3MP6A

Complex structure of sgf29 and dimethylated h3k4
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
517
structure length
508
Chain Sequence
MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALAAAQTNAAAEFGSSYWTSEYNPNAPILVGSEVAYKPRGEWIQCEVLKVVADGTRFEVRDPEPDELGNSGKVYKCNRKELLLIPPGFPTKNYPPGTKVLARYPETTTFYPAIVIGTKRDGTCRLRFDGEKETEVTRRLVLPSPTALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Histone binding protein
molecule keywords Maltose-binding periplasmic protein,LINKER,SAGA-associated f
total genus 151
structure length 508
sequence length 517
ec nomenclature
pdb deposition date 2010-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
A PF07039 DUF1325 SGF29 tudor-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3mp6A05
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3mp6A01
1B2HA 1OZ2A 2Y7RA 3W9WA 2RHYA 3LC8A 2H9BA 3K2DA 4X1DA 2D21A 3MPKA 2I3VA 4EDUA 3H6TA 5D6YA 5IN1A 3S2VA 5AA2A 5CM6A 3DB3A 1KHCA 4ESWA 2HQXA 1QUKA 1GVCA 2I48A 3GXAA 4POWA 3U93A 2RI5A 1AL3A 2Q89A 2RHIA 2F35A 5FTHA 5A5XA 4R6HA 2D3IA 1NNTA 3E9XA 4M4GA 4F2OA 1B6HA 5H8NB 1CE2A 1B0LA 2NVUB 2B3FA 5AA2B 1VE4A 1EZOA 1YTVA 4GL8A 4KYSA 2PX1A 3C4MA 1IXIA 1RYXA 4YAHX 3PNWC 4RA1A 2XXHA 3KUFA 3T9UA 5AA1A 3SDFA 1AH5A 4R75A 2F7AA 5F1QA 3V89B 1A40A 3Q28A 2GFAA 4E7LA 2PT2A 3IAZA 1BP5A 4IY5A 4MH5A 3FDRA 4YB5A 2QSXA 2XDPA 3FJGA 4DE8A 2NOOA 4FEDA 1OIBA 5AE4A 4OEVA 1O7TA 3E3KA 3MJNA 1FQEA 2DVZA 3H06B 2F7CA 4RYAA 2O1MA 4EXKA 5C6SA 1ANFA 1T0KA 1MQJA 4YB7A 1N04A 4BDQA 4JDFA 4Z7EA 2REJA 3OYJA 4LVQA 4OQOA 1MY3A 1N84A 4G4PA 5FROA 1LAGE 3UN6A 4BE2A 4N4HA 4XXUA 1PBPA 3M3LA 3MAMA 3KOTA 3LH0A 3H7MA 1QJMA 3Q1JA 4G77A 3O66A 4GVOA 2DXRA 1FQFA 4F1UA 4G68C 4RXLA 4BDRA 3EN3A 1RYOA 5H8FB 2DIGA 2RC9A 2E6NA 3OMBA 4EQ7A 5ICTA 4F18A 1OLAA 1H43A 1MS7A 3T93B 1TWYA 3QSLA 4PP0A 2ZNTA 4NF5B 3C31A 5KCHA 4ND9A 3MZBA 2ZYOA 4U1OA 3P8DA 3IJOB 4F3SA 3KGCA 2RF1A 1N27A 1AIVA 3CVGA 3MQ9A 2RI2A 3UK4A 4GOTA 2FHDA 3HPIA 1H3DA 5JEIA 4NTLA 2QRYA 4B9XA 1QW0A 3L2UA 5K2XA 1SI0A 4NF5A 1MQHA 2DSFA 3OYMA 2Q88A 3LSWA 1MXUA 4FATA 4KPTA 4U22A 3OSQA 4ZE8A 3LSLA 3MVYA 1Y3QA 3EAEA 5D6XA 5CMKA 3SETA 4QRZA 3OYLA 1Y1ZA 3S9NC 2HXWA 5DT6A 1UIVA 3UGWA 4Z0IA 2H99A 3MVXA 2A5SA 3QAXA 4X34A 1LFGA 4LZ8A 4F29A 3FJ7A 1FQAA 4F3PA 4XKNA 2F36A 4IGTA 4QFNA 3OYBA 1OVTA 3KN8A 2UYFA 4NMYA 2UVHA 2OLBA 1Z7ME 4PLLA 4ELRA 2R57A 3TCHA 1FQBA 2UVIA 2Q2CA 4MLVA 2E5QA 3UP9A 1LFHA 4ECFA 1JNFA 5TP9B 4JWXA 1SW4A 2RC7A 4HTGA 2XD2A 3OY9A 3S4UA 1LBCA 4EDPA 3L2QA 4IO4A 1QKAA 2BUDA 3JZJA 4FEBA 3CR9A 4LA9A 3K6WA 1EZPA 1MDQA 4ELQA 3L6GA 4KHZE 1NNKA 2Y7IA 4F3BA 3NTKA 3TKDA 3DP4A 5IKBA 2HAUA 3ZSFA 1JEUA 1LLSA 1ZBMA 5CIUA 4P0IA 4GIZA 3KSXA 3PPRA 4C0RA 3H6WA 4OFLA 3N26A 4U21A 4RG2A 2X7PA 2RINA 2HAVA 4KYEA 4FORA 1IQ7A 1MPDA 3LYIA 2HFBA 1HSLA 4DCXA 3F11A 3PMIA 2RHUA 3FV1A 3DP6A 5KDTB 2H25A 2RC8A 4QSCA 2RJFA 4CRIA 3VVEA 1A8EA 2B8AA 1JEVA 1EZ9A 4IO5A 1LAHE 4PL6A 1D3KA 2DXYA 1SQYA 4OMBA 4E7HA 4NE4A 2DVCA 4OVJA 2DWAA 2M1HA 1SVXB 3MC2A 3TQWA 4PFWA 4WEDA 3OQ5A 4OFJA 3QBYA 1B4ZA 3ODBA 3GBBA 1N3WA 3R26A 3OEMA 3CRBA 3O6GA 5BUUA 1GTKA 2ALUA 3OYHA 3OMGA 1M5BA 5CMMA 5B7DA 2QJEA 3RTWB 2I58A 1ZTYA 4BACA 3TTMA 4EXLA 5TPAB 3E9GA 5I56B 1N0TA 4QSEA 2NWJA 4IO7A 4C5GA 2WACA 4RY1A 3L2VA 3IB2A 2Z8EA 3PFSA 3TCFA 2UVJA 4YKJA 2OJTA 1MQDA 5J39A 4P0GA 2V3TA 4YMBA 3PPQA 4ZDMA 1IIWA 2GRVA 1Y4CA 3Q27A 1GV8A 2PVUA 3UORA 3TQLA 2DS9A 5I56A 4YU0A 1BKAA 1POTA 1ZJLA 4NF8A 2F5XA 2FNCA 3O29A 4JB7A 1M5FA 5CC2A 2XD3A 4H5GA 1P1OA 1B05A 1B4HA 1NKXA 1XOCA 3S6WA 3FC3A 2FYIA 3KZGA 5I84A 3U1OA 4IUQA 1DSNA 3RT6B 1B1XA 1XNIA 4DZ1A 4IUTA 3H6VA 3GBAA 3LX7A 1OVBA 4XKQA 4IO6A 1IEJA 4N4GA 2HQEA 3TCGA 2XXWA 4AB6A 2A5TA 1H3ZA 3OYDA 1LAXA 2YLNA 1NNPA 1M5EA 4F2QA 2GFEA 2RJDA 4FU6A 5TU0A 2RO0A 3I5OA 4YKPA 1JETA 2ZYKA 4G68A 4RNSA 2ZYMA 4IGRA 4R6YA 1XC1A 1DTZA 5H8FA 4IO3A 2F34A 2H4IA 1MQIA 2A5TB 1Z7NE 4ZTFA 5CBSA 1JVYA 3IOUA 2H98A 2XHDA 2ANJA 4PQJA 4U4SA 1H45A 1DPPA 3OO8A 3PV0E 3O28A 4BDMA 4GFRA 5F7VA 2DP8A 4E0WA 4E7IA 3OMCA 1XHYA 1MXXA 4R6KA 3OO6A 3U72A 3LSFB 2YRVA 1QKBA 4RK9A 4LZ7A 4OERA 4KYDA 3USDA 3W15C 4GF8A 4QFPA 5DVFA 3G7WA 3K4UA 3PPPA 1IXHA 4R9FA 4PFYA 3VLWA 2Y7KA 4THIA 3HHGA 1DOTA 3H6UA 2H5YA 4U4XA 3JV9A 1B3FA 3PUZE 3RN8A 4GQOA 4H1XA 5K2YA 3K6UA 1ZIUA 4Q30B 2Z22A 1BIYA 4UACA 3SEWA 2GHBA 5KZTA 3LSXA 3PMXA 4E0XA 3P7IA 4QFOA 1BLFA 3RGYA 3K01A 5CRYA 2DWJA 4BLAA 3WAFA 2XXRA 2ZNUA 3TTLA 2W7YA 1B58A 3OS2A 3NTIA 3RPWA 2QMWA 4F39A 5AA4A 3H4ZA 4ZS9A 4KD5A 5J26A 2DWIA 2QQRA 3DB4A 1UQWA 3S9LC 2GHAA 3EPEA 4LATA 4R2BA 4C1TA 2DAQA 2R5AA 1URDA 3SKPA 1B7ZA 1LB8A 3MZ9A 3N5LA 5JTYB 1QULA 3ILUB 5B70A 4EUOA 1A54A 3EQ1A 4JBZA 3VFJA 3I3VA 4C5EA 4R72A 3FVGA 3OYGA 3FEOA 4I1DA 2K3YA 3VLUA 2QS2A 3G3IA 1FTJA 4TOZA 4ZEDA 4NF4B 4F1VA 1PBQA 3PPOA 4B9WA 2JTFA 3E13X 3T9XB 3MP8A 1N3XA 3TTNA 4LONB 2HZLA 4G8MA 2XXTA 1JVXA 1I6AA 2EFIA 1USYE 1ELJA 1FQCA 2XXVA 4ELOA 3MEUA 3IOVA 1A8FA 1PB8A 3G3FA 1TT1A 3EF7A 1MH3A 3W9VA 4YMAA 1JW1A 2ABHA 4BE0A 3OENA 4DXUA 3H8ZA 1LFIA 3O9PA 2LCCA 1OLCA 4PFTA 3MVZA 2ZYNA 3TUSA 1OZ3A 1URSA 2EKOA 4NS5A 2I4BA 4R2FA 2O84X 5KCJA 3V5AA 2O69A 1FCKA 1TFDA 1MPCA 3VV5A 2I0CA 5J1DA 1URGA 1NH8A 1ZLQA 5ISUA 3DLNA 3TZAA 4H65A 2ZNSA 1NNFA 1UTBB 2CZLA 3K02A 2QPQA 2HQ0A 5EHSA 2DQVA 5HBCA 3B7DA 4OWDA 2BJJX 3VE1B 2M0OA 1JW4A 3RQTA 4OXVA 4DLDA 3PUXE 2ONRA 1F9BA 4BDYA 1MRPA 3T22A 3P8HA 2PMSA 1AMFA 1TXFA 3KG2A 3ILTB 3F70A 3A3UA 2K3XA 4FL6A 4R73A 4QHQA 1SW2A 4BE1A 4BDOA 2VD2A 2R5MA 4N4IA 4QFLA 1Y3NA 2IEEA 2I3WA 3O2AA 3HN0A 4KCCA 1A99A 4OFOA 4RK2A 4Z02A 3FVKA 3O97A 3QXMA 4JWOA 2Y7PA 3QKJA 2UVGA 2O4XB 2PQWA 3FVNA 2IG0A 2I6EA 5HM4B 4DXCA 1MHNA 2F6PA 3CSBA 4YKKA 4WXJA 1USYH 3HV1A 4OZ9A 4Q0CA 2ZMBA 3FUZA 4IUVA 4O3AA 4C5IA 2O6AA 4Q5TA 2OBGA 2VYTA 5KCJB 3RNNA 4QQ6A 2ZXTA 4DXBA 2Y84A 3MO8A 2D9TA 5AA3A 5H8SA 2XXYA 3R6UA 5I2KB 3OS1A 2DWHA 1D9YA 1J1NA 1KWHA 4LQ5A 4KFQA 3B6WA 3CI8A 4OYVA 3E9FA 1Y4TA 3L2RA 3TELA 1MY2A 4EF1A 5FHNA 4E7JA 2EQJA 1OYXA 3IB1A 3B6TA 3C4SA 4QQGA 3OYIA 1PC3A 3A09A 4ZZEA 5IAIA 1B51A 4IUPA 5FHOA 4U1ZA 4YKIA 2B3BA 3RLFE 1WDNA 2F6GA 3K1PA 5L9SA 3ZEHA 3OB9A 2MWOA 1M5DA 2O7IA 2I0BA 5TPAA 4I8CA 3V83A 5I57B 3C34A 2DIQA 2XK0A 5DEXA 1B3HA 1MXWA 1QUJA 4N13A 3K6XA 2OZZA 1US4A 3MWBA 1SW1A 1IZ1A 3TYHA 3LGLA 3KJ7A 3OA6A 2YPNA 3TTRA 1LBBA 3DM0A 4OHNA 5EYFA 3TDJA 4Q8RA 5H8QA 2G3RA 1IXCA 3IB0A 2OWTA 3VVDA 3CFLA 4OVAA 4IB2A 4O3CA 3SEYA 1O63A 2AL4A 3M9QA 4ESXA 4MFIA 3OD7A 1XS5A 4KR5A 3FXQA 3H03A 4H8IA 4M1VA 4POXA 4KCDA 4JWYA 2LTOA 1LCTA 2BIVA 5D6WA 4TQUQ 2EQKA 3BFTA 2QQSA 4P11A 1IUDA 2Z8FA 2RJCA 1FTOA 3PD8A 3K1MA 4FECA 3MVWA 2M8CA 5CI5A 4MBPA 1MG1A 3MEAA 1MXVA 3MZ1A 1R9QA 5M2VA 2RHXA 2G29A 2P0SA 2V93A 4JXIA 3M3KA 1BTJA 3BBRA 4XKPA 3G3JA 3FATA 3KN3A 5AA2D 1WVJA 3EHUA 4L17A 2RI3A 3TEPA 5HPQA 5C0MA 4PE5B 4I9DA 3LBSA 1JW5A 3MBPA 4OEUA 3OXNA 4HCYA 3PMWA 4I62A 2HCAA 1Y3PA 3HO7A 4MF3A 1EH3A 3IX1A 3OYFA 2XX8A 3CFXA 4RPOA 3C36A 4G8NA 4OETA 4X48A 3SEUA 4XTCQ 4ZTJA 1B7UA 4GRKA 2P1SA 2F5KA 2E1SA 1B40A 1MM7A 3TODA 4A4FA 4H5FA 1PB7A 3SERA 4GWOA 4N07A 4PLIA 3OYKA 2XXPA 3Q29A 5I2KA 1YAEA 4QFKA 4RJZA 4EF2A 3O6HA 2G93A 4ZE9A 1UIUA 3PMTA 2LAOA 2AL5A 3AXFA 3BDLA 1QVSA 3MUQA 3WAEA 2VD3A 1O64A 2DE2A 4R9GA 2VOZA 1B7HA 2AIXA 3DP8A 3K00A 3BFUA 1WJQA 4F1YA 4NF4A 4FE8A 2V3UA 2F78A 3V8XB 2QS4A 4K3FA 2ONSA 3FLGA 3S3MA 5I2NA 3N6TA 1B52A 4FIMA 4ZZAA 2X35A 4GXSB 3KJTA 2PYYA 3THIA 3KBRA 2I4CA 3G3GA 3N94A 4TLLB 1Y1MA 4ELPA 5ICQA 4A4GA 3CG1A 4QQDA 5JTYA 5ITOA 2GF7A 1RI0A 1B3EA 3VLVA 5LOMA 2FA7A 1I6BA 2NUVA 2D5WA 5DVJA 3TAJA 2XX9A 1R9LA 3G3KA 1FTLA 1WODA 1CB6A 1R1NA 3OELA 3KOSA 4GD5A 4HW8A 1EU8A 5KDTA 3PUVE 2QS1A 3M8UA 1B46A 5CBRA 3OYEA 4WKMA 1GR2A 4GXAA 3HSTA 1ZU0A 3QJ6A 3IJXB 4QW2A 1MY0A 2NXOA 4DDDA 3IK6B 3O6IA 3LUYA 3SESA 4HCWA 2QL3A 4G68B 1FW0A 4PETA 5FTIA 1GGGA 1SDXA 3ECRA 3MPLA 4II1A 1I6QA 4NF8B 1P1NA 1NFTA 5BWJA 4IO2A 4GY5A 1Y20A 2R9JA 3EHSA 2P2AA 3ZKLA 1B32A 1SYHA 2CKKA 1B5IA 3PU5A 5L9OA 4QF9A 3ONMA 1OI1A 5TP9A 2Z23A 3TFLA 1FTKA 1VFEA 4G8HA 3PD9A 3EHTA 3PGFA 3QUFA 3G3HA 1MPBA 4ZEFA 2WKYA 2OCUA 2ONKE 3FD3A 2L3RA 2Q2AA 4LUBA 1OMPA 3R7XA 4F22A 4BD3A 2OWSA 3MW0A 2XXXA 5I57A 2R6GE 1LSTA 3IOTA 5FHMA 1SYIA 1B1HA 3GZGA 2P0KA 1H44A 3C35A 3OS0A 1UTHB 4AB5A 4N6PA 3IL1B 1MH4A 4GLIA 3GOXA 1N7WA 4BDZA 3D4CA 3NTHA 4R74A 2RCAA 3O8VA 4G2ZA 3MEWA 4NEDA 3U92A 3B6QA 2LDMA 1Y9UA 3QUJA 3S3NA 4KI0E 1ATGA 1MM6A 4UA8A 2QS3A 3LLRA 2MWPA 2I49A 1A7LA 3MEVA 3KN7A 4ISUA 5AA4B 2UXAA 3CIJA 3TPAA 3A3CA 1ZKBA 3CEYA 2F8DA 4YZZA 2O1LA 3T9VA 4EQBA 3OYCA 3IO4A 2VGQA 1G5VA 2X4XA 4ZEBA 5KCOA 5ITPA 4UC4A 1SD3A 4FAJA 4IURA 4X1BA 3SEVA 1XT8A 3PUWE 1HSJA 5L8DA 2BKDN 4BDLA 4IUUA 2X26A 4IY6A 3S9MC 1NMUA 1B5JA 1SBPA 3I6VA 3D4GA 2QMXA 3GLBA 1SSFA 4ONYA 3FASA 2E0SA 3OSRA 5DTBA 1LGBC 1N76A 4OENA 1NL5A 3L42A 1MXZA 2L89A 4ZEKA 1H76A 4L59A 1PDAA 1S9TA 1RKMA 3N6UA 4LZ5A 3L2WA 3LGFA 2UYEA 3META 4FJPA 3S9EA 3OYNA 4ZECA 3PMVA 2O51A 1B0HA 3IOWA 4ZEIA 2YJPA 1Q35A 1MDP1 3RY3A 4WEPA 1R6ZA 1DTGA 2ESNA 4H67A 1MQGA 2Q8JA 3QYTA 3K0VA 4LQ2A 5IAYA 1B3GA 4NWCA 2REGA 3L6HA 4OTEA 4LP2B 3VXBA 3IORA 5M9OA 1S7YA 4KQPA 4XKRA 1FTMA 4JSOA 1B3LA 1B5HA 3ASKA 1P1UA 3FVOA 2XXQA 1PB9A 4YB6A 1WJSA 2NLUA 3IR1A 4C1UA 1WJRA 1POY1 3QIIA 3FV2A 1VSOA 2XXUA 4YICA 1DPEA 3ZS6A 2Z8DA 1AOVA 2DYXA 4QSDA 1YPNA 4AQ4A 1N7XA 2X4WA 4XIGQ 1JQFA 4BDNA 5CMCA 3S3OA 1MXYA 1PEBA 3ZKKA 4NF6A 5I59A 5L9MA 4DIGA 3M3FA 3C33A 3UT1A 2AYSA 2GFUA 1DMBA 2F97A 5H8QB 1D9VA 2DOJA 3HCQA 1OQHA 3VDFA 2L8DA 3IO6A 1I69A 3JYRA 4C5HA 4EQ9A 3FZVA 3KEIA 4LD6A 2LVMA 3MP1A 3RUMA 3C9HA 1P1QA 1US5A 2EQMA 3KFMA 5I58A 5ELVA 3CSGA 2KLFA 1LCFA 2PT1A 2R71A 2Y7WA 5A5XB 5EHMA 1IITA 3ME9A 5DEXB 5JK4A 4H6DA 1XVYA 5H8NA 3RTFB 3U94A 4NWDA 3T9HB 5I2NB 1D4NA 1L5TA 2VHAA 3T96B 5H8HB 2DE3A 3RT8A 1QUIA 1FQDA 1LB9A 2V84A 1YCJA 2GH9A 3OO9A 3H6ZA 3T66A 1UTBA 3U8QA 3UIFA 3KSJA 2XX7A 3FIRA 1HSEA 3QIMA 3FJMA 3SEXA 2V25A 4HCZA 5H8HA 3BKIB 2EQUA 3OYAA 1M5CA 3OEKA 4H8JA 4OESA 1II5A 2HEUA 2X7QA 1B9JA 2RJEA 1VFDA 3FXUA 3UWNA 4X9TA 2CMOA 1IXGA 4JSDA 4NF6B 5I59B 1OQGA 3PPNA 3FGSA 3K6VA 4O3BA 3UA8A 4U23A 5KE3A 1P1WA 4A4EA 2LRQA 1A55A 5I58B 5DYHA 4PFUA 3E4RA 4TLMB 5DVIA 4E7KA 5FRNA 4H0WA 4IKFA 1MY4A 2Q9TA 3Q26A 1LAFE 3QK6A 2M16A 2RKMA 3PUYE 3Q25A 4QVZA 2R58A 1XVXA 2THIA 3HHFA 5KE2A 1P99A 5FRMA 4F19A 3CG3A 1WGSA 4F31B 2XXIA 2OK2A 4HS7A 3TMGA 2RHZA 2HZKA 2RCBA 1TFAA 2VP1A 1SW5A 1S50A 2F7BA 4U2RA 3DLMA 1NH7A 3C32A 4DCYA 4A4HA 4GL0A 4RPNA 2O68A 3CFZA 4F3GA 3OOAA 4MLQA 3TTKA 2JZ2A 3FXRA 5CMBA 2O4XA 2O7UA 3MP6A 3K1NA 1MY1A 3OO7A 4Q5WA 2IA4A 3VXCA 3SD4A 3LR1A 1Q1KA 3DELB 3H3GA 1ZMGA 2V3QA 1VR5A 5KH6A 2B65A 2X4YA 1SI1A 2DE4A 1UTHA 3VVFA 2PBWA
chains in the Genus database with same CATH superfamily
4M78B 1B2HA 1OZ2A 2EJGA 3JCMh 2Y7RA 3W9WA 2RHYA 1BI1A 3LC8A 2LJ1A 2H9BA 3K2DA 1RACB 4N8YA 1TH7A 2CSQA 2KNBB 1KJWA 3M0TA 4X1DA 2D21A 1JQQA 3I5RA 2E10A 3MPKA 1JO8A 2I3VA 4EDUA 2RK2A 3H6TA 3CD6Q 3ROJA 4J9HA 5D6YA 5IN1A 3GBQA 3A98A 3S2VA 5AA2A 5GMKh 2JS2A 2OTLT 1LBZA 1U1TA 3SZPA 5A0DA 3CCVT 3DB3A 5CM6A 1FWZA 2DKGA 1KHCA 1KSWA 2C0TA 5GAN6 4ESWA 2HQXA 5IHNA 1S72Q 1VQ6Q 1QUKA 1GVCA 2I48A 3GXAA 2QQBA 4POWA 3X26B 3U93A 2RI5A 1AL3A 2Q89A 2RHIA 2K79A 2QA4A 2F35A 5FTHA 5A5XA 4F14A 1X6OA 1D0XA 1WHMA 4R6HA 2D3IA 4C0DB 1FMKA 1DCUA 1NNTA 3E9XA 4M4GA 4F2OA 1B6HA 5H8NB 4N6KA 1CE2A 2L2PA 3EFRA 4BI8B 1B0LA 2NVUB 2I0NA 2B3FA 4LDYA 5AA2B 1B7TA 3RKXA 1ZSZA 3VKIA 5HKCA 1VE4A 1EZOA 5KYNA 1YTVA 4GL8A 1YNZA 2VXEA 4PJOB 4KYSA 3TEEA 4C92F 2D8HA 2PX1A 3AHUA 3C4MA 1IXIA 1RYXA 4YAHX 3BFMA 2HBPA 1RAIB 3PNWC 4RTWA 3UA6A 4RA1A 2XXHA 3KUFA 4JJBA 3T9UA 5I7IA 5AA1A 3SDFA 4FYYB 5LDZA 1AH5A 4NAPA 2LNHB 1NLPC 4R75A 2F7AA 3OW2A 1QKWA 4M75E 5F1QA 3V89B 2E4HA 2QFLA 1A40A 1LBWA 3RR6A 3Q28A 3QG1A 2QQAA 5FU7B 4M7DA 2GFAA 4E7LA 2PT2A 3M0SA 1BP5A 3IAZA 1AOJA 2KRSA 3QDRB 4IY5A 1YZ0A 4MH5A 3FDRA 1FBCA 4OVTA 2QSXA 4YB5A 3L2ZA 5LJ3f 2XDPA 3FJGA 4DE8A 1R0CB 5LJ3g 1X6GA 2VKNA 2NOOA 4FEDA 3EFOB 2QTXA 1OIBA 5AE4A 3X28B 3I55Q 4OEVA 1ZUYA 3CC2Q 1RDYA 1O7TA 1LBYA 1YITQ 3GYYA 2WSCE 3E3KA 5EYGA 3MJNA 2DL5A 1FQEA 4M75C 1VQOT 2DVZA 1RDXA 3H06B 1RAHB 2F7CA 4RYAA 1D1CA 2O1MA 4EXKA 5C6SA 5HCKA 3GLXA 5GANh 1ANFA 4GWSA 1T0KA 3TSZA 1PKSA 4ANJA 1MQJA 4YB7A 1N04A 1UGPB 1N8RR 2AZSA 4JDFA 1EIFA 4BDQA 4Z7EA 2REJA 1W6XA 4OVSA 2KVQG 3OYJA 1Q86U 4OMPA 4LVQA 4OQOA 1MY3A 5GAOm 1UHCA 5FROA 1N84A 2QVVA 4G4PA 2XICA 1LAGE 4BE2A 1X27A 3UN6A 2ECZA 4JZ4A 4N4HA 2QI2A 4XXUA 2BZXA 4LXCA 4KT0E 4M7DE 1PBPA 4JVDA 3M3LA 3MAMA 3KOTA 1UTIA 3LH0A 4OGCA 2XG8D 4YTLA 3H7MA 5KYWA 1QJMA 3Q1JA 4DOWA 1NI9A 4I3EA 1M2VA 4G77A 3O66A 4PGNA 3NFCA 4GVOA 1BI2A 2V8IA 2DXRA 1VQKT 5CAIA 1FQFA 1PSEA 4F1UA 4G68C 2DXBA 2YSQA 4JRKA 4C8QE 2GQVA 3X25B 4RXLA 5IT9E 2QGGA 1I8FA 1ZSZC 4BDRA 3EN3A 4A4KA 1YJ9T 1RYOA 4PCDA 5FU6C 5EQAA 2CDTA 5H8FB 2DIGA 2RC9A 2E6NA 4X1VA 3OMBA 4EQ7A 5ICTA 4F18A 1MV3A 5IZ3B 1BI3A 1OLAA 3HKSA 1H43A 1MS7A 3T93B 1KD1C 4J6WA 4LD9K 5I22A 4DI3D 2QEXQ 1TWYA 2KT1A 3QSLA 1N8RC 2L5QA 2JXBA 4PP0A 3PTAA 2MK5A 2ZNTA 4NF5B 4O7IA 4GX4A 3M0QA 3C31A 1AWBA 5KCHA 4D8DA 2E5KA 2NUPB 5I21A 2C0IA 3MZBA 4ND9A 2ZYOA 4U1OA 3P8DA 3IJOB 4RKUE 1SRLA 4M7AC 4F3SA 2D6FA 1GBQA 3KGCA 2RF1A 1N27A 1WZOA 1AIVA 3CVGA 3MQ9A 2EYQA 4M78G 2RI2A 4RTZA 1KQSS 3UK4A 1FPDA 4GOTA 2FHDA 1SSHA 3HPIA 4C92G 1H3DA 1R0BG 5JEIA 5IHIA 2ZPIB 4NTLA 1QKXA 4ZN3A 2D1XA 2QRYA 1FXXA 2DE0X 2FEIA 4B9XA 5CR2A 1QW0A 3L2UA 2CP5A 4NF0A 5K2XA 1SI0A 4NF5A 2E12A 3M0PA 1MQHA 4V2SA 2DSFA 2CZ7B 3OYMA 2Q88A 4PFIA 3LSWA 1MXUA 4FATA 2DVJA 4KPTA 4MZTA 2KAFA 4U22A 3NMZC 5GANj 3OSQA 1TUCA 4X8RA 4M77C 2LT1A 4ZE8A 2YUNA 3LSLA 3MVYA 1Y3QA 1BK4A 2V1QA 3CCJT 2L5VA 3NOHA 3EAEA 5D6XA 5CMKA 2EWNA 4K11A 3V7RA 5GAMg 3OYLA 2VT5A 4QRZA 3SETA 5GAN2 1NUYA 1TUGB 3JCMV 1Y1ZA 4PAIA 2DEUA 3H0IA 4J9CA 5LJ3d 2PTKA 4PJLA 2DXCA 3S9NC 2HXWA 5DT6A 2ED0A 2OJ2A 1UIVA 4EMKA 5ECAA 1FPIA 3UGWA 2J6KA 2A7YA 4FW2A 4HXVA 4Z0IA 1FYNA 2H99A 1K9AA 3HL8A 3MVXA 2A5SA 3QAXA 4X34A 3I56Q 1LFGA 1WQWA 4LZ8A 4F29A 3FJ7A 2KMTA 2JVVA 2F5TX 1FQAA 1YIJQ 2X3WD 4F3PA 5HK0A 3CPFA 4XKNA 4GX6A 3CBOA 5A2QE 2F36A 4IGTA 4QFNA 3OYBA 1OVTA 3VJPA 3KN8A 2OTLA 2UYFA 4NMYA 2UVHA 1I4K1 1PHTA 4EMGA 2OLBA 1SHFA 3C94A 4PLLA 4GBQA 1JP4A 1Z7ME 5LJ5e 4R56A 4ELRA 2R57A 3TCHA 3QUIA 4BI4A 3BDUA 1IMAA 1FQBA 2UVIA 2Q2CA 1OX8A 2B86A 4MLVA 2E5QA 3UP9A 1LFHA 2KXDA 2JJKA 1JNFA 4ECFA 5TP9B 4HT9A 1K9YA 4JWXA 5A0GA 2JTMA 1SW4A 2RC7A 1T3LA 3FB9A 1M4ZA 2XD2A 2P4RA 4HTGA 3OY9A 3CCLQ 3S4UA 1LBCA 1GCPA 3JCMg 4EDPA 1O75A 3L2QA 1KA0A 1WHKA 3HTRA 4IO4A 1Y71A 1QKAA 2BUDA 3JZJA 3QO3A 4FEBA 4XU1A 2YWWA 2QVRA 3CR9A 4LA9A 3T0JA 3K6WA 3JCMQ 1EZPA 1MDQA 4ELQA 3L6GA 4KHZE 1QQJA 2GGRA 1NNKA 4RTXA 2Y7IA 5GAN4 1NUWA 4F3BA 4P1LA 4XFEA 3NTKA 3TKDA 3DP4A 5IKBA 2HAUA 2CP7A 3ZSFA 4JPBW 1JEUA 1LLSA 1ZBMA 5CIUA 4P0IA 4GIZA 1NV2A 1BB9A 3KSXA 3PPRA 4C0RA 3TCJA 3H6WA 4OFLA 3N26A 1IREB 4RG2A 4U21A 1QVGS 3RMSA 2CS7A 4EMKC 2X7PA 3CCJA 3EHRA 1YHQT 2RINA 1Q82U 2HAVA 4KYEA 1U8RA 1Q82C 1FTAA 4FORA 4AG2C 1IQ7A 1MPDA 4F7UE 3CD6T 2DZCA 3LYIA 2HFBA 1NLOC 1K76A 1HSLA 2ZZVA 3F11A 4DCXA 1KD1U 2DYBA 1VQ7Q 3PMIA 2C06A 1VIEA 2K5FA 2RHUA 3FV1A 3DP6A 5KDTB 3C95A 1ZSGA 2H25A 4C8QG 1SPKA 2RC8A 1NV5A 4KRTA 3JB9J 4QSCA 3CQTA 3EH1A 2RJFA 1YITA 5ET8A 1UUEA 4CRIA 3PT9A 1LEVA 5GAN7 3REBB 3VVEA 1A8EA 2B8AA 3QWXX 4PFPA 3VUZA 1JEVA 1EZ9A 4IO5A 1LAHE 3OBYA 4PL6A 3VS4A 1D3KA 2DXYA 4C0DC 4OB1B 3M4GA 1SQYA 2FZCB 4FBPA 1X69A 4OMBA 4E7HA 1PCXA 4NE4A 2JT4A 3EFSA 5DLQE 3MKDA 2DVCA 4OVJA 2K7AA 1IXDA 2DWAA 3CC4A 2M1HA 1OQKA 1M1KR 1SVXB 3MC2A 3TQWA 2FRWA 2K6DA 4ZN1A 1U3OA 1G3YA 5GMKm 1G83A 3PIOA 1CKAA 4PFWA 4WEDA 3OQ5A 4KUIA 3OW2S 3QBYA 4OFJA 1B4ZA 3CCUT 2W10A 4FM4B 3ODBA 3GBBA 1WNLA 5KYWB 2EBPA 1N3WA 3R26A 2XWVA 3OEMA 2J06A 1YWPA 5ET6A 4JUVA 3CRBA 3O6GA 5BUUA 1GTKA 2ALUA 3OYHA 3JV3A 4N6DA 1F1BB 3OMGA 1VQMA 1M5BA 5CMMA 5B7DA 2P0QA 5GAOr 4OA4A 2RQVA 3JCMf 2QJEA 3RTWB 5GAMf 4FCYA 2I58A 1ZTYA 3FJPA 2DYIA 3J80E 4MMKA 2WYPA 4BACA 3TTMA 4EXLA 4DQ2A 1WHHA 5TPAB 2KDSA 3E9GA 3I56A 5I56B 1N0TA 4QSEA 2NWJA 4IO7A 1WA7A 4FSSA 4C5GA 1JXMA 2DL4A 1AZEA 2MAMA 2WACA 3VS1A 2OTJA 2EGCA 3L2VA 4RY1A 3IB2A 2Z8EA 3PFSA 4M78C 5CVIA 4NL2A 1Q81R 3TCFA 3JCMJ 2UVJA 4FW1A 4YKJA 1AHJB 2BZYA 2OJTA 4AFUC 1MQDA 2DXUA 4M75A 1M3AA 4E2FB 1LJOA 1AZGB 5J39A 4P0GA 2V3TA 4NGUA 1YITT 4YMBA 1ARKA 1FPBA 3PPQA 5ET5A 2L3QA 1BK2A 1FPJA 4ZDMA 2XIDA 1IIWA 2GRVA 1Y4CA 3Q27A 5GAOp 2EJFA 1GV8A 2FZGB 2PVUA 2RF0A 2VGMA 3UORA 3TQLA 3CD6A 2KXCA 3EG3A 2DS9A 3FJ5A 5I56A 2V8KA 1IGUA 3CMAA 4YU0A 1BKAA 2J7IA 3SB2A 2V8JA 1POTA 1ZJLA 2XWIA 2QG9B 3PTYA 4NF8A 3CC4Q 1QCOA 2DDKA 2F5XA 2FNCA 2KT8A 3JB9D 3KXTA 3UF4A 3O29A 2FVUA 1WYXA 3D1RA 3KC1A 3M55A 1KIKA 2WYKA 4ORZA 1VIFA 4JB7A 3UDCA 4N0AC 4HVVA 1M5FA 5CC2A 2ZPBB 5I5PA 3OSSC 1M1GA 2KBTA 2RQWA 1P1OA 3CCVQ 2L0AA 1B05A 1B4HA 2XD3A 1NKXA 4H5GA 2DMOA 1XOCA 1Z9ZA 3S6WA 3FC3A 2NWMA 2GCXA 1RAFB 4M7AB 4PC9A 2FYIA 2QDLA 5IZ1A 3KZGA 5I84A 2CZIA 3U1OA 1VQ7T 1VQLT 2JTEA 4IUQA 2JNGA 1DSNA 3RT6B 1B1XA 4MEVA 1XNIA 1FSAA 2RQTA 4DZ1A 2CEYA 2QDYB 4PJOF 1WI7A 2HHMA 4IUTA 4JS4A 5DM7R 4Z8AA 3H6VA 4PGPA 3GBAA 3LX7A 1NYFA 1OVBA 4XKQA 2E3IA 3GP8A 3QZ9B 4IO6A 1W70A 2YLBA 1IEJA 4N4GA 2HQEA 3TCGA 1IHWA 2WX9A 1TU0B 2XWKA 2XXWA 4AB6A 1HK9A 1JU5C 4AFQC 1H3ZA 2A5TA 3OYDA 1LAXA 2YLNA 3EG9A 1NNPA 1EX4A 1M5EA 2GFEA 4F2QA 2DK3A 2JM9A 2RJDA 4M77B 4FU6A 3G4SA 3PIPA 2RA2A 5TU0A 1RLQC 2DL8A 2RO0A 3I5OA 2FPDA 8ATCB 4HVWA 4M77G 2X4JA 4YKPA 1TXQA 5CKFA 1JETA 2J05A 2ZYKA 3T1BA 4G68A 4M7DC 2MKZA 4RNSA 4PKCC 1UGRB 2ZYMA 3I35A 4XK8E 4IGRA 2DL7A 4R6YA 4XTVA 4HE1A 1QCNA 1XC1A 1DTZA 3SFMA 5H8FA 2KROA 4F7UA 4IO3A 2F34A 2H4IA 1MQIA 2A5TB 1Z7NE 4ZTFA 1RAGB 3EFOA 5CBSA 1JVYA 3IOUA 1YJNQ 2COZA 2H98A 2X3XD 2XHDA 2ANJA 2HQHA 4PQJA 4U4SA 5CKBA 2AHJB 1H45A 1DPPA 3OO8A 3PV0E 1E7OA 3O28A 4BDMA 1BYMA 4PBQA 1YI2A 4GFRA 1Q81C 1VQLA 4PFRA 1BCOA 1Q82R 5F7VA 4KXPA 1X75C 1NM7A 2K4YA 2DP8A 4E0WA 1GFCA 4E7IA 3CBPA 1NPPA 3OMCA 2I2LA 4KGZB 1XHYA 1UJYA 1VQ5A 5I11A 1YJNA 1M3BA 1MXXA 4HCCA 4N0AA 2JS0A 4A53A 2FIEA 4R6KA 3OO6A 1CKBA 2LCLA 1RDZA 3U72A 3LSFB 2YRVA 1QKBA 4RK9A 4LZ7A 3JCMP 5IGAA 4OERA 4C8QC 4KYDA 3USDA 3A8OB 3W15C 4GF8A 4QFPA 3QYHB 4PNOA 4ESRA 4DBHA 5DVFA 3G7WA 2GTJA 3K4UA 3PPPA 1IXHA 2DO3A 3DKMA 1TOVA 2HMAA 5LJ5g 4F7UG 1QVFP 3QZ5B 2YLCA 1FPLA 4JVCA 4R9FA 4PFYA 3VLWA 1WIEA 2Y7KA 4THIA 4J7IA 3HHGA 1DOTA 2F2VA 4XTXA 3H6UA 2KE9A 2H5YA 4U4XA 1M90U 3JV9A 2K5LA 1B3FA 3PUZE 3RN8A 3G6EQ 3CCRQ 4GQOA 4H1XA 5GMKj 5K2YA 1K0SA 2QVUA 2O2OA 1K4US 2IIMA 2OI3A 3JCMW 3REAB 2CYZB 4RCBA 1CNQA 3K6UA 1ZIUA 3VU3C 4Q30B 4MDXA 2CT3A 3R6OA 1BIYA 2Z22A 3FXBA 4UACA 3SEWA 2GHBA 3H41A 3JRZA 5KZTA 1Q7YR 2QA4T 2MF2A 2DL3A 3LSXA 3PMXA 1VQOA 4E0XA 3P7IA 1LCKA 1W2BA 4QFOA 1BLFA 3RGYA 3K01A 5CRYA 3RESA 2DWJA 4BLAA 1WPYA 4LN5A 2E41A 3WAFA 1IMDA 2XXRA 1I07A 3CCMA 3H0FA 2ZNUA 1QVGA 3TTLA 2VVKA 5KYUA 1M1KU 1I1JA 4M7DD 1B58A 2W7YA 3QWYA 3OS2A 2M51A 3NTIA 3JCMc 1Q9DA 3WVDB 2HZYA 3RPWA 4FT4A 1JJ2S 2ESWA 2QMWA 4F39A 5AA4A 3H4ZA 4ZS9A 1MNEA 4KD5A 5J26A 5GANg 4ZNXA 4Z89A 1VQMT 2CP0A 4HE2A 3M57A 4C8QB 2DWIA 4M7AF 2QQRA 2H8HA 2OX7A 3DB4A 1UQWA 3D7SB 5EG2A 1N9SA 3S9LC 2EKHA 2GHAA 4GWZA 3EPEA 4LATA 1NPRA 1RLPC 4R2BA 4C1TA 1VQ4Q 2RNAA 2FPEA 3LWHA 2H3JA 2DAQA 2R5AA 3KC0A 1URDA 1PG5B 3SKPA 2WSFE 4F04B 5LJ3h 1A0NB 1B7ZA 1LB8A 2ROTA 2P84A 2EGEA 3MZ9A 5KYXB 2LX7A 2H3EB 2YUQA 3N5LA 5JTYB 1QULA 3ILUB 2V4CA 4ZGDB 1GL5A 2OTJT 5B70A 4EUOA 2DD5A 2KQZA 1QVFA 1A54A 2F2XA 3EQ1A 4JBZA 3VFJA 3I3VA 4C5EA 1G0IA 1HXDA 4R72A 2ED1A 1KQSP 4C8QA 3MJXA 3FVGA 4F16A 4NG7A 2OTJQ 1K9MR 3OYGA 2F3DA 3FEOA 2V26A 3U23A 2A3LA 4PDDA 3VYHB 2WEFA 4I1DA 2K3YA 3VLUA 2E70A 2QS2A 5GJVB 3G3IA 1FTJA 1OPLA 4TOZA 4ZEDA 4NF4B 4F1VA 1PBQA 3PPOA 4I40A 3M5AA 4B9WA 3RPLA 4NX1A 1D3BA 1BIBA 2JTFA 1YP5A 3E13X 4MCOA 3T9XB 3MP8A 3JCMd 1N3XA 2LX9A 4ATOA 5HK3A 3TTNA 2JMCA 4LONB 3SDZA 2HZLA 4G8MA 2Y4YA 3X24B 1BIAA 2XXTA 2JW4A 2YUOA 1I6AA 1JVXA 1D1BA 2EFIA 1USYE 1ELJA 1FQCA 2EYWA 3O5ZA 4FYVB 2XXVA 4C0GA 1VQPQ 1IRXA 4ELOA 3MEUA 1I0CA 3RUXA 4MNCA 3IOVA 1A8FA 1PB8A 3G3FA 5LTCA 1TT1A 3EF7A 2QK0A 2FL7A 4IIOA 1MH3A 3W9VA 2CUDA 4YMAA 1JW1A 5FBPA 2ABHA 4OVQA 2VV5A 4DEYA 4BE0A 4LDUA 3OENA 4DXUA 3H8ZA 3RPLB 1LFIA 4OF1A 3O9PA 2LCCA 1OLCA 4FYWB 1RAAB 3MVZA 4PFTA 2ZYNA 3TUSA 2KEAA 1OZ3A 1URSA 4MX6A 2DEQA 2EKOA 3VS6A 1FRPA 4NS5A 2I4BA 1HSQA 4R2FA 2CZ6B 2NUTA 1K9MC 3E78A 5EQ9A 4OVRA 2PNIA 1KG1A 2O84X 5KCJA 3V5AA 2O69A 2K3BA 1FCKA 1TFDA 4OVPA 4IIMA 1MPCA 1JXOA 1K8AR 2I0CA 3VV5A 1YHQQ 4J6XA 5J1DA 4M7DG 3V8LA 4QKUA 1URGA 4DBQA 3R6NA 1NH8A 5IZ3A 5GAMj 1ZLQA 1U5SA 5ISUA 3DLNA 1IB8A 1V76A 4CI0C 4MZMA 3TZAA 4H65A 3EGXB 2ZNSA 1QW1A 1VQOQ 1NNFA 1UTBB 2CZLA 1CSKA 3K02A 4RMOA 4JJNK 2QPQA 3M58A 2HQ0A 2DQVA 5EHSA 5HBCA 1B3QA 4OMNA 4GWYA 3B7DA 4MMLA 3RKYA 4OWDA 2BJJX 2ZPGB 5LJ3j 1Q95G 4F7UB 3VE1B 2M0OA 1WFWA 3P8BB 3I55T 1JW4A 3RQTA 2E3HA 4DOVA 4OXVA 1W2BP 4DLDA 3JSCA 3PUXE 1X43A 5GANe 1BU1A 4M78D 1QMCA 2EPDA 2ONRA 1ZA2B 2JOYA 2DM1A 1F9BA 4BDYA 1FPEA 4R0KA 1MRPA 3P8HA 2PMSA 3T22A 1AMFA 1XI6A 1BI0A 3CMEA 1TXFA 3KG2A 3CCLT 2ZPFB 5GAOn 2E65A 3BY7A 3ILTB 3F70A 3VS5A 3A3UA 3A1PA 2K3XA 4FL6A 3SEMA 4BY6C 2LQNA 3IFCA 4R73A 2FPFA 4QHQA 1SW2A 3CCST 4PK4A 1ZLMA 5AT1B 4KBMB 4BE1A 1KQSA 1M9SA 5I2SA 4BDOA 1M5Q1 1VQNQ 2GTOA 2HNIA 2IVWA 3AT1B 2R5MA 4N4IA 2GQ1A 4XTZA 2VD2A 3WXMB 4QFLA 4LE9A 2OTLQ 1Y3NA 2IEEA 2I3WA 3LH5A 3O2AA 1N6AA 3HN0A 2F69A 4KCCA 2BE9B 3GNFB 1A99A 4PDHA 4OFOA 4RK2A 4QT7A 3TREA 4Z02A 3FVKA 3O97A 2D0QB 5IXBA 1TWBA 3RIRA 2QTVA 3QXMA 1WXTA 4OMLA 4KUDK 1DK4A 3QKJA 2B4MA 2Y7PA 4JWOA 1AT1B 2UVGA 3C0CA 3B50A 1YIJT 1FJ9A 5IHKA 1YI2Q 2O4XB 2PQWA 3CMAQ 3FVNA 2QEXT 2IG0A 2I6EA 1KC8R 5HM4B 4DXCA 1MHNA 1UG1A 2F6PA 3NGPA 3CSBA 4YKKA 4WXJA 1USYH 3CC2T 3EKIA 3HV1A 4OZ9A 4Q0CA 4OANA 4JJCA 2KR0A 2ZMBA 1RL2A 3CCQT 3FUZA 2HKQB 4IUVA 4O3AA 4C5IA 1S72T 1VQ6T 2O6AA 4Q5TA 2Z0WA 1XOVA 4XQ3A 2OBGA 2VYTA 2Y5LA 2PVGB 3BW1A 5KCJB 3RNNA 4QQ6A 2ZXTA 2CP3A 2GBQA 2W0ZA 2Y84A 3MO8A 4DXBA 2D9TA 4BY6B 5AA3A 1IZ6A 2CEXA 5H8SA 1GCQA 1WHJA 2MI6A 3N5BB 4JDSA 4G61A 2XXYA 2VWFA 4CC4B 4DEXA 4F7UF 3R6UA 2LC4A 3OS5A 5I2KB 3OS1A 2DWHA 1D3BB 2LNVA 1D9YA 2AKLA 1LOJA 1J1NA 1KWHA 2C0OA 4LQ5A 4KFQA 3B6WA 5LJ5d 3CI8A 3EH2A 4J9BA 4OYVA 3E9FA 4N81A 1Y4TA 3FRNA 3L2RA 1WX6A 1VQMQ 1MY2A 3TELA 1VOMA 4EF1A 5FHNA 5ET7A 4WF2A 4E7JA 3CC7Q 2EQJA 2HAXA 1UECA 2CZ0B 1OYXA 1PRMC 2HCKA 4J7FA 2BJIA 1NUXA 3IB1A 2O9SA 5DW8A 4E6RA 3CCMQ 3B6TA 2JMAA 3C4SA 1SPIA 4QQGA 3OYIA 5LL6S 1PC3A 2LQWA 3PGGA 3A09A 3LV0A 4ZZEA 2DX1A 1C6VX 1AVZC 5IAIA 1NBEB 1B51A 4IUPA 3I55A 4JLIA 5FHOA 3CCMT 4MIJA 4U1ZA 4YKIA 1Z9QA 2B3BA 3RLFE 1WDNA 5IM2A 2F6GA 3CC7A 3K1PA 3ZEHA 1EYKA 5L9SA 3OB9A 4RUGA 2MWOA 2RMOA 1M5DA 2O7IA 1RAEB 1ZA1B 2I0BA 1VQ9Q 3JB9G 2HSPA 4WCIA 1D0ZA 5TPAA 4I8CA 3V83A 5I57B 1VYTA 1QP2A 3SWNC 2GQIA 3C34A 2DIQA 2XK0A 3GPLA 2L3SA 2QQ9A 5DEXA 2DRKA 1B3HA 2MMPA 5GJWB 1MXWA 3SHWA 2KR3A 4LNPA 1M8MA 1E6HA 1QUJA 4N13A 1K9MU 4PFOA 5CKHA 3K6XA 1NZ9A 2OZZA 1US4A 3MWBA 4FYXB 1MV0B 5KYYA 1Q86R 2DVEA 2K9GA 2HKNA 1D9QA 3LW5E 1SW1A 4X04A 1IZ1A 2E64A 4GBVA 3TYHA 3JCMX 4J6YA 3LGLA 3KJ7A 3OA6A 2YPNA 3TTRA 1LBBA 1T0HA 3DM0A 1ABQA 1IMCA 4O7MA 4OHNA 5EYFA 3TDJA 4Q8RA 4PTKA 2HD0A 2PZ1A 2VGNA 5H8QA 2G3RA 1IXCA 2DZ9A 4JS5A 2JJ9A 3IB0A 2OWTA 3VVDA 3CFLA 4H45A 1I5OB 3VS3A 4PJOG 4VUBA 1TTHB 1KC8C 2XHCA 1NJIU 4OVAA 4IB2A 4O3CA 5CK9A 4J9FA 1SEMA 3SEYA 4JZ3A 1ZSZB 1O63A 4FSXA 2AL4A 3QMFA 3M9QA 4PF6A 4MFIA 4ESXA 3OD7A 1YI2T 3TU4K 1XS5A 3FXQA 1NV1A 3H03A 4KR5A 4H8IA 4M1VA 1SG5A 7AT1B 2VASA 4POXA 4M7AA 1JEGA 3G1JA 4KCDA 4JWYA 2VXFA 2LCSA 2LTOA 5IXFA 1LCTA 2BIVA 3HFOA 5D6WA 4CC2A 4P47A 4TQUQ 4A54A 2EQKA 1VQNT 3BFTA 2O31A 1VYVA 2QQSA 4P11A 4J9EA 1IUDA 2QYZA 2RJCA 2Z8FA 3TSWA 2NYSA 1FTOA 3RDVA 1IMFA 3PD8A 1R77A 5GAOl 3K1MA 3U65A 1FX7A 4FECA 3CMEQ 3MVWA 2M8CA 4NN3A 1YBYA 5CI5A 4MBPA 2ROLA 2FO0A 1MG1A 1O9SA 4M7DF 2HPGA 4PJOC 3MEAA 3EG1A 1MXVA 5A0LA 3MZ1A 1R9QA 2X51A 2CZ1B 5M2VA 2RHXA 1HJDA 2G29A 2P0SA 2PFYA 2V93A 4GLKA 4JXIA 1M90R 3M3KA 5AYFA 4GLMA 1BTJA 1ZUUA 1YFNA 3CCUQ 3BBRA 4XKPA 3CMAT 3UPUA 4HT8A 5KYXA 3G3JA 3FATA 2PU9B 3KN3A 1QVPA 5AA2D 1QWFA 1WVJA 3EHUA 1YYZA 2RI3A 4ELZC 4L17A 3TEPA 1FBGA 5HPQA 5C0MA 3CCJQ 1AWWA 1B34A 5FLXE 4HKEA 4PE5B 2DETA 2A0FB 1C0MA 4I9DA 2EGAA 3LBSA 5HY6A 4PJOE 1JW5A 3MBPA 1TUDA 2COYA 3CCEA 4OEUA 3OXNA 4HCYA 3CCLA 3PMWA 4I62A 4C0ZA 2HCAA 1Y3PA 3IQLA 3ZFJA 1N8RU 4OMQA 3HO7A 4MF3A 4F1YA 3JB9F 1EH3A 4L6V5 3IX1A 2FYKA 3OYFA 2XX8A 3CFXA 4PF8A 1UFFA 3JCMb 4RPOA 3C36A 4G8NA 4M75B 2VPNA 3CCSQ 1H641 4OETA 1SRMA 4X48A 2DNUA 3SEUA 4XTCQ 4ZTJA 4C0FA 1VQ9T 1B7UA 1QGXA 4GRKA 2P1SA 1BBZA 2F5KA 4M7DB 2E1SA 1B40A 1MM7A 2Q8MA 1M90C 4KH0B 3TODA 4N91A 4A4FA 2XI9A 3HFUA 4H5FA 1PB7A 4X9DA 3SERA 4OB3B 4GWOA 2A36A 4N8GA 1IMEA 4N07A 4PLIA 4M7AG 5L23A 3OYKA 1JJ2A 4O94A 4PBHA 1YJWT 2E1HA 2XXPA 4JRIA 2BZ8A 4MZPA 3CCSA 1FPFA 3Q29A 2FB7A 1G0HA 2DTHA 5I2KA 1RABB 1YAEA 4QFKA 3ISPA 4RJZA 4EF2A 2QEXA 3O6HA 2G93A 2VUBA 4EPCA 1D0YA 5GMKl 1WXUA 1FMWA 4ZE9A 1JJ2P 1UIUA 5CQYA 4ZGJB 3A8GB 1KD1R 3C12A 2FVZA 3PMTA 3QXEB 2PCRA 2AZVA 2LJ0A 2LAOA 3A5ZB 1Y96B 1EYJA 1NV4A 2AL5A 4RTTA 3AXFA 3BDLA 1QVSA 3MUQA 3EG2A 3INZA 4GWWA 3WAEA 3VUBA 1VQ5Q 2VD3A 2ENMA 2K2MA 1O64A 2A08A 2DE2A 2VOZA 1B7HA 4R9GA 4L5GA 1B07A 4XU3A 4A63B 2ABLA 1PWTA 2AIXA 3DP8A 3E79A 1NE8A 1HD3A 3K00A 3BFUA 1LNXA 1WJQA 3EG0A 3L1AA 4NL3A 3LWIA 4NF4A 2MYSA 4FE8A 2V3UA 9ATCB 2F78A 3V8XB 2DA9A 2QS4A 1MMNA 1VA7A 4K3FA 1MMGA 5I2MA 2ONSA 4N15A 2QAZA 3FLGA 5GAMd 3S3MA 4O5VA 5I2NA 3N6TA 3M59A 3MSTA 1YHQA 3JAME 3RERA 4KULA 1NG2A 4MHFA 2EQIA 4HE0A 1B52A 1MGQA 4FIMA 4ZZAA 2X35A 4ELYC 2EAYA 3CC7T 1M8VA 4GXSB 4C8QD 3KJTA 2PYYA 3THIA 4E7ZA 1GCQC 3KBRA 5GMKe 3G6ET 3G71Q 1XTDA 3I56T 1E6GA 1KHIA 2YHTA 2I4CA 3M4YA 3GF5A 3G3GA 3N94A 3G7ZA 1Y1MA 4TLLB 2K57A 4ELPA 1KK7A 1C1AA 5ICQA 4A4GA 1D09B 1TSFA 2DTOA 1M30A 3CG1A 2KQWA 4OB0B 2PVOB 4QQDA 4E47A 3DLLA 4JLGA 1LBVA 4C92D 5ITOA 5JTYA 2GF7A 1RI0A 3RNJA 1M1KC 1B3EA 1QCFA 3VLVA 4AFSC 5LOMA 3KBZA 1R8OB 2FA7A 1I6BA 4M75F 1XQHA 2D5WA 2NUVA 4J9GA 5GMKi 5DVJA 3TAJA 2XX9A 3OSVA 1R9LA 1VQ5T 1FTLA 3JCMe 3G3KA 1WQ7A 1WODA 4M78A 1VDWA 2DRMA 2SEMA 1CB6A 1BKBA 2ZPHB 1OOTA 1R1NA 3OELA 1IMBA 4PJMA 3CCQQ 3KOSA 4FIBA 1SKUB 2ZZDA 4GD5A 3V7SA 2A37A 1QLYA 8AT1B 4BUGA 1TG0A 4RTYA 4HW8A 1EU8A 2KK4A 5KDTA 3PUVE 4OMFB 2QS1A 3M8UA 1OEBA 1B46A 5CBRA 4Z88A 3OYEA 4WKMA 1GR2A 5KYUB 2SRCA 4JRQA 1KQ2A 4E7SA 4GXAA 2Y90A 3HSTA 1ZU0A 2ZCFB 1PKTA 3QJ6A 4KGVB 3IJXB 2CUBA 3PVLA 2ZAEA 4QW2A 5I3SA 1YWOA 4FT2A 4BI3A 4OP0A 1MY0A 2XKOC 5J3BA 2DF6A 2NXOA 4NHBA 4DDDA 3IK6B 4M77F 3O6IA 5GAN8 4MJOA 5IZZA 3TVTA 3V8JA 3LUYA 3SESA 3MHXA 3M0RA 3B8BA 4HCWA 2QXFA 3X20B 2QL3A 1FJ6A 2DBKA 2M9UA 1VQ4A 1V1CA 4G68B 4LDXA 1FW0A 4PETA 5FTIA 1P92A 3HHTB 1GGGA 1SDXA 5T3JA 2DXTA 3ECRA 4PJOA 3MPLA 3EGDB 4II1A 4XTUA 1I6QA 4NF8B 1WHGA 1EYIA 1P1NA 1NFTA 1WDXA 5BWJA 4P8BA 2LZ6B 4IO2A 4GY5A 1Y20A 4IR8A 2R9JA 3EHSA 5F24A 2ZZXA 2K2VA 3HRSA 4CC3A 2P2AA 3ZKLA 4DI4B 3VYGA 1B32A 1SYHA 1GFDA 1NEGA 2KRNA 3BE3A 3T9NA 2XMFA 2CKKA 2ZPEB 3M0UA 3ZL7C 3CCRT 1VQKQ 1NYGA 1B5IA 2R8TA 3PU5A 4GWXA 5L9OA 4QF9A 1VQ4T 3ONMA 1FBPA 1NV6A 1OI1A 5TP9A 2Z23A 4XEQA 1VQ7A 3TFLA 3EGDA 1FTKA 4M78E 1VFEA 4MAGA 1Y57A 4G8HA 3PD9A 5CCAA 4N4UA 3EHTA 2QGFB 1IGQA 4M78F 3PGFA 4TVRA 1XJWB 3QUFA 3G3HA 2CGHA 1MPBA 4ZEFA 3CXCA 2WKYA 6AT1B 2MIOA 1PM3A 2OCUA 2IPOB 2ONKE 3FD3A 4J8OA 2L3RA 2CZKA 2Q2AA 4LUBA 1QVGP 1OMPA 4I3YA 3R7XA 4F22A 1LVKA 5CKDA 5J16A 2RQRA 4BD3A 2OWSA 3MW0A 2EYYA 2DJZA 1DJ7B 2XXXA 3E2UA 3CXCP 1FMVA 5I57A 2AIRB 2R6GE 2HL3A 1LSTA 3IOTA 1RUWA 4BB7A 3CCQA 5FHMA 1SYIA 2P3VA 1B1HA 1EFNA 4LDVA 3GZGA 1K8AU 2P0KA 1T3SA 1H44A 4NQ8A 3C35A 3OS0A 1UTHB 4AB5A 4N6PA 1VQ8T 1YJ9A 4XF5A 3IL1B 2FRYA 2NUTB 5KYYB 2KSSA 5IH2A 3CCVA 1MH4A 4GLIA 3I5SA 3GOXA 1N7WA 4BDZA 5GAMh 3V8KA 1K73U 5CO7A 3D4CA 2CT4A 4M77E 4RCCA 3NTHA 4R74A 2RCAA 1VQLQ 3O8VA 4G2ZA 3MEWA 1VQKA 1ZHIA 1K73R 4NEDA 5LJ5f 3U92A 3B6QA 4C92C 2LDMA 1FBDA 2CP6A 4O6JA 1Y9UA 3QUJA 1H92A 3S3NA 4KI0E 1ATGA 4AS5A 2OAUA 1MM6A 4UA8A 2QS3A 3LLRA 4J5YA 2MWPA 2I49A 1A7LA 3J7AF 3MEVA 3KN7A 3EG9B 1NV3A 4ISUA 5AA4B 1PRLC 2UXAA 1PC0A 1S72A 1VQ6A 4WTOB 3CIJA 2CH4A 3A3CA 1ZX6A 4HVUA 1ZKBA 3TPAA 4PJJA 3CEYA 1YJWA 2F8DA 3CMET 1YXIA 2K5IA 1MMDA 5LJ5j 4YZZA 3E19A 2XWOA 5ESYA 2O1LA 3T9VA 2RB6A 4EQBA 3KBGA 1NV0A 2F3BA 3OYCA 4EMKB 3J81E 5GAN3 2DTIA 1NJIR 3IO4A 3CBMA 3VS2A 1UHFA 2VGQA 1G5VA 2A28A 2X4XA 1VQPT 4PJOD 2NUPA 4ZEBA 5KCOA 4DBRA 4D6WA 2WSEE 1JRIA 5FWBA 5ITPA 4UC4A 3SWNA 1INPA 1SD3A 4FAJA 2MCNA 4IURA 1H3HA 4X1BA 3SEVA 1M1FA 1XT8A 3PUWE 5DY9A 1QWEA 1YCSB 1HSJA 5L8DA 5FWCA 2BKDN 4BDLA 4IUUA 1UGSB 2X26A 2YRDA 1PSFA 1OULA 3URGA 5EYHA 4IY6A 2G6FX 3S9MC 1NMUA 2RM4A 1B5JA 2M0YA 3NHNA 1QVFS 3THKA 1SBPA 3I6VA 2XD0A 4MDWA 3D4GA 2QMXA 2EVRA 3GLBA 2EYZA 3CCUA 3EGXA 2PUKB 3RYDA 1SF9A 4P5NA 4HA8A 1SSFA 2JUFA 2KYBA 4ONYA 3FASA 1IO6A 2KRMA 1G8XA 3FIFA 4Y92A 1M27C 2E0SA 4P56A 3OSRA 5DTBA 2YXYA 1LGBC 1N76A 4PAFA 4OENA 3GIBA 1NL5A 3L42A 1MXZA 2L89A 2V1RA 4ZEKA 4PJNA 4B6MA 4L59A 1VQNA 1H76A 1PDAA 1RKMA 1S9TA 3N6UA 4LZ5A 1K1ZA 2LMJA 3CPWS 2WBBA 4N17A 5EQ7A 2COWA 4X9CA 5L8RE 3L2WA 3LGFA 3FBPA 3A29A 1AWJA 3QDFA 2UYEA 4QBAA 2DBMA 4RTUA 4C8QF 1N5ZA 3META 2NUZA 4FJPA 4MNIA 3S9EA 3OYNA 4ZECA 3BIGA 3PMVA 3CC2A 1K0XA 2O51A 4DA4A 1ZBJA 2J6OA 1VQ8Q 1B0HA 2Y4XA 1W2BS 4H46A 3IOWA 4ZEIA 2LP5A 2YJPA 1Q35A 1MDP1 2FG0A 3RY3A 3IFAA 4WEPA 2M02A 1R6ZA 1UEBA 1DTGA 2F2WA 1FPGA 2ESNA 1W4SA 4OB2B 1MQGA 4H67A 2Q8JA 3QYTA 4XU2A 1GXIE 5LJ5h 3K0VA 4LQ2A 4LN2A 2LQ8A 4P9KA 4M7AE 3CC4T 1AD5A 3G4ST 3ZBDA 5IAYA 1JBMA 2RD1A 2X9HA 1K73C 1B3GA 3QJYA 1D1AA 3QYGB 2REGA 3L6HA 4MMPA 4NWCA 1PD0A 4OTEA 4JVIA 4LP2B 3VXBA 3IORA 5GAOq 1M3CA 4XAXB 2AT1B 5M9OA 3OYYA 3SWNB 3JB9H 2YRCA 1G3TA 1S7YA 4KQPA 1S1NA 4XKRA 1FTMA 4JSOA 1GBRA 1B3LA 1B5HA 4M75G 2VPOA 4QXDA 2PFZA 3ASKA 4P1EA 3MPUB 1P1UA 1GRIA 4LDWA 1WHLA 3HP9A 3FVOA 4LUDA 2LQKA 3VV0A 2XXQA 1PB9A 1I81A 2ZZWA 4YB6A 1WJSA 2GNCA 2NLUA 3IR1A 4C1UA 1WJRA 1POY1 1T0JA 5CKEA 2XDDA 3QIIA 2XA5A 1KC8U 3CPWA 3FV2A 3MYUA 1VSOA 2XXUA 5FU6B 2LJ3A 2OAWA 2QA4Q 4YICA 1DPEA 3PVQA 3ZS6A 1OV3A 2Z8DA 1AOVA 1EZZB 1VQ9A 1FBHA 2DYXA 3QPHA 3CHGA 3OW2P 3VS7A 4QSDA 1YPNA 5GAMe 4AQ4A 1N7XA 2X4WA 4XIGQ 1JQFA 4BDNA 1KFZA 5CMCA 1FPKA 3BIHA 2HEQA 2P0PA 4F17A 1AEYA 3S3OA 1MXYA 1Q86C 1PEBA 3ZKKA 1ZUKA 2OX3A 4NF6A 2FZKB 2CREA 2EYXA 4C92E 5I59A 2KGTA 5L9MA 1FBEA 3LUZA 4J83A 2OWZA 4DIGA 2O88A 3M3FA 3C33A 3UT1A 2XDBA 2KYMA 3HPWA 2AYSA 2GFUA 3UA7A 2O9VA 2YDLA 1X2KA 1U06A 1I5LA 1MMAA 4Y28E 1DMBA 2QASA 2F97A 1D9VA 3HSBA 2DOJA 1OQHA 3HCQA 5H8QB 3VDFA 2L8DA 4EIKA 1I69A 3IO6A 3JYRA 1PNJA 4C5HA 4EQ9A 3FZVA 2AK5A 3KEIA 3G71T 4CC7A 2FBPA 4QVCA 2P4TA 2CP2A 2LVMA 4LD6A 1Q7YU 3MP1A 1G3WA 1Y96A 4M77A 3EGUA 3RUMA 3C9HA 1P1QA 1US5A 2DLPA 2EQMA 2RN8A 3KFMA 5I58A 5ELVA 2ZGWA 3CSGA 2KLFA 3G6EA 4OMOA 1LCFA 2JM8A 2PT1A 1RADB 2R71A 2Y7WA 5A5XB 4DBFA 5EHMA 2XU8A 1IITA 1ZBXA 3ME9A 5DEXB 5JK4A 3A8LB 3TQ7P 1H8KA 1VQ8A 5EQ8A 4H6DA 4M4ZA 2HBWA 2PUOB 1XVYA 1UDLA 5H8NA 3RTFB 2EW3A 5A5LA 3U94A 4NWDA 1Y07A 5CQXA 1YCYA 1WLPB 3T9HB 5I2NB 4JJDA 3VRZA 4C92A 1D4NA 1L5TA 2VHAA 1M2OA 5H8HB 3QSUA 2VB6A 2DE3A 3T96B 3RT8A 1QUIA 1FQDA 4XTYA 1MNDA 1LB9A 3V7CA 2V84A 2WBDA 2DILA 4HCKA 1YCJA 2GH9A 3H6ZA 3OO9A 3T66A 1TS9A 3A8HB 4KH1B 3HFNA 1UTBA 3U8QA 1X6BA 4AMCA 1OX9A 3UIFA 3KSJA 2XX7A 4PAKA 2RK1A 1FBFA 2E6ZA 4LUEA 3FIRA 1HSEA 2YUPA 1OU8A 3E1SA 2J6FA 1UE9A 3QIMA 3RMQA 3FJMA 4PE3A 3SEXA 3G71A 2V25A 4HCZA 1G2BA 5H8HA 4Y91A 3BKIB 4M75D 2EQUA 2B4LA 1VQPA 3OYAA 4RTVA 1M5CA 2FIXA 3OEKA 3A8MB 4C92B 4H8JA 3ULRB 4OESA 1II5A 1B34B 2HEUA 1AWOA 1UGVA 2X7QA 2VC8A 1LBXA 2LT4A 4HCBA 2RJEA 1B9JA 1UGQB 1YIJA 4RG8A 5D7UA 1VFDA 3FXUA 2CZHA 3UWNA 4X9TA 3MCAB 2CMOA 1IXGA 4J9IA 1JB0E 4JSDA 4NF6B 5I59B 1KZ8A 1RI9A 1BCMA 1Q81U 2CH4W 2CSIA 1OQGA 3PPNA 3FGSA 2EIFA 3K6VA 4O3BA 1UJ0A 4AG1C 5GAN5 3UATA 2MPXC 3UA8A 4U23A 3HRTA 3H9NA 1ACMB 1VUBA 2KY9A 5FW9A 5KE3A 4PFZA 2DD4A 2DERA 3WVEB 3G4SQ 1P1WA 4MNPA 1KQ1A 3PE0A 4A4EA 2LRQA 1J3TA 2Q74A 1ABOA 2MOXA 1A55A 2HL5C 4M77D 5I58B 5DYHA 4PFUA 3E4RA 2HSEB 1N9RA 4TLMB 1AWXA 5DVIA 4E7KA 1MUZA 3VRYA 5FRNA 1X01A 4UABA 4H0WA 3M56A 1NEBA 5GANd 4XU0A 4IKFA 1Y7XA 4AT1B 4OMMA 1MY4A 2HXRA 4D8KA 3CCET 2Q9TA 1OU9A 3Q26A 1NJIC 3KFVA 1LAFE 1W1FA 1K9ZA 3QK6A 1M2VB 2M16A 3QHSA 1KA1A 2XXKA 2Y5KA 3GNGA 1IHVA 4NOYA 2RKMA 4AS4A 4QVDA 3PUYE 1G3SA 3HHFA 4QVZA 2R58A 3CCEQ 1XVXA 2THIA 3Q25A 3M54A 5KE2A 1YN8A 4HXJA 1P99A 4M7AD 4KGXB 5FRMA 1Y0MA 2EJ9A 4F19A 2YT6A 1WXBA 1YJ9Q 3CG3A 4P3LA 1NV7A 1WGSA 4F31B 2XXIA 5EC7A 2OK2A 4HS7A 3TMGA 4GWUA 2KI7A 2RHZA 3HRUA 2HZKA 4JRPA 2RCBA 1TFAA 4PFBA 2F1LA 4ZGEB 3CXCS 4OGEA 5FU7C 2VP1A 1SW5A 1S50A 2F7BA 1NUZA 4U2RA 3VS0A 2FHYA 4GBWA 2RH2A 2HDAA 3DLMA 1K8AC 1HYOA 1NH7A 1YJNT 3JB9I 2BE7D 4R55A 1Q7YC 3C32A 1U1SA 4DCYA 4A4HA 4GL0A 1LPLA 4RPNA 1PD1A 2BTTA 3ER0A 2O68A 3CFZA 4O8MA 4F3GA 3OOAA 3RKWA 4EMHA 1SHGA 4J9DA 3CPWP 2DFUA 3CCRA 2L3PA 4MLQA 4AFZC 3TTKA 2AKKA 4XTWA 2JZ2A 1VYUA 1UB4A 3FXRA 2DJQA 5CMBA 2O4XA 2O7UA 2P3NA 3MP6A 3I9QA 3OBWA 3K1NA 2DPPB 4ME7A 1MY1A 3OO7A 2RQUA 4Q5WA 3NPFA 2ATCB 2IA4A 4GX3A 1X2QA 3EHQA 3VXCA 3SD4A 3M53A 2RPNA 3LR1A 1DBZA 1OPKA 1Q1KA 3H0HA 3DELB 3H3GA 5DLOA 1V29B 1ZMGA 2V3QA 2O01E 5GANf 1YJWQ 1VR5A 5KH6A 2B65A 1QP3A 2JN0A 2X4YA 3RBBB 1SI1A 2DE4A 1ZQ1A 2PVDB 5LJ3e 1UTHA 2D0NA 2D8JA 3VVFA 2PBWA
chains in the Genus database with same CATH topology
4M78B 1B2HA 1OZ2A 2EJGA 3JCMh 2Y7RA 3W9WA 2RHYA 1BI1A 3LC8A 2H9BA 3K2DA 1TH7A 4X1DA 2D21A 2E10A 3MPKA 2I3VA 4EDUA 2RK2A 3H6TA 5D6YA 5IN1A 3S2VA 5AA2A 5GMKh 2OTLT 1U1TA 5CM6A 5A0DA 3CCVT 3DB3A 1FWZA 2DKGA 1KHCA 5GAN6 4ESWA 2HQXA 1QUKA 1GVCA 2I48A 3GXAA 2QQBA 4POWA 3X26B 3U93A 2RI5A 1AL3A 2Q89A 2RHIA 2QA4A 2F35A 5FTHA 5A5XA 1X6OA 4R6HA 2D3IA 4C0DB 1NNTA 3E9XA 4M4GA 4F2OA 1B6HA 5H8NB 1CE2A 3EFRA 4BI8B 1B0LA 2NVUB 2B3FA 4LDYA 5AA2B 3RKXA 3VKIA 5HKCA 1VE4A 1EZOA 1YTVA 4GL8A 2VXEA 4PJOB 4KYSA 3TEEA 4C92F 2PX1A 3AHUA 3C4MA 1IXIA 1RYXA 4YAHX 3BFMA 2HBPA 3PNWC 4RA1A 2XXHA 3KUFA 3T9UA 5AA1A 3SDFA 1AH5A 4R75A 2F7AA 3OW2A 4M75E 5F1QA 3V89B 1A40A 3Q28A 3QG1A 2QQAA 5FU7B 4M7DA 2GFAA 4E7LA 2PT2A 3IAZA 1BP5A 3QDRB 4IY5A 4MH5A 3FDRA 4YB5A 2QSXA 3L2ZA 5LJ3f 2XDPA 3FJGA 4DE8A 5LJ3g 2NOOA 4FEDA 2QTXA 1OIBA 5AE4A 3X28B 4OEVA 1O7TA 2WSCE 3E3KA 3MJNA 1FQEA 4M75C 1VQOT 2DVZA 3H06B 2F7CA 4RYAA 2O1MA 4EXKA 5C6SA 3GLXA 5GANh 1ANFA 1T0KA 1MQJA 4YB7A 1N04A 1UGPB 4BDQA 4JDFA 1EIFA 4Z7EA 2REJA 2KVQG 3OYJA 1Q86U 4LVQA 4OQOA 1MY3A 5GAOm 1N84A 5FROA 4G4PA 2XICA 1LAGE 4BE2A 3UN6A 4N4HA 2QI2A 4XXUA 1PBPA 4KT0E 4M7DE 3M3LA 3MAMA 3KOTA 3LH0A 4OGCA 2XG8D 4YTLA 3H7MA 1QJMA 3Q1JA 4DOWA 4G77A 3O66A 3NFCA 4GVOA 1BI2A 2V8IA 2DXRA 1VQKT 5CAIA 1FQFA 1PSEA 4F1UA 4G68C 2DXBA 4JRKA 4C8QE 2GQVA 3X25B 4RXLA 5IT9E 1I8FA 4BDRA 3EN3A 4A4KA 1YJ9T 1RYOA 5FU6C 5H8FB 2DIGA 2RC9A 2E6NA 3OMBA 4EQ7A 5ICTA 4F18A 1BI3A 1OLAA 3HKSA 1H43A 1MS7A 3T93B 1KD1C 4J6WA 4LD9K 1TWYA 3QSLA 1N8RC 2L5QA 4PP0A 3PTAA 2ZNTA 4NF5B 3C31A 5KCHA 5I21A 4ND9A 3MZBA 2ZYOA 4U1OA 3P8DA 3IJOB 4RKUE 4M7AC 4F3SA 2D6FA 3KGCA 2RF1A 1N27A 1AIVA 3CVGA 3MQ9A 2EYQA 4M78G 2RI2A 1KQSS 3UK4A 4GOTA 2FHDA 3HPIA 4C92G 1H3DA 5JEIA 2ZPIB 4NTLA 4ZN3A 2QRYA 1FXXA 4B9XA 5CR2A 1QW0A 3L2UA 5K2XA 1SI0A 4NF5A 2E12A 1MQHA 4V2SA 2DSFA 2CZ7B 3OYMA 2Q88A 3LSWA 1MXUA 4FATA 4KPTA 4MZTA 2KAFA 4U22A 5GANj 3OSQA 4ZE8A 4M77C 2LT1A 3LSLA 3MVYA 1Y3QA 3CCJT 3EAEA 5D6XA 5CMKA 2EWNA 3SETA 3V7RA 5GAMg 3OYLA 4QRZA 5GAN2 1Y1ZA 3JCMV 5LJ3d 2DXCA 3S9NC 2HXWA 5DT6A 1UIVA 4EMKA 3UGWA 2A7YA 4Z0IA 2H99A 3HL8A 3MVXA 2A5SA 3QAXA 4X34A 1LFGA 1WQWA 4LZ8A 4F29A 3FJ7A 2KMTA 2JVVA 2F5TX 1FQAA 4F3PA 5HK0A 3CPFA 4XKNA 3CBOA 5A2QE 2F36A 4IGTA 4QFNA 3OYBA 1OVTA 3VJPA 3KN8A 2OTLA 2UYFA 4NMYA 2UVHA 1I4K1 4EMGA 2OLBA 1Z7ME 3C94A 4PLLA 5LJ5e 4R56A 4ELRA 2R57A 3TCHA 3QUIA 4BI4A 3BDUA 1FQBA 2UVIA 2Q2CA 4MLVA 2E5QA 3UP9A 1LFHA 4ECFA 1JNFA 5TP9B 4HT9A 4JWXA 5A0GA 2JTMA 1SW4A 2RC7A 3FB9A 1M4ZA 2XD2A 4HTGA 3OY9A 3S4UA 1LBCA 3JCMg 4EDPA 1O75A 3L2QA 4IO4A 1Y71A 1QKAA 2BUDA 3JZJA 3QO3A 4FEBA 4XU1A 3CR9A 4LA9A 3K6WA 3JCMQ 1EZPA 1MDQA 4ELQA 3L6GA 4KHZE 1NNKA 2Y7IA 5GAN4 4F3BA 3NTKA 3TKDA 3DP4A 5IKBA 2HAUA 3ZSFA 1JEUA 1LLSA 1ZBMA 5CIUA 4P0IA 4GIZA 3KSXA 3PPRA 4C0RA 3TCJA 3H6WA 4OFLA 3N26A 1IREB 4RG2A 4U21A 1QVGS 3RMSA 2CS7A 4EMKC 2X7PA 3CCJA 2RINA 1YHQT 1Q82U 2HAVA 4KYEA 1U8RA 1Q82C 4FORA 1IQ7A 1MPDA 4F7UE 3CD6T 2DZCA 3LYIA 2HFBA 1HSLA 4DCXA 3F11A 1KD1U 3PMIA 2C06A 1VIEA 2K5FA 2RHUA 3FV1A 3DP6A 5KDTB 3C95A 2H25A 4C8QG 2RC8A 3JB9J 4QSCA 2RJFA 1YITA 4CRIA 3PT9A 5GAN7 3VVEA 1A8EA 2B8AA 3VUZA 1JEVA 1EZ9A 4IO5A 1LAHE 3OBYA 4PL6A 1D3KA 2DXYA 4C0DC 4OB1B 3M4GA 1SQYA 4OMBA 4E7HA 4NE4A 3EFSA 5DLQE 2DVCA 4OVJA 2DWAA 3CC4A 2M1HA 1SVXB 3MC2A 3TQWA 4ZN1A 1G3YA 5GMKm 3PIOA 4PFWA 4WEDA 3OQ5A 4KUIA 3OW2S 3QBYA 4OFJA 1B4ZA 3CCUT 4FM4B 3ODBA 3GBBA 1WNLA 1N3WA 3R26A 3OEMA 4JUVA 3CRBA 3O6GA 5BUUA 1GTKA 2ALUA 3OYHA 3OMGA 1VQMA 1M5BA 5CMMA 5B7DA 2P0QA 5GAOr 3JCMf 2QJEA 3RTWB 5GAMf 2I58A 1ZTYA 3FJPA 3J80E 4MMKA 4BACA 3TTMA 4EXLA 4DQ2A 5TPAB 2KDSA 3E9GA 3I56A 5I56B 1N0TA 4QSEA 2NWJA 4IO7A 4C5GA 2MAMA 2WACA 2OTJA 4RY1A 3L2VA 3IB2A 2Z8EA 3PFSA 4M78C 5CVIA 4NL2A 3TCFA 3JCMJ 2UVJA 4YKJA 1AHJB 2OJTA 1MQDA 2DXUA 4M75A 1LJOA 5J39A 4P0GA 2V3TA 1YITT 4YMBA 3PPQA 4ZDMA 2XIDA 1IIWA 2GRVA 1Y4CA 3Q27A 5GAOp 2EJFA 1GV8A 2PVUA 2VGMA 3UORA 3TQLA 3CD6A 2DS9A 5I56A 2V8KA 3CMAA 4YU0A 1BKAA 3SB2A 2V8JA 1POTA 1ZJLA 4NF8A 2F5XA 2FNCA 3JB9D 3KXTA 3O29A 2FVUA 3M55A 4JB7A 1VIFA 3UDCA 4N0AC 1M5FA 5CC2A 2ZPBB 3OSSC 1M1GA 2XD3A 4H5GA 1P1OA 1B05A 1B4HA 1NKXA 1XOCA 3S6WA 3FC3A 2GCXA 4M7AB 2FYIA 3KZGA 5I84A 3U1OA 1VQ7T 1VQLT 4IUQA 2JNGA 1DSNA 3RT6B 1B1XA 1XNIA 4DZ1A 2QDYB 4PJOF 4IUTA 4JS4A 5DM7R 3H6VA 3GBAA 3LX7A 1OVBA 4XKQA 3GP8A 3QZ9B 4IO6A 2YLBA 1IEJA 4N4GA 2HQEA 3TCGA 2XXWA 4AB6A 1HK9A 2A5TA 1H3ZA 3OYDA 1LAXA 2YLNA 1NNPA 1M5EA 4F2QA 2GFEA 2DK3A 4M77B 2RJDA 4FU6A 3G4SA 3PIPA 2RA2A 5TU0A 2RO0A 3I5OA 4M77G 2X4JA 4YKPA 5CKFA 1JETA 2ZYKA 4G68A 4M7DC 4RNSA 4PKCC 1UGRB 2ZYMA 4XK8E 4IGRA 4R6YA 4XTVA 1XC1A 1DTZA 3SFMA 5H8FA 4F7UA 4IO3A 2F34A 2H4IA 1MQIA 2A5TB 1Z7NE 4ZTFA 5CBSA 1JVYA 3IOUA 2H98A 2XHDA 2ANJA 4PQJA 4U4SA 5CKBA 2AHJB 1H45A 1DPPA 3OO8A 3PV0E 3O28A 4BDMA 1BYMA 1YI2A 4GFRA 1Q81C 1VQLA 5F7VA 1X75C 2K4YA 2DP8A 4E0WA 4E7IA 3CBPA 1NPPA 3OMCA 2I2LA 1XHYA 1VQ5A 1YJNA 1MXXA 4HCCA 4N0AA 4A53A 4R6KA 3OO6A 2LCLA 3U72A 3LSFB 2YRVA 1QKBA 4RK9A 4LZ7A 3JCMP 4OERA 4C8QC 4KYDA 3USDA 3A8OB 3W15C 4GF8A 4QFPA 3QYHB 4PNOA 5DVFA 3G7WA 3K4UA 3PPPA 1IXHA 2DO3A 3DKMA 5LJ5g 4F7UG 3QZ5B 2YLCA 4R9FA 4PFYA 3VLWA 2Y7KA 4THIA 4J7IA 3HHGA 1DOTA 4XTXA 3H6UA 2H5YA 4U4XA 1M90U 3JV9A 2K5LA 1B3FA 3PUZE 3RN8A 4GQOA 4H1XA 5GMKj 5K2YA 3JCMW 2CYZB 4RCBA 3K6UA 1ZIUA 3VU3C 4Q30B 4MDXA 3R6OA 1BIYA 2Z22A 4UACA 3SEWA 2GHBA 3JRZA 5KZTA 2QA4T 2MF2A 3LSXA 3PMXA 1VQOA 4E0XA 3P7IA 1W2BA 4QFOA 1BLFA 3RGYA 3K01A 5CRYA 3RESA 2DWJA 4BLAA 1WPYA 2E41A 3WAFA 2XXRA 2ZNUA 3CCMA 3TTLA 1QVGA 1M1KU 4M7DD 2W7YA 1B58A 3OS2A 3NTIA 3JCMc 3WVDB 3RPWA 4FT4A 1JJ2S 2QMWA 4F39A 5AA4A 3H4ZA 4ZS9A 4KD5A 5J26A 5GANg 1VQMT 3M57A 4C8QB 2DWIA 4M7AF 2QQRA 3DB4A 1UQWA 5EG2A 1N9SA 3S9LC 2GHAA 3EPEA 4LATA 1NPRA 4R2BA 4C1TA 3LWHA 2H3JA 2DAQA 2R5AA 1URDA 3SKPA 2WSFE 5LJ3h 1B7ZA 1LB8A 3MZ9A 3N5LA 5JTYB 1QULA 3ILUB 4ZGDB 2OTJT 5B70A 4EUOA 2DD5A 1QVFA 1A54A 3EQ1A 4JBZA 3VFJA 3I3VA 4C5EA 1HXDA 4R72A 4C8QA 3FVGA 3OYGA 3FEOA 2A3LA 3VYHB 4I1DA 2K3YA 3VLUA 2E70A 2QS2A 3G3IA 1FTJA 4TOZA 4ZEDA 4NF4B 4F1VA 1PBQA 3PPOA 3M5AA 4B9WA 1D3BA 1BIBA 2JTFA 3E13X 3T9XB 3MP8A 3JCMd 1N3XA 2LX9A 4ATOA 5HK3A 3TTNA 4LONB 3SDZA 2HZLA 4G8MA 2Y4YA 3X24B 1BIAA 2XXTA 1JVXA 1I6AA 2EFIA 1USYE 1ELJA 1FQCA 2XXVA 4C0GA 4ELOA 3MEUA 3RUXA 3IOVA 1A8FA 1PB8A 3G3FA 1TT1A 3EF7A 2FL7A 1MH3A 3W9VA 4YMAA 1JW1A 2ABHA 2VV5A 4BE0A 4LDUA 3OENA 4DXUA 3H8ZA 1LFIA 4OF1A 3O9PA 2LCCA 1OLCA 4PFTA 3MVZA 2ZYNA 3TUSA 1OZ3A 1URSA 2DEQA 2EKOA 4NS5A 2I4BA 4R2FA 2CZ6B 1K9MC 1KG1A 2O84X 5KCJA 3V5AA 2O69A 1FCKA 1TFDA 1MPCA 3VV5A 2I0CA 4J6XA 5J1DA 4M7DG 3V8LA 1URGA 1NH8A 5GAMj 1ZLQA 5ISUA 3DLNA 4CI0C 4MZMA 3TZAA 4H65A 2ZNSA 1QW1A 1NNFA 1UTBB 2CZLA 3K02A 4RMOA 4JJNK 2QPQA 3M58A 2HQ0A 2DQVA 5EHSA 5HBCA 3B7DA 4MMLA 3RKYA 4OWDA 2BJJX 2ZPGB 5LJ3j 4F7UB 3VE1B 2M0OA 3P8BB 3I55T 1JW4A 3RQTA 4DOVA 4OXVA 4DLDA 3JSCA 3PUXE 5GANe 4M78D 2ONRA 2JOYA 1F9BA 4BDYA 1MRPA 3T22A 3P8HA 2PMSA 1AMFA 1BI0A 3CMEA 1TXFA 3KG2A 3CCLT 2ZPFB 5GAOn 2E65A 3BY7A 3ILTB 3F70A 3A3UA 2K3XA 4FL6A 4BY6C 4R73A 4QHQA 1SW2A 3CCST 4KBMB 4BE1A 1KQSA 1M9SA 5I2SA 4BDOA 1M5Q1 2HNIA 2IVWA 2VD2A 2R5MA 4N4IA 4QFLA 4XTZA 3WXMB 1Y3NA 2IEEA 2I3WA 3O2AA 1N6AA 3HN0A 2F69A 4KCCA 3GNFB 1A99A 4OFOA 4RK2A 3TREA 4Z02A 3FVKA 3O97A 2D0QB 3RIRA 3QXMA 4JWOA 4KUDK 2Y7PA 3QKJA 2UVGA 1YIJT 2O4XB 2PQWA 3FVNA 2QEXT 2IG0A 2I6EA 5HM4B 4DXCA 1MHNA 2F6PA 3CSBA 4YKKA 4WXJA 1USYH 3CC2T 3HV1A 4OZ9A 4Q0CA 2ZMBA 1RL2A 3CCQT 3FUZA 4IUVA 4O3AA 4C5IA 1S72T 1VQ6T 2O6AA 4Q5TA 1XOVA 4XQ3A 2OBGA 2VYTA 2PVGB 3BW1A 5KCJB 3RNNA 4QQ6A 2ZXTA 4DXBA 2Y84A 3MO8A 2D9TA 4BY6B 5AA3A 1IZ6A 5H8SA 2MI6A 3N5BB 4JDSA 2XXYA 4F7UF 3R6UA 2LC4A 3OS5A 5I2KB 3OS1A 2DWHA 1D3BB 2LNVA 1D9YA 1LOJA 1J1NA 1KWHA 4LQ5A 4KFQA 3B6WA 5LJ5d 3CI8A 4OYVA 3E9FA 1Y4TA 3FRNA 3L2RA 3TELA 1MY2A 4EF1A 5FHNA 4E7JA 4WF2A 2EQJA 2HAXA 2CZ0B 1OYXA 4J7FA 3IB1A 3B6TA 3C4SA 4QQGA 3OYIA 5LL6S 1PC3A 3PGGA 3A09A 4ZZEA 5IAIA 1B51A 4IUPA 3I55A 4JLIA 5FHOA 3CCMT 4U1ZA 4YKIA 2B3BA 3RLFE 1WDNA 2F6GA 3CC7A 3K1PA 3ZEHA <