3MP6A

Complex structure of sgf29 and dimethylated h3k4
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
517
structure length
508
Chain Sequence
MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALAAAQTNAAAEFGSSYWTSEYNPNAPILVGSEVAYKPRGEWIQCEVLKVVADGTRFEVRDPEPDELGNSGKVYKCNRKELLLIPPGFPTKNYPPGTKVLARYPETTTFYPAIVIGTKRDGTCRLRFDGEKETEVTRRLVLPSPTALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Histone binding protein
molecule keywords Maltose-binding periplasmic protein,LINKER,SAGA-associated f
total genus 151
structure length 508
sequence length 517
ec nomenclature
pdb deposition date 2010-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
A PF07039 DUF1325 SGF29 tudor-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3mp6A05
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3mp6A01
3OB9A 2Y7IA 3VVEA 2QS3A 1N0TA 4ZE9A 1RI0A 1QUJA 3U92A 2F78A 3OA6A 2XXTA 4PFUA 3FXQA 3K6XA 5CI5A 5K2XA 4ZTJA 4RYAA 3LH0A 1NNFA 3C35A 4I1DA 3SKPA 1Y3QA 3TYHA 2HAUA 2OBGA 1POTA 2JZ2A 4CRIA 3N5LA 2FHDA 3QBYA 3KOSA 3O97A 2L89A 4P11A 3IB1A 4U23A 1MXUA 2GFEA 3FD3A 3MVXA 5M9OA 2ALUA 3FVKA 3FUZA 1IEJA 2AL4A 2QL3A 4DE8A 3OMGA 4IGTA 2O68A 4AQ4A 1WVJA 1NNTA 4KQPA 3RY3A 2I49A 1UIVA 1B2HA 2R9JA 2XXWA 3FC3A 4PFTA 1SVXB 3H4ZA 1H3ZA 4C5EA 1B05A 3OYEA 4TLLB 4C0RA 4UA8A 4EQ7A 2GHBA 2PX1A 5AA4B 3VVFA 4HS7A 3TTMA 4ZEKA 4F29A 4JBZA 4XXUA 1P1QA 3T93B 1CE2A 4BE2A 2V84A 1MG1A 1H45A 3HPIA 3OENA 3OXNA 3PUXE 1B3HA 3C34A 1OIBA 4QSCA 4YMBA 4Q5TA 1OYXA 1MXWA 3OYJA 1DPEA 4JWOA 1B6HA 1QULA 4QQDA 3SD4A 1OLCA 4BDNA 4Q8RA 3TCGA 3CSGA 3TTLA 2XXQA 2Y7PA 1HSLA 4QVZA 1LAGE 2REGA 5I59B 4KYDA 5I58A 3O6HA 2P2AA 3QYTA 4ZEIA 5FHNA 3RNNA 3K02A 3D4GA 4Q30B 2PT2A 4XKRA 3QK6A 1RKMA 3FXUA 1BKAA 2E6NA 1SDXA 3LSLA 2RJFA 2EQKA 3IOWA 1LFIA 4ELRA 2DP8A 4PQJA 3C31A 5H8FB 4RK9A 3HHGA 4U1OA 1Y1MA 3TCFA 3V8XB 2Y7WA 1ATGA 3C32A 3SESA 3TPAA 4R2BA 1B7UA 2E5QA 3G3JA 3OS0A 4GXAA 1I6QA 4L17A 4N4IA 1JW5A 3I6VA 1MH3A 1LLSA 3FVNA 5CMKA 4LONB 3E9XA 4A4HA 1MY0A 4QRZA 4WXJA 3CG1A 1N04A 1M5CA 3QIMA 5C0MA 4KR5A 2OK2A 3PMVA 2ANJA 4LQ2A 4PP0A 3AXFA 4PL6A 3KOTA 4KI0E 3FV2A 3TCHA 3OMCA 3TTNA 4II1A 2EQMA 1URSA 1MY4A 2WKYA 2D9TA 3KZGA 3EHSA 3TEPA 5CIUA 2ONKE 3MP1A 3K01A 2ESNA 3ASKA 4BACA 4C1UA 1B46A 2RC8A 3H6WA 1OQHA 4GXSB 3MJNA 3PMWA 1M5EA 2X4YA 4F31B 3A09A 4N07A 1IXIA 1Y3NA 4P0GA 2RJEA 3O29A 2CMOA 3FATA 3JZJA 2F36A 1ZLQA 3OYIA 4H0WA 3M3FA 3TUSA 3VDFA 5H8NA 5EYFA 1SW4A 3R26A 4K3FA 3FV1A 3EHTA 3CFLA 4FEDA 1BTJA 4ONYA 3S9EA 1NH8A 3H06B 1XC1A 3TELA 1XS5A 2DSFA 4L59A 1TWYA 3I3VA 2NVUB 3G7WA 4IURA 3MPKA 4IGRA 4MH5A 3B7DA 1XOCA 1MH4A 2QPQA 2XX7A 3S9MC 4U1ZA 5TPAB 3UP9A 4DXBA 4OZ9A 3IAZA 2X4XA 4FATA 3SEWA 3DP4A 4QFOA 4YB6A 4FJPA 5H8SA 4XTCQ 2O4XB 5H8QA 5ITPA 3PU5A 4AB6A 4Z02A 1PB7A 3K1NA 5I2NA 2I58A 3G3HA 4LZ7A 4LUBA 2XX8A 5IAYA 1N76A 4XKQA 4C5IA 2Z8FA 1Z7NE 4DXCA 2M1HA 5D6YA 3IB0A 2QS2A 4GF8A 3QUFA 1B4ZA 2Q89A 1XHYA 4XIGQ 5BWJA 2Q8JA 4NF5B 3C33A 4H6DA 3S3NA 3M3KA 1Q1KA 2K3YA 1Y4TA 4JSOA 3ILUB 1IZ1A 1B51A 1MM6A 4WEDA 3MEWA 1J1NA 1RYXA 2UVJA 3N6UA 4KCDA 3BFTA 1JETA 4F1YA 4E7HA 1RYOA 4UC4A 3OO9A 1M5BA 2Q9TA 2V3UA 2K3XA 4EDUA 1LAHE 3OYLA 2F8DA 3R7XA 1MQGA 2AL5A 4R2FA 4ND9A 1P1UA 3META 4EF1A 1QKAA 2O1MA 4MLQA 2CKKA 3VLVA 2HFBA 3SEUA 3OO7A 3FJGA 1SYIA 3S9LC 1ZU0A 3CEYA 1Y3PA 5I84A 3ZEHA 4OTEA 4N13A 1Y9UA 2BJJX 5F7VA 1LB8A 1USYH 5FTIA 1OZ3A 4ELQA 4ZEBA 4FORA 2I0BA 4I9DA 3FEOA 5J39A 3OEKA 4IKFA 3E9GA 2DWIA 2DE2A 1FTKA 4ZEDA 2DYXA 3G3GA 4RPOA 2R5MA 1IQ7A 1Z7ME 3DP6A 4Q0CA 3DB4A 4JSDA 3W9WA 3WAEA 4I62A 2OZZA 3OD7A 4E7JA 3O66A 4R74A 2ONSA 2DE4A 3KSJA 3GLBA 2L3RA 3LSWA 2RI5A 3L42A 1LGBC 4A4FA 3ZS6A 1ZBMA 4Z0IA 2HAVA 2VHAA 2OWSA 3IR1A 3O8VA 1B58A 1DTGA 5TU0A 4X48A 5EHMA 3HSTA 1JQFA 3HV1A 4Q5WA 5KCHA 3OOAA 1TT1A 2A5TA 1ZMGA 3MZBA 1YPNA 3QAXA 1WJRA 4F3BA 2B8AA 4EUOA 4H8JA 2O84X 2XXRA 3KJ7A 4YAHX 5JK4A 2R5AA 2MWPA 4ZDMA 5I56B 1ANFA 1FW0A 2LDMA 3PPPA 2JTFA 2YLNA 2EFIA 4DCXA 3HCQA 4BD3A 1EU8A 1I6BA 4IO3A 1B32A 2LRQA 5K2YA 1PB8A 4H8IA 2OJTA 4EXLA 5L9MA 1LFHA 4QFLA 1KHCA 5KCJA 5HPQA 3VLUA 2DQVA 4A4GA 3KBRA 1SI0A 3TODA 2X26A 2QMXA 1GTKA 2F34A 3VLWA 3OYAA 3O9PA 3FIRA 3IO6A 4ZZAA 3DB3A 1AH5A 4YB7A 3MP8A 4ELPA 2FYIA 2PYYA 3E13X 1YCJA 1LB9A 1FQAA 4PLLA 3L2WA 5I57B 4QQ6A 3BBRA 1II5A 2A5TB 4QHQA 2RINA 3EAEA 1Y1ZA 2ZXTA 3KN7A 1ZKBA 5AA3A 1EH3A 4R9FA 1EZOA 4F1VA 1DSNA 3RQTA 4F2QA 2UVHA 1B40A 4IO2A 4GWOA 1QUIA 2LCCA 1B3FA 1VFDA 4KFQA 4R75A 1B7ZA 3CFXA 4WEPA 3FDRA 3GBBA 2E0SA 3IL1B 1WDNA 2QSXA 1B3GA 2F7AA 4N4HA 3RN8A 3OYDA 2Q88A 3TQLA 1OVBA 1B0LA 4G68B 1SW2A 4DZ1A 1D9VA 1MXXA 3SDFA 3ME9A 1SW1A 1YTVA 4QSEA 4H65A 3P8DA 3R6UA 1S9TA 3RT6B 4GRKA 2H25A 2NWJA 3FASA 4LQ5A 1Q35A 3A3CA 2G29A 3VFJA 1UIUA 5CBSA 4ISUA 2BUDA 3N94A 3MBPA 4MFIA 3OYKA 3TTKA 4PE5B 2Y7RA 5KE2A 2RJDA 2QQRA 5EHSA 1R1NA 4H1XA 2F7CA 1XNIA 4FU6A 1DTZA 1BP5A 3VE1B 4BDZA 2UVIA 3H03A 1MPDA 4M1VA 2V3QA 2DIQA 1N27A 4BLAA 3OEMA 5AA2A 4DDDA 1D9YA 5FRMA 4YU0A 2RJCA 3OYFA 4NF5A 1BIYA 1N7XA 3LGLA 5DVJA 2RCBA 3CG3A 2GFAA 3UWNA 4O3BA 4NMYA 5KCOA 2XX9A 3OYMA 1B4HA 1WGSA 2L8DA 4ZEFA 3LX7A 3OELA 2YRVA 4YKKA 5DVFA 1US4A 3OS1A 2WACA 1NMUA 2EKOA 5KDTA 3UN6A 3ECRA 4R73A 3O2AA 1M5DA 1FQBA 3EQ1A 1Y4CA 4IO4A 4OMBA 5FHOA 3T66A 3KFMA 2O7UA 4NE4A 4JWYA 3NTIA 5B7DA 1PC3A 1WODA 1PDAA 4EF2A 4BDLA 3DM0A 4I8CA 5KH6A 1B3LA 2AYSA 5DVIA 4NF6B 1OLAA 3OSRA 3V83A 4B9WA 2EQJA 3O6GA 4JXIA 3G3IA 1A55A 3K1PA 1H43A 5LOMA 4IO5A 3SETA 2P0KA 1I69A 4N4GA 5JEIA 3MEVA 1SW5A 1N3XA 4IO7A 4JB7A 4E7IA 4EDPA 5KZTA 1JW4A 2M16A 4FL6A 3FZVA 3TTRA 4OFOA 2P1SA 2BIVA 1I6AA 2PQWA 2DS9A 4POWA 3OYGA 3OQ5A 2I6EA 2OCUA 1URGA 3N26A 4Z7EA 1KWHA 2DAQA 4PFYA 3GOXA 2B3FA 5IAIA 2X7PA 4RNSA 2HZKA 3Q27A 3P7IA 3JYRA 4YZZA 4OVAA 2ZMBA 1P1WA 1R9QA 5DTBA 2ZYMA 2HCAA 5TPAA 3C4MA 4NF8B 2F6GA 4GLIA 2XXPA 3C9HA 1MDP1 3SEYA 5DEXA 4WKMA 2O4XA 4IUUA 1UTBB 1D4NA 3CR9A 4G8MA 3MZ1A 3IJXB 1B9JA 1MM7A 4C5GA 3LLRA 2DE3A 4R6KA 3V89B 2H98A 4F1UA 2GH9A 4X34A 1GR2A 4OWDA 4U22A 2RHZA 2ABHA 3H6TA 3UIFA 4OYVA 3HHFA 5DYHA 4NWDA 3PMTA 3MP6A 5IN1A 4OERA 5ISUA 1H76A 1USYE 3EHUA 1LCTA 4C1TA 2O6AA 1B5JA 1MDQA 1D3KA 3OMBA 2B3BA 3CVGA 4JWXA 1MPBA 3ZKLA 3EPEA 4QFKA 2YPNA 3ZSFA 3H6VA 1LBBA 2R58A 4M4GA 5L9SA 1FTJA 1A40A 4IUTA 3L2VA 4QSDA 3N6TA 3U1OA 5ICTA 1OVTA 4IB2A 1VE4A 5FTHA 1R9LA 2HEUA 1AMFA 1LCFA 1OZ2A 2THIA 3Q29A 1AL3A 1JW1A 4F3SA 4FECA 3DELB 2M0OA 4KYEA 3FXRA 4MF3A 2F6PA 4G2ZA 4FEBA 5I57A 4OQOA 1FQFA 2YJPA 3U72A 4YB5A 3UK4A 3FLGA 4GFRA 3C36A 4IY6A 3M3LA 3PPNA 2BKDN 3OYHA 5A5XB 4HCYA 3U94A 5AE4A 2VD3A 1QKBA 3PUYE 3T9HB 5J1DA 4E0WA 2RF1A 4ESWA 2OWTA 4KPTA 2HXWA 3UT1A 4HW8A 1UTHB 2RO0A 2UYEA 4E7KA 2DXYA 3DLMA 1NNKA 5DEXB 3U8QA 4MBPA 3CRBA 1MXYA 2UXAA 1VR5A 3P8HA 1N84A 4JDFA 2W7YA 3K4UA 4TOZA 4GQOA 2I4BA 1MRPA 2PBWA 2G93A 1MQJA 2DWHA 1OI1A 4G8NA 2H4IA 2GFUA 5FRNA 2XK0A 2XXYA 3KJTA 3TFLA 3IOVA 2R57A 4DXUA 4R6YA 2M8CA 4DCYA 5CBRA 1WJQA 1US5A 4LZ8A 4U4XA 3PGFA 3PUWE 2LVMA 1OQGA 4AB5A 2O1LA 2VYTA 4B9XA 3QSLA 4H5FA 3RGYA 3MPLA 1N7WA 2B65A 4G77A 1JNFA 3RT8A 2VGQA 4F18A 5ELVA 5I59A 1H44A 2F5KA 3Q26A 2NUVA 3GXAA 2NOOA 2DOJA 3KG2A 4XKNA 4QF9A 2RI3A 2X4WA 5L9OA 3PMXA 1ZTYA 1TFAA 3L2UA 1URDA 3K1MA 1FTLA 5HBCA 5CM6A 4U4SA 3I5OA 2RHIA 2I48A 1MHNA 3TKDA 3B6WA 4LD6A 4RXLA 4BDOA 3F70A 5BUUA 4RK2A 1MPCA 4F19A 2VP1A 4R72A 3W15C 3D4CA 2PMSA 2V3TA 3L2QA 2REJA 3CFZA 3MEAA 4GD5A 4F39A 2X35A 3FJ7A 4HTGA 1B52A 3PPOA 2PVUA 1XVYA 4BDQA 3S9NC 1S50A 1MY3A 1S7YA 3MVWA 4ECFA 5J26A 3IOUA 3PPQA 2LTOA 2RI2A 4R9GA 1DOTA 3LR1A 3MVZA 3LUYA 3T9VA 4H67A 2I3VA 1EZ9A 3IO4A 3HN0A 3H3GA 1LAFE 2VOZA 1IXGA 2LAOA 3T22A 2HQ0A 1HSEA 3TDJA 5ICQA 1L5TA 4GY5A 3K6UA 4RPNA 4QW2A 1JEUA 3VVDA 3EN3A 1F9BA 2H9BA 4ZTFA 3L2RA 3KN3A 1WJSA 3PMIA 4MLVA 2D21A 3V5AA 4OENA 4P0IA 3QUJA 3Q1JA 3B6QA 4C5HA 3H6UA 1JVXA 5JTYB 4G4PA 3MW0A 1NFTA 2ZNUA 3L6HA 1IXHA 4OEVA 2CZLA 3FVGA 4YICA 1SYHA 1A8EA 4NTLA 2ZYNA 1IXCA 1A99A 2PT1A 3K6VA 2E1SA 3LSXA 1QW0A 4OEUA 5I56A 2XXUA 3BKIB 1VSOA 4OESA 5I2NB 4LA9A 1O7TA 3S6WA 3UA8A 4X9TA 3RUMA 5L8DA 2F35A 3QXMA 2XXHA 1B1HA 3QKJA 1POY1 5I2KB 5B70A 4DLDA 3IX1A 3VV5A 1FTOA 3SEXA 3S3OA 4TLMB 4BDYA 2RHYA 3PD9A 1SD3A 2HQEA 3NTHA 1QVSA 2QS4A 1HSJA 2KLFA 2QJEA 1LSTA 4FIMA 2D5WA 1GGGA 2Z8EA 2G3RA 1PBPA 4OETA 2DVCA 3PV0E 1MY2A 4XKPA 4X1DA 3Q25A 4GOTA 5AA4A 4OFLA 4HCZA 2RC9A 3QJ6A 1B1XA 1DPPA 4ELOA 2XD3A 4G68C 1IIWA 2ZYOA 3S3MA 1B0HA 3T96B 3MC2A 3WAFA 1MXVA 5H8NB 1YAEA 3SERA 3FJMA 1PEBA 1NNPA 2GHAA 3MZ9A 4ZE8A 3OYNA 2O7IA 3GZGA 5I58B 5CMCA 3KN8A 4LVQA 4FE8A 1O63A 4EQ9A 3OO6A 3KEIA 1LBCA 2Z8DA 2UVGA 3MO8A 5C6SA 2VD2A 5JTYA 4YKIA 4IUQA 1NL5A 4E7LA 3SEVA 2UYFA 5CMMA 4EXKA 1SI1A 4ZZEA 1TXFA 3TQWA 4F3GA 4R6HA 3OYBA 4OVJA 4U2RA 1FQDA 1LAXA 2XXXA 1B7HA 3QIIA 4NF4A 3O28A 4X1BA 2ZYKA 3MVYA 3GBAA 2IEEA 5H8HB 3IOTA 3IB2A 4F3PA 2V93A 3DP8A 3BDLA 1TFDA 5I2KA 4RA1A 3A3UA 4NEDA 1QUKA 4HCWA 4YKPA 4OXVA 3MAMA 3MUQA 3OO8A 1PBQA 1P1OA 1H3DA 1A54A 3TAJA 2Z23A 3T9UA 5AA2D 2R71A 4BDRA 1MQDA 4KHZE 1GV8A 3MQ9A 5H8FA 3M9QA 4H5GA 3K2DA 5KDTB 3E3KA 2HQXA 4IY5A 4KCCA 5D6XA 1A8FA 1QJMA 3DLNA 4BDMA 4QFPA 4ZS9A 3MEUA 4GL0A 1O64A 3HO7A 4LP2B 3LC8A 4F22A 5CC2A 3LBSA 4KYSA 1JEVA 2DIGA 3PFSA 5FROA 1BLFA 3PPRA 2O51A 1B5IA 5TP9A 2Z22A 3S2VA 1UTHA 2D3IA 3ONMA 2O69A 1JVYA 2NLUA 1PB9A 2QMWA 4RG2A 4G68A 2R6GE 2RHUA 2XXVA 2I3WA 3USDA 5TP9B 1UQWA 3RLFE 4NF4B 4BE1A 1OMPA 5D6WA 2RHXA 3THIA 3KUFA 2H5YA 1CB6A 3PUVE 3IJOB 3M8UA 3LGFA 4PLIA 2FNCA 1N3WA 5FHMA 4UACA 2V25A 1NH7A 1GVCA 4U21A 5M2VA 2GRVA 1NKXA 2F5XA 3F11A 4O3CA 4F2OA 2AIXA 3FGSA 4NWCA 5ITOA 1T0KA 1FQCA 5DT6A 2EQUA 3G3FA 5AA2B 4THIA 3EF7A 4A4EA 3E4RA 1B3EA 1DMBA 2IA4A 4POXA 3KGCA 3CSBA 4RY1A 3UGWA 3K6WA 5H8QB 3E9FA 3FVOA 2RKMA 1G5VA 1VFEA 1SBPA 5KE3A 4OHNA 3L6GA 4DIGA 1P1NA 4LZ5A 2XXIA 2F7BA 3PUZE 5H8HA 1MS7A 4G8HA 2A5SA 3H6ZA 3OS2A 1IUDA 4QQGA 1P99A 2Y84A 5A5XA 3LSFB 2H99A 2I0CA 2GF7A 4N6PA 3K0VA 5AA1A 4O3AA 2MWOA 1SSFA 1M5FA 3RTFB 2QQSA 5CMBA 2RC7A 3VXBA 1FCKA 1UTBA 2Q2CA 2DXRA 5CRYA 4LATA 3KSXA 2ZNTA 3ILTB 2XHDA 2DWJA 3UORA 3MWBA 2RCAA 4ESXA 3T9XB 3C4SA 2XD2A 4KD5A 3TMGA 2OLBA 3ZKKA 2X7QA 2DWAA 3TZAA 3RPWA 1FQEA 2P0SA 1SQYA 1MQIA 3BFUA 1ELJA 3OSQA 4BE0A 4PETA 2QS1A 4TQUQ 2Y7KA 4NS5A 3NTKA 4PFWA 1ZIUA 5HM4B 1XT8A 2FA7A 5IKBA 4QFNA 1ZJLA 3K00A 4GVOA 5F1QA 3H8ZA 3H7MA 1R6ZA 3O6IA 4YMAA 3ODBA 1IITA 4GIZA 4IO6A 4NF8A 2HZLA 2F97A 4GL8A 1EZPA 1FTMA 3W9VA 4RJZA 2QRYA 1XVXA 3OYCA 2NXOA 4IUVA 4ZECA 1AOVA 4OFJA 3LYIA 4YKJA 4E0XA 2IG0A 1MY1A 4FAJA 4IUPA 2XDPA 1AIVA 2Q2AA 3U93A 1MXZA 4EQBA 2ONRA 2I4CA 3VXCA 1LFGA 3PD8A 3IORA 3OY9A 5KCJB 2ZNSA 3IK6B 3B6TA 3JV9A 1MQHA 1Y20A 4NF6A 2DVZA 3Q28A 3PNWC 3S4UA 3CI8A 3RTWB 1B5HA 3G3KA 3CIJA 1A7LA
chains in the Genus database with same CATH superfamily
3OB9A 3MKDA 4PJOG 2Y7IA 1AWWA 3VVEA 2QS3A 1BU1A 1N0TA 2LMJA 1RI0A 1QUJA 4ZE9A 3U92A 3SB2A 2GQIA 2F78A 2VGMA 4NG7A 1QMCA 2CT4A 2D0NA 3FIFA 4X9DA 3OA6A 2XXTA 4C0DB 1GBRA 2RMOA 4PFUA 3FXQA 3K6XA 1UGPB 4XU2A 2K7AA 3IFAA 4ORZA 5CI5A 5K2XA 3CD6T 4ZTJA 4RYAA 1QGXA 3EKIA 1ARKA 3HFOA 1YJWT 2KR0A 3LH0A 1NNFA 2VT5A 3C35A 4I1DA 1Y3QA 3SKPA 1WX6A 1D0XA 1LBWA 2HAUA 3TYHA 2YDLA 4B6MA 3VS0A 2OBGA 1QWFA 1POTA 2EYQA 2JZ2A 2LQKA 4CRIA 3N5LA 4ANJA 2DXTA 2FHDA 3QBYA 3NHNA 3KOSA 1WXBA 3O97A 2L89A 2RN8A 1NV3A 4P11A 4PJOC 3IB1A 4U23A 4M77F 1MXUA 2GFEA 3FD3A 3MVXA 2QI2A 3RUXA 4P1LA 5M9OA 2ALUA 3FVKA 3FUZA 2EGCA 3CCVQ 1M1KU 1IEJA 1BI2A 2AL4A 2XDBA 2QL3A 4DE8A 3CCLA 5GAMd 2RH2A 1UECA 4AT1B 1QLYA 3UF4A 3OMGA 4PJOE 4I3YA 2DO3A 4IGTA 1ZA2B 5J3BA 3CCQQ 4ELYC 4FYYB 2O68A 4AQ4A 2AHJB 1WVJA 5I7IA 2KXCA 1LBZA 2DL8A 1SRMA 1NNTA 3MYUA 4KQPA 1U8RA 2YXYA 3RY3A 2I49A 3H0HA 2ROTA 5CO7A 2KRNA 5I3SA 1K0SA 3M56A 3VS7A 1UIVA 2DD4A 1B2HA 2R9JA 2QQAA 2XXWA 3FC3A 4PFTA 1SVXB 3H4ZA 2FBPA 2DETA 1F1BB 4Y92A 3E1SA 1H3ZA 5EG2A 1I07A 4C5EA 1B05A 1ZQ1A 2VV5A 2FB7A 3VU3C 3OYEA 4TLLB 4C0RA 4UA8A 1PD1A 2RQWA 3CCJT 4DI4B 4AFZC 1H92A 4EQ7A 2GHBA 2PX1A 5AA4B 3VVFA 1X6BA 3CCVA 4HS7A 3TTMA 4ZEKA 2F2XA 4E7SA 3A8OB 1KQSP 4F29A 1SHGA 3VS6A 5KYUB 4JBZA 4PFBA 4HCKA 4C8QA 4XXUA 2EBPA 5GAMh 1FPGA 1P1QA 4RTUA 3T93B 5A0LA 4N0AA 1CE2A 2DPPB 4BE2A 4MIJA 1KC8C 4M75C 4NN3A 2V84A 3V8KA 5I11A 1VQOQ 1V29B 2P0QA 1MG1A 1H45A 3HPIA 4DBFA 4JUVA 2HD0A 1RI9A 3DKMA 3OENA 3OXNA 3PUXE 1Y07A 5HK3A 1B3HA 1NEGA 4O8MA 3C34A 1RLQC 1QCOA 1OIBA 4QSCA 4YMBA 4Q5TA 3GLXA 1OYXA 1MXWA 1VQ6T 3OYJA 1DPEA 4C92F 4JWOA 1B6HA 2HDAA 1U1TA 2L2PA 1QULA 1LEVA 3I55Q 1FBCA 2C06A 4QQDA 1VYTA 3SD4A 1OLCA 4BDNA 4Q8RA 4XTVA 3TCGA 3EGDA 3CSGA 2JM9A 4QT7A 2RK2A 3CCSQ 3TTLA 2XXQA 1M2VB 2K79A 2Y7PA 3JCMf 3QG1A 1G3YA 4M7AB 4F7UG 1HSLA 4QVZA 3VUBA 1LAGE 2REGA 4F7UA 4M75D 5I59B 3QWXX 4KYDA 5I58A 3O6HA 2P2AA 3QYTA 3NFCA 3SWNA 4ZEIA 5FHNA 3RNNA 3K02A 1OQKA 2IPOB 4OGEA 1IMFA 3D4GA 4Q30B 4E6RA 2PT2A 4PBHA 1B3QA 2CP3A 3QK6A 4XKRA 1RKMA 3NMZC 3HPWA 1TTHB 3FXUA 1TU0B 2NUPA 1BKAA 2E6NA 1SDXA 3LSLA 5GMKe 2RJFA 3JB9F 2CDTA 2EQKA 4EMKA 3IOWA 1LFIA 4ELRA 2DP8A 1WLPB 3CBOA 1QVFS 2AKLA 1VQ7T 4PQJA 2DMOA 4NGUA 3C31A 1T0JA 5H8FB 2Y90A 4RK9A 2EPDA 1FPBA 3HHGA 4U1OA 2IVWA 1Y1MA 3TCFA 3V8XB 3CCSA 2Y7WA 1ATGA 1QVGP 4NL3A 3C32A 3SESA 3TPAA 4R2BA 1B7UA 2E5QA 2XWIA 4JZ4A 1M8MA 3OS0A 1GFDA 3G3JA 1I6QA 4GXAA 1VQNT 4DI3D 2V8IA 2BJIA 1VQMQ 2D6FA 1MGQA 2EVRA 1QVFP 1IMAA 2B4LA 2E70A 3G6ET 3CCRQ 4L17A 2W10A 1KD1U 3LH5A 4N4IA 1M1GA 2E64A 1JW5A 5GAN4 2L3QA 1WNLA 5HKCA 3I6VA 3JCMW 2KVQG 4C0DC 1YJNQ 3ER0A 1MH3A 4GBWA 1LLSA 3FVNA 1T0HA 5CMKA 4LONB 3E9XA 3CC2Q 1LBVA 3QZ9B 3G6EQ 4A4HA 1MY0A 4QRZA 4WXJA 1WFWA 4RKUE 3CG1A 1N04A 1M5CA 3QIMA 2YUOA 5C0MA 1IMEA 2OK2A 4KR5A 3PMVA 2ANJA 8AT1B 4LQ2A 4R55A 4PP0A 4C92E 3AXFA 5ET8A 4PL6A 2DX1A 3KOTA 1UTIA 3FV2A 2CEXA 2K5LA 3OMCA 4KI0E 3TCHA 4OVSA 2K6DA 4Y91A 5GANe 1VQMA 1VQ4Q 3TTNA 2FG0A 4II1A 4O6JA 2EQMA 1YITT 4P3LA 1URSA 1MY4A 4JVDA 1PM3A 2WSCE 2WKYA 1G8XA 3CCRA 2D9TA 3KZGA 3EHSA 4DBRA 2DD5A 3TEPA 4PDHA 1PCXA 5CIUA 2ONKE 5GAOl 3MP1A 2ZCFB 1TSFA 3K01A 2V1RA 2ESNA 4GWXA 3ASKA 4BACA 4C1UA 1B46A 2RC8A 3H6WA 3G6EA 1OQHA 4GXSB 5GMKl 3MJNA 3PVLA 3PMWA 1YI2T 1VQ5A 1M5EA 2X4YA 2KGTA 4F31B 4LDVA 3A09A 3IQLA 1K9YA 4N07A 1IXIA 1Y3NA 1EYJA 4P0GA 2RJEA 3O29A 4XU3A 2CMOA 3FATA 4MDXA 3JZJA 2F36A 1NZ9A 1JEGA 1ZLQA 3OYIA 4RMOA 1RUWA 2WEFA 4H0WA 1HXDA 1AWJA 2HL5C 3M3FA 3TUSA 2PVDB 2YUQA 8ATCB 4M75F 5GAOr 1ZUKA 5H8NA 3ZFJA 3WXMB 3VDFA 1RDZA 5EYFA 2Q74A 1SW4A 1YXIA 3G1JA 3R26A 4K3FA 4OVPA 1U06A 3A98A 4M75E 3FV1A 1B34B 3EHTA 2FL7A 3CFLA 4JRKA 4JLGA 1WQWA 2KRSA 2JUFA 4FEDA 3KBGA 4OMMA 1BTJA 4ONYA 3S9EA 1NH8A 3H06B 1XC1A 3TELA 1XS5A 4C8QF 5A5LA 2DSFA 1QW1A 2QVRA 2CZ7B 2DYIA 2VKNA 4JS5A 5ESYA 2P4RA 4L59A 1TWYA 2KRMA 3QDFA 3GNGA 1PRMC 3I3VA 5LDZA 2NVUB 3G7WA 4IURA 1RAGB 3MPKA 1T3SA 4RUGA 4IGRA 3CPFA 4MH5A 2LQNA 1G2BA 3D7SB 4JDSA 3B7DA 1XOCA 1MH4A 1ABQA 2QPQA 2KYMA 2XX7A 3A8MB 3S9MC 4U1ZA 4ZGDB 1WXTA 4PJLA 5TPAB 3UP9A 4DXBA 4R56A 4OZ9A 2FHYA 1BYMA 3IAZA 2X4XA 3CCEA 1AVZC 4FATA 2LJ3A 3SEWA 3DP4A 4QFOA 3CC4A 2E5KA 2GTJA 4MNPA 4YB6A 4FJPA 1Q9DA 3RMSA 5H8SA 4XTCQ 2O4XB 5H8QA 1UEBA 1VQNQ 3GNFB 5ITPA 4L5GA 4MZPA 4MNCA 2D0QB 3PU5A 4AB6A 3EHRA 4Z02A 5LJ5h 1PB7A 3K1NA 2ROLA 5I2NA 2DVJA 2L3PA 2I58A 3G3HA 4LZ7A 4LUBA 2MAMA 5GMKi 2XX8A 1BB9A 1WA7A 1AOJA 4M78C 5IAYA 4PFOA 1N76A 4J5YA 4XKQA 2J6OA 4C5IA 1YIJQ 2Z8FA 1Z7NE 4DXCA 3CBPA 2M1HA 5D6YA 1JJ2P 3IB0A 1W4SA 2QS2A 3QHSA 2QEXA 4GF8A 4HT8A 3QUFA 4MAGA 1VQ8Q 1B4ZA 2P3VA 3SFMA 4EMGA 2Q89A 2YLCA 5GAOn 1XHYA 3OYYA 2RNAA 4J6YA 4XIGQ 1H3HA 5BWJA 2Q8JA 1V76A 3CMAA 2JS0A 4NF5B 3C33A 4A54A 4H6DA 1FPLA 3OS5A 4PAFA 3S3NA 1AHJB 3M3KA 1JP4A 1Q1KA 3BE3A 1H8KA 2K3YA 3E79A 1Y4TA 5KYXB 4JSOA 3ILUB 2JM8A 3E2UA 2DL5A 1Q82U 1KQ1A 2DRKA 1NLOC 3CHGA 1IZ1A 1B51A 2ZPFB 1MM6A 4WEDA 3MEWA 5I21A 4GWZA 2HPGA 1J1NA 4M78D 1RYXA 2UVJA 3N6UA 2CP7A 4BB7A 4KCDA 3BFTA 1JETA 1XTDA 4F1YA 4E7HA 1FPDA 4M7DC 2FIEA 1RYOA 4KRTA 4UC4A 1XI6A 1M5BA 3OO9A 2Q9TA 2V3UA 2K3XA 2QEXQ 2ED1A 4EDUA 3QMFA 5GAOp 1LAHE 3OYLA 2E3IA 4RG8A 1VQ9Q 2F8DA 1MQGA 2AL5A 3R7XA 4R2FA 1NG2A 4ND9A 1P1UA 1UHFA 1D1CA 3META 4EF1A 2CSQA 2KE9A 3CMAQ 1QKAA 2O1MA 2HZYA 4MLQA 4N6KA 2CKKA 3VLVA 2HFBA 3SEUA 4DBQA 1QKXA 4MEVA 4M75A 3OO7A 2DA9A 3FJGA 1SYIA 3S9LC 4P5NA 1ZU0A 3CEYA 2I0NA 1EZZB 4RTYA 3JCMg 4XTYA 1Y3PA 4H46A 5I84A 4LN5A 1YI2Q 2HEQA 1EX4A 4K11A 3ZEHA 5HCKA 3M4GA 4OTEA 1WIEA 4N13A 4J9CA 4XU0A 4AMCA 2FPDA 1Y9UA 2BJJX 5F7VA 1YJ9T 4CC4B 2VC8A 5GAOm 1LB8A 2OX3A 3URGA 5EYHA 1XQHA 1USYH 5FTIA 2DRMA 4JS4A 4J6XA 1OZ3A 4ELQA 1OULA 2QFLA 4PCDA 2DE0X 2DTIA 2L5QA 4PKCC 3M0QA 1MNEA 4FORA 4ZEBA 2O2OA 4OMQA 3RMQA 5AT1B 1JJ2S 2I0BA 4I9DA 4RCBA 1YHQA 1RDXA 1RAFB 3FEOA 5J39A 3OEKA 4IKFA 5EQ7A 3E9GA 2F1LA 2DWIA 2M0YA 1K9MU 3TSWA 4MMKA 1FPFA 2DE2A 1FTKA 4ZEDA 1B34A 2FRYA 2DYXA 3G3GA 4RPOA 5J16A 3CQTA 2DF6A 2R5MA 1IQ7A 1Z7ME 2WX9A 5GAN7 3DP6A 4O5VA 2CSIA 4Q0CA 4NQ8A 2PVGB 4MDWA 4Z88A 3DB4A 4C92C 5CAIA 2QVVA 1VQOT 4JSDA 3KBZA 3W9WA 1CKBA 1OPKA 4M7AC 3WAEA 5LL6S 4I62A 2OZZA 3OD7A 5GAN6 4E7JA 4F7UF 3O66A 4R74A 2ONSA 5HY6A 3VS2A 2DE4A 3KSJA 3GLBA 4JPBW 2L3RA 4ZN3A 3LSWA 2XIDA 2COYA 2RI5A 1J3TA 2FYKA 3L42A 1LGBC 1QVPA 4A4FA 3ZS6A 1QKWA 1ZBMA 4PBQA 5ET5A 4Z0IA 2XMFA 2HAVA 2VHAA 4P1EA 2OWSA 3IR1A 3O8VA 1B58A 1DTGA 1MNDA 4P8BA 4XQ3A 1R0CB 4X48A 5D7UA 4HVVA 5TU0A 5EHMA 2FPFA 3PIOA 4AG1C 1SPIA 1O75A 3HSTA 4ESRA 1JQFA 1Q86U 3HV1A 1RAHB 4Q5WA 5KCHA 3OOAA 3VS4A 3JCMV 1TT1A 3EFOA 2A5TA 2COWA 1FBHA 1ZMGA 3MZBA 1YPNA 2KEAA 3QAXA 1W70A 3REBB 2DVEA 5IGAA 1WJRA 4F3BA 2B8AA 1TUGB 1RDYA 4KUIA 3G71T 1WHJA 4N8YA 4FSSA 4EUOA 3JCMb 4M77C 1WPYA 2O84X 1K8AR 3EG3A 4OMLA 1ZX6A 2XXRA 3KJ7A 4H8JA 2D8HA 2R5AA 3CXCA 1Q86R 4YAHX 5JK4A 2MWPA 3CMEA 2LC4A 1X6GA 4ZDMA 3QUIA 1AZGB 2FPEA 3CCVT 5I56B 2JT4A 1ANFA 1Q81C 1FW0A 6AT1B 2LDMA 4JRIA 2JTFA 2YLNA 2EFIA 3PPPA 4DCXA 1MMAA 1NUXA 3HCQA 2CZ6B 3JRZA 3M0PA 1M30A 4BD3A 1BK4A 1EU8A 1I6BA 1OOTA 4IO3A 1B32A 2LRQA 2D1XA 5GAMe 5K2YA 1CNQA 5ECAA 2OTLT 5EQAA 5EC7A 3U23A 1PB8A 4H8IA 3VRYA 2OJTA 2J05A 3I55T 4EXLA 5L9MA 1LFHA 4QFLA 1KHCA 2QVUA 5KCJA 1R77A 1YJWQ 1RAAB 5HPQA 2KXDA 2IIMA 2ATCB 4WTOB 2VB6A 5LJ5j 1K73R 3VLUA 1Y96B 2ABLA 4A4GA 2DQVA 5IM2A 3KBRA 1AT1B 1SI0A 1RAIB 3TODA 4KXPA 2PVOB 3EGXB 2X26A 2QMXA 3CC2T 2DBKA 2J6KA 2L0AA 1GTKA 1KHIA 2F34A 3VLWA 4MMLA 3OYAA 3J7AF 4Z8AA 2E3HA 3O9PA 3FIRA 2DILA 3IO6A 2DKGA 4ZZAA 1G0HA 3FJPA 2MKZA 3DB3A 3N5BB 1VQKT 1AH5A 4YB7A 1E7OA 1BI1A 3I35A 3CCRT 3MP8A 4ELPA 4OANA 4PJOB 2FYIA 2PYYA 3E13X 1CKAA 1YCJA 2XA5A 1YCYA 1LB9A 1VQMT 1NUZA 1FQAA 1PSEA 2PUOB 4PLLA 4C92D 3L2WA 5I57B 2DM1A 4QQ6A 5CCAA 4M7DD 2EYZA 3BBRA 1NLPC 4M7AD 3WVDB 1II5A 2A5TB 4C8QD 3EFOB 2J06A 4HXJA 4QHQA 2RINA 3EAEA 1B07A 2OJ2A 3VYHB 1Y1ZA 2QAZA 2ZXTA 1BCMA 3KN7A 1EYKA 2XI9A 1ZKBA 1EH3A 5AA3A 4R9FA 1EZOA 4FYWB 5KYNA 2Y5LA 4F1VA 3AT1B 1DSNA 3RQTA 4F2QA 1RAEB 4ZN1A 1KD1R 2QA4A 2UVHA 1B40A 3RR6A 4IO2A 4OMFB 4GWOA 4AS5A 1IMBA 4M7AF 1QUIA 2EWNA 2DL7A 2LCCA 1B3FA 2F2WA 1VFDA 4KFQA 4R75A 1B7ZA 3CFXA 1UGQB 4P47A 4WEPA 1ZBJA 5LJ3g 3FDRA 4FYXB 4IIMA 1YP5A 3GBBA 2E0SA 3IL1B 5I2MA 1WDNA 1Z9QA 2JS2A 1Q7YC 2E12A 2QSXA 2X51A 5FU6B 2AIRB 3NPFA 4OB1B 2ZZXA 2JJ9A 1B3GA 1Q82C 4XTZA 2GTOA 1MV3A 2F7AA 3HFUA 4N4HA 3RN8A 3B50A 1VQPT 3OYDA 2Q88A 4BI4A 3TVTA 3TQLA 1FXXA 1N9SA 1OVBA 1ZA1B 4GX6A 1B0LA 2NYSA 4G68B 4HT9A 1SW2A 3RPLB 4DZ1A 4F7UB 1D9VA 1MXXA 3SDFA 1PWTA 3ME9A 1SW1A 1H641 1YTVA 4QSEA 5I2SA 2K3BA 4JJNK 3I5SA 4ME7A 4H65A 3P8DA 2AZSA 4J7FA 1S9TA 3R6UA 4NF0A 3RT6B 3TSZA 4GRKA 1JJ2A 2H25A 2NWJA 2DZCA 2JVVA 3FASA 4LQ5A 1Q35A 3QDRB 1UE9A 1BI3A 1VQ7Q 2COZA 3A3CA 1X43A 2G29A 2FRWA 4GWWA 1JO8A 3VFJA 1YWPA 1IRXA 1UIUA 1BIBA 4FCYA 4LD9K 5CBSA 3GIBA 5KYWA 4PNOA 3THKA 4J9HA 1SPKA 2GCXA 4J9FA 4ISUA 2BUDA 3N94A 1FPKA 3MBPA 1GL5A 4GWSA 4RTWA 4MFIA 2WSEE 5LJ5g 5GJVB 1LVKA 3OYKA 4PJOD 5DM7R 3OW2S 3TTKA 1HD3A 3H41A 3CD6A 4PE5B 2JNGA 5GAN3 5LJ5d 2XG8D 2EKHA 1WZOA 2Y7RA 4PFZA 1NYGA 5KYUA 1M27C 5KE2A 2RJDA 3M59A 4CC2A 3VUZA 2QQRA 4PE3A 3CCMQ 5EHSA 4HCCA 1VQ7A 4Z89A 1R1NA 2DDKA 4H1XA 2F7CA 1XNIA 4FU6A 1DTZA 2KDSA 4NHBA 1BP5A 3VE1B 4BDZA 2HBWA 2O01E 2UVIA 2DZ9A 3H03A 2MCNA 1IHWA 3VS3A 2LQWA 1MPDA 4M1VA 2V3QA 2DIQA 5LJ3h 1N27A 1NPPA 3IFCA 1C1AA 1O9SA 5IH2A 4BLAA 4DBHA 1I1JA 3OEMA 2KT1A 3I56A 4KULA 5AA2A 5DY9A 4KH0B 4DDDA 1D9YA 1VQKA 2AK5A 4CC3A 5FRMA 3JSCA 4DA4A 4LNPA 2RJCA 3OYFA 1BBZA 1D09B 2PCRA 4YU0A 4NF5A 1BIYA 1N7XA 3LGLA 3M4YA 1WHGA 5DVJA 3I9QA 3C12A 2RCBA 1K73C 3CG3A 2GFAA 2ESWA 3UWNA 1YITA 4NMYA 4O3BA 5KCOA 4C0GA 2K9GA 2CP2A 2XX9A 1E6HA 4XTXA 3OYMA 3I5RA 1WGSA 2L8DA 3CCMA 1B4HA 1FBEA 4ZEFA 3LX7A 5AYFA 4PFIA 5IZ3A 2PTKA 3OELA 2YRVA 4YKKA 5DVFA 1US4A 3CCJQ 1CSKA 3OS1A 3DLLA 1X75C 2WACA 1G3SA 1YJ9Q 4QXDA 2DLPA 4PFPA 2YHTA 2L5VA 1NMUA 3SZPA 3SWNB 1KC8R 2EKOA 5KDTA 2KROA 3UN6A 2YSQA 3ECRA 4R73A 5ET7A 1NBEB 3JB9H 3O2AA 1M5DA 1FQBA 3EQ1A 1Y4CA 5FWCA 1Y71A 4IO4A 4OMBA 5FHOA 2ZGWA 3CPWA 3T66A 3KFMA 1SKUB 2O7UA 1FX7A 3G4SA 4JWYA 1X27A 3NTIA 4AG2C 4NE4A 2QDYB 2K5FA 4JZ3A 5B7DA 1ACMB 4OVRA 2O31A 2YT6A 1PC3A 1WODA 1UUEA 1PDAA 3L1AA 1G3TA 4XAXB 4M7AE 3MCAB 4BDLA 1MUZA 4EF2A 2O9SA 3DM0A 5GAMg 1FRPA 3CMET 4ATOA 4I8CA 4M7AG 5KH6A 1B3LA 1JBMA 1NV1A 2AYSA 1KA1A 5DVIA 3HFNA 4NF6B 1PSFA 2CP6A 1OLAA 3OSRA 3V83A 4B9WA 3CCJA 2EJ9A 1WDXA 4HE2A 2EQJA 4HVWA 3O6GA 2RQUA 2QASA 4N0AC 4HKEA 4JXIA 3G3IA 1A55A 3K1PA 1H43A 1IZ6A 5LOMA 1M5Q1 4IO5A 3SETA 2P0KA 1X6OA 2BE7D 2CZHA 1I69A 1EIFA 5CVIA 1KD1C 2GGRA 1IB8A 4N4GA 5JEIA 3MEVA 1GFCA 2QGGA 5F24A 4LXCA 1N3XA 1SW5A 4IO7A 4JB7A 1NM7A 4E7IA 4EDPA 5KZTA 1JW4A 2M16A 2H3EB 1JB0E 4FL6A 4C0ZA 1M3CA 3FZVA 3TTRA 3QJYA 4OFOA 2FVUA 2P1SA 2BIVA 1I6AA 5KYWB 4OF1A 4FW1A 2PQWA 9ATCB 3CC4T 2DS9A 4AFUC 3H0IA 4POWA 4PJOF 3NOHA 4FW2A 3OYGA 1KC8U 3OQ5A 1D9QA 3X28B 2I6EA 2OCUA 1URGA 3N26A 4J9EA 4HVUA 2F2VA 4Z7EA 1KWHA 2DAQA 4JJDA 1M3AA 5FU7B 2Y4YA 3FJ5A 1W2BS 3BIGA 2CP5A 2HKQB 3GOXA 4PFYA 2B3FA 5IAIA 4OGCA 2QDLA 1Q86C 2DEUA 2X7PA 2HZKA 3G71Q 3Q27A 4RNSA 3P7IA 2A08A 3JYRA 4YZZA 4OVAA 2ZMBA 1P1WA 1R9QA 2CEYA 5DTBA 1SSHA 2ZYMA 1KZ8A 2HCAA 5TPAA 3C4MA 1LCKA 4NF8B 1MMDA 3ROJA 2XWVA 2F6GA 4GLIA 2XXPA 3EG1A 1FBFA 3C9HA 1MDP1 3SDZA 4OMPA 4PJOA 1HK9A 5DEXA 4WKMA 2V8KA 3CCQT 2O4XA 4IUUA 1NJIR 1YHQT 5T3JA 1KG1A 1W6XA 4D8DA 3JCMd 4M77A 1DBZA 3A5ZB 1UTBB 4WCIA 1D4NA 3CR9A 4MNIA 4G8MA 4M77G 3IJXB 3MZ1A 2WYKA 1B9JA 1U1SA 2LJ1A 4EMKC 1MM7A 4M78F 2X9HA 2CH4W 4C5GA 3CCQA 3LLRA 2DE3A 1NV5A 2CYZB 5FWBA 4RTXA 2BZ8A 2PZ1A 3VYGA 4R6KA 2AKKA 2XHCA 4XTWA 3V89B 2H98A 2LJ0A 4F1UA 2GH9A 3HP9A 4X34A 1GR2A 1WHKA 4OWDA 3G71A 4PAKA 2J7IA 2RHZA 5GANh 4V2SA 5GMKj 2ABHA 2O9VA 3H6TA 2PU9B 3TEEA 4OMOA 4OMNA 3UIFA 4OYVA 2HXRA 3HHFA 5DYHA 3HL8A 3REAB 2VASA 4NWDA 4N4UA 1NV7A 3PMTA 4JRQA 3MP6A 1A0NB 2AZVA 5IN1A 4OERA 5ISUA 1H76A 1USYE 3V7RA 3EHUA 4E2FB 1LCTA 1Y7XA 2P4TA 2DL4A 2M02A 4C1TA 2O6AA 1B5JA 1MDQA 1KSWA 3R6OA 2HSEB 1D3KA 3OMBA 2B3BA 3CVGA 3JB9I 4JWXA 2KY9A 4J9DA 2B86A 4OB2B 4MX6A 2FZKB 4XTUA 3UA7A 1MPBA 1K73U 3ZKLA 2FEIA 1TH7A 2ED0A 3EPEA 4QFKA 2YPNA 2DK3A 2EW3A 3ZBDA 5LJ3j 1VDWA 3VS1A 2DXUA 2K5IA 5KYYA 2FIXA 1QVGS 3ZSFA 2QGFB 2KQWA 1M2OA 1AWOA 3H6VA 2E65A 3UDCA 1LBBA 2A0FB 2R58A 4M75G 4M4GA 1FTJA 5L9SA 2KYBA 1A40A 4IUTA 4OP0A 2XKOC 3L2VA 1Y0MA 1M90U 2OAUA 3EG2A 2DTHA 5KYYB 2ZZWA 4PJNA 3N6TA 4QSDA 3U1OA 5ICTA 4C8QG 3CCLQ 2VVKA 4M7DE 1OVTA 2GNCA 4IB2A 1VE4A 5IZ1A 3D1RA 5FTHA 3B8BA 1ZUYA 2HSPA 1R9LA 2BZYA 2YRDA 1K9ZA 2HEUA 1JQQA 1AMFA 4N6DA 2KAFA 1LCFA 1SRLA 1OZ2A 2THIA 2YRCA 2HCKA 3Q29A 1AL3A 1W2BA 1JW1A 4F3SA 2QA4T 4FECA 3DELB 2M0OA 1Q7YR 3FXRA 4KYEA 4MF3A 1NYFA 2F6PA 4G2ZA 3C0CA 4FEBA 5LJ5f 5I57A 5DLOA 1QVGA 4OQOA 1FQFA 1VQ4T 2YJPA 1IMCA 4YB5A 3U72A 3UK4A 1M4ZA 3C95A 3FLGA 3CBMA 4GFRA 4IIOA 3C36A 4IY6A 1K1ZA 2CUBA 3M3LA 3PPNA 1B7TA 2BKDN 3RKXA 4UABA 3PTYA 3OYHA 5A5XB 4HCYA 3U94A 3X26B 3QZ5B 1YN8A 1ZHIA 4LDWA 5AE4A 4J9IA 5GANg 4XU1A 2VD3A 1M90C 5LJ3e 1QKBA 3PUYE 3T9HB 2EYWA 3JB9G 2C0OA 4E0WA 2CS7A 4XK8E 2RF1A 4ESWA 2ENMA 5J1DA 2KSSA 2OWTA 1UB4A 4KPTA 2HXWA 2V8JA 1C0MA 3UT1A 2BE9B 1G3WA 4HW8A 1UTHB 2XD0A 1D1AA 2RO0A 5GMKh 1VQOA 1OX8A 2UYEA 2JXBA 4E7KA 2SEMA 2DXYA 1IREB 1D3BB 3DLMA 1NNKA 2CZ0B 5DEXB 1WQ7A 4HXVA 4FM4B 3U8QA 1FPIA 4MBPA 3VRZA 3CRBA 3QSUA 3EG9A 1ZLMA 1MXYA 1YJNA 2KMTA 3I55A 4IR8A 2UXAA 3T9NA 2DEQA 1VR5A 4ZGJB 2FZGB 3LW5E 3SEMA 3P8HA 4BI8B 2OTLA 1N84A 4JDFA 2W7YA 3K4UA 4TOZA 2MF2A 4GQOA 3M0TA 2I4BA 1MRPA 2PBWA 4OVQA 2QTXA 4PTKA 2G93A 4U22A 1M3BA 2HKNA 4FT2A 4E47A 1MQJA 2DWHA 3LUZA 4GLMA 3JB9J 2XICA 4NL2A 1OI1A 2LX9A 2C0TA 2KQZA 4G8NA 1M2VA 2H4IA 2GFUA 5FRNA 1Q81R 1ZSGA 2XK0A 2QTVA 3V8LA 4EIKA 2XXYA 4GLKA 3KJTA 2H8HA 3TFLA 3IOVA 1LJOA 2R57A 4DXUA 4R6YA 2M8CA 4PDDA 5LJ3f 4XEQA 4DCYA 4DOVA 3P8BB 1QQJA 4O7MA 5CBRA 1WJQA 1US5A 3E78A 4LZ8A 4U4XA 3PGFA 3PUWE 2LVMA 1NJIC 1OQGA 5CQXA 4AB5A 2O1LA 4BI3A 1K0XA 1R8OB 2PFYA 2VYTA 4F17A 4B9XA 3KC1A 3QSLA 2OTLQ 1SG5A 1FMKA 3JCMc 2X3XD 4H5FA 1VQ5Q 3RGYA 3MPLA 3PIPA 3CC7T 1N7WA 2EGAA 2B65A 2ECZA 3JCMQ 4G77A 2OX7A 1K9AA 4M75B 2C0IA 3OW2A 3JCMJ 1JNFA 3RT8A 2VGQA 2EGEA 1XOVA 4F18A 5ELVA 5I59A 1H44A 2MI6A 2F5KA 3M0RA 3Q26A 1M1FA 2MIOA 3CCLT 2NUVA 1DCUA 2NOOA 3GXAA 2YLBA 2DOJA 3KG2A 4XKNA 2RPNA 4QF9A 4N15A 2CH4A 3A8LB 3A1PA 2RI3A 2X4WA 5L9OA 3QWYA 3PMXA 1ZTYA 1KA0A 1TFAA 3L2UA 1OPLA 5LJ5e 1URDA 3K1MA 1FTLA 1N8RU 5HBCA 5CM6A 4U4SA 3I5OA 2GQ1A 2RHIA 3JCMP 1NUYA 5IHNA 2I48A 1MHNA 1PRLC 3TKDA 2B4MA 3B6WA 4LD6A 4RXLA 3QYHB 3CC2A 3F70A 4BDOA 3X20B 1XJWB 4KGVB 3HHTB 5BUUA 5FW9A 2V4CA 4RK2A 1MPCA 5CKFA 4F19A 4OA4A 1I4K1 4GX4A 2VP1A 1N9RA 4N81A 4R72A 3W15C 3D4CA 4A53A 2PMSA 1M1KR 2V3TA 5CKEA 3L2QA 2REJA 4MZMA 3CFZA 3EH2A 5EYGA 3MEAA 1UFFA 4LE9A 4GD5A 1VQ4A 4J9BA 3CCEQ 4F39A 2G6FX 2X35A 3CC4Q 2FVZA 3FJ7A 4HTGA 1B52A 3PPOA 4JVIA 2HAXA 2PVUA 1XVYA 4BDQA 4TVRA 3TQ7P 3S9NC 1X2KA 4YTLA 4LN2A 4OB0B 3UA6A 1S50A 2AT1B 1VYVA 1MY3A 1S7YA 3MVWA 4ECFA 5J26A 2XXKA 1BK2A 1QP2A 5CQYA 2J6FA 2A28A 2JOYA 3IOUA 3PPQA 2LTOA 2RI2A 2F5TX 4ZGEB 3X25B 4R9GA 1DOTA 3MHXA 3ZL7C 1VQ8T 2DXBA 3LR1A 1D3BA 4HE1A 2EJFA 4FIBA 1YIJA 3MVZA 3LUYA 2F69A 4PGNA 3T9VA 2V26A 4M77E 3M55A 4H67A 2I3VA 1EZ9A 1T3LA 3IO4A 4HA8A 5LTCA 1TS9A 4A63B 1VQ8A 4XF5A 1GCQA 1FMVA 3TU4K 3HN0A 3RKYA 3H3GA 1LAFE 2VOZA 3CIJA 1IXGA 1UJ0A 1K8AC 2LAOA 3T22A 2HQ0A 1HSEA 4J9GA 1M9SA 3TDJA 5ICQA 1L5TA 4C92G 3OBWA 1WYXA 1ABOA 2JTEA 1S72T 4GY5A 3K6UA 2F3DA 2X4JA 2JMAA 2LQ8A 4PK4A 4RPNA 4RTTA 3EH1A 3V7SA 4QW2A 1JEUA 3VVDA 3EN3A 5EQ9A 1EYIA 4QKUA 1F9BA 2H9BA 4ZTFA 3L2RA 3KN3A 1WJSA 3PMIA 1QCNA 4X9CA 1FMWA 2GBQA 2YUNA 1M90R 3RYDA 4MLVA 1PKTA 2D21A 3QYGB 3U65A 3V5AA 4OENA 2XU8A 3QUJA 4P0IA 3G7ZA 5IZZA 1WI7A 3Q1JA 1C6VX 4I40A 3B6QA 4L6V5 3FXBA 4C5HA 1FSAA 3A8GB 5GAMf 3H6UA 1VQ9A 1JVXA 1Z9ZA 5JTYB 4G4PA 2RA2A 2WSFE 3MW0A 1NFTA 3EHQA 2ZNUA 2NUTA 1FBPA 2QEXT 3L6HA 4P56A 1IXHA 4OEVA 1VQ9T 2CZLA 2LT4A 3FVGA 1VQNA 4YICA 1SYHA 3BDUA 3RPLA 1A8EA 4NTLA 2ZYNA 4KBMB 1D0ZA 2QXFA 1IXCA 1A99A 2CZ1B 2WBDA 3KC0A 2PT1A 3K6VA 2E1SA 3M5AA 4AS4A 3LSXA 1QW0A 3INZA 4OEUA 1RL2A 5I22A 2JTMA 1OV3A 2H3JA 2VWFA 5I56A 2XXUA 2M51A 1QCFA 2LNVA 3BKIB 1VSOA 1PG5B 4OESA 4OB3B 5I2NB 4LA9A 1O7TA 3S6WA 1ZBXA 4HCBA 1MMNA 4X9TA 3UA8A 3A8HB 4GX3A 7AT1B 4PJJA 3RDVA 5L8DA 2F35A 3RUMA 1NV0A 3QXMA 2E41A 1D0YA 1RACB 2XXHA 1I5OB 2V1QA 3QKJA 1B1HA 1POY1 5I2KB 5B70A 4DLDA 3IX1A 3VV5A 1FTOA 3SEXA 2RQVA 3S3OA 1YHQQ 1JXMA 2VXFA 4TLMB 4BDYA 2RHYA 3PD9A 3J81E 4F7UE 2VPOA 2RQRA 1SD3A 2CUDA 2HQEA 4FSXA 5GAMj 3BW1A 3NTHA 5ET6A 1QVSA 1FTAA 4I3EA 2QS4A 1HSJA 2KLFA 3T1BA 2QJEA 1LSTA 4FIMA 2D5WA 2Y4XA 1UGVA 2DFUA 1GGGA 2Z8EA 5DW8A 2G3RA 2VGNA 1TG0A 1PBPA 4OETA 1QVFA 2DVCA 4MHFA 1YWOA 4GWYA 1NE8A 2EYYA 2JW4A 1IO6A 1SF9A 4KUDK 3PV0E 1K76A 2A3LA 1MY2A 1R0BG 4XKPA 2P3NA 4X1DA 3Q25A 3GYYA 1UGSB 5CKBA 1IMDA 5DLQE 4GOTA 1RABB 2XDDA 1GXIE 4OFLA 5AA4A 4HCZA 3FRNA 2RC9A 1RLPC 3QJ6A 3VJPA 5GAN8 1B1XA 1DPPA 1Y96A 2JMCA 2P0PA 2WYPA 4ELOA 2XD3A 4G68C 3MJXA 1IIWA 2ZYOA 2PUKB 4X8RA 3S3MA 1Q81U 4LDXA 1B0HA 3T96B 2ZPBB 3MC2A 2JJKA 1MXVA 1S1NA 3WAFA 5CR2A 5H8NB 1YAEA 2CT3A 1FPEA 3SERA 2MK5A 3FJMA 1PEBA 1NNPA 4M7DF 3GF5A 1K4US 2GHAA 1PNJA 3MZ9A 3OYNA 2O7IA 3GZGA 4ZE8A 1YI2A 5CMCA 5I58B 3KN8A 4LVQA 4FE8A 1O63A 4EQ9A 3OO6A 3KEIA 1VQ5T 1VIEA 4QVDA 1LBCA 3JB9D 1ZUUA 2Z8DA 2DNUA 1AEYA 2UVGA 4J7IA 3MO8A 5GJWB 4C92B 1KQSA 5C6SA 2VD2A 5JTYA 4YKIA 2NUPB 4IUQA 1NL5A 3M0UA 1OU9A 4E7LA 5IT9E 3HRSA 3QXEB 1TWBA 3HRUA 4FYVB 4AFQC 4J6WA 3SEVA 5I5PA 2UYFA 3EGXA 5IXBA 2HQHA 5CMMA 4EXKA 1BCOA 4LUEA 1SI1A 2ZPHB 4ZZEA 1TOVA 3CMEQ 1W2BP 1TXFA 2OWZA 3TQWA 4F3GA 3CXCP 3RKWA 1IHVA 4R6HA 3OYBA 1LBXA 4OVJA 4U2RA 2HMAA 4WF2A 3MPUB 1FQDA 1LAXA 3M54A 2XXXA 1B7HA 1WXUA 3QIIA 4NF4A 3O28A 3V8JA 3BY7A 5FBPA 5FLXE 4X1BA 2ZYKA 1RADB 1N8RR 1QWEA 3MSTA 3UATA 5GANd 2XWKA 3MVYA 3OSVA 3GBAA 2BZXA 4MMPA 2IEEA 2A37A 5H8HB 1NPRA 4P9KA 1FWZA 2LX7A 3IOTA 3IB2A 2SRCA 1K9MR 1PKSA 2HNIA 4F3PA 3CPWP 2V93A 1IGQA 4C8QB 1YIJT 3DP8A 1S72Q 4EPCA 4X04A 2OTJT 3BDLA 1TFDA 5FU6C 1BKBA 4RA1A 3A3UA 1KJWA 5I2KA 4NEDA 1QUKA 3FB9A 3TCJA 4HCWA 1INPA 2E1HA 4YKPA 2JN0A 3BFMA 1G0IA 4OXVA 3MAMA 1MMGA 3OW2P 3MUQA 1X01A 3TREA 1QP3A 1FJ6A 4M78E 3CCUQ 2F3BA 3OO8A 1WHLA 1PBQA 2E4HA 1P1OA 3RBBB 1H3DA 1A54A 3ISPA 1YYZA 3TAJA 2Z23A 1AD5A 3T9UA 2DBMA 2KK4A 1I5LA 5AA2D 2R71A 4BDRA 4JLIA 3OBYA 1G83A 3A29A 1MQDA 2MYSA 4KHZE 2RM4A 1GV8A 4BUGA 3MQ9A 1DK4A 1EFNA 1U3OA 1GCQC 1YJNT 3FBPA 3T0JA 5H8FA 3M9QA 2YWWA 4H5GA 3K2DA 4X1VA 1AWBA 5KDTB 1S72A 4GWUA 1NI9A 3E3KA 2HQXA 1KIKA 4IY5A 4KCCA 5D6XA 3CC7Q 4RCCA 1A8FA 1SHFA 5HK0A 1QJMA 3DLNA 4BDMA 4LDUA 4QFPA 4ZS9A 3GP8A 3C94A 4PAIA 1YBYA 3MEUA 4JJBA 4D8KA 4GL0A 1O64A 3HO7A 1MV0B 3WVEB 2ZZVA 3CCET 1GRIA 3QO3A 5IZ3B 4ZNXA 2LT1A 4MCOA 3J80E 4LP2B 4DEXA 3CCUA 3LC8A 3LWIA 1YZ0A 4F22A 1VA7A 1GCPA 5CC2A 3RIRA 1AZEA 3LBSA 2QA4Q 5A0GA 2X3WD 4KYSA 1JEVA 1HSQA 2DIGA 4M78A 1TUDA 1VIFA 3PFSA 1HYOA 5FROA 4QVCA 1BLFA 4M78G 3HTRA 3JCMX 1Q7YU 3LV0A 2ZPIB 3PPRA 3EGDB 3JCMh 2O51A 4G61A 4KH1B 1B5IA 3I56T 2HL3A 5TP9A 2Z22A 3VKIA 3S2VA 1UTHA 2Z0WA 4FBPA 4FT4A 1VQ6A 2D3IA 2W0ZA 2K2VA 3ONMA 1KQSS 2O69A 4N8GA 1YJWA 3SEYA 1JVYA 4MJOA 1NEBA 2LCLA 2NLUA 4N17A 1PB9A 3CC7A 4J83A 2LCSA 2QMWA 4RG2A 4G68A 2R6GE 2RHUA 2HHMA 4VUBA 2I3WA 1UHCA 2XXVA 3PE0A 3USDA 3CPWS 5TP9B 1TUCA 2Q8MA 4HE0A 1UQWA 1LBYA 3RLFE 4NF4B 4M4ZA 1I81A 5GAN5 4BE1A 1OMPA 4PGPA 5D6WA 2ZAEA 2RHXA 5L23A 2NUZA 3THIA 4O7IA 2EAYA 3GPLA 3KUFA 3PTAA 2H5YA 1W1FA 1CB6A 3PUVE 4RTVA 2QQ9A 1WHHA 3IJOB 1PD0A 4C0FA 2Y5KA 3M8UA 2NWMA 4DEYA 3LGFA 4PLIA 2FNCA 1N3WA 5FHMA 1M8VA 3UPUA 4UACA 2V25A 2MMPA 3EG0A 3GBQA 1VQ6Q 5CK9A 1NH7A 1LPLA 4C8QC 2EQIA 3G4ST 1GVCA 4U21A 5M2VA 3R6NA 5GANf 4KT0E 2BTTA 2GRVA 3EFRA 4PF8A 2EJGA 4CC7A 1NKXA 2F5XA 2CGHA 3F11A 4O3CA 1ZSZB 2E10A 2AIXA 4F2OA 3FGSA 4NWCA 3VS5A 1JRIA 4D6WA 4EMHA 5ITOA 1T0KA 1Y57A 1FQCA 2EIFA 3RESA 4O94A 2PNIA 5DT6A 2OI3A 3AHUA 3RNJA 5L8RE 4RTZA 2RK1A 4R0KA 2EQUA 5A0DA 5KYXA 3G3FA 1Q82R 3HKSA 5AA2B 4C92A 1UG1A 4THIA 1FYNA 3EF7A 2DTOA 4A4EA 2GQVA 2MPXC 3JAME 1Q95G 3E4RA 1VQLQ 4KGXB 3H0FA 1B3EA 4M78B 3M57A 1M1KC 2CZIA 2ZPEB 1DMBA 2PFZA 2CZKA 2IA4A 4POXA 3KGCA 3M0SA 1YNZA 4H45A 3SHWA 5CKDA 3CSBA 4RY1A 1YCSB 3K6WA 3UGWA 5H8QB 1HJDA 4JVCA 3E9FA 1WHMA 3FVOA 2M9UA 2RKMA 1G5VA 1VFEA 3PVQA 1SBPA 1FBGA 2FO0A 1P92A 5KE3A 4OVTA 4OHNA 3L6GA 1D1BA 4DIGA 4E7ZA 2DJQA 1P1NA 4F16A 4LZ5A 2XXIA 5A2QE 3BIHA 5IHKA 2F7BA 3PUZE 3EGUA 5H8HA 1MS7A 4GBQA 1PC0A 4G8HA 2A5SA 1VYUA 1OU8A 3PGGA 3CXCS 2DJZA 4KGZB 3H6ZA 1VQKQ 3OS2A 2OTJQ 1FPJA 1IUDA 4QQGA 1P99A 1K9MC 1VQLA 3JV3A 2KI7A 2Y84A 2O88A 5A5XA 5LJ3d 2K4YA 3LSFB 2H99A 2I0CA 2GF7A 1DJ7B 4J8OA 4DOWA 4M7DB 4N6PA 3CCST 1N8RC 3K0VA 5AA1A 4O3AA 1VQLT 1E6GA 2DYBA 2ZZDA 2MWOA 1SSFA 3HSBA 1M5FA 3RTFB 4DQ2A 1JU5C 2QQSA 5CMBA 2KBTA 3NGPA 3HRTA 2RC7A 3VXBA 2K2MA 2DERA 2VPNA 1NUWA 5GAN2 1KQ2A 1YJ9A 1FCKA 1KK7A 4AFSC 1UTBA 1N6AA 4M77B 2QG9B 2Q2CA 2I2LA 2DXRA 1X69A 2MOXA 3CCMT 4LATA 1OX9A 5CRYA 3KSXA 2ZNTA 4QBAA 3ILTB 4A4KA 2K57A 2DWJA 2XHDA 4F14A 1N5ZA 3UORA 1V1CA 1KFZA 2OTJA 1UDLA 2R8TA 4PFRA 3MWBA 2RCAA 4ESXA 1I0CA 3T9XB 2FZCB 3CD6Q 2L3SA 3C4SA 4LUDA 3EG9B 2OLBA 2XD2A 4KD5A 3TMGA 3ZKKA 1VUBA 2DWAA 2X7QA 3TZAA 3RPWA 1FQEA 2P0SA 3PT9A 1SQYA 1MQIA 1LNXA 3BFUA 1NV2A 1ELJA 3OSQA 4BE0A 4PETA 2QS1A 4TQUQ 2Y7KA 2RF0A 2QQBA 2EYXA 4NS5A 5GAOq 4GBVA 2RB6A 1UJYA 3O5ZA 4JRPA 3L2ZA 3NTKA 1ZSZC 4PFWA 1VQPA 1ZIUA 5HM4B 4NOYA 1XT8A 2FA7A 4Y28E 5IKBA 3SWNC 4QFNA 1ZJLA 3I56Q 3K00A 1FBDA 2QYZA 3LWHA 4GVOA 5F1QA 3H8ZA 5GMKm 3H7MA 2RQTA 2VUBA 1R6ZA 3O6IA 4YMAA 2P84A 5FU7C 3ODBA 1IITA 4PF6A 4GIZA 4IO6A 4NF8A 2HZLA 3CMAT 2F97A 2WBBA 4N91A 2LZ6B 2XWOA 2OAWA 2CREA 4GL8A 1EZPA 1IXDA 4M7DA 3VV0A 1NV6A 4M7AA 1YITQ 1JXOA 1FTMA 3W9VA 4RJZA 2QRYA 1OEBA 4C8QE 4M7DG 1XVXA 3OYCA 3E19A 3QPHA 2NXOA 4IUVA 4ZECA 4PJMA 3RERA 2D8JA 1K8AU 3M53A 4LDYA 1AOVA 4PC9A 4M77D 3KFVA 3JCMe 2E6ZA 4OFJA 3LYIA 1NJIU 4YKJA 1SEMA 3M58A 4XFEA 2IG0A 1PHTA 1VQPQ 1YFNA 4E0XA 1I8FA 2LP5A 1MY1A 2NUTB 4EMKB 2YUPA 1GBQA 4FAJA 4IUPA 3H9NA 4JJCA 3X24B 2XDPA 1AIVA 3G4SQ 2Q2AA 3U93A 4MZTA 1MXZA 4EQBA 2ONRA 2VXEA 1BIAA 2A7YA 2KT8A 2I4CA 4NAPA 2KNBB 1VOMA 1TXQA 2LNHB 3ULRB 1ZSZA 3VXCA 1IGUA 2HBPA 2KR3A 1LFGA 5IHIA 2CP0A 3OSSC 3PD8A 3V7CA 3IORA 3OY9A 2QK0A 5KCJB 1BI0A 2ZNSA 1X2QA 2A36A 1NV4A 1U5SA 4CI0C 3IK6B 3B6TA 2ZPGB 3CCUT 4F04B 4BY6B 3JV9A 2RD1A 1MQHA 2DXCA 1Y20A 3EFSA 4NF6A 2DVZA 4NX1A 3Q28A 1AWXA 5EQ8A 5IXFA 1UGRB 1FJ9A 3PNWC 3S4UA 3CI8A 3RTWB 4BY6C 3KXTA 5CKHA 1B5HA 2DL3A 3G3KA 4ELZC 5GANj 1LOJA 1A7LA
chains in the Genus database with same CATH topology
3OB9A 4PJOG 2Y7IA 3VVEA 2QS3A 1N0TA 4ZE9A 1RI0A 1QUJA 3U92A 3SB2A 2F78A 2VGMA 4X9DA 3FIFA 3OA6A 2XXTA 4C0DB 4PFUA 3FXQA 3K6XA 1UGPB 4XU2A 5CI5A 5K2XA 3CD6T 4ZTJA 4RYAA 3HFOA 1YJWT 3LH0A 1NNFA 3C35A 4I1DA 3SKPA 1Y3QA 3TYHA 2HAUA 2OBGA 1POTA 2EYQA 2LQKA 2JZ2A 4CRIA 3N5LA 2DXTA 2FHDA 3QBYA 3KOSA 3O97A 2L89A 4P11A 4PJOC 3IB1A 4U23A 4M77F 1MXUA 2GFEA 3FD3A 3MVXA 2QI2A 3RUXA 5M9OA 2ALUA 3FVKA 3FUZA 1M1KU 1IEJA 1BI2A 2AL4A 2XDBA 2QL3A 4DE8A 3CCLA 5GAMd 2RH2A 3OMGA 4PJOE 2DO3A 4IGTA 5J3BA 4ELYC 2O68A 4AQ4A 2AHJB 1WVJA 1NNTA 4KQPA 1U8RA 3RY3A 2I49A 5CO7A 3M56A 1UIVA 2DD4A 1B2HA 2R9JA 2QQAA 2XXWA 3FC3A 4PFTA 1SVXB 3H4ZA 3E1SA 1H3ZA 5EG2A 4C5EA 1B05A 1ZQ1A 2VV5A 2FB7A 3VU3C 3OYEA 4TLLB 4C0RA 4UA8A 3CCJT 4EQ7A 2GHBA 2PX1A 5AA4B 3VVFA 3CCVA 4HS7A 3TTMA 4ZEKA 3A8OB 4F29A 4JBZA 4C8QA 4XXUA 5GAMh 1P1QA 3T93B 5A0LA 4N0AA 1CE2A 2DPPB 4BE2A 1KC8C 4M75C 2V84A 3V8KA 1V29B 2P0QA 1MG1A 1H45A 3HPIA 4JUVA 2HD0A 3OENA 3DKMA 3OXNA 3PUXE 1Y07A 5HK3A 1B3HA 3C34A 1OIBA 4QSCA 4YMBA 4Q5TA 3GLXA 1OYXA 1MXWA 1VQ6T 3OYJA 1DPEA 4C92F 4JWOA 1B6HA 1U1TA 1QULA 2C06A 4QQDA 3SD4A 1OLCA 4BDNA 4Q8RA 4XTVA 3TCGA 3CSGA 2RK2A 3TTLA 2XXQA 2Y7PA 3JCMf 3QG1A 1G3YA 4M7AB 4F7UG 1HSLA 4QVZA 3VUBA 1LAGE 2REGA 4F7UA 4M75D 5I59B 4KYDA 5I58A 3O6HA 2P2AA 3QYTA 3NFCA 3SWNA 4ZEIA 5FHNA 3RNNA 3K02A 3D4GA 4OGEA 4Q30B 2PT2A 4XKRA 3QK6A 1RKMA 3HPWA 3FXUA 1BKAA 2E6NA 1SDXA 3LSLA 5GMKe 2RJFA 3JB9F 4EMKA 2EQKA 3IOWA 1LFIA 4ELRA 2DP8A 3CBOA 1QVFS 4PQJA 1VQ7T 3C31A 5H8FB 2Y90A 4RK9A 3HHGA 4U1OA 2IVWA 1Y1MA 3TCFA 3V8XB 3CCSA 2Y7WA 1ATGA 4NL3A 3C32A 3SESA 3TPAA 4R2BA 1B7UA 2E5QA 3G3JA 3OS0A 4GXAA 1I6QA 1VQNT 2V8IA 2D6FA 1MGQA 2E70A 3G6ET 4L17A 1KD1U 4N4IA 1M1GA 2E64A 1JW5A 5GAN4 1WNLA 5HKCA 3I6VA 3JCMW 2KVQG 4C0DC 3ER0A 1MH3A 1LLSA 3FVNA 5CMKA 4LONB 3E9XA 3QZ9B 4A4HA 1MY0A 4QRZA 4WXJA 4RKUE 3CG1A 1N04A 1M5CA 3QIMA 5C0MA 4KR5A 2OK2A 3PMVA 2ANJA 4LQ2A 4R55A 4PP0A 4C92E 3AXFA 4PL6A 3KOTA 4KI0E 3FV2A 3TCHA 2K5LA 3OMCA 1VQMA 4Y91A 5GANe 3TTNA 4II1A 4O6JA 2EQMA 1YITT 1URSA 1MY4A 2WSCE 2WKYA 3CCRA 2D9TA 3KZGA 3EHSA 2DD5A 3TEPA 5CIUA 2ONKE 5GAOl 3MP1A 2ZCFB 3K01A 2ESNA 3ASKA 4BACA 4C1UA 1B46A 2RC8A 3H6WA 3G6EA 1OQHA 4GXSB 5GMKl 3MJNA 3PMWA 1YI2T 1VQ5A 1M5EA 2X4YA 4F31B 4LDVA 3A09A 4N07A 1IXIA 1Y3NA 4P0GA 2RJEA 3O29A 4XU3A 2CMOA 3FATA 4MDXA 3JZJA 2F36A 1NZ9A 1ZLQA 3OYIA 4RMOA 4H0WA 1HXDA 3M3FA 3TUSA 2PVDB 5GAOr 4M75F 3VDFA 5H8NA 3ZFJA 3WXMB 5EYFA 1SW4A 3R26A 4K3FA 4M75E 3FV1A 1B34B 3EHTA 2FL7A 3CFLA 4JRKA 4JLGA 1WQWA 2JUFA 4FEDA 3KBGA 1BTJA 4ONYA 3S9EA 1NH8A 3H06B 1XC1A 3TELA 1XS5A 4C8QF 2DSFA 1QW1A 2CZ7B 4JS5A 4L59A 1TWYA 3GNGA 3I3VA 2NVUB 3G7WA 4IURA 3MPKA 4IGRA 3CPFA 4MH5A 4JDSA 3B7DA 1XOCA 1MH4A 2QPQA 2XX7A 3A8MB 3S9MC 4U1ZA 4ZGDB 5TPAB 3UP9A 4DXBA 4R56A 4OZ9A 1BYMA 3IAZA 2X4XA 3CCEA 4FATA 3SEWA 3DP4A 4QFOA 3CC4A 4YB6A 4FJPA 5H8SA 3RMSA 4XTCQ 2O4XB 5H8QA 1UEBA 3GNFB 5ITPA 4L5GA 4MZPA 2D0QB 3PU5A 4AB6A 4Z02A 5LJ5h 1PB7A 3K1NA 5I2NA 2I58A 3G3HA 4LZ7A 4LUBA 2MAMA 5GMKi 2XX8A 4M78C 5IAYA 1N76A 4J5YA 4XKQA 4C5IA 2Z8FA 1Z7NE 4DXCA 3CBPA 2M1HA 5D6YA 3IB0A 1W4SA 2QS2A 3QHSA 2QEXA 4GF8A 4HT8A 3QUFA 1B4ZA 3SFMA 4EMGA 2Q89A 2YLCA 5GAOn 1XHYA 3OYYA 4J6YA 4XIGQ 5BWJA 2Q8JA 3CMAA 4NF5B 3C33A 4A54A 4H6DA 3OS5A 3S3NA 1AHJB 3M3KA 1Q1KA 2K3YA 1Y4TA 4JSOA 3ILUB 1Q82U 1KQ1A 1IZ1A 1B51A 2ZPFB 1MM6A 4WEDA 3MEWA 5I21A 1J1NA 4M78D 1RYXA 2UVJA 3N6UA 4BB7A 4KCDA 3BFTA 1JETA 1XTDA 4F1YA 4E7HA 4M7DC 1RYOA 4UC4A 3OO9A 1M5BA 2Q9TA 2V3UA 2K3XA 4EDUA 5GAOp 1LAHE 3OYLA 4RG8A 2F8DA 1MQGA 2AL5A 3R7XA 4R2FA 4ND9A 1P1UA 3META 4EF1A 1QKAA 2O1MA 4MLQA 2CKKA 3VLVA 2HFBA 3SEUA 4M75A 3OO7A 3FJGA 1SYIA 3S9LC 4P5NA 1ZU0A 3CEYA 3JCMg 4XTYA 1Y3PA 5I84A 3ZEHA 3M4GA 4OTEA 4N13A 4XU0A 1Y9UA 2BJJX 5F7VA 1YJ9T 2VC8A 5GAOm 1LB8A 3URGA 1XQHA 1USYH 5FTIA 4JS4A 4J6XA 1OZ3A 4ELQA 2DTIA 2L5QA 4PKCC 4FORA 4ZEBA 3RMQA 1JJ2S 2I0BA 4I9DA 4RCBA 1YHQA 3FEOA 5J39A 3OEKA 4IKFA 3E9GA 2DWIA 1K9MU 4MMKA 2DE2A 1FTKA 4ZEDA 1B34A 2DYXA 3G3GA 4RPOA 2R5MA 1IQ7A 1Z7ME 5GAN7 3DP6A 4O5VA 4Q0CA 2PVGB 4MDWA 3DB4A 4C92C 5CAIA 1VQOT 4JSDA 3W9WA 4M7AC 3WAEA 5LL6S 4I62A 2OZZA 3OD7A 5GAN6 4E7JA 4F7UF 3O66A 4R74A 2ONSA 5HY6A 2DE4A 3KSJA 3GLBA 2L3RA 4ZN3A 3LSWA 2XIDA 2RI5A 2FYKA 3L42A 1LGBC 1QVPA 4A4FA 3ZS6A 1ZBMA 4Z0IA 2HAVA 2VHAA 2OWSA 3IR1A 3O8VA 1B58A 1DTGA 4XQ3A 5TU0A 4X48A 5EHMA 3PIOA 1O75A 3HSTA 1JQFA 3HV1A 1Q86U 4Q5WA 5KCHA 3OOAA 3JCMV 1TT1A 2A5TA 1ZMGA 3MZBA 1YPNA 3QAXA 2DVEA 1WJRA 4F3BA 2B8AA 4KUIA 3G71T 4EUOA 3JCMb 4M77C 1WPYA 2O84X 2XXRA 4H8JA 3KJ7A 4YAHX 5JK4A 2R5AA 3CXCA 2MWPA 3CMEA 2LC4A 4ZDMA 3QUIA 5I56B 3CCVT 1ANFA 1Q81C 1FW0A 2LDMA 4JRIA 2JTFA 2YLNA 2EFIA 3PPPA 4DCXA 3HCQA 2CZ6B 3JRZA 4BD3A 1EU8A 1I6BA 4IO3A 1B32A 2LRQA 5GAMe 5K2YA 2OTLT 1PB8A 4H8IA 2OJTA 3I55T 4EXLA 5L9MA 1LFHA 4QFLA 1KHCA 5KCJA 5HPQA 5LJ5j 3VLUA 1Y96B 2DQVA 4A4GA 3KBRA 1SI0A 3TODA 2PVOB 2X26A 2QMXA 3CC2T 1GTKA 1KHIA 2F34A 3VLWA 4MMLA 3OYAA 3J7AF 3O9PA 3FIRA 3IO6A 2DKGA 4ZZAA 3FJPA 3DB3A 3N5BB 1VQKT 1AH5A 4YB7A 3CCRT 1BI1A 3MP8A 4ELPA 4PJOB 2FYIA 2PYYA 3E13X 1YCJA 1YCYA 1LB9A 1VQMT 1FQAA 1PSEA 2PUOB 4PLLA 4C92D 3L2WA 5I57B 4QQ6A 5CCAA 4M7DD 3BBRA 4M7AD 3WVDB 1II5A 2A5TB 4C8QD 4QHQA 2RINA 3EAEA 3VYHB 1Y1ZA 2ZXTA 3KN7A 2XI9A 1ZKBA 1EH3A 5AA3A 4R9FA 1EZOA 4F1VA 1DSNA 3RQTA 4F2QA 4ZN1A 2QA4A 2UVHA 1B40A 4IO2A 4OMFB 4GWOA 4M7AF 1QUIA 2EWNA 2LCCA 1B3FA 1VFDA 4KFQA 4R75A 1B7ZA 3CFXA 1UGQB 4WEPA 5LJ3g 3FDRA 3GBBA 2E0SA 3IL1B 5I2MA 1WDNA 1Q7YC 2E12A 2QSXA 5FU6B 4OB1B 1B3GA 1Q82C 4XTZA 2F7AA 4N4HA 3RN8A 1VQPT 3OYDA 2Q88A 4BI4A 3TQLA 1FXXA 1N9SA 1OVBA 1B0LA 4G68B 4HT9A 1SW2A 4DZ1A 4F7UB 1D9VA 1MXXA 3SDFA 3ME9A 1SW1A 1H641 1YTVA 4QSEA 5I2SA 4JJNK 4ME7A 4H65A 3P8DA 4J7FA 1S9TA 3R6UA 3RT6B 4GRKA 1JJ2A 2H25A 2NWJA 2DZCA 2JVVA 3FASA 4LQ5A 1Q35A 3QDRB 1BI3A 3A3CA 2G29A 3VFJA 1UIUA 1BIBA 4LD9K 5CBSA 3GIBA 4PNOA 2GCXA 4ISUA 2BUDA 3N94A 3MBPA 4MFIA 2WSEE 5LJ5g 3OYKA 4PJOD 5DM7R 3OW2S 3TTKA 3CD6A 4PE5B 2JNGA 5GAN3 5LJ5d 2XG8D 2Y7RA 5KE2A 2RJDA 3M59A 3VUZA 2QQRA 5EHSA 1R1NA 1VQ7A 4HCCA 4H1XA 2F7CA 1XNIA 4FU6A 1DTZA 2KDSA 1BP5A 3VE1B 4BDZA 2O01E 2UVIA 2DZ9A 3H03A 1MPDA 4M1VA 2V3QA 2DIQA 5LJ3h 1N27A 1NPPA 1O9SA 4BLAA 3OEMA 3I56A 4KULA 5AA2A 5DY9A 4DDDA 1D9YA 1VQKA 5FRMA 3JSCA 4DA4A 4YU0A 2RJCA 3OYFA 4NF5A 1BIYA 1N7XA 3LGLA 3M4YA 5DVJA 3C12A 2RCBA 1K73C 3CG3A 2GFAA 3UWNA 1YITA 4NMYA 4O3BA 5KCOA 4C0GA 2XX9A 4XTXA 3OYMA 1B4HA 1WGSA 2L8DA 3CCMA 4ZEFA 3LX7A 5AYFA 3OELA 2YRVA 4YKKA 5DVFA 1US4A 3OS1A 3DLLA 1X75C 2WACA 1G3SA 2YHTA 1NMUA 3SWNB 2EKOA 5KDTA 3UN6A 3ECRA 4R73A 3JB9H 3O2AA 1M5DA 1FQBA 3EQ1A 1Y4CA 4IO4A 1Y71A 4OMBA 5FHOA 2ZGWA 3CPWA 3T66A 3KFMA 2O7UA 1FX7A 3G4SA 4JWYA 4NE4A 3NTIA 2QDYB 2K5FA 5B7DA 1PC3A 1WODA 1PDAA 3L1AA 1G3TA 4XAXB 4M7AE 3MCAB 4BDLA 4EF2A 3DM0A 5GAMg 3CMET 4ATOA 4I8CA 4M7AG 5KH6A 1B3LA 1JBMA 2AYSA 5DVIA 3HFNA 4NF6B 1PSFA 1OLAA 3OSRA 3V83A 4B9WA 3CCJA 2EJ9A 2EQJA 3O6GA 4HKEA 4N0AC 4JXIA 3G3IA 1A55A 3K1PA 1H43A 1IZ6A 5LOMA 1M5Q1 4IO5A 3SETA 2P0KA 1X6OA 1I69A 1EIFA 5CVIA 1KD1C 4N4GA 5JEIA 3MEVA 1SW5A 1N3XA 4IO7A 4JB7A 4E7IA 4EDPA 5KZTA 1JW4A 2M16A 1JB0E 4FL6A 4C0ZA 3FZVA 3TTRA 3QJYA 4OFOA 2FVUA 2P1SA 2BIVA 1I6AA 4OF1A 2PQWA 3CC4T 2DS9A 4POWA 4PJOF 3OYGA 1KC8U 3OQ5A 3X28B 2I6EA 2OCUA 1URGA 3N26A 4Z7EA 1KWHA 2DAQA 4PFYA 2Y4YA 5FU7B 1W2BS 3GOXA 2B3FA 5IAIA 4OGCA 1Q86C 2X7PA 4RNSA 2HZKA 3Q27A 3P7IA 3JYRA 4YZZA 4OVAA 2ZMBA 1P1WA 1R9QA 5DTBA 2ZYMA 2HCAA 5TPAA 3C4MA 4NF8B 2F6GA 4GLIA 2XXPA 3C9HA 1MDP1 3SDZA 4PJOA 3SEYA 1HK9A 5DEXA 4WKMA 2V8KA 3CCQT 2O4XA 4IUUA 1YHQT 1KG1A 3JCMd 4M77A 3A5ZB 1UTBB 1D4NA 3CR9A 4G8MA 4M77G 3IJXB 3MZ1A 1B9JA 1U1SA 4EMKC 1MM7A 4M78F 4C5GA 3CCQA 3LLRA 2DE3A 2CYZB 3VYGA 4R6KA 2XHCA 4XTWA 3V89B 2H98A 4F1UA 2GH9A 3HP9A 4X34A 1GR2A 4OWDA 3G71A 4U22A 5GANh 2RHZA 4V2SA 2ABHA 5GMKj 3H6TA 2PU9B 3TEEA 3UIFA 4OYVA 3HHFA 5DYHA 3HL8A 4NWDA 3PMTA 4JRQA 3MP6A 5IN1A 4OERA 5ISUA 1H76A 1USYE 3V7RA 3EHUA 1LCTA 1Y7XA 2P4TA 4C1TA 2O6AA 1B5JA 1MDQA 3R6OA 1D3KA 3OMBA 2B3BA 3CVGA 3JB9I 4JWXA 2KY9A 4OB2B <