3MP6A

Complex structure of sgf29 and dimethylated h3k4
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
517
structure length
508
Chain Sequence
b'MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALAAAQTNAAAEFGSSYWTSEYNPNAPILVGSEVAYKPRGEWIQCEVLKVVADGTRFEVRDPEPDELGNSGKVYKCNRKELLLIPPGFPTKNYPPGTKVLARYPETTTFYPAIVIGTKRDGTCRLRFDGEKETEVTRRLVLPSPTALA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Maltose-binding periplasmic protein,LINKER,SAGA-associated f
publication title Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Histone binding protein
total genus 151
structure length 508
sequence length 517
ec nomenclature
pdb deposition date 2010-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
A PF07039 DUF1325 SGF29 tudor-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3mp6A05
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3mp6A01
4KQPA 3MEVA 4KR5A 5DVFA 4QFPA 4MFIA 3S6WA 5KCHA 4HW8A 4RA1A 4X48A 2EFIA 2KLFA 1VFEA 4PETA 3L42A 3M8UA 1ATGA 3UORA 2PYYA 3H03A 5JTYB 4G68B 1JEUA 3PMWA 1LFHA 3O97A 4OEUA 1B32A 3ZS6A 2F8DA 2M0OA 1P99A 5I2NB 2QMWA 1LGBC 2VGQA 5AE4A 4U4XA 3META 2XDPA 4IURA 4ELOA 3ECRA 3VFJA 5AA2B 3BFUA 4E7IA 5DVIA 2XXHA 2X4YA 4JSDA 2Z23A 2DXYA 2E1SA 2YRVA 3H4ZA 2PVUA 2UVJA 2V93A 4THIA 3TMGA 2QSXA 4KYEA 3L2WA 3C9HA 1XNIA 4LZ5A 1FTKA 2RHZA 3CFLA 2ANJA 2LTOA 4GWOA 1B3HA 1GTKA 1I6BA 2RF1A 3C33A 4ISUA 2AL4A 4ECFA 1OMPA 4OTEA 5KH6A 5FHNA 1FQAA 3QIMA 3E3KA 2XXXA 1VSOA 1RI0A 4E7HA 4YB6A 3OYIA 5DYHA 3CEYA 4E7KA 3TEPA 2RHYA 3FIRA 2ESNA 4WEPA 2G3RA 2I4BA 2REGA 3OQ5A 5KCOA 3L6GA 1URDA 2A5SA 3E9XA 1IEJA 4II1A 3L2UA 3ILTB 3OYNA 1QJMA 3FGSA 3FZVA 3IX1A 3OS1A 2QS4A 1LAXA 3IR1A 1B3GA 4QRZA 1D9YA 2I6EA 3FD3A 5I2NA 3R26A 2GH9A 4FU6A 1LCFA 1ELJA 3C31A 4IO2A 4GLIA 4IO4A 3PUYE 3EHUA 3PUZE 1IQ7A 2OWSA 5D6YA 3KJTA 4OMBA 3O8VA 3OYAA 4U1ZA 3QYTA 4P11A 1RKMA 3TPAA 3RPWA 3TCHA 4LQ5A 3OSQA 5L9MA 4B9WA 3UIFA 2QRYA 4POXA 5KE3A 3N94A 5TP9B 1AH5A 3PPNA 1A7LA 1Y3QA 4DXCA 2QS3A 1B05A 2K3YA 1BP5A 3RUMA 4POWA 4E7LA 2D3IA 3BBRA 4I1DA 5IAYA 1DSNA 2BIVA 1FQFA 2DWAA 2ZNTA 3MW0A 3V5AA 1B1HA 1N3XA 1M5CA 2Y7PA 2DE4A 5IAIA 1LAFE 4QHQA 4A4GA 1FTJA 2GF7A 5CBRA 2B3BA 2PQWA 1CE2A 1DTGA 2F7BA 3MC2A 4X9TA 4X1BA 3ZKKA 3NTKA 1N7WA 2H99A 4R6HA 4YMBA 4F1UA 4E0WA 1UIUA 3O9PA 4GRKA 4YKIA 3MEAA 4DIGA 3S9LC 4FE8A 3PNWC 2AYSA 1P1NA 4MF3A 2M1HA 1F9BA 3SKPA 1IITA 3O6GA 3FATA 1OZ3A 1Z7NE 3ZSFA 4F22A 2HXWA 3RTWB 5AA1A 4NF6A 3LSFB 5A5XB 1QULA 4FIMA 3TUSA 1NH7A 4PFYA 1SI0A 1B4ZA 4OENA 4LP2B 4GL8A 4F3BA 2XX9A 4G77A 1MQDA 1EH3A 4ELRA 3UT1A 4U4SA 2EKOA 3OYMA 1UTHB 1TFAA 1Y4TA 2F97A 4IUUA 4YMAA 2HAVA 5H8HB 4KYDA 5CMCA 1N84A 2H5YA 1ZJLA 4OESA 1S9TA 5KDTB 4AB6A 3ASKA 4LA9A 2XD2A 1URSA 3KG2A 4Q30B 3ZKLA 3MWBA 4BD3A 1OLCA 3PMXA 5B70A 2ONKE 4IO3A 1SVXB 4H1XA 4X34A 4P0IA 2OZZA 4EDPA 3N6UA 5J39A 2UVGA 5AA4A 3C35A 3U92A 4BE1A 4F2QA 5J26A 1AOVA 2X4WA 3OEKA 5LOMA 1H76A 3USDA 1A99A 5ELVA 4IGRA 3KN8A 4R2FA 3FUZA 4GIZA 4OFOA 4H6DA 3EN3A 3OSRA 5HPQA 2DS9A 3O6HA 3BDLA 1QVSA 1QUKA 3K1PA 1N7XA 1H3ZA 1XVXA 2V25A 4MBPA 2F7AA 2DSFA 3H6WA 4Z02A 3OS2A 1POY1 3F11A 4GXAA 3MVZA 4OVAA 4KCCA 1JW1A 1HSEA 3ZEHA 2IG0A 1XC1A 3W9WA 3B6WA 1N3WA 3OENA 4R73A 4BDRA 1II5A 1DMBA 5CM6A 2DYXA 4YKKA 4G8MA 3LYIA 3TFLA 1NKXA 4YAHX 2THIA 4OEVA 3SESA 3KOSA 3PMTA 5DTBA 4LVQA 3HCQA 1LBCA 1MM6A 2RJCA 4EF1A 1URGA 4H65A 4H0WA 4QFNA 3KSXA 2UVHA 4KCDA 2E0SA 2CMOA 1P1WA 3U1OA 2F5KA 3T9UA 1D4NA 1PBQA 1N0TA 2QS1A 1MY1A 4EXKA 4DCXA 1SW5A 3KZGA 1FQBA 1MY4A 4E7JA 1NNKA 3UP9A 2LRQA 4R9GA 5FROA 2H98A 4U1OA 3HPIA 4OXVA 3T9VA 3OY9A 2XXUA 4R75A 4IUQA 4NF4A 2UVIA 3LH0A 3E9GA 2XK0A 3D4CA 4R74A 4I8CA 3HN0A 2FHDA 4QSDA 5CMBA 4ONYA 4XTCQ 3H6UA 1XVYA 3HHGA 4F18A 1I6QA 3LSXA 1JVXA 1BKAA 3G3JA 2DWHA 4YKJA 4ZEIA 3B7DA 4YU0A 2DP8A 1S50A 3QUJA 4QW2A 2IA4A 2LCCA 3FJGA 3UN6A 5KZTA 1UTBA 5CC2A 3ME9A 3OO9A 2PT2A 4N4IA 5L9SA 4N13A 3HHFA 3PU5A 3OYKA 3TODA 1SQYA 2JTFA 2B8AA 4I62A 3QBYA 3CVGA 3TQWA 4QF9A 2RHXA 2DOJA 5CRYA 2WKYA 2L89A 5AA2D 4PL6A 4O3BA 4ZS9A 3TELA 4HCWA 5M9OA 3OYHA 1YPNA 1QW0A 1MQHA 4YZZA 2ZYMA 2ZXTA 2FYIA 1P1UA 3OS0A 2ONRA 3RNNA 1B3FA 3K6VA 3JZJA 3CSBA 4KD5A 1MXVA 1GVCA 5IN1A 5DEXA 2Q89A 4IB2A 3G3GA 4GD5A 3DM0A 1JEVA 2O69A 4N07A 1MHNA 3MP6A 2OLBA 1QKAA 2UYEA 2R71A 3MEUA 4ZE9A 2RJDA 3EAEA 1VE4A 3OO8A 3U94A 3Q27A 2I4CA 4QFOA 3I3VA 2V3TA 1A54A 3IB1A 1XOCA 1SD3A 3TTLA 1JNFA 4CRIA 3QJ6A 1B0HA 1USYH 3K1NA 1CB6A 4RYAA 1MXYA 4WKMA 3BFTA 1LAHE 2B65A 3TTKA 4BACA 3IJXB 1SSFA 1LBBA 3LSLA 1MY0A 3GLBA 3FVOA 3VDFA 3T9XB 3OYLA 2GRVA 3O28A 1MM7A 3P7IA 4R9FA 4FORA 4DZ1A 3L6HA 2FA7A 4GL0A 3MVXA 1MS7A 3CG3A 5D6WA 3EF7A 4IUVA 4MH5A 4E0XA 1MXUA 2HQ0A 4IUPA 2X7QA 1NL5A 1OVBA 4GXSB 2Z8FA 4JBZA 4OQOA 1ZBMA 4DLDA 3KFMA 2ABHA 4N4GA 3THIA 3UA8A 2F6GA 2AL5A 1OQHA 4F3SA 4EF2A 2XD3A 4OFLA 1MRPA 4IO5A 2O51A 4DCYA 2V3UA 4BDNA 3IK6B 3RQTA 3OB9A 4C0RA 2XXWA 3PPOA 3CI8A 3T66A 2CZLA 5I57A 1M5DA 1B58A 4KFQA 2D9TA 1B3EA 2QQSA 2V3QA 3TTNA 5HM4B 3K6UA 3IOTA 3O2AA 2NUVA 5B7DA 2RI5A 1TT1A 5BWJA 2LDMA 3FXUA 4NF6B 1TFDA 2LAOA 3LGFA 3H7MA 4DDDA 1RYOA 1YCJA 2XXTA 3QAXA 4H67A 4TLMB 1EZ9A 5FHMA 3DB4A 1MQIA 3K4UA 3Q29A 3GOXA 2ALUA 2F36A 4LD6A 5I56A 4ZTFA 4A4HA 1WJQA 3HSTA 3OMBA 3T9HB 1US4A 2BKDN 1HSJA 5ISUA 1QKBA 2HEUA 4U2RA 2QMXA 4C5EA 2E5QA 3KBRA 2G93A 3KN3A 4Z0IA 3FXQA 5C6SA 4H8IA 3K2DA 1B6HA 5FRNA 5TPAB 1MY2A 2O7IA 4JWXA 2RI3A 4ESWA 1J1NA 5AA4B 4OETA 2Y7RA 5I2KA 1GGGA 5HBCA 4F3GA 4RJZA 4G8HA 5F7VA 1MQJA 3KJ7A 2QPQA 5KE2A 3OYBA 1P1OA 4BDZA 1G5VA 4NWDA 3RTFB 1MXZA 5ICTA 4ZDMA 2HQEA 3OYGA 2RO0A 4NF5B 4XXUA 3VVDA 3DELB 3U72A 3IB2A 3PMVA 5L9OA 1B7ZA 3TQLA 2RJEA 3IL1B 1ZU0A 4GF8A 2R58A 4H5GA 5H8NB 1R9LA 1US5A 3H8ZA 4KPTA 4LUBA 3TTRA 2L8DA 1BLFA 3FLGA 2UXAA 1MH3A 1B7UA 1B2HA 1SDXA 3DP4A 3FJ7A 4RNSA 2DIQA 1LB8A 2DE3A 4ESXA 2EQJA 1FCKA 4HCYA 5I58A 2RCAA 5I59A 5H8QA 3C32A 1MPBA 4QSEA 4IY5A 3OELA 3SERA 2I0BA 3M3LA 3VE1B 5FTHA 4Q5WA 5TPAA 1AL3A 3MVYA 1LFIA 3H6VA 4LZ7A 2NWJA 3QK6A 3RN8A 2O7UA 4C5HA 3SEXA 3O29A 3BKIB 5CIUA 3I5OA 4A4EA 1DPPA 1PB9A 1O64A 3LR1A 3PGFA 4GVOA 4C1UA 4TQUQ 3OD7A 4YB7A 3LGLA 1B51A 2L3RA 3TAJA 4KYSA 3VVFA 4RPOA 4I9DA 3IORA 3KEIA 1PDAA 4NF5A 3V83A 3S4UA 1A8EA 3RLFE 3MAMA 1PC3A 1OVTA 3HO7A 4NF4B 3QUFA 2Y7IA 3P8HA 1FW0A 4IKFA 2UYFA 1UQWA 3JYRA 2GHBA 1FQEA 4HTGA 5ITOA 5H8NA 1WJRA 3MZ9A 2P0KA 4FAJA 3PV0E 4NE4A 2F5XA 2I48A 4RPNA 2HZLA 1GR2A 4YB5A 3MZ1A 2Q2CA 4G4PA 2XXVA 1UTBB 3G3KA 3PPQA 1PBPA 1IIWA 3DB3A 1OIBA 2RINA 1EZOA 4L17A 4G8NA 4IUTA 3C34A 2X35A 3G3IA 3M9QA 3FJMA 3SETA 3CRBA 2X7PA 2B3FA 1EZPA 3OOAA 5CBSA 1FTOA 4RY1A 1B5IA 2DVZA 3V8XB 1R9QA 3VLUA 2F35A 4ZZEA 4OHNA 4LQ2A 1NMUA 4XKNA 2G29A 5DEXB 2WACA 2R5MA 3G3FA 1PB8A 3IOVA 4X1DA 1LCTA 4H5FA 3PUXE 3KN7A 1VFDA 1SYIA 2DAQA 4BDLA 1DPEA 4DXUA 4RXLA 5EHMA 2IEEA 4F39A 3CFZA 2XXPA 4OFJA 4ELQA 2A5TA 2H9BA 4ZECA 2EQUA 1LFGA 1DOTA 3D4GA 4F1YA 2QL3A 2HZKA 4O3CA 1Y3NA 3K02A 3VLVA 2I3WA 3S9MC 2H25A 3FEOA 1Y1ZA 1NH8A 1SYHA 1B7HA 3JV9A 2RC7A 1IUDA 3H6ZA 4NEDA 4BDOA 1XT8A 1MY3A 2XXYA 1WVJA 1L5TA 1ZMGA 5CI5A 5JEIA 3N6TA 3TCFA 3MBPA 3PUVE 3OMCA 3IOWA 3CSGA 4JWOA 2K3XA 2X26A 3DP6A 1B5HA 1R1NA 3VXCA 3C4SA 2ZNUA 2QQRA 4EUOA 4K3FA 4MLVA 4NTLA 3K00A 3G3HA 3PPPA 4YICA 3VXBA 4JWYA 1BTJA 2VD3A 3EPEA 3VVEA 4EQBA 3NTHA 3E13X 3K01A 3AXFA 4ZEDA 3GBAA 2RHIA 1BIYA 1JVYA 1H45A 3E9FA 4BE2A 3CIJA 1N76A 4QQ6A 2R9JA 3IAZA 4Z7EA 1HSLA 1NNFA 3FXRA 3CR9A 1SW4A 1B9JA 3U8QA 3KUFA 1UIVA 2DWJA 4IO7A 3WAEA 1MDP1 3W15C 2O68A 5ICQA 5DT6A 3OYJA 1MXXA 3K6WA 1ZLQA 4PFWA 3SDFA 4R6YA 4PFTA 4PLIA 2DXRA 3DLNA 2O4XA 5I57B 3QKJA 2XX7A 2I49A 1SW1A 1I69A 4PE5B 3TZAA 3TDJA 2DE2A 4NMYA 2RJFA 3OYDA 2RC9A 5F1QA 1SI1A 2F7CA 1ANFA 2DIGA 2FNCA 3MJNA 1B1XA 2OCUA 4KHZE 1SW2A 3FASA 4BE0A 1WODA 1PEBA 2XXRA 5KCJA 1JW4A 4GFRA 5DVJA 4EQ9A 2HCAA 1IZ1A 4QSCA 5I56B 3S3MA 3O66A 4UACA 2XX8A 3OA6A 3R7XA 4F31B 1OI1A 1N27A 4QFLA 4QVZA 5K2YA 1FQCA 3NTIA 2R57A 3MP8A 3KGCA 3VV5A 1ZTYA 4HCZA 3K1MA 4U23A 4PLLA 1TXFA 4NF8A 3LX7A 1H43A 4WXJA 4OZ9A 2ONSA 4FATA 4U21A 2P0SA 3FVKA 3OXNA 3PFSA 5CMKA 5C0MA 3LSWA 2DWIA 2DQVA 4FECA 5I2KB 1B0LA 1O63A 2EQMA 3VLWA 3MPLA 1A40A 4M1VA 1Y9UA 2Q88A 4ZEKA 5JTYA 3B6QA 4G68A 2OK2A 2PT1A 4ZEBA 3S3OA 4AQ4A 4YKPA 2BUDA 3OYFA 5M2VA 1Q35A 3IB0A 3RGYA 4ELPA 1TWYA 2O6AA 3W9VA 4BLAA 3QSLA 2REJA 3LUYA 3S9EA 3MZBA 5BUUA 3K0VA 5AA2A 1NNPA 4RK2A 2MWOA 4ZTJA 1OZ2A 3Q25A 2RC8A 1B40A 1MDQA 4XKPA 1OLAA 4FJPA 3FDRA 5D6XA 4IO6A 3OYCA 3A09A 1A8FA 3PUWE 4F29A 2Y7KA 3Q1JA 5I58B 4PP0A 1Y1MA 4ND9A 1ZIUA 5I59B 5H8QB 5TU0A 3R6UA 1I6AA 3MO8A 4G2ZA 5AA3A 1IXHA 3CFXA 3H6TA 5ITPA 1YTVA 3GBBA 1RYXA 4GOTA 1OQGA 3EHTA 3S9NC 1Q1KA 3SD4A 2P2AA 1LSTA 2JZ2A 4Q8RA 4DXBA 4FL6A 3PMIA 4N6PA 3A3CA 2NLUA 2QJEA 3MPKA 1LAGE 3MQ9A 3U93A 4TOZA 4Q0CA 4G68C 4GY5A 2EQKA 3M3KA 3GZGA 4EDUA 1B4HA 1H44A 4R2BA 5H8FB 1NFTA 2ZMBA 3PPRA 2F78A 5FRMA 3IO4A 1USYE 1B3LA 1JETA 4JDFA 1Y4CA 3OO7A 4EXLA 3SEVA 4XKQA 2I0CA 3Q26A 4IY6A 1IXIA 4PQJA 3TKDA 4LONB 2Q8JA 4QQGA 3L2RA 2OBGA 1ZKBA 3Q28A 4F2OA 3DLMA 2D21A 5TP9A 1T0KA 3T22A 2XHDA 3RT8A 4B9XA 5FHOA 3KOTA 5EYFA 2E6NA 4F1VA 3MEWA 2NOOA 2GFAA 2Y84A 3S3NA 1M5FA 2ZNSA 3HV1A 2R5AA 1B46A 4L59A 3P8DA 3L2VA 1M5EA 4OERA 2Z8EA 1IXGA 4DE8A 2XXIA 1FTMA 3S2VA 3N5LA 4PFUA 3WAFA 2AIXA 2YJPA 3T93B 2D5WA 5FTIA 1YAEA 5JK4A 1PB7A 4RG2A 4TLLB 1LLSA 4OYVA 2H4IA 2RI2A 3PD9A 1MPDA 3FVGA 3DP8A 1MXWA 4JXIA 3E4RA 3K6XA 1MQGA 2GHAA 1XS5A 3PD8A 3LBSA 1WGSA 1GV8A 3GXAA 1WDNA 1D9VA 2I3VA 2W7YA 5H8FA 5H8SA 4BDMA 3L2QA 3H3GA 4Q5TA 4LATA 3EQ1A 2DVCA 4C5IA 3G7WA 4FEBA 3B6TA 1P1QA 4AB5A 3N26A 3T96B 4OVJA 1A55A 2RHUA 4NS5A 2YPNA 2A5TB 2M8CA 2YLNA 4NWCA 1QUIA 3UGWA 1D3KA 5L8DA 3ILUB 5A5XA 2Z8DA 1KHCA 2P1SA 3LLRA 4F19A 4QFKA 4ZEFA 2HFBA 3FV2A 2VYTA 1SBPA 2BJJX 4R72A 2OJTA 3KSJA 2Y7WA 2M16A 4BDQA 2VHAA 4OWDA 4IGTA 4JSOA 3IO6A 2RKMA 1AMFA 1MPCA 5I84A 1UTHA 2VD2A 1JW5A 5EHSA 5J1DA 5IKBA 1MH4A 2V84A 5CMMA 4P0GA 3QXMA 1FTLA 5H8HA 2I58A 2ZYKA 3C36A 5KDTA 4UA8A 2PX1A 1QUJA 2VP1A 2VOZA 3RT6B 4BDYA 2Z22A 2O84X 3SEUA 1POTA 2X4XA 1S7YA 4LZ8A 2PBWA 2OWTA 1R6ZA 1MG1A 1IXCA 2Q9TA 4XKRA 3FC3A 2GFEA 4XIGQ 3OMGA 1OYXA 3FVNA 2GFUA 2NXOA 3F70A 3RY3A 3ODBA 2NVUB 4U22A 3ONMA 1VR5A 4C5GA 2ZYOA 2CKKA 1LB9A 4EQ7A 2QS2A 3LC8A 1Y3PA 1AIVA 3TYHA 2F6PA 1O7TA 1Z7ME 2LVMA 1WJSA 4GQOA 4UC4A 3UWNA 3OO6A 2O4XB 1KWHA 4KI0E 2XXQA 4N4HA 3QIIA 1DTZA 4WEDA 3SEWA 4F3PA 1H3DA 1EU8A 4H8JA 1Y20A 1M5BA 3OEMA 2HQXA 2MWPA 1N04A 1FQDA 4M4GA 1B5JA 2F34A 3OYEA 3SEYA 2R6GE 2O1MA 5KCJB 5K2XA 1XHYA 3FV1A 4JB7A 4O3AA 3V89B 3CG1A 4R6KA 2O1LA 4RK9A 3A3UA 2HAUA 2RCBA 3M3FA 1NNTA 3TTMA 2Q2AA 4FEDA 2PMSA 3EHSA 2ZYNA 3C4MA 3MVWA 3UK4A 4A4FA 3IOUA 3O6IA 4MLQA 4C1TA 3MP1A 3I6VA 4NF8B 4ZE8A 4ZZAA 3IJOB 4HS7A 4QQDA 3TCGA 1JQFA 3H06B 3MUQA 1B52A
chains in the Genus database with same CATH superfamily
1Q86U 2HZYA 3M56A 4KQPA 2F2XA 1WDXA 3MEVA 3M58A 4KR5A 5DVFA 4QFPA 4MFIA 2L2PA 1IHWA 3S6WA 1KZ8A 2FYKA 5KCHA 3JB9F 4HW8A 3QWYA 1IXDA 1OU8A 4RA1A 1E6HA 7AT1B 4X48A 2EFIA 2COZA 1VFEA 2KLFA 5GAN2 3EFOA 4PETA 3L42A 2OTJT 3M8UA 1TUCA 1ATGA 3UORA 4IIOA 1M1GA 4DI4B 4M77A 4JRKA 2PYYA 3H03A 1YJ9Q 5JTYB 5KYXA 4G68B 4KBMB 1JEUA 3PMWA 1LFHA 4GBQA 3O97A 4LUEA 4OEUA 4M78A 1IO6A 1JRIA 1FBDA 1B32A 3ZS6A 1VQ5Q 2F8DA 2M0OA 1P99A 5I2NB 1X6GA 3WVEB 2QMWA 1LGBC 2VGQA 5AE4A 4U4XA 3CXCP 1CKAA 3A98A 2XWIA 3SB2A 2QVRA 3META 2XDPA 2VB6A 1LNXA 2KYBA 3V7SA 4MZTA 3J81E 4IURA 4ELOA 3ECRA 4PJNA 3VFJA 5AA2B 1FMWA 3BFUA 4E7IA 5DVIA 2XXHA 1KQ2A 1Q86R 2LC4A 1GCQC 1I0CA 1ZSGA 1KQSS 2X4YA 2GQ1A 3QMFA 1D9QA 2Z23A 4JSDA 1AZGB 2YLBA 1VQMQ 4HVUA 4XTVA 5GAN7 1LBVA 2DXYA 2ZPEB 2E1SA 2YRVA 2FBPA 3H4ZA 4JZ3A 2PVUA 2KQWA 2UVJA 2V93A 4THIA 3TMGA 3VRYA 2DL8A 2J6KA 2FG0A 2QSXA 4KYEA 1OV3A 2OTLA 1U1TA 3L2WA 3C9HA 1XNIA 1GBQA 4LZ5A 1FTKA 2RHZA 2F1LA 3CFLA 2ANJA 2MK5A 2NWMA 3HRSA 2LTOA 5A0GA 4GWOA 4X1VA 1B3HA 1GTKA 4LDVA 1I6BA 1PRLC 4YTLA 2RF1A 4D8DA 3C33A 4ISUA 1T3SA 1KD1C 2AL4A 4HT8A 2YWWA 2O31A 5J3BA 1VQ9T 4ECFA 1OMPA 1YXIA 3HRUA 2FVZA 2VXEA 4OTEA 5KH6A 5FHNA 1ZBJA 1FQAA 3QIMA 3E3KA 2XXXA 2K9GA 3NMZC 1FPEA 1EZZB 4PJOA 5CQXA 2QDLA 1VSOA 1NBEB 1LVKA 1RI0A 4NL3A 4E7HA 1NPPA 4JS5A 1DCUA 4YB6A 1M27C 3OYIA 1TU0B 4GWWA 1MUZA 2OTJA 5DYHA 3CEYA 3R6NA 4E7KA 3TEPA 2RHYA 1J3TA 1I5OB 2RQVA 3FIRA 1RDXA 2ESNA 4WEPA 4FSXA 2G3RA 4WCIA 2I4BA 3VS6A 2REGA 3M0TA 5LJ3g 2QI2A 3OQ5A 5KCOA 3L6GA 1URDA 2A5SA 2CDTA 5FU7B 3E9XA 1IEJA 2OX7A 2F3DA 4II1A 2FEIA 3L2UA 4M78C 1EX4A 3ILTB 1IZ6A 5GJVB 2KAFA 2NUPB 1XQHA 4D6WA 3OYNA 1QJMA 3FGSA 3FZVA 2HEQA 2BJIA 3IX1A 3OS1A 2QS4A 4FYXB 1LAXA 1BK2A 3IR1A 1B3GA 4QRZA 1UJ0A 1D9YA 2I6EA 1FBHA 3FD3A 5I2NA 4ZGDB 3R26A 2GH9A 4FU6A 1EYKA 4X9DA 5GAOl 1K0SA 1ELJA 1LCFA 1ARKA 2SRCA 3C31A 4IO2A 4GLIA 4IO4A 3PUYE 3HFNA 3TQ7P 3EHUA 3CD6Q 3PUZE 4N15A 4RTVA 1IQ7A 1R0CB 2OWSA 5D6YA 2CT3A 4F7UE 3KJTA 2LMJA 4OMBA 3O8VA 3OYAA 4PJJA 4U1ZA 3QYTA 4P11A 3BE3A 3H9NA 2ZZXA 1RKMA 3TPAA 3CCQQ 3RPWA 3G71T 2RK2A 1ZHIA 3TCHA 3G6ET 1VQLQ 3OSQA 4LQ5A 1W4SA 2CZHA 4MEVA 5L9MA 4XTWA 4OVQA 4B9WA 4J9CA 4XTYA 3UIFA 2QRYA 4POXA 5KE3A 3N94A 1XI6A 3CPFA 5TP9B 1AH5A 3PPNA 2CT4A 1A7LA 1Y3QA 4DXCA 1VQ9A 4N8GA 1K9MC 3C95A 3ER0A 2QS3A 4N8YA 5CCAA 2EVRA 2P0QA 4HE2A 2P4TA 2FPEA 4E47A 1B05A 4NG7A 2K3YA 1NV0A 1IMBA 1DBZA 1I8FA 3FXBA 1BP5A 2E6ZA 4C0GA 5ET5A 1GFCA 4DBHA 3RUMA 4N4UA 2LT1A 3M0QA 4POWA 3OW2P 2M02A 4E7LA 2HQHA 2YUNA 2D3IA 3FJ5A 3BBRA 4I1DA 1D1BA 2K2MA 3VUZA 5IAYA 1DSNA 2CZIA 2BIVA 1FQFA 2DWAA 2EJ9A 1VA7A 4DEXA 4JVDA 3SHWA 3VV0A 2ZNTA 3MW0A 3V5AA 5GAMd 1B1HA 1N3XA 1IHVA 4LNPA 1M5CA 1KQSA 2DE4A 2Y7PA 5IAIA 2DMOA 1LAFE 4QHQA 1SHGA 1B52A 4A4GA 1FTJA 3QZ9B 5GMKm 2GF7A 5EYHA 5CBRA 4OMMA 2B3BA 4AFQC 4OB0B 2PQWA 1Y7XA 3JCMd 2QASA 1CE2A 1DTGA 3INZA 2DBMA 2DYBA 2F7BA 3MC2A 4X9TA 4X1BA 3ZKKA 3NTKA 1FBFA 1N7WA 2CP3A 1UGRB 2CZ7B 2H99A 4R6HA 3OBWA 1YJNT 4YMBA 5LJ3e 1QWEA 2AK5A 1HXDA 1JXMA 2WX9A 4GBWA 4F1UA 1ZA1B 4HE0A 4E0WA 1UIUA 3O9PA 5GAN4 1WIEA 4GRKA 4YKIA 3H41A 1FBCA 2YSQA 2DL5A 3MEAA 4DIGA 3S9LC 4FE8A 4KH1B 2CZKA 3PNWC 2AYSA 1UHCA 1FPLA 5KYYA 2O9SA 1P1NA 2MIOA 4HCCA 2M1HA 4MF3A 1F9BA 3SKPA 4IIMA 1IITA 3O6GA 4XTXA 4GX4A 2XG8D 3FATA 3G71A 1OZ3A 1Z7NE 3ZSFA 1R0BG 3G6EA 4F22A 2HXWA 2A36A 2I2LA 4AFSC 1VQKT 3CC7T 3ONMA 3H0IA 4OVTA 1OQKA 4FM4B 3RTWB 1UGPB 3LV0A 1ACMB 2CP2A 2VWFA 4M77G 4PF8A 5AA1A 4NF6A 3LSFB 5A5XB 1TUGB 3EHRA 1QULA 2CSQA 4FIMA 4N17A 3BIGA 3TUSA 1NH7A 1DJ7B 4A63B 2KQZA 4MDXA 4PFYA 1D1CA 3PTAA 1SI0A 4RUGA 1B4ZA 4OENA 1AWBA 1RADB 2VGNA 4GL8A 4LP2B 4F3BA 2HL5C 2XX9A 5EQ7A 3JCMP 4G77A 3V7RA 1MQDA 2V4CA 4Z88A 1EH3A 3FBPA 4GX3A 4LD9K 2KGTA 4ELRA 1WHGA 3UT1A 2JS0A 4U4SA 2EKOA 3OYMA 1UTHB 4XEQA 2K79A 1M2OA 1UGSB 1TFAA 4P9KA 1Y4TA 2F97A 3D7SB 1R77A 4IUUA 4YMAA 4RKUE 2HAVA 4M75B 5LTCA 2K57A 3KBZA 5H8HB 4KYDA 5CMCA 1N84A 2YLCA 2H5YA 1ZJLA 1MMGA 4P47A 1QWFA 4J6WA 4OESA 2KSSA 1S9TA 5KDTB 4M7AD 4AB6A 3KC1A 3ASKA 1AT1B 2CEXA 3CC7Q 2K5LA 2XD2A 4LA9A 1URSA 3KG2A 4Q30B 3ZKLA 3MWBA 2D8JA 1NV3A 1O9SA 4BD3A 3VS0A 1OLCA 3PMXA 5B70A 1M3AA 5CKBA 1YJNA 2ONKE 1U1SA 4IO3A 1SVXB 2DZ9A 3EHQA 4H1XA 2HHMA 1TOVA 2QG9B 4X34A 5CKEA 2GNCA 1E7OA 4P0IA 4AT1B 3QDRB 2OZZA 3BIHA 4MIJA 5GAN5 1LBXA 4OB1B 4EDPA 3N6UA 5J39A 1V1CA 4PJOG 2YHTA 2QA4Q 2XWOA 2FRYA 2EAYA 2PFZA 2UVGA 4DOVA 5AA4A 3C35A 3OSVA 3U92A 4BE1A 1K9MR 2X9HA 4F2QA 1VQKA 1G0HA 1X27A 5J26A 1ZSZB 2X4WA 1AOVA 2LZ6B 3CCEQ 2QQ9A 3OEKA 5ET8A 5LOMA 2FPFA 2FIXA 3FIFA 1O75A 1KK7A 2C06A 1H76A 4M7DE 3USDA 2VGMA 4NGUA 3LWHA 1A99A 5GAN6 5A5LA 3RIRA 5ELVA 2EYZA 4HKEA 4IGRA 1XJWB 5KYWA 1QCNA 4O8MA 3KN8A 3CXCA 4R2FA 2JXBA 3FUZA 1KC8U 3KC0A 4GIZA 1G3YA 1KFZA 1SRMA 2KRNA 4H6DA 3EN3A 4OFOA 3UA7A 2ZAEA 3VS7A 3OSRA 4DI3D 5HPQA 2CYZB 2Z0WA 1YNZA 2DS9A 3O6HA 1Q82U 4PBQA 3BDLA 1QVSA 1QUKA 4GLKA 3BDUA 3H0HA 1M1KR 3K1PA 4C92D 1N7XA 3DLLA 1FTAA 1H3ZA 3TCJA 4ORZA 1XVXA 4RTYA 2V25A 4N91A 4MBPA 1JJ2S 2F7AA 2DSFA 1Q9DA 1NUYA 3H6WA 4Z02A 4FCYA 3OS2A 1POY1 3F11A 1D0XA 3E19A 4GXAA 3MVZA 4OVAA 4KCCA 5EC7A 1JW1A 1HSEA 4FBPA 3ZEHA 3EGUA 3CPWP 1I81A 2IG0A 1XC1A 3W9WA 5I5PA 1OPLA 4NHBA 1AVZC 3RYDA 3B6WA 1N3WA 3OENA 2K5FA 4R73A 4BDRA 1G83A 1II5A 1M9SA 4GWUA 1DMBA 5CM6A 1NPRA 3EG0A 2DYXA 1D09B 4YKKA 4G8MA 1WYXA 4BUGA 1X2QA 4Y92A 3LYIA 3TFLA 1RI9A 5GMKl 1FPJA 1NKXA 4DE8A 4J6YA 4PFZA 4CC2A 1Q82R 4YAHX 2THIA 1UGVA 4OEVA 3SESA 3KOSA 4MJOA 3PMTA 2JNGA 5DTBA 3E2UA 5DLQE 4LVQA 2CUBA 3HCQA 1LBCA 1MM6A 4C0DB 4F04B 1G3SA 5IHNA 1N8RC 2RJCA 4EF1A 1URGA 4K11A 1M5Q1 2KVQG 4J9HA 2B4MA 4H65A 4H0WA 4QFNA 3KSXA 2UVHA 4KCDA 2E0SA 2CMOA 1C0MA 4OMOA 1P1WA 3U1OA 2BZ8A 2F5KA 3T9UA 1D4NA 1PBQA 2DJZA 2CZ0B 3HL8A 1AWOA 1N0TA 2QS1A 1MY1A 4EXKA 1M90C 2EKHA 2GCXA 4DCXA 1SW5A 3KZGA 3EG9B 4MMLA 1FQBA 1MY4A 4E7JA 1NNKA 3UP9A 2CGHA 5GANg 2ZPFB 4HCKA 4RTXA 2LRQA 3GPLA 1ABQA 4R9GA 5GAMh 1Q81R 1ZA2B 2L0AA 2CREA 2HPGA 2DNUA 3QUIA 5FROA 2JMCA 2H98A 3EH1A 3EH2A 4U1OA 4GWXA 3HPIA 4OXVA 3T9VA 2IIMA 4CI0C 4C0FA 3OY9A 3OBYA 1W2BP 3JSCA 2XXUA 4R75A 1X69A 2YUQA 4IUQA 2JW4A 4NF4A 2UVIA 3JCMh 2KR0A 3LH0A 3QSUA 3E9GA 1SHFA 2K4YA 4QVDA 1GCPA 5EQAA 2XK0A 3EFOB 2DXCA 3D4CA 2PUKB 4I8CA 4R74A 3HN0A 2FHDA 4QSDA 1SSHA 5LJ5d 2QXFA 2JN0A 4M77B 5CMBA 4Y91A 1Q7YR 2ABLA 1VDWA 4ONYA 5KYXB 3H6UA 4XTCQ 3E79A 1XVYA 3HHGA 2NYSA 2DXBA 4NOYA 5ESYA 3M53A 4F18A 1I6QA 3LSXA 1MNDA 4M78B 1RAHB 1JVXA 5IM2A 1BKAA 4N81A 3G3JA 2DWHA 4YKJA 4ZEIA 3B7DA 4YU0A 1LCKA 1BB9A 2DP8A 4M7AA 5CK9A 3RKXA 1S50A 3QUJA 4KUIA 2JS2A 4QW2A 1HK9A 2IA4A 2OX3A 2LCCA 3FJGA 3UN6A 2OI3A 5KZTA 3OW2A 2RK1A 1UTBA 5CC2A 2CH4A 1LJOA 3ME9A 3OS5A 4KT0E 4N4IA 1K8AU 1KA1A 2PT2A 3HHFA 3OO9A 3M59A 4N13A 5L9SA 3PU5A 3OYKA 4VUBA 3TODA 1SQYA 2JTFA 1YI2T 2B8AA 4PAIA 2DVJA 1U06A 4E7SA 4C8QA 4I62A 3QBYA 3CVGA 3RKWA 4OP0A 1K9YA 3TQWA 3GYYA 2XDBA 2RHXA 2DOJA 1TTHB 4QF9A 1NZ9A 1FJ9A 5CRYA 2WKYA 2M9UA 4NF0A 2L89A 2DK3A 5AA2D 4M75E 4PL6A 3M4YA 4O3BA 3O5ZA 1K73C 1K0XA 1ZSZC 4JJBA 4ZS9A 3DKMA 3TELA 4HCWA 4L5GA 5M9OA 3OYHA 1YPNA 3CCLT 1QW0A 3TSZA 1RUWA 1MQHA 3M0SA 4YZZA 2ZYMA 2ZXTA 1WX6A 4MNPA 4RTZA 5CAIA 2MPXC 2FYIA 1P1UA 3OS0A 2ONRA 3RNNA 1B3FA 3K6VA 2OJ2A 4M77F 4OMNA 3JZJA 3CSBA 4PFPA 4KD5A 1X75C 2FZKB 4EMHA 4PJOB 2DILA 5IN1A 1MXVA 5DEXA 2Q89A 4IB2A 1GVCA 2CZ1B 3G3GA 4GD5A 2XKOC 2DF6A 2E12A 3DM0A 5GANe 1JEVA 2O69A 1V76A 4N07A 1X2KA 4DBQA 1MHNA 3MP6A 2OLBA 1QKAA 1TSFA 4C92A 2R71A 3MEUA 2UYEA 4ZE9A 2RJDA 3GLXA 3EAEA 1VE4A 4ZGEB 3QPHA 3OO8A 3U94A 3PTYA 3Q27A 2I4CA 4QFOA 4WTOB 2VC8A 3JV3A 1NV5A 3I3VA 2BE7D 2V3TA 2XA5A 1A54A 3PT9A 3IB1A 2O2OA 4EMGA 1XOCA 4XTZA 3T9NA 4LDWA 1SD3A 3TTLA 4XAXB 1JNFA 1K9AA 4CRIA 3QJ6A 2OTLQ 1B0HA 1USYH 3K1NA 1GXIE 1CB6A 4M7DD 1MMAA 4RYAA 2XWKA 5AYFA 2H8HA 2CP7A 1MXYA 4WKMA 3BFTA 1YI2A 3EG2A 3JCMJ 1LAHE 1NJIC 2WYKA 2F69A 2B65A 2MYSA 3TTKA 2G6FX 3M0UA 4BACA 3IJXB 2PVDB 1SSFA 1LBBA 2A28A 1QVGP 5GMKh 3M0RA 3LSLA 1MY0A 5A2QE 4C0DC 4GWSA 1M4ZA 3GLBA 5IHKA 2GQVA 3FVOA 1ZQ1A 1WFWA 3VYHB 5CKFA 3VDFA 1VQ7T 4PJOF 1C6VX 2EW3A 3T9XB 3OYLA 2LNVA 4B6MA 2GRVA 3CCLA 2OTJQ 3O28A 1MM7A 2MKZA 2QEXT 2WBBA 4NAPA 3P7IA 2JT4A 4R9FA 2FZGB 1OU9A 2FPDA 4KULA 2LJ3A 4FORA 5GMKj 4DZ1A 5LJ3d 2ED0A 3TEEA 3L6HA 2HSEB 1RDZA 2DERA 2FA7A 4GL0A 3MVXA 4A4KA 3G7ZA 1MS7A 1RDYA 3CG3A 5L23A 3UA6A 2FB7A 5D6WA 3EF7A 4C0ZA 1FSAA 2DTHA 2K2VA 2QDYB 4IUVA 1XTDA 3NFCA 3J7AF 4MH5A 4E0XA 2V1QA 4F16A 1MXUA 2HQ0A 2I0NA 2JJ9A 4IUPA 1VQ4A 3QZ5B 1KG1A 2X7QA 2FZCB 1NL5A 1OVBA 4CC3A 2A3LA 4GXSB 5CR2A 1VQPT 4AS4A 3MHXA 1ZLMA 2Z8FA 5ET6A 4JBZA 3CMET 2HAXA 4OQOA 1ZBMA 4DLDA 3KFMA 3HRTA 2ABHA 2OAWA 4M77C 4N4GA 2P4RA 3EFSA 5FU6B 3D1RA 3THIA 3UA8A 4AG1C 4J6XA 2NUTB 2F6GA 1SKUB 4OMPA 1OQHA 2AL5A 3JCMb 4F3SA 2ZZDA 4EF2A 2XD3A 4PK4A 4OFLA 1MRPA 3GNGA 4IO5A 2KR3A 2O51A 4DCYA 2V3UA 1FPIA 4BDNA 4LN2A 3IK6B 3KBGA 3SEMA 3RQTA 3EGXA 3TREA 2RMOA 3OB9A 1YZ0A 2XD0A 1WQ7A 4C0RA 1BIAA 2QGFB 1IMDA 3E1SA 4KGZB 2XXWA 3PPOA 3CI8A 1GRIA 1K73R 2CZLA 3T66A 1QCFA 3I56A 5I57A 1VQ9Q 5KYYB 2V26A 2BZXA 3JRZA 2DYIA 1M5DA 1B58A 4KFQA 2D9TA 1N9SA 3LW5E 3I55A 1UG1A 1VUBA 2EYWA 1B3EA 2QQSA 4A53A 3PIOA 2V3QA 3TTNA 5HM4B 3K6UA 1VQ7A 3IOTA 3O2AA 3QXEB 2NUVA 5B7DA 1QCOA 2RI5A 1DK4A 1TT1A 2RQUA 3RMQA 1VQPQ 4GWYA 5BWJA 2LDMA 2EYQA 5LJ5f 3CPWA 4RTUA 3FXUA 4NF6B 1TFDA 2QEXA 3G4ST 4M77E 3VS5A 2LAOA 3LGFA 4R55A 3H7MA 5HKCA 3MKDA 5IXFA 2ZZVA 4DDDA 1RYOA 2P3VA 2AIRB 1YCJA 4PGPA 2XXTA 2E5KA 4M78E 1KIKA 2QAZA 3QAXA 4H67A 8ATCB 3IQLA 4TLMB 3CHGA 1BCOA 1IGQA 1EZ9A 5FHMA 5LJ5h 4M7AG 3DB4A 1TWBA 1OPKA 2HL3A 4MX6A 2EGAA 1MQIA 1MV3A 1FBGA 3K4UA 3Q29A 3GOXA 4OGEA 2ALUA 4D8KA 2E3HA 1YHQT 4LD6A 2F36A 5I56A 1RAFB 4ZTFA 4PJOC 4BI3A 2DVEA 5GAOr 4A4HA 4PJMA 1VQPA 2QK0A 1WJQA 2DZCA 3HTRA 3H0FA 5LJ5j 3HSTA 4C8QG 3CMEA 1YYZA 3OMBA 4J8OA 3T9HB 1US4A 2VPOA 2BKDN 4BB7A 4OB3B 3IFCA 1I1JA 2DL4A 5ECAA 3CXCS 1HSJA 5ISUA 1QKBA 2D1XA 1P92A 2HEUA 5GAN3 1NJIR 4U2RA 2P84A 2ZPGB 1UEBA 3G71Q 2QMXA 4C5EA 1VIFA 1AWJA 2E5QA 1Y57A 2YUPA 2G93A 3KBRA 3KN3A 4Z0IA 3FXQA 3G6EQ 5C6SA 4H8IA 5I7IA 1R8OB 1TXQA 3K2DA 2J06A 2NUTA 1B6HA 1PD1A 2H3EB 4M75D 5FRNA 3V8JA 5TPAB 2XHCA 1MY2A 1RL2A 5CQYA 3HP9A 4DQ2A 1W2BA 2O7IA 4JVCA 2PU9B 4MNIA 5HK0A 4JWXA 2RI3A 5DLOA 4ESWA 2QYZA 1J1NA 2RD1A 4PJOE 4J9FA 3RPLA 3CC2T 5AA4B 4OETA 2Y7RA 5I2KA 1GGGA 5HBCA 4F3GA 4RJZA 3I5RA 4G8HA 5F7VA 5LDZA 4LDXA 2L5QA 4R0KA 4C92G 1MQJA 2QPQA 3KJ7A 3X28B 5KE2A 3G4SA 3OYBA 1P1OA 4EMKA 2RN8A 1W6XA 1KD1R 4BDZA 1G5VA 1X43A 1IRXA 1IMFA 4NWDA 3RTFB 5KYWB 1MXZA 5ICTA 1PCXA 4ZDMA 3JCMc 2HQEA 5GAMg 3OYGA 2PCRA 2OWZA 1B3QA 2KMTA 2RB6A 3ISPA 2RO0A 1PG5B 1Y71A 4NF5B 4J83A 2ATCB 4XXUA 3VVDA 2JM8A 1I4K1 2WEFA 2QQAA 3DELB 5KYNA 4G61A 1NLPC 4JPBW 3U72A 1AHJB 3IB2A 3PMVA 3PGGA 4J7IA 1BI3A 5L9OA 2E4HA 1YHQA 2E65A 3UATA 1B7ZA 3WXMB 3TQLA 3JCMg 2RJEA 3IL1B 1VQ6T 1ZU0A 4GF8A 1JU5C 2DL7A 2R58A 1YJNQ 4H5GA 5H8NB 2DO3A 1D0ZA 2J6OA 2DDKA 2EJGA 1R9LA 1US5A 4GX6A 2K6DA 3H8ZA 3L1AA 4KPTA 5CKDA 4LUBA 2M51A 1PSFA 1M3BA 2L8DA 3ZFJA 1BLFA 3TTRA 3FLGA 1K9MU 2WSCE 2UXAA 1MH3A 3VYGA 1B7UA 1JEGA 1B2HA 1SDXA 3QO3A 3DP4A 3FJ7A 4ELYC 4N6KA 4J9DA 1BK4A 4RNSA 2DIQA 1LB8A 2A08A 2DE3A 4ESXA 2EQJA 2MI6A 1FCKA 4HCYA 5I58A 3A8HB 1VQKQ 2QTVA 2RCAA 4V2SA 1VIEA 2DTOA 3T1BA 5I59A 5H8QA 3MSTA 1S72T 4MZMA 5FU6C 3C32A 4NX1A 3ROJA 1MPBA 1E6GA 5LJ3f 2J7IA 4QSEA 4IY5A 2DA9A 3OELA 4KRTA 3L2ZA 3IFAA 4JRIA 3SERA 3REBB 2I0BA 1AZEA 2X3WD 3M3LA 3VE1B 5FTHA 4AG2C 4Q5WA 1M1KU 4OMLA 3CC2A 5TPAA 2CS7A 1AL3A 3MVYA 3I5SA 1LFIA 2GQIA 4LDUA 3RBBB 1BU1A 1FBEA 3H6VA 2X3XD 5LJ3h 3JB9I 1ZUKA 3CCJT 3VS1A 4LZ7A 4J9GA 3QK6A 2NWJA 3RN8A 2O7UA 1YFNA 1YCSB 1AWWA 1HSQA 4C5HA 3SEXA 3O29A 3BKIB 5CIUA 3I5OA 4A4EA 1QVFP 1DPPA 1LBWA 2BTTA 1YBYA 1O64A 3M55A 1PB9A 4JZ4A 3X20B 3LR1A 1EYJA 2CEYA 3PGFA 4GVOA 4ATOA 4C1UA 4PDDA 4TQUQ 3OD7A 4YB7A 1UB4A 2K5IA 3LGLA 1B51A 2L3RA 5LJ3j 3TAJA 4KYSA 2L3QA 5CVIA 4QXDA 1PNJA 3VVFA 3OW2S 1H8KA 2XICA 1K9ZA 1VQ8A 4P3LA 4RPOA 4I9DA 3IORA 3KEIA 1OOTA 1PDAA 4NF5A 3V83A 1M2VA 3S4UA 1VQ6A 1A8EA 4PGNA 1NLOC 3RLFE 3RDVA 3MAMA 3EG1A 5GAN8 1PC3A 4I3YA 1OVTA 1N5ZA 3HO7A 4NF4B 2V8IA 1A0NB 2WSEE 3QUFA 4PE3A 2Y7IA 3P8HA 4NN3A 1QVGA 1FW0A 4IKFA 5GAMe 1IMEA 1JQQA 3V8KA 4DEYA 2UYFA 4XU1A 2K7AA 1B7TA 1UQWA 3JYRA 2GHBA 1FQEA 1WHKA 4P5NA 4HTGA 5ITOA 3CMAT 5H8NA 1WJRA 4MMPA 3MZ9A 3PVQA 2P0KA 3MJXA 2DE0X 4FAJA 3QDFA 4GLMA 3PV0E 3JCMe 5FW9A 4LDYA 3CBPA 1HYOA 2Y5LA 4NE4A 1GFDA 2F5XA 2Y4YA 4XU0A 3A8LB 1WXUA 1S72A 2I48A 4M7AB 2LT4A 4PAKA 2HZLA 1GR2A 1UUEA 2LQWA 1NYFA 4CC4B 3MZ1A 4YB5A 3VUBA 3CCRT 2KI7A 1N6AA 1Q81U 2Q2CA 4G4PA 1UTIA 5I2SA 2XXVA 1UTBB 2WYPA 2XXKA 3G3KA 5I3SA 3PPQA 1YITT 4M77D 1PBPA 4NQ8A 4ZN3A 5GANd 1IIWA 3DB3A 1OIBA 2RINA 1EZOA 1PM3A 3CQTA 5L8RE 2F5TX 4M78D 4OVRA 4DBFA 3CCJA 1RAEB 3PE0A 1SEMA 3TU4K 1FBPA 4L17A 4C8QB 2DTIA 1D3BA 4FYYB 4ZNXA 5FLXE 4G8NA 4IUTA 2C0OA 3C34A 2X35A 5FBPA 3G3IA 3M9QA 4J5YA 3FJMA 3JB9D 3NPFA 1YJWT 3SETA 3CRBA 3MCAB 2X7PA 4JLIA 1Q7YU 2VASA 2B3FA 1EZPA 3OOAA 4FW2A 9ATCB 5CBSA 2HSPA 4N0AA 4OB2B 4XK8E 1AWXA 2PTKA 1FTOA 4HE1A 1UHFA 4RY1A 2VKNA 1B5IA 3UF4A 2DVZA 3P8BB 4O5VA 4O94A 1R9QA 4OMFB 3V8XB 3VLUA 2F35A 4ZZEA 2BE9B 2Y4XA 1FMKA 1WLPB 4OHNA 4LQ2A 2A7YA 1NMUA 3OYYA 1FMVA 4XKNA 2M0YA 2G29A 5DEXB 3JAME 2WACA 4ANJA 2R5MA 2FIEA 3G3FA 1PB8A 3IOVA 4X1DA 1LCTA 4H5FA 1PSEA 3PUXE 4PJLA 4J9IA 3KN7A 2K3BA 4X04A 3VRZA 8AT1B 1VFDA 4C92B 4M7AF 1KQSP 4M7DG 3CMAA 2Q74A 1Q86C 1SYIA 2DAQA 4BDLA 1DPEA 1VQNA 4DXUA 4RXLA 5EHMA 2RQTA 3HKSA 2IEEA 4F39A 4KGXB 4BI8B 1I07A 2XXPA 3CFZA 4OFJA 4ELQA 2EJFA 4KUDK 2A5TA 5GMKi 2H9BA 4ZECA 2EQUA 1LFGA 2E1HA 2RM4A 1DOTA 4ESRA 3D4GA 4F1YA 3NHNA 2QL3A 1QMCA 4GBVA 2KBTA 1YWPA 2HZKA 1FPGA 4O3CA 5IT9E 3X24B 1Y3NA 1H92A 3K02A 4C8QF 3CCRA 3U23A 2I3WA 3VLVA 3GBQA 1NV1A 3S9MC 2H25A 4CC7A 3FEOA 2DXTA 2MCNA 1YITA 1NH8A 1SYHA 1Y1ZA 1B7HA 2E41A 3CBOA 3CCMA 4DBRA 3JV9A 2RC7A 1IUDA 4ME7A 2KYMA 3H6ZA 1Z9QA 4NEDA 1IREB 4BDOA 4ZN1A 3CCUT 1MY3A 1XT8A 2XXYA 1WVJA 1LPLA 1L5TA 1ZMGA 5CI5A 4JRPA 5JEIA 2YRDA 4N6DA 3N6TA 2DM1A 3TCFA 3MBPA 3PUVE 4IR8A 3OMCA 3A1PA 3IOWA 4FIBA 3QJYA 5GAOm 2DEQA 1YJWA 2FVUA 1D0YA 3CSGA 4JWOA 1MV0B 1YIJT 2K3XA 2X26A 3DP6A 1B5HA 1R1NA 2NUZA 1EIFA 3VXCA 3I9QA 4RCCA 1G0IA 3C4SA 2ZNUA 2QQRA 2ZPIB 4EUOA 2KT8A 3QHSA 4K3FA 1M3CA 4MLVA 2DL3A 4NTLA 1WA7A 3K00A 3G3HA 4HA8A 1G2BA 3PPPA 4YICA 3SDZA 1MNEA 4C92F 4LUDA 2RA2A 1QP2A 3REAB 1JB0E 1N8RU 2YRCA 1RACB 3VXBA 4JWYA 4HCBA 1BTJA 2VD3A 4E2FB 2SEMA 3FB9A 3EPEA 4O7MA 1LEVA 3VVEA 4QKUA 2O01E 3NTHA 4EQBA 2F2VA 1FPDA 3E13X 3K01A 1WNLA 2GBQA 1K76A 4HVWA 3AXFA 2X51A 1OULA 4KH0B 2MOXA 3JCMQ 2IVWA 1YJ9T 2YT6A 4ZEDA 3GBAA 4OVSA 4F7UF 1UJYA 1LBZA 2RHIA 1BIYA 1JVYA 3CPWS 5IZ3A 2EBPA 1VQ5T 4FYVB 2AHJB 1H45A 2ED1A 2RF0A 3E9FA 4BE2A 2D6FA 3CIJA 1YI2Q 1N76A 4QQ6A 2R9JA 1QQJA 3IAZA 5HY6A 4Z7EA 2V1RA 2HNIA 1HSLA 1VQ4T 1NNFA 3FXRA 4RTTA 1HD3A 3CR9A 1SW4A 5FWCA 1B9JA 3U8QA 3TVTA 3KUFA 1UIVA 2DWJA 4IO7A 3WAEA 1MDP1 2PUOB 3W15C 1NV2A 2O68A 5ICQA 5DT6A 1VQMT 3OYJA 1MXXA 1N8RR 3K6WA 2PFYA 1NE8A 1FPKA 3CCUA 1QGXA 3EGXB 1ZLQA 3CCLQ 4F7UA 4M7AC 4PFWA 3SDFA 4R6YA 4PFTA 2W10A 4PLIA 1IMAA 4X8RA 3BFMA 2DXRA 4OF1A 3V8LA 3ZL7C 3DLNA 2O4XA 5I57B 3QKJA 4MNCA 3URGA 2KEAA 3QWXX 1ZUUA 1QW1A 2CP5A 2LNHB 2WBDA 2XX7A 1BBZA 2W0ZA 1M90R 2I49A 1SW1A 1CSKA 5A0DA 1FYNA 1YIJA 1I69A 4PE5B 4PAFA 3TZAA 1PC0A 3I56T 4MDWA 1VQOT 3TDJA 5J16A 5A0LA 2DE2A 4C8QC 1S1NA 4NMYA 5IZ1A 3ULRB 1AOJA 1WZOA 1Y96A 2RJFA 3J80E 3OYDA 2RC9A 2Y5KA 1FRPA 3I55T 5F1QA 1SI1A 1ABOA 2HKNA 5KYUA 2F7CA 1ANFA 2QVUA 5F24A 2XIDA 2DIGA 1VQ4Q 3EG3A 2B86A 2FNCA 3MJNA 1B1XA 2OCUA 3A5ZB 4KHZE 1GBRA 5EYGA 1PWTA 1W2BS 1FX7A 3VJPA 1SW2A 2PZ1A 3FASA 1WHLA 4BE0A 1WODA 1PEBA 2XXRA 4M7AE 1IGUA 2CP6A 3TSWA 5KCJA 3HHTB 3JB9J 1JW4A 4GFRA 5DVJA 4EQ9A 2HCAA 3GP8A 4QVCA 4JLGA 1YJ9A 1IZ1A 4QSCA 4PDHA 5I56B 5GANf 3S3MA 5CO7A 3O66A 4GWZA 2V8KA 4UACA 1K73U 2VUBA 2XX8A 2JJKA 3OA6A 1W70A 2O88A 2LJ1A 3R7XA 2MF2A 1LBYA 4F31B 4M75G 1VQ5A 5LJ5e 1OI1A 3E78A 1N27A 3JCMV 4QFLA 3RMSA 4QVZA 5K2YA 1FQCA 4C8QE 3NTIA 2R57A 3MP8A 3LWIA 1QVFA 3KGCA 4C92C 1W1FA 3GF5A 1VYVA 5EQ9A 1ZUYA 3I56Q 1VQOQ 5I21A 1ZTYA 3VV5A 2CUDA 5GANh 4H45A 4OA4A 4HCZA 3K1MA 2QVVA 1NI9A 1YWOA 3I55Q 1GL5A 1K1ZA 3NOHA 4U23A 4PLLA 1TXFA 4NF8A 2XWVA 1NEGA 2E10A 1VQMA 3LX7A 1VQ7Q 4AS5A 1H43A 4WXJA 3CD6T 4OZ9A 3PVLA 4HXJA 1QKXA 2ONSA 4FATA 4U21A 2P0SA 2QEXQ 4LN5A 3FVKA 2DRMA 5IHIA 3OXNA 3PFSA 5I2MA 3QG1A 5CMKA 5GANj 1MMNA 5C0MA 4Z89A 4OMQA 3WVDB 3LSWA 1XOVA 3CCQT 4M7DB 2XDDA 2DWIA 3SWNB 4PFBA 1UGQB 2E70A 2GGRA 2DQVA 3RPLB 4FECA 5I2KB 3RNJA 2HMAA 1B0LA 3THKA 1VQLT 1O63A 2EQMA 3GIBA 1AEYA 4OVPA 1VQOA 3CC4T 3FJPA 3VLWA 2RH2A 3MPLA 5HK3A 1A40A 2F3BA 1RLQC 2KXCA 1TS9A 1Y9UA 2Q88A 4M1VA 4C92E 1AD5A 4AMCA 4ZEKA 1EFNA 4EMKB 1PD0A 4PBHA 2O9VA 5JTYA 1PKSA 3B6QA 1OEBA 3RR6A 4G68A 3EKIA 2HXRA 2OK2A 5IXBA 2PT1A 4ZEBA 3S3OA 4AQ4A 4F17A 4YKPA 2BUDA 3OYFA 5M2VA 4QBAA 2QTXA 1Q35A 3IB0A 2XMFA 1ZBXA 3RGYA 1NJIU 2J6FA 1TWYA 3CMEQ 2O6AA 3W9VA 4ELPA 4BLAA 3QSLA 2REJA 1Y07A 4RMOA 2HBWA 3LUYA 3S9EA 2D8HA 3MZBA 1VYTA 5BUUA 3K0VA 1X6OA 5AA2A 1NNPA 2AKLA 4JJCA 3AHUA 3M54A 2Y90A 1WQWA 2KK4A 4RK2A 2MWOA 1T0JA 4ZTJA 1OZ2A 2L3SA 3Q25A 4PFRA 2RC8A 4XQ3A 1B40A 1MDQA 2OAUA 5GAOq 4XKPA 1OLAA 4FJPA 2GTOA 3VS4A 2FO0A 3FDRA 5D6XA 3MPUB 1INPA 5I22A 3CC4Q 1KJWA 2RNAA 4IO6A 1X01A 3T0JA 2DRKA 2EWNA 1Y0MA 3OYCA 1EYIA 2KRMA 1I5LA 3A09A 2DX1A 2LX7A 1A8FA 3PUWE 4F29A 3R6OA 5D7UA 2Y7KA 1KD1U 4M7DF 3Q1JA 3CD6A 5I58B 3VU3C 2X4JA 4PP0A 1Y1MA 4ND9A 4BI4A 1ZIUA 3VKIA 5I59B 5H8QB 3G4SQ 5TU0A 3R6UA 4NL2A 1I6AA 3MO8A 1JXOA 2EGEA 4H46A 4G2ZA 5AA3A 1NV7A 1IXHA 1UDLA 3CFXA 1G3WA 3CCQA 2ESWA 1H3HA 3H6TA 1QVGS 5ITPA 4Z8AA 1YTVA 3GBBA 1RYXA 1VQLA 4GOTA 1NUZA 1OQGA 3EHTA 3CC4A 2LX9A 1NUXA 3RKYA 3SD4A 1Q1KA 2P2AA 3S9NC 2VPNA 1LSTA 2JZ2A 1SG5A 4Q8RA 2AKKA 3OSSC 1M1KC 4PF6A 4DXBA 1WXBA 4M7DA 4FL6A 3SWNA 4P1LA 3PMIA 4N6PA 4P1EA 3CCST 4JRQA 3A3CA 2NLUA 1YHQQ 2KE9A 1IB8A 1QVPA 1JJ2P 2HBPA 1LAGE 2QJEA 1KSWA 3MPKA 3MQ9A 1G8XA 3U93A 3EGDB 3VS2A 4TOZA 4Q0CA 4G68C 1T3LA 2ROLA 4GY5A 2EQKA 3HPWA 2YDLA 3B50A 2KXDA 3M3KA 3GZGA 1MGQA 4EDUA 2NUPA 4PC9A 3CCVT 2EYYA 5GAOp 1B4HA 4O6JA 1H44A 2AZSA 4R2BA 3LUZA 2HDAA 4O7IA 2QQBA 1D1AA 1WPYA 2COWA 3EFRA 5H8FB 1NFTA 2ZMBA 1M2VB 3PPRA 4FT2A 1QKWA 2F78A 5FRMA 3IO4A 4OGCA 1USYE 5HCKA 1B3LA 4I40A 1JETA 4F7UG 2DLPA 1KC8C 2DFUA 4JDFA 1Y4CA 2LCLA 1OX9A 1VQ8T 3OO7A 5T3JA 1Q82C 1M1FA 3A8MB 4EXLA 3SEVA 4XKQA 2CP0A 4FYWB 1NYGA 4JDSA 2I0CA 3RUXA 3Q26A 2VT5A 4IY6A 1BCMA 4HT9A 3A8OB 1IXIA 4PQJA 2A37A 3TKDA 3CCSQ 4LONB 3CC2Q 2EPDA 2Q8JA 4M78G 4QQGA 4P56A 2DKGA 3L2RA 2OBGA 1ZKBA 3Q28A 4F2OA 3CBMA 3M57A 3DLMA 2D21A 3KXTA 4J9BA 5TP9A 3HFOA 1T0KA 3T22A 3BY7A 2XHDA 3RT8A 2VV5A 2P3NA 3LH5A 3CCVQ 3SZPA 4FSSA 3JB9G 4FT4A 4B9XA 4HVVA 2QA4T 5FHOA 3KOTA 4RCBA 5EYFA 1SF9A 2E6NA 2JUFA 3MEWA 4F1VA 2NOOA 1C1AA 2GFAA 2Y84A 2EQIA 3S3NA 1Q81C 1M5FA 4J7FA 4BY6B 2RPNA 3CCET 2ZNSA 3HV1A 2R5AA 4OANA 1B46A 4L59A 1D3BB 1RLPC 2GTJA 3P8DA 4PNOA 3L2VA 1VQ8Q 3CCSA 1M5EA 4OERA 2JVVA 2Z8EA 2E3IA 4M7DC 4PTKA 1IXGA 3SWNC 1VQ6Q 2XXIA 1FWZA 2CH4W 2LCSA 1FTMA 3N5LA 4MCOA 4PFUA 3S2VA 3I35A 3QYHB 2AIXA 3WAFA 2JTMA 2QGGA 4E7ZA 2HD0A 3G1JA 1FJ6A 2YJPA 2D5WA 3T93B 1YP5A 4WF2A 5FU7C 1YAEA 3M4GA 5FTIA 2D0NA 5JK4A 5DY9A 2D0QB 3CCVA 1PB7A 4RG2A 4TLLB 1LLSA 4OYVA 2H4IA 2RI2A 4J9EA 2FHYA 3PD9A 4A54A 2YXYA 3EGDA 4EMKC 5CKHA 4X9CA 1BKBA 1MPDA 3FVGA 3DP8A 1Q7YC 1MXWA 3E4RA 3K6XA 4JXIA 4MAGA 1MQGA 1BI1A 2GHAA 4MHFA 1BI0A 4MZPA 1XS5A 4XTUA 3PD8A 4JJNK 4C8QD 4DOWA 3LBSA 2C0IA 2E64A 1WGSA 1T0HA 4MMKA 4FW1A 1GV8A 3GXAA 2KDSA 1WDNA 1D9VA 2ZPBB 2I3VA 1PRMC 2W7YA 1U5SA 2ZCFB 4KGVB 5IH2A 1S72Q 5H8FA 3X25B 5H8SA 4BDMA 3L2QA 3H3GA 4Q5TA 1FPFA 3EQ1A 2DVCA 3CC7A 4LATA 1RABB 4C5IA 2R8TA 2JTEA 2FRWA 3G7WA 4FEBA 1B34B 2COYA 3B6TA 4XF5A 1P1QA 2DJQA 4AB5A 3N26A 3T96B 4OVJA 1A55A 2RHUA 1PHTA 2AT1B 4E6RA 1IMCA 4NS5A 2YPNA 2A5TB 1Q95G 1OX8A 3UPUA 2IPOB 2M8CA 2EYXA 2YLNA 4NWCA 1QUIA 3UGWA 3CCJQ 1D3KA 2LJ0A 5L8DA 3ILUB 5A5XA 2Z8DA 5GAOn 1KHCA 2P0PA 2P1SA 2LQ8A 3LLRA 1VQNT 1BI2A 4M75F 4QFKA 4ZEFA 4F19A 4AFZC 2HFBA 2VYTA 3VS3A 1SBPA 1QP3A 2BJJX 3FV2A 4JVIA 4R72A 4EPCA 1TUDA 2QA4A 2OJTA 3KSJA 2Y7WA 2M16A 4BDQA 5GJWB 4Y28E 2VHAA 5IZZA 4OWDA 3A29A 4IGTA 3HSBA 4JSOA 1KQ1A 2PVOB 4LXCA 4QT7A 3IO6A 2L3PA 2RKMA 3N5BB 4M4ZA 1JO8A 1FXXA 3CCEA 1AMFA 1MPCA 5I84A 1UTHA 2ECZA 2VD2A 1VYUA 1JW5A 5EHSA 1M8MA 1WHJA 1NV4A 5J1DA 3JCMW 1MH4A 5IKBA 2V84A 5CMMA 5IGAA 1WHMA 1HJDA 3QYGB 3CCMT 4P0GA 3QXMA 3AT1B 2CSIA 1FTLA 1MMDA 1B07A 4M75A 1JP4A 5H8HA 1ZX6A 4R56A 1K8AC 2I58A 2ZYKA 2C0TA 4LE9A 1SPKA 1YN8A 3C36A 5KDTA 5EQ8A 4UA8A 3NGPA 2PVGB 4AFUC 2PX1A 1QUJA 2ROTA 2VP1A 2VOZA 1KC8R 1BIBA 4JJDA 3CMAQ 3RT6B 1U8RA 1UFFA 3GNFB 4BDYA 1VQNQ 5DM7R 1M8VA 1RAGB 4EIKA 1K4US 2Z22A 1WI7A 3JCMX 2O84X 4RG8A 3A8GB 3SEUA 2KROA 1POTA 2DPPB 2DEUA 2X4XA 1S7YA 2BZYA 4LZ8A 1NEBA 2HKQB 1LOJA 3FRNA 4ELZC 2OWTA 2PBWA 2ZZWA 1R6ZA 2B4LA 1MG1A 1IXCA 3CCRQ 1NG2A 1CNQA 2Q9TA 4XKRA 2LP5A 5GAMf 3FC3A 2GFEA 4RPNA 1YITQ 4HXVA 4XIGQ 3OMGA 2DD5A 3UDCA 3C12A 3CCMQ 5IZ3B 1OYXA 2V8JA 4DA4A 3FVNA 1ZSZA 1M30A 1KA0A 1CKBA 2GFUA 2DD4A 2H3JA 2NXOA 3F70A 3RY3A 2RQRA 3ODBA 1SPIA 2NVUB 1B34A 2MMPA 2ZGWA 1VOMA 4U22A 3JCMf 3ZBDA 5LL6S 1FPBA 5EG2A 4C5GA 1VR5A 2QFLA 2CKKA 1LB9A 2ZYOA 4EQ7A 2QS2A 3LC8A 3MYUA 1WXTA 1Y3PA 1Z9ZA 2JM9A 2KY9A 1YJWQ 1AIVA 5ET7A 4I3EA 3TYHA 2RQWA 2A0FB 3SFMA 1N9RA 4PJOD 1O7TA 2F6PA 2DBKA 2WSFE 1Z7ME 1BYMA 6AT1B 2LVMA 2EGCA 4F14A 1WJSA 2F2WA 3B8BA 3M5AA 4GQOA 1NUWA 4UC4A 4F7UB 1WHHA 2XU8A 3UWNA 2HCKA 1QLYA 3OO6A 5GAMj 2O4XB 1KWHA 2FL7A 4KI0E 5I11A 2XXQA 2L5VA 4N4HA 1X6BA 4ZGJB 3RESA 3QIIA 3BW1A 1JBMA 2CZ6B 1QVFS 4BY6C 1DTZA 4XU3A 4M75C 3M0PA 4WEDA 3SEWA 4F3PA 1H3DA 3PIPA 1UE9A 1EU8A 1Y96B 4H8JA 1V29B 5KYUB 2VVKA 4TVRA 1M5BA 1Y20A 3OEMA 2PNIA 2YUOA 2LQNA 2ZPHB 2ENMA 2J05A 2HQXA 2MWPA 1F1BB 3C0CA 1N04A 1FQDA 4M4GA 1B5JA 2DXUA 3OYEA 2F34A 3SEYA 5FWBA 4XU2A 2R6GE 4N0AC 3JB9H 5GMKe 4PKCC 2EIFA 2O1MA 4JS4A 5KCJB 3C94A 5K2XA 1XHYA 2LQKA 3FV1A 1U3OA 4PFIA 5LJ5g 4JB7A 1GCQA 4KXPA 4O3AA 3U65A 1H641 3V89B 3CG1A 1TH7A 2O1LA 4JUVA 2VXFA 4R6KA 1G3TA 4RK9A 3A3UA 5AT1B 2HAUA 2RCBA 1RAAB 3KFVA 3M3FA 1NNTA 3HFUA 1NM7A 4XFEA 1SRLA 3CCUQ 3TTMA 2Q8MA 2Q2AA 1JJ2A 2MAMA 4FEDA 1TG0A 1M90U 1RAIB 2AZVA 4PFOA 2PMSA 3EHSA 4P8BA 2ZYNA 3C4MA 2DETA 4L6V5 1NV6A 4PCDA 1PKTA 1UECA 3MVWA 3V7CA 3UK4A 4A4FA 2JMAA 3IOUA 2OTLT 2KT1A 3EG9A 3O6IA 3RERA 4MLQA 4C1TA 4RTWA 1KHIA 2JOYA 3MP1A 3I6VA 4NF8B 4ZZAA 4ZE8A 2KRSA 3IJOB 1YIJQ 1YCYA 4HS7A 4QQDA 3TCGA 1JQFA 2XI9A 3H06B 3X26B 3MUQA 2KNBB 4UABA 4M78F 5DW8A 1K8AR
chains in the Genus database with same CATH topology
1Q86U 3M56A 4KQPA 3MEVA 3M58A 4KR5A 5DVFA 4QFPA 4MFIA 3S6WA 2FYKA 5KCHA 3JB9F 4HW8A 4RA1A 4X48A 2EFIA 2KLFA 1VFEA 5GAN2 4PETA 3L42A 2OTJT 3M8UA 1ATGA 3UORA 1M1GA 4M77A 4JRKA 2PYYA 3H03A 5JTYB 4G68B 4KBMB 1JEUA 3PMWA 1LFHA 3O97A 4OEUA 4M78A 1JRIA 1B32A 3ZS6A 2F8DA 2M0OA 1P99A 5I2NB 3WVEB 2QMWA 1LGBC 2VGQA 5AE4A 4U4XA 3SB2A 3META 2XDPA 3J81E 1LNXA 3V7SA 4MZTA 4IURA 4ELOA 3ECRA 3VFJA 5AA2B 3BFUA 4E7IA 5DVIA 2XXHA 1KQ2A 2LC4A 1KQSS 2X4YA 4JSDA 2Z23A 2YLBA 4XTVA 5GAN7 2DXYA 2ZPEB 2E1SA 2YRVA 3H4ZA 2PVUA 2KQWA 2UVJA 2V93A 4THIA 3TMGA 2QSXA 4KYEA 2OTLA 1U1TA 3L2WA 3C9HA 1XNIA 4LZ5A 1FTKA 2RHZA 3CFLA 2ANJA 3HRSA 2LTOA 5A0GA 4GWOA 1B3HA 1GTKA 4LDVA 1I6BA 2RF1A 4YTLA 3C33A 4ISUA 1KD1C 2AL4A 4HT8A 1VQ9T 5J3BA 4ECFA 1OMPA 3HRUA 4OTEA 2VXEA 5KH6A 5FHNA 1FQAA 3QIMA 3E3KA 2XXXA 4PJOA 5CQXA 1VSOA 1RI0A 4NL3A 4E7HA 1NPPA 4JS5A 4YB6A 3OYIA 2OTJA 5DYHA 3CEYA 4E7KA 3TEPA 2RHYA 3FIRA 2ESNA 4WEPA 4FSXA 2G3RA 2I4BA 2REGA 5LJ3g 2QI2A 3OQ5A 5KCOA 3L6GA 1URDA 2A5SA 5FU7B 3E9XA 1IEJA 4II1A 3L2UA 4M78C 3ILTB 1IZ6A 2KAFA 1XQHA 4D6WA 3OYNA 1QJMA 3FGSA 3FZVA 3IX1A 3OS1A 2QS4A 1LAXA 3IR1A 1B3GA 4QRZA 1D9YA 2I6EA 3FD3A 5I2NA 4ZGDB 3R26A 2GH9A 4FU6A 1LCFA 4X9DA 5GAOl 1ELJA 3C31A 4IO2A 4GLIA 4IO4A 3PUYE 3HFNA 3EHUA 3PUZE 1IQ7A 2OWSA 5D6YA 4F7UE 3KJTA 4OMBA 3O8VA 3OYAA 4U1ZA 3QYTA 4P11A 1RKMA 3TPAA 3RPWA 3G71T 2RK2A 1ZHIA 3TCHA 3G6ET 4LQ5A 3OSQA 1W4SA 5L9MA 4XTWA 4B9WA 4XTYA 3UIFA 2QRYA 4POXA 5KE3A 3N94A 5TP9B 3CPFA 1AH5A 3PPNA 1A7LA 1Y3QA 4DXCA 1VQ9A 1K9MC 3C95A 3ER0A 2QS3A 5CCAA 2P0QA 2P4TA 4E47A 1B05A 2K3YA 1I8FA 1BP5A 2E6ZA 4C0GA 3RUMA 2LT1A 4POWA 4E7LA 2D3IA 3BBRA 4I1DA 3VUZA 5IAYA 1DSNA 2BIVA 1FQFA 2DWAA 2EJ9A 3VV0A 2ZNTA 3MW0A 3V5AA 5GAMd 1B1HA 1N3XA 1M5CA 2Y7PA 2DE4A 1KQSA 5IAIA 1LAFE 4QHQA 4A4GA 1FTJA 3QZ9B 5GMKm 2GF7A 5CBRA 2B3BA 4OB0B 2PQWA 1Y7XA 3JCMd 1CE2A 1DTGA 3INZA 2F7BA 3MC2A 4X9TA 4X1BA 3ZKKA 3NTKA 1N7WA 1UGRB 2CZ7B 2H99A 4R6HA 3OBWA 1YJNT 4YMBA 5LJ3e 4F1UA 1HXDA 4E0WA 1UIUA 3O9PA 5GAN4 4GRKA 4YKIA 3MEAA 4DIGA 3S9LC 4FE8A 3PNWC 2AYSA 1P1NA 4HCCA 2M1HA 4MF3A 1F9BA 3SKPA 1IITA 3O6GA 4XTXA 2XG8D 3FATA 3G71A 1OZ3A 1Z7NE 3ZSFA 3G6EA 4F22A 2HXWA 2I2LA 1VQKT 3CC7T 3RTWB 4FM4B 1UGPB 4M77G 5AA1A 4NF6A 3LSFB 5A5XB 1QULA 4FIMA 3TUSA 1NH7A 1DJ7B 4MDXA 4PFYA 3PTAA 1SI0A 1B4ZA 4OENA 2VGNA 4LP2B 4GL8A 4F3BA 2XX9A 3JCMP 4G77A 3V7RA 1MQDA 1EH3A 4LD9K 4ELRA 3UT1A 4U4SA 2EKOA 3OYMA 1UTHB 1UGSB 1TFAA 1Y4TA 2F97A 4IUUA 4YMAA 4RKUE 2HAVA 4M75B 2K57A 5H8HB 4KYDA 5CMCA 1N84A 2YLCA 2H5YA 1ZJLA 4J6WA 4OESA 2KSSA 1S9TA 5KDTB 4M7AD 4AB6A 3ASKA 2K5LA 2XD2A 4LA9A 1URSA 3KG2A 4Q30B 3ZKLA 3MWBA 1O9SA 4BD3A 1OLCA 3PMXA 5B70A 5CKBA 1YJNA 2ONKE 1U1SA 4IO3A 1SVXB 2DZ9A 4H1XA 4X34A 5CKEA 4P0IA 3QDRB 2OZZA 5GAN5 4OB1B 4EDPA 3N6UA 5J39A 4PJOG 2YHTA 2EAYA 2UVGA 4DOVA 5AA4A 3C35A 3OSVA 3U92A 4BE1A 4F2QA 1VQKA 5J26A 1AOVA 2X4WA 2QQ9A 3OEKA 5LOMA 3FIFA 1O75A 2C06A 1H76A 4M7DE 3USDA 2VGMA 3LWHA 1A99A 5GAN6 3RIRA 5ELVA 4HKEA 4IGRA 3KN8A 3CXCA 4R2FA 3FUZA 1KC8U 4GIZA 1G3YA 4OFOA 4H6DA 3EN3A 3OSRA 5HPQA 2CYZB 2DS9A 3O6HA 1Q82U 3BDLA 1QVSA 1QUKA 4GLKA 3BDUA 3K1PA 4C92D 1N7XA 3DLLA 1H3ZA 3TCJA 1XVXA 2V25A 4MBPA 1JJ2S 2F7AA 2DSFA 3H6WA 4Z02A 3OS2A 1POY1 3F11A 3E19A 4GXAA 3MVZA 4OVAA 4KCCA 1JW1A 1HSEA 3ZEHA 1I81A 2IG0A 1XC1A 3W9WA 3B6WA 1N3WA 3OENA 2K5FA 4R73A 4BDRA 1II5A 1M9SA 1DMBA 5CM6A 1NPRA 2DYXA 4YKKA 4G8MA 4BUGA 3LYIA 3TFLA 5GMKl 1NKXA 4J6YA 4YAHX 2THIA 4OEVA 3SESA 3KOSA 3PMTA 2JNGA 5DTBA 5DLQE 4LVQA 3HCQA 1LBCA 1MM6A 4C0DB 1G3SA 1N8RC 2RJCA 4EF1A 1URGA 1M5Q1 2KVQG 4H65A 4H0WA 4QFNA 3KSXA 2UVHA 4KCDA 2E0SA 2CMOA 1P1WA 3U1OA 2F5KA 3T9UA 1D4NA 1PBQA 2DJZA 2CZ0B 3HL8A 1N0TA 2QS1A 1MY1A 4EXKA 1M90C 2GCXA 4DCXA 1SW5A 3KZGA 1FQBA 4MMLA 1MY4A 4E7JA 1NNKA 3UP9A 2CGHA 5GANg 2ZPFB 2LRQA 3GPLA 4R9GA 5GAMh 3QUIA 5FROA 2H98A 4U1OA 3HPIA 4OXVA 3T9VA 4CI0C 4C0FA 3OY9A 3OBYA 3JSCA 2XXUA 4R75A 4IUQA 4NF4A 2UVIA 3JCMh 3LH0A 3QSUA 3E9GA 2K4YA 4QVDA 2XK0A 2DXCA 3D4CA 2PUKB 4I8CA 4R74A 3HN0A 2FHDA 4QSDA 5LJ5d 2QXFA 2JN0A 4M77B 5CMBA 4Y91A 4ONYA 4XTCQ 3H6UA 1XVYA 3HHGA 2DXBA 4NOYA 4F18A 3M53A 1I6QA 3LSXA 4M78B 1JVXA 1BKAA 3G3JA 2DWHA 4YKJA 4ZEIA 3B7DA 4YU0A 2DP8A 4M7AA 5CK9A 3RKXA 1S50A 3QUJA 4KUIA 4QW2A 1HK9A 2IA4A 2LCCA 3FJGA 3UN6A 5KZTA 3OW2A 2RK1A 1UTBA 5CC2A 1LJOA 3ME9A 3OS5A 4KT0E 4N4IA 1K8AU 2PT2A 3HHFA 3OO9A 4N13A 3M59A 5L9SA 3PU5A 3OYKA 4VUBA 3TODA 1SQYA 2JTFA 1YI2T 2B8AA 4I62A 4C8QA 3QBYA 3CVGA 3RKWA 4OP0A 3TQWA 2XDBA 2RHXA 2DOJA 4QF9A 1NZ9A 5CRYA 2WKYA 2M9UA 2L89A 2DK3A 5AA2D 4M75E 4PL6A 3M4YA 4O3BA 1K73C 4ZS9A 3DKMA 3TELA 4HCWA 4L5GA 5M9OA 3OYHA 1YPNA 3CCLT 1QW0A 1MQHA 4YZZA 2ZYMA 2ZXTA 5CAIA 2FYIA 1P1UA 3OS0A 2ONRA 3RNNA 1B3FA 3K6VA 4M77F 3JZJA 3CSBA 4KD5A 1X75C 4EMHA 4PJOB 1MXVA 5IN1A 1GVCA 5DEXA 2Q89A 4IB2A 2CZ1B 3G3GA 4GD5A 2XKOC 2E12A 3DM0A 5GANe 1JEVA 2O69A 4N07A 1MHNA 3MP6A 2OLBA 1QKAA 4C92A 2UYEA 2R71A 3MEUA 4ZE9A 2RJDA 3GLXA 3EAEA 1VE4A 4ZGEB 3QPHA 3OO8A 3U94A 3Q27A 2I4CA 4QFOA 2VC8A 3I3VA 2V3TA 1A54A 3PT9A 3IB1A 4EMGA 1XOCA 4XTZA 3T9NA 4LDWA 1SD3A 3TTLA 4XAXB 1JNFA 4CRIA 3QJ6A 1B0HA 1USYH 3K1NA 1GXIE 1CB6A 4M7DD 4RYAA 5AYFA 1MXYA 4WKMA 3BFTA 1YI2A 3JCMJ 1LAHE 1NJIC 2F69A 2B65A 3TTKA 4BACA 3IJXB 2PVDB 1SSFA 1LBBA 5GMKh 3LSLA 1MY0A 5A2QE 4C0DC 1M4ZA 3GLBA 2GQVA 3FVOA 1ZQ1A 3VYHB 5CKFA 3VDFA 1VQ7T 4PJOF 3T9XB 3OYLA 2LNVA 2GRVA 3CCLA 3O28A 1MM7A 2QEXT 3P7IA 4R9FA 4KULA 4FORA 5GMKj 4DZ1A 5LJ3d 3TEEA 3L6HA 2FA7A 4GL0A 3MVXA 4A4KA 3G7ZA 1MS7A 3CG3A 2FB7A 5D6WA 3EF7A 4C0ZA 2DTHA 2K2VA 2QDYB 4IUVA 1XTDA 3NFCA 3J7AF 4MH5A 4E0XA 1MXUA 2HQ0A 4IUPA 1VQ4A 3QZ5B 1KG1A 2X7QA 1NL5A 1OVBA 2A3LA 4GXSB 5CR2A 1VQPT 3MHXA 2Z8FA 4JBZA 3CMET 2HAXA 4OQOA 1ZBMA 4DLDA 3KFMA 3HRTA 2ABHA 4M77C 4N4GA 3EFSA 5FU6B 3THIA 3UA8A 4J6XA 2F6GA 2AL5A 1OQHA 3JCMb 4F3SA 2ZZDA 4EF2A 2XD3A 4OFLA 1MRPA 3GNGA 4IO5A 2O51A 4DCYA 2V3UA 4BDNA 3IK6B 3KBGA 3RQTA 3TREA 3OB9A 2XD0A 1WQ7A 4C0RA 1BIAA 3E1SA 2XXWA 3PPOA 3CI8A 3T66A 2CZLA 3I56A 5I57A 3JRZA 1M5DA 1B58A 4KFQA 2D9TA 1N9SA 3LW5E 3I55A 1VUBA 1B3EA 2QQSA 4A53A 3PIOA 2V3QA 3TTNA 5HM4B 3K6UA 1VQ7A 3IOTA 3O2AA 3QXEB 2NUVA 5B7DA 2RI5A 1TT1A 3RMQA 5BWJA 2LDMA 2EYQA 5LJ5f 3CPWA 3FXUA 4NF6B 1TFDA 2QEXA 3G4ST 4M77E 2LAOA 3LGFA 4R55A 3H7MA 5HKCA 4DDDA 1RYOA 1YCJA 2XXTA 4M78E 3QAXA 4H67A 4TLMB 1EZ9A 5FHMA 5LJ5h 4M7AG 3DB4A 1MQIA 3K4UA 3Q29A 3GOXA 4OGEA 2ALUA 1YHQT 4LD6A 2F36A 5I56A 4ZTFA 4PJOC 4BI3A 2DVEA 5GAOr 4A4HA 1VQPA 1WJQA 2DZCA 5LJ5j 3HSTA 4C8QG 3CMEA 3OMBA 4J8OA 3T9HB 1US4A 2BKDN 4BB7A 4OB3B 3CXCS 1HSJA 5ISUA 1QKBA 1P92A 2HEUA 5GAN3 4U2RA 2ZPGB 1UEBA 2QMXA 4C5EA 1VIFA 2E5QA 3KBRA 2G93A 3KN3A 4Z0IA 3FXQA 5C6SA 4H8IA 1R8OB 3K2DA 1B6HA 4M75D 5FRNA 3V8JA 5TPAB 2XHCA 1MY2A 1RL2A 5CQYA 3HP9A 4DQ2A 1W2BA 2O7IA 2PU9B 5HK0A 4JWXA 2RI3A 5DLOA 4ESWA 1J1NA 2RD1A 4PJOE 3CC2T 5AA4B 4OETA 2Y7RA 5I2KA 1GGGA 5HBCA 4F3GA 4RJZA 4G8HA 5F7VA 4LDXA 2L5QA 4C92G 1MQJA 3KJ7A 2QPQA 3X28B 5KE2A 3G4SA 3OYBA 1P1OA 4EMKA 4BDZA 1G5VA 4NWDA 3RTFB 1MXZA 5ICTA 4ZDMA 3JCMc 2HQEA 5GAMg 3OYGA 2KMTA 2RB6A 2RO0A 4NF5B 1Y71A 4J83A 4XXUA 3VVDA 1I4K1 2QQAA 3DELB 3U72A 1AHJB 3IB2A 3PMVA 3PGGA 4J7IA 1BI3A 5L9OA 1YHQA 2E65A 1B7ZA 3WXMB 3TQLA 3JCMg 2RJEA 3IL1B 1VQ6T 1ZU0A 4GF8A 2R58A 4H5GA 5H8NB 2DO3A 2EJGA 1R9LA 1US5A 3H8ZA 3L1AA 4KPTA 5CKDA 4LUBA 1PSFA 2L8DA 1BLFA 3ZFJA 3TTRA 1K9MU 3FLGA 2WSCE 2UXAA 1MH3A 3VYGA 1B7UA 1B2HA 1SDXA 3QO3A 3DP4A 3FJ7A 4ELYC 4RNSA 2DIQA 1LB8A 2DE3A 4ESXA 2EQJA 2MI6A 1FCKA 4HCYA 5I58A 3A8HB 2RCAA 4V2SA 1VIEA 2DTOA 5I59A 5H8QA 1S72T 4MZMA 5FU6C 3C32A 1MPBA 5LJ3f 4QSEA 4IY5A 3OELA 3L2ZA 4JRIA 3SERA 2I0BA 3M3LA 3VE1B 5FTHA 4Q5WA 1M1KU 3CC2A 5TPAA 2CS7A 1AL3A 3MVYA 1LFIA 4LDUA 3H6VA 5LJ3h 3JB9I 3CCJT 4LZ7A 2NWJA 3QK6A 3RN8A 2O7UA 4C5HA 3SEXA 3O29A 3BKIB 5CIUA 3I5OA 4A4EA 1DPPA 1YBYA 1O64A 3M55A 1PB9A 3LR1A 3X20B 3PGFA 4GVOA 4C1UA 4ATOA 4TQUQ 3OD7A 4YB7A 1UB4A 2K5IA 3LGLA 1B51A 2L3RA 5LJ3j 3TAJA 4KYSA 5CVIA 3VVFA 3OW2S 2XICA 1VQ8A 4RPOA 4I9DA 3IORA 3KEIA 1PDAA 4NF5A 3V83A 3S4UA 1VQ6A 1A8EA 3RLFE 3MAMA