3MP6A

Complex structure of sgf29 and dimethylated h3k4
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
517
structure length
508
Chain Sequence
MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALAAAQTNAAAEFGSSYWTSEYNPNAPILVGSEVAYKPRGEWIQCEVLKVVADGTRFEVRDPEPDELGNSGKVYKCNRKELLLIPPGFPTKNYPPGTKVLARYPETTTFYPAIVIGTKRDGTCRLRFDGEKETEVTRRLVLPSPTALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Histone binding protein
molecule keywords Maltose-binding periplasmic protein,LINKER,SAGA-associated f
publication title Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation
pubmed doi rcsb
source organism Escherichia coli k-12
total genus 151
structure length 508
sequence length 517
ec nomenclature
pdb deposition date 2010-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
A PF07039 DUF1325 SGF29 tudor-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3mp6A05
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3mp6A01
4H5FA 4Z7EA 1MY1A 1MH4A 1OVTA 4QHQA 2DIQA 1IITA 5HPQA 4L17A 2Z22A 2QQRA 3KBRA 3IX1A 3ZS6A 1QKAA 1DMBA 3OD7A 3M9QA 3W15C 3S9LC 3H6UA 2NLUA 1B51A 3MW0A 1BLFA 4NWCA 4R75A 4QQ6A 4A4HA 3OYMA 5AA3A 1MQDA 3PPOA 1FTLA 1B7HA 5I84A 3T9VA 2LCCA 3QYTA 1GVCA 1US5A 4ZECA 2CZLA 3H03A 2VD2A 1ZBMA 1AIVA 3C33A 1AL3A 5ISUA 1UIVA 1B1HA 1H45A 4IY5A 1URGA 4OVAA 4KD5A 3TTRA 4ISUA 4ESWA 1J1NA 2HQEA 4NWDA 5J26A 4QQDA 2EQUA 5KZTA 1T0KA 2P0KA 3FUZA 5DTBA 3E4RA 1Y3QA 5ELVA 2VP1A 2F7AA 3LH0A 4BDYA 4F2QA 2I58A 3D4GA 3DP4A 2QRYA 3PUWE 3MEAA 1OIBA 1B5JA 3MUQA 2M8CA 3OMGA 4GL0A 3S9NC 2RI3A 4ZZEA 2Q2AA 4F29A 1UTHA 3MP6A 4QQGA 5EHMA 2UYEA 3K6VA 5I2KA 1LFGA 3MQ9A 3ONMA 3VFJA 5KDTA 3OO6A 3HHFA 5JTYA 4OERA 1MDQA 3PGFA 4PFWA 3PNWC 1LLSA 3DP8A 1NL5A 2AL4A 2RHUA 2RI2A 4JWXA 4KR5A 3RLFE 2QMWA 4KYEA 4ESXA 2OBGA 4YU0A 1A99A 4P0GA 1VE4A 1SI1A 1I6AA 1YPNA 2XXYA 1Y4CA 1P99A 5H8FA 3KN7A 4WXJA 4BLAA 5IKBA 3V83A 2RHXA 1PBPA 3SEYA 3K6UA 2ONRA 3QIMA 3HHGA 4OEVA 5B70A 4TLLB 2HAVA 3MVYA 1B3EA 2NXOA 3EQ1A 1LBCA 4YZZA 2QMXA 1RI0A 3OS1A 1M5CA 3ILUB 1ZKBA 2V93A 2DVZA 3RGYA 3L6GA 1Y1ZA 3FXUA 3HN0A 2ZNSA 3C36A 1AMFA 2HFBA 4IUUA 2VD3A 5K2XA 4X1BA 4I8CA 3Q27A 5J1DA 2XXPA 3SD4A 2ZXTA 2O69A 2D9TA 4GWOA 4QF9A 3U72A 2DE4A 3IK6B 4ZS9A 2QS2A 1FQFA 3CG1A 3K4UA 4E7KA 2ANJA 4LUBA 3FIRA 2I6EA 4O3AA 3MZBA 3L2RA 5EYFA 1PDAA 5CBSA 3E13X 1R9QA 3KOTA 3OOAA 4C5GA 4G2ZA 2X26A 3M3KA 2I49A 3N5LA 3JZJA 2YRVA 3O6HA 2ZMBA 5IAYA 2OZZA 1B2HA 3OYJA 3B6TA 4II1A 1JW5A 1OMPA 3V8XB 2H9BA 2UVJA 4E7HA 2ABHA 2EFIA 2DWHA 2WKYA 1N0TA 4IO4A 2R9JA 3TELA 3QBYA 2DOJA 4AB5A 3L6HA 4HCWA 3UK4A 3IO6A 4LZ8A 4A4EA 4OYVA 1B5IA 4KYSA 1FCKA 1PB9A 2M1HA 1RYXA 4UACA 1CB6A 1MQJA 3O9PA 4NE4A 1MXUA 4JXIA 5CMCA 2JZ2A 4BDMA 1N27A 3E9XA 3E3KA 3N6UA 2DP8A 2I4CA 1P1UA 3OO7A 1N3WA 3SETA 2V3TA 1A8EA 2L8DA 3O6IA 1A54A 3PPRA 3IORA 1XC1A 2HZKA 3G3KA 4WKMA 3K1PA 2X4XA 4M1VA 4R72A 4BACA 5FTIA 1OQHA 3M8UA 3IOVA 3OYFA 3ECRA 4P11A 3R7XA 3O28A 4PETA 3K6XA 3EAEA 4BDRA 4NEDA 2IA4A 3OYNA 1G5VA 2ONKE 1YCJA 4ZDMA 2B3FA 3VLUA 1Y9UA 3IOWA 4ZZAA 4ONYA 5ICTA 1UIUA 2HQ0A 3VVDA 3I6VA 2Q9TA 2F6PA 3FVNA 3LSLA 4XKPA 2Q2CA 2V3QA 2AIXA 1LB9A 3K01A 5F1QA 3E9FA 4FL6A 3I5OA 3E9GA 1MQIA 3P8DA 4IB2A 4XXUA 3DP6A 1H76A 2NUVA 4R2FA 3K1NA 4FEDA 3Q1JA 2DXYA 3MEWA 4NF6B 3LX7A 4RYAA 1BIYA 1DPPA 4EF1A 4QFKA 3LSWA 1SYHA 4XKQA 2X7PA 3MWBA 1BTJA 4YB6A 3RT8A 1H3DA 3CEYA 3MEVA 4FECA 1QUKA 3KJTA 3OO9A 2PMSA 2P2AA 2E1SA 3IB0A 4R2BA 1B5HA 1B05A 3IB2A 3SEUA 4NF4B 2XXQA 5B7DA 3HSTA 2DQVA 3FVKA 4GXAA 2DAQA 2F78A 4OFLA 3CFZA 3S6WA 3UWNA 2IEEA 3C4MA 3SDFA 1AH5A 2ZYMA 2ZYOA 3GBAA 2NWJA 2RC8A 4MLVA 1JW1A 4QFOA 3VV5A 3LUYA 4IO2A 2RHZA 4EQ7A 1SQYA 1URSA 2GFUA 4N13A 1I6BA 2UYFA 4FE8A 3TTLA 3QJ6A 3QIIA 3ODBA 4Q8RA 2EQJA 3H06B 3H7MA 2OWTA 1GR2A 1VSOA 1MH3A 4GVOA 5I56B 3Q29A 1FQBA 2AYSA 1MXXA 1N3XA 2HXWA 5TP9B 2F5KA 4QSCA 1QVSA 4R6HA 4GFRA 4RJZA 2FYIA 3CFLA 1MDP1 1F9BA 4LONB 4TLMB 4F1VA 1TWYA 2M16A 3CSBA 4YKJA 2R5AA 3RUMA 1I6QA 4ELOA 4RK2A 4LATA 2B65A 3U1OA 2MWPA 1MY3A 3ILTB 3DM0A 1CE2A 3KN8A 4JSDA 3UT1A 2REGA 4AB6A 4O3CA 4Q0CA 4IURA 4DCYA 3MVZA 4X34A 2V25A 1MPBA 1D9VA 3NTHA 3OYBA 5F7VA 3VDFA 1PB8A 4G77A 4E7LA 3N26A 4U1ZA 3RNNA 2BUDA 3FV2A 4WEDA 1B3LA 5L9SA 4R73A 4G8NA 4ND9A 4N4IA 3G3FA 1II5A 2XXUA 3MZ9A 3OSQA 1Q35A 1M5EA 1USYE 4PE5B 1ZLQA 4F1UA 1A40A 4NF6A 2RJCA 1NKXA 2HAUA 4C1UA 4F22A 5M9OA 1OLAA 1PBQA 5D6XA 4LD6A 5CIUA 1SSFA 4CRIA 2F7BA 3KSJA 3ASKA 1DPEA 2O4XB 3VXBA 1Y1MA 2P1SA 2RI5A 1JNFA 2GFAA 3WAEA 2X35A 3MEUA 4E7IA 3C32A 5DVFA 2XXIA 4E0XA 3KFMA 3TCHA 4NF4A 4XIGQ 1URDA 3T9UA 2DXRA 4GLIA 2Q88A 3EHTA 2R57A 3EPEA 3ME9A 3CI8A 3S9EA 4IO6A 4BE2A 3B6WA 4RK9A 5D6WA 2UXAA 4GXSB 3F11A 3IJXB 4IGTA 1LGBC 4JDFA 3RQTA 4JWOA 2M0OA 1TT1A 2RKMA 5IAIA 1B9JA 4JSOA 1SW5A 4HTGA 3MPKA 2XDPA 3MZ1A 1WJQA 1FW0A 1FQCA 2L89A 2UVHA 4EUOA 1FTKA 1OQGA 3FEOA 2Z8DA 3META 2UVGA 2D5WA 3DELB 2XX7A 5I56A 5JEIA 4H65A 4C5HA 4PLIA 3JV9A 1GV8A 3OELA 4U2RA 1SYIA 1DTGA 5I2NB 5TP9A 4OFJA 4EXLA 2NOOA 2QSXA 4A4GA 1WJRA 4IY6A 4N6PA 1NNFA 4H1XA 2W7YA 4FATA 3MO8A 3GBBA 1QULA 4N4GA 2Y7WA 4YICA 2Q89A 4LVQA 1OLCA 1SI0A 3PPPA 2QQSA 4F3GA 3PD9A 3SERA 4IGRA 5KCHA 2O1MA 1IIWA 1P1WA 1EZ9A 4IUQA 4DXCA 2IG0A 2A5TB 2ESNA 4R9FA 3GZGA 3UIFA 4OETA 2O7UA 1LAXA 2RJDA 1MXYA 3TZAA 5AA1A 5EHSA 2OWSA 3A3CA 4QFLA 5H8HB 4LP2B 1N04A 4DZ1A 3R6UA 1JQFA 3O29A 2O4XA 4IO3A 3LGFA 3QUFA 4LZ5A 2R71A 4KHZE 4YB7A 4RA1A 1OYXA 3IB1A 4EDUA 3QUJA 2A5SA 3RT6B 4LQ2A 1IXHA 4N07A 4RPOA 2X4YA 3CSGA 3LSFB 4EF2A 5BUUA 5I58B 5DT6A 1EH3A 1MM7A 2GHAA 5K2YA 4OEUA 3V89B 3IAZA 2PBWA 4IKFA 2XK0A 3OYDA 2XXHA 3IOTA 4OQOA 4GY5A 4HCYA 1D9YA 5M2VA 3HO7A 5CMMA 3C34A 1SBPA 4QRZA 4DCXA 4C5IA 2PT2A 5H8NB 5FRNA 1ZU0A 2H25A 2PQWA 4OWDA 3HV1A 1ZTYA 5I2NA 3HPIA 2PT1A 2QS4A 1LAGE 2O68A 3AXFA 4GD5A 4I9DA 3SEXA 1B3HA 1Y3NA 1B0HA 5AA4B 2DYXA 4A4FA 1MM6A 1WVJA 2WACA 4IUTA 4Q30B 2Z23A 1XOCA 2E5QA 3JYRA 2VGQA 4B9WA 4U22A 3FASA 4F3BA 4OHNA 1AOVA 2BJJX 1IXIA 1Y20A 4G4PA 1RKMA 3IO4A 3TYHA 4B9XA 2A5TA 3LR1A 5CMKA 4BD3A 3DLNA 1FTMA 1QUIA 3A09A 3PMWA 1VR5A 4R6KA 4Z0IA 4DXBA 1MG1A 1MQHA 5J39A 3VE1B 2MWOA 1B32A 3PV0E 1UQWA 3NTIA 1WODA 1XVYA 1B4ZA 5H8HA 4DXUA 1O7TA 1XVXA 3USDA 1Z7NE 3Q28A 2LDMA 2RF1A 3PUYE 1GTKA 3H3GA 4C0RA 2OK2A 1MPDA 1OI1A 4ZEDA 1ZIUA 3K02A 1NH7A 2YJPA 3PUZE 2NVUB 3S4UA 3O8VA 3B7DA 4F39A 2UVIA 1M5FA 3RTFB 2AL5A 5IN1A 4F19A 1JEUA 1ZMGA 4DDDA 1S9TA 5I58A 3OYHA 3MP1A 3TODA 3LYIA 5FHNA 1L5TA 2O51A 3L2VA 1NMUA 2F34A 4NTLA 1S7YA 4RPNA 3G3JA 5H8NA 3M3FA 3KOSA 4Q5TA 4ZE9A 5AA2B 2REJA 3K0VA 3TEPA 2DWAA 4F3PA 2LTOA 4MLQA 5DVIA 4U4SA 4ZEIA 3OS2A 5CM6A 1B3FA 2RC9A 1M5DA 5BWJA 3PMVA 5AA4A 2K3YA 4IO7A 1KWHA 1B7UA 3DB3A 1LSTA 1DOTA 4C5EA 1WDNA 2O1LA 4X9TA 2FNCA 1RYOA 3F70A 1Y4TA 2L3RA 4LQ5A 3ZKLA 5C0MA 5KE3A 5A5XB 4QSDA 4XKNA 2LVMA 2HZLA 4JB7A 3ZSFA 1PB7A 2XXWA 2DWJA 5TPAB 3VLWA 4GF8A 4IUVA 3BKIB 4OESA 3NTKA 3FATA 3S9MC 2RC7A 2THIA 4G8HA 3FD3A 3PUVE 4TOZA 3T93B 4H5GA 1SD3A 4G68C 3K2DA 1MPCA 1S50A 3R26A 1MQGA 5CC2A 1LAHE 1LAFE 1B46A 1A8FA 3LSXA 2DSFA 3VVEA 4LZ7A 3MVXA 1N84A 4DLDA 1USYH 1SW1A 2E0SA 5I59B 1HSEA 4R6YA 5H8SA 2LAOA 4FAJA 1P1QA 1QUJA 3O2AA 3FVGA 1XHYA 5JK4A 1FTJA 3KJ7A 4H67A 3MVWA 1NH8A 3G3IA 3PFSA 3KUFA 4JBZA 4ECFA 4BDNA 3SEWA 3FXQA 5L8DA 4RNSA 4PFTA 1LCFA 3TTKA 5LOMA 2GHBA 4EDPA 5DEXB 2Y84A 1TXFA 4L59A 3IR1A 3TTNA 3VXCA 5CBRA 1O64A 3PPNA 1A55A 2K3XA 1JW4A 1A7LA 2CMOA 3OSRA 1MY0A 2Z8EA 5CI5A 3H6ZA 3O97A 4N4HA 2BKDN 1D4NA 1POY1 2F35A 2GFEA 2PX1A 4NF8B 3C9HA 2H4IA 3OS0A 1QJMA 5AA2A 1QW0A 4BDZA 3UP9A 1KHCA 3P8HA 3FXRA 1JEVA 2XXVA 5TU0A 2E6NA 2ZYNA 1B40A 3V5AA 3BFUA 3C31A 2FHDA 3N94A 3FZVA 4XKRA 4F2OA 4H6DA 5HBCA 3T9HB 4U21A 4YB5A 1PEBA 3EN3A 2JTFA 1Y3PA 3OB9A 1IZ1A 3O6GA 3TKDA 4BDLA 3D4CA 5A5XA 4OENA 1LB8A 3H6WA 4KQPA 2R6GE 3WAFA 4PL6A 1BKAA 3TPAA 1B0LA 2G3RA 5TPAA 3C35A 4POWA 1OZ3A 3SKPA 1ELJA 5C6SA 4KFQA 3OYKA 3PMXA 5FHOA 4RXLA 4AQ4A 1JETA 3MC2A 2F7CA 2XHDA 3CG3A 4NMYA 3UN6A 3FJ7A 1H3ZA 3U92A 5DYHA 5FHMA 1B58A 5FRMA 4OZ9A 4UC4A 1LFIA 1MXWA 1YAEA 3KSXA 5I59A 1ATGA 2Q8JA 2O7IA 1TFDA 4LA9A 3FJGA 4ZEFA 1MS7A 4QW2A 1SW2A 1PC3A 2F8DA 3UA8A 3I3VA 3TQLA 3CFXA 2ZNUA 3TDJA 5DEXA 1LFHA 3QK6A 2XXRA 4GRKA 4KCDA 1UTBB 1SW4A 4H8JA 4FIMA 1NFTA 2O6AA 3KN3A 2RCAA 4RG2A 3MJNA 1NNTA 2QS1A 2EKOA 4OXVA 2RHIA 3SESA 5FTHA 2F5XA 1SDXA 2YPNA 3UGWA 1D3KA 4NF8A 4IO5A 3UORA 2GF7A 3OYEA 1DSNA 5DVJA 4G8MA 1MXZA 2V3UA 3PMTA 3L2QA 1N7WA 5KCJB 1HSJA 2BIVA 3RTWB 3U93A 3OYIA 3CR9A 3Q26A 4BE1A 1N7XA 3C4SA 2F97A 2RHYA 1B1XA 3Q25A 5CRYA 1NNKA 1R1NA 1MRPA 4DIGA 4XTCQ 2RJFA 3OYGA 1QKBA 5ITOA 1IUDA 4WEPA 3QAXA 5L9MA 4O3BA 4ELRA 3OYCA 3K6WA 4KPTA 5D6YA 3FDRA 4THIA 2H98A 4QFNA 1EU8A 4Z02A 3LC8A 2XD3A 3MP8A 5HM4B 4KYDA 2I48A 3FVOA 3OY9A 4F3SA 1Q1KA 4OFOA 2EQKA 1LBBA 3M3LA 2VOZA 2R58A 1HSLA 3OYAA 3TQWA 1R9LA 3KZGA 5AE4A 3IOUA 4OVJA 4BDQA 3T96B 3U8QA 1OZ2A 2YLNA 3PPQA 4QFPA 3PD8A 1MY2A 2QL3A 2FA7A 4PFUA 1MY4A 2DIGA 3BFTA 3EHUA 3P7IA 3SEVA 3RPWA 5I57B 3TAJA 1P1NA 2VHAA 3H6TA 4X48A 4G68B 3TMGA 2I0BA 1DTZA 3L2UA 2RJEA 2PVUA 2V84A 4FJPA 3LBSA 4PLLA 4C1TA 2O84X 4FORA 3OMBA 3W9VA 3QSLA 2G29A 4YAHX 4PP0A 1B52A 3OMCA 2LRQA 4FEBA 1IEJA 1UTBA 3H6VA 4X1DA 3T66A 3TUSA 3T22A 4IUPA 4GOTA 2DS9A 2DE3A 1BP5A 3QXMA 1B3GA 2G93A 2Y7KA 4P0IA 3TCFA 3HCQA 3K1MA 1I69A 2EQMA 1ZJLA 3DLMA 3KG2A 4NS5A 3G3HA 3ZEHA 1NNPA 5KCJA 2DVCA 4FU6A 4POXA 1B6HA 3L2WA 4HCZA 1VFDA 4ELPA 1Z7ME 2Y7PA 4NF5B 4PQJA 4K3FA 4YMAA 3QKJA 3OYLA 5H8QB 3KEIA 4MH5A 3GLBA 4YKPA 2CKKA 4YKKA 3BBRA 2I0CA 2B3BA 2P0SA 3TTMA 1US4A 2OJTA 3FLGA 1ANFA 3PU5A 4YMBA 3FJMA 5L9OA 2RO0A 2RINA 3G7WA 3CVGA 4F1YA 2ZNTA 3MBPA 4E7JA 1WGSA 1IQ7A 4HW8A 5KE2A 1N76A 3H8ZA 4ZTFA 3BDLA 1YTVA 2H99A 1TFAA 1JVYA 3A3UA 2VYTA 2QJEA 4HS7A 1P1OA 2GH9A 4EQBA 5FROA 2B8AA 1O63A 1R6ZA 2KLFA 2XX9A 4OMBA 3CIJA 4F18A 3S3MA 2XXXA 3TFLA 3LGLA 1H44A 2X4WA 4U4XA 4U23A 3CRBA 4U1OA 5I57A 4F31B 4G68A 2R5MA 1M5BA 4R9GA 2D3IA 3W9WA 1B4HA 2OCUA 3OA6A 2XX8A 2HEUA 3U94A 4RY1A 3VLVA 4MFIA 2DE2A 3EHSA 1MHNA 4QVZA 2ZYKA 4GL8A 4BE0A 3L42A 4I1DA 2ALUA 3IL1B 3GXAA 2HCAA 2I3VA 3B6QA 4GQOA 4H0WA 4H8IA 3T9XB 4UA8A 3FV1A 3TCGA 2QS3A 3OENA 3PMIA 3G3GA 4ZEKA 4KI0E 1FQDA 2OLBA 3LLRA 2HQXA 1XS5A 1WJSA 5KCOA 4GIZA 2F6GA 4DE8A 2I4BA 3RN8A 3OEMA 3OXNA 3MPLA 3K00A 1JVXA 3GOXA 2DWIA 4MBPA 4YKIA 1FTOA 1SVXB 1GGGA 4TQUQ 4JWYA 3OEKA 1EZOA 5CMBA 3DB4A 2RCBA 2QPQA 2XXTA 4OTEA 3VVFA 5ICQA 1FQAA 4NF5A 2PYYA 3MAMA 1OVBA 4M4GA 3S3OA 3FGSA 1B7ZA 3N6TA 3PUXE 1EZPA 4PFYA 3OO8A 5H8QA 2Y7RA 5KH6A 3ZKKA 3KGCA 2H5YA 2Y7IA 4EXKA 1UTHB 4ZE8A 3S3NA 5ITPA 2GRVA 3OQ5A 5I2KB 5AA2D 3O66A 5KDTB 2F36A 4I62A 5JTYB 3EF7A 4ZEBA 1MXVA 4EQ9A 1POTA 2XD2A 3RY3A 2I3WA 1XT8A 4R74A 2X7QA 3H4ZA 2ONSA 3IJOB 2Z8FA 1VFEA 4BDOA 4KCCA 4ZTJA 1LCTA 4Q5WA 1IXCA 3THIA 1FQEA 2D21A 1H43A 4MF3A 1XNIA 1IXGA 5H8FB 3S2VA 4ELQA 3FC3A 4E0WA 4QSEA
chains in the Genus database with same CATH superfamily
3O5ZA 4H5FA 4M78C 1HJDA 3C12A 3CMEQ 4Z7EA 1MY1A 3CBPA 1MH4A 1OVTA 4QHQA 4M77F 2DIQA 1D0ZA 1QLYA 2ATCB 4HVVA 1IITA 1YHQA 5HPQA 1M8MA 1K9AA 4L17A 4PAFA 2CREA 2Z22A 1LJOA 1MMDA 2QDLA 1K76A 2QQRA 4L5GA 3KBRA 3IX1A 1VQ8A 4HT9A 3ZS6A 1G2BA 1QKAA 2QYZA 4OB0B 1DMBA 3OD7A 2CP0A 1TTHB 4P56A 1X6BA 2ZZWA 3M9QA 1NLOC 2E64A 3W15C 1VQOA 3S9LC 2CGHA 3SEMA 3SDZA 3H6UA 1UHCA 3HRUA 2NLUA 2EIFA 3VS5A 2CT3A 1B51A 3A8HB 3MW0A 1QVPA 2RK1A 1BLFA 2CZ0B 1S1NA 4M7DA 2YT6A 1VQKT 4NWCA 4R75A 1QVGP 4M7DE 4QQ6A 3C0CA 3ZFJA 4A4HA 2MKZA 3OYMA 4OB1B 5AA3A 1MQDA 3PPOA 5ET7A 4BUGA 1FTLA 1G0IA 4AMCA 3QMFA 1B7HA 5I84A 1E6HA 4N6KA 4ME7A 3T9VA 2LCCA 3QYTA 1GVCA 1ZA2B 1NJIC 1US5A 2DVJA 4ZECA 2AK5A 2CZLA 3H03A 4J9IA 2VD2A 1ZBMA 1AIVA 3C33A 1AL3A 5L8RE 2ENMA 5FU6B 5ISUA 5KYXA 3CXCP 1UIVA 4M77E 1JU5C 1UB4A 1B1HA 1H45A 3HFOA 1P92A 3CCUA 4IY5A 1URGA 4M7AF 3EGUA 3CCMQ 3D1RA 4OVAA 4ELYC 2XHCA 2DL4A 4KD5A 2ZPIB 3TTRA 5I7IA 3CBOA 4HA8A 4ISUA 1BYMA 4ESWA 1J1NA 2EBPA 3X20B 4M7DG 1VQMA 2HQEA 4NWDA 3FBPA 3HKSA 2OTJT 3QZ5B 4DA4A 5J26A 4PDHA 4LUEA 4QQDA 1VQPA 1VQ7T 2EQUA 5KZTA 1T0KA 1EX4A 2P0KA 3VRZA 3FUZA 5DTBA 5FWBA 1LNXA 1UDLA 3E4RA 4Z8AA 5LJ3f 1Y3QA 5ELVA 2VP1A 2DYIA 2F7AA 1QVFS 3LH0A 4BDYA 4F2QA 4J7FA 2I58A 3D4GA 5LJ3h 2QQAA 3T0JA 3DP4A 3EH2A 2QRYA 3NHNA 1PRLC 1TS9A 3QXEB 3PUWE 4M77G 3MEAA 1YI2A 1OIBA 1B5JA 2C0OA 3MUQA 1PKSA 2M8CA 1GCPA 3OMGA 5CQYA 4GL0A 4QXDA 3IQLA 3S9NC 2RI3A 4ZZEA 2Q2AA 4F29A 1UTHA 3CCVT 3MP6A 4QQGA 5EHMA 2UYEA 4M7AE 2I0NA 4FBPA 5FLXE 5HCKA 5IHNA 2DA9A 3CMEA 4JS5A 4XU3A 3K6VA 5I2KA 3CCLQ 1RADB 1LFGA 3MQ9A 3ONMA 1HK9A 5F24A 2DL7A 3VFJA 4C8QC 2L3PA 3LV0A 5KDTA 3OO6A 3HHFA 5EYHA 2MI6A 1MMAA 1RAHB 5JTYA 1WQWA 4PF8A 2YLBA 4OERA 2IPOB 2LJ0A 1MDQA 4UABA 2DK3A 2KXCA 2CZIA 3PE0A 1RAEB 2VUBA 2FO0A 3PGFA 2HHMA 2I2LA 3AT1B 1WHKA 1WQ7A 2OAUA 4PJJA 4PFWA 4PBQA 2XIDA 3H0HA 3PNWC 2CDTA 1YJNQ 1LLSA 2QVRA 3DP8A 1NL5A 2AL4A 2RHUA 2RI2A 3EFOA 4JWXA 1NYGA 4KR5A 1ZSZB 2XICA 2OTLQ 2EYZA 2QMWA 3RLFE 3M53A 2VB6A 4KYEA 3M0SA 3BFMA 4ESXA 4KGZB 4I3EA 1UEBA 1WHJA 2OBGA 4YU0A 4LDYA 1A99A 5I11A 1OX9A 2A08A 1N8RU 4M7AG 4P0GA 2F2VA 1VE4A 2DILA 4MDXA 1TU0B 3CCJQ 5LDZA 1R77A 1I6AA 1SI1A 3CC2Q 5FBPA 1YPNA 3UATA 4OMLA 2XXYA 1M1FA 1FTAA 1KZ8A 2A3LA 1C0MA 1Y4CA 2ESWA 4G61A 1S72T 1P99A 5H8FA 3KN7A 4WXJA 4BLAA 5IKBA 3V83A 2RHXA 1PBPA 3EHQA 1OU9A 4MNIA 3SEYA 2F3DA 3K6UA 1VYUA 2ONRA 3QIMA 3HHGA 1UGPB 5CR2A 1SPKA 4AFUC 2XG8D 4OEVA 5B70A 1B07A 4TLLB 2HAVA 1PM3A 3MVYA 1JJ2A 1B3EA 1E7OA 2CP3A 2NXOA 4J6WA 3EQ1A 5GANe 1IHWA 1LBCA 2BE7D 4YZZA 4PGNA 2QMXA 1RI0A 2X51A 3OS1A 2JS2A 2KK4A 1M5CA 3ILUB 1ZKBA 2V93A 2DVZA 2O9VA 3RGYA 1Y96B 3L6GA 2D8JA 1X75C 5GANd 4X9DA 4I40A 1Y1ZA 3FXUA 4GWUA 4PFBA 3HN0A 2ZNSA 4JJCA 3C36A 1AMFA 1K9ZA 2O88A 4Z88A 2HBPA 2C0IA 2ZZDA 3A1PA 2HFBA 4IUUA 2VD3A 1QCNA 5K2XA 2DX1A 4X1BA 2FPEA 4RTWA 4I8CA 5EQAA 1N8RC 2JUFA 3Q27A 5IHKA 5J1DA 4P3LA 1GRIA 4FIBA 2XXPA 1WHLA 3QWXX 3SD4A 1B34B 1NEBA 2DXBA 2O69A 2ZXTA 5ET5A 2D9TA 2HKNA 4GWOA 4QF9A 3U72A 2DE4A 1YJWT 3IK6B 4ZS9A 2QS2A 4E6RA 4HVUA 4RTTA 1FQFA 3CG1A 2DBKA 1QP3A 1D3BB 2XU8A 3K4UA 4E7KA 2ANJA 4LUBA 1G8XA 3FIRA 2I6EA 4O94A 4O3AA 3MZBA 2HMAA 3L2RA 4HCCA 1FPJA 1AWXA 1OEBA 2OX7A 5EYFA 2NYSA 1PDAA 1M2VB 5CBSA 2QK0A 3E13X 1R9QA 3KOTA 2KSSA 3OOAA 2EKHA 4C5GA 4G2ZA 4FYYB 2X26A 3M3KA 2FVZA 2HSEB 2I49A 3N5LA 3JZJA 2YRVA 2K5LA 3O6HA 5LTCA 2X4JA 5GMKl 2ZMBA 5IAYA 5GAN2 1WX6A 2OZZA 1B2HA 2JJ9A 3OYJA 5GJVB 3B6TA 4II1A 4DEYA 1JW5A 1OMPA 4GLMA 1WA7A 3GNFB 4LD9K 2ZZXA 1UG1A 3V8XB 5GAN4 2H9BA 2UVJA 4E7HA 1FRPA 2OTLA 4F04B 1VQPT 2QQ9A 2ABHA 5GAMj 1NPRA 3CCEA 2EFIA 2QFLA 2DWHA 1Q82U 2E3IA 2KAFA 2WKYA 1N0TA 3CCJA 5CKEA 4IO4A 2R9JA 1Z9ZA 2COZA 3TELA 3QBYA 1LEVA 2DOJA 4AB5A 3L6HA 4HCWA 3REAB 3UK4A 1ZSGA 2K2VA 3IO6A 2FL7A 4LZ8A 4A4EA 2OJ2A 4OYVA 1B5IA 4KYSA 1FCKA 1PB9A 1FWZA 2M1HA 4FCYA 1RYXA 4UACA 1WPYA 4PFZA 1CB6A 1MQJA 3O9PA 4NE4A 1MXUA 4VUBA 1N6AA 1OPLA 4HE1A 4JXIA 5CMCA 2JZ2A 4BDMA 1N27A 3E9XA 2COYA 3X26B 3M54A 1B7TA 2X9HA 3E3KA 3N6UA 2DP8A 2I4CA 2HEQA 1I0CA 1P1UA 4MIJA 4FYWB 1IRXA 4KUIA 1FMVA 3OO7A 2K9GA 1R0CB 4WF2A 1NV0A 3OYYA 3VKIA 1N3WA 3VS7A 4HVWA 2RNAA 3SETA 1OOTA 2V3TA 1A8EA 2L8DA 3O6IA 4QVDA 4MAGA 4C0GA 1A54A 1CNQA 2QVUA 3PPRA 3IORA 1V29B 1XC1A 3QHSA 2HZKA 3G3KA 1YCSB 2K5IA 1ZSZA 4WKMA 4PCDA 3K1PA 1PSFA 2ABLA 1M4ZA 1Q82C 2X4XA 1WXBA 1Y0MA 4M1VA 4R72A 4BACA 9ATCB 2Y5KA 3PGGA 1K9MU 1WDXA 1ZA1B 2WYPA 1VQ9Q 3G6ET 5FTIA 2XA5A 1OQHA 1SPIA 4QT7A 5GAOl 1EYJA 3M8UA 3CCQQ 3OYFA 1Q81C 3IOVA 3ECRA 4P11A 3J7AF 3KBGA 3GIBA 4JJBA 1V1CA 3R7XA 1TSFA 3O28A 4PE3A 4PETA 3K6XA 4CC4B 3EAEA 2W10A 2HQHA 4BDRA 4NEDA 1SEMA 2QVVA 2IA4A 4OF1A 3OYNA 3OW2S 4ZGEB 1G5VA 1YCJA 2ONKE 4ZDMA 2B3FA 4NQ8A 3VLUA 3KC1A 1JRIA 1Y9UA 3IOWA 1FBPA 4ZZAA 4ONYA 1FBFA 3V8JA 5ICTA 1UIUA 2HQ0A 2D8HA 3I6VA 1AWOA 2Q9TA 3VVDA 2KQWA 2F6PA 3PIPA 3EG0A 1QVFP 3FVNA 3LSLA 4XKPA 2CUDA 2Q2CA 4PJOD 2AIXA 2V3QA 1KD1R 1Y96A 3OSSC 1LB9A 2J6OA 4BI4A 2XWKA 3K01A 5F1QA 3E9FA 4FL6A 3JCMX 3H0FA 1INPA 3JCMQ 1YP5A 3I5OA 3E9GA 1MQIA 3P8DA 4M75D 4N15A 2MMPA 4GWYA 1YWOA 2OTJQ 2NUTB 2DL3A 1VQ7Q 4IB2A 4XXUA 1NZ9A 3DP6A 1H76A 2NUVA 4R2FA 3K1NA 2WSCE 4EMHA 4FEDA 1FSAA 3Q1JA 2DXYA 4M78B 2B4LA 3MEWA 4NF6B 3LX7A 4RYAA 1B34A 4CC3A 1BIYA 1D1AA 5IHIA 2XDBA 4PAIA 1NYFA 1DPPA 1PD0A 4EF1A 4QFKA 2EPDA 5LJ5f 4FW1A 3R6OA 2Y5LA 1Q95G 3LSWA 1SYHA 4XKQA 2X7PA 3MWBA 1D3BA 5LJ5h 1T3LA 1BTJA 4YB6A 2QTVA 1JJ2S 2WYKA 3RDVA 2ZPBB 2XWVA 4N6DA 1ABOA 3RT8A 1H3DA 3CCVQ 3CEYA 1Q9DA 4ELZC 3MEVA 4FECA 1M2VA 3REBB 1VQ4T 1QUKA 5KYWB 3KJTA 3OO9A 2PMSA 1NG2A 4LDUA 2P2AA 2E1SA 3IB0A 1T3SA 2GBQA 2MYSA 4R2BA 1MV0B 3JB9J 1B5HA 1B05A 1YJ9Q 3IB2A 3SEUA 1XJWB 4BI8B 2P3NA 2MCNA 1KC8U 4NF4B 2XXQA 2EYWA 3RMSA 1KSWA 1X6OA 3OSVA 5LL6S 3HSTA 5B7DA 2DQVA 3FVKA 4GXAA 2DAQA 2F78A 4JRIA 5IZZA 2XWIA 4OFLA 3CFZA 3S6WA 3UWNA 2P0QA 2IEEA 2EQIA 3RKYA 1RDZA 3C4MA 3SDFA 1UJYA 1AH5A 2ZYMA 3ER0A 1TOVA 2ZYOA 3GBAA 1VQ5T 2NWJA 2RC8A 4MLVA 5GMKi 1VQKA 1JW1A 4QFOA 3VV5A 2J6KA 2PVDB 2FZKB 3EGDB 3HFNA 4Y91A 3LUYA 4IO2A 3T9NA 3VV0A 1ZBXA 4FT2A 2RHZA 3E78A 4EQ7A 2F3BA 3NFCA 4F14A 3CCET 1SQYA 2A28A 1FPIA 4X9CA 1URSA 4LDVA 1QQJA 2GFUA 4N8YA 4N13A 1I6BA 1FJ9A 2UYFA 4FE8A 3TTLA 3QJ6A 4C0DC 1DCUA 3QIIA 3ODBA 1PNJA 1S72Q 4Q8RA 1G3WA 2EQJA 3H06B 2ED0A 3H7MA 3SZPA 2CP5A 2OWTA 1GR2A 1VSOA 2ZPFB 1MH3A 4M77B 4FT4A 4GVOA 1YNZA 5I56B 5IXFA 4DBRA 1KC8C 3Q29A 1Q82R 1FQBA 2CP6A 5IGAA 3CMAT 4WCIA 5ECAA 1KHIA 2AYSA 1MXXA 1N3XA 2DLPA 2HXWA 4OMOA 5TP9B 2HDAA 2F5KA 4QSCA 1QVSA 4E47A 5LJ3e 4R6HA 4GFRA 2OTJA 4RJZA 2FYIA 1Q81R 3PVLA 2JOYA 3EG3A 1VQ7A 3CFLA 1MDP1 1F9BA 4NAPA 4FYVB 3GBQA 5LJ3d 5GMKh 3R6NA 2KQZA 4LONB 4TLMB 4N91A 4F1VA 4C8QB 1TWYA 2M16A 5CKHA 3CSBA 2DZCA 2R5AA 4YKJA 1ZQ1A 3PIOA 1PD1A 4LDWA 4M78F 5DM7R 3RUMA 1AWJA 4JLGA 1I6QA 4ELOA 3QWYA 4RK2A 2A36A 4LATA 2B65A 3U1OA 2MWPA 1MY3A 3ILTB 3CCVA 2HL5C 3DM0A 1CE2A 4XU2A 3VS6A 3KN8A 4JSDA 3UT1A 2REGA 4AB6A 1CKBA 4M7AB 4O3CA 4Q0CA 4IURA 5GAOp 4OMQA 4DCYA 3MVZA 4X34A 1FPLA 1N5ZA 2FG0A 2V25A 1MPBA 4PAKA 1NBEB 2QQBA 1NUXA 5A5LA 1D9VA 3NTHA 3OYBA 1M90R 5F7VA 3BY7A 4OB2B 3VDFA 3LWIA 3CCUQ 1PB8A 4G77A 1SKUB 4E7LA 3N26A 4U1ZA 3RNNA 2WBBA 2BUDA 3FV2A 4WEDA 3J81E 1MUZA 1B3LA 4GBVA 2E65A 5L9SA 4R73A 4G8NA 4ND9A 4N4IA 4C92F 3G3FA 5KYUB 1II5A 2XXUA 3MZ9A 4GX4A 2EYYA 3TCJA 4GLKA 4LXCA 4EMKC 2GQIA 1Q35A 3OSQA 2NUTA 3BW1A 4AG1C 1M5EA 1USYE 4NHBA 2XXKA 2ECZA 1KQSA 4GWWA 1NUWA 1W2BS 4PTKA 4PE5B 2DBMA 1ZLQA 4F1UA 1A40A 4ZNXA 4M78A 5GAMg 4NF6A 1VQPQ 2RJCA 1NKXA 4M78E 2HAUA 1G83A 2DVEA 4C1UA 4F22A 1M1GA 1U3OA 2DJZA 4RTZA 5M9OA 3M4GA 4N0AC 1OLAA 1PBQA 5D6XA 1FMWA 4LD6A 4XTWA 2DETA 2FIEA 5CIUA 2L2PA 4KH1B 5D7UA 4QBAA 3NGPA 1SSFA 4CRIA 1K1ZA 2F7BA 1M8VA 3KSJA 3EGXB 3JB9F 4FYXB 3ASKA 1PKTA 1DPEA 2O4XB 3JB9H 2LCSA 1KQ1A 1S72A 3VXBA 1Y1MA 1YI2Q 2P1SA 4RG8A 2RI5A 4O8MA 1JNFA 2GFAA 2FZGB 5KYWA 4F7UF 1LBXA 3WAEA 3MEUA 2X35A 1FYNA 2Y90A 4E7IA 3C32A 3L2ZA 5DVFA 5CKFA 4ANJA 2RF0A 2XXIA 4E7ZA 4E0XA 2DRKA 4XTYA 4C92E 4D8DA 3KFMA 2P4TA 1QGXA 4NF4A 3TCHA 2RQWA 4XIGQ 1URDA 2CT4A 1VUBA 3T9UA 1HSQA 2DXRA 1M9SA 4GLIA 2Q88A 1Q86C 4M7DD 3EHTA 4M78G 2R57A 2AKKA 1XTDA 3GLXA 3EPEA 3ME9A 2FPFA 3PT9A 4JZ4A 3CI8A 4X8RA 3S9EA 5FWCA 3EGDA 1GFCA 5J3BA 2COWA 4BE2A 4IO6A 3B6WA 3I9QA 4A54A 3HSBA 4RK9A 4NGUA 2JM8A 5D6WA 2ROTA 4KULA 2UXAA 4GXSB 3F11A 3IJXB 4IGTA 1LPLA 4K11A 4OMNA 8AT1B 1LGBC 4JDFA 4JWOA 2M0OA 1TT1A 2RKMA 3RQTA 5IAIA 3OW2P 4C92C 1B9JA 3G6EQ 4JSOA 4M77D 1KC8R 1SW5A 1PRMC 1Y57A 2RQUA 1YJWA 2GTOA 2PCRA 4HTGA 4C8QF 1NV3A 4F7UE 1JBMA 3MPKA 2XDPA 1KQ2A 3MZ1A 1WJQA 1FW0A 1BIAA 1FQCA 2L89A 2UVHA 2J06A 1U06A 4C92G 4EUOA 3NMZC 1FTKA 1OQGA 3FEOA 4OVTA 2Z8DA 3META 2UVGA 4NOYA 2D5WA 4M77A 3DELB 2XX7A 2CP2A 1NE8A 1M2OA 2GGRA 1GXIE 5I56A 5JEIA 4H65A 4C5HA 4PLIA 3ISPA 1EZZB 4LDXA 3JV9A 1GV8A 3OELA 1LBWA 2QEXT 2FRWA 4U2RA 1SYIA 1DTGA 1X69A 5I2NB 4DI4B 5TP9A 4O6JA 4OFJA 1XQHA 5GAN8 2NOOA 2QSXA 4EXLA 4A4GA 4IIOA 1VDWA 4RTVA 1ZLMA 1WJRA 2YRCA 1VIFA 2LT4A 4IY6A 4N6PA 3JB9G 1NNFA 2F5TX 2VGNA 4H1XA 1JJ2P 1MNEA 3JCMc 3QG1A 2W7YA 4FATA 2JT4A 1O9SA 4JVDA 3MO8A 1IMAA 4F7UG 4C8QA 3GBBA 1QULA 4N4GA 4C8QE 2Y7WA 4YICA 1X2KA 1Y7XA 8ATCB 4M7AD 2Q89A 1JXOA 3TEEA 5KYNA 4LVQA 1QCFA 3V7RA 3JCMf 1OLCA 1SI0A 2Y4XA 2QQSA 3PPPA 3JCMh 4DI3D 1WZOA 3QUIA 1RI9A 5LJ3g 1K4US 4MCOA 4RCBA 2EGCA 2HL3A 1BI2A 2CEXA 4F3GA 3PD9A 3SERA 4IGRA 5KCHA 1NV7A 4M7AA 4HE0A 5GAOn 2QDYB 1IIWA 2O1MA 1P1WA 1VQ4Q 1EZ9A 3CPWA 4IUQA 4DXCA 3GP8A 2CP7A 4NL3A 4JDSA 1KK7A 5GAN3 5LJ5j 2IG0A 4OVQA 3QZ9B 2A5TB 2ESNA 1YN8A 1WIEA 4RCCA 1YXIA 2C06A 4PFPA 4E2FB 4J9FA 4R9FA 5GANj 1U1SA 3GZGA 5KYUA 3UIFA 2DYBA 4HXJA 4OETA 2O7UA 1LAXA 2K57A 2RJDA 3G71T 1X01A 4C8QG 1MXYA 3TZAA 1NM7A 5AA1A 1M3BA 2XD0A 3SWNC 5EHSA 2VXEA 1VQ5Q 2JJKA 1FBGA 2OWSA 3A3CA 4E7SA 2DXCA 4RTUA 4QFLA 2LZ6B 4LP2B 5H8HB 2CSIA 3E19A 1N04A 3G6EA 4GBWA 2H8HA 1LBYA 4DZ1A 1FBEA 2O31A 3R6UA 3N5BB 3HFUA 3CCEQ 1YFNA 3EGXA 3A8MB 1JEGA 4HKEA 3MPUB 1JQFA 3O29A 2O4XA 2M02A 4IO3A 3LGFA 1KFZA 3QUFA 2PUKB 4LZ5A 4KGVB 1Q86R 2R71A 4KHZE 3H0IA 1FPFA 4YB7A 3VYHB 4PNOA 1K8AU 4RA1A 1OYXA 1X6GA 1IHVA 3IB1A 1BCOA 4EDUA 3QUJA 3X28B 2A5SA 3RT6B 4LQ2A 3CXCA 2EYQA 1IO6A 1IXHA 2VKNA 4ORZA 1KQSS 4N07A 2CZ7B 1K9YA 4RPOA 2GCXA 2QGGA 3GYYA 2X4YA 3CSGA 1ARKA 1LCKA 4F17A 2FIXA 1WHGA 3LSFB 1YIJT 4EF2A 3KFVA 5BUUA 5I58B 2QA4A 2DZ9A 5DT6A 3A5ZB 4IIMA 1EH3A 1MM7A 2GHAA 1NJIR 5K2YA 4ZN3A 3V8KA 4OEUA 3V89B 3L1AA 1BCMA 3CCRT 2PBWA 3IAZA 4IKFA 2EWNA 4CC7A 2XK0A 3OYDA 4J9GA 3M0QA 1Q7YU 2XXHA 3IOTA 4OQOA 1SRMA 3OBWA 1K0SA 1FPBA 4GWZA 4GY5A 4HCYA 1D1BA 1LBVA 1D9YA 2WEFA 2ED1A 4I3YA 4N8GA 5M2VA 5GMKj 3HO7A 1IMDA 2V8KA 5CMMA 3C34A 4BY6C 1SBPA 4QRZA 4DCXA 4C5IA 2CZKA 2PT2A 1IZ6A 2YUOA 4O5VA 5H8NB 3EH1A 2IVWA 2O9SA 5FRNA 1VQ4A 1ZU0A 4PFOA 2H25A 2PQWA 3ZL7C 4OWDA 3HV1A 1W2BP 1ZTYA 2VVKA 1AZGB 1I4K1 1TXQA 5I2NA 4FW2A 4NN3A 3HPIA 2PT1A 1A0NB 2QS4A 1LAGE 2JVVA 2O68A 4PFRA 3AXFA 1GCQC 1SHGA 2F1LA 2YHTA 4LN2A 4GD5A 4IR8A 4JS4A 4H45A 4I9DA 4MZTA 3SEXA 1B3HA 1Y3NA 1B0HA 1WYXA 5AA4B 2DYXA 1VQ5A 2CH4W 2KRSA 4A4FA 1PSEA 2E3HA 1MM6A 1WVJA 2RPNA 2WACA 2HD0A 4IUTA 1Q7YC 3EG1A 4EMGA 4Q30B 1GBQA 2Z23A 1XOCA 2E5QA 2CZ6B 2LP5A 2YLCA 4MEVA 3JYRA 2XI9A 2VGQA 1Y71A 5I2SA 4B9WA 4R0KA 2FRYA 3FASA 4U22A 4OHNA 4F3BA 1AOVA 2BJJX 3BE3A 1IXIA 2EGEA 5FU6C 3U23A 3AHUA 1Y20A 4G4PA 1RKMA 3IO4A 3JRZA 4P5NA 3RKXA 3LW5E 4DOVA 4LE9A 1TH7A 3TYHA 4B9XA 2PU9B 3FJ5A 2A5TA 3LR1A 3CMAA 5CMKA 1OULA 4BD3A 3X25B 3DLNA 2YWWA 1FTMA 1QUIA 3A09A 1WFWA 3PMWA 1VR5A 3I55T 3JCMJ 4R6KA 4Z0IA 4DXBA 1MG1A 1MQHA 1TG0A 5J39A 1K73U 2VPNA 3VE1B 1OQKA 1QKWA 2MWOA 4RTYA 1B32A 2HCKA 3PV0E 1YITT 1UQWA 2AZSA 4JJDA 4JRQA 3NTIA 2VC8A 5EC7A 2E4HA 1WODA 1XVYA 2LQNA 1B4ZA 5H8HA 4DXUA 1O7TA 1G3YA 3VS2A 4H46A 4PGPA 2BZXA 1WXTA 1XVXA 1VQKQ 4TVRA 3FRNA 3USDA 4MZPA 4B6MA 1Z7NE 3Q28A 1AD5A 2LDMA 2RF1A 1VQLA 1GTKA 3PUYE 2DD4A 5ET6A 3H3GA 4C0RA 1QKXA 1BB9A 5GAN5 2OK2A 1MPDA 1OI1A 4ZEDA 2V26A 2VASA 1ZIUA 3K02A 2DM1A 4LUDA 2OX3A 1NH7A 4PJLA 2J6FA 4EMKB 2YJPA 2K4YA 2EGAA 1FPKA 3PUZE 1M5Q1 2NVUB 3S4UA 3O8VA 3B7DA 3RERA 4F39A 5GAMe 4QKUA 2UVIA 3G4ST 1M5FA 3RTFB 2AL5A 5IN1A 2QEXQ 3RMQA 5GAMd 4OMFB 1N8RR 1AWWA 1JEUA 4F19A 1ZMGA 1IMBA 1FPDA 4DDDA 2MAMA 1S9TA 3MKDA 5I58A 3UA6A 4NL2A 1AT1B 2DMOA 4M75F 3OYHA 1FMKA 4OA4A 3MP1A 4GWSA 2DTOA 3TODA 1RABB 3LYIA 4XTXA 2KXDA 2QA4T 5FHNA 1ZSZC 5GJWB 2HXRA 2DTHA 5GAN7 1K9MC 2KMTA 1L5TA 3VS0A 3CC4T 4JRKA 2O51A 3L2VA 1NMUA 2F34A 3FJPA 3JCMP 3CCMT 4NTLA 2BE9B 1S7YA 2RMOA 3A8OB 4DBFA 1IMEA 1X2QA 4NG7A 4RPNA 2DL5A 2EVRA 4A53A 3A8GB 4AFQC 3G3JA 5GAN6 5H8NA 3M3FA 3KOSA 4OB3B 5GANf 4Q5TA 4ZE9A 5AA2B 3E2UA 5EG2A 2REJA 3K0VA 2JW4A 5GANh 2DJQA 5LJ5g 1Z9QA 3TEPA 2RQVA 4ZGJB 4P1LA 2DWAA 1Q7YR 4F3PA 2ZZVA 4M75E 2LTOA 5I22A 2RK2A 1FBDA 1VQNA 4MLQA 2DDKA 5DVIA 4U4SA 5AYFA 4ZEIA 4C92B 3OS2A 1NLPC 2KRMA 3T1BA 5CM6A 1B3FA 2RC9A 2YUQA 1M5DA 5BWJA 3PMVA 5AA4A 3EFSA 2K3YA 3G71Q 4IO7A 3GF5A 1KWHA 1B7UA 2FHYA 3DB3A 2ZPHB 3RPLB 1I5OB 2JTMA 1DOTA 1LSTA 4FM4B 1UGRB 4N81A 4C5EA 1WDNA 1NV2A 2DL8A 3RUXA 4PJOC 4DBQA 2O1LA 4X9TA 2FNCA 1JO8A 1RYOA 3F70A 1Y4TA 2L3RA 2X3WD 4M75C 4LQ5A 3TU4K 3ZKLA 5C0MA 5KE3A 5A5XB 4QSDA 5CQXA 2WBDA 4XKNA 2LVMA 7AT1B 2HZLA 1KQSP 4JB7A 3ZSFA 5L23A 4KUDK 1MGQA 1RLQC 1BK2A 4J7IA 5A0DA 1LOJA 1PB7A 2K2MA 1DJ7B 4F7UB 4M75G 5ESYA 1AZEA 2XXWA 2PTKA 2QI2A 5A2QE 2E1HA 2SEMA 3QJYA 2DWJA 5TPAB 3VLWA 3A8LB 4GF8A 1ZX6A 4IUVA 3BKIB 3JV3A 2QAZA 4CC2A 2LNHB 2K7AA 4WTOB 2QEXA 4OESA 3NTKA 1NV1A 3FATA 3S9MC 1I5LA 2RC7A 2THIA 4G8HA 4PK4A 1B3QA 2V8IA 3FD3A 1JB0E 3PUVE 4TOZA 3WVDB 3T93B 4H5GA 4XU1A 3CBMA 2V8JA 2J05A 1SD3A 3CC2T 3M55A 4G68C 2KI7A 3K2DA 4KXPA 4AS5A 3VJPA 1MPCA 1S50A 1QVFA 1NUYA 3R26A 1MQGA 5AT1B 2HPGA 5CC2A 1LAHE 1LAFE 5CKDA 1B46A 1A8FA 3LSXA 2DKGA 2DSFA 3VVEA 4LZ7A 2Q8MA 3MHXA 3MVXA 5EQ8A 3CCRQ 4J9DA 1N84A 1DK4A 4DLDA 1USYH 2A0FB 3KBZA 1SW1A 4XK8E 2E0SA 5CO7A 1HSEA 5I59B 1U8RA 4R6YA 5H8SA 2LAOA 4FAJA 3JCMV 1M1KU 1VQLT 1P1QA 1QUJA 3O2AA 2LMJA 2FBPA 1YJWQ 3EHRA 3FVGA 4EMKA 2HSPA 4HCKA 4ZN1A 2ZAEA 1XHYA 5JK4A 1FTJA 3KJ7A 4H67A 3MVWA 1NH8A 3G3IA 3PFSA 3KUFA 3SWNB 4JBZA 2OAWA 4BDNA 4ECFA 3SEWA 3FXQA 5L8DA 2MK5A 3SB2A 1WLPB 4RNSA 4PFTA 1LCFA 1JP4A 3TTKA 3OBYA 5LOMA 3QYHB 1K9MR 2GNCA 4GWXA 4OVRA 1VIEA 2GHBA 4EDPA 4N0AA 5DEXB 2Y84A 1TXFA 1N9SA 1EYIA 2VV5A 2W0ZA 4L59A 2WSEE 3IR1A 3P8BB 4J5YA 2VWFA 4M78D 3TTNA 3VXCA 1UJ0A 5CBRA 1O64A 3G71A 3PPNA 1A55A 1TUCA 2R8TA 4HT8A 1R0BG 2O01E 5CCAA 2K3XA 1DBZA 1JW4A 1A7LA 3HTRA 2CMOA 2Z0WA 4XTUA 2P3VA 1W70A 3OSRA 2KE9A 1MY0A 1AEYA 3M59A 2JXBA 2YUNA 5CKBA 2Z8EA 5CI5A 3H6ZA 3O97A 2FZCB 4N4HA 2YRDA 2BKDN 2KT1A 3ULRB 2XWOA 3E1SA 1D4NA 1M1KC 1QWEA 5HK3A 1POY1 2F35A 2GFEA 4DOWA 4ESRA 1BK4A 2PX1A 4NF8B 3LWHA 2LQKA 3C9HA 1RAFB 2H4IA 4MNCA 2DFUA 3OS0A 1WHHA 1QJMA 5AA2A 1QW0A 2QASA 3EG9B 4BDZA 1PCXA 2M0YA 3UP9A 1UTIA 4A63B 1KHCA 3I56T 2D0NA 3CD6T 3P8HA 1OU8A 4L6V5 1H92A 3FXRA 1JEVA 3QPHA 2XXVA 5TU0A 3FXBA 4PF6A 2E6NA 4P47A 4C92A 3LUZA 2EJ9A 1B40A 2ZYNA 3V5AA 3CHGA 4MNPA 3HL8A 3BFUA 3C31A 2FHDA 2FYKA 1YIJA 3M0RA 1VQNT 3THKA 3FZVA 3N94A 2DXTA 4XKRA 4BY6B 3JB9D 4F2OA 4H6DA 5HBCA 3T9HB 4U21A 1RDYA 3RPLA 2NUZA 1PEBA 4YB5A 1YITQ 1UUEA 5CVIA 3EN3A 5IT9E 5FU7C 2JTFA 1UHFA 3CCRA 1Y3PA 2QTXA 4CI0C 1MMGA 3OB9A 2PFYA 1HD3A 1IZ1A 2WX9A 3O6GA 1YYZA 1R8OB 2GQ1A 3TKDA 2LQWA 3D4CA 2P84A 4BDLA 5A5XA 4OENA 5A0GA 1LB8A 3H6WA 3BDUA 4JRPA 4KQPA 2DERA 2R6GE 3INZA 3WAFA 2XDDA 4PL6A 2XKOC 4F7UA 4FSXA 1BKAA 3JCMb 3TPAA 1B0LA 2MIOA 3FC3A 2G3RA 5TPAA 4JPBW 3C35A 4POWA 1OZ3A 2RH2A 3SKPA 3HPWA 4OVPA 1ELJA 5FW9A 3G4SQ 2E41A 1VQ9T 5C6SA 4MX6A 4KFQA 3OYKA 4ATOA 3CC7A 3PMXA 2LT1A 4MDWA 1WXUA 1RDXA 4XEQA 5FHOA 1GBRA 4RXLA 1YBYA 4AQ4A 3CCQT 5CK9A 1JETA 3MC2A 1UGSB 1K0XA 2F7CA 3MYUA 3J80E 3WXMB 4C8QD 4XQ3A 2XHDA 3CG3A 4NMYA 3QDFA 3FJ7A 3UN6A 1H3ZA 3U92A 5HKCA 2O2OA 5DYHA 5FHMA 3M58A 2JTEA 5IH2A 1B58A 4N17A 1U1TA 3I35A 2QA4Q 5FRMA 4OZ9A 2KBTA 2FVUA 2KYMA 4UC4A 1LFIA 3C95A 1MXWA 3CCST 2LC4A 1YAEA 3CC4Q 4M7DC 3KSXA 2E6ZA 5I59A 5IZ1A 1IB8A 1ATGA 2Q8JA 2O7IA 4KBMB 1TFDA 3TQ7P 1AWBA 2KEAA 4JZ3A 4LA9A 3FJGA 1RACB 4ZEFA 1MS7A 4QW2A 1SW2A 5J16A 2ZGWA 4C0FA 2LJ3A 1PC3A 2F8DA 3UA8A 2RQRA 3NPFA 4PJNA 3I3VA 1TUDA 3SWNA 2FB7A 2P4RA 5EQ9A 3TQLA 3ZBDA 2KR0A 4M77C 3CFXA 2ZNUA 3JCMg 4KT0E 2PNIA 1UE9A 4YTLA 3TDJA 2E12A 5DEXA 1MNDA 1LFHA 3QK6A 4M4ZA 2JN0A 2XXRA 4PJMA 3H9NA 3I55A 1IGUA 1M1KR 4RMOA 2CZHA 4GRKA 4V2SA 3PTYA 3D7SB 3DKMA 4KCDA 1M27C 1UTBB 5A0LA 1SW4A 4H8JA 4MMPA 4KH0B 1NFTA 2O6AA 1YITA 3KN3A 5HY6A 2ROLA 2RCAA 4FIMA 5IM2A 5KYYB 1KG1A 1OPKA 4RG2A 1VQ6T 2YSQA 1PWTA 3MJNA 4A4KA 4PDDA 3KC0A 1N9RA 2DF6A 1NNTA 1QCOA 2QS1A 2EKOA 4XFEA 5I5PA 4OXVA 2RHIA 2LNVA 3SESA 3G1JA 5FTHA 1BI0A 1WHMA 2F5XA 1SDXA 6AT1B 2YPNA 1YJ9T 3UGWA 1D3KA 2JS0A 4NF8A 4IO5A 3UORA 1PG5B 2GF7A 4OANA 2F2WA 1W6XA 2D1XA 1QVGA 4GX3A 2H3JA 5GAOq 2NUPB 3VYGA 2VGMA 3OW2A 2D6FA 1M30A 3OYEA 2GTJA 1D9QA 1DSNA 5DVJA 3EG9A 2KNBB 4G8MA 3VUZA 1FX7A 1MXZA 2V3UA 2V1RA 2JM9A 3ROJA 1W1FA 2DPPB 4M7AC 1LVKA 3PMTA 2Q74A 3GPLA 3L2QA 2AT1B 2PZ1A 2QG9B 3GNGA 1N7WA 5KCJB 1HSJA 3G4SA 2FPDA 4N4UA 3M4YA 2BIVA 1RAIB 3I5RA 2EW3A 3RTWB 2L3SA 1D0XA 3U93A 5GMKm 3OYIA 3CR9A 2HNIA 3Q26A 4BE1A 1N7XA 3MSTA 3C4SA 3CMAQ 2F97A 2RHYA 1B1XA 3Q25A 2OI3A 2Y4YA 5CRYA 1ZUKA 1NNKA 1KD1U 1PC0A 1SF9A 1D09B 1XI6A 1R1NA 1MRPA 4J9EA 1J3TA 3U65A 4DIGA 1KIKA 3RESA 3HRTA 4X1VA 2AKLA 1G3SA 4XTCQ 3CC4A 2A7YA 5LJ5e 1XOVA 2RJFA 3RIRA 3OYGA 3MJXA 1QKBA 2FEIA 2EJFA 3CCMA 4JLIA 5ITOA 1M3AA 1C6VX 1IUDA 4J6YA 4WEPA 3V7CA 2XMFA 3UPUA 3QAXA 2VT5A 5LJ5d 3TREA 1GCQA 5L9MA 1YHQT 4AFSC 4O3BA 2WSFE 4ELRA 2CEYA 1VQLQ 2YXYA 1H8KA 2PVGB 3OYCA 1VQ8T 3K6WA 2PVOB 4MZMA 4KPTA 5D6YA 3FDRA 4THIA 2H98A 4QFNA 3DLLA 4PC9A 1EU8A 1K8AC 1U5SA 4Z02A 3LC8A 1X43A 3A29A 2XD3A 3QO3A 1VQOT 2KY9A 1GL5A 2DEQA 3MP8A 5HM4B 4KYDA 2I48A 4OVSA 3FVOA 1FPEA 4PJOB 3TSZA 1NUZA 3OY9A 3G7ZA 4PBHA 4F3SA 3C94A 2F69A 2DO3A 1Q1KA 1KD1C 4OFOA 1D1CA 3KXTA 4M75B 2EQKA 1LBBA 3M3LA 3CC7T 2R58A 2VOZA 3H41A 3QDRB 1HSLA 3OYAA 4D6WA 5IZ3B 3TQWA 1R9LA 1MMNA 2L3QA 1ACMB 1AHJB 2V1QA 3KZGA 4DQ2A 5AE4A 1F1BB 3IOUA 4OVJA 4BDQA 3T96B 3U8QA 1EYKA 1FJ6A 2SRCA 1CKAA 1BI3A 4RUGA 4C0DB 3CCLA 1OZ2A 3WVEB 2YLNA 3PPQA 2JMCA 4QFPA 3PD8A 1MY2A 2QL3A 2JNGA 2FA7A 3PTAA 4D8KA 1MY4A 2F2XA 1YZ0A 4JVCA 4PFUA 5I3SA 3VUBA 5GAOm 2DIGA 3BFTA 3EHUA 1IGQA 1NV5A 2CSQA 3CCUT 3P7IA 4J9BA 3SEVA 1NEGA 3RPWA 2CUBA 3HHTB 5I57B 1C1AA 4J83A 3TAJA 1P1NA 2VHAA 4R55A 3H6TA 1X27A 4P1EA 1ZUYA 4E0WA 3CPFA 4X48A 1RAAB 4G68B 3TMGA 2I0BA 1BKBA 1IREB 1W4SA 4AG2C 1YJNA 2DRMA 1DTZA 4OP0A 3L2UA 2RJEA 2PVUA 1HXDA 2V84A 4FJPA 1VQMT 3QYGB 3LBSA 2IIMA 3RKWA 4OMMA 4PLLA 2K3BA 4C1TA 1WI7A 3I56Q 4GBQA 2O84X 3CD6Q 2MF2A 3OMBA 4FORA 3HRSA 2PFZA 3W9VA 3QSLA 1NI9A 2G29A 1D0YA 4YAHX 1QP2A 3VS3A 1B52A 4PP0A 3OMCA 5GMKe 3CC2A 3VS1A 1GFDA 2EYXA 1JQQA 2ZCFB 1AVZC 2LRQA 3M0TA 3JCMW 4FEBA 4JJNK 1IEJA 5ET8A 1UTBA 3H6VA 4X1DA 1VQNQ 3T66A 3TUSA 2CYZB 1QWFA 1YI2T 5KYYA 3T22A 4IUPA 2DD5A 1Q81U 5EQ7A 3V7SA 3E79A 4GOTA 2DS9A 1SG5A 2DE3A 1BP5A 4DEXA 3QXMA 1B3GA 1ZBJA 4C0ZA 2G93A 2Y7KA 4P0IA 2AIRB 3TCFA 1PHTA 1T0JA 2RN8A 2DEUA 1KA1A 3HCQA 3CMET 3RYDA 2KT8A 3K1MA 1VYVA 4AFZC 2BTTA 2EQMA 1IMFA 1I69A 4KGXB 2E5KA 2HKQB 2NUPA 1JXMA 4JVIA 1ZJLA 2M9UA 4AT1B 3VRYA 4P9KA 3CPWS 1QW1A 3DLMA 2M51A 3IFAA 1V76A 3JB9I 3TVTA 2LX9A 3KG2A 1OV3A 4NS5A 4Y28E 3VU3C 3G3HA 3ZEHA 3M57A 1VYTA 2CZ1B 1NNPA 4FU6A 2DVCA 5KCJA 2BZ8A 4KRTA 4POXA 1B6HA 4XTVA 3L2WA 1E6GA 4HCZA 1VFDA 2PUOB 1I1JA 4ELPA 3V8LA 1Z7ME 4BB7A 2Y7PA 4NF5B 4PQJA 4K3FA 1M90U 4PKCC 1ABQA 4GX6A 4AS4A 4YMAA 1W2BA 4PJOF 1RL2A 3QKJA 3OYLA 3B50A 2DTIA 1K73C 1RLPC 3IFCA 5H8QB 3KEIA 3SFMA 4MH5A 1HYOA 3GLBA 1BBZA 1I81A 2V4CA 4YKPA 3M0PA 2CKKA 1QVGS 4YKKA 1K8AR 3BBRA 4ZGDB 4NX1A 2I0CA 2A37A 2RB6A 2B3BA 2P0SA 3CCSQ 3TTMA 3EG2A 1US4A 2OJTA 3SHWA 4XF5A 2KROA 2L0AA 3TSWA 1CSKA 1EFNA 3FLGA 1ZUUA 1ANFA 3PU5A 4YMBA 3FJMA 5L9OA 1QMCA 1UFFA 2RO0A 2RINA 4XAXB 3G7WA 2KRNA 3CXCS 2LX7A 3CVGA 2KDSA 2EJGA 4F1YA 2ZNTA 3MBPA 4E7JA 1WGSA 2HBWA 3I56A 2DNUA 1IQ7A 2EAYA 3CD6A 4HW8A 3RNJA 5KE2A 4EPCA 3H8ZA 5GAOr 1N76A 4PJOA 1M90C 5FU7B 4ZTFA 3BDLA 1YTVA 4PJOE 2H99A 1TFAA 2H3EB 1JVYA 3A3UA 2VYTA 2QJEA 4HS7A 4M75A 4P8BA 1P1OA 1FBCA 2GH9A 2E70A 2HAXA 5IZ3A 4EQBA 5GANg 5FROA 3OS5A 2B8AA 1IXDA 1O63A 1R6ZA 4LNPA 1OX8A 3RBBB 4J6XA 5CAIA 3JSCA 3M56A 2KR3A 5LJ3j 2KLFA 1VQ6Q 2XX9A 1RUWA 4OMBA 2DE0X 3CIJA 3S3MA 2XXXA 4F18A 4OMPA 1UECA 3TFLA 2RM4A 3LGLA 1H44A 1H3HA 4OGCA 3CCLT 2HZYA 2DXUA 2X4WA 2B4MA 1UGVA 4U4XA 4U23A 2QGFB 3UA7A 3CRBA 4U1OA 5I57A 1H641 2KVQG 2LQ8A 1BIBA 4F31B 4G68A 2YDLA 2R5MA 4F16A 1M5BA 2BZYA 1UGQB 4R9GA 2JMAA 2D3IA 3BIHA 3W9WA 2X3XD 2RA2A 4PJOG 1B4HA 2OCUA 4EIKA 3OA6A 1EIFA 2XX8A 5T3JA 3X24B 2HEUA 1O75A 3U94A 4RY1A 3VLVA 1M3CA 2CS7A 1YJNT 4MFIA 2B86A 2DE2A 3EHSA 2CH4A 2LCLA 1MHNA 4QVZA 2ZYKA 4GL8A 4BE0A 3L42A 3UDCA 4Z89A 2OTLT 4I1DA 1VQ9A 2ALUA 3IL1B 1LBZA 2ZPGB 3GXAA 2ZPEB 2HCAA 4M7DB 2I3VA 1FXXA 4J9CA 3B6QA 4GQOA 4XTZA 3CCQA 4H0WA 2VXFA 4H8IA 1RAGB 3CCJT 3T9XB 3VS4A 4O7MA 4UA8A 3FV1A 3TCGA 2QS3A 3OENA 3PMIA 4BI3A 1YIJQ 3G3GA 4MMKA 2KYBA 4ZEKA 2YUPA 2K5FA 4Y92A 2VPOA 4KI0E 4PFIA 1FQDA 3BIGA 1IMCA 2OLBA 3LLRA 2HQXA 3FIFA 1XS5A 3M0UA 1WJSA 5KCOA 3CCSA 4GIZA 3JCMe 5KYXB 2F6GA 1G0HA 4DE8A 2I4BA 2J7IA 3RN8A 4MHFA 3LH5A 3OEMA 3OXNA 3UF4A 3MPLA 3K00A 1JVXA 5I2MA 3RR6A 3JCMd 2QXFA 3GOXA 2DWIA 2NWMA 4MBPA 4YKIA 1FTOA 3B8BA 5EYGA 1YHQQ 1NV4A 3EKIA 5DW8A 1SVXB 4X04A 1KJWA 1GGGA 4TQUQ 4JWYA 3OEKA 1VQ8Q 1K73R 5CMBA 1EZOA 3DB4A 2RCBA 1VOMA 2QPQA 2XXTA 4OTEA 3VVFA 5ICQA 1FQAA 4LN5A 1VQOQ 4NF0A 1VA7A 3MCAB 4J9HA 2MOXA 4NF5A 2PYYA 3CQTA 3MAMA 1OVBA 2P0PA 3JAME 4QVCA 2OWZA 5IXBA 3URGA 4M4GA 3S3OA 2G6FX 2AHJB 3FGSA 1B7ZA 3N6TA 2AZVA 3PUXE 2LJ1A 1EZPA 1T0HA 4HCBA 4PFYA 3OO8A 5H8QA 2Y7RA 2MPXC 1SHFA 5KH6A 3CC7Q 2L5QA 3ZKKA 1YWPA 4R56A 2KGTA 1NV6A 1FPGA 1I8FA 1MV3A 3KGCA 1VQ6A 2H5YA 2GQVA 1TWBA 2Y7IA 1FBHA 3QSUA 4OGEA 4O7IA 4EXKA 1SRLA 1UTHB 3M5AA 1Y07A 4ZE8A 2RD1A 5DLQE 5I21A 3S3NA 5ITPA 4HXVA 2GRVA 1YJ9A 3OQ5A 5I2KB 5AA2D 2E10A 3FB9A 1KA0A 1BI1A 4JUVA 3O66A 5KDTB 2F36A 4I62A 5GAMf 3NOHA 5JTYB 3EF7A 2BJIA 1ZHIA 4ZEBA 3A98A 1MXVA 2K79A 5GAMh 4EQ9A 1Q86U 4HE2A 4J8OA 4C92D 1VQMQ 1POTA 5DLOA 3PVQA 4XU0A 2XD2A 2D0QB 3RY3A 2I3WA 1XT8A 1I07A 1NPPA 5HK0A 3EFOB 4R74A 2X7QA 2L5VA 2RQTA 3H4ZA 4MMLA 2ONSA 4DBHA 1BU1A 3IJOB 2Z8FA 1VFEA 1YCYA 4FSSA 4BDOA 4KCCA 2C0TA 4ZTJA 1WNLA 3I5SA 4M7DF 4MJOA 1LCTA 4Q5WA 1IXCA 3THIA 3I55Q 1TUGB 1FQEA 2D21A 4RTXA 1H43A 4MF3A 1XNIA 1IXGA 3EFRA 3CPWP 1G3TA 5H8FB 4RKUE 1SSHA 3S2VA 3HP9A 1NJIU 4ELQA 1AOJA 5DY9A 2K6DA 4QSEA
chains in the Genus database with same CATH topology
4H5FA 4M78C 3C12A 4Z7EA 1MY1A 3CBPA 1MH4A 1OVTA 4QHQA 4M77F 2DIQA 1IITA 1YHQA 5HPQA 4L17A 2Z22A 1LJOA 2QQRA 4L5GA 3KBRA 3IX1A 1VQ8A 4HT9A 3ZS6A 1QKAA 4OB0B 1DMBA 3OD7A 3M9QA 2E64A 3W15C 1VQOA 3S9LC 2CGHA 3SDZA 3H6UA 3HRUA 2NLUA 2EIFA 1B51A 3A8HB 3MW0A 1QVPA 2RK1A 1BLFA 2CZ0B 4M7DA 1VQKT 4NWCA 4R75A 4M7DE 4QQ6A 3ZFJA 4A4HA 3OYMA 4OB1B 5AA3A 1MQDA 3PPOA 4BUGA 1FTLA 1B7HA 5I84A 4ME7A 3T9VA 2LCCA 3QYTA 1GVCA 1NJIC 1US5A 4ZECA 2CZLA 3H03A 2VD2A 1ZBMA 1AIVA 3C33A 1AL3A 5L8RE 5ISUA 5FU6B 1UIVA 4M77E 1UB4A 1B1HA 1H45A 3HFOA 1P92A 3CCUA 4IY5A 1URGA 4M7AF 4OVAA 4ELYC 2XHCA 4KD5A 2ZPIB 3TTRA 3CBOA 4HA8A 4ISUA 1BYMA 4ESWA 1J1NA 3X20B 4M7DG 1VQMA 2HQEA 4NWDA 3HKSA 2OTJT 3QZ5B 4DA4A 5J26A 4QQDA 1VQPA 1VQ7T 2EQUA 5KZTA 1T0KA 2P0KA 3FUZA 5DTBA 1LNXA 3E4RA 1Y3QA 5LJ3f 5ELVA 2VP1A 2F7AA 1QVFS 3LH0A 4BDYA 4F2QA 4J7FA 2I58A 3D4GA 5LJ3h 2QQAA 3DP4A 2QRYA 3PUWE 3QXEB 4M77G 3MEAA 1YI2A 1OIBA 1B5JA 3MUQA 2M8CA 3OMGA 5CQYA 4GL0A 3S9NC 2RI3A 4ZZEA 2Q2AA 4F29A 1UTHA 3CCVT 3MP6A 4QQGA 5EHMA 2UYEA 4M7AE 5FLXE 3CMEA 4JS5A 4XU3A 3K6VA 5I2KA 1LFGA 3MQ9A 3ONMA 1HK9A 3VFJA 4C8QC 5KDTA 3OO6A 3HHFA 2MI6A 5JTYA 1WQWA 2YLBA 4OERA 1MDQA 2DK3A 2VUBA 3PGFA 2I2LA 1WQ7A 2OAUA 4PFWA 2XIDA 3PNWC 1LLSA 3DP8A 1NL5A 2AL4A 2RHUA 2RI2A 4JWXA 4KR5A 2XICA 3RLFE 2QMWA 3M53A 4KYEA 3BFMA 4ESXA 1UEBA 2OBGA 4YU0A 4LDYA 1A99A 1N8RU 4M7AG 4P0GA 1VE4A 4MDXA 1SI1A 1I6AA 1YPNA 2XXYA 1M1FA 2A3LA 1Y4CA 1S72T 1P99A 5H8FA 3KN7A 4WXJA 4BLAA 5IKBA 3V83A 2RHXA 1PBPA 3SEYA 3K6UA 2ONRA 3QIMA 3HHGA 1UGPB 5CR2A 4OEVA 2XG8D 5B70A 4TLLB 2HAVA 3MVYA 1JJ2A 1B3EA 2NXOA 4J6WA 3EQ1A 5GANe 1LBCA 4YZZA 2QMXA 1RI0A 3OS1A 1M5CA 2KK4A 3ILUB 1ZKBA 2V93A 2DVZA 3RGYA 1Y96B 3L6GA 5GANd 1X75C 4X9DA 1Y1ZA 3FXUA 3HN0A 2ZNSA 3C36A 1AMFA 2HBPA 2ZZDA 2HFBA 4IUUA 2VD3A 5K2XA 4X1BA 4I8CA 1N8RC 2JUFA 3Q27A 5J1DA 4FIBA 2XXPA 3SD4A 2ZXTA 1B34B 2DXBA 2O69A 2D9TA 4GWOA 4QF9A 3U72A 2DE4A 1YJWT 3IK6B 4ZS9A 2QS2A 1FQFA 3CG1A 1QP3A 1D3BB 2XU8A 3K4UA 4E7KA 2ANJA 4LUBA 3FIRA 2I6EA 4O3AA 3MZBA 3L2RA 4HCCA 5EYFA 1PDAA 5CBSA 3E13X 1R9QA 3KOTA 2KSSA 3OOAA 4C5GA 4G2ZA 2X26A 3M3KA 2I49A 3N5LA 3JZJA 2YRVA 2K5LA 3O6HA 2X4JA 5GMKl 2ZMBA 5IAYA 5GAN2 2OZZA 1B2HA 3OYJA 3B6TA 4II1A 1JW5A 1OMPA 3GNFB 4LD9K 3V8XB 5GAN4 2H9BA 2UVJA 4E7HA 2OTLA 1VQPT 2QQ9A 2ABHA 5GAMj 1NPRA 3CCEA 2EFIA 2DWHA 1Q82U 2KAFA 2WKYA 1N0TA 3CCJA 5CKEA 4IO4A 2R9JA 3TELA 3QBYA 2DOJA 4AB5A 3L6HA 4HCWA 3UK4A 2K2VA 3IO6A 2FL7A 4LZ8A 4A4EA 4OYVA 1B5IA 4KYSA 1FCKA 1PB9A 1FWZA 2M1HA 1RYXA 4UACA 1WPYA 1CB6A 1MQJA 3O9PA 4NE4A 1MXUA 4VUBA 1N6AA 4JXIA 5CMCA 2JZ2A 4BDMA 1N27A 3E9XA 3X26B 3M54A 3E3KA 3N6UA 2DP8A 2I4CA 1P1UA 4KUIA 3OO7A 4WF2A 3OYYA 3VKIA 1N3WA 3SETA 2V3TA 1A8EA 2L8DA 3O6IA 4QVDA 4C0GA 1A54A 3PPRA 3IORA 1V29B 1XC1A 3QHSA 2HZKA 3G3KA 2K5IA 4WKMA 3K1PA 1PSFA 1M4ZA 1Q82C 2X4XA 4M1VA 4R72A 4BACA 3PGGA 1K9MU 3G6ET 5FTIA 1OQHA 5GAOl 3M8UA 1Q81C 3OYFA 3IOVA 3ECRA 4P11A 3J7AF 3KBGA 3GIBA 3R7XA 3O28A 4PETA 3K6XA 3EAEA 4BDRA 4NEDA 2IA4A 4OF1A 3OYNA 3OW2S 4ZGEB 1G5VA 1YCJA 2ONKE 4ZDMA 2B3FA 3VLUA 1JRIA 1Y9UA 3IOWA 4ZZAA 4ONYA 3V8JA 5ICTA 1UIUA 2HQ0A 3VVDA 3I6VA 2Q9TA 2KQWA 2F6PA 3PIPA 3FVNA 3LSLA 4XKPA 2Q2CA 2V3QA 4PJOD 2AIXA 1Y96A 3OSSC 1LB9A 4BI4A 3K01A 5F1QA 3E9FA 4FL6A 3JCMX 3I5OA 3JCMQ 3E9GA 1MQIA 3P8DA 4M75D 2MMPA 4IB2A 4XXUA 1NZ9A 3DP6A 1H76A 2NUVA 4R2FA 3K1NA 2WSCE 4EMHA 4FEDA 3Q1JA 2DXYA 4M78B 3MEWA 4NF6B 5DY9A 3LX7A 4RYAA 1B34A 1BIYA 2XDBA 1DPPA 4EF1A 4QFKA 5LJ5f 3R6OA 3LSWA 1SYHA 4XKQA 2X7PA 3MWBA 1D3BA 5LJ5h 1BTJA 4YB6A 1JJ2S 2ZPBB 3RT8A 1H3DA 3CEYA 4ELZC 3MEVA 4FECA 1VQ4T 1QUKA 3KJTA 3OO9A 2PMSA 4LDUA 2P2AA 2E1SA 3IB0A 4R2BA 3JB9J 1B5HA 1B05A 3IB2A 3SEUA 4BI8B 1KC8U 4NF4B 2XXQA 3RMSA 1X6OA 3OSVA 5LL6S 3HSTA 5B7DA 2DQVA 3FVKA 4GXAA 2DAQA 2F78A 4JRIA 4OFLA 3CFZA 3S6WA 3UWNA 2P0QA 2IEEA 3RKYA 3C4MA 3SDFA 1AH5A 2ZYMA 3ER0A 2ZYOA 3GBAA 1VQ5T 2NWJA 2RC8A 4MLVA 5GMKi 1JW1A 1VQKA 4QFOA 3VV5A 2PVDB 3HFNA 4Y91A 3LUYA 4IO2A 3T9NA 3VV0A 1ZBXA 4FT2A 2RHZA 4EQ7A 3NFCA 3CCET 1SQYA 4X9CA 1URSA 4LDVA 2GFUA 4N13A 1I6BA 2UYFA 4FE8A 3TTLA 3QJ6A 4C0DC 3QIIA 3ODBA 4Q8RA 1G3WA 2EQJA 3H06B 3H7MA 2OWTA 1GR2A 1VSOA 2ZPFB 1MH3A 4M77B 4FT4A 4GVOA 5I56B 1KC8C 3Q29A 1FQBA 3CMAT 1KHIA 2AYSA 1MXXA 1N3XA 2HXWA 5TP9B 2F5KA 4QSCA 1QVSA 4E47A 5LJ3e 4R6HA 4GFRA 2OTJA 4RJZA 2FYIA 2JOYA 1VQ7A 3CFLA 1MDP1 1F9BA 5GMKh 5LJ3d 4LONB 4TLMB 4F1VA 4C8QB 1TWYA 2M16A 5CKHA 3CSBA 2DZCA 2R5AA 4YKJA 1ZQ1A 3PIOA 4LDWA 4M78F 5DM7R 3RUMA 1I6QA 4JLGA 4ELOA 4RK2A 4LATA 2B65A 3U1OA 2MWPA 1MY3A 3ILTB 3CCVA 3DM0A 1CE2A 4XU2A 3KN8A 4JSDA 3UT1A 2REGA 4AB6A 4M7AB 4O3CA 4Q0CA 4IURA 5GAOp 4DCYA 3MVZA 4X34A 2V25A 1MPBA 2QQBA 1D9VA 3NTHA 3OYBA 5F7VA 3BY7A 4OB2B 3VDFA 3LWIA 1PB8A 4G77A 4E7LA 3N26A 4U1ZA 3RNNA 2BUDA 3FV2A 4WEDA 3J81E 1B3LA 5L9SA 2E65A 4R73A 4G8NA 4ND9A 4N4IA 4C92F 3G3FA 1II5A 2XXUA 3MZ9A 3TCJA 4GLKA 4EMKC 3OSQA 1Q35A 3BW1A 1M5EA 1USYE 1KQSA 1W2BS 4PE5B 1ZLQA 4F1UA 1A40A 4M78A 5GAMg 4NF6A 2RJCA 1NKXA 4M78E 2HAUA 2DVEA 4C1UA 4F22A 1M1GA 2DJZA 5M9OA 3M4GA 4N0AC 1OLAA 1PBQA 5D6XA 4LD6A 4XTWA 5CIUA 1SSFA 4CRIA 2F7BA 1M8VA 3KSJA 3JB9F 3ASKA 1DPEA 2O4XB 3JB9H 1KQ1A 1S72A 3VXBA 1Y1MA 2P1SA 4RG8A 2RI5A 1JNFA 2GFAA 3WAEA 4F7UF 2X35A 3MEUA 2Y90A 4E7IA 3C32A 3L2ZA 5DVFA 5CKFA 2XXIA 4E0XA 4XTYA 4C92E 3KFMA 4NF4A 2P4TA 3TCHA 4XIGQ 1URDA 3T9UA 1VUBA 2DXRA 1M9SA 4GLIA 2Q88A 1Q86C 4M7DD 3EHTA 4M78G 2R57A 1XTDA 3GLXA 3EPEA 3ME9A 3PT9A 3CI8A 3S9EA 5J3BA 4BE2A 4IO6A 3B6WA 4A54A 3HSBA 4RK9A 5D6WA 4KULA 2UXAA 4GXSB 3F11A 3IJXB 4IGTA 1LGBC 4JDFA 3RQTA 4JWOA 2M0OA 1TT1A 2RKMA 5IAIA 4C92C 1B9JA 4JSOA 4M77D 1SW5A 1YJWA 4HTGA 4C8QF 4F7UE 1JBMA 3MPKA 2XDPA 1KQ2A 3MZ1A 1WJQA 1FW0A 1BIAA 1FQCA 2L89A 2UVHA 4C92G 4EUOA 1FTKA 1OQGA 3FEOA 2Z8DA 3META 2UVGA 4NOYA 2D5WA 4M77A 3DELB 2XX7A 1NE8A 5I56A 1GXIE 5JEIA 4H65A 4C5HA 4PLIA 4LDXA 3JV9A 1GV8A 3OELA 2QEXT 4U2RA 1SYIA 1DTGA 5I2NB 5TP9A 4O6JA 4OFJA 1XQHA 5GAN8 2NOOA 2QSXA 4EXLA 4A4GA 1WJRA 1VIFA 2LT4A 4IY6A 4N6PA 3JB9G 1NNFA 2F5TX 2VGNA 4H1XA 3JCMc 3QG1A 2W7YA 4FATA 1O9SA 3MO8A 4F7UG 4C8QA 3GBBA 1QULA 4N4GA 4C8QE 2Y7WA 4YICA 1Y7XA 4M7AD 2Q89A 3TEEA 4LVQA 3V7RA 3JCMf 1OLCA 1SI0A 2Y4XA 2QQSA 3PPPA 3JCMh 3QUIA 5LJ3g 4RCBA 1BI2A 4F3GA 3PD9A 3SERA 4IGRA 5KCHA 4M7AA 5GAOn 2QDYB 1IIWA 2O1MA 1P1WA 1EZ9A 3CPWA 4IUQA 4DXCA 3GP8A 4NL3A 4JDSA 5GAN3 5LJ5j 2IG0A 3QZ9B 2A5TB 2ESNA 4RCCA 2C06A 4R9FA 5GANj 1U1SA 3GZGA 3UIFA 4OETA 2O7UA 1LAXA 2K57A 2RJDA 3G71T 1X01A 4C8QG 1MXYA 3TZAA 5AA1A 2XD0A 3SWNC 5EHSA 2VXEA 2OWSA 3A3CA 2DXCA 4QFLA 5H8HB 4LP2B 3E19A 1N04A 3G6EA 4DZ1A 3R6UA 3N5BB 3A8MB 1JQFA 4HKEA 3O29A 2O4XA 4IO3A 3LGFA 3QUFA 2PUKB 4LZ5A 2R71A 4KHZE 4YB7A 3VYHB 4PNOA 1K8AU 4RA1A 1OYXA 3IB1A 4EDUA 3QUJA 3X28B 2A5SA 3RT6B 4LQ2A 3CXCA 2EYQA 1IXHA 1KQSS 4N07A 2CZ7B 4RPOA 2GCXA 2X4YA 3CSGA 3LSFB 4EF2A 1YIJT 5BUUA 5I58B 2QA4A 2DZ9A 5DT6A 3A5ZB 1EH3A 1MM7A 2GHAA 5K2YA 4ZN3A 3V8KA 4OEUA 3V89B 3L1AA 3IAZA 3CCRT 2PBWA 4IKFA 2EWNA 2XK0A 3OYDA 2XXHA 3IOTA 1Q7YU 4OQOA 3OBWA 4GY5A 4HCYA 1D9YA 5M2VA 5GMKj 3HO7A 2V8KA 5CMMA 3C34A 4BY6C 1SBPA 4QRZA 4DCXA 4C5IA 2PT2A 1IZ6A 4O5VA 5H8NB 2IVWA 5FRNA 1VQ4A 1ZU0A 2H25A 2PQWA 4OWDA 3HV1A 1ZTYA 1I4K1 5I2NA 3HPIA 2PT1A 2QS4A 1LAGE 2JVVA 2O68A 3AXFA 2YHTA 4GD5A 4JS4A 4I9DA 4MZTA 3SEXA 1B3HA 1Y3NA 1B0HA 5AA4B 2DYXA 1VQ5A 4A4FA 1PSEA 1MM6A 1WVJA 2WACA 2HD0A 4IUTA 1Q7YC 4EMGA 4Q30B 2Z23A 1XOCA 2E5QA 2CZ6B 2YLCA 3JYRA 2XI9A 2VGQA 1Y71A 5I2SA 4B9WA 4U22A 3FASA 4F3BA 4OHNA 1AOVA 2BJJX 1IXIA 5FU6C 3AHUA 1Y20A 4G4PA 1RKMA 3IO4A 3JRZA 4P5NA 3RKXA 3LW5E 4DOVA 1TH7A 3TYHA 4B9XA 2PU9B 2A5TA 3LR1A 3CMAA 5CMKA 4BD3A 3X25B 3DLNA 1FTMA 1QUIA 3A09A 3PMWA 1VR5A 3I55T 3JCMJ 4R6KA 4Z0IA 4DXBA 1MG1A 1MQHA 1K73U 5J39A 3VE1B 2MWOA 1B32A 3PV0E 1YITT 1UQWA 4JRQA 3NTIA 2VC8A 1WODA 1XVYA 1B4ZA 5H8HA 4DXUA 1O7TA 1G3YA 1XVXA 4TVRA 3FRNA 3USDA 4MZPA 1Z7NE 3Q28A 2LDMA 2RF1A 3PUYE 1VQLA 1GTKA 2DD4A 3H3GA 4C0RA 5GAN5 2OK2A 1MPDA 1OI1A 4ZEDA 1ZIUA 3K02A 1NH7A 4EMKB 2YJPA 2K4YA 3PUZE 1M5Q1 2NVUB 3S4UA 3O8VA 3B7DA 3RERA 4F39A