3MP6A

Complex structure of sgf29 and dimethylated h3k4
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
517
structure length
508
Chain Sequence
MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALAAAQTNAAAEFGSSYWTSEYNPNAPILVGSEVAYKPRGEWIQCEVLKVVADGTRFEVRDPEPDELGNSGKVYKCNRKELLLIPPGFPTKNYPPGTKVLARYPETTTFYPAIVIGTKRDGTCRLRFDGEKETEVTRRLVLPSPTALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Maltose-binding periplasmic protein,LINKER,SAGA-associated f
publication title Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Histone binding protein
total genus 151
structure length 508
sequence length 517
ec nomenclature
pdb deposition date 2010-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
A PF07039 DUF1325 SGF29 tudor-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3mp6A05
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3mp6A01
1SW5A 3GZGA 3FC3A 2G3RA 2B8AA 3SEWA 3OYDA 4BLAA 2V25A 4BD3A 3RTFB 3PU5A 4ZE9A 5H8QA 4U4XA 2XX7A 3H03A 1N84A 2V84A 4H8JA 2VYTA 1SYHA 2UVGA 3LBSA 3ONMA 5AA2D 3S9LC 1Y4CA 2I4BA 4X48A 3TTKA 2XK0A 3L2RA 3VLVA 3E13X 5CMCA 2O4XB 1R9QA 4KPTA 1JW1A 1FTLA 2ZYKA 1QUKA 5I2KA 1OVTA 2O7UA 5IKBA 3IO4A 4JWXA 5D6XA 1B46A 4IUQA 3MAMA 3MP8A 4PE5B 1B05A 2XXHA 5A5XB 5FRMA 3DP4A 2F35A 3TKDA 5ICTA 5I58B 4E0WA 4WEPA 2E5QA 1B40A 1UTBB 2XXRA 1IEJA 3TODA 3VFJA 2DYXA 1A40A 4KYEA 2OWSA 4QF9A 4IY5A 1Y4TA 3FVNA 1B5JA 4BDOA 2B3FA 2DWIA 4FATA 4ONYA 2F6PA 2BKDN 1WODA 4OESA 3DELB 2XXVA 3CR9A 5L9OA 1UTHB 1II5A 3C32A 3F11A 3IOTA 3TCFA 3KFMA 1RYXA 1OIBA 2O84X 3CFXA 3TQWA 2RINA 1ZTYA 4I1DA 1FQEA 2O4XA 1N3XA 4EQ9A 1XT8A 4NF6B 2JTFA 4C1UA 1VE4A 1XVYA 1IXCA 1NNKA 2Q2AA 4BDLA 4H8IA 1A7LA 3M3KA 2VD3A 1PB8A 5EYFA 1O63A 1B6HA 3Q28A 3OY9A 2OJTA 3KBRA 3IL1B 4ZECA 3CI8A 1DTGA 3MEAA 5CI5A 5KCOA 3FUZA 2R57A 4QFPA 1LSTA 1UTBA 2HEUA 4JXIA 3OO7A 4EQ7A 1RKMA 4FAJA 3V83A 1URSA 1P1NA 4PFUA 3T93B 2DOJA 1H3DA 3L2VA 1N04A 5KZTA 1OI1A 1Y1MA 3JYRA 3DB4A 1TT1A 1P1UA 4RYAA 3IJXB 4NF4B 4LA9A 2V3TA 5CBRA 4FL6A 2QMXA 3BFUA 1UTHA 1VFDA 4GOTA 4EQBA 2I58A 3KZGA 5DEXB 4JB7A 1HSEA 2LVMA 4U1ZA 2XXXA 4FIMA 1SSFA 4RY1A 3MP1A 3QIMA 3K1PA 4FE8A 3NTIA 1MXZA 1LLSA 2H5YA 2K3XA 3G3IA 4NF6A 2B65A 5HBCA 3T96B 1N7XA 1BIYA 1MPCA 2R71A 4LATA 3T9VA 3OOAA 5KE3A 4EDPA 5FRNA 4IUPA 4JDFA 2R58A 3OYCA 3KN7A 1LCFA 3ME9A 2D9TA 1TFDA 4PLIA 2PBWA 1ANFA 1FTKA 2X4YA 3PUZE 2YRVA 1EZPA 3O28A 1FQAA 4H0WA 1MXVA 4LONB 4ELOA 5L9MA 2LRQA 4OYVA 2MWOA 1MXXA 2QMWA 1VSOA 2REGA 1IIWA 2HQXA 4F22A 3DP6A 4AQ4A 1OYXA 2Q88A 4DDDA 4WKMA 4HCWA 2HAUA 4R75A 2EFIA 2DWJA 2JZ2A 2I0BA 5D6YA 1O64A 3FD3A 2KLFA 4NF4A 5BUUA 4YZZA 4IUVA 3OENA 3OO8A 5CBSA 1S7YA 2ZMBA 2GFUA 1LB8A 4DCYA 4WEDA 5DEXA 4OETA 3IOWA 3T66A 3EAEA 2P0KA 4GXAA 1P99A 3TEPA 2V93A 4LVQA 3E9GA 1M5EA 2M1HA 4ZS9A 1LAGE 3W15C 2R6GE 3AXFA 3PUXE 1FTJA 3S4UA 3MO8A 3KJ7A 3DM0A 3FVKA 4NS5A 4A4GA 1PB9A 5AA3A 4PQJA 3OO6A 1POY1 4JSDA 3USDA 4JWOA 3KSXA 1WGSA 5ICQA 2GHAA 2NWJA 3VE1B 4PL6A 3K02A 3O6HA 5HPQA 2EQKA 1MPDA 1BKAA 2MWPA 1ZLQA 3SEUA 2HAVA 4QW2A 2H9BA 1B4ZA 1O7TA 3PMWA 1EZOA 3OYEA 5J1DA 1B3LA 2F6GA 4X9TA 3K0VA 2O51A 2EQUA 4X1DA 2DWHA 3FVOA 2F7AA 2Z8EA 5ISUA 1QUIA 4POWA 1M5BA 3O9PA 1JNFA 4QSCA 4ISUA 3L42A 4PLLA 2LDMA 2A5TB 3B6WA 3PPOA 3T9XB 3HHFA 4ZEKA 3OSQA 3G3JA 3L6HA 1ZKBA 3Q1JA 3C36A 2I3VA 1MQHA 2F78A 3O97A 1UQWA 4F3GA 4HCYA 4Q0CA 4IGTA 1FQDA 3UGWA 3T22A 1FQBA 4OENA 1PEBA 4XKNA 4QQ6A 4L17A 3BFTA 4TQUQ 2GFAA 4Q5WA 4GIZA 4B9XA 2OZZA 2RC8A 3GLBA 1SYIA 2AIXA 1URDA 1P1OA 5DVIA 4C5IA 3DB3A 4OVJA 3CG3A 1A99A 3H3GA 2WACA 4YKIA 2H99A 5F7VA 4GQOA 2QRYA 3ILTB 5FTHA 3VDFA 4F18A 2ZYNA 2LCCA 3MW0A 3PMTA 4TLLB 2RHYA 1LFHA 3A09A 5CRYA 2GF7A 1JVXA 4OFJA 4Q5TA 1D4NA 3EF7A 1ZBMA 4DXUA 4F3PA 3ILUB 2RI2A 1XS5A 4N4GA 1MQJA 1B9JA 2CKKA 2QS4A 3L2QA 1ZU0A 2IA4A 1XOCA 3MPLA 4CRIA 1LBBA 1JQFA 3K6WA 3C9HA 4EF1A 3CFLA 4N4IA 3M8UA 4KD5A 3LGLA 2I3WA 3OMGA 1SI1A 4KFQA 1DOTA 4H5FA 4Z02A 3N5LA 2G93A 2NOOA 3H4ZA 1OZ2A 4QRZA 4G2ZA 4C5EA 1B5IA 1MPBA 4ECFA 2ZXTA 3FJ7A 3OELA 3TYHA 2XX8A 3OSRA 3B6TA 2GH9A 1R9LA 3S6WA 2XD2A 2G29A 3N6UA 3OYAA 1Y9UA 4F39A 2QPQA 5DVJA 1HSJA 3DLMA 5TU0A 3UA8A 4IKFA 3BKIB 4QHQA 3S9EA 5EHMA 3VLWA 2ZYOA 4F3BA 4KQPA 5FTIA 3C34A 3TTRA 1B0HA 2FHDA 1JETA 5C0MA 1QKBA 1H3ZA 3EN3A 4ELRA 3QUJA 3OS1A 3MZ9A 3FV2A 4LQ5A 2RCBA 1NMUA 1NKXA 3UK4A 1Q1KA 1LB9A 3L2UA 4GL0A 1FCKA 4DCXA 3HSTA 2F36A 2XXWA 3MZBA 2NLUA 3LSFB 3LSXA 5B7DA 3FIRA 3TMGA 1H45A 3O66A 3MEVA 4MBPA 1MXYA 3PFSA 2XXYA 3G3HA 3H6WA 1MXUA 4RK9A 1MHNA 3GXAA 1MH4A 4RPOA 2THIA 5CIUA 3GBAA 4WXJA 3VXBA 2XX9A 2O1MA 2RHZA 4RPNA 5K2XA 1ELJA 4ESWA 2I48A 1P1WA 1P1QA 2RF1A 5FHOA 3LC8A 3DLNA 3QJ6A 4ND9A 3EPEA 4O3BA 5K2YA 4YAHX 1SW1A 1AL3A 3RUMA 5F1QA 1B5HA 1TXFA 2H98A 2L3RA 2HCAA 1QVSA 1T0KA 5FHMA 1DPEA 4EDUA 3GOXA 3PD8A 3MBPA 4THIA 4F2OA 3H8ZA 1XNIA 1B32A 3M9QA 1F9BA 1N27A 4DLDA 3L6GA 2PT2A 5M9OA 2RKMA 2ANJA 3LR1A 1LBCA 4H67A 3QXMA 3SD4A 4XTCQ 3MEUA 2IG0A 1OVBA 1QUJA 2CZLA 5JK4A 3C31A 4C5HA 4FECA 3MWBA 2R5AA 4IO5A 1OMPA 3FZVA 3RT8A 2UVJA 3RNNA 3UORA 3K6VA 4LD6A 2RJEA 4OTEA 2ESNA 2B3BA 4U22A 2AYSA 3CIJA 3IJOB 4F29A 3U1OA 4R9FA 4OERA 1SQYA 2L89A 1PC3A 4ZZEA 1Z7ME 2ABHA 1D9YA 3K1MA 4F1UA 4QSDA 1MY2A 3PGFA 4E0XA 2QQRA 2F34A 3PPPA 4IUTA 4G68C 3I5OA 4XIGQ 3W9VA 2BIVA 4KHZE 4LZ5A 4UC4A 1NNTA 1B52A 4IGRA 3V8XB 2QSXA 4NE4A 2I49A 4G4PA 1N7WA 4QFNA 3U72A 5CMBA 5AA1A 3O6IA 3MVYA 1PBPA 2P2AA 4PFWA 2RI5A 4U21A 2Z22A 1RI0A 4YKKA 3D4GA 3RN8A 4R6YA 3HPIA 3LX7A 3UIFA 2W7YA 1JW4A 3PUYE 2NXOA 1TFAA 4DXCA 1OLCA 1MH3A 1Y3PA 2XHDA 4F1VA 3JZJA 1SVXB 4C0RA 3RGYA 3UP9A 2FYIA 3P7IA 4F1YA 2O1LA 3VVFA 3FASA 2OK2A 2BUDA 1KWHA 3H7MA 4GD5A 5J26A 2O6AA 2XD3A 1FQCA 1MM6A 1L5TA 4M4GA 5CM6A 1OLAA 3SEXA 5DYHA 1LFIA 2D5WA 4QFOA 3U8QA 3C4SA 4E7LA 1N76A 4KI0E 2X7PA 3TAJA 3UT1A 4Q8RA 2EQMA 3OYNA 5I57B 2ONKE 1Y3QA 1LAXA 1ATGA 4BDRA 4Q30B 4ELPA 2DQVA 1Y20A 1S50A 5I84A 2CMOA 1WDNA 4KR5A 1UIUA 2E0SA 3KGCA 3KUFA 1MXWA 3ODBA 3HO7A 3OMBA 1FTMA 3K4UA 1UIVA 4MLQA 2AL4A 2O68A 4MF3A 3M3FA 3VLUA 1HSLA 4EXLA 3MC2A 3TCHA 3E3KA 2F7BA 4JBZA 4IURA 3H06B 1WJQA 4GXSB 4NF8B 3OYGA 2X4XA 2XXPA 2ONSA 1WJRA 4FORA 1H76A 4A4EA 2RHIA 4LZ7A 4YB7A 4BE2A 2GHBA 4R74A 2VGQA 3LYIA 3MQ9A 3ASKA 2D21A 1IITA 3U92A 3N26A 2GFEA 1LCTA 3RQTA 3OS0A 4QSEA 4N4HA 3PMXA 4KYSA 4G8HA 4HS7A 1VFEA 2HXWA 5I59B 5I57A 1KHCA 3LH0A 3QYTA 4I8CA 4YB5A 5FHNA 3G3KA 4ZZAA 2ZNUA 5TPAB 2Y7WA 3TUSA 5H8FB 3R26A 1BP5A 1RYOA 3TQLA 4KYDA 2UVHA 5JTYB 2YLNA 2HQEA 1B7HA 2H25A 2QS2A 4OVAA 1EH3A 2UXAA 1Y3NA 4IO6A 4PP0A 3EHTA 4POXA 1QW0A 5ELVA 3SEYA 4H5GA 1MY1A 2ZYMA 2DE3A 3FJGA 3C33A 2YPNA 3FXUA 4O3AA 2OCUA 3K2DA 4NF8A 4LP2B 4DIGA 4GF8A 2RO0A 3KOTA 1DMBA 1DSNA 3PV0E 4I62A 2X4WA 3KEIA 4OEVA 1A54A 3PMIA 1LAFE 2XXTA 3TFLA 2P0SA 5KCHA 3K1NA 4NMYA 2X7QA 1H44A 3QKJA 1USYE 4ZEIA 3FEOA 3G3GA 2OBGA 4II1A 3EHSA 3IB1A 3TTMA 4E7JA 5FROA 2DE4A 5I59A 4G77A 4ZTFA 3OYJA 4QFKA 3KJTA 4OFOA 2HFBA 5KH6A 3HN0A 5TPAA 3FV1A 2NUVA 3LSLA 3SESA 2Q9TA 1IXHA 2DXRA 5H8FA 4BE0A 3M3LA 1NFTA 2LAOA 3FXQA 5JTYA 4RG2A 2BJJX 3SETA 3VXCA 4DE8A 5L8DA 1FTOA 2DIQA 3PNWC 2R5MA 4BDNA 4XKQA 3O2AA 3CG1A 1M5DA 1SD3A 1FQFA 1MRPA 2PT1A 3PUWE 4RK2A 2Y7IA 4KCCA 4U4SA 2Y7RA 2RHUA 1Y1ZA 4MLVA 4LQ2A 4G8MA 2PYYA 1OQGA 5I2NB 3NTHA 3META 4X1BA 4QVZA 1B0LA 3W9WA 1SI0A 1MY0A 4IB2A 3B7DA 3CSBA 3ZEHA 1MDP1 2GRVA 3ZSFA 2O7IA 2XXQA 1NH8A 4MFIA 3LSWA 4OFLA 1JW5A 4NF5A 4RXLA 3T9UA 4QQDA 3VV5A 1AH5A 3FXRA 4M1VA 1OZ3A 1QULA 1XVXA 2EKOA 2ALUA 3LGFA 3Q29A 4E7KA 4YICA 4OMBA 3RPWA 2I0CA 3EHUA 3P8DA 4R72A 5CC2A 1ZJLA 4GL8A 4XKRA 2Y7PA 3PUVE 4ESXA 1H43A 5HM4B 2Q8JA 4BE1A 3QBYA 2LTOA 2DE2A 3MVXA 5IAIA 4ZEDA 2D3IA 3IK6B 3GBBA 3ZS6A 1JEVA 1N0TA 3L2WA 2M8CA 4BDYA 4Z7EA 2QS3A 1D3KA 4YKJA 2F8DA 1IQ7A 4B9WA 5KCJB 3C35A 4K3FA 1A8EA 5I2NA 1CE2A 3OYHA 1Z7NE 4EF2A 3TELA 3E4RA 1M5CA 2QQSA 3Q27A 1MM7A 1M5FA 2YJPA 2RI3A 4X34A 4ZEBA 3G3FA 1B7ZA 3IR1A 3RT6B 5EHSA 2R9JA 4GRKA 4L59A 4C5GA 4OHNA 1B3FA 4EXKA 1SW4A 3TDJA 3QSLA 2UYEA 4A4FA 4JWYA 4R2FA 1R6ZA 4U2RA 4U1OA 2Z23A 2HZLA 5ITOA 4NWCA 3PD9A 3O8VA 3IX1A 3CEYA 3VVEA 1JEUA 1I6QA 4AB6A 2V3QA 4OZ9A 4F2QA 1MG1A 2XXUA 4F31B 4IO4A 5BWJA 4FEDA 2Y7KA 4O3CA 5AA2B 5IN1A 1POTA 2HQ0A 1PDAA 1SW2A 1D9VA 3OYBA 4YMAA 3TPAA 5KCJA 1A8FA 2RC7A 3A3UA 3S9MC 3IORA 5IAYA 2DVCA 1A55A 3MPKA 3WAEA 4UACA 2PMSA 3I3VA 3DP8A 4LZ8A 3C4MA 2F97A 4FU6A 4ZDMA 1ZMGA 5I56B 4BDQA 4YMBA 3FVGA 2E1SA 4BDMA 1J1NA 4GLIA 1B1XA 3WAFA 4U23A 1NH7A 3IB0A 2WKYA 3FJMA 4IY6A 1B3GA 4G68B 1N3WA 3H6TA 4JSOA 2FA7A 1SDXA 5A5XA 4H65A 2XXIA 2QL3A 3KN8A 5I58A 2OLBA 3R6UA 3G7WA 1I69A 1G5VA 1US5A 4KCDA 2VOZA 1IZ1A 3FGSA 4ZEFA 2Q2CA 3MJNA 1QJMA 5DT6A 4F19A 5H8NB 2NVUB 5KDTB 2OWTA 3K01A 1DPPA 3OYMA 4R9GA 3F70A 4ZTJA 5AA2A 1MDQA 3NTKA 4PETA 2QS1A 2ZNTA 2RCAA 1B3EA 3OXNA 3KG2A 5JEIA 1I6AA 1NNFA 5H8HB 4FEBA 1YAEA 2HZKA 3OS2A 4GVOA 1MY3A 1WJSA 1DTZA 3O29A 5I56A 1QKAA 3KN3A 1I6BA 3LUYA 2DP8A 3ZKLA 2QJEA 4XKPA 4ELQA 4G68A 1SBPA 3BDLA 3OYKA 1YPNA 3K6UA 4N13A 3IAZA 3OA6A 2O69A 4DZ1A 3PPQA 3TTLA 4R6HA 3UWNA 4TOZA 4C1TA 4H1XA 4FJPA 2AL5A 3CRBA 3E9FA 3QAXA 3PPNA 1BTJA 1NL5A 5L9SA 4R6KA 2I6EA 4EUOA 5H8NA 3OYFA 1B58A 5KDTA 2X26A 5AA4B 3S3MA 3QK6A 3RLFE 5H8SA 3B6QA 2VP1A 4OEUA 3OMCA 4GFRA 1Q35A 1EZ9A 4BDZA 3FLGA 2UYFA 2VD2A 3OYIA 3MZ1A 5CMMA 1WVJA 2DVZA 3P8HA 1MQDA 4F3SA 4QQGA 5H8HA 4Z0IA 4DXBA 3SEVA 4R2BA 4YU0A 5AE4A 3IO6A 3CFZA 3T9HB 4P0IA 3BBRA 3CSGA 3A3CA 3ZKKA 3MVWA 3OO9A 1GVCA 3JV9A 2H4IA 3O6GA 1LFGA 2X35A 4LUBA 3OD7A 3S3OA 4RJZA 1US4A 4YKPA 2I4CA 5C6SA 3IOVA 3I6VA 1EU8A 3PPRA 5DTBA 2ZNSA 2UVIA 2E6NA 4IO7A 4N6PA 1LAHE 4ZE8A 1XHYA 3H6ZA 2Z8DA 3H6UA 4OXVA 4H6DA 1LGBC 3IOUA 4MH5A 3UN6A 3QUFA 5B70A 1B1HA 4GWOA 1NNPA 1AIVA 4AB5A 3KOSA 2DAQA 2DIGA 3U93A 5AA4A 1PB7A 2PVUA 4NWDA 3TTNA 1TWYA 3OQ5A 2F7CA 2Y84A 2Q89A 3ECRA 1USYH 1B4HA 3RY3A 1MS7A 2P1SA 1OQHA 3V89B 2VHAA 2A5SA 4P11A 4N07A 1S9TA 2REJA 3VVDA 1MQGA 2RC9A 3HCQA 2DXYA 1B3HA 4TLMB 1XC1A 4QFLA 4XXUA 2EQJA 3V5AA 2Z8FA 5CMKA 2DWAA 1CB6A 4NF5B 3RTWB 2K3YA 5TP9B 2M16A 3K6XA 2PQWA 1R1NA 2V3UA 3EQ1A 3TCGA 3OEMA 2RJDA 4OQOA 2FNCA 3HV1A 3THIA 3MVZA 3SKPA 3N6TA 3IB2A 1AMFA 1GGGA 4E7IA 3MUQA 2L8DA 2DSFA 4PFYA 2F5KA 2IEEA 4HTGA 4RA1A 3SERA 5M2VA 4E7HA 1YTVA 3SDFA 4NEDA 1JVYA 5ITPA 4GY5A 4BACA 3LLRA 1PBQA 5KE2A 3OYLA 4P0GA 1B2HA 1URGA 4IO3A 1B51A 1IXGA 5J39A 5D6WA 5H8QB 1MY4A 1VR5A 2A5TA 3K00A 3MP6A 4HW8A 1ZIUA 2XDPA 1AOVA 3HHGA 4IO2A 3U94A 3S9NC 3FATA 3D4CA 2DS9A 3Q25A 3S2VA 1IUDA 4R73A 1GV8A 4PFTA 3KSJA 1YCJA 1BLFA 3TZAA 3S3NA 1GR2A 4OWDA 3PMVA 2ONRA 4UA8A 3QIIA 5I2KB 2RJCA 1FW0A 4G8NA 1MQIA 2M0OA 2RHXA 3CVGA 5DVFA 5LOMA 4I9DA 3E9XA 3H6VA 3N94A 5TP9A 1IXIA 2PX1A 4YB6A 1GTKA 1B7UA 3Q26A 4A4HA 3FDRA 2F5XA 3MEWA 2RJFA 3OB9A 4IUUA 3OEKA 4HCZA 4RNSA 3R7XA 4NTLA
chains in the Genus database with same CATH superfamily
3CCLQ 1SW5A 4P5NA 3JB9H 2BE7D 3GZGA 1WFWA 3RBBB 2WSCE 4BI4A 3FC3A 1RABB 2G3RA 1E6GA 2B8AA 1VQKQ 3SEWA 3OYDA 1RAIB 4BLAA 4I40A 1J3TA 1QKXA 2V25A 4BD3A 1ZA2B 2CZIA 2COZA 2YRDA 4RMOA 3RTFB 1U3OA 1VQ4Q 4M75F 1P92A 2JMAA 1EYIA 3PU5A 5CO7A 4ZE9A 5H8QA 4U4XA 3J80E 1X27A 2XX7A 5FU6C 3H03A 1LCKA 4FCYA 4OMFB 1W2BS 1N84A 4J7IA 2FG0A 2L5QA 2V84A 1NYFA 1PSFA 3X24B 4J9CA 1QVPA 4HE0A 4M7AA 1OULA 4H8JA 2VYTA 1SYHA 5KYXA 3JCMW 2UVGA 5FU7B 3LBSA 2E4HA 1TS9A 3ONMA 5AA2D 3S9LC 3G4SA 3I55Q 1Y4CA 1NV5A 3CXCS 2I4BA 4X48A 1OU8A 2VWFA 3TTKA 2XK0A 2F3DA 4QXDA 3L2RA 3VLVA 2ED1A 4IIMA 3SFMA 3E13X 5CMCA 2Y4YA 4KRTA 3V8KA 7AT1B 1RAAB 2O4XB 1R9QA 4KPTA 1JW1A 1FTLA 2DXBA 1T3SA 5A0DA 2ZYKA 1QUKA 3I56A 1H641 5I2KA 1ABOA 4KXPA 3MSTA 4Z89A 1M3CA 5GMKh 4GLKA 4DOVA 1YXIA 4MMPA 4MMKA 1OVTA 2O7UA 1Y96B 5IKBA 3IO4A 4JWXA 3KFVA 4P47A 5D6XA 2K5LA 1B46A 4IUQA 1M3BA 4JLIA 2YLCA 3MAMA 5ET6A 2QA4Q 3MP8A 4J6WA 4ANJA 4PE5B 1B05A 2XXHA 1N5ZA 4OVQA 5GANg 5A5XB 5FRMA 3G7ZA 2ROLA 3DP4A 2CZ1B 4DA4A 2F35A 2ZPEB 3ZFJA 3TKDA 4JRIA 2PNIA 5ICTA 5I58B 5I7IA 3QJYA 4C8QA 4M4ZA 2LX9A 4E0WA 4WEPA 2E5QA 3CCJT 2GCXA 2KRMA 1YJ9A 1B40A 1KQSA 4P1EA 1JJ2S 3EFRA 1UTBB 2XXRA 1ZA1B 1TTHB 1IEJA 1S1NA 3TODA 3VFJA 3TCJA 2DYBA 2NUTB 2DYXA 1VQNQ 1A40A 4G61A 4KYEA 1RAFB 4O6JA 3CPWS 4NOYA 2OWSA 4QF9A 2OX3A 4IY5A 1M1KU 1RADB 1Y4TA 1B5JA 3FVNA 2MMPA 1NUXA 5IGAA 3T0JA 4BDOA 2DKGA 2LJ3A 2V26A 3M0UA 2LQ8A 2RQTA 2B3FA 2DWIA 4FATA 1PCXA 2F6PA 4ONYA 1QWEA 2BKDN 4KGZB 1WODA 4OESA 4PJOE 3SWNB 1YJWT 2ZZXA 3R6NA 1YN8A 3DELB 4M7AE 1M2OA 5IH2A 2XXVA 3CR9A 3HP9A 5L9OA 5LJ3e 1FPKA 1KSWA 1MNDA 1O75A 1II5A 1UTHB 3C32A 5GAN5 3F11A 5IZZA 3IOTA 4BI8B 3KFMA 3TCFA 2XWIA 1RYXA 1PD0A 3VUBA 3QG1A 2FRYA 3URGA 4HT9A 1IMEA 1OIBA 4OVRA 2O84X 2JTEA 1YP5A 1M90U 3CFXA 5HK0A 3TQWA 5GAMd 2RINA 1SPKA 2AKKA 2AK5A 1GBRA 4PAIA 1ZTYA 3EGXB 1M5Q1 2J6KA 4I1DA 1FQEA 2O4XA 1N3XA 2PVOB 3ROJA 4EQ9A 2DRKA 1IGUA 1XT8A 4NF6B 3HHTB 1KJWA 2JTFA 2K5FA 4NQ8A 1VE4A 3CD6A 1XVYA 2JW4A 4MNIA 4NX1A 4C1UA 4J9FA 2QVVA 1IXCA 1KC8U 1NNKA 2HNIA 2Q2AA 4BDLA 3CCUT 2L2PA 3CCMA 4H8IA 1Q7YR 2E70A 4N81A 1A7LA 1YNZA 1Y96A 3WVEB 3M3KA 2VD3A 3CC7A 1PB8A 5EYFA 1O63A 2DTIA 1B6HA 2LCSA 3Q28A 2QQ9A 2X3XD 3OY9A 1K9MR 1VQ7T 3EG1A 2OJTA 2XA5A 1GRIA 2OTLT 2LT1A 3KBRA 2EWNA 4DI4B 3V8LA 4JJDA 4OMLA 4PFZA 3IL1B 4C8QE 4ZECA 1LBYA 4LE9A 3CI8A 1DTGA 3HRTA 3MEAA 2FEIA 5CI5A 5KCOA 3FUZA 1BYMA 2EYQA 3CCJQ 2R57A 4PJOF 4QFPA 1LSTA 1UTBA 2HEUA 4JXIA 2OJ2A 4M7AF 3RESA 4LNPA 1RKMA 3OO7A 4EQ7A 2NUTA 4FAJA 1BU1A 2EYZA 3V83A 2JM9A 2VASA 1P1NA 5CKHA 1URSA 2OWZA 4PFUA 1KK7A 3H41A 2WYKA 3T93B 2DX1A 2DOJA 1H3DA 1PNJA 3L2VA 1N04A 1NV2A 1OI1A 1Y1MA 5KZTA 3JYRA 3DB4A 2NUPA 4MIJA 1NLPC 5IXFA 4EPCA 1TT1A 1QVFS 1P1UA 4RYAA 2C0OA 1UJ0A 4VUBA 3IJXB 4RTWA 4A4KA 3ZL7C 4NF4B 1X75C 1K73C 4LA9A 1N8RU 3A8LB 3PTYA 2V3TA 5CBRA 4FL6A 3C94A 1VQ4A 1QGXA 1FBCA 2QMXA 3BFUA 4PDDA 4F14A 1UTHA 2HDAA 1PHTA 4OB1B 1VFDA 4GOTA 4EQBA 2I58A 1OQKA 3KZGA 1NJIU 3M0RA 1QLYA 4JB7A 1MMNA 1HSEA 5DEXB 2DL7A 2LVMA 2QTXA 2XXXA 1NI9A 4U1ZA 4FIMA 4KH0B 3EG2A 1SSFA 3R6OA 2EVRA 4BUGA 1VQ9Q 1MV3A 4RY1A 3MP1A 2HKNA 3QIMA 1LJOA 3K1PA 4JJCA 4FE8A 3NTIA 1GCQC 3INZA 4JZ4A 2BZXA 3EGXA 3I55A 3X26B 1LLSA 1MXZA 2H5YA 4M75D 5I2MA 5ET5A 1AD5A 2K3XA 4XU0A 3G3IA 1BI1A 1IMFA 4NF6A 2B65A 5HBCA 3T96B 4JJBA 2P84A 1EX4A 1AWWA 1BIYA 4M7DB 1TG0A 2RMOA 1MPCA 1N7XA 2R71A 4LATA 3T9VA 3OOAA 5KE3A 3TVTA 3BFMA 5FRNA 4EDPA 4C92F 4IUPA 3N5BB 1Q81C 1GBQA 5CR2A 2F2XA 2DDKA 4JDFA 2R58A 1UJYA 2PTKA 3VJPA 3OYCA 3KN7A 1W70A 4E47A 1VQMT 1LCFA 3ME9A 2D9TA 1Z9ZA 1TFDA 4PLIA 3I5RA 2KXDA 2PBWA 4MZPA 1ANFA 1PRLC 4HVVA 2OTLQ 1FTKA 4KUDK 1LPLA 2X4YA 1KA1A 3PUZE 1QP2A 2YRVA 2QA4A 1EZPA 3O28A 1FQAA 4H0WA 1MXVA 2F3BA 4LONB 4ELOA 4DBRA 5L9MA 3CQTA 2LRQA 4OYVA 2MWOA 1MXXA 2QMWA 4O7IA 3UA6A 1VSOA 2REGA 4N8GA 2QVRA 3QDRB 4LXCA 1IIWA 2HQXA 4F22A 3DP6A 4LDWA 2RM4A 2BJIA 4AQ4A 1OYXA 2Q88A 4DDDA 4WKMA 2PVDB 4EMKC 1WXBA 5GAMg 1Q7YC 1FPBA 4WTOB 2FHYA 1AVZC 4HCWA 1VQNA 2HAUA 4R75A 5EQ9A 2EFIA 3E2UA 2GGRA 2DWJA 2JZ2A 4R56A 2I0BA 1K9MC 1N9RA 5D6YA 1O64A 1OV3A 1R0CB 1Y07A 4DEYA 3FD3A 2KLFA 1FPLA 4NF4A 1QCNA 5BUUA 1M2VB 4YZZA 4IUVA 4BI3A 3OENA 1UUEA 1I81A 2YT6A 3OO8A 5CBSA 1S7YA 1KD1C 2ZMBA 2HMAA 2GFUA 1LB8A 4DCYA 4WEDA 5DEXA 2M51A 4OANA 4FYVB 5CK9A 4Z8AA 4OETA 3CC4T 3IOWA 3T66A 4J9EA 4M78D 3EAEA 3QZ5B 2DL4A 5GANe 2SEMA 2P0KA 4GXAA 4JPBW 1P99A 3QMFA 3TEPA 2V93A 2C0TA 4PGNA 1BCMA 4LVQA 1M4ZA 1MUZA 3E9GA 1M5EA 2M1HA 4ZS9A 4M7DA 1LAGE 3W15C 2R6GE 3AXFA 1UGQB 1FTJA 3PUXE 3S4UA 4OMPA 1Q86U 3MO8A 1WYXA 1YIJT 3LUZA 3KJ7A 4PFBA 2YRCA 3SEMA 1QVGS 3DM0A 3FVKA 2VB6A 4NS5A 4A4GA 1PB9A 5AA3A 4PQJA 2DRMA 3K6WA 3X28B 4ZGEB 1K9AA 3OO6A 1VQMQ 1POY1 4RCCA 1YCYA 2MF2A 3QDFA 4JSDA 3USDA 4JWOA 3KSXA 4HE2A 1WGSA 5ICQA 2GHAA 3O5ZA 1FPDA 2NWJA 1D09B 3VE1B 4C0FA 4LN5A 2KT1A 5HKCA 4PL6A 3K02A 3O6HA 3BDUA 5HPQA 2EQKA 1NYGA 4OB3B 5KYUA 1BKAA 1MPDA 2MWPA 1ZLQA 3SEUA 3QUIA 2HAVA 4QW2A 4F7UB 2H9BA 2A36A 2KE9A 1B4ZA 1O7TA 2VGNA 3PMWA 1EZOA 2XIDA 3OYEA 5J1DA 1YI2T 1B3LA 2F6GA 4X9TA 4HA8A 2P3NA 1NEBA 3K0VA 4ATOA 2O51A 2EQUA 4X1DA 2DWHA 3FVOA 3CCJA 1M1KR 2F7AA 2Z8EA 4MNCA 1INPA 1QUIA 5ISUA 4POWA 1M5BA 3O9PA 1JNFA 2Q8MA 4QSCA 2Z0WA 4ISUA 3L42A 2EJ9A 4PLLA 2LDMA 2A5TB 3B6WA 3PPOA 4MMLA 3T9XB 2KVQG 5GAOp 2L3QA 3HHFA 4ZEKA 3OSQA 3G3JA 3L6HA 1ZKBA 1XOVA 3Q1JA 1M2VA 3C36A 2CZ6B 5EYGA 2I3VA 1MQHA 2F78A 3O97A 1WA7A 2M0YA 1UQWA 1VYVA 4F3GA 1M27C 3FBPA 4PE3A 3M0TA 1RAHB 1XTDA 3DKMA 4M78B 2FZCB 4DEXA 1YJWA 4M7AD 4HCYA 3M53A 2JVVA 2K57A 2QG9B 4Q0CA 4IGTA 4I3YA 3JCMc 1FQDA 4X8RA 1ZUKA 3UGWA 3T22A 3CBPA 1FQBA 2VPNA 1PEBA 4OENA 4XKNA 4QQ6A 4L17A 5LL6S 3BFTA 2LJ0A 3QHSA 4OGCA 2GFAA 4TQUQ 4Q5WA 4B9XA 3CCMT 4GIZA 4PAKA 2OZZA 1VQ9A 4FSSA 5I22A 2RC8A 3CCRQ 1SYIA 1Y0MA 3GLBA 2AIXA 1URDA 2O01E 2LC4A 2EPDA 1P1OA 5DVIA 4M7DE 4C5IA 3DB3A 3E19A 1KC8R 1ZHIA 1YHQQ 2WBBA 4OVJA 3CG3A 1FPEA 1A99A 2EJFA 3A98A 3H3GA 2XG8D 2WACA 4YKIA 4XU1A 5GAOn 2AKLA 3EFOB 1YIJQ 2H99A 5F7VA 2LT4A 4GQOA 1X6BA 2DPPB 2QRYA 2QTVA 3BIGA 1NZ9A 1IHVA 1M8MA 5GMKm 3ILTB 4J5YA 5FTHA 3VDFA 2ZYNA 2LCCA 3CCUA 4F18A 3MW0A 2ZPHB 5GAN3 3PMTA 1BIBA 4TLLB 2RHYA 1MNEA 2RK2A 1LFHA 2YWWA 3A09A 3H0IA 2DFUA 1UHCA 4EIKA 5CRYA 3GPLA 2GF7A 2B4MA 1RLPC 3FJPA 3TREA 3OW2S 1JVXA 4OFJA 1D4NA 2OTLA 1I0CA 3EF7A 4Q5TA 1ZBMA 4KGXB 4Y92A 4DXUA 1KQ2A 4J6XA 4F3PA 4C8QD 3ILUB 3JCMf 3CCLT 2RI2A 1XS5A 4N4GA 2RF0A 1Q9DA 1IHWA 1MQJA 2WSEE 1B9JA 2CKKA 4GX4A 1FTAA 2QS4A 4ZGJB 1VQKT 3IFAA 3L2QA 1ZU0A 2IA4A 2LX7A 2KR3A 5A0GA 1XOCA 3MPLA 4GWZA 1Y57A 4CRIA 2AT1B 3C12A 1SRMA 1JQFA 1B07A 1LBBA 3C9HA 2JUFA 1VQ4T 1M9SA 3CFLA 4EF1A 4N4IA 3M8UA 4KD5A 3LGLA 2I3WA 3UF4A 3CMAQ 5IXBA 2ZPBB 3OMGA 3B8BA 1SI1A 3JCMg 1N8RR 4KFQA 1DOTA 4H5FA 4KGVB 4Z02A 4PBQA 3N5LA 3NPFA 2G93A 2NOOA 2HHMA 4LDYA 1NJIR 4M7DF 3H4ZA 1OZ2A 4ME7A 3NGPA 1UB4A 3I55T 4QRZA 2CP3A 4G2ZA 4PJOC 4C5EA 2AIRB 2A08A 1B5IA 3REBB 1MPBA 4ECFA 2ZXTA 5IHIA 2E41A 2OAWA 3FJ7A 2DLPA 3OELA 1SPIA 3TYHA 4CC2A 2MKZA 5GMKi 2QI2A 2COYA 3LW5E 5CKEA 2XX8A 2CEYA 3OSRA 3B6TA 2GH9A 3HRUA 4KBMB 1R9LA 2AZSA 3S6WA 2XD2A 3EH2A 2G29A 3N6UA 3OYAA 1Y9UA 1SKUB 2QPQA 4L5GA 4F39A 5DVJA 1HSJA 4K11A 3SHWA 3DLMA 4QKUA 5TU0A 2H3JA 3UA8A 2QGFB 1M1GA 3EFOA 4IKFA 3BKIB 3A5ZB 2EGEA 4PNOA 3KC1A 4QHQA 3S9EA 1LBWA 5EHMA 5GAMe 1X6GA 3VLWA 2ZYOA 1WX6A 1NEGA 1FXXA 4FT4A 3RMQA 2WBDA 3RIRA 3RMSA 1Q95G 4EMGA 1WHGA 2OX7A 3CCET 4KQPA 1CKBA 4F3BA 5FBPA 1VQMA 4C8QB 5FTIA 3C34A 3TTRA 1B0HA 1YWPA 3RR6A 5DW8A 2FHDA 1JETA 4JDSA 3CPWP 5C0MA 4V2SA 5KYNA 1QKBA 1H3ZA 2KBTA 3EN3A 4OA4A 4ELRA 1FYNA 1DCUA 2JT4A 1VQNT 4GWYA 3QUJA 5GAN4 3OS1A 2ABLA 3MZ9A 5EQ7A 1G0IA 3FV2A 4C92C 4LQ5A 4ESRA 1I5OB 1X2QA 2RA2A 3A8GB 1B34A 1SF9A 3OBWA 5GMKl 1NMUA 2RCBA 1NKXA 4OMOA 3UK4A 4J6YA 4H45A 2HEQA 1H3HA 3I9QA 2EYXA 1Q1KA 2DTOA 2GQ1A 1U8RA 1LB9A 3L2UA 4GL0A 2DBKA 1FCKA 1NV0A 2KROA 1OX8A 3VS3A 4DCXA 3ZBDA 1K1ZA 3JB9I 2F36A 3HSTA 2XXWA 3MZBA 2NLUA 2DTHA 4M78E 3LSFB 3G71Q 4PJOG 3LSXA 1TOVA 5B7DA 3FIRA 4M7AG 3JCMh 3TMGA 1U06A 1H45A 2K5IA 2HKQB 1WHJA 2QDLA 3O66A 1NBEB 2CREA 3M54A 2DL3A 3M0SA 5J16A 3MEVA 3ISPA 5FU7C 4MBPA 1XJWB 5L8RE 1MXYA 3PFSA 3CC4A 2XXYA 1TSFA 3G3HA 3H6WA 3PGGA 1MXUA 2E3IA 1MHNA 3GXAA 1MH4A 4RK9A 4RPOA 1VQ5T 2THIA 2SRCA 5CIUA 4OB2B 2DJZA 5IT9E 3GBAA 4WXJA 2K2MA 3U23A 3VXBA 1WLPB 1Q86R 3QXEB 4GWWA 2QXFA 2O1MA 2XX9A 4P9KA 3CCRA 2H3EB 1VYUA 2E1HA 4F7UF 2F5TX 1FPFA 3HFUA 2RHZA 5LTCA 2EBPA 4RPNA 5K2XA 1ELJA 4ESWA 2ZPFB 2KR0A 2I48A 1P1WA 1P1QA 3FIFA 2RF1A 1TU0B 1QMCA 5FHOA 3LC8A 1YIJA 3DLNA 3QJ6A 4HCBA 4XTUA 4ND9A 4E2FB 5GAOm 2KRSA 3JCMJ 3EPEA 4O3BA 5K2YA 4YAHX 3CCEQ 1SW1A 1AL3A 3RUMA 5F1QA 1B5HA 1AWBA 1TXFA 2L3RA 2H98A 2HCAA 1OX9A 4GX3A 1QVSA 1NPPA 2P4RA 5FHMA 1T0KA 1DPEA 4EDUA 3GOXA 1VDWA 3PD8A 3MBPA 4THIA 2VXEA 4C92G 1UGSB 2JNGA 1AOJA 1Q82C 4F2OA 1SEMA 3H8ZA 2FIEA 1XNIA 1YJNQ 1B32A 2PFYA 1JXMA 4M78F 3M9QA 1QVFP 4HE1A 1F9BA 1BKBA 1N27A 4DLDA 2HL3A 3QO3A 1VQ8Q 1YI2A 3L6GA 1TUDA 2PT2A 5M9OA 2NUPB 2RKMA 5KYYA 2ANJA 5LJ5e 3LR1A 3VS0A 3G1JA 1LBCA 5DLOA 4H67A 1WPYA 2YUOA 2DEUA 3BW1A 2RK1A 3VUZA 1IRXA 1FBGA 3QXMA 3SD4A 4XTCQ 1M3AA 2KNBB 3MEUA 4LDUA 1NUYA 2IG0A 3MYUA 2J7IA 1OVBA 2VPOA 1QUJA 1BIAA 2MCNA 4GBWA 1TWBA 4OMQA 2CZLA 1H8KA 5JK4A 1K8AC 1FRPA 4YTLA 3C31A 3SWNC 4C5HA 4FECA 3MWBA 2R5AA 2CP5A 2DK3A 1VQ9T 4PFPA 4IO5A 4PC9A 5LDZA 4DBFA 1OMPA 1YYZA 1X69A 3FZVA 3HTRA 1ZBXA 2O31A 3RT8A 2WX9A 3VYHB 2UVJA 3RNNA 1PKTA 2JTMA 3UORA 5D7UA 3V7RA 3K6VA 4LD6A 4AS5A 2RJEA 4OMMA 4IIOA 2D0QB 1PRMC 4OTEA 2BZ8A 1VQ5Q 2CZKA 1KA0A 2ESNA 1R8OB 2VV5A 1IMCA 2B3BA 4U22A 4JJNK 2AYSA 3CIJA 4XTZA 1UEBA 1VA7A 4XU2A 3IJOB 4NN3A 4F29A 3U1OA 1M30A 4M7DD 3VS4A 4J83A 1QP3A 4DBQA 2ZAEA 2QAZA 4R9FA 4OERA 4PAFA 1JU5C 5EG2A 3OSVA 1SQYA 2L89A 1PC3A 1YITT 4N0AC 4ZZEA 2O2OA 1Z7ME 2ABHA 1MMAA 1D9YA 3K1MA 4EMHA 4F1UA 5GAOq 4QSDA 1MY2A 3PGFA 4E0XA 2QQRA 4GBVA 2F34A 3PPPA 4IUTA 4G68C 2CUDA 3RKWA 2F1LA 3I5OA 4XIGQ 3W9VA 2BIVA 1I5LA 4LD9K 2CP7A 4KHZE 4LZ5A 4H46A 4UC4A 2PUOB 1NNTA 1MMGA 1B52A 2NUZA 2ZZDA 2FO0A 2MPXC 4IGRA 4RTXA 3V8XB 2X9HA 1Z9QA 3QPHA 2QSXA 1C6VX 1VQ6T 4NE4A 3L1AA 2I49A 2A7YA 4G4PA 1N7WA 4QFNA 3U72A 3CCLA 5CMBA 3CBMA 5AA1A 3O6IA 1XQHA 3MVYA 2LZ6B 1PBPA 2P2AA 4KUIA 4PFWA 2RI5A 4U21A 2Z22A 1RI0A 4HVWA 1VQKA 4LDXA 1WQWA 1JP4A 4YKKA 3D4GA 5GAOl 4R6YA 3RN8A 8AT1B 3HPIA 3LX7A 2QEXQ 1FPIA 2MYSA 2PCRA 2M9UA 4JS4A 3QYHB 3UIFA 4KT0E 2CGHA 1W4SA 1TUCA 2W7YA 1DK4A 1JW4A 3GYYA 3PUYE 2NXOA 1TFAA 4DXCA 3HRSA 1OLCA 1MH3A 1Y3PA 2XHDA 2CP6A 4F1VA 2G6FX 1OU9A 2JS0A 4F17A 1UHFA 3JZJA 2EIFA 1IO6A 4M77B 1SVXB 2Y90A 2JJKA 4MEVA 4C0RA 3RGYA 1B3QA 2NYSA 1M8VA 3UP9A 2FYIA 3P7IA 5CQXA 4F1YA 4A53A 2O1LA 1QKWA 3VVFA 3FASA 1K9ZA 2OK2A 1U1SA 2BUDA 1KWHA 2PUKB 3H7MA 4GD5A 5J26A 4QBAA 2O6AA 3M58A 3BE3A 3UATA 4Z88A 4X1VA 2OTJQ 2XD3A 4C8QF 2D8JA 2QQAA 2D6FA 2KSSA 1FQCA 1MM6A 1L5TA 1AT1B 4M4GA 1NG2A 2KRNA 2FVZA 1BK2A 2DERA 5CM6A 1OLAA 3SEXA 3HL8A 2LNVA 5DYHA 1LFIA 4M7DC 1WXTA 5GAN8 2D5WA 3WVDB 2P0QA 4QFOA 3U8QA 1YITQ 9ATCB 1NLOC 3C4SA 5KYWB 4E7LA 1N76A 4KI0E 3A1PA 2DYIA 2X7PA 4N91A 3TAJA 3UT1A 1PG5B 5KYUB 4Q8RA 2EQMA 3OYNA 5I57B 2YSQA 3EG9B 2ONKE 3LV0A 1Y3QA 1LAXA 1ATGA 2MAMA 4BDRA 2DL8A 1CKAA 4Q30B 4ELPA 3CCEA 2L3PA 2DQVA 1Y20A 3L2ZA 4RTYA 4J9HA 1S50A 5I84A 2E3HA 2V8KA 1WDNA 3PVLA 1VQ6Q 2DZCA 2CMOA 4KR5A 1X43A 1UIUA 2E0SA 3KGCA 3KUFA 1MXWA 4JZ3A 3ODBA 3HO7A 3OMBA 1FTMA 3GBQA 4NGUA 4EMKB 4N17A 2D0NA 3K4UA 5IHNA 1RLQC 1D1CA 1UIVA 4MLQA 4NL3A 1FBFA 1VQPT 2AL4A 1FJ9A 5I11A 2O68A 5I3SA 4LN2A 4HXJA 1FSAA 4MF3A 3M3FA 3VLUA 1HSLA 4EXLA 3MC2A 3TCHA 5J3BA 2HPGA 3E3KA 2F7BA 3VKIA 4JBZA 1AWJA 4IURA 3H06B 1WJQA 4GXSB 4JRQA 4PF8A 4M77A 4NF8B 3T1BA 3FRNA 3OYGA 2DVEA 2X4XA 5FLXE 1D9QA 2XXPA 1W2BA 3EHQA 2ONSA 1WJRA 5IZ3B 3CCRT 4FORA 3JCMd 1H76A 1GCQA 4A4EA 1ZUUA 1FJ6A 5GAOr 3SDZA 2RHIA 2KYBA 4M75C 1YHQT 2X3WD 4LZ7A 4YB7A 1BI0A 1ZSGA 2KDSA 4BE2A 2QFLA 2ROTA 3JB9D 3CCVT 2GHBA 5IZ1A 4R74A 2W0ZA 2VGQA 3LYIA 2CP2A 3CXCA 2O9SA 4M7DG 3ASKA 1VQ5A 2D21A 3MQ9A 3TU4K 1IITA 1UE9A 3LWIA 3U92A 2YLBA 3N26A 4ORZA 2GFEA 3JCMQ 1E7OA 1LCTA 5DY9A 3RQTA 2I2LA 3SZPA 3OS0A 1DBZA 4QSEA 4N4HA 4QT7A 1BK4A 5KYWA 3PMXA 4KYSA 4G8HA 4HS7A 1VFEA 2HAXA 1G0HA 3RKXA 2HXWA 5I59B 5I57A 1KQSS 1ZX6A 1D0ZA 3EG9A 4HT8A 1KHCA 1N6AA 3LH0A 3QYTA 4I8CA 4R55A 4YB5A 3P8BB 5FHNA 3UDCA 3G3KA 3C0CA 2DVJA 4MHFA 2ZNUA 4ZZAA 5TPAB 2Y7WA 1K73U 2E5KA 3TUSA 2DBMA 2QQBA 4FYWB 5H8FB 3G6ET 3A29A 1BP5A 3R26A 2WYPA 4QVDA 1RYOA 3TQLA 1K76A 2DXTA 2MI6A 4KYDA 3A8MB 4BY6B 2UVHA 5JTYB 2YLNA 2HQEA 1B7HA 4PFRA 2CT3A 2H25A 2QS2A 4EMKA 4OVAA 1EH3A 5LJ5j 4OGEA 3CMAT 2UXAA 4GX6A 1Y3NA 4PTKA 1JJ2A 1VQPQ 4IO6A 4PP0A 1FMVA 3EHTA 4POXA 1QW0A 4N6DA 4NHBA 5ELVA 4H5GA 3PIPA 1MY1A 4LUDA 3SEYA 2ZYMA 2DE3A 5LJ3j 3GP8A 3FJGA 1HK9A 4WF2A 3CPWA 2W10A 1VQLT 1BBZA 1LEVA 3C33A 1V1CA 2YPNA 3FXUA 1ZSZC 1G3TA 4M77E 2LQKA 4O3AA 1M90R 1BCOA 2OCUA 2DJQA 3LWHA 2DF6A 3THKA 3KBZA 3K2DA 4NF8A 2CP0A 3AHUA 1WZOA 4OF1A 4LP2B 1Q81U 2COWA 4XU3A 3G4SQ 2CSQA 4M78C 5LJ5f 4DIGA 4GF8A 2L0AA 4M75G 3NOHA 2RO0A 3KOTA 1PSEA 1DMBA 5IZ3A 4RTZA 4RKUE 1DSNA 4E7ZA 4MCOA 2HSEB 3PV0E 4I62A 3FB9A 4DBHA 3CCST 2X4WA 3KEIA 4OEVA 1ZQ1A 5LJ3f 1A54A 3CCVQ 2DXUA 4N8YA 3PMIA 3I56Q 2A28A 2HCKA 5DLQE 1LAFE 2XXTA 2ZZWA 2ECZA 1AWOA 2P0SA 3TFLA 3HPWA 2LMJA 5KCHA 1BI3A 2P4TA 1IGQA 3K1NA 1S72T 4NMYA 2KT8A 2X7QA 3VS6A 2JXBA 1H44A 3QKJA 1NUZA 1USYE 4ZEIA 3FEOA 1I07A 4AG2C 5AYFA 3G3GA 3D7SB 2RQVA 5LJ3g 2OBGA 4II1A 3EHSA 5GJWB 3IB1A 3TTMA 4E7JA 5FROA 2DE4A 5IM2A 2AZVA 1Q7YU 4G77A 2XWOA 1YITA 4XEQA 3VYGA 5I59A 4ZTFA 2KI7A 3OYJA 4QFKA 2PVGB 1O9SA 3KJTA 4OFOA 1IZ6A 2ZCFB 2HFBA 5KH6A 3HN0A 1K9MU 2FIXA 4Y28E 5TPAA 3BY7A 3PIOA 1XI6A 3QYGB 2NUVA 3FV1A 3LSLA 4F7UG 3VS1A 3SESA 2Q9TA 1IXHA 2BZYA 4RTVA 3GLXA 4C0DB 3G6EQ 2DXRA 1PD1A 4X04A 5H8FA 2IIMA 4BE0A 1KD1U 1UGRB 2RH2A 1W2BP 3M3LA 1B34B 1NFTA 1RI9A 2LJ1A 4M77F 2LAOA 3FXQA 2KK4A 5JTYA 4RG2A 3QSUA 2FZGB 2BJJX 1EIFA 2IVWA 3SETA 1VQ6A 3VXCA 1KD1R 4DE8A 4L6V5 1GL5A 1G83A 5L8DA 2VKNA 1FTOA 2B4LA 2EAYA 2DIQA 3JRZA 4PJJA 4JLGA 5I2SA 3PNWC 2R5MA 4BDNA 4PBHA 1CSKA 4XKQA 4JVIA 3QZ9B 3CXCP 1PKSA 3O2AA 3CG1A 2LQNA 1MGQA 4KULA 1M5DA 3G71T 1SD3A 3EKIA 4NG7A 1VQLQ 1FQFA 3REAB 2HZYA 2VT5A 1MRPA 2PT1A 1LOJA 1FBEA 2FVUA 2LQWA 1VIEA 2A37A 2GQIA 1LBZA 3PUWE 4RK2A 4M78G 2Y7IA 4M7AC 1T0HA 4KCCA 1QVFA 1HXDA 2J6FA 1E6HA 1RAGB 5ESYA 4U4SA 4RG8A 1WDXA 5IHKA 1M1KC 2Y7RA 1N9SA 1OPKA 2RHUA 5CKFA 1Y1ZA 4D8DA 4MLVA 4LQ2A 4TVRA 2FL7A 4NL2A 1JRIA 4G8MA 2K9GA 3CCSQ 1NV3A 2F2VA 4XTYA 2PYYA 1OQGA 1JEGA 5I2NB 1WQ7A 3META 3NTHA 4XF5A 4X1BA 4QVZA 2X51A 1B0LA 3W9WA 1SI0A 2F2WA 1D0YA 2XHCA 4CC3A 1MY0A 4IB2A 3B7DA 1D3BB 5EQAA 3CSBA 3ZEHA 1BB9A 1KFZA 1MDP1 4PK4A 2GRVA 4RCBA 3ZSFA 1D0XA 3MHXA 1S72Q 2O7IA 2XXQA 1NH8A 4MFIA 5CCAA 2EW3A 4FIBA 3V7CA 3M0QA 2ED0A 2DD4A 3MJXA 4JRPA 2YUPA 1JJ2P 4XK8E 4D6WA 1M90C 3LSWA 4OFLA 1JW5A 4NF5A 1IB8A 4RXLA 3T9UA 4MX6A 4QQDA 2JM8A 2OI3A 3VV5A 2E10A 5LJ5h 1AH5A 1EFNA 3FXRA 1FMKA 3TSWA 3VS2A 4M1VA 3ER0A 1OZ3A 1ABQA 2KY9A 2LNHB 4DI3D 2DEQA 1QULA 1GXIE 1JQQA 3KXTA 3D1RA 1XVXA 5LJ3h 2K2VA 1YJNT 2EKOA 4C8QC 1KC8C 2H8HA 2ALUA 4MAGA 3LGFA 1NV6A 3Q29A 4E7KA 2DZ9A 3H0HA 4OMBA 4YICA 3RPWA 4RTUA 1VQ8T 3CMET 2I0CA 3EHUA 3P8DA 2EGCA 2PU9B 3JCMX 3DLLA 5KYYB 2CUBA 4R72A 4C92B 5CC2A 3CC2Q 1ZJLA 4GL8A 4XKRA 3NMZC 2MK5A 2Y7PA 3PUVE 4ESXA 1H43A 5HM4B 5FW9A 1KHIA 5A5LA 2JOYA 2FPFA 2Q8JA 4BE1A 3QBYA 2V8IA 4MDXA 2LTOA 5FU6B 2DE2A 4A54A 3MVXA 5IAIA 3CPFA 2I0NA 4ZEDA 2D3IA 2EYWA 3IK6B 3GBBA 2CZ7B 1VQPA 3ZS6A 1VQOT 4F04B 2XI9A 1JEVA 2K4YA 2XMFA 1N0TA 3L2WA 2E64A 1A0NB 2M8CA 3VRZA 4BDYA 5GANj 4PJOA 3VS5A 4OMNA 4Z7EA 2J06A 5CKDA 2QS3A 3OSSC 1GFDA 1NPRA 1D3KA 4YKJA 2F8DA 1K4US 4RUGA 2DXCA 1GCPA 1IQ7A 1JO8A 4B9WA 1UGVA 5KCJB 2GTJA 1MV0B 3TSZA 3C35A 4GBQA 4K3FA 1A8EA 4GWUA 5I2NA 5HY6A 3RNJA 2J6OA 2L3SA 2DL5A 1N8RC 1FBPA 1LVKA 1CE2A 3SB2A 2JN0A 1D3BA 1YHQA 3OYHA 1Z7NE 4EF2A 3JB9J 3CCVA 3X20B 3A8OB 1NJIC 4JRKA 2WEFA 5GANf 3TELA 4FM4B 1EYKA 4PJNA 3E4RA 1B7TA 1M5CA 4B6MA 1JBMA 1LNXA 2CDTA 2QQSA 4PJMA 1UG1A 3Q27A 1MM7A 2MOXA 3KBGA 2GQVA 1M5FA 2KMTA 2YJPA 4AFSC 4HCCA 2RI3A 4X34A 2YDLA 1QVGA 2FRWA 4C8QG 2KQZA 3G3FA 4ZEBA 1B7ZA 3EGUA 1OPLA 3IR1A 3RT6B 1NV4A 1NUWA 5EHSA 1U1TA 2R9JA 1K73R 2KAFA 2E65A 4GRKA 4L59A 2LP5A 5CVIA 1KIKA 5I5PA 2XDDA 4C5GA 2XWKA 3J7AF 4OHNA 3CMEQ 3CHGA 1B3FA 4EXKA 2GBQA 1SW4A 1QCFA 3TDJA 3QSLA 1WIEA 4C92A 4PJLA 1QW1A 3KC0A 1ZBJA 2UYEA 2E12A 4A4FA 3G6EA 4JWYA 4R2FA 3CBOA 3ULRB 1VOMA 1QQJA 2QEXT 1R6ZA 4U1OA 4U2RA 4QVCA 5EQ8A 3JB9F 2Z23A 1YWOA 2HZLA 1PWTA 1X01A 3CMAA 5ITOA 4NWCA 3PD9A 3O8VA 3IX1A 3CEYA 2ZZVA 3VVEA 4BB7A 1JEUA 2ZGWA 1I6QA 1VQOQ 2P3VA 2DA9A 4HCKA 4AB6A 4J9BA 4RTTA 2V3QA 1VQLA 1WHMA 4OZ9A 1Q81R 1MG1A 2XXUA 4F2QA 4F31B 4IO4A 2CT4A 3JCMP 4FEDA 2X4JA 2Y7KA 4O3CA 4M77D 5BWJA 1W6XA 2GNCA 5AA2B 5IN1A 1POTA 2HQ0A 1PDAA 1SW2A 1D9VA 5HK3A 5GAN2 2DETA 4ZNXA 4ZN3A 3OYBA 4YMAA 4DQ2A 2OTJT 3TPAA 5KCJA 1A8FA 4GLMA 2RC7A 1T3LA 4AG1C 3A3UA 3HSBA 1TH7A 3S9MC 3M55A 3IORA 3NFCA 4J9IA 4AFZC 5IAYA 2JMCA 4D8KA 1A55A 2DVCA 3MPKA 3WAEA 3EHRA 4DOWA 5ECAA 3CCSA 1YCSB 2PZ1A 2PMSA 3I3VA 1HSQA 4PKCC 4UACA 3DP8A 3RDVA 4LZ8A 3C4MA 2F97A 4FU6A 4ZDMA 2KEAA 1ZMGA 4P8BA 1R77A 5I56B 4ZN1A 4BDQA 4YMBA 3FVGA 2E1SA 2KXCA 2FBPA 3JCMe 4BDMA 1J1NA 1M1FA 1S72A 4GLIA 3M4GA 6AT1B 1B1XA 1VYTA 4U23A 3WAFA 4F16A 1NH7A 1WHHA 3IB0A 2WKYA 3H0FA 3FJMA 3JCMV 4IY6A 1B3GA 3RERA 4G68B 1T0JA 1N3WA 3H6TA 1YFNA 4PFOA 1OOTA 3NHNA 4JSOA 3RYDA 2FA7A 1G3SA 2FPEA 2RPNA 5HCKA 1SDXA 1X2KA 5A5XA 5T3JA 2B86A 4A63B 3U65A 4HKEA 3MCAB 4X9DA 3M57A 4C0GA 3PT9A 2CZ0B 5GMKe 1Q86C 4E6RA 3VS7A 2XXIA 2EKHA 1LBXA 3TQ7P 2QL3A 3KN8A 3E78A 5I58A 4C92E 2OLBA 3R6UA 4PDHA 3G7WA 1I69A 1G5VA 2F69A 4OVTA 1X6OA 1US5A 4KCDA 2E6ZA 3OW2A 2ESWA 2VOZA 5GANh 1IZ1A 3FGSA 3GNGA 4ZEFA 2V1QA 3RUXA 2XKOC 3CC2A 2V8JA 2VC8A 1IXDA 2Q2CA 5GAN7 2Y5LA 3MJNA 5ET7A 4UABA 1QJMA 3MPUB 4O5VA 1EZZB 5DT6A 4F19A 2HBWA 2NVUB 5H8NB 3IQLA 1LBVA 4JVDA 5KDTB 4ELZC 2OWTA 3TEEA 3K01A 1DPPA 4WCIA 4MDWA 2QDYB 3OYMA 2RQUA 3G71A 4R9GA 1YJWQ 3SWNA 2C06A 3F70A 4ZTJA 1I4K1 4P1LA 1MDQA 1VIFA 2FYKA 3NTKA 3EFSA 1KG1A 3UPUA 4PETA 5AA2A 2HSPA 2QS1A 2VXFA 2ZNTA 2RCAA 5ET8A 2Y4XA 1QVGP 4M77C 1VUBA 1B3EA 1Y71A 5GAN6 3M0PA 3PE0A 3OXNA 2XICA 4CI0C 2WSFE 3KG2A 5JEIA 1IMDA 1I6AA 1NNFA 5H8HB 4FEBA 1C1AA 1YAEA 2HZKA 1ZLMA 3OS2A 2RNAA 4GVOA 1G3YA 1FPJA 1WI7A 3E79A 4AT1B 1ACMB 3CCQT 4J9GA 3BIHA 1MY3A 5GAMj 1KQSP 1WJSA 1DTZA 4OP0A 1Q82U 3O29A 2OAUA 5I56A 1QKAA 4E7SA 3FXBA 3KN3A 4N0AA 1SRLA 1UECA 3CCUQ 1I6BA 2DP8A 3IFCA 4FYYB 3LUYA 4KH1B 3MKDA 2XWVA 3ZKLA 1FBHA 2QJEA 4MZTA 4XKPA 4ELQA 3GF5A 4G68A 1VQ7Q 2D8HA 1WNLA 4C0ZA 2DO3A 4MNPA 1WHLA 2MIOA 4NAPA 1SBPA 1C0MA 1HYOA 3BDLA 1AZGB 3OYKA 1YPNA 4I3EA 2C0IA 5LJ5d 2YHTA 2A0FB 3K6UA 5GAMf 5EC7A 4N13A 4N4UA 3IAZA 2K6DA 2CEXA 4AFQC 4HXVA 3OA6A 2CS7A 3HFOA 2O69A 1K8AU 3PPQA 4DZ1A 1MMDA 4OB0B 1YJNA 3TTLA 5LJ3d 1RL2A 3E1SA 3T9NA 4H65A 4R6HA 3UWNA 1VQ8A 2R8TA 3CMEA 4TOZA 4C1TA 5FWCA 3EG3A 1FBDA 4H1XA 3I5SA 4FJPA 4AS4A 4FW1A 2AL5A 3CRBA 3E9FA 3QAXA 3PPNA 2JS2A 2Y5KA 1BTJA 1NL5A 4XTVA 2D1XA 1UFFA 4R6KA 2I6EA 5L9SA 4EUOA 5H8NA 3OYFA 1H92A 1SHFA 2HL5C 1B58A 5KDTA 1RUWA 1IREB 5A2QE 2X26A 5AA4B 2QYZA 3S3MA 2EQIA 1K0SA 2HBPA 1R0BG 1AWXA 3QK6A 2DE0X 5H8SA 3RLFE 3B6QA 2ENMA 4N15A 1AHJB 2VP1A 3G4ST 4OEUA 2KGTA 3H9NA 3OMCA 1D1BA 3VU3C 4M77G 1HJDA 1VQOA 4GFRA 3C95A 1Q35A 1EZ9A 4BDZA 1SSHA 2PFZA 3FLGA 4ELYC 2UYFA 3A8HB 2VD2A 2HQHA 3OYIA 3MZ1A 4PFIA 5CMMA 1WVJA 2DVZA 3P8HA 1MQDA 4N6KA 4F3SA 2YXYA 4QQGA 2DD5A 2VGMA 5H8HA 4M75B 1FMWA 3I56T 4Z0IA 3RKYA 4DXBA 3SEVA 4R2BA 4PCDA 4YU0A 3IO6A 5AE4A 2CZHA 3M5AA 3CFZA 4HVUA 4P0IA 3T9HB 3BBRA 1ARKA 3CSGA 4JVCA 3CCQQ 2HXRA 2KQWA 2XD0A 2QVUA 3A3CA 1TUGB 1TXQA 3ZKKA 3OW2P 3MVWA 3OO9A 1GVCA 3OYYA 5I21A 3JV9A 2H4IA 2CYZB 3O6GA 1LFGA 2X35A 4LUBA 2RQWA 3M4YA 3JSCA 3OD7A 3S3OA 4RJZA 1US4A 3RPLB 1UGPB 3GNFB 4YKPA 2FZKB 2ZPIB 2I4CA 5C6SA 1IMBA 2P0PA 3V7SA 3IOVA 3HKSA 4AMCA 2DILA 3QWXX 1YJ9T 1RACB 1SHGA 3VV0A 1EU8A 4XAXB 2HD0A 3I6VA 3M59A 3PPRA 5DTBA 3HFNA 2ZNSA 2DMOA 3I35A 2UVIA 2E6NA 4MJOA 1DJ7B 4IO7A 4N6PA 1QWFA 2JJ9A 1LAHE 1FPGA 4ZE8A 2QASA 1XHYA 3H6ZA 2Z8DA 3H6UA 4OXVA 4H6DA 1LGBC 3IOUA 1AEYA 4BY6C 4MH5A 3UN6A 3M56A 3QUFA 5B70A 1FX7A 2KYMA 2AHJB 1B1HA 4GWOA 1NNPA 1AIVA 2QEXA 1K0XA 2EGAA 4AB5A 3X25B 3KOSA 4IR8A 4PF6A 2DAQA 2RB6A 2DIGA 2CSIA 3OBYA 3U93A 1EYJA 1PB7A 5AA4A 1ZSZB 3WXMB 4J9DA 1CNQA 2K79A 2XU8A 3FJ5A 4J7FA 2PVUA 4NWDA 1NV1A 3TTNA 1TWYA 3OQ5A 1JXOA 2F7CA 2Y84A 5GAMh 2Q89A 3ECRA 5CQYA 1USYH 1B4HA 3RY3A 1MS7A 2P1SA 4PJOD 4FBPA 4XTWA 1GFCA 1OQHA 3V89B 2VHAA 3J81E 2A5SA 3QWYA 1YBYA 3JAME 2VUBA 4P11A 3CC4Q 4JUVA 1S9TA 1IMAA 4N07A 4LUEA 4M75A 2REJA 3CD6T 3VVDA 4FSXA 1MQGA 4XFEA 2RD1A 1ZUYA 2RC9A 3HCQA 2OTJA 4JS5A 1JB0E 2DXYA 1B3HA 4TLMB 1XC1A 5LJ5g 2EJGA 4CC7A 2BE9B 4QFLA 1WXUA 4XXUA 2O9VA 4LDVA 2NWMA 3EGDB 2EQJA 3V5AA 2Z8FA 5CMKA 1QCOA 3CC7T 2Q74A 5F24A 2DWAA 4OVSA 1CB6A 4NF5B 1V29B 1RAEB 3PTAA 4GWSA 1OEBA 3RTWB 2QGGA 3RPLA 2K3YA 1YZ0A 2DNUA 5TP9B 3UA7A 2M16A 5L23A 1F1BB 3K6XA 2PQWA 3VRYA 4CC4B 2LCLA 1R1NA 1SG5A 2V3UA 3EQ1A 3TCGA 3OEMA 3EG0A 2RJDA 1YJ9Q 4OQOA 2FNCA 3HV1A 3THIA 3MVZA 4PGPA 3SKPA 4P56A 2VVKA 2RN8A 1VQ7A 3IB2A 3N6TA 3GIBA 5GMKj 2K7AA 1V76A 1G8XA 1AMFA 1GGGA 3PVQA 3CC2T 4E7IA 2O88A 3MUQA 8ATCB 2L8DA 2DSFA 4PFYA 2F5KA 2IEEA 4F7UA 4J8OA 2RQRA 4HTGA 4RA1A 3SERA 1I8FA 2L5VA 2J05A 5M2VA 1FWZA 4E7HA 1YI2Q 3OS5A 4C0DC 4C92D 1YTVA 3SDFA 4ZGDB 4NEDA 1JVYA 5ITPA 1RDYA 4GY5A 2IPOB 2QK0A 4FYXB 4BACA 3LLRA 1PBQA 5KE2A 3OYLA 2FPDA 5CKBA 1B2HA 1URGA 4P0GA 5GANd 1B51A 1IXGA 1NV7A 1K9YA 4IO3A 5J39A 5D6WA 5H8QB 4OVPA 4O8MA 4R0KA 1MY4A 1VR5A 2GTOA 2A5TA 3K00A 2CH4A 1UDLA 3MP6A 1ZSZA 2V4CA 4HW8A 1PM3A 4NF0A 1ZIUA 4PJOB 2ATCB 2K3BA 2XDPA 1RDXA 5AT1B 2YUQA 3JCMb 1AOVA 4O94A 4M7AB 2V1RA 1UTIA 5KYXB 2FB7A 1W1FA 3HHGA 5DM7R 4IO2A 4M78A 1WHKA 3U94A 3S9NC 1U5SA 3FATA 3D4CA 2M02A 1KZ8A 2DS9A 3JB9G 2XXKA 2DM1A 3LH5A 4M75E 3Q25A 3S2VA 1IUDA 5GJVB 4R73A 4GWXA 1GV8A 4PFTA 3KSJA 3CD6Q 4XQ3A 1YCJA 1BLFA 3V8JA 1AZEA 3TZAA 4P3LA 3CCMQ 3S3NA 1GR2A 4OWDA 1HD3A 3PMVA 3EGDA 1Q82R 1G3WA 2ONRA 4UA8A 3QIIA 5I2KB 1Y7XA 1NE8A 2RJCA 3CC7Q 1FW0A 1I1JA 4G8NA 5FWBA 2EYYA 3CCQA 1BI2A 1MQIA 2XDBA 2M0OA 2RHXA 3CVGA 5DVFA 5LOMA 1D1AA 2YUNA 4MZMA 4X9CA 3AT1B 4I9DA 3E9XA 3H6VA 4FW2A 3N94A 5A0LA 3JV3A 5TP9A 2ZPGB 4O7MA 2QA4T 2A3LA 1G2BA 5CAIA 4XTXA 1IXIA 3B50A 1NM7A 2PX1A 4YB6A 1GTKA 1KQ1A 1B7UA 3Q26A 4A4HA 4AFUC 3FDRA 2CH4W 3MEWA 2RJFA 3OB9A 4IUUA 2F5XA 3EH1A 3OEKA 4HCZA 1K8AR 4FT2A 2BTTA 4F7UE 4RNSA 5EYHA 1RDZA 3R7XA 4NTLA 4Y91A 1PC0A
chains in the Genus database with same CATH topology
1SW5A 4P5NA 3JB9H 3GZGA 2WSCE 4BI4A 3FC3A 2G3RA 2B8AA 3SEWA 3OYDA 4BLAA 2V25A 4BD3A 4RMOA 3RTFB 4M75F 1P92A 3PU5A 4ZE9A 5CO7A 5H8QA 4U4XA 3J80E 2XX7A 5FU6C 3H03A 4OMFB 1W2BS 1N84A 4J7IA 2L5QA 2V84A 1PSFA 3X24B 1QVPA 4M7AA 4H8JA 2VYTA 1SYHA 3JCMW 2UVGA 5FU7B 3LBSA 3ONMA 5AA2D 3S9LC 3G4SA 1Y4CA 2I4BA 3CXCS 4X48A 3TTKA 2XK0A 3L2RA 3VLVA 3SFMA 3E13X 5CMCA 2Y4YA 3V8KA 2O4XB 1R9QA 4KPTA 1JW1A 1FTLA 2DXBA 5A0DA 2ZYKA 1QUKA 3I56A 1H641 5I2KA 5GMKh 4GLKA 4DOVA 4MMKA 1OVTA 2O7UA 1Y96B 5IKBA 3IO4A 4JWXA 5D6XA 2K5LA 1B46A 4IUQA 4JLIA 2YLCA 3MAMA 3MP8A 4J6WA 4PE5B 1B05A 2XXHA 5GANg 5A5XB 5FRMA 3G7ZA 3DP4A 2CZ1B 4DA4A 2F35A 2ZPEB 3ZFJA 3TKDA 4JRIA 5ICTA 5I58B 3QJYA 4C8QA 2LX9A 4E0WA 4WEPA 2E5QA 3CCJT 2GCXA 1YJ9A 1B40A 1KQSA 1JJ2S 3EFRA 1UTBB 2XXRA 1IEJA 3TODA 3VFJA 3TCJA 2DYXA 1A40A 4KYEA 4O6JA 3CPWS 4NOYA 2OWSA 4QF9A 4IY5A 1M1KU 1Y4TA 3FVNA 1B5JA 2MMPA 4BDOA 2DKGA 2LQ8A 2B3FA 2DWIA 4FATA 4ONYA 2F6PA 2BKDN 1WODA 4OESA 4PJOE 3SWNB 1YJWT 3DELB 4M7AE 2XXVA 3CR9A 3HP9A 5L9OA 5LJ3e 1II5A 1UTHB 1O75A 3C32A 3F11A 5GAN5 3IOTA 4BI8B 3KFMA 3TCFA 1RYXA 3VUBA 3QG1A 3URGA 4HT9A 1OIBA 2O84X 1M90U 3CFXA 5HK0A 3TQWA 5GAMd 2RINA 1ZTYA 1M5Q1 4I1DA 1FQEA 2O4XA 1N3XA 2PVOB 4EQ9A 1XT8A 4NF6B 3HHTB 2JTFA 2K5FA 4C1UA 1VE4A 3CD6A 1XVYA 1IXCA 1KC8U 1NNKA 2HNIA 2Q2AA 4BDLA 3CCUT 3CCMA 4H8IA 2E70A 1A7LA 1Y96A 3WVEB 3M3KA 2VD3A 3CC7A 1PB8A 5EYFA 1O63A 2DTIA 1B6HA 3Q28A 2QQ9A 3OY9A 1VQ7T 2OJTA 2OTLT 2LT1A 3KBRA 2EWNA 3V8LA 3IL1B 4C8QE 4ZECA 3CI8A 1DTGA 3HRTA 3MEAA 5CI5A 5KCOA 3FUZA 1BYMA 2EYQA 2R57A 4PJOF 4QFPA 1LSTA 1UTBA 2HEUA 4JXIA 4M7AF 3RESA 3OO7A 1RKMA 4EQ7A 4FAJA 3V83A 1URSA 1P1NA 4PFUA 5CKHA 3T93B 2DOJA 1H3DA 3L2VA 1N04A 5KZTA 1OI1A 1Y1MA 3JYRA 3DB4A 1TT1A 4EPCA 1QVFS 1P1UA 4RYAA 4VUBA 3IJXB 4A4KA 4NF4B 1X75C 1K73C 4LA9A 1N8RU 3A8LB 2V3TA 5CBRA 4FL6A 3C94A 1VQ4A 2QMXA 3BFUA 1UTHA 4OB1B 1VFDA 4GOTA 4EQBA 2I58A 3KZGA 1NJIU 5DEXB 4JB7A 1HSEA 2LVMA 2QTXA 4U1ZA 2XXXA 4FIMA 1SSFA 3R6OA 4BUGA 4RY1A 3MP1A 3QIMA 1LJOA 3K1PA 4FE8A 3NTIA 3INZA 3I55A 1MXZA 3X26B 1LLSA 2H5YA 4M75D 5I2MA 2K3XA 4XU0A 3G3IA 1BI1A 4NF6A 2B65A 5HBCA 3T96B 1N7XA 1BIYA 4M7DB 1MPCA 2R71A 4LATA 3T9VA 3OOAA 5KE3A 4EDPA 3BFMA 5FRNA 4C92F 4IUPA 3N5BB 1Q81C 5CR2A 4JDFA 2R58A 3VJPA 3OYCA 3KN7A 4E47A 1VQMT 1LCFA 3ME9A 2D9TA 1TFDA 4PLIA 2PBWA 4MZPA 1ANFA 1FTKA 4KUDK 2X4YA 3PUZE 1QP2A 2YRVA 2QA4A 1EZPA 3O28A 1FQAA 4H0WA 1MXVA 4LONB 4ELOA 5L9MA 2LRQA 4OYVA 2MWOA 1MXXA 2QMWA 1VSOA 2REGA 3QDRB 1IIWA 2HQXA 4F22A 3DP6A 4LDWA 2RM4A 4AQ4A 1OYXA 2Q88A 4DDDA 4WKMA 2PVDB 4EMKC 5GAMg 1Q7YC 4HCWA 1VQNA 2HAUA 4R75A 2EFIA 2DWJA 2JZ2A 4R56A 2I0BA 1K9MC 1N9RA 5D6YA 1O64A 1Y07A 3FD3A 2KLFA 4NF4A 5BUUA 4YZZA 4IUVA 4BI3A 3OENA 1I81A 3OO8A 5CBSA 1S7YA 1KD1C 2ZMBA 2GFUA 1LB8A 4DCYA 4WEDA 5DEXA 5CK9A 4OETA 3CC4T 3IOWA 3T66A 4M78D 3EAEA 3QZ5B 5GANe 2P0KA 4GXAA 1P99A 3TEPA 2V93A 4LVQA 1M4ZA 3E9GA 1M5EA 2M1HA 4ZS9A 4M7DA 1LAGE 3W15C 2R6GE 3AXFA 1UGQB 1FTJA 3PUXE 3S4UA 1Q86U 3MO8A 1YIJT 3KJ7A 1QVGS 3DM0A 3FVKA 4NS5A 4A4GA 1PB9A 5AA3A 4PQJA 3X28B 4ZGEB 3OO6A 1POY1 4RCCA 1YCYA 2MF2A 4JSDA 3USDA 4JWOA 3KSXA 1WGSA 5ICQA 2GHAA 2NWJA 3VE1B 4C0FA 5HKCA 4PL6A 3K02A 3O6HA 3BDUA 5HPQA 2EQKA 4OB3B 1MPDA 1BKAA 2MWPA 1ZLQA 3SEUA 3QUIA 2HAVA 4QW2A 4F7UB 2H9BA 1B4ZA 1O7TA 2VGNA 3PMWA 1EZOA 2XIDA 3OYEA 5J1DA 1YI2T 1B3LA 2F6GA 4X9TA 4HA8A 3K0VA 4ATOA 2O51A 2EQUA 4X1DA 2DWHA 3FVOA 3CCJA 2F7AA 2Z8EA 5ISUA 1QUIA 4POWA 1M5BA 3O9PA 1JNFA 4QSCA 4ISUA 3L42A 2EJ9A 4PLLA 2LDMA 2A5TB 3B6WA 3PPOA 4MMLA 3T9XB 2KVQG 5GAOp 3HHFA 4ZEKA 3OSQA 3G3JA 3L6HA 1ZKBA 1XOVA 3Q1JA 3C36A 2CZ6B 2I3VA 1MQHA 2F78A 3O97A 1UQWA 4F3GA 1XTDA 3DKMA 4M78B 1YJWA 4M7AD 4HCYA 3M53A 2JVVA 2K57A 4Q0CA 4IGTA 3JCMc 1FQDA 3UGWA 3T22A 3CBPA 1FQBA 4OENA 1PEBA 4XKNA 4QQ6A 4L17A 5LL6S 3BFTA 3QHSA 4OGCA 4TQUQ 2GFAA 4Q5WA 3CCMT 4B9XA 4GIZA 2OZZA 1VQ9A 2RC8A 3GLBA 1SYIA 2AIXA 1URDA 2O01E 2LC4A 1P1OA 5DVIA 4M7DE 4C5IA 3DB3A 3E19A 1ZHIA 4OVJA 3CG3A 1A99A 2EJFA 3H3GA 2XG8D 2WACA 4YKIA 4XU1A 5GAOn 2H99A 5F7VA 2LT4A 4GQOA 2DPPB 2QRYA 1NZ9A 5GMKm 3ILTB 4J5YA 5FTHA 3VDFA 2ZYNA 2LCCA 3CCUA 4F18A 3MW0A 2ZPHB 5GAN3 3PMTA 1BIBA 4TLLB 2RHYA 2RK2A 1LFHA 3A09A 5CRYA 3GPLA 2GF7A 3TREA 3FJPA 3OW2S 1JVXA 4OFJA 4Q5TA 1D4NA 2OTLA 3EF7A 1ZBMA 4DXUA 1KQ2A 4J6XA 4F3PA 4C8QD 3ILUB 3JCMf 3CCLT 2RI2A 1XS5A 4N4GA 1MQJA 2WSEE 1B9JA 2CKKA 2QS4A 4ZGJB 1VQKT 3L2QA 1ZU0A 2IA4A 5A0GA 1XOCA 3MPLA 4CRIA 1LBBA 3C12A 1JQFA 3K6WA 3C9HA 2JUFA 1VQ4T 1M9SA 3CFLA 4EF1A 4N4IA 3M8UA 4KD5A 3LGLA 2I3WA 2ZPBB 3OMGA 1SI1A 3JCMg 4KFQA 1DOTA 4H5FA 4Z02A 3N5LA 2G93A 2NOOA 4LDYA 4M7DF 3H4ZA 1OZ2A 4ME7A 1UB4A 3I55T 4QRZA 4G2ZA 4PJOC 4C5EA 1B5IA 1MPBA 4ECFA 2ZXTA 2E41A 3FJ7A 3OELA 3TYHA 5GMKi 2QI2A 3LW5E 5CKEA 2XX8A 3OSRA 3B6TA 2GH9A 3HRUA 4KBMB 1R9LA 3S6WA 2XD2A 2G29A 3N6UA 3OYAA 1Y9UA 4F39A 2QPQA 4L5GA 5DVJA 1HSJA 3DLMA 5TU0A 2H3JA 3UA8A 1M1GA 4IKFA 3BKIB 3A5ZB 4PNOA 4QHQA 3S9EA 5EHMA 5GAMe 3VLWA 2ZYOA 1FXXA 4FT4A 3RMQA 3RIRA 3RMSA 4EMGA 3CCET 4F3BA 4KQPA 1VQMA 4C8QB 5FTIA 3C34A 3TTRA 1B0HA 2FHDA 1JETA 4JDSA 5C0MA 4V2SA 1QKBA 1H3ZA 3EN3A 4ELRA 1VQNT 3QUJA 5GAN4 3OS1A 3MZ9A 3FV2A 4C92C 4LQ5A 2RCBA 2RA2A 3A8GB 1B34A 3OBWA 5GMKl 1NMUA 1NKXA 3UK4A 4J6YA 1Q1KA 2DTOA 1U8RA 1LB9A 3L2UA 4GL0A 1FCKA 4DCXA 3ZBDA 3JB9I 2F36A 3HSTA 2XXWA 3MZBA 2NLUA 2DTHA 4M78E 3LSFB 4PJOG 3LSXA 5B7DA 3FIRA 4M7AG 3JCMh 3TMGA 1H45A 2K5IA 3O66A 3M54A 3MEVA 5FU7C 4MBPA 5L8RE 1MXYA 3PFSA 3CC4A 2XXYA 3G3HA 3H6WA 3PGGA 1MXUA 4RK9A 1MHNA 3GXAA 1MH4A 4RPOA 1VQ5T 2THIA 5CIUA 4OB2B 2DJZA 5IT9E 3GBAA 4WXJA 3VXBA 3QXEB 2QXFA 2O1MA 2XX9A 3CCRA 2E1HA 4F7UF 2F5TX 2RHZA 4RPNA 5K2XA 1ELJA 4ESWA 2ZPFB 2I48A 1P1WA 1P1QA 3FIFA 2RF1A 5FHOA 3LC8A 1YIJA 3DLNA 3QJ6A 4HCBA 4XTUA 4ND9A 5GAOm 3JCMJ 3EPEA 4O3BA 5K2YA 4YAHX 1SW1A 1AL3A 3RUMA 5F1QA 1B5HA 1TXFA 2H98A 2L3RA 2HCAA 1QVSA 1NPPA 1T0KA 5FHMA 1DPEA 4EDUA 3GOXA 3PD8A 3MBPA 4THIA 2VXEA 4C92G 1UGSB 2JNGA 4F2OA 1Q82C 3H8ZA 1XNIA 1B32A 4M78F 3M9QA 1F9BA 1BKBA 1N27A 4DLDA 3QO3A 1YI2A 3L6GA 2PT2A 5M9OA 2RKMA 2ANJA 5LJ5e 3LR1A 1LBCA 5DLOA 4H67A 1WPYA 3BW1A 2RK1A 3VUZA 3QXMA 3SD4A 4XTCQ 3MEUA 4LDUA 2IG0A 1OVBA 1QUJA 1BIAA 2CZLA 5JK4A 1K8AC 4YTLA 3C31A 3SWNC 4C5HA 4FECA 3MWBA 2R5AA 2DK3A 1VQ9T 4IO5A 1OMPA 3FZVA 3RT8A 1ZBXA 3VYHB 2UVJA 3RNNA 2JTMA 3UORA 3K6VA 3V7RA 4LD6A 2RJEA 2D0QB 4OTEA 2ESNA 1R8OB 2VV5A 2B3BA 4U22A 4JJNK 2AYSA 3CIJA 4XTZA 1UEBA 4XU2A 3IJOB 4F29A 3U1OA 4M7DD 4J83A 1QP3A 4R9FA 4OERA 5EG2A 3OSVA 1SQYA 2L89A 1PC3A 1YITT 4N0AC 4ZZEA 1Z7ME 2ABHA 1D9YA 3K1MA 4EMHA 4F1UA 5GAOq 4QSDA 1MY2A 3PGFA 4E0XA 2QQRA 2F34A 3PPPA 4IUTA 4G68C 3RKWA 3I5OA 4XIGQ 3W9VA 2BIVA 1I5LA 4LD9K 4KHZE 4LZ5A 4UC4A 2PUOB 1NNTA 1B52A 2ZZDA 4IGRA 3V8XB 3QPHA 2QSXA 1VQ6T 4NE4A 3L1AA 2I49A 2A7YA 4G4PA 1N7WA 4QFNA 3U72A 3CCLA 5CMBA 3CBMA 5AA1A 3O6IA 1XQHA 3MVYA 1PBPA 2P2AA 4KUIA 4PFWA 2RI5A 4U21A 2Z22A 1RI0A 1VQKA 4LDXA 1WQWA 4YKKA 3D4GA 5GAOl 4R6YA 3RN8A 3HPIA 3LX7A 2M9UA 4JS4A 3QYHB 3UIFA 4KT0E 2CGHA 1W4SA 2W7YA 1JW4A 3PUYE 2NXOA 1TFAA 4DXCA 3HRSA 1OLCA 1MH3A 1Y3PA 2XHDA 4F1VA 3JZJA 2EIFA 4M77B 1SVXB 2Y90A 4C0RA 3RGYA 1M8VA 3UP9A 2FYIA 3P7IA 5CQXA 4F1YA 4A53A 2O1LA 3VVFA 3FASA 2OK2A 1U1SA 2BUDA 1KWHA 2PUKB 3H7MA 4GD5A 5J26A 2O6AA 3M58A 2XD3A 4C8QF 2QQAA 2D6FA 2KSSA 1FQCA 1MM6A 1L5TA 4M4GA 5CM6A 1OLAA 3SEXA 3HL8A 2LNVA 5DYHA 1LFIA 4M7DC 5GAN8 2D5WA 3WVDB 2P0QA 4QFOA 3U8QA 3C4SA 4E7LA 1N76A 4KI0E 2X7PA 3TAJA 3UT1A 4Q8RA 2EQMA 3OYNA 5I57B 2ONKE 1Y3QA 1LAXA 1ATGA 2MAMA 4BDRA 4Q30B 4ELPA 3CCEA 2DQVA 1Y20A 3L2ZA 1S50A 5I84A 2CMOA 2V8KA 1WDNA 2DZCA 4KR5A 1UIUA 2E0SA 3KGCA 3KUFA 1MXWA 3ODBA 3HO7A 3OMBA 1FTMA 4EMKB 3K4UA 1UIVA 4MLQA 4NL3A 1VQPT 2AL4A 2O68A 4MF3A 3M3FA 3VLUA 1HSLA 4EXLA 3MC2A 3TCHA 5J3BA 3E3KA 2F7BA 3VKIA 4JBZA 4IURA 3H06B 1WJQA 4GXSB 4JRQA 4M77A 4NF8B 3FRNA 3OYGA 2DVEA 2X4XA 5FLXE 2XXPA 1W2BA 2ONSA 1WJRA 3CCRT 4FORA 3JCMd 1H76A 4A4EA 5GAOr 3SDZA 2RHIA 4M75C 4LZ7A 1YHQT 4YB7A 1BI0A 2KDSA 4BE2A 3JB9D 3CCVT 2GHBA 4R74A 2VGQA 3LYIA 3CXCA 4M7DG 3ASKA 1VQ5A 2D21A 3MQ9A