 4OA4A 2XWKA 2HPGA 4XF5A 2VPNA 4PE3A 4PFRA 4MIJA 4PFIA 4PCDA 4XFEA 4O8MA 4MX6A 4P8BA 4PDDA 4N91A 2XWVA 4NG7A 4N4UA 4DI3D 5IZZA 2WYKA 2V4CA 2ZZXA 2HZKA 4N6DA 4PBHA 2XWOA 5I7IA 4N17A 3B50A 4NN3A 4PDHA 4NQ8A 4OVPA 4MAGA 5LTCA 4MNCA 3FXBA 4NGUA 4PFBA 4O94A 4MHFA 2PFZA 2HZLA 4MNIA 4LN5A 4X04A 4PAIA 4OVQA 4MCOA 3U65A 4N15A 4PETA 2XWIA 4MMPA 4NHBA 4PAFA 5IM2A 4XEQA 4X8RA 2CEXA 4N8GA
chains in the Genus database with same CATH superfamily
5I2NB 3IOVA 2GHAA 1B52A 3KBRA 1Y3PA 4ZEBA 4JVCA 2NUVA 3IX1A 3OEKA 3UA8A 4NF5B 3PD9A 3K6XA 1VSOA 5CM6A 4OMBA 3C31A 1GVCA 4WEDA 1EYIA 2BJIA 5AA1A 4Z7EA 2Q2AA 3LC8A 3PMVA 1LB9A 1O63A 2VT5A 5A5XB 3OELA 1J1NA 5K2YA 3N5LA 4JDFA 4ZEDA 2Q2CA 4KPTA 2R8TA 2G93A 4G2ZA 4DI3D 3IAZA 4OETA 5EQ8A 3GXAA 1K9YA 3MSTA 2XD2A 3DP6A 5J1DA 1B5IA 1QJMA 4IY5A 4RNSA 3MVYA 4R9FA 4U4XA 2UVJA 1JW5A 2FIXA 4XXUA 1FTLA 3CSBA 3TTLA 5ITPA 3HHFA 4OFJA 1B6HA 4QFPA 3Q25A 1IEJA 1NNFA 3T66A 2CMOA 4F3PA 4FEDA 2XWIA 4QSCA 3OO9A 3IJOB 4Q5TA 1UTBA 2XXTA 1MY4A 3WAFA 3S9MC 3BFTA 1H43A 1FTOA 1QUKA 1JW4A 4QXDA 2QS4A 3G3IA 4KYDA 4R74A 4P56A 5FHMA 2WEFA 1I6QA 3E4RA 1KWHA 3H06B 4JVDA 4PTKA 4YMAA 3EF7A 4QHQA 2F7CA 4ELOA 3PPRA 2WYPA 1Y3NA 1LCFA 2GH9A 4F1YA 2ZNUA 4KYEA 3BIHA 3K6VA 3I6VA 3VXCA 4YKKA 1UIVA 1MH4A 4GFRA 2F5XA 3PUVE 2F3DA 5AA2B 5I58B 4UA8A 4QRZA 2B4LA 1GV8A 2FNCA 2PVUA 1JW1A 4I3EA 3T96B 2H98A 3KGCA 4H6DA 3S4UA 4OVPA 3FXRA 5I84A 1B3LA 3M3LA 4PP0A 3UGWA 2QSXA 4GWWA 1SPIA 4GXSB 4PAIA 1B51A 1B1HA 3EPEA 1NH8A 1POY1 3CFZA 3O6IA 5T3JA 3EHTA 1B3FA 4HCYA 4BDQA 2I4CA 4H5FA 2Y7PA 4KYSA 3LSLA 3FJ7A 1FBHA 4LUBA 5H8NB 3W15C 4PAKA 1MRPA 3UP9A 3HCQA 1LAXA 3MWBA 4NF0A 4ONYA 4MBPA 3SEYA 1FBPA 2I48A 3KOTA 3QYTA 4PQJA 4YB5A 3KC1A 3Q29A 4X48A 4EDPA 4LQ2A 3SESA 4N6PA 2R71A 5AA2D 2HFBA 2I6EA 4G77A 2ZYOA 1JNFA 1P1WA 3PV0E 3K6UA 4MLVA 3DP8A 1PB9A 4O7MA 1PBQA 3CI8A 2UVIA 1MQGA 4OA4A 3TZAA 2VPNA 3M3KA 3NOHA 1LBBA 3USDA 4FE8A 1A55A 5H8FB 4O8MA 1P1QA 3G3KA 2DXYA 3BKIB 1US4A 2WYKA 4GX4A 4NF4A 4X1DA 4QBAA 4OZ9A 1N7WA 4JWOA 1FBFA 2XXXA 4PDHA 3FATA 2ZNTA 1MXXA 2E0SA 1KZ8A 2HQ0A 5I59B 1URDA 3IB2A 4EQ7A 3JYRA 1F9BA 2IA4A 4POWA 1Q1KA 4RPOA 1A40A 1FW0A 2L5VA 1POTA 4IO2A 4RJZA 3QK6A 5TPAB 1MPBA 1T0KA 2XXPA 4LP2B 3K02A 1EYJA 1EU8A 4OFLA 1IMCA 3PUXE 1SYIA 1SI1A 2QVRA 4R75A 1MY3A 4NTLA 4PGPA 1SI0A 2V3QA 1FPFA 1ZBMA 3KC0A 4DI4B 1A8EA 3S9NC 3RY3A 1MY1A 5HBCA 5EHMA 1I69A 2I3WA 1LFHA 1FPIA 3IR1A 3CVGA 4OFOA 5IZ1A 3U8QA 3GZGA 3UORA 4NE4A 2RC9A 4U1ZA 2HPGA 3EHSA 1TT1A 3H6VA 1JP4A 4IO4A 1FQAA 4N91A 4OWDA 4LA9A 1PC3A 4QSEA 2VP1A 1FPEA 4X9TA 3SETA 1WVJA 3N6UA 1DCUA 2B3FA 4FJPA 3HO7A 3RNNA 2Z8DA 5DVJA 2OWSA 1NV7A 1GGGA 3RPLB 1IMDA 4ELPA 3MP1A 2DWHA 5CRYA 5F7VA 4F2OA 2Q9TA 3RPLA 3VLWA 4DE8A 3VVFA 1IXGA 2OX3A 3MVWA 4DIGA 4GWXA 4FORA 4NHBA 4NF8B 4IO7A 1AH5A 4X8RA 1L5TA 2KQZA 3C4MA 1NNTA 2V93A 3IORA 4OEVA 4HCWA 4UABA 2DS9A 3C35A 1OVBA 1JQFA 3C33A 3VV5A 5EHSA 1O64A 3IO4A 2UXAA 4R2FA 4YICA 2RKMA 4MH5A 4TLLB 4LZ5A 4L17A 4OESA 4YZZA 1A54A 2XXKA 5AA4B 2F7BA 3IL1B 1NH7A 1MXZA 1MQDA 1USYH 4N8YA 1IUDA 4H8IA 3MUQA 3EKIA 5DTBA 2DSFA 4OXVA 4OVRA 1NV4A 4O3CA 1RDXA 3ROJA 4R6KA 5K2XA 2WBBA 4DZ1A 4OYVA 3H6UA 1B0HA 5IZ3A 2HAUA 4LZ8A 2XXRA 2F6GA 4AS4A 1QW0A 1D9YA 4N6DA 5KDTA 2H4IA 1P1UA 1MG1A 3HN0A 1MXVA 3TYHA 3GLBA 5HPQA 4IR8A 1Q35A 5H8QA 2O7IA 2X7QA 1N04A 4RXLA 3RTWB 3TQWA 2Z8FA 4O94A 4U1OA 1LBZA 3JV9A 3QXMA 3CRBA 3H3GA 1B46A 2UYFA 3MPKA 3TFLA 2DWIA 4LQ5A 1MPCA 4ECFA 3U65A 5ET6A 5B7DA 2UVGA 1H3DA 4MMPA 1SW1A 2NVUB 1D9QA 5IM2A 3E79A 1IMEA 5ICTA 2VGQA 4PF8A 4GF8A 4KCDA 1KA1A 1NV6A 1AMFA 4G68B 1VE4A 2VPOA 3LUZA 4YMBA 4ZEFA 1NNKA 3O2AA 1M5BA 5HM4B 3Q26A 4G68A 3BFUA 1IXHA 4QF9A 3PPNA 5CMMA 3ECRA 4NX1A 3UK4A 1FCKA 4OERA 1OLAA 4NWDA 1FQCA 4NAPA 2B4MA 4P9KA 3HSTA 3G3GA 3V89B 3C36A 3QSLA 4EXKA 3TTNA 2VOZA 3FGSA 3O6GA 2F78A 1MM7A 4Q30B 4NEDA 3IB1A 1LAGE 3U94A 3I3VA 2XXHA 2QMXA 3FXQA 4RK2A 3MZ9A 3MAMA 2X26A 1XOCA 4KD5A 5L9SA 3CHGA 4KFQA 1LAHE 2XXUA 4MNCA 5A5LA 2ONKE 4I3YA 1NL5A 4PFBA 2Z23A 4F39A 1LEVA 1M5CA 4BDRA 4IO6A 4MLQA 4EQ9A 3VXBA 3U1OA 4IO5A 1NNPA 3SEUA 2H99A 5FTHA 3RQTA 1N3XA 4F2QA 4JWYA 3UIFA 4P47A 2DWAA 1DBZA 5JK4A 4YAHX 1B4HA 1NV3A 1IMAA 1IITA 1DOTA 1M5EA 2VD2A 4R9GA 1VDWA 4IY6A 3ZS6A 5FBPA 3KBZA 1B3EA 2G29A 2XX7A 1UTBB 2NXOA 3OOAA 3RT6B 1LBXA 3R7XA 4F3SA 1K9ZA 3BIGA 4PC9A 3HFUA 2ZZWA 4ND9A 1HSEA 1FQBA 1N76A 4I8CA 3SZPA 4GWUA 2QMWA 3HPIA 1RKMA 3B8BA 4YKPA 2XWKA 4YB7A 5LOMA 1B7UA 5LDZA 3VFJA 4QFNA 4ZEIA 3CG1A 3MW0A 1JEVA 2NWJA 3KOSA 1B40A 1MQIA 2CZHA 4GD5A 2OWTA 2Y7RA 3B6WA 3MZ1A 5ET7A 3K1NA 2V4CA 1GR2A 1FJ9A 2Y7WA 3OO8A 4PFUA 1UTHB 1MY2A 4RPNA 5EQ7A 3Q27A 2Y7KA 3H6WA 2A5TA 1FQEA 1XI6A 1M5DA 5FTIA 3O9PA 1JVYA 1UTHA 1LFIA 2ZXTA 3RLFE 3OO6A 3DP4A 4C0RA 4GWYA 3IO6A 4H1XA 1B5JA 4EF2A 4DCYA 1DMBA 2P3VA 4IGRA 2OCUA 2V25A 4F3BA 1HSJA 1MQHA 2DDKA 2GRVA 1QUIA 2QL3A 1ZKBA 4IGTA 1R9LA 2CEXA 1EZOA 1D9VA 1UQWA 2QS3A 4F1UA 2OZZA 1P1OA 4BDOA 2F3BA 4RK9A 4P3LA 1XT8A 1ZTYA 3KFMA 1NI9A 3KZGA 3FUZA 2YLNA 3G3JA 4P0IA 4OHNA 2Y5KA 4IB2A 5ET8A 1DK4A 3SEXA 2UYEA 1B3GA 1B05A 4POXA 2E1SA 4AB5A 1MXUA 3MZBA 2IEEA 4OVTA 1FTAA 1XS5A 4E0XA 1D3KA 1UIUA 1VR5A 1NV2A 1KA0A 5I56A 1FQFA 1ATGA 1PB8A 1Y3QA 2F7AA 1SW2A 2WKYA 4F29A 3H4ZA 5IZZA 4GVOA 2O6AA 1ELJA 2DWJA 1EH3A 4YKIA 4P11A 4DXUA 3B6TA 3LSXA 1MPDA 1B0LA 1MDP1 3O29A 1A7LA 2R6GE 1FTKA 3SERA 4ZE9A 4O3BA 4AS5A 4ZS9A 4NF4B 2XHDA 4MHFA 3W9WA 4F31B 4WXJA 4I40A 5CI5A 4X04A 1TFAA 3FBPA 2GQ1A 4XKRA 3L6HA 3KN8A 3D4CA 1BLFA 5EYHA 1H45A 1OLCA 1LLSA 4PAFA 4BDLA 3SEVA 3AXFA 1IMFA 5BUUA 4NF6A 3C34A 4P1LA 4U23A 4O3AA 1MQJA 1YTVA 1CB6A 3OEMA 4JSDA 5I5PA 3E9XA 4PGNA 1IIWA 5ICQA 2PFYA 2DQVA 4QFKA 3IFCA 1NUZA 1A99A 4WEPA 5AE4A 3FJMA 2CZIA 5JTYA 3OSQA 4TLMB 3RPWA 2I58A 4LVQA 4XF5A 3TMGA 3I5OA 1ZMGA 4FAJA 1SW4A 4XFEA 4MX6A 2XWVA 2XXIA 3FXUA 2P0SA 1SW5A 3FD3A 5L9MA 5ITOA 2O7UA 1IQ7A 5I2KA 5I7IA 3B50A 4XIGQ 3MBPA 5EQ9A 4HE0A 1SD3A 3CR9A 5I3SA 1NV5A 2JJKA 3A09A 3FIRA 3ZKKA 3O28A 3TTMA 4XKPA 2H25A 4OENA 4GX6A 3GBBA 3ODBA 4GL0A 3RN8A 5F24A 2PX1A 4BDNA 1FJ6A 2DE3A 4KHZE 1QUJA 3K1MA 2ZNSA 3KSJA 1B3HA 2KLFA 5JEIA 4HTGA 3MPLA 1BKAA 4U21A 3KJ7A 4UACA 3IFAA 3CFLA 1QKBA 4FIMA 1TWYA 4GBWA 4JWXA 4F1VA 4RYAA 4GRKA 1OVTA 4PBQA 3L6GA 3M3FA 1TFDA 4IO3A 2H9BA 1QVSA 1LGBC 2FIEA 4N6KA 3E13X 1N84A 2CZKA 4N13A 1G0HA 5ET5A 1N7XA 2PT1A 1Z7ME 4EUOA 1PDAA 4H67A 2LAOA 2O68A 2X7PA 3ILTB 4C1TA 2ONSA 5EQAA 2PT2A 4NMYA 4R73A 4PCDA 4OTEA 3TPAA 2Q8MA 4FECA 3ZKLA 4YU0A 4BDMA 2OJTA 4GX3A 1AIVA 4KQPA 4NWCA 2ZZXA 1RDZA 1B7ZA 5IZ3B 1Y9UA 1G0IA 5LTCA 3T93B 4GBVA 5DW8A 5TP9A 4TQUQ 3TTKA 1JEUA 5KDTB 3IOUA 2UVHA 5KCJA 4MJOA 4OVJA 4OVQA 4MCOA 4G8HA 5H8QB 2HXRA 1M5FA 1XHYA 2I0BA 2R9JA 3RTFB 1BK4A 4JB7A 4K3FA 5DVFA 2MKZA 1YYZA 1B4ZA 1B7HA 1MM6A 4ZEKA 5DYHA 2Y7IA 2D5WA 5I57A 3F11A 2D3IA 2ZYNA 3THIA 2W7YA 2RCAA 3TODA 4R6HA 2O1LA 5EYFA 2A5SA 5IKBA 3RUMA 4F3GA 2RF1A 1DSNA 3KG2A 1DTGA 3SDFA 1R6ZA 4BLAA 4GL8A 5CMBA 3EHUA 4AB6A 3E3KA 4KI0E 2VD3A 1R9QA 2THIA 4JXIA 3Q28A 1Y1ZA 1TXFA 2F34A 1N3WA 2ZYMA 4PE3A 2AYSA 4MIJA 4G8NA 3CFXA 3O66A 1US5A 4E0WA 3FVOA 3PUWE 4PFYA 4GQOA 4YB6A 3MYUA 3B6QA 3T22A 3TDJA 2O1MA 4R6YA 4EXLA 2AL5A 1B2HA 2ANJA 2F8DA 1IZ1A 4M4GA 3FVGA 2QFLA 1HSLA 4NQ8A 3KEIA 1QGXA 5TU0A 4GOTA 4NGUA 3LSWA 2HZLA 5CMKA 1URGA 4LN5A 1YPNA 5I2NA 1EZ9A 3LSFB 1B5HA 1N0TA 4PETA 1ZIUA 1LB8A 5H8HB 4DXCA 4ISUA 4NF5A 3CIJA 4ZECA 4KCCA 3H6TA 1FBEA 1Y20A 3TCGA 5H8HA 2I4BA 2ALUA 1NFTA 1AOVA 4G61A 4AQ4A 2XX9A 1ZU0A 3IK6B 3N6TA 1NUWA 4THIA 4ESWA 1FBGA 5A5XA 3IB0A 3FVNA 1Y1MA 3FZVA 5CBSA 3PMWA 3T9VA 2PBWA 1VFDA 2YPNA 4OANA 1B32A 2FVZA 4G68C 3A29A 3QIMA 3PTYA 1OMPA 3TCFA 1YZ0A 4ZE8A 4PFIA 4X1BA 2REGA 3DLNA 1WODA 4I9DA 3SEWA 1GTKA 3U72A 3D1RA 2QJEA 5L9OA 2OLBA 3QMFA 1SDXA 2KR0A 4N17A 1FRPA 3K2DA 2B3BA 2ZMBA 2PYYA 1NUXA 1PEBA 4DXBA 2DE4A 1LCTA 2CZLA 2I0CA 4KR5A 2ABHA 2A5TB 3TAJA 3OO7A 1FQDA 4GWSA 2ESNA 3QUJA 3WAEA 2AIXA 1OQHA 3FJGA 3LUYA 3V5AA 3ONMA 4N07A 4U22A 1BIYA 2ZYKA 1LBCA 1DPPA 2I3VA 3SKPA 1NV1A 3MP8A 2ZZVA 3CG3A 4XKNA 4QFLA 1FTMA 3S9LC 3C32A 3VLUA 3PUZE 2Y5LA 3FV2A 3PPQA 2XXVA 4I62A 4PE5B 4OEUA 1JETA 3R26A 1FPJA 1OQGA 1NV0A 2VHAA 4C1UA 3GBAA 2XA5A 2OK2A 2I49A 4PF6A 3KJTA 3OD7A 1EYKA 4DCXA 3K1PA 1A8FA 3H7MA 1FSAA 4OVSA 1FPKA 1PB7A 1YAEA 2V3TA 3IJXB 4Z0IA 1LBYA 4MF3A 5AA2A 5I58A 4G4PA 1I6AA 1NUYA 1I6BA 4H5GA 5F1QA 4JBZA 1IXCA 5BWJA 3IOTA 3K00A 4ZZEA 4LONB 2Z8EA 4PBHA 3TELA 3PPPA 1S50A 2XWOA 1YXIA 5L8DA 5I56B 1MH3A 3LR1A 3R6UA 1B58A 3FVKA 4H45A 4HE2A 3MQ9A 3FXBA 1ZLQA 3MC2A 4GLIA 5J16A 3VVEA 4I1DA 1IMBA 3PPOA 3RT8A 2RCBA 2DE2A 3N26A 1NMUA 3VE1B 3MVZA 5ESYA 4HW8A 4HE1A 5H8NA 1MS7A 1EZPA 4LATA 3OENA 3T1BA 3PUYE 3LBSA 1CE2A 2HCAA 3G3HA 4ELRA 5ELVA 1FTJA 1B9JA 3K01A 3KN7A 4LZ7A 2XX8A 2HEUA 3K4UA 1BTJA 4PFWA 3MJNA 3RGYA 4EF1A 4R72A 1MXWA 3K0VA 2O51A 3V8XB 4KXPA 1FBDA 2F35A 4NF6B 1FPLA 3ISPA 4MNPA 1WDNA 3N94A 3B7DA 2RINA 5DVIA 2B65A 2WX9A 5M2VA 4N81A 3G7WA 1R1NA 3KSXA 4OQOA 3FV1A 5H8FA 5IGAA 3GYYA 1AWBA 2AL4A 2DVZA 3TEPA 1MY0A 1AL3A 3T9XB 3D4GA 1ZJLA 4EQBA 1JVXA 1S9TA 1QULA 3HV1A 5JTYB 1FPGA 4P8BA 4PDDA 4NG7A 4ZZAA 3VDFA 3BBRA 3E78A 2FYIA 1DTZA 4YKJA 3U93A 2QVUA 2HZKA 3C9HA 5I59A 1O7TA 3PGFA 4GXAA 4QFOA 1MDQA 4P0GA 5CBRA 5IAIA 5CMCA 3V83A 2F97A 1H44A 3T9UA 3P7IA 2RC8A 3DM0A 4WKMA 4O7IA 1RYXA 5DT6A 2PFZA 5I2KB 1FPBA 5TPAA 5DEXB 5FHNA 3OMBA 1II5A 2ONRA 4XTCQ 2FBPA 1XVYA 1SYHA 5DEXA 3LV0A 1P1NA 1B1XA 2GFEA 2P3NA 2Q8JA 2OWZA 4ESXA 3ZSFA 3S9EA 1DPEA 2DOJA 3T9HB 2HXWA 2HAVA 4TOZA 1SQYA 2CEYA 4M1VA 4F18A 3PD8A 5ISUA 1Z7NE 2F36A 4FATA 2M8CA 3OXNA 1XC1A 2O84X 2F6PA 1PBPA 4FEBA 1Q9DA 1URSA 1FBCA 2WBDA 5KZTA 3JZJA 1LBWA 3ILUB 4H46A 4GIZA 3VLVA 5CC2A 3DELB 3OSRA 5EYGA 3K6WA 2D21A 3TTRA 3MP6A 3HHGA 1INPA 4N4UA 4RY1A 1SVXB 3M8UA 1XVXA 3EN3A 1MXYA 4RA1A 4NN3A 1RDYA 2DYXA 4Q8RA 1LFGA 2QS1A 2Y84A 2QVVA 4JVIA 3CSGA 3EQ1A 4NF8A 1RYOA 1NKXA 2FA7A 3TCHA 4DDDA 1S7YA 4N15A 2P1SA 5TP9B 2RC7A 5KCJB 2H5YA 4XEQA 3O6HA 2PMSA 3QUFA 4GWZA 1D4NA 1Y4CA 2HHMA 2NOOA 4HS7A 5AA4A 1USYE 2V84A 1LBVA 4U2RA 4HXVA 3U92A 3QAXA 4MEVA 4H65A 5I57B 4U4SA 4GWOA 3A3UA 4F19A 4P1EA 5H8SA 3O97A 1LAFE 2PCRA 2Q88A 2XXQA 3PMXA 3H03A 3W9VA 4MFIA 4JSOA 3T0JA 5AA3A 2DVCA 2DP8A 3A3CA 3TUSA 1ANFA 4PFRA 4ELQA 3TQLA 2V3UA 1FPDA 2XXYA 2GHBA 1YCJA 2Q89A 2DXRA 2P2AA 1LSTA 2QPQA 5FHOA 2OBGA 4H0WA 3TKDA 3IOWA 1QKAA 1P99A 4G8MA 4MAGA 2BJJX 3FASA 4ZDMA 1CNQA 3UN6A 1IXIA 4MNIA 3VVDA 4DLDA 4PFTA 4FBPA 2Z22A 1BP5A 1Y4TA 2O69A 4XKQA 3KN3A 2REJA 4Q0CA 2XXWA 3MVXA 1VFEA 2FHYA 5B70A 4QSDA 1SBPA 2QRYA 3G3FA 3RYDA 1H76A 2YJPA 4R2BA 2XD3A 4H8JA 2QS2A 1OIBA 2Q74A 4N8GA 4F22A 3PU5A 3S2VA
chains in the Genus database with same CATH topology
1NV1A 2ZZVA 4HCWA 4P1LA 4UABA 4JVCA 4YICA 2Y5LA 5I5PA 4YZZA 4PGNA 2XXKA 1FPJA 2PFYA 1NV0A 3IFCA 5CM6A 2XA5A 1NUZA 1EYIA 2BJIA 4N8YA 4PF6A 1EYKA 3EKIA 2CZIA 1FSAA 4OVSA 1FPKA 4OVRA 1LBYA 1NV4A 2VT5A 1RDXA 3ROJA 4XF5A 2WBBA 1NUYA 4XFEA 5IZ3A 4MX6A 2XWVA 2R8TA 4DI3D 4AS4A 5EQ8A 4N6DA 4PBHA 2XWOA 1YXIA 1K9YA 5I7IA 3MSTA 3B50A 5J1DA 4IR8A 4H45A 4HE2A 5EQ9A 4HE0A 3FXBA 5I3SA 1NV5A 4O94A 2JJKA 1LBZA 2FIXA 5J16A 1IMBA 2DE2A 4GX6A 5ESYA 5F24A 4HE1A 3U65A 5ET6A 1FJ6A 2DE3A 2XWIA 4MMPA 3T1BA 1D9QA 5IM2A 3E79A 1IMEA 4PF8A 3IFAA 1KA1A 1NV6A 4GBWA 4F1VA 4QXDA 2VPOA 3LUZA 4PBQA 4P56A 2WEFA 4KXPA 1FBDA 2FIEA 4JVDA 4PTKA 1FPLA 4N6KA 3ISPA 4MNPA 4NX1A 2CZKA 1G0HA 5ET5A 2WX9A 4N81A 4NAPA 2WYPA 2B4MA 4P9KA 5IGAA 3GYYA 1AWBA 2DVZA 5EQAA 3BIHA 2F5XA 4PCDA 2Q8MA 1FPGA 4P8BA 2F3DA 4PDDA 4NG7A 4GX3A 3E78A 2B4LA 2ZZXA 1RDZA 2QVUA 2HZKA 4I3EA 5IZ3B 3CHGA 4OVPA 1G0IA 5LTCA 4GBVA 4MNCA 5A5LA 4I3YA 5DW8A 4PFBA 4O7IA 2PFZA 1FPBA 4GWWA 1LEVA 1SPIA 4MJOA 4PAIA 4OVQA 4MCOA 2HXRA 2FBPA 1BK4A 5T3JA 2MKZA 3LV0A 4HCYA 2P3NA 1YYZA 2OWZA 1FBHA 4P47A 1DBZA 5JK4A 1NV3A 1IMAA 4PAKA 2CEYA 1VDWA 4M1VA 4F18A 5FBPA 3KBZA 4NF0A 1FBPA 3KC1A 1LBXA 1K9ZA 3BIGA 4PC9A 3HFUA 2ZZWA 1Q9DA 1FBCA 2WBDA 1LBWA 4H46A 4O7MA 3SZPA 4GWUA 3B8BA 4OA4A 2XWKA 5LDZA 2VPNA 5EYGA 3NOHA 4PE3A 4MIJA 2CZHA 4O8MA 1INPA 5ET7A 4N4UA 2WYKA 2V4CA 3MYUA 1FJ9A 4GX4A 4QBAA 5EQ7A 4NN3A 1FBFA 1RDYA 4PDHA 2QFLA 4NQ8A 1XI6A 1QGXA 1KZ8A 4NGUA 2QVVA 4JVIA 2HZLA 4GWYA 4LN5A 2P3VA 4N15A 2DDKA 4PETA 2L5VA 4XEQA 2CEXA 4GWZA 2HHMA 1EYJA 4F1UA 1FBEA 1IMCA 2F3BA 2QVRA 4P3LA 4G61A 1LBVA 4HXVA 1NI9A 4PGPA 4MEVA 1NUWA 2V3QA 1FPFA 1FBGA 3KC0A 2Y5KA 4DI4B 4F19A 5ET8A 1DK4A 4P1EA 2PCRA 3W9VA 1FPIA 4OANA 4OVTA 3T0JA 2FVZA 5IZ1A 3A29A 1FTAA 3PTYA 2HPGA 1YZ0A 4PFRA 1NV2A 4PFIA 1KA0A 1JP4A 4N91A 1FPDA 5IZZA 3D1RA 2QPQA 3QMFA 1FPEA 4X9TA 2KR0A 4N17A 1FRPA 1DCUA 4MAGA 1NUXA 4AS5A 4MHFA 1NV7A 2DE4A 3RPLB 1CNQA 3W9WA 4I40A 1IMDA 4MNIA 4X04A 4FBPA 3FBPA 2GQ1A 2Q9TA 4GWSA 3RPLA 2FHYA 2OX3A 3RYDA 4GWXA 5EYHA 4NHBA 4PAFA 2Q74A 4X8RA 2KQZA 4N8GA 1IMFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P47 A;  4PF8 A;  2ZZV A;  4PAK A;  4P1L A;  2CEY A;  4UAB A;  4P3L A;  2VPO A;  4NF0 A;  4PBQ A;  4YIC A;  4P56 A;  4PGP A;  4MEV A;  5I5P A;  4YZZ A;  4PGN A;  2XXK A;  4DI4 B;  4N6K A;  2PFY A;  4MNP A;  5CM6 A;  2XA5 A;  4NX1 A;  4P1E A;  4PC9 A;  4PF6 A;  2WX9 A;  4N8Y A;  2ZZW A;  4OAN A;  4NAP A;  2WYP A;  4O7M A;  4OVT A;  4P9K A;  4OVS A;  5IGA A;  4OVR A;  3GYY A;  4OA4 A;  2XWK A;  2HPG A;  4XF5 A;  2VPN A;  4PE3 A;  4PFR A;  4MIJ A;  4PFI A;  4PCD A;  4XFE A;  4O8M A;  4MX6 A;  4P8B A;  4PDD A;  4N91 A;  2XWV A;  4NG7 A;  4N4U A;  4DI3 D;  5IZZ A;  2WYK A;  2V4C A;  2ZZX A;  2HZK A;  4N6D A;  4PBH A;  2XWO A;  5I7I A;  4N17 A;  3B50 A;  4NN3 A;  4PDH A;  4NQ8 A;  4OVP A;  4MAG A;  5LTC A;  4MNC A;  3FXB A;  4NGU A;  4PFB A;  4O94 A;  4MHF A;  2PFZ A;  2HZL A;  4MNI A;  4LN5 A;  4X04 A;  4PAI A;  4OVQ A;  4MCO A;  3U65 A;  4N15 A;  4PET A;  2XWI A;  4MMP A;  4NHB A;  4PAF A;  5IM2 A;  4XEQ A;  4X8R A;  2CEX A;  4N8G A; 
#chains in the Genus database with same CATH topology
 5I2N B;  3IOV A;  2GHA A;  1B52 A;  3KBR A;  1Y3P A;  4ZEB A;  4JVC A;  2NUV A;  3IX1 A;  3OEK A;  3UA8 A;  4NF5 B;  3PD9 A;  3K6X A;  1VSO A;  5CM6 A;  4OMB A;  3C31 A;  1GVC A;  4WED A;  1EYI A;  2BJI A;  5AA1 A;  4Z7E A;  2Q2A A;  3LC8 A;  3PMV A;  1LB9 A;  1O63 A;  2VT5 A;  5A5X B;  3OEL A;  1J1N A;  5K2Y A;  3N5L A;  4JDF A;  4ZED A;  2Q2C A;  4KPT A;  2R8T A;  2G93 A;  4G2Z A;  4DI3 D;  3IAZ A;  4OET A;  5EQ8 A;  3GXA A;  1K9Y A;  3MST A;  2XD2 A;  3DP6 A;  5J1D A;  1B5I A;  1QJM A;  4IY5 A;  4RNS A;  3MVY A;  4R9F A;  4U4X A;  2UVJ A;  1JW5 A;  2FIX A;  4XXU A;  1FTL A;  3CSB A;  3TTL A;  5ITP A;  3HHF A;  4OFJ A;  1B6H A;  4QFP A;  3Q25 A;  1IEJ A;  1NNF A;  3T66 A;  2CMO A;  4F3P A;  4FED A;  2XWI A;  4QSC A;  3OO9 A;  3IJO B;  4Q5T A;  1UTB A;  2XXT A;  1MY4 A;  3WAF A;  3S9M C;  3BFT A;  1H43 A;  1FTO A;  1QUK A;  1JW4 A;  4QXD A;  2QS4 A;  3G3I A;  4KYD A;  4R74 A;  4P56 A;  5FHM A;  2WEF A;  1I6Q A;  3E4R A;  1KWH A;  3H06 B;  4JVD A;  4PTK A;  4YMA A;  3EF7 A;  4QHQ A;  2F7C A;  4ELO A;  3PPR A;  2WYP A;  1Y3N A;  1LCF A;  2GH9 A;  4F1Y A;  2ZNU A;  4KYE A;  3BIH A;  3K6V A;  3I6V A;  3VXC A;  4YKK A;  1UIV A;  1MH4 A;  4GFR A;  2F5X A;  3PUV E;  2F3D A;  5AA2 B;  5I58 B;  4UA8 A;  4QRZ A;  2B4L A;  1GV8 A;  2FNC A;  2PVU A;  1JW1 A;  4I3E A;  3T96 B;  2H98 A;  3KGC A;  4H6D A;  3S4U A;  4OVP A;  3FXR A;  5I84 A;  1B3L A;  3M3L A;  4PP0 A;  3UGW A;  2QSX A;  4GWW A;  1SPI A;  4GXS B;  4PAI A;  1B51 A;  1B1H A;  3EPE A;  1NH8 A;  1POY 1;  3CFZ A;  3O6I A;  5T3J A;  3EHT A;  1B3F A;  4HCY A;  4BDQ A;  2I4C A;  4H5F A;  2Y7P A;  4KYS A;  3LSL A;  3FJ7 A;  1FBH A;  4LUB A;  5H8N B;  3W15 C;  4PAK A;  1MRP A;  3UP9 A;  3HCQ A;  1LAX A;  3MWB A;  4NF0 A;  4ONY A;  4MBP A;  3SEY A;  1FBP A;  2I48 A;  3KOT A;  3QYT A;  4PQJ A;  4YB5 A;  3KC1 A;  3Q29 A;  4X48 A;  4EDP A;  4LQ2 A;  3SES A;  4N6P A;  2R71 A;  5AA2 D;  2HFB A;  2I6E A;  4G77 A;  2ZYO A;  1JNF A;  1P1W A;  3PV0 E;  3K6U A;  4MLV A;  3DP8 A;  1PB9 A;  4O7M A;  1PBQ A;  3CI8 A;  2UVI A;  1MQG A;  4OA4 A;  3TZA A;  2VPN A;  3M3K A;  3NOH A;  1LBB A;  3USD A;  4FE8 A;  1A55 A;  5H8F B;  4O8M A;  1P1Q A;  3G3K A;  2DXY A;  3BKI B;  1US4 A;  2WYK A;  4GX4 A;  4NF4 A;  4X1D A;  4QBA A;  4OZ9 A;  1N7W A;  4JWO A;  1FBF A;  2XXX A;  4PDH A;  3FAT A;  2ZNT A;  1MXX A;  2E0S A;  1KZ8 A;  2HQ0 A;  5I59 B;  1URD A;  3IB2 A;  4EQ7 A;  3JYR A;  1F9B A;  2IA4 A;  4POW A;  1Q1K A;  4RPO A;  1A40 A;  1FW0 A;  2L5V A;  1POT A;  4IO2 A;  4RJZ A;  3QK6 A;  5TPA B;  1MPB A;  1T0K A;  2XXP A;  4LP2 B;  3K02 A;  1EYJ A;  1EU8 A;  4OFL A;  1IMC A;  3PUX E;  1SYI A;  1SI1 A;  2QVR A;  4R75 A;  1MY3 A;  4NTL A;  4PGP A;  1SI0 A;  2V3Q A;  1FPF A;  1ZBM A;  3KC0 A;  4DI4 B;  1A8E A;  3S9N C;  3RY3 A;  1MY1 A;  5HBC A;  5EHM A;  1I69 A;  2I3W A;  1LFH A;  1FPI A;  3IR1 A;  3CVG A;  4OFO A;  5IZ1 A;  3U8Q A;  3GZG A;  3UOR A;  4NE4 A;  2RC9 A;  4U1Z A;  2HPG A;  3EHS A;  1TT1 A;  3H6V A;  1JP4 A;  4IO4 A;  1FQA A;  4N91 A;  4OWD A;  4LA9 A;  1PC3 A;  4QSE A;  2VP1 A;  1FPE A;  4X9T A;  3SET A;  1WVJ A;  3N6U A;  1DCU A;  2B3F A;  4FJP A;  3HO7 A;  3RNN A;  2Z8D A;  5DVJ A;  2OWS A;  1NV7 A;  1GGG A;  3RPL B;  1IMD A;  4ELP A;  3MP1 A;  2DWH A;  5CRY A;  5F7V A;  4F2O A;  2Q9T A;  3RPL A;  3VLW A;  4DE8 A;  3VVF A;  1IXG A;  2OX3 A;  3MVW A;  4DIG A;  4GWX A;  4FOR A;  4NHB A;  4NF8 B;  4IO7 A;  1AH5 A;  4X8R A;  1L5T A;  2KQZ A;  3C4M A;  1NNT A;  2V93 A;  3IOR A;  4OEV A;  4HCW A;  4UAB A;  2DS9 A;  3C35 A;  1OVB A;  1JQF A;  3C33 A;  3VV5 A;  5EHS A;  1O64 A;  3IO4 A;  2UXA A;  4R2F A;  4YIC A;  2RKM A;  4MH5 A;  4TLL B;  4LZ5 A;  4L17 A;  4OES A;  4YZZ A;  1A54 A;  2XXK A;  5AA4 B;  2F7B A;  3IL1 B;  1NH7 A;  1MXZ A;  1MQD A;  1USY H;  4N8Y A;  1IUD A;  4H8I A;  3MUQ A;  3EKI A;  5DTB A;  2DSF A;  4OXV A;  4OVR A;  1NV4 A;  4O3C A;  1RDX A;  3ROJ A;  4R6K A;  5K2X A;  2WBB A;  4DZ1 A;  4OYV A;  3H6U A;  1B0H A;  5IZ3 A;  2HAU A;  4LZ8 A;  2XXR A;  2F6G A;  4AS4 A;  1QW0 A;  1D9Y A;  4N6D A;  5KDT A;  2H4I A;  1P1U A;  1MG1 A;  3HN0 A;  1MXV A;  3TYH A;  3GLB A;  5HPQ A;  4IR8 A;  1Q35 A;  5H8Q A;  2O7I A;  2X7Q A;  1N04 A;  4RXL A;  3RTW B;  3TQW A;  2Z8F A;  4O94 A;  4U1O A;  1LBZ A;  3JV9 A;  3QXM A;  3CRB A;  3H3G A;  1B46 A;  2UYF A;  3MPK A;  3TFL A;  2DWI A;  4LQ5 A;  1MPC A;  4ECF A;  3U65 A;  5ET6 A;  5B7D A;  2UVG A;  1H3D A;  4MMP A;  1SW1 A;  2NVU B;  1D9Q A;  5IM2 A;  3E79 A;  1IME A;  5ICT A;  2VGQ A;  4PF8 A;  4GF8 A;  4KCD A;  1KA1 A;  1NV6 A;  1AMF A;  4G68 B;  1VE4 A;  2VPO A;  3LUZ A;  4YMB A;  4ZEF A;  1NNK A;  3O2A A;  1M5B A;  5HM4 B;  3Q26 A;  4G68 A;  3BFU A;  1IXH A;  4QF9 A;  3PPN A;  5CMM A;  3ECR A;  4NX1 A;  3UK4 A;  1FCK A;  4OER A;  1OLA A;  4NWD A;  1FQC A;  4NAP A;  2B4M A;  4P9K A;  3HST A;  3G3G A;  3V89 B;  3C36 A;  3QSL A;  4EXK A;  3TTN A;  2VOZ A;  3FGS A;  3O6G A;  2F78 A;  1MM7 A;  4Q30 B;  4NED A;  3IB1 A;  1LAG E;  3U94 A;  3I3V A;  2XXH A;  2QMX A;  3FXQ A;  4RK2 A;  3MZ9 A;  3MAM A;  2X26 A;  1XOC A;  4KD5 A;  5L9S A;  3CHG A;  4KFQ A;  1LAH E;  2XXU A;  4MNC A;  5A5L A;  2ONK E;  4I3Y A;  1NL5 A;  4PFB A;  2Z23 A;  4F39 A;  1LEV A;  1M5C A;  4BDR A;  4IO6 A;  4MLQ A;  4EQ9 A;  3VXB A;  3U1O A;  4IO5 A;  1NNP A;  3SEU A;  2H99 A;  5FTH A;  3RQT A;  1N3X A;  4F2Q A;  4JWY A;  3UIF A;  4P47 A;  2DWA A;  1DBZ A;  5JK4 A;  4YAH X;  1B4H A;  1NV3 A;  1IMA A;  1IIT A;  1DOT A;  1M5E A;  2VD2 A;  4R9G A;  1VDW A;  4IY6 A;  3ZS6 A;  5FBP A;  3KBZ A;  1B3E A;  2G29 A;  2XX7 A;  1UTB B;  2NXO A;  3OOA A;  3RT6 B;  1LBX A;  3R7X A;  4F3S A;  1K9Z A;  3BIG A;  4PC9 A;  3HFU A;  2ZZW A;  4ND9 A;  1HSE A;  1FQB A;  1N76 A;  4I8C A;  3SZP A;  4GWU A;  2QMW A;  3HPI A;  1RKM A;  3B8B A;  4YKP A;  2XWK A;  4YB7 A;  5LOM A;  1B7U A;  5LDZ A;  3VFJ A;  4QFN A;  4ZEI A;  3CG1 A;  3MW0 A;  1JEV A;  2NWJ A;  3KOS A;  1B40 A;  1MQI A;  2CZH A;  4GD5 A;  2OWT A;  2Y7R A;  3B6W A;  3MZ1 A;  5ET7 A;  3K1N A;  2V4C A;  1GR2 A;  1FJ9 A;  2Y7W A;  3OO8 A;  4PFU A;  1UTH B;  1MY2 A;  4RPN A;  5EQ7 A;  3Q27 A;  2Y7K A;  3H6W A;  2A5T A;  1FQE A;  1XI6 A;  1M5D A;  5FTI A;  3O9P A;  1JVY A;  1UTH A;  1LFI A;  2ZXT A;  3RLF E;  3OO6 A;  3DP4 A;  4C0R A;  4GWY A;  3IO6 A;  4H1X A;  1B5J A;  4EF2 A;  4DCY A;  1DMB A;  2P3V A;  4IGR A;  2OCU A;  2V25 A;  4F3B A;  1HSJ A;  1MQH A;  2DDK A;  2GRV A;  1QUI A;  2QL3 A;  1ZKB A;  4IGT A;  1R9L A;  2CEX A;  1EZO A;  1D9V A;  1UQW A;  2QS3 A;  4F1U A;  2OZZ A;  1P1O A;  4BDO A;  2F3B A;  4RK9 A;  4P3L A;  1XT8 A;  1ZTY A;  3KFM A;  1NI9 A;  3KZG A;  3FUZ A;  2YLN A;  3G3J A;  4P0I A;  4OHN A;  2Y5K A;  4IB2 A;  5ET8 A;  1DK4 A;  3SEX A;  2UYE A;  1B3G A;  1B05 A;  4POX A;  2E1S A;  4AB5 A;  1MXU A;  3MZB A;  2IEE A;  4OVT A;  1FTA A;  1XS5 A;  4E0X A;  1D3K A;  1UIU A;  1VR5 A;  1NV2 A;  1KA0 A;  5I56 A;  1FQF A;  1ATG A;  1PB8 A;  1Y3Q A;  2F7A A;  1SW2 A;  2WKY A;  4F29 A;  3H4Z A;  5IZZ A;  4GVO A;  2O6A A;  1ELJ A;  2DWJ A;  1EH3 A;  4YKI A;  4P11 A;  4DXU A;  3B6T A;  3LSX A;  1MPD A;  1B0L A;  1MDP 1;  3O29 A;  1A7L A;  2R6G E;  1FTK A;  3SER A;  4ZE9 A;  4O3B A;  4AS5 A;  4ZS9 A;  4NF4 B;  2XHD A;  4MHF A;  3W9W A;  4F31 B;  4WXJ A;  4I40 A;  5CI5 A;  4X04 A;  1TFA A;  3FBP A;  2GQ1 A;  4XKR A;  3L6H A;  3KN8 A;  3D4C A;  1BLF A;  5EYH A;  1H45 A;  1OLC A;  1LLS A;  4PAF A;  4BDL A;  3SEV A;  3AXF A;  1IMF A;  5BUU A;  4NF6 A;  3C34 A;  4P1L A;  4U23 A;  4O3A A;  1MQJ A;  1YTV A;  1CB6 A;  3OEM A;  4JSD A;  5I5P A;  3E9X A;  4PGN A;  1IIW A;  5ICQ A;  2PFY A;  2DQV A;  4QFK A;  3IFC A;  1NUZ A;  1A99 A;  4WEP A;  5AE4 A;  3FJM A;  2CZI A;  5JTY A;  3OSQ A;  4TLM B;  3RPW A;  2I58 A;  4LVQ A;  4XF5 A;  3TMG A;  3I5O A;  1ZMG A;  4FAJ A;  1SW4 A;  4XFE A;  4MX6 A;  2XWV A;  2XXI A;  3FXU A;  2P0S A;  1SW5 A;  3FD3 A;  5L9M A;  5ITO A;  2O7U A;  1IQ7 A;  5I2K A;  5I7I A;  3B50 A;  4XIG Q;  3MBP A;  5EQ9 A;  4HE0 A;  1SD3 A;  3CR9 A;  5I3S A;  1NV5 A;  2JJK A;  3A09 A;  3FIR A;  3ZKK A;  3O28 A;  3TTM A;  4XKP A;  2H25 A;  4OEN A;  4GX6 A;  3GBB A;  3ODB A;  4GL0 A;  3RN8 A;  5F24 A;  2PX1 A;  4BDN A;  1FJ6 A;  2DE3 A;  4KHZ E;  1QUJ A;  3K1M A;  2ZNS A;  3KSJ A;  1B3H A;  2KLF A;  5JEI A;  4HTG A;  3MPL A;  1BKA A;  4U21 A;  3KJ7 A;  4UAC A;  3IFA A;  3CFL A;  1QKB A;  4FIM A;  1TWY A;  4GBW A;  4JWX A;  4F1V A;  4RYA A;  4GRK A;  1OVT A;  4PBQ A;  3L6G A;  3M3F A;  1TFD A;  4IO3 A;  2H9B A;  1QVS A;  1LGB C;  2FIE A;  4N6K A;  3E13 X;  1N84 A;  2CZK A;  4N13 A;  1G0H A;  5ET5 A;  1N7X A;  2PT1 A;  1Z7M E;  4EUO A;  1PDA A;  4H67 A;  2LAO A;  2O68 A;  2X7P A;  3ILT B;  4C1T A;  2ONS A;  5EQA A;  2PT2 A;  4NMY A;  4R73 A;  4PCD A;  4OTE A;  3TPA A;  2Q8M A;  4FEC A;  3ZKL A;  4YU0 A;  4BDM A;  2OJT A;  4GX3 A;  1AIV A;  4KQP A;  4NWC A;  2ZZX A;  1RDZ A;  1B7Z A;  5IZ3 B;  1Y9U A;  1G0I A;  5LTC A;  3T93 B;  4GBV A;  5DW8 A;  5TP9 A;  4TQU Q;  3TTK A;  1JEU A;  5KDT B;  3IOU A;  2UVH A;  5KCJ A;  4MJO A;  4OVJ A;  4OVQ A;  4MCO A;  4G8H A;  5H8Q B;  2HXR A;  1M5F A;  1XHY A;  2I0B A;  2R9J A;  3RTF B;  1BK4 A;  4JB7 A;  4K3F A;  5DVF A;  2MKZ A;  1YYZ A;  1B4Z A;  1B7H A;  1MM6 A;  4ZEK A;  5DYH A;  2Y7I A;  2D5W A;  5I57 A;  3F11 A;  2D3I A;  2ZYN A;  3THI A;  2W7Y A;  2RCA A;  3TOD A;  4R6H A;  2O1L A;  5EYF A;  2A5S A;  5IKB A;  3RUM A;  4F3G A;  2RF1 A;  1DSN A;  3KG2 A;  1DTG A;  3SDF A;  1R6Z A;  4BLA A;  4GL8 A;  5CMB A;  3EHU A;  4AB6 A;  3E3K A;  4KI0 E;  2VD3 A;  1R9Q A;  2THI A;  4JXI A;  3Q28 A;  1Y1Z A;  1TXF A;  2F34 A;  1N3W A;  2ZYM A;  4PE3 A;  2AYS A;  4MIJ A;  4G8N A;  3CFX A;  3O66 A;  1US5 A;  4E0W A;  3FVO A;  3PUW E;  4PFY A;  4GQO A;  4YB6 A;  3MYU A;  3B6Q A;  3T22 A;  3TDJ A;  2O1M A;  4R6Y A;  4EXL A;  2AL5 A;  1B2H A;  2ANJ A;  2F8D A;  1IZ1 A;  4M4G A;  3FVG A;  2QFL A;  1HSL A;  4NQ8 A;  3KEI A;  1QGX A;  5TU0 A;  4GOT A;  4NGU A;  3LSW A;  2HZL A;  5CMK A;  1URG A;  4LN5 A;  1YPN A;  5I2N A;  1EZ9 A;  3LSF B;  1B5H A;  1N0T A;  4PET A;  1ZIU A;  1LB8 A;  5H8H B;  4DXC A;  4ISU A;  4NF5 A;  3CIJ A;  4ZEC A;  4KCC A;  3H6T A;  1FBE A;  1Y20 A;  3TCG A;  5H8H A;  2I4B A;  2ALU A;  1NFT A;  1AOV A;  4G61 A;  4AQ4 A;  2XX9 A;  1ZU0 A;  3IK6 B;  3N6T A;  1NUW A;  4THI A;  4ESW A;  1FBG A;  5A5X A;  3IB0 A;  3FVN A;  1Y1M A;  3FZV A;  5CBS A;  3PMW A;  3T9V A;  2PBW A;  1VFD A;  2YPN A;  4OAN A;  1B32 A;  2FVZ A;  4G68 C;  3A29 A;  3QIM A;  3PTY A;  1OMP A;  3TCF A;  1YZ0 A;  4ZE8 A;  4PFI A;  4X1B A;  2REG A;  3DLN A;  1WOD A;  4I9D A;  3SEW A;  1GTK A;  3U72 A;  3D1R A;  2QJE A;  5L9O A;  2OLB A;  3QMF A;  1SDX A;  2KR0 A;  4N17 A;  1FRP A;  3K2D A;  2B3B A;  2ZMB A;  2PYY A;  1NUX A;  1PEB A;  4DXB A;  2DE4 A;  1LCT A;  2CZL A;  2I0C A;  4KR5 A;  2ABH A;  2A5T B;  3TAJ A;  3OO7 A;  1FQD A;  4GWS A;  2ESN A;  3QUJ A;  3WAE A;  2AIX A;  1OQH A;  3FJG A;  3LUY A;  3V5A A;  3ONM A;  4N07 A;  4U22 A;  1BIY A;  2ZYK A;  1LBC A;  1DPP A;  2I3V A;  3SKP A;  1NV1 A;  3MP8 A;  2ZZV A;  3CG3 A;  4XKN A;  4QFL A;  1FTM A;  3S9L C;  3C32 A;  3VLU A;  3PUZ E;  2Y5L A;  3FV2 A;  3PPQ A;  2XXV A;  4I62 A;  4PE5 B;  4OEU A;  1JET A;  3R26 A;  1FPJ A;  1OQG A;  1NV0 A;  2VHA A;  4C1U A;  3GBA A;  2XA5 A;  2OK2 A;  2I49 A;  4PF6 A;  3KJT A;  3OD7 A;  1EYK A;  4DCX A;  3K1P A;  1A8F A;  3H7M A;  1FSA A;  4OVS A;  1FPK A;  1PB7 A;  1YAE A;  2V3T A;  3IJX B;  4Z0I A;  1LBY A;  4MF3 A;  5AA2 A;  5I58 A;  4G4P A;  1I6A A;  1NUY A;  1I6B A;  4H5G A;  5F1Q A;  4JBZ A;  1IXC A;  5BWJ A;  3IOT A;  3K00 A;  4ZZE A;  4LON B;  2Z8E A;  4PBH A;  3TEL A;  3PPP A;  1S50 A;  2XWO A;  1YXI A;  5L8D A;  5I56 B;  1MH3 A;  3LR1 A;  3R6U A;  1B58 A;  3FVK A;  4H45 A;  4HE2 A;  3MQ9 A;  3FXB A;  1ZLQ A;  3MC2 A;  4GLI A;  5J16 A;  3VVE A;  4I1D A;  1IMB A;  3PPO A;  3RT8 A;  2RCB A;  2DE2 A;  3N26 A;  1NMU A;  3VE1 B;  3MVZ A;  5ESY A;  4HW8 A;  4HE1 A;  5H8N A;  1MS7 A;  1EZP A;  4LAT A;  3OEN A;  3T1B A;  3PUY E;  3LBS A;  1CE2 A;  2HCA A;  3G3H A;  4ELR A;  5ELV A;  1FTJ A;  1B9J A;  3K01 A;  3KN7 A;  4LZ7 A;  2XX8 A;  2HEU A;  3K4U A;  1BTJ A;  4PFW A;  3MJN A;  3RGY A;  4EF1 A;  4R72 A;  1MXW A;  3K0V A;  2O51 A;  3V8X B;  4KXP A;  1FBD A;  2F35 A;  4NF6 B;  1FPL A;  3ISP A;  4MNP A;  1WDN A;  3N94 A;  3B7D A;  2RIN A;  5DVI A;  2B65 A;  2WX9 A;  5M2V A;  4N81 A;  3G7W A;  1R1N A;  3KSX A;  4OQO A;  3FV1 A;  5H8F A;  5IGA A;  3GYY A;  1AWB A;  2AL4 A;  2DVZ A;  3TEP A;  1MY0 A;  1AL3 A;  3T9X B;  3D4G A;  1ZJL A;  4EQB A;  1JVX A;  1S9T A;  1QUL A;  3HV1 A;  5JTY B;  1FPG A;  4P8B A;  4PDD A;  4NG7 A;  4ZZA A;  3VDF A;  3BBR A;  3E78 A;  2FYI A;  1DTZ A;  4YKJ A;  3U93 A;  2QVU A;  2HZK A;  3C9H A;  5I59 A;  1O7T A;  3PGF A;  4GXA A;  4QFO A;  1MDQ A;  4P0G A;  5CBR A;  5IAI A;  5CMC A;  3V83 A;  2F97 A;  1H44 A;  3T9U A;  3P7I A;  2RC8 A;  3DM0 A;  4WKM A;  4O7I A;  1RYX A;  5DT6 A;  2PFZ A;  5I2K B;  1FPB A;  5TPA A;  5DEX B;  5FHN A;  3OMB A;  1II5 A;  2ONR A;  4XTC Q;  2FBP A;  1XVY A;  1SYH A;  5DEX A;  3LV0 A;  1P1N A;  1B1X A;  2GFE A;  2P3N A;  2Q8J A;  2OWZ A;  4ESX A;  3ZSF A;  3S9E A;  1DPE A;  2DOJ A;  3T9H B;  2HXW A;  2HAV A;  4TOZ A;  1SQY A;  2CEY A;  4M1V A;  4F18 A;  3PD8 A;  5ISU A;  1Z7N E;  2F36 A;  4FAT A;  2M8C A;  3OXN A;  1XC1 A;  2O84 X;  2F6P A;  1PBP A;  4FEB A;  1Q9D A;  1URS A;  1FBC A;  2WBD A;  5KZT A;  3JZJ A;  1LBW A;  3ILU B;  4H46 A;  4GIZ A;  3VLV A;  5CC2 A;  3DEL B;  3OSR A;  5EYG A;  3K6W A;  2D21 A;  3TTR A;  3MP6 A;  3HHG A;  1INP A;  4N4U A;  4RY1 A;  1SVX B;  3M8U A;  1XVX A;  3EN3 A;  1MXY A;  4RA1 A;  4NN3 A;  1RDY A;  2DYX A;  4Q8R A;  1LFG A;  2QS1 A;  2Y84 A;  2QVV A;  4JVI A;  3CSG A;  3EQ1 A;  4NF8 A;  1RYO A;  1NKX A;  2FA7 A;  3TCH A;  4DDD A;  1S7Y A;  4N15 A;  2P1S A;  5TP9 B;  2RC7 A;  5KCJ B;  2H5Y A;  4XEQ A;  3O6H A;  2PMS A;  3QUF A;  4GWZ A;  1D4N A;  1Y4C A;  2HHM A;  2NOO A;  4HS7 A;  5AA4 A;  1USY E;  2V84 A;  1LBV A;  4U2R A;  4HXV A;  3U92 A;  3QAX A;  4MEV A;  4H65 A;  5I57 B;  4U4S A;  4GWO A;  3A3U A;  4F19 A;  4P1E A;  5H8S A;  3O97 A;  1LAF E;  2PCR A;  2Q88 A;  2XXQ A;  3PMX A;  3H03 A;  3W9V A;  4MFI A;  4JSO A;  3T0J A;  5AA3 A;  2DVC A;  2DP8 A;  3A3C A;  3TUS A;  1ANF A;  4PFR A;  4ELQ A;  3TQL A;  2V3U A;  1FPD A;  2XXY A;  2GHB A;  1YCJ A;  2Q89 A;  2DXR A;  2P2A A;  1LST A;  2QPQ A;  5FHO A;  2OBG A;  4H0W A;  3TKD A;  3IOW A;  1QKA A;  1P99 A;  4G8M A;  4MAG A;  2BJJ X;  3FAS A;  4ZDM A;  1CNQ A;  3UN6 A;  1IXI A;  4MNI A;  3VVD A;  4DLD A;  4PFT A;  4FBP A;  2Z22 A;  1BP5 A;  1Y4T A;  2O69 A;  4XKQ A;  3KN3 A;  2REJ A;  4Q0C A;  2XXW A;  3MVX A;  1VFE A;  2FHY A;  5B70 A;  4QSD A;  1SBP A;  2QRY A;  3G3F A;  3RYD A;  1H76 A;  2YJP A;  4R2B A;  2XD3 A;  4H8J A;  2QS2 A;  1OIB A;  2Q74 A;  4N8G A;  4F22 A;  3PU5 A;  3S2V A; 
#chains in the Genus database with same CATH homology
 1NV1 A;  2ZZV A;  4HCW A;  4P1L A;  4UAB A;  4JVC A;  4YIC A;  2Y5L A;  5I5P A;  4YZZ A;  4PGN A;  2XXK A;  1FPJ A;  2PFY A;  1NV0 A;  3IFC A;  5CM6 A;  2XA5 A;  1NUZ A;  1EYI A;  2BJI A;  4N8Y A;  4PF6 A;  1EYK A;  3EKI A;  2CZI A;  1FSA A;  4OVS A;  1FPK A;  4OVR A;  1LBY A;  1NV4 A;  2VT5 A;  1RDX A;  3ROJ A;  4XF5 A;  2WBB A;  1NUY A;  4XFE A;  5IZ3 A;  4MX6 A;  2XWV A;  2R8T A;  4DI3 D;  4AS4 A;  5EQ8 A;  4N6D A;  4PBH A;  2XWO A;  1YXI A;  1K9Y A;  5I7I A;  3MST A;  3B50 A;  5J1D A;  4IR8 A;  4H45 A;  4HE2 A;  5EQ9 A;  4HE0 A;  3FXB A;  5I3S A;  1NV5 A;  4O94 A;  2JJK A;  1LBZ A;  2FIX A;  5J16 A;  1IMB A;  2DE2 A;  4GX6 A;  5ESY A;  5F24 A;  4HE1 A;  3U65 A;  5ET6 A;  1FJ6 A;  2DE3 A;  2XWI A;  4MMP A;  3T1B A;  1D9Q A;  5IM2 A;  3E79 A;  1IME A;  4PF8 A;  3IFA A;  1KA1 A;  1NV6 A;  4GBW A;  4F1V A;  4QXD A;  2VPO A;  3LUZ A;  4PBQ A;  4P56 A;  2WEF A;  4KXP A;  1FBD A;  2FIE A;  4JVD A;  4PTK A;  1FPL A;  4N6K A;  3ISP A;  4MNP A;  4NX1 A;  2CZK A;  1G0H A;  5ET5 A;  2WX9 A;  4N81 A;  4NAP A;  2WYP A;  2B4M A;  4P9K A;  5IGA A;  3GYY A;  1AWB A;  2DVZ A;  5EQA A;  3BIH A;  2F5X A;  4PCD A;  2Q8M A;  1FPG A;  4P8B A;  2F3D A;  4PDD A;  4NG7 A;  4GX3 A;  3E78 A;  2B4L A;  2ZZX A;  1RDZ A;  2QVU A;  2HZK A;  4I3E A;  5IZ3 B;  3CHG A;  4OVP A;  1G0I A;  5LTC A;  4GBV A;  4MNC A;  5A5L A;  4I3Y A;  5DW8 A;  4PFB A;  4O7I A;  2PFZ A;  1FPB A;  4GWW A;  1LEV A;  1SPI A;  4MJO A;  4PAI A;  4OVQ A;  4MCO A;  2HXR A;  2FBP A;  1BK4 A;  5T3J A;  2MKZ A;  3LV0 A;  4HCY A;  2P3N A;  1YYZ A;  2OWZ A;  1FBH A;  4P47 A;  1DBZ A;  5JK4 A;  1NV3 A;  1IMA A;  4PAK A;  2CEY A;  1VDW A;  4M1V A;  4F18 A;  5FBP A;  3KBZ A;  4NF0 A;  1FBP A;  3KC1 A;  1LBX A;  1K9Z A;  3BIG A;  4PC9 A;  3HFU A;  2ZZW A;  1Q9D A;  1FBC A;  2WBD A;  1LBW A;  4H46 A;  4O7M A;  3SZP A;  4GWU A;  3B8B A;  4OA4 A;  2XWK A;  5LDZ A;  2VPN A;  5EYG A;  3NOH A;  4PE3 A;  4MIJ A;  2CZH A;  4O8M A;  1INP A;  5ET7 A;  4N4U A;  2WYK A;  2V4C A;  3MYU A;  1FJ9 A;  4GX4 A;  4QBA A;  5EQ7 A;  4NN3 A;  1FBF A;  1RDY A;  4PDH A;  2QFL A;  4NQ8 A;  1XI6 A;  1QGX A;  1KZ8 A;  4NGU A;  2QVV A;  4JVI A;  2HZL A;  4GWY A;  4LN5 A;  2P3V A;  4N15 A;  2DDK A;  4PET A;  2L5V A;  4XEQ A;  2CEX A;  4GWZ A;  2HHM A;  1EYJ A;  4F1U A;  1FBE A;  1IMC A;  2F3B A;  2QVR A;  4P3L A;  4G61 A;  1LBV A;  4HXV A;  1NI9 A;  4PGP A;  4MEV A;  1NUW A;  2V3Q A;  1FPF A;  1FBG A;  3KC0 A;  2Y5K A;  4DI4 B;  4F19 A;  5ET8 A;  1DK4 A;  4P1E A;  2PCR A;  3W9V A;  1FPI A;  4OAN A;  4OVT A;  3T0J A;  2FVZ A;  5IZ1 A;  3A29 A;  1FTA A;  3PTY A;  2HPG A;  1YZ0 A;  4PFR A;  1NV2 A;  4PFI A;  1KA0 A;  1JP4 A;  4N91 A;  1FPD A;  5IZZ A;  3D1R A;  2QPQ A;  3QMF A;  1FPE A;  4X9T A;  2KR0 A;  4N17 A;  1FRP A;  1DCU A;  4MAG A;  1NUX A;  4AS5 A;  4MHF A;  1NV7 A;  2DE4 A;  3RPL B;  1CNQ A;  3W9W A;  4I40 A;  1IMD A;  4MNI A;  4X04 A;  4FBP A;  3FBP A;  2GQ1 A;  2Q9T A;  4GWS A;  3RPL A;  2FHY A;  2OX3 A;  3RYD A;  4GWX A;  5EYH A;  4NHB A;  4PAF A;  2Q74 A;  4X8R A;  2KQZ A;  4N8G A;  1IMF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...