3MP6A

Complex structure of sgf29 and dimethylated h3k4
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
517
structure length
508
Chain Sequence
MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALAAAQTNAAAEFGSSYWTSEYNPNAPILVGSEVAYKPRGEWIQCEVLKVVADGTRFEVRDPEPDELGNSGKVYKCNRKELLLIPPGFPTKNYPPGTKVLARYPETTTFYPAIVIGTKRDGTCRLRFDGEKETEVTRRLVLPSPTALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Maltose-binding periplasmic protein,LINKER,SAGA-associated f
publication title Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Histone binding protein
total genus 151
structure length 508
sequence length 517
ec nomenclature
pdb deposition date 2010-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
A PF07039 DUF1325 SGF29 tudor-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3mp6A05
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3mp6A01
4FEDA 1L5TA 3OO8A 2OJTA 4Q5WA 2DWHA 5KCHA 4NF4B 4Q8RA 3G3FA 4OFJA 2I3WA 1PDAA 2LAOA 3O28A 2LRQA 1XT8A 4YKKA 1I69A 1PBQA 3UN6A 2PX1A 3C32A 1HSJA 4BDQA 2ZXTA 4GFRA 1EZOA 5FRMA 3C35A 3BFTA 4LZ5A 2D9TA 1B3FA 3FUZA 1EU8A 1LB8A 1Z7ME 1QKBA 2VD2A 3H03A 2EQMA 3TTMA 5KCOA 1US5A 3PD9A 3QKJA 2V3TA 2X4YA 1EZ9A 4ZTJA 2E5QA 1MH4A 3B7DA 4N6PA 3DM0A 3OMCA 3H6WA 3IOUA 3E13X 3CR9A 3IB1A 1B6HA 3K4UA 1B7ZA 2LVMA 2I3VA 1NH8A 1LBBA 3H7MA 5KE3A 5I57B 2ONRA 1SD3A 4IY6A 5JTYB 3E9FA 3ONMA 1AL3A 5ICTA 3E9GA 2UVHA 4GD5A 4C1UA 4BD3A 5D6WA 1PB8A 3B6QA 1XHYA 1B5JA 1MXVA 4XKQA 3OEKA 2PBWA 3OMGA 3CEYA 4I1DA 4RK2A 4R2BA 2AYSA 3TTRA 1JW4A 5M2VA 2JZ2A 4YB7A 4JDFA 4JWXA 4YZZA 3IJOB 5ITOA 5H8FA 1Y3PA 3C34A 1O7TA 4L59A 2XX8A 3B6TA 4TLLB 2HZKA 1A55A 3T66A 4BE0A 3UK4A 3C4MA 2XXYA 5H8NB 5AA2B 3N94A 3HHGA 2V3UA 5KDTA 4MFIA 2I48A 4GIZA 2K3XA 4POXA 3MWBA 1B9JA 1B5HA 1MDP1 1KWHA 2RHIA 2RKMA 3KEIA 4C5EA 1OVBA 3FXRA 2MWPA 2F35A 2O4XB 2BKDN 2HAVA 4MBPA 2I6EA 3CIJA 4F39A 4YB6A 1B05A 1G5VA 3MVWA 4A4EA 3TCGA 4E0XA 3O8VA 4GWOA 4BDMA 3O2AA 1QVSA 4TLMB 1D9VA 3K00A 3IR1A 4XKRA 3E4RA 1SW4A 3OS1A 2L89A 1BP5A 4F29A 3EPEA 4E7LA 5FRNA 3N6UA 5DTBA 3UORA 2XXPA 4Q0CA 2PMSA 2NLUA 3DP4A 5CIUA 4RA1A 1B4HA 3RT8A 5EYFA 3H3GA 4DXCA 3U1OA 3OYGA 3L2VA 3MQ9A 2AL5A 3SETA 2L3RA 4ZE8A 2XXQA 3Q28A 3FVKA 4KYDA 2O68A 5IN1A 1B3HA 2OZZA 1ZKBA 3IORA 1B5IA 1ZU0A 1YAEA 3PMVA 1SDXA 4A4FA 2THIA 1SBPA 5K2XA 4H8IA 4F1VA 3W9VA 4BLAA 1FCKA 3WAEA 3O9PA 1WJRA 1B0LA 3KN7A 3RTFB 3U8QA 3SEWA 4B9WA 4KCDA 4THIA 3SEUA 1Y4CA 3H4ZA 2OWSA 3OYCA 1B1HA 4ZE9A 4R6KA 3OYDA 4DXUA 1N7WA 4LQ5A 4RPOA 4U4SA 3TTKA 4ZEFA 3G3GA 4NWDA 3K6VA 3CFLA 2IEEA 1VR5A 1LFGA 1QULA 4BDRA 1MQHA 3CSBA 1Y9UA 4OFLA 3KFMA 4U4XA 3GLBA 4H65A 4F3PA 1FTKA 4G8HA 4TQUQ 2X35A 3LC8A 4MLQA 3OO9A 2DWIA 1UQWA 4U22A 4O3AA 2I4CA 1MM7A 3BDLA 1ELJA 2P2AA 5L9MA 1IITA 2ZYNA 1N04A 1POY1 1M5EA 5CMKA 3OSRA 5AA2D 3MPKA 2OCUA 3L42A 5JK4A 3QUFA 1HSEA 3U92A 4NF4A 3W15C 3SESA 5J1DA 3IK6B 4RNSA 5EHMA 4AB6A 1B2HA 4BDLA 3K6XA 2E0SA 3CFZA 4YICA 2F6PA 4Q5TA 3IB0A 1RI0A 1S7YA 1XVXA 2UYFA 5KE2A 2X7QA 3PFSA 3LGFA 5LOMA 1DTGA 1I6AA 4NF8A 4HCYA 4QRZA 5CRYA 3QJ6A 3ZSFA 3UT1A 4PFWA 1Y1MA 1LBCA 3THIA 5I58B 1PEBA 2XXXA 5KCJA 3FVGA 3R6UA 5CMBA 4OFOA 1FTOA 3S9NC 3HV1A 5FTIA 3TFLA 5A5XB 3PPQA 4FU6A 3FC3A 1A8EA 4LA9A 2Y7PA 1MDQA 3OYNA 3T22A 2F36A 3K01A 3V8XB 4QVZA 3GXAA 5JTYA 3UIFA 4G77A 4E7IA 1NL5A 1RYXA 1WODA 1Q1KA 3OYLA 4P0GA 4H0WA 4OEUA 2ZYKA 5CBRA 1OLCA 3EHSA 3D4GA 5KH6A 4ZEDA 3OYAA 3OMBA 4QFPA 2UVJA 3OS2A 1OZ3A 1SYIA 1B7HA 3OD7A 2REJA 3S3NA 5BUUA 1MXXA 3KJ7A 3DP6A 1GGGA 3TCHA 3Q27A 4PL6A 4E7JA 4PFYA 2NVUB 1DOTA 3NTIA 3KN8A 5M9OA 5D6YA 2H98A 5I56B 1XC1A 1TT1A 3ILUB 2QQRA 3OA6A 1M5CA 4II1A 4NF5B 5H8NA 2LTOA 3M8UA 4QFNA 3OELA 3EF7A 4JB7A 1SI0A 1MPCA 1P1UA 1CB6A 2XXTA 4F19A 3FD3A 4C1TA 1LFIA 3D4CA 3I6VA 1JW5A 4OVJA 1IXCA 2HEUA 2RI2A 2R58A 5I2NB 2QS2A 2CKKA 4KPTA 4QSDA 4EF1A 1M5DA 4R9GA 4BDOA 4M1VA 3SERA 3IAZA 4DZ1A 4UACA 2WKYA 3IL1B 4RPNA 2RJDA 2X7PA 1PBPA 4BDZA 1UTHA 3LSFB 2D21A 3H8ZA 1LAHE 2QPQA 3TPAA 2DE4A 4H8JA 3QBYA 5IAIA 3SEVA 2ZYMA 4HCWA 4ZTFA 2NUVA 4PFUA 1R9QA 1SSFA 2QRYA 3KSJA 3PU5A 3DLNA 2B65A 2K3YA 4IKFA 2QS4A 4K3FA 4F1YA 1LSTA 4RY1A 3BBRA 4QFOA 5HBCA 3OYHA 3O6HA 2I58A 1VSOA 2DWJA 2LCCA 2REGA 3FGSA 4LONB 4A4HA 4KYSA 3QSLA 3PGFA 1LCFA 5FROA 3HN0A 1FQBA 3KGCA 2E1SA 4X9TA 4FATA 2O69A 1I6BA 1P1QA 3MEAA 2BIVA 3OQ5A 1NNTA 2I0CA 2YRVA 2RF1A 4IGRA 1M5FA 2Y7IA 4IO2A 3N5LA 2W7YA 4XIGQ 2F5XA 2XX9A 4MF3A 3LUYA 4ESXA 5ICQA 4C5GA 4QW2A 5DYHA 2Z23A 3ZS6A 3FXQA 3TTNA 1N3XA 1QUJA 2ESNA 2RJCA 4IURA 2RI3A 3RY3A 2EFIA 3VV5A 4R9FA 1BKAA 1LFHA 3R26A 5CI5A 2ZYOA 2VD3A 3QIIA 2BUDA 1HSLA 2ZNSA 3MZ1A 4OENA 1Y3NA 3MZBA 4P0IA 4GVOA 2E6NA 2RINA 2RO0A 1FQFA 2M16A 1J1NA 1RYOA 2M0OA 4PQJA 5J26A 4IO5A 3KZGA 1B3EA 4RXLA 3RNNA 3FVNA 3PPOA 1B7UA 4ZDMA 1IIWA 2H5YA 3AXFA 1CE2A 3C36A 3QIMA 4ZS9A 4H5FA 1NH7A 1SW5A 3F70A 3OY9A 3CRBA 3HHFA 4FAJA 2X4WA 5L9SA 3KSXA 4X1BA 4OESA 4JXIA 1Z7NE 4FORA 3VXBA 4FE8A 1MY3A 1N7XA 5B70A 1SQYA 1MXWA 3ILTB 2UVIA 4KQPA 3BKIB 3EAEA 2QMWA 1JVXA 1RKMA 5I59A 2EKOA 3JZJA 1Q35A 5I58A 3G3KA 3GOXA 4ND9A 3H6ZA 1TFDA 1ZJLA 3I5OA 2GFUA 4U2RA 3S3MA 2FYIA 3EHTA 4HCZA 3FDRA 4NEDA 2G93A 2RHYA 5A5XA 3OYBA 4X1DA 4XTCQ 1OMPA 3H06B 4BACA 3IO6A 2F78A 3FV1A 1N76A 2XXRA 2UXAA 4NF6B 4GL8A 1DPPA 2WACA 4FIMA 3V83A 1M5BA 5CMCA 2O7UA 4JSDA 4I62A 3PUYE 2GHBA 1R1NA 4GQOA 4GLIA 3K0VA 3GBAA 4U21A 4R6HA 4LVQA 3RN8A 2D3IA 2LDMA 3SD4A 1LAXA 3C33A 2F7AA 3SDFA 3FVOA 1FQAA 3FV2A 3QUJA 5DVIA 2YJPA 4PE5B 5I56A 4F22A 2OWTA 3SEYA 4R75A 3PNWC 4FL6A 3DELB 4PFTA 1AOVA 1D4NA 4IY5A 2RC7A 4QHQA 1A99A 2FNCA 3HO7A 2DXYA 1D3KA 1DTZA 3OOAA 4QFLA 3OYEA 3IB2A 3KUFA 5JEIA 3PMXA 5AE4A 1WDNA 4EXLA 5D6XA 2HQEA 1JETA 1N84A 3OENA 3WAFA 2DQVA 3UP9A 2V84A 3ME9A 3L2QA 3ASKA 3L2RA 3M3KA 4HTGA 4ONYA 4Q30B 3NTKA 1JNFA 4G68B 2PVUA 2DIQA 1BIYA 2NOOA 1IQ7A 2DIGA 1Y1ZA 2Y7WA 1FTMA 2D5WA 4DE8A 2UYEA 3CI8A 1FQEA 4HW8A 4RG2A 2PYYA 1SI1A 4POWA 1XOCA 2RHXA 4U1ZA 2QQSA 5I2KB 5CM6A 1IUDA 4PLIA 1T0KA 4LP2B 2Z22A 1JVYA 1OQGA 2I4BA 4KYEA 1FTLA 5L8DA 2F6GA 4QFKA 1A40A 2QL3A 3VXCA 3QAXA 1MS7A 1PB7A 4Z0IA 4FECA 1ATGA 2M1HA 4YMBA 3TEPA 1SVXB 5IKBA 4F3SA 4EUOA 2KLFA 2O84X 3LR1A 1F9BA 3H6VA 2DWAA 4LZ8A 2NWJA 3VFJA 2A5TB 4ELOA 4WEPA 3EQ1A 3T93B 1Y3QA 3RT6B 4E7KA 5BWJA 1A54A 2XXUA 1P99A 2ONSA 1GR2A 4EF2A 2DE3A 2H9BA 2ANJA 2QS3A 4WKMA 3FASA 2QJEA 3EN3A 5DVFA 1MY2A 3PUXE 4X34A 3S4UA 4IO4A 1VFEA 2EQJA 3H6UA 4FEBA 3QYTA 1P1OA 3RUMA 1UTBB 3MJNA 4IUPA 4OVAA 3V5AA 1B3GA 4UA8A 4R72A 3S9EA 3C4SA 3MPLA 3LBSA 1QUKA 4WXJA 1OQHA 3OYJA 1VE4A 4MH5A 4ELPA 4PP0A 5F1QA 4YAHX 2F5KA 1TXFA 5HPQA 1MPDA 3OSQA 1NFTA 3R7XA 2ONKE 5I57A 3KOTA 1JW1A 2DS9A 2A5SA 1OZ2A 2L8DA 3MVYA 2V25A 3HSTA 3RGYA 2O51A 3ZEHA 4M4GA 3USDA 5ISUA 3CFXA 4QSCA 4YKIA 5I84A 3G3IA 2F7CA 2HQXA 3DB4A 1NKXA 2RI5A 4G2ZA 2Q2CA 4EQBA 4BE2A 5AA4B 4ZZEA 4ZEIA 1NMUA 3MP1A 3KOSA 4LATA 2XD2A 3Q26A 3META 1MPBA 3CG3A 1ANFA 3A3UA 4GXSB 5AA2A 3DB3A 3M9QA 4UC4A 1B40A 3OYFA 1BTJA 3OB9A 2FA7A 3MEWA 3LGLA 4F31B 3RTWB 2HCAA 2X4XA 4HS7A 4GF8A 3U94A 3C9HA 4DCXA 5TPAB 1SW1A 3EHUA 4ZZAA 4ESWA 2DXRA 2Q9TA 4TOZA 4IUVA 2O4XA 3FZVA 3TTLA 2XXWA 4ECFA 5CBSA 1QJMA 2EQUA 4IUTA 2R5AA 3DLMA 2X26A 4KCCA 3UWNA 2XDPA 2AIXA 4IUUA 3VLWA 3LH0A 4NF6A 1A7LA 1Y4TA 2RHUA 2I49A 1MQJA 5CMMA 1TFAA 4EQ7A 1A8FA 3MEUA 5KZTA 1PB9A 1FQCA 3TMGA 4YKJA 1NNPA 2GFAA 3ZKKA 4OYVA 4F3BA 4IUQA 2V3QA 2FHDA 1B52A 3CVGA 2DE2A 3K1NA 5FTHA 3TDJA 3OO6A 1B58A 1H76A 3TZAA 1LLSA 3PPPA 1URSA 4YMAA 2VYTA 1AH5A 1IXGA 1ZIUA 3P8HA 4DDDA 2Y84A 4QSEA 2PT2A 2RJEA 4FJPA 3KBRA 2RC8A 4ZEKA 4U1OA 2ZMBA 2PT1A 3QXMA 3RPWA 3O29A 4ZEBA 1B51A 1GTKA 4BE1A 2F97A 1DMBA 4N07A 1XVYA 5TP9B 3K6WA 2QSXA 5FHNA 2DAQA 3K02A 3FEOA 2B3BA 1MG1A 1PC3A 1SYHA 1WJQA 4R74A 2XHDA 1B4ZA 4G68A 1LAFE 2P0SA 4F18A 2DYXA 4R6YA 4NF8B 1MXYA 3TODA 1WGSA 2HXWA 2ZNUA 3RLFE 1H45A 2F7BA 5I2KA 1ZBMA 2IA4A 4GXAA 3ODBA 2OK2A 3MVXA 3FXUA 3PUVE 1BLFA 5KCJB 4RK9A 3PPNA 2GH9A 3L2WA 4YKPA 3SKPA 2H4IA 2H25A 5FHMA 4XXUA 1Y20A 2XX7A 1H43A 1O63A 2RC9A 3MVZA 4DLDA 4IO6A 3QK6A 3UGWA 3L2UA 3Q25A 2XK0A 4H5GA 2VP1A 3T9VA 2Z8FA 3TAJA 3U93A 3TQWA 4EDPA 2DSFA 4QF9A 4OTEA 4GOTA 3O66A 1II5A 3MUQA 3FIRA 5DVJA 3TYHA 1MM6A 2A5TA 4C5HA 3N6TA 1YTVA 4C0RA 3VDFA 4F3GA 3PMIA 3LLRA 3E9XA 2P1SA 1R9LA 3VVEA 5H8QB 2Z8DA 3G3JA 5TU0A 4OXVA 2Q88A 2DVCA 4DXBA 2HFBA 4C5IA 5HM4B 3HPIA 4OZ9A 3ECRA 4BDYA 4KHZE 3IOTA 2F8DA 4N4GA 4H6DA 4G68C 2QS1A 1UTBA 5DEXB 1YCJA 2Q2AA 4L17A 2R9JA 3K1PA 1ZTYA 3OEMA 1DSNA 4JBZA 1UIUA 4ELQA 1WVJA 4E7HA 1IXIA 2G3RA 4LD6A 3P7IA 1DPEA 4XKNA 1LCTA 4F2OA 1AMFA 1H3ZA 3KN3A 4OWDA 3VE1B 3IJXB 3TKDA 4F2QA 3MO8A 3OS0A 1R6ZA 5ELVA 1MY0A 2PQWA 2GHAA 4JWYA 1QKAA 5AA3A 2IG0A 1B3LA 3CG1A 3E3KA 1UTHB 1JEUA 2RHZA 4OETA 5CC2A 4H67A 1S50A 2YLNA 2MWOA 5AA4A 2F34A 3F11A 4EXKA 4RJZA 4R2FA 1IXHA 5IAYA 3K6UA 1IZ1A 2O1MA 1WJSA 5H8HB 3MZ9A 3Q1JA 2R5MA 1OVTA 4GL0A 4ISUA 3HCQA 4NF5A 3PV0E 2R57A 4NMYA 4OEVA 5K2YA 2XXIA 2NXOA 3KJTA 3VLVA 1URGA 1ZLQA 2XXHA 3IX1A 4N4IA 1US4A 2OBGA 1N0TA 3G3HA 1QW0A 3G7WA 4LQ2A 3TELA 1MXZA 4OMBA 2CZLA 3IOVA 5I2NA 5TPAA 2M8CA 4ELRA 1POTA 3OYMA 4DIGA 4KR5A 2XD3A 2B3FA 3TQLA 1N3WA 4LUBA 4IB2A 1MQGA 4CRIA 2GFEA 3IOWA 1P1NA 4G4PA 4EDUA 1GV8A 1MRPA 1OLAA 3VVFA 5ITPA 4B9XA 1MY1A 1SW2A 4I8CA 3LSXA 3RQTA 1FTJA 3PUWE 3O97A 2JTFA 2VOZA 4IO7A 2R71A 3MP6A 4GY5A 4OHNA 3S9LC 2RCBA 3P8DA 2EQKA 4BDNA 4I9DA 4O3BA 4JSOA 1NNKA 1B0HA 2R6GE 3H6TA 4WEDA 4NE4A 2V93A 2H99A 4E0WA 4O3CA 2O6AA 3S2VA 3VLUA 4X48A 3BFUA 2XXVA 4G8MA 1FW0A 4NWCA 2O7IA 4ZECA 3B6WA 3M3LA 4P11A 3GBBA 1MXUA 3JYRA 4MLVA 3O6GA 3MP8A 1XNIA 5TP9A 3MBPA 4NTLA 1VFDA 3W9WA 2OLBA 3SEXA 2O1LA 3O6IA 5H8FB 4Z7EA 3JV9A 4F1UA 3S3OA 1N27A 2HAUA 3FATA 3C31A 3Q29A 1P1WA 2AL4A 1LB9A 5KDTB 3OYKA 2VHAA 3NTHA 2Q89A 4PLLA 3MAMA 3LX7A 3LYIA 2RJFA 5I59B 1OI1A 3FJGA 5F7VA 2DOJA 1GVCA 3DP8A 4R73A 1LAGE 3OYIA 1MHNA 4QQGA 3MC2A 1AIVA 3L6HA 3VVDA 5J39A 3TUSA 4G8NA 5EHSA 2VGQA 3K2DA 4H1XA 4Z02A 3KG2A 4EQ9A 3MW0A 1XS5A 3S6WA 4A4GA 4KI0E 5C6SA 5L9OA 1EH3A 3M3FA 2CMOA 3PMWA 4RYAA 3MEVA 3FJMA 5FHOA 1URDA 2Y7RA 5C0MA 1QUIA 5AA1A 4AB5A 3CSGA 1S9TA 3ZKLA 4OQOA 1NNFA 1B46A 2HQ0A 4JWOA 4LZ7A 5H8QA 3FJ7A 1OIBA 3PMTA 4IGTA 1ZMGA 4PETA 4QQDA 2DP8A 1UIVA 4KFQA 3U72A 3FLGA 3A09A 3A3CA 1USYH 4DCYA 1OYXA 2ZNTA 5DEXA 3N26A 1MY4A 2ABHA 3TCFA 1TWYA 2B8AA 3UA8A 2UVGA 4AQ4A 4GRKA 2DVZA 2P0KA 3I3VA 1FQDA 2Q8JA 3T9XB 1YPNA 2GF7A 1MQIA 4KD5A 1MH3A 3GZGA 4N13A 3T9UA 2Z8EA 3T96B 5B7DA 1B1XA 3S9MC 4QQ6A 1H3DA 1USYE 3LSLA 1H44A 3K1MA 4IO3A 2G29A 1MQDA 1LGBC 1D9YA 1B32A 1I6QA 5H8SA 3PUZE 1JEVA 1JQFA 1EZPA 2BJJX 3OXNA 2RCAA 1KHCA 3LSWA 3OO7A 3IO4A 4YB5A 4YU0A 1O64A 2ALUA 2HZLA 1IEJA 2GRVA 2I0BA 3L6GA 4U23A 3PD8A 5H8HA 4N4HA 4OERA 2YPNA 5DT6A 4NS5A 2QMXA 2Y7KA 3V89B 3T9HB 4XKPA 3PPRA
chains in the Genus database with same CATH superfamily
3J80E 3M0SA 4FEDA 2DYBA 4M77C 3CXCA 1G3YA 1PSFA 1L5TA 2CREA 3MKDA 1PKTA 2LNHB 3OO8A 2OJTA 4Q5WA 4OVPA 1WZOA 3RESA 2DWHA 5KCHA 1VQ8T 4NF4B 4Q8RA 5CQXA 3CMEQ 3G3FA 4OFJA 3PTAA 2EIFA 2I3WA 4M77G 1PDAA 5CKEA 2LAOA 1K9MU 2ZPGB 4GBWA 2DFUA 3J7AF 1YIJQ 1LNXA 4ZN3A 3OW2A 3O28A 2QGFB 3JCMQ 3JCMc 1H3HA 2LRQA 3HTRA 1HD3A 1I69A 1XT8A 1PBQA 4YKKA 2KXDA 3UN6A 1LVKA 2PX1A 9ATCB 2DBMA 3RBBB 3VJPA 2X51A 4J6WA 4PJOC 1VQNQ 2BE7D 3QUIA 3C32A 1HSJA 3IQLA 4PFIA 4BDQA 2ZXTA 4GFRA 4OP0A 1EZOA 4C0FA 4C8QC 3FXBA 5FRMA 3C35A 5CQYA 4E47A 1FBGA 4R56A 3BFTA 4PCDA 2KMTA 4J83A 4RG8A 4LZ5A 3FJPA 2D9TA 2CT3A 4OMPA 1B3FA 3FUZA 1EU8A 2YSQA 1QWFA 4PJOG 3CCEA 4QVDA 1LB8A 1Z7ME 1JO8A 1QKBA 2VD2A 3H03A 3CCVT 1AOJA 2EQMA 5FU6C 3CMAA 3TTMA 5KCOA 1M2VA 1US5A 5IHIA 4C8QG 3PD9A 2XA5A 2RQWA 3EG0A 3QKJA 3QZ9B 3ULRB 1KQ1A 1OX8A 2X4YA 2V3TA 4MNIA 4P47A 1EZ9A 3LH5A 4ZTJA 2M9UA 4GWSA 3RKWA 1NPPA 2E5QA 4OB0B 3I55A 1MH4A 3B7DA 4N6PA 3DM0A 3OMCA 5GMKe 3LW5E 5A2QE 3VUBA 2FZCB 1ZLMA 3H6WA 3PGGA 1JBMA 4EIKA 2PVOB 3IOUA 3E13X 3CR9A 3IB1A 1B6HA 3CCLT 1JU5C 2ED1A 4BB7A 1KK7A 1IHWA 3K4UA 1B7ZA 2LVMA 5LTCA 2I3VA 1NH8A 4B6MA 1LBBA 1D3BA 5KE3A 3H7MA 4J9DA 5I57B 2ONRA 1QP3A 2BZYA 1SD3A 4IY6A 4GWUA 5JTYB 3E9FA 4KUIA 3ONMA 2DA9A 1AL3A 2CZIA 2EAYA 4PE3A 1VQPQ 5ICTA 3E9GA 2J6FA 2UVHA 3QZ5B 1D0XA 1O9SA 4FSXA 4GD5A 4BY6B 4C1UA 1Q86R 3M4YA 4BD3A 5D6WA 1PB8A 2E12A 3B6QA 1XHYA 2GQVA 1Y7XA 4PJJA 1B5JA 1MXVA 4XKQA 3OEKA 2OX3A 2PBWA 2EPDA 3OMGA 5GANj 3U65A 3CEYA 4I1DA 2RK2A 1BI3A 4R2BA 4RK2A 2AYSA 1YI2T 3TTRA 1JW4A 3CC7T 1MUZA 1IXDA 5M2VA 2JZ2A 4YB7A 5IM2A 1T3SA 5FWBA 4JDFA 1BIBA 2CP2A 5KYXB 4M75E 1X6GA 4JWXA 4YZZA 4Y28E 3IJOB 1VQOQ 5ITOA 1KC8C 2CEYA 4DEYA 5H8FA 1Y3PA 4DBRA 3C34A 1O7TA 2PNIA 4L59A 2XX8A 3B6TA 4NHBA 1KG1A 4TLLB 3VRZA 2HZKA 1A55A 3T66A 1ZSZA 4BE0A 3UK4A 3C4MA 3JCMf 2XXYA 4JUVA 4OMFB 2VB6A 3M56A 5FU7B 5H8NB 4FT2A 4HT8A 5AA2B 3N94A 3HHGA 1MMGA 2EBPA 2V3UA 5KDTA 4MFIA 2E3HA 4ME7A 5CKDA 3UDCA 5GAMe 2EJGA 2I48A 4GIZA 1VIFA 2K3XA 4POXA 3VUZA 3MWBA 2LT4A 1B9JA 1TUGB 2RK1A 2I0NA 2OTJA 4FCYA 2NUPA 1B5HA 1GCPA 1YNZA 1MDP1 4JRPA 1KWHA 2RHIA 1OU8A 2RKMA 3KEIA 4C5EA 4X04A 1OVBA 5HKCA 1UDLA 3FXRA 4F04B 4DA4A 2MWPA 2F35A 2O4XB 2BKDN 5DW8A 3TSWA 1G3TA 4K11A 1ARKA 2HAVA 4MBPA 2DJZA 2YT6A 2I6EA 3CIJA 4D8KA 1P92A 4F39A 4YB6A 1B05A 1G5VA 3MVWA 3RNJA 4A4EA 3TCGA 4E0XA 1X2QA 2ROTA 1HYOA 3O8VA 4GWOA 2AZVA 2CH4A 4BDMA 4PAKA 4AT1B 3O2AA 1QVSA 2V1RA 4QKUA 2FYKA 2LNVA 4TLMB 4A4KA 3CCST 2YUNA 1RAEB 2HD0A 1D9VA 2CZKA 3K00A 5GAN7 4GBQA 3IR1A 4XKRA 4M7DF 4KT0E 4QVCA 1SW4A 3E4RA 3OS1A 1MGQA 2L89A 2ZGWA 1YJWQ 2DXCA 1K0SA 1BP5A 3QWXX 4F29A 2CEXA 2DL4A 4M7DB 3FRNA 4E7LA 3EPEA 1M2OA 4HE0A 5FRNA 1TUCA 2E41A 3B50A 4L5GA 3N6UA 3M0PA 4LUEA 5DTBA 2XXPA 3UORA 2VUBA 4JJCA 4A53A 4DBHA 1I81A 1YITA 3EG3A 2IVWA 5J3BA 4FSSA 1N9RA 4ELZC 4Q0CA 2K5FA 2PMSA 3V8LA 2NLUA 1NUZA 3DP4A 3C12A 5CIUA 4RA1A 2Z0WA 1B4HA 3RT8A 5EYFA 1KHIA 3H3GA 1X6OA 4DXCA 1WFWA 3OYGA 3U1OA 1FTAA 1CKAA 3L2VA 3MQ9A 2KYMA 2AL5A 3SETA 4AS4A 2GBQA 4FBPA 2L3RA 2VVKA 4GWXA 2QI2A 1ABQA 4ZE8A 2QA4T 2XXQA 3Q28A 4HCKA 2XHCA 3FVKA 1YJNQ 2MIOA 4KYDA 2O68A 2KGTA 5IN1A 3JB9H 1W1FA 1B3HA 4FYXB 2OZZA 2ZZDA 1ZKBA 3IORA 1B34B 3MSTA 2YUOA 1ZSZC 1ZBJA 3HRUA 2FB7A 2DETA 4JJNK 1B5IA 1ZU0A 1XTDA 1YAEA 1RLQC 5AYFA 3PMVA 1SDXA 4A4FA 1YCYA 3ZFJA 1MMAA 2THIA 1SBPA 5K2XA 2KDSA 2OTLA 4H8IA 4F1VA 3W9VA 1BK2A 3KFVA 4BLAA 4XU3A 1FCKA 1QKXA 4KH0B 3WAEA 3O9PA 1WJRA 4RMOA 1KZ8A 1B0LA 3KN7A 3RTFB 3U8QA 3SEWA 4F7UE 4JVIA 4B9WA 2PFYA 4KCDA 1Q7YU 4THIA 1Y4CA 3H4ZA 3SEUA 2V8JA 1IREB 1ZHIA 3I9QA 3CC2T 2OWSA 2HSEB 3OYCA 2XWOA 4MEVA 8AT1B 3G71Q 1B1HA 1K9YA 1SPIA 4R6KA 3OYDA 4DXUA 4ZE9A 4NAPA 3RPLB 1NJIR 3EGXA 1AZGB 3G1JA 5HCKA 3VS3A 1N7WA 4LQ5A 5EQ9A 4RPOA 4U4SA 1KD1U 3TTKA 1NV1A 2E65A 4C92F 1S72T 4ZEFA 1OULA 1WHLA 4J9IA 1WXBA 4LN2A 3G3GA 4NWDA 1AT1B 1X01A 1C0MA 2XMFA 4C92B 1PC0A 1U1TA 5KYWA 3K6VA 2Q74A 3CFLA 2IEEA 1VR5A 4J7IA 5IZ1A 3G4ST 1LFGA 4P1EA 1QULA 1LEVA 1XOVA 3V7SA 4BDRA 1TS9A 1WXTA 2Y4YA 1MQHA 1LBWA 3CSBA 1Y9UA 4OFLA 3KFMA 4X1VA 4U4XA 5LJ5f 4FIBA 1AWXA 3GLBA 4OB1B 4H65A 4F3PA 1FTKA 4G8HA 4TQUQ 1VQ8A 2Y4XA 5GAOq 2X35A 3VS6A 1LOJA 2F69A 3LC8A 4MLQA 2RN8A 4J9HA 3OO9A 1VQ6Q 2DWIA 2JVVA 1UQWA 4U22A 2EYWA 4O3AA 5LJ3f 1JXOA 1RDXA 2I4CA 2P0PA 2XWKA 4OGCA 2B4LA 1MM7A 3UF4A 2WYPA 1WI7A 3BDLA 1ELJA 2P2AA 5L9MA 1M5Q1 1IITA 3V7CA 2ZYNA 1N04A 1POY1 3JCMd 1G8XA 5DY9A 1M5EA 5CMKA 2A36A 3OSRA 5AA2D 3MPKA 2OCUA 4XF5A 3L42A 1QVGS 5ET7A 2DEQA 1B7TA 2JM8A 1PD1A 4XEQA 3HPWA 3I56T 3QUFA 1QLYA 2HSPA 3M4GA 5CO7A 5JK4A 1HSEA 1NUYA 3U92A 4NF4A 3W15C 4LDVA 3SESA 1VQLT 5J1DA 5GAMf 1CSKA 1AWJA 2JOYA 5T3JA 3IK6B 1YJ9T 4RNSA 5EHMA 4F17A 2K4YA 1VQ7Q 4AB6A 1B2HA 4BDLA 2LQNA 4J9GA 3K6XA 2E0SA 1EYJA 3CFZA 4YICA 2F6PA 4Q5TA 3IB0A 3CCVA 1RI0A 1S7YA 5I11A 5IT9E 1XVXA 4GWZA 1GL5A 1K9MC 2UYFA 5KE2A 3E19A 1TU0B 2X7QA 5FBPA 5GMKm 3PFSA 1UGPB 3LGFA 5LOMA 2E64A 1DTGA 1AEYA 1I6AA 4NF8A 3FIFA 5DLOA 1G83A 2A0FB 2HL3A 2LT1A 3EH1A 4HCYA 5I3SA 4QRZA 5CRYA 2CSQA 3QJ6A 8ATCB 3CMAQ 3ZSFA 1VQMT 2QEXT 4RTTA 4JLGA 3M0QA 2GNCA 2RMOA 3QWYA 1OU9A 3UT1A 3J81E 4OMQA 1FJ9A 1Y1MA 4PFWA 5A0GA 3CCLA 1LBCA 1AZEA 2FPFA 3A98A 3CCRQ 3THIA 4MMKA 3I55Q 4M7DD 5I58B 1PEBA 2XXXA 2Y5KA 1UHCA 5KCJA 3T1BA 1VQ9Q 3FVGA 2V26A 3R6UA 1KQ2A 5CMBA 3EFOB 2K7AA 3M5AA 4OFOA 2SEMA 1FTOA 1IZ6A 2ZAEA 2QVVA 3S9NC 1Z9QA 3HV1A 5FTIA 2M02A 3TFLA 2GTJA 5A5XB 1DBZA 3PPQA 2W10A 4FU6A 2XXKA 1BI0A 4X9CA 3FC3A 3HRSA 2RD1A 4KGXB 1A8EA 4LA9A 5AT1B 1DK4A 2Y7PA 1YI2A 1UG1A 2ZPFB 2RQTA 3QG1A 1MDQA 2F2XA 3OYNA 4N81A 3GYYA 4XU2A 3T22A 4N4UA 1PNJA 4IIMA 2F36A 3OBYA 3K01A 2EYXA 2J6OA 2KRNA 3V8XB 3G6EQ 3GNGA 4FT4A 4QVZA 3JB9I 5KYUB 2JXBA 3GXAA 5JTYA 3UIFA 5ECAA 4G77A 4E7IA 1NL5A 1RYXA 1BCOA 1MMNA 2DPPB 1WODA 1IMDA 1Q1KA 1M9SA 1TUDA 1TWBA 3OYLA 4MMPA 2PFZA 4P0GA 1D1AA 2XIDA 4PJNA 2QAZA 4H0WA 1SPKA 4OEUA 2ZYKA 5CBRA 1OLCA 3EHSA 2ZZWA 3D4GA 5KH6A 4ZEDA 2LCLA 3OYAA 4HT9A 2PUOB 3OMBA 4QFPA 1TTHB 2UVJA 3OS2A 3A8LB 1OZ3A 4XQ3A 1SYIA 3THKA 1RAIB 4GX6A 1B7HA 2LQWA 1B3QA 2KYBA 1VQ5T 2REJA 3OD7A 3S3NA 4MCOA 1ZBXA 5GAOn 1MXXA 3KJ7A 5BUUA 4XU0A 3DP6A 1GGGA 3TCHA 3NMZC 2JJKA 1WIEA 4PL6A 5KYXA 4E7JA 3Q27A 4PFYA 4HVUA 2NVUB 1DOTA 3NTIA 3KN8A 5M9OA 5D6YA 2QQBA 2H98A 4I3YA 5I56B 3KBZA 1XC1A 5IHKA 4GWWA 1TT1A 3ILUB 2QQRA 3OA6A 1M5CA 4II1A 2HHMA 4NF5B 5DM7R 4AFZC 5IGAA 5H8NA 2LTOA 3UPUA 3M8UA 4C92D 4QFNA 3OELA 3EF7A 4JB7A 1SI0A 4RTWA 1MPCA 1P1UA 1W2BA 2HQHA 1CB6A 2XXTA 4F19A 3REAB 4M75F 1XJWB 2MF2A 3FD3A 4C1TA 2XX7A 1OQKA 1LFIA 3D4CA 2LCSA 2XDDA 3I6VA 1JW5A 4OVJA 4M75B 1IXCA 2HEUA 2RI2A 3CCMQ 2R58A 3CCSA 1ZUKA 1M1KR 5I2NB 1JJ2A 2QS2A 2M0YA 2CKKA 4KPTA 4QSDA 3E1SA 4EF1A 3T9NA 3QDFA 5I5PA 1M5DA 4JVCA 4R9GA 4BDOA 4M1VA 4I40A 3SERA 3IAZA 4DZ1A 4FYYB 4UACA 2WKYA 3IL1B 3CCQQ 4PJMA 1SG5A 4RPNA 1PSEA 2RJDA 2D8HA 2X7PA 1PBPA 2ZCFB 3OSVA 4BDZA 1UTHA 3LSFB 4AMCA 4XTXA 4RTXA 1BCMA 4M7AE 2D21A 1U8RA 3H8ZA 1LAHE 1AWWA 2QPQA 3RKXA 3TPAA 2B4MA 2DE4A 4H8JA 3QBYA 5IAIA 4LDWA 4F14A 4RUGA 3GNFB 3SEVA 4M7DA 2ZYMA 2QA4A 3JCMJ 4HCWA 2GCXA 2EYQA 1Q9DA 4ZTFA 2NUVA 4PFUA 1R9QA 1FX7A 1SSFA 3CMET 5ESYA 2X3WD 1V76A 1VQKQ 3RMSA 2QRYA 3X25B 3KSJA 3PU5A 1SRLA 3DLNA 1YXIA 3JCMg 5I22A 4BY6C 2B65A 2K3YA 4IKFA 2GQIA 2QS4A 4NGUA 5HK0A 1YIJT 4K3FA 4F1YA 1LSTA 2DLPA 3BBRA 4RY1A 4QFOA 5HBCA 4J7FA 3OYHA 3O6HA 3PIPA 2I58A 1VSOA 2DWJA 2LCCA 2REGA 3FGSA 4LONB 4A4HA 3IFAA 2QTVA 1VQNT 4HA8A 4KYSA 3EH2A 2JW4A 1UJYA 1IB8A 3QSLA 1YCSB 5CK9A 3CC2A 1FXXA 3PGFA 1LCFA 1OV3A 2E6ZA 3A8GB 5EQ8A 1IO6A 2P4RA 1GRIA 5FROA 3HN0A 3QXEB 4NOYA 3BY7A 4J9FA 1S72A 1FQBA 2E1SA 3KGCA 4X9TA 2DEUA 5FU7C 4FATA 2O69A 5IXBA 3CBOA 1I6BA 1P1QA 2BE9B 3MEAA 1W2BS 1O75A 2C0OA 3A1PA 4ELYC 2BIVA 3OQ5A 3WVEB 1I4K1 2DVEA 3G4SA 1NNTA 1PRLC 1D0ZA 2RM4A 2I0CA 2YRVA 3HL8A 2RF1A 4IGRA 1FPEA 3EGUA 3EGDA 1HXDA 4MZMA 1M5FA 2Y7IA 4AFUC 4IO2A 4PGNA 3N5LA 1FWZA 2W7YA 1JJ2S 2MI6A 1RI9A 3HFNA 3RUXA 4XIGQ 4ZGDB 1SHFA 1N5ZA 4P8BA 2F5XA 3OS5A 2XX9A 1Q7YC 2DDKA 4PNOA 4WCIA 4MF3A 1UTIA 1IMBA 4A63B 1G0IA 3LUYA 4C92A 4ESXA 3RR6A 4F7UF 1KD1C 5ICQA 4C5GA 4E7SA 4QW2A 5DYHA 2Z23A 1GBQA 4MNPA 3ZS6A 4F7UB 3FXQA 3A8MB 5GMKh 3E79A 3TTNA 1N3XA 3JB9F 1QUJA 2ESNA 1VQPT 1YHQT 1NUXA 2RJCA 4IURA 4JVDA 3RERA 2EQIA 2RI3A 4MMLA 4HCCA 2EFIA 2F2VA 3CCUT 3RY3A 3VV5A 4TVRA 2E1HA 3ZBDA 4R9FA 1BKAA 4HCBA 4V2SA 1Y07A 3I56A 1UB4A 2P3VA 3HP9A 4C0ZA 1KQSP 1LFHA 3R26A 4Z89A 5CI5A 4M7DC 1VQLA 2ZYOA 4EPCA 2VD3A 1YJ9A 2SRCA 3QIIA 2ZZVA 4H46A 2XD0A 2BUDA 3JB9J 1HSLA 2ZNSA 1W70A 2LX9A 1K8AU 2ZPEB 1QVPA 3EG9B 3D1RA 3MZ1A 4OENA 2ECZA 1Y3NA 3MZBA 1X75C 3AHUA 4P0IA 4GVOA 1VQOT 2E6NA 2RINA 3CPWA 1YWPA 2RO0A 4M7DG 1FQFA 2M16A 1QVGP 5LJ5h 1K73R 4AG2C 1J1NA 1NV0A 1RYOA 3CXCS 2NWMA 2M0OA 4PQJA 1QP2A 5J26A 4IO5A 3KZGA 1GFDA 5LJ5e 1B3EA 2DM1A 4RXLA 4M78E 2X4JA 2FL7A 5L8RE 1VQ4Q 2F3DA 2R8TA 3RNNA 3SWNA 5GANf 3BE3A 4M75D 5LJ3h 4EMHA 2QEXA 1VQMA 3FVNA 3PPOA 1N8RU 5ET6A 3QO3A 1B7UA 1K0XA 4ZDMA 1IIWA 2H5YA 3AXFA 3CD6Q 1CE2A 3C36A 5LJ3e 4WF2A 2J6KA 3QIMA 4ZS9A 4H5FA 1NH7A 1SW5A 3OW2S 3F70A 3OY9A 2IPOB 1NV6A 5F24A 3CRBA 3HHFA 4FAJA 1U1SA 1N6AA 2X4WA 1UECA 4FYWB 3A29A 5L9SA 3KSXA 4X1BA 1IMAA 2DBKA 4OESA 3VU3C 4JXIA 1Z7NE 4JPBW 3JCMP 1M1KU 5GAMh 5EG2A 1FMWA 4FORA 3BDUA 3VXBA 4ZNXA 1WPYA 4FE8A 1TG0A 1MY3A 2J06A 2CP7A 1N7XA 5B70A 2A08A 1SQYA 1X43A 5D7UA 4KUDK 1MXWA 4JRQA 3ILTB 2CUDA 2UVIA 1X69A 3H0FA 4KQPA 3EG2A 3BKIB 3EAEA 2MPXC 2DL8A 2K3BA 1FBPA 1JVXA 2QMWA 1RKMA 5I59A 2EKOA 3CCJQ 2MKZA 2A3LA 3JZJA 5LJ3g 1Q35A 5I58A 3G3KA 4OA4A 3GOXA 4ND9A 3HSBA 3H6ZA 2EKHA 4Z8AA 1TFDA 4C92C 1ZJLA 1VUBA 1X2KA 3I5OA 2GFUA 4YTLA 5KYYA 3S3MA 2FIXA 2FYIA 4U2RA 5HK3A 1YJWT 3EHTA 4XAXB 1M90R 2WEFA 3JV3A 4HCZA 2HDAA 2YUQA 3FDRA 4NEDA 4J8OA 5I21A 5A0DA 2KSSA 2G93A 2RHYA 1Q81U 5A5XA 3OYBA 4X1DA 4XTCQ 1OMPA 4PBQA 4MAGA 3H06B 4BACA 3IO6A 2KY9A 2XG8D 2F78A 4C92G 1R0BG 3FV1A 1N76A 2XXRA 2RB6A 2EJ9A 1FPJA 2UXAA 4NF6B 4GL8A 2EGCA 5GAMg 1DPPA 2WACA 5GJWB 4FIMA 1VQ5A 3V83A 1M5BA 5CMCA 4LUDA 2QFLA 2O7UA 1NYFA 4MDXA 1HSQA 3RMQA 2HZYA 3MPUB 4JSDA 4I62A 3CPFA 3PUYE 4O7MA 2QASA 1UHFA 2GHBA 5KYUA 1BBZA 3GPLA 4PF6A 1YP5A 1R1NA 1KSWA 4GQOA 4GLIA 3TVTA 1TSFA 2F1LA 4R0KA 3K0VA 2GGRA 3UATA 3CPWS 3GBAA 1YJNT 4RTUA 4U21A 3B8BA 4OMNA 4R6HA 4N8GA 1RACB 1E6HA 4LVQA 3RN8A 1SHGA 2D3IA 1BIAA 3GP8A 2LDMA 3SD4A 1LAXA 3C33A 2L3SA 2KRSA 4PFRA 4MJOA 3L1AA 1HJDA 2F7AA 3SWNC 3SDFA 1I0CA 3FVOA 4AG1C 2K9GA 1FQAA 2KVQG 3JRZA 1J3TA 4FW2A 4M4ZA 3FV2A 3LV0A 3QUJA 4OANA 1WNLA 5DVIA 2KR3A 4HXJA 2YJPA 3FJ5A 4PE5B 5I56A 4ANJA 1ZA1B 4F22A 2OWTA 4FM4B 2RF0A 3SEYA 3G71T 1M4ZA 4R75A 4JRIA 3PNWC 2KI7A 4FL6A 3DELB 1TH7A 1FPLA 4PFTA 2JJ9A 1AOVA 5CVIA 2C0IA 1D4NA 4IY5A 3SFMA 2RC7A 4QHQA 2QGGA 1K1ZA 2DF6A 2LX7A 3DKMA 3CCSQ 1GXIE 1A99A 2FNCA 3HO7A 1EX4A 2DXYA 1D3KA 1DTZA 2W0ZA 3QSUA 1G0HA 1PG5B 3OOAA 4QFLA 3OYEA 3OBWA 3TREA 3IB2A 3KUFA 2KEAA 5JEIA 3PMXA 1BU1A 4M75A 1RAHB 1VYUA 5CAIA 5AE4A 1WDNA 4EXLA 5D6XA 3JB9D 2HQEA 2DTIA 2CUBA 2AK5A 2EYZA 4MZTA 1JETA 1N84A 4N15A 1D1CA 2L3QA 3OENA 2DQVA 3WAFA 2D8JA 3UP9A 2DKGA 2V84A 4JDSA 2L5VA 3ME9A 1VIEA 2AIRB 1T3LA 3L2QA 3ASKA 3L2RA 3CMEA 1NPRA 3QYGB 3M3KA 1EIFA 4HTGA 1D1BA 1NV5A 4ONYA 4Q30B 3NTKA 3PVLA 1VQ6T 1JNFA 2PVUA 4G68B 2DIQA 1BIYA 2NOOA 4E7ZA 4OVSA 1KA1A 3C0CA 1IQ7A 2DIGA 1Y1ZA 1FTMA 2Y7WA 2D5WA 4DE8A 4WTOB 2UYEA 3CI8A 1FQEA 4HW8A 2QA4Q 4RG2A 2PYYA 4FYVB 1SI1A 4KGVB 4D8DA 4POWA 1XOCA 2FVZA 2RHXA 1CNQA 4U1ZA 1T0HA 2QQSA 4O6JA 1VQNA 2IIMA 2KBTA 3EFRA 1UGQB 5I2KB 2VASA 1Z9ZA 2V8KA 2DXUA 2QXFA 5CM6A 2LQ8A 1IUDA 4PLIA 2MCNA 1T0KA 1K73U 4LP2B 1I1JA 1Q86U 1VQ7T 5GAOr 2Z22A 4M7AF 2H3EB 1JVYA 1K9ZA 1OQGA 2I4BA 1WHJA 4KYEA 1FTLA 5L8DA 1BI1A 4M7AB 5IXFA 2F6GA 1Q82R 1LPLA 3RKYA 4QFKA 7AT1B 1E7OA 2NUTB 1K4US 3CQTA 1A40A 2QL3A 3VXCA 3QAXA 1MS7A 1EYKA 1PB7A 1SF9A 4Z0IA 4FECA 1ATGA 4VUBA 2M1HA 1YYZA 4YMBA 4J6XA 3TEPA 4M77E 1SVXB 5IKBA 4EMKB 2QVUA 4F3SA 4EUOA 2KLFA 2O84X 3MYUA 2VKNA 4D6WA 2CGHA 3G4SQ 3LR1A 2LMJA 1X27A 1F9BA 3H6VA 1W2BP 2DWAA 4DQ2A 4LZ8A 2HBWA 2NWJA 3VFJA 1MNDA 2VGNA 2MYSA 3CCRT 1RAGB 2A5TB 4ELOA 3BW1A 4WEPA 1VQ9T 1H92A 2OI3A 4OB2B 4X8RA 2KQZA 3EQ1A 3T93B 4NX1A 1NUWA 4M75C 1M27C 1VQPA 2B86A 1YHQA 2VWFA 1Y3QA 2H3JA 3RT6B 4E7KA 5BWJA 4IIOA 3CCEQ 3CCUA 1FMKA 4DOWA 1A54A 2XXUA 1P99A 3VKIA 1IGUA 2ONSA 3M57A 2OWZA 1GR2A 4EF2A 3VYGA 2DE3A 2H9BA 2ANJA 2QS3A 1M90U 1DCUA 4WKMA 4PJOE 3FASA 2QJEA 3EN3A 5DVFA 1MY2A 3PUXE 4X34A 3S4UA 4M75G 4IO4A 1VFEA 2EQJA 3TQ7P 3H6UA 4FEBA 4C8QE 3QYTA 1UGVA 1P1OA 3RUMA 2X9HA 2QG9B 4OGEA 1UTBB 4IUPA 4OVAA 3MJNA 3G6ET 1K9MR 3V5AA 1Y96B 2V1QA 4F7UA 1B3GA 4UA8A 1VQOA 2JN0A 4R72A 3LUZA 3ISPA 4XTYA 1RUWA 3C4SA 1VQLQ 2JNGA 2RA2A 3LBSA 3MPLA 3S9EA 1QUKA 2FRWA 1U5SA 1VYVA 3WXMB 2ATCB 1YJ9Q 1QQJA 4WXJA 5LL6S 1OQHA 3OYJA 1VE4A 4MH5A 4ELPA 2GQ1A 4PP0A 4DBFA 3E78A 1TXQA 2O9VA 1BK4A 2E3IA 2AZSA 4CC2A 2NUPB 5F1QA 4YAHX 2CZ1B 5IZ3B 2F5KA 1WYXA 1TXFA 5HPQA 3H41A 4HVWA 1MPDA 3CC7A 3OSQA 1NFTA 2ESWA 4J9EA 1BKBA 3EG9A 2ONKE 3R7XA 5I57A 1XI6A 3QPHA 3HKSA 3KOTA 2DNUA 1NLPC 3V8KA 4HKEA 3VRYA 1JW1A 2DS9A 2A5SA 2HXRA 1OZ2A 3REBB 1ZUUA 2L8DA 2HMAA 1RDZA 2V25A 3HSTA 3MVYA 4NN3A 1K8AC 3RGYA 3CXCP 2O51A 3ZEHA 1VQMQ 4M4GA 1IMEA 3USDA 1PM3A 5ISUA 1NYGA 2DXBA 4N6KA 1YZ0A 3CFXA 4HE1A 1QCNA 3G3IA 2F7CA 3TU4K 4QSCA 4YKIA 5I84A 2HQXA 4EMGA 1Y0MA 3DB4A 1NBEB 3V8JA 1IRXA 2K5LA 3URGA 1NKXA 2RI5A 4G2ZA 3HFOA 2DVJA 1NM7A 2Q2CA 2OJ2A 4EQBA 4PDHA 4BE2A 5AA4B 4DBQA 4ZZEA 1BYMA 1JB0E 3VS1A 4XFEA 4N8YA 1M8MA 3L2ZA 3CCMT 4KBMB 3OW2P 4ZEIA 1N8RC 3JCMb 3D7SB 1NMUA 3VS5A 2GTOA 4PBHA 3MP1A 4M78F 4A54A 3KOSA 4LATA 4XK8E 2ZPBB 1V1CA 1C1AA 3META 2XD2A 3Q26A 1MPBA 3M54A 4O8MA 1YWOA 5EC7A 1MV3A 4M78B 2KE9A 1ANFA 3A3UA 3EHQA 3SHWA 3CG3A 5GANh 3DB3A 4G61A 4GXSB 2OTJQ 5AA2A 2PVGB 3M9QA 3SB2A 4XTUA 2E10A 3CCQT 3CC4T 1BB9A 2NYSA 4UC4A 1B40A 3OYFA 1BTJA 3OB9A 2VPOA 2E5KA 2FA7A 3MEWA 3LGLA 5FW9A 1NJIU 4F31B 3RTWB 1M1KC 5GANe 2HCAA 3TEEA 2X4XA 4HS7A 1M8VA 1RABB 4GF8A 1D09B 4PK4A 1FPGA 3U94A 3NFCA 3C9HA 4DCXA 2D0NA 2A37A 5LJ5d 2COWA 2HNIA 2LC4A 3FB9A 5TPAB 3I5SA 1SW1A 3EHUA 2EYYA 4ZZAA 4ESWA 2DXRA 2Q9TA 4TOZA 2O4XA 4IUVA 1FSAA 4E6RA 2NUZA 3FZVA 3TTLA 3N5BB 3JAME 3KC1A 2XXWA 4ECFA 1YJNA 5CBSA 1QJMA 5LJ3d 1VQKT 1YFNA 2EQUA 4IUTA 4MHFA 2R5AA 1R0CB 3DLMA 4CI0C 2X26A 4KCCA 3UWNA 2XDPA 4M7AD 2AIXA 4IUUA 4O5VA 1PRMC 2FPEA 2E4HA 3LH0A 3VLWA 4NF6A 1EZZB 3SZPA 2G6FX 1A7LA 1FJ6A 2YRCA 1Q81C 1Y4TA 1QGXA 2RHUA 1Y71A 2I49A 4F7UG 5CR2A 2H8HA 1MQJA 5IHNA 5CMMA 4DEXA 1TFAA 5GAN8 3FBPA 4EQ7A 3KXTA 1A8FA 2O31A 3MEUA 1FPBA 2Y5LA 5KZTA 1YITQ 3JB9G 1PB9A 4PGPA 1FQCA 3C95A 5GAMd 4CC4B 3TMGA 5LDZA 1Q82U 1OX9A 2JTEA 3G71A 4YKJA 1NLOC 2YWWA 2AT1B 4PAFA 1NNPA 3CHGA 1SRMA 2GFAA 3I35A 4GX3A 3ZKKA 4OYVA 5GAOl 4C0DB 4F3BA 4IUQA 1NEBA 2V3QA 4DI4B 2AHJB 2FHDA 1B52A 4LNPA 4NF0A 3CVGA 2DE2A 2WSEE 1LBYA 2HAXA 4RTVA 3K1NA 1ZX6A 5FTHA 3TDJA 1FBFA 3OO6A 1B58A 2VV5A 1WXUA 5CKHA 1H76A 3TZAA 1LLSA 3PPPA 1URSA 3MCAB 4YMAA 3JCMW 2VYTA 1AH5A 1IXGA 1ZIUA 3P8HA 5GMKi 4DDDA 2Y84A 4QSEA 2PT2A 2RJEA 3VS4A 2OTLQ 4FJPA 3KBRA 2RC8A 4ZEKA 4XTZA 4U1OA 1B34A 2ZMBA 1NE8A 2PT1A 1D0YA 1VQ6A 1WQWA 3JCMV 3QXMA 3RPWA 3O29A 1FPDA 4ZEBA 1B51A 1GTKA 4BE1A 2F97A 1A0NB 2I2LA 5EYGA 2XDBA 4N17A 2KRMA 1DMBA 4N07A 2L3PA 2ZZXA 4LDYA 2Q8MA 1XVYA 4N91A 5TP9B 3K6WA 2QSXA 2VGMA 4OVTA 5FHNA 2DAQA 3IFCA 2FIEA 3K02A 3FEOA 2B3BA 1MG1A 2KT8A 3RPLA 1PC3A 1SYHA 4Z88A 1WJQA 4HVVA 4R74A 2XICA 4DI3D 2XHDA 1B4ZA 1QW1A 2XI9A 2WBBA 4G68A 1LAFE 2P0SA 5HY6A 1RADB 1VQ7A 3BIHA 1ACMB 3SEMA 4F18A 4J9BA 4J5YA 1QVFA 2DYXA 4MX6A 4R6YA 2CZ7B 3ER0A 4NF8B 1MXYA 3TODA 4J9CA 1WGSA 1AHJB 1VQ8Q 4RTZA 2HXWA 2ZNUA 3RLFE 2F2WA 1H45A 4DOVA 2F7BA 2PUKB 2FG0A 4ZGJB 5I2KA 2RQUA 2JTMA 1ZBMA 2IA4A 4GXAA 3ODBA 2OK2A 2WBDA 3MHXA 4PAIA 3V7RA 3MVXA 3X28B 2DL5A 2MAMA 1VQ4T 1Q7YR 3FXUA 3PUVE 1FBEA 1BLFA 5KCJB 4RK9A 3PPNA 5FWCA 2GH9A 2VC8A 5GAN5 1DJ7B 1LBXA 2BZXA 2DTHA 3L2WA 2H4IA 4IR8A 4YKPA 3SKPA 4KH1B 2D6FA 2H25A 1XQHA 1MMDA 3CD6T 1K73C 1KD1R 5FHMA 4XXUA 3CCRA 1Y20A 4OMMA 2LP5A 2PTKA 1H8KA 1KFZA 1H43A 2YHTA 3JSCA 4M7AA 1O63A 1Q86C 2RC9A 3MVZA 2BZ8A 4DLDA 1VQ9A 1NV7A 1OEBA 4IO6A 4M78D 2NUTA 3QK6A 3UGWA 3UA6A 3L2UA 3Q25A 2XK0A 3NGPA 4H5GA 2VP1A 2EGEA 3T9VA 2Z8FA 3TAJA 3U93A 2F3BA 4GLKA 3TQWA 4EMKA 1QCOA 3CCVQ 2DSFA 4QF9A 2A7YA 4EDPA 4NL3A 2HPGA 4OTEA 3CBPA 4GOTA 2DMOA 1T0JA 3O66A 1II5A 3QYHB 3MUQA 3FIRA 2DE0X 5EQ7A 5DVJA 2MOXA 2DK3A 2PU9B 2ZPHB 1YHQQ 3CCJT 1MM6A 3TYHA 2A5TA 4C5HA 4P5NA 3N6TA 3CCUQ 4JZ3A 2EWNA 1JXMA 2K5IA 2PZ1A 4LD9K 3G6EA 1K9AA 1NEGA 1YTVA 4C0RA 1PKSA 3VDFA 4F3GA 1PD0A 4OMOA 1NI9A 4M77F 5ET5A 3PMIA 3LLRA 3INZA 3E9XA 3RDVA 2FBPA 2P1SA 2WYKA 1R9LA 3VVEA 3CCLQ 5IZZA 3QDRB 3A5ZB 4M77B 5H8QB 2M51A 2Z8DA 3G3JA 4JS5A 1M3CA 4OXVA 5LJ5g 2KR0A 5TU0A 2Q88A 2K79A 3SDZA 2DVCA 5I2SA 4PFPA 4DXBA 2K6DA 2Y90A 2HFBA 2QDLA 4C5IA 2FRYA 3R6NA 3HPIA 5HM4B 4OZ9A 3ECRA 4BDYA 4KHZE 3IOTA 2F8DA 4N4GA 2FPDA 4H6DA 1M90C 4G68C 2KXCA 2QS1A 1UTBA 3NHNA 1KC8R 1Y96A 2JMAA 4NQ8A 1B07A 2CDTA 1QVFS 5DEXB 3EFOA 1YCJA 2Q2AA 4L17A 3OSSC 1IMFA 2RQRA 2R9JA 2PCRA 3K1PA 2J7IA 1ZTYA 3OEMA 1DSNA 1PCXA 2RNAA 3EG1A 4JBZA 1UIUA 4ELQA 4PJOF 1U06A 1WVJA 2KK4A 2VXFA 1WHKA 1YI2Q 4E7HA 1IXIA 3CC7Q 2G3RA 1FMVA 1M1GA 4QT7A 4LD6A 4PJOB 1JEGA 1DPEA 2J05A 3I5RA 3P7IA 2KROA 4C8QF 3VS7A 2QK0A 4XKNA 4H45A 5IZ3A 1LCTA 2DO3A 3M0TA 4FW1A 4C0GA 1AMFA 4F2OA 4C8QB 1H3ZA 1QKWA 3KN3A 4OWDA 3VE1B 3HHTB 2WX9A 1HK9A 3EFSA 3GBQA 4OB3B 3CCMA 1KJWA 4Y92A 1INPA 3IJXB 3TKDA 4F2QA 4ORZA 1NZ9A 3MO8A 3M58A 3OS0A 1CKBA 2YLBA 1R6ZA 2HKQB 4M7AC 2L0AA 5FU6B 5ELVA 1MY0A 4KXPA 2DZ9A 3ROJA 2PQWA 2GHAA 4JWYA 1QKAA 2DJQA 5AA3A 2IG0A 1B3LA 3CG1A 3E3KA 1UTHB 1JEUA 2RHZA 4OETA 2DILA 1RDYA 4PFOA 3CCQA 1KA0A 3CC4A 4CC3A 5CC2A 2FZKB 4H67A 4P1LA 2CP5A 4P3LA 4EMKC 1S50A 2YLNA 4M7AG 2MWOA 4ZN1A 2RQVA 3TCJA 3VV0A 1AWOA 1M3AA 5AA4A 2F34A 3F11A 4EXKA 4RJZA 3O5ZA 1LCKA 3E2UA 2DXTA 1IXHA 4R2FA 2KAFA 1KQSA 3KC0A 5IAYA 4MIJA 3K6UA 3M0UA 3R6OA 1IZ1A 2MK5A 2O1MA 3HFUA 1WJSA 4J6YA 1K76A 5H8HB 3MZ9A 3Q1JA 2R5MA 1OVTA 4GL0A 4ISUA 1GCQA 1NV3A 3HCQA 2P3NA 1RL2A 4NF5A 3X20B 3PV0E 2R57A 5EQAA 4RCCA 4NMYA 4M78A 4OEVA 3A8OB 1VQKA 5K2YA 2QTXA 2L5QA 2XXIA 5GAN2 2NXOA 5CCAA 3KJTA 2X3XD 3VLVA 1R77A 1QVGA 1URGA 1ZLQA 2XXHA 3IX1A 4N4IA 4OF1A 1US4A 2YLCA 2COZA 2OBGA 3M53A 4NG7A 1N0TA 2CZ0B 3G3HA 1QW0A 3G7WA 4LQ2A 3TELA 1JRIA 3VS0A 2F5TX 1MXZA 3UA7A 4OMBA 1AVZC 2CZLA 3IOVA 5I2MA 2EJFA 1NJIC 3M59A 5I2NA 5TPAA 2M8CA 4ELRA 1POTA 1QCFA 2L2PA 3OYMA 1GBRA 4PF8A 4DIGA 1N9SA 2DRKA 2O2OA 2P4TA 1FPIA 4KR5A 1GFCA 2YDLA 2OAUA 2XD3A 2FO0A 3T0JA 2DERA 2B3FA 2K2VA 3H0HA 3TQLA 2LJ0A 3PT9A 1PHTA 2QQ9A 1N3WA 4UABA 1YBYA 2VXEA 2ROLA 4IB2A 1MQGA 4LUBA 4CRIA 2GFEA 1FYNA 3IOWA 1P1NA 4Y91A 5GMKj 4G4PA 4EDUA 1YIJA 2CYZB 1GV8A 3EGDB 1MRPA 2CZ6B 1OLAA 3VVFA 5ITPA 4B9XA 1MY1A 1SW2A 4I8CA 1ABOA 3LSXA 4F16A 3RQTA 1X6BA 2QDYB 1FTJA 1VYTA 4PC9A 4N0AA 3PUWE 3O97A 2QQAA 4BI4A 5A5LA 2ABLA 2JTFA 2VOZA 4X9DA 4IO7A 5L23A 2R71A 3MP6A 2JT4A 5GANd 2YUPA 4RCBA 1LJOA 4GY5A 4OHNA 3S9LC 2RCBA 1M2VB 1QWEA 4XTVA 3H0IA 1VA7A 4P9KA 3P8DA 1Q82C 2EQKA 4JJDA 4MNCA 4BDNA 4I9DA 1WDXA 4O3BA 4QBAA 4JSOA 1NNKA 5LJ5j 1IHVA 1B0HA 3QHSA 2R6GE 4LN5A 3CC2Q 3H6TA 2HL5C 4WEDA 4NE4A 2YRDA 1FPKA 2H99A 2V93A 1BI2A 4M77D 1OOTA 1UJ0A 2FEIA 4E0WA 3HRTA 1KQSS 2XWIA 1S72Q 1FBDA 4O3CA 4PFZA 5LJ3j 1OPKA 3CCET 2C06A 2O6AA 4GBVA 4PDDA 1G2BA 4BI8B 3S2VA 3GLXA 2LJ1A 3VLUA 4X48A 3BFUA 2XXVA 4G8MA 1FW0A 4O7IA 3CMAT 1D3BB 2CZHA 4NWCA 1GCQC 4JS4A 2O7IA 1UE9A 2ZPIB 1SKUB 4ZECA 3B6WA 2COYA 1I8FA 4M78C 4JRKA 1MV0B 3C94A 4GX4A 3M3LA 4P11A 4OVQA 3I55T 2EVRA 4AFSC 2WSCE 1YN8A 1NV2A 3GBBA 3GF5A 1WHHA 1MXUA 1E6GA 2MMPA 3MJXA 3JYRA 4MLVA 5GAMj 3O6GA 2JMCA 3X26B 3MP8A 1XNIA 3NPFA 4PJOD 5TP9A 3SWNB 4AFQC 1JJ2P 3MBPA 3A8HB 4M78G 4NTLA 1VFDA 1C6VX 3LWIA 1AD5A 1RAFB 1KC8U 1QMCA 4ZGEB 3W9WA 2OX7A 5DLQE 4C8QD 4HE2A 1LBZA 2OLBA 1VQ4A 2QYZA 3M0RA 5FLXE 3SEXA 5IH2A 3X24B 2QVRA 2O1LA 2XKOC 4PTKA 1U3OA 3O6IA 3U23A 5H8FB 4Z7EA 3PVQA 3JV9A 5GMKl 4F1UA 3GIBA 3CD6A 1SEMA 4RKUE 3S3OA 1ZSZB 2AKLA 1N27A 2O88A 3I56Q 4XU1A 2RH2A 1I5OB 1EYIA 3CBMA 1NV4A 2HAUA 2DL7A 3FATA 3C31A 4HXVA 3Q29A 3H9NA 1P1WA 1R8OB 2JM9A 1LB9A 4BUGA 2AL4A 2JS2A 1W6XA 5KDTB 1WQ7A 2ED0A 3OYKA 2VHAA 2KT1A 3NTHA 4N0AC 3WVDB 3G7ZA 2Q89A 1M30A 4PLLA 4KRTA 5CKBA 5KYNA 2HKNA 3LX7A 1D9QA 3LYIA 1JP4A 3MAMA 1KIKA 5I7IA 2RJFA 1S1NA 5I59B 1OI1A 1AWBA 2KNBB 4PFBA 2E70A 3FJGA 5F7VA 2DOJA 5KYYB 1GVCA 3DP8A 4R73A 2LJ3A 1LAGE 2EW3A 1NG2A 3OYIA 1MHNA 1UUEA 1H641 4QQGA 4C0DC 4KULA 3MC2A 1AIVA 3LWHA 3CCJA 2O9SA 4M7DE 3L6HA 6AT1B 3VVDA 5J39A 2EGAA 3TUSA 4G8NA 5EHSA 2FVUA 2D1XA 4LE9A 2LZ6B 2XU8A 2VT5A 4MZPA 4LXCA 3JCMX 1LBVA 2VGQA 2QEXQ 3K2DA 4OVRA 4H1XA 3P8BB 2PVDB 2P0QA 1ZSGA 4Z02A 2CSIA 3KG2A 5A0LA 4EQ9A 3MW0A 1SSHA 4AS5A 1F1BB 2HCKA 5EYHA 1XS5A 2OTJT 3S6WA 5GAN6 2D0QB 4JLIA 2WSFE 2O01E 3M55A 1FPFA 4A4GA 4KI0E 3VS2A 5J16A 2CP3A 1VOMA 2FZGB 3AT1B 3PE0A 5C6SA 4JZ4A 2HBPA 2V4CA 4N6DA 1EH3A 3M3FA 5L9OA 1W4SA 2CMOA 3PMWA 4RYAA 3MEVA 1WA7A 2YXYA 2KQWA 4LDUA 1M3BA 1Q95G 3FJMA 5FHOA 1I5LA 1URDA 1K8AR 1YJWA 2Y7RA 5C0MA 1MNEA 1QUIA 5ET8A 5AA1A 4KGZB 4AB5A 2CP6A 2DRMA 1I07A 1EFNA 1NNFA 1B46A 1S9TA 3CSGA 4OQOA 3ZKLA 4I3EA 2HQ0A 4M77A 4JWOA 4LZ7A 4BI3A 3FJ7A 1OIBA 5H8QA 3RYDA 4O94A 3PMTA 1WHGA 4IGTA 1TOVA 2JS0A 1FBCA 1ZMGA 3BFMA 4PETA 2DYIA 4QQDA 2DP8A 1UIVA 4RTYA 4GWYA 2CH4W 2K2MA 4KFQA 3U72A 3FLGA 3DLLA 3A09A 2DD5A 3A3CA 2DD4A 1USYH 5CKFA 4DCYA 1N8RR 1OYXA 1FRPA 1QVFP 1RLPC 2P84A 2ZNTA 5DEXA 3OYYA 1WHMA 1YITT 3N26A 2AKKA 1MY4A 2ABHA 3TCFA 1TWYA 2B8AA 3UA8A 2UVGA 2ENMA 4AQ4A 4GRKA 2DVZA 2P0KA 3I3VA 3PIOA 1JQQA 1Y57A 4E2FB 4MDWA 3QMFA 1ZUYA 5GAN4 1VQ5Q 3EHRA 2CP0A 4C92E 1VDWA 2HEQA 1FQDA 2Q8JA 4PJOA 1UEBA 2A28A 3T9XB 1YPNA 2GF7A 4LDXA 1MQIA 4XTWA 4L6V5 4KD5A 1MH3A 1OPLA 1G3WA 5GAOp 1IMCA 3GZGA 2DTOA 4N13A 2Z8EA 3KBGA 3T9UA 3T96B 4C8QA 5B7DA 5GANg 3VYHB 1B1XA 4QXDA 2RPNA 4QQ6A 2DX1A 3JCMh 2C0TA 1H3DA 3S9MC 1G3SA 1USYE 2DL3A 3ZL7C 3LSLA 4OMLA 1V29B 3NOHA 1WLPB 1M1FA 1ZQ1A 2FHYA 3EGXB 1H44A 4CC7A 3K1MA 1UGRB 2BTTA 4IO3A 3JCMe 4JJBA 4ESRA 3CPWP 3CC4Q 1FBHA 4PJLA 2G29A 5GJVB 4ATOA 1MQDA 2OTLT 1LGBC 2OAWA 5KYWB 1D9YA 2JUFA 1B32A 4NL2A 3PTYA 5GAOm 1I6QA 3EKIA 5H8SA 3PUZE 2XWVA 1JEVA 1UFFA 1JQFA 1EZPA 1IGQA 2V8IA 1RAAB 2BJJX 5GAN3 3RIRA 1Q81R 2RCAA 3OXNA 1KHCA 3LSWA 3OO7A 4P56A 3IO4A 4YB5A 4YU0A 1O64A 2ALUA 2HZLA 2K57A 4GLMA 2CT4A 1IEJA 2GRVA 3BIGA 2CS7A 1ZA2B 2I0BA 1UGSB 3L6GA 4U23A 3PD8A 5H8HA 4N4HA 1WX6A 2VPNA 4OERA 2BJIA 2YPNA 5DT6A 4NS5A 2QMXA 2Y7KA 4PKCC 3T9HB 3QJYA 4XKPA 3V89B 1PWTA 2DZCA 4R55A 3TSZA 3PPRA 2LQKA
chains in the Genus database with same CATH topology
3J80E 4FEDA 4M77C 3CXCA 1G3YA 1PSFA 1L5TA 3OO8A 2OJTA 4Q5WA 3RESA 2DWHA 5KCHA 1VQ8T 4NF4B 4Q8RA 5CQXA 3G3FA 4OFJA 3PTAA 2EIFA 2I3WA 4M77G 1PDAA 5CKEA 2LAOA 1K9MU 2ZPGB 3J7AF 1LNXA 4ZN3A 3OW2A 3O28A 3JCMQ 3JCMc 2LRQA 1XT8A 4YKKA 1I69A 1PBQA 3UN6A 2PX1A 3VJPA 4J6WA 4PJOC 3C32A 3QUIA 1HSJA 4BDQA 2ZXTA 4GFRA 4OP0A 1EZOA 4C0FA 4C8QC 5FRMA 3C35A 5CQYA 4E47A 3BFTA 4R56A 2KMTA 4J83A 4RG8A 4LZ5A 3FJPA 2D9TA 1B3FA 3FUZA 1EU8A 4PJOG 3CCEA 4QVDA 1LB8A 1Z7ME 1QKBA 2VD2A 3H03A 3CCVT 2EQMA 5FU6C 3CMAA 3TTMA 5KCOA 1US5A 4C8QG 3PD9A 3QKJA 3QZ9B 1KQ1A 2V3TA 2X4YA 1EZ9A 4ZTJA 2M9UA 3RKWA 1NPPA 2E5QA 4OB0B 3I55A 1MH4A 3B7DA 4N6PA 3DM0A 3OMCA 5GMKe 3LW5E 5A2QE 3VUBA 3H6WA 3PGGA 1JBMA 2PVOB 3IOUA 3E13X 3CR9A 3IB1A 1B6HA 3CCLT 4BB7A 3K4UA 1B7ZA 2LVMA 2I3VA 1NH8A 1LBBA 1D3BA 5KE3A 3H7MA 5I57B 2ONRA 1QP3A 1SD3A 4IY6A 5JTYB 3E9FA 4KUIA 3ONMA 1AL3A 2EAYA 5ICTA 3E9GA 2UVHA 3QZ5B 1O9SA 4FSXA 4GD5A 4BY6B 4C1UA 3M4YA 4BD3A 5D6WA 1PB8A 2E12A 3B6QA 1XHYA 2GQVA 1Y7XA 1B5JA 1MXVA 4XKQA 3OEKA 2PBWA 3OMGA 5GANj 3CEYA 4I1DA 2RK2A 1BI3A 4R2BA 4RK2A 2AYSA 1YI2T 3TTRA 1JW4A 3CC7T 5M2VA 2JZ2A 4YB7A 4JDFA 1BIBA 4M75E 4JWXA 4YZZA 4Y28E 3IJOB 5ITOA 5H8FA 1KC8C 1Y3PA 3C34A 1O7TA 4L59A 2XX8A 3B6TA 1KG1A 4TLLB 2HZKA 1A55A 3T66A 4BE0A 3UK4A 3C4MA 3JCMf 2XXYA 4JUVA 4OMFB 3M56A 5FU7B 5H8NB 4FT2A 4HT8A 5AA2B 3N94A 3HHGA 2V3UA 5KDTA 4MFIA 4ME7A 5CKDA 3UDCA 5GAMe 2EJGA 2I48A 4GIZA 1VIFA 2K3XA 4POXA 3VUZA 3MWBA 2LT4A 1B9JA 2RK1A 2OTJA 1B5HA 1MDP1 4JRPA 1KWHA 2RHIA 2RKMA 3KEIA 4C5EA 1OVBA 5HKCA 3FXRA 4DA4A 2MWPA 2F35A 2O4XB 2BKDN 1G3TA 2HAVA 4MBPA 2DJZA 2I6EA 3CIJA 1P92A 4F39A 4YB6A 1B05A 1G5VA 3MVWA 4A4EA 3TCGA 4E0XA 3O8VA 4GWOA 4BDMA 3O2AA 1QVSA 2FYKA 2LNVA 4TLMB 4A4KA 3CCST 1D9VA 2HD0A 3K00A 5GAN7 3IR1A 4XKRA 4M7DF 4KT0E 4QVCA 1SW4A 3E4RA 3OS1A 1MGQA 2L89A 2ZGWA 2DXCA 1BP5A 4F29A 4M7DB 3FRNA 4E7LA 3EPEA 5FRNA 2E41A 4L5GA 3N6UA 5DTBA 3UORA 2XXPA 2VUBA 4A53A 1I81A 1YITA 2IVWA 5J3BA 1N9RA 4ELZC 4Q0CA 2K5FA 2PMSA 3V8LA 2NLUA 3DP4A 3C12A 5CIUA 4RA1A 1B4HA 3RT8A 5EYFA 1KHIA 3H3GA 1X6OA 4DXCA 3U1OA 3OYGA 3L2VA 3MQ9A 2AL5A 3SETA 2L3RA 4ZE8A 2QI2A 2QA4T 2XXQA 3Q28A 2XHCA 3FVKA 4KYDA 2O68A 5IN1A 3JB9H 1B3HA 2OZZA 2ZZDA 1ZKBA 3IORA 1B34B 2FB7A 3HRUA 1B5IA 4JJNK 1ZU0A 1XTDA 1YAEA 5AYFA 3PMVA 1SDXA 4A4FA 1YCYA 3ZFJA 2THIA 1SBPA 5K2XA 2KDSA 2OTLA 4H8IA 4F1VA 3W9VA 4BLAA 4XU3A 1FCKA 3WAEA 3O9PA 1WJRA 4RMOA 1B0LA 3KN7A 3RTFB 3U8QA 3SEWA 4F7UE 4B9WA 4KCDA 1Q7YU 4THIA 1Y4CA 3H4ZA 3SEUA 2V8JA 1IREB 1ZHIA 3CC2T 2OWSA 3OYCA 1B1HA 4ZE9A 4R6KA 3OYDA 4DXUA 1N7WA 4LQ5A 4RPOA 4U4SA 1KD1U 3TTKA 2E65A 4C92F 1S72T 4ZEFA 3G3GA 4NWDA 1X01A 4C92B 1U1TA 3K6VA 3CFLA 2IEEA 1VR5A 4J7IA 3G4ST 1LFGA 1QULA 1XOVA 3V7SA 4BDRA 2Y4YA 1MQHA 3CSBA 1Y9UA 4OFLA 3KFMA 4U4XA 5LJ5f 4FIBA 3GLBA 4OB1B 4H65A 4F3PA 1FTKA 4G8HA 4TQUQ 1VQ8A 2Y4XA 5GAOq 2X35A 1LOJA 2F69A 3LC8A 4MLQA 3OO9A 2DWIA 2JVVA 1UQWA 4U22A 4O3AA 5LJ3f 2I4CA 2P0PA 4OGCA 1MM7A 3BDLA 1ELJA 2P2AA 5L9MA 1M5Q1 1IITA 3V7CA 2ZYNA 1N04A 1POY1 3JCMd 5DY9A 1M5EA 5CMKA 3OSRA 5AA2D 3MPKA 2OCUA 3L42A 1QVGS 2DEQA 5JK4A 3HPWA 3I56T 3QUFA 3M4GA 5CO7A 1HSEA 3U92A 4NF4A 3W15C 4LDVA 3SESA 1VQLT 5J1DA 5GAMf 2JOYA 3IK6B 1YJ9T 4RNSA 5EHMA 2K4YA 4AB6A 1B2HA 4BDLA 3K6XA 2E0SA 3CFZA 4YICA 2F6PA 4Q5TA 3IB0A 3CCVA 1RI0A 1S7YA 5IT9E 1XVXA 1K9MC 2UYFA 5KE2A 3E19A 2X7QA 5GMKm 3PFSA 1UGPB 3LGFA 5LOMA 2E64A 1DTGA 1I6AA 4NF8A 3FIFA 5DLOA 2LT1A 4HCYA 4QRZA 5CRYA 3QJ6A 3ZSFA 1VQMT 2QEXT 4JLGA 3UT1A 4PFWA 3J81E 1Y1MA 5A0GA 3CCLA 1LBCA 3THIA 4MMKA 4M7DD 5I58B 1PEBA 2XXXA 5KCJA 3FVGA 3R6UA 1KQ2A 5CMBA 3M5AA 4OFOA 1FTOA 1IZ6A 3S9NC 3HV1A 5FTIA 3TFLA 5A5XB 3PPQA 4FU6A 1BI0A 4X9CA 3FC3A 3HRSA 2RD1A 1A8EA 4LA9A 2Y7PA 1YI2A 2ZPFB 3QG1A 1MDQA 3OYNA 4XU2A 3T22A 2F36A 3OBYA 3K01A 3V8XB 3GNGA 4FT4A 4QVZA 3JB9I 3GXAA 5JTYA 3UIFA 4G77A 4E7IA 1NL5A 1RYXA 2DPPB 1WODA 1Q1KA 1M9SA 3OYLA 4P0GA 2XIDA 4H0WA 4OEUA 2ZYKA 5CBRA 1OLCA 3EHSA 3D4GA 5KH6A 4ZEDA 2LCLA 3OYAA 4HT9A 2PUOB 3OMBA 4QFPA 2UVJA 3OS2A 3A8LB 1OZ3A 4XQ3A 1SYIA 1B7HA 1VQ5T 2REJA 3OD7A 3S3NA 1ZBXA 5GAOn 1MXXA 3KJ7A 5BUUA 4XU0A 3DP6A 1GGGA 3TCHA 3Q27A 4PL6A 4E7JA 4PFYA 2NVUB 1DOTA 3NTIA 3KN8A 5M9OA 5D6YA 2QQBA 2H98A 5I56B 1XC1A 1TT1A 3ILUB 2QQRA 3OA6A 1M5CA 4II1A 4NF5B 5DM7R 5H8NA 2LTOA 3UPUA 3M8UA 4C92D 4QFNA 3OELA 3EF7A 4JB7A 1SI0A 1MPCA 1P1UA 1W2BA 1CB6A 2XXTA 4F19A 4M75F 2MF2A 3FD3A 4C1TA 1LFIA 3D4CA 2XDDA 3I6VA 1JW5A 4OVJA 4M75B 1IXCA 2HEUA 2RI2A 2R58A 3CCSA 5I2NB 1JJ2A 2QS2A 2CKKA 4KPTA 4QSDA 3E1SA 4EF1A 3T9NA 1M5DA 4R9GA 4BDOA 4M1VA 3SERA 3IAZA 4DZ1A 4UACA 2WKYA 3IL1B 4RPNA 1PSEA 2RJDA 2X7PA 1PBPA 2ZCFB 3OSVA 4BDZA 1UTHA 3LSFB 4XTXA 4M7AE 2D21A 1U8RA 3H8ZA 1LAHE 2QPQA 3RKXA 3TPAA 2DE4A 4H8JA 3QBYA 5IAIA 4LDWA 3GNFB 3SEVA 4M7DA 2ZYMA 2QA4A 3JCMJ 4HCWA 2GCXA 2EYQA 4ZTFA 2NUVA 4PFUA 1R9QA 1FX7A 1SSFA 3CMET 3RMSA 2QRYA 3X25B 3KSJA 3PU5A 3DLNA 3JCMg 4BY6C 2B65A 2K3YA 4IKFA 2QS4A 5HK0A 1YIJT 4K3FA 4F1YA 1LSTA 4RY1A 3BBRA 4QFOA 5HBCA 4J7FA 3OYHA 3O6HA 3PIPA 2I58A 1VSOA 2DWJA 2LCCA 2REGA 3FGSA 4LONB 4A4HA 1VQNT 4HA8A 4KYSA 3QSLA 5CK9A 3CC2A 1FXXA 3PGFA 1LCFA 2E6ZA 3A8GB 5FROA 3HN0A 3QXEB 4NOYA 3BY7A 1FQBA 1S72A 3KGCA 2E1SA 4X9TA 5FU7C 4FATA 2O69A 3CBOA 1I6BA 1P1QA 3MEAA 1W2BS 1O75A 4ELYC 2BIVA 3OQ5A 3WVEB 1I4K1 2DVEA 3G4SA 1NNTA 2RM4A 2I0CA 2YRVA 3HL8A 2RF1A 4IGRA 1HXDA 4MZMA 1M5FA 2Y7IA 4IO2A 3N5LA 1FWZA 2W7YA 1JJ2S 2MI6A 3HFNA 3RUXA 4XIGQ 4ZGDB 2F5XA 3OS5A 2XX9A 1Q7YC 4PNOA 4MF3A 3LUYA 4C92A 4ESXA 4F7UF 1KD1C 5ICQA 4C5GA 4QW2A 5DYHA 2Z23A 3ZS6A 4F7UB 3FXQA 3A8MB 5GMKh 3TTNA 1N3XA 3JB9F 1QUJA 2ESNA 1VQPT 1YHQT 2RJCA 4IURA 3RERA 2RI3A 4MMLA 4HCCA 3RY3A 2EFIA 3CCUT 3VV5A 4TVRA 2E1HA 3ZBDA 4R9FA 1BKAA 4HCBA 4V2SA 1Y07A 3I56A 1UB4A 3HP9A 4C0ZA 1LFHA 3R26A 5CI5A 4M7DC 1VQLA 2ZYOA 4EPCA 2VD3A 1YJ9A 3QIIA 2XD0A 2BUDA 3JB9J 1HSLA 2ZNSA 2LX9A 1K8AU 2ZPEB 1QVPA 3MZ1A 4OENA 1Y3NA 3MZBA 1X75C 3AHUA 4P0IA 4GVOA 1VQOT 2E6NA 2RINA 3CPWA 2RO0A 4M7DG 1FQFA 2M16A 5LJ5h 1J1NA 1RYOA 3CXCS 2M0OA 4PQJA 1QP2A 5J26A 4IO5A 3KZGA 5LJ5e 1B3EA 4RXLA 4M78E 2X4JA 2FL7A 5L8RE 3RNNA 3SWNA 5GANf 4M75D 5LJ3h 4EMHA 2QEXA 1VQMA 3FVNA 3PPOA 1N8RU 3QO3A 1B7UA 4ZDMA 1IIWA 2H5YA 3AXFA 1CE2A 3C36A 5LJ3e 4WF2A 3QIMA 4ZS9A 4H5FA 1NH7A 1SW5A 3OW2S 3F70A 3OY9A 3CRBA 3HHFA 4FAJA 1U1SA 1N6AA 2X4WA 5L9SA 3KSXA 4X1BA 4OESA 3VU3C 4JXIA 1Z7NE 3JCMP 1M1KU 5GAMh 5EG2A 4FORA 3BDUA 3VXBA 1WPYA 4FE8A 1MY3A 1N7XA 5B70A 1SQYA 1MXWA 4KUDK 3ILTB 4JRQA 2UVIA 4KQPA 3BKIB 3EAEA 2QMWA 1JVXA 1RKMA 5I59A 2EKOA 2A3LA 3JZJA 5LJ3g 1Q35A 5I58A 3G3KA 3GOXA 4ND9A 3HSBA 3H6ZA 1TFDA 4C92C 1ZJLA 1VUBA 3I5OA 2GFUA 4YTLA 3S3MA 4U2RA 2FYIA 5HK3A 1YJWT 3EHTA 4XAXB 4HCZA 3FDRA 4NEDA 4J8OA 5I21A 5A0DA 2KSSA 2G93A 2RHYA 1Q81U 5A5XA 3OYBA 4X1DA 4XTCQ 1OMPA 3H06B 4BACA 3IO6A 2KY9A 2XG8D 2F78A 4C92G 3FV1A 1N76A 2XXRA 2RB6A 2EJ9A 2UXAA 4NF6B 4GL8A 5GAMg 1DPPA 2WACA 4FIMA 3V83A 1VQ5A 1M5BA 5CMCA 2O7UA 4MDXA 3RMQA 4JSDA 4I62A 3CPFA 3PUYE 2GHBA 3GPLA 1R1NA 4GQOA 4GLIA 3K0VA 3CPWS 3GBAA 1YJNT 4U21A 4R6HA 4LVQA 3RN8A 2D3IA 1BIAA 3GP8A 2LDMA 3SD4A 1LAXA 3C33A 3L1AA 2F7AA 3SWNC 3SDFA 3FVOA 1FQAA 2KVQG 3JRZA 3FV2A 3QUJA 1WNLA 5DVIA 2YJPA 4PE5B 5I56A 4F22A 2OWTA 4FM4B 3SEYA 3G71T 1M4ZA 4R75A 4JRIA 3PNWC 4FL6A 3DELB 1TH7A 4PFTA 1AOVA 5CVIA 1D4NA 4IY5A 3SFMA 2RC7A 4QHQA 3DKMA 1A99A 2FNCA 1GXIE 3HO7A 2DXYA 1D3KA 1DTZA 3QSUA 3OOAA 4QFLA 3OYEA 3OBWA 3TREA 3IB2A 3KUFA 5JEIA 3PMXA 4M75A 5CAIA 5AE4A 1WDNA 4EXLA 5D6XA 3JB9D 2HQEA 2DTIA 4MZTA 1JETA 1N84A 3OENA 3WAFA 2DQVA 3UP9A 2DKGA 2V84A 4JDSA 3ME9A 1VIEA 3L2QA 3ASKA 3CMEA 3L2RA 1NPRA 3QYGB 3M3KA 1EIFA 4HTGA 4ONYA 4Q30B 3NTKA 1VQ6T 1JNFA 2PVUA 4G68B 2DIQA 1BIYA 2NOOA 1IQ7A 2DIGA 1Y1ZA 1FTMA 2Y7WA 2D5WA 4DE8A 2UYEA 3CI8A 1FQEA 4HW8A 4RG2A 2PYYA 1SI1A 4POWA 1XOCA 2RHXA 4U1ZA 2QQSA 4O6JA 1VQNA 3EFRA 1UGQB 5I2KB 2V8KA 2DXUA 2QXFA 5CM6A 2LQ8A 1IUDA 4PLIA 1T0KA 1K73U 4LP2B 1Q86U 1VQ7T 5GAOr 2Z22A 4M7AF 1JVYA 1OQGA 2I4BA 4KYEA 1FTLA 5L8DA 1BI1A 4M7AB 2F6GA 3RKYA 4QFKA 1A40A 2QL3A 3VXCA 3QAXA 1MS7A 1PB7A 4Z0IA