1NL5A

Engineered high-affinity maltose-binding protein
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
366
structure length
366
Chain Sequence
KIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYGDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATAENAAKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTRITK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into the Conformational Equilibria of Maltose-binding Protein by Analysis of High Affinity Mutants.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Sugar binding protein
molecule keywords Maltose-binding periplasmic protein
total genus 119
structure length 366
sequence length 366
ec nomenclature
pdb deposition date 2003-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1nl5A02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1nl5A01
3TAJA 2XXPA 1DSNA 3IJXB 1MXUA 3JV9A 4KI0E 4QHQA 4YKKA 3RUMA 1IZ1A 1UIVA 1XVYA 3CG3A 4NWDA 3F11A 4G8HA 4ELPA 3TUSA 1R1NA 2F78A 2REJA 4NF4A 3OO8A 1N3XA 3SERA 4F1YA 2UVHA 1B1HA 4FEBA 1I6AA 2ZMBA 3M3FA 5CMMA 3N26A 4YKIA 3V8XB 5I2KA 5IAIA 1IEJA 1B5HA 3L6GA 3EHSA 1D9VA 2R6GE 1N76A 1P1OA 3UK4A 1SW5A 2V3QA 1OLAA 3P7IA 4WKMA 2GH9A 2YPNA 1A99A 4U23A 4Z0IA 4LP2B 5TPAB 3TDJA 4F31B 3ZKLA 5CC2A 2D21A 2OZZA 2F5XA 3C34A 1EU8A 4L17A 2M8CA 4R73A 1USYH 4U22A 5BWJA 3SEYA 3KOTA 4IGTA 4NEDA 3ILUB 4WXJA 3FV1A 2ZYOA 2B3FA 1MH4A 3OOAA 3CG1A 1ZLQA 4ZZAA 5I58B 5J1DA 4M1VA 2UVJA 5JEIA 3C35A 4QF9A 4GXAA 3C31A 3UIFA 4TLLB 1FQCA 3IO4A 3RTFB 2UYEA 3E13X 4ZDMA 2KLFA 4F19A 3VVFA 1II5A 3CIJA 4NWCA 3CI8A 4ELOA 1AIVA 3M3LA 3KEIA 4EXKA 5HM4B 4ZE8A 1LBCA 1LCTA 4MLQA 3Q27A 4KR5A 3KJTA 4DZ1A 1H44A 3MC2A 5KZTA 2B3BA 2UVGA 1MQIA 5H8FB 2RF1A 4R72A 1B5JA 5TP9A 3BFTA 2O51A 3DM0A 3OSRA 4JXIA 5I2KB 3T9UA 3G3HA 2I48A 3O6HA 3TTKA 1UTBA 4FORA 3RLFE 3FVOA 4N6PA 4YZZA 1BTJA 1RKMA 4LA9A 4EXLA 3QUJA 5KDTB 2A5SA 3FV2A 3GBBA 3ODBA 2Y7IA 1DPEA 1DTGA 2G93A 4EF1A 4PFTA 1MY4A 1POY1 3QSLA 1NNPA 3E3KA 4EQ7A 1XT8A 1JVYA 3GZGA 4MFIA 4ZS9A 2W7YA 2QSXA 2XXQA 1ZMGA 5AE4A 3ZSFA 3VFJA 1HSLA 3RGYA 1SW2A 1I6BA 4IY6A 1FQAA 1RYXA 3RQTA 3HN0A 1M5BA 1GV8A 3CRBA 4FE8A 3PMXA 4H1XA 1MS7A 5H8FA 3ZS6A 3S9NC 1B05A 1LCFA 3KGCA 3TYHA 2F8DA 2ZXTA 3IR1A 2IEEA 4XKNA 5K2XA 4RY1A 3IOWA 2HXWA 3EHUA 3OEMA 3I6VA 3K02A 2QL3A 2AIXA 3FJ7A 3GXAA 3OXNA 2H5YA 3D4CA 3BKIB 1PB9A 5CMCA 3VE1B 2O1MA 4GOTA 3U93A 4NE4A 4DIGA 3C4MA 2DE2A 2H4IA 2Y84A 3WAEA 1IXIA 4F39A 1VR5A 1SVXB 1PBPA 1AH5A 3TQWA 4LZ8A 3UN6A 3MVZA 4IB2A 4GF8A 1MM6A 3TMGA 5JK4A 1SD3A 5AA2A 2Z8FA 1P1UA 2Z22A 5CMBA 3B7DA 2O1LA 3HCQA 1ZIUA 3TQLA 3G3JA 1HSEA 1ELJA 3CSBA 1LAGE 1MXWA 2AYSA 1WVJA 2ANJA 4ND9A 4Q5TA 3TCHA 3TCFA 3TELA 4ECFA 3DELB 3W15C 1VFDA 4F18A 3OMBA 1R9LA 1Y1MA 1UQWA 3KG2A 4G8NA 3PMVA 5I2NB 4QFLA 4QFPA 5ICTA 1XHYA 3IB2A 3G3GA 3S9EA 2HFBA 2DS9A 3PU5A 1B51A 1JEUA 4QFOA 3K01A 3ZKKA 3HHFA 5DYHA 4RNSA 3EQ1A 1AMFA 1TFDA 3TZAA 2QMWA 4F3BA 1MPDA 2I0BA 3K1MA 3G3FA 3QIMA 1F9BA 2R71A 3JYRA 1US4A 1B0LA 2E1SA 2Q2CA 3R7XA 5CBRA 1OLCA 4X9TA 2DWJA 1PB8A 1LAHE 2QJEA 4FJPA 1N7WA 2DVZA 5ITPA 3QYTA 4ESXA 1EH3A 2UVIA 4IO2A 2OBGA 1Y3PA 1LAXA 3O9PA 1MY1A 1QKBA 3RT6B 1TFAA 1MH3A 2VGQA 4H0WA 1GTKA 1IXGA 3DP8A 1B7ZA 4RYAA 3T93B 4F3SA 2DXYA 1MY2A 2P1SA 3V83A 3DLNA 3H06B 3VXBA 5JTYA 2GRVA 5JTYB 3FVNA 4G77A 3OO7A 4MLVA 4BDRA 4AB5A 3K6VA 4QRZA 2XXWA 5L8DA 5FHOA 1JEVA 3PUYE 2DOJA 3PPRA 3PV0E 4HS7A 4LATA 3IOVA 4QFKA 4IGRA 1PEBA 4HCWA 1EZPA 4C0RA 3KSXA 4Z7EA 2OJTA 2UXAA 4M4GA 3TODA 4F2OA 3T9HB 3N6UA 3TFLA 1PBQA 2XXXA 4DDDA 3HPIA 1D4NA 1MDQA 1Y20A 4YU0A 2OCUA 1FQFA 1M5DA 4GXSB 1Y3NA 1SW4A 1MQGA 2RC8A 5I56A 5TP9B 1B3FA 2PBWA 2H99A 4IO4A 4NF6B 3H6TA 5H8HB 4DCXA 4DXCA 1B40A 2H25A 2IA4A 4XIGQ 1QUKA 2Y7PA 4Q0CA 3MZ9A 1WDNA 2UYFA 3TCGA 4YMBA 1POTA 1IITA 1A54A 3WAFA 3B6QA 1P1WA 2OWSA 4PFWA 4DXUA 1YAEA 1MXVA 1ANFA 1OQHA 3KJ7A 2DWAA 4DCYA 3S9LC 2DP8A 2XXVA 2XXUA 1B7HA 1MY3A 2ZNUA 3FZVA 4JWXA 1MQJA 4BDNA 1FQEA 1PB7A 2AL5A 4JWYA 1H76A 3E9XA 1QW0A 1LFGA 1R6ZA 4OETA 1GR2A 1MXZA 3Q29A 4R9GA 3G3IA 1B52A 1SI0A 3IB1A 2HQ0A 4HTGA 4YB5A 5A5XA 2Q89A 3BFUA 4OMBA 3KFMA 4OXVA 4P0IA 1FTOA 2QRYA 1VSOA 1CB6A 3TTMA 3JZJA 5AA2D 4X1BA 2YJPA 4ZE9A 4GRKA 4OZ9A 2RCBA 1RYOA 3FATA 1N84A 5CM6A 3ECRA 4NF8B 3S9MC 1SYHA 3H6VA 4KHZE 3L6HA 2B65A 4OEVA 3TTNA 4OQOA 3UGWA 3VXCA 1D3KA 3PPQA 5AA1A 4BDQA 4OFJA 2F97A 5L9OA 1USYE 4H65A 2PMSA 1JNFA 3KSJA 2ZNTA 2ZYKA 5DT6A 3MPLA 1NH8A 2F7AA 5FTHA 3SEWA 1SBPA 1UIUA 3DP6A 5DTBA 4JBZA 1YCJA 3N6TA 2Q88A 2Z8EA 4RK9A 3QAXA 4YAHX 5H8SA 4E0WA 3G7WA 2PVUA 1YPNA 3Q28A 4R2FA 4THIA 1S50A 3RTWB 2FYIA 3MP8A 4GIZA 4OERA 1B4HA 3LSWA 5H8QA 4BLAA 4DXBA 2I4CA 2CZLA 3Q25A 1N3WA 3OO9A 1B6HA 4OWDA 4OFOA 1PC3A 1H45A 3MZ1A 4LONB 4G8MA 2NWJA 1TWYA 1BIYA 3MAMA 5DVFA 3BBRA 1B46A 3THIA 5L9SA 3N94A 1DTZA 2G29A 1P1QA 1NNFA 1OQGA 3IOTA 1A40A 4GWOA 1DOTA 1S7YA 2ONKE 1LAFE 1Y9UA 1QUIA 2I6EA 1UTBB 2O6AA 3U92A 5ICQA 5AA4B 5ISUA 4OYVA 1MM7A 1N04A 1QVSA 1D9YA 4GL8A 1URDA 3CR9A 2I4BA 1YTVA 2RC7A 3K6WA 4YICA 1JETA 2ESNA 1KWHA 1OVBA 3K6XA 2F35A 4R6YA 5ELVA 3QUFA 1MDP1 1JW5A 3PGFA 1MY0A 4KYDA 3UP9A 3FJMA 2D3IA 3VVDA 1SI1A 3MQ9A 4P11A 1LBBA 4EDPA 4F2QA 5CRYA 3CVGA 1WODA 1N7XA 2ZYMA 4N13A 1XOCA 2ONRA 4GQOA 3FXQA 5DEXB 3VLWA 1MPCA 4QFNA 1LB8A 3GLBA 3VLUA 2XHDA 3B6WA 2A5TA 4GL0A 4KCCA 3OENA 4U2RA 1UTHB 2Y7KA 2HEUA 2O7UA 2XXRA 1URSA 4TLMB 4ZZEA 1I69A 4F1UA 1NNTA 1NH7A 3CFXA 4C1TA 2I3WA 3S4UA 2NUVA 5FTIA 3HHGA 4ZEDA 2VP1A 2HAVA 3O6GA 4G68A 4MH5A 4XKPA 3PUVE 4NTLA 4TQUQ 3D4GA 4BDOA 4XKQA 2ZNSA 4YKPA 3FGSA 4F3GA 3UORA 4POWA 4RPOA 1IUDA 3PPNA 3PPPA 5DVJA 3SETA 1B0HA 3EPEA 3MBPA 3SDFA 2THIA 1SQYA 2BJJX 3K0VA 4OEUA 4OESA 4H8JA 4R2BA 4R6KA 1B3EA 3VDFA 1FW0A 3FJGA 1LGBC 3LBSA 4N07A 3KN3A 1FTJA 3HO7A 3MWBA 5M2VA 1IXHA 4LQ5A 2P2AA 2F6PA 3CFZA 3QK6A 3DP4A 3IX1A 1AOVA 4JSOA 3E4RA 3MP1A 4PE5B 3U72A 3U8QA 5A5XB 1B2HA 1JW4A 4WEDA 3SEXA 2PYYA 3OEKA 1US5A 2F7CA 2D5WA 3K1PA 4LUBA 4H8IA 1Q1KA 1TT1A 4NF5A 1OMPA 3PPOA 1B3GA 4JDFA 4OFLA 2H98A 3O66A 2Y7RA 4G2ZA 3S2VA 5DEXA 3EHTA 3UA8A 3ILTB 2OK2A 1B5IA 5FHNA 4YB7A 4ZEBA 2VHAA 3MVWA 5B70A 2Z8DA 2CMOA 3MVXA 1TXFA 5HPQA 1Y4TA 4U4XA 3KZGA 3PMWA 4I1DA 5EHMA 1ATGA 1LLSA 1S9TA 1XVXA 2DWHA 4P0GA 1P99A 1BP5A 2PT1A 2QS4A 4PFUA 5H8NA 4ELRA 5IKBA 4UA8A 4I62A 1VFEA 1EZ9A 1N0TA 2QMXA 3OO6A 3M8UA 1M5FA 3O28A 4O3BA 2PX1A 3H03A 3R6UA 1VE4A 1Y3QA 2FNCA 2R9JA 3RN8A 3T9XB 2GHAA 4R9FA 2XXHA 1ZU0A 2RC9A 2HZKA 4X1DA 5TU0A 5I59A 1FCKA 4U1OA 2FA7A 3IO6A 2NVUB 3IAZA 3O29A 3TTRA 4H5FA 4KFQA 4E0XA 2Q8JA 2REGA 3MZBA 3O97A 1BLFA 4MBPA 3KN8A 3LSFB 4LZ5A 1L5TA 3MPKA 2I3VA 4IO7A 3I3VA 3FUZA 1LFIA 3LR1A 4O3AA 1IXCA 4H5GA 4KYSA 4X48A 5KCJB 1FTLA 1AL3A 4IO6A 2X7QA 3MP6A 1J1NA 4G68B 3T66A 4HW8A 5K2YA 1URGA 3EF7A 4EF2A 1A7LA 3TTLA 3U1OA 1IIWA 1DPPA 4OTEA 4YMAA 4O3CA 2A5TB 4U4SA 4JB7A 4AQ4A 2RINA 2XX8A 5ITOA 5BUUA 1MPBA 3PUXE 4NF8A 2Y7WA 2DE3A 4DLDA 3U94A 5F7VA 3GBAA 1SYIA 3ONMA 4JSDA 5I59B 2QS1A 3K6UA 2H9BA 4ZECA 5I57A 4WEPA 1EZOA 1Y4CA 5AA2B 3PD9A 3PD8A 1A8FA 2QS3A 3HV1A 3O6IA 3K2DA 3CSGA 1NMUA 4OENA 4QSDA 1M5EA 3TKDA 1B32A 3OSQA 4FECA 1P1NA 2Z23A 3RY3A 2XD3A 5LOMA 3RPWA 1I6QA 2OLBA 2WKYA 3CFLA 4RJZA 4FAJA 3TEPA 3H3GA 4F29A 1QUJA 2O7IA 2VOZA 4RK2A 2XX9A 2X26A 3M3KA 3IORA 4I8CA 5DVIA 3A3CA 3LUYA 2P0SA 2Q9TA 4GVOA 3IOUA 1MG1A 3G3KA 2NOOA 3PUZE 2DSFA 5AA3A 2HZLA 4GLIA 4BDLA 1LB9A 2RCAA 3H7MA 3SEVA 3IK6B 5I56B 3TPAA 3R26A 1B7UA 1B9JA 2ABHA 4XXUA 4Q8RA 2DXRA 1DMBA 1NKXA 4XTCQ 1A55A 3K1NA 5FHMA 3VVEA 5EYFA 2QS2A 4IO5A 3KOSA 3W9WA 4EQBA 4I9DA 1H43A 3H6UA 1HSJA 3A09A 3T96B 4U1ZA 1Q35A 3RNNA 3V5AA 2E0SA 3N5LA 1FQBA 4IY5A 1GGGA 4LQ2A 2X7PA 4EQ9A 4NF5B 4F3PA 3OD7A 2O84X 2V84A 1R9QA 3C33A 4KQPA 4KD5A 2V93A 3T22A 3FXUA 4DE8A 4GFRA 2F34A 3FD3A 1BKAA 2VD3A 4PFYA 4F22A 1JQFA 5I57B 1NNKA 1JVXA 1LSTA 5I84A 2V3UA 3HSTA 1MRPA 3IL1B 1FTMA 4PETA 5EHSA 1NFTA 3USDA 4G4PA 5F1QA 3LC8A 1FTKA 3QXMA 1IQ7A 4RXLA 5CBSA 4HCYA 4KYEA 3VLVA 1MQDA 1M5CA 1H3DA 2DE4A 4K3FA 1Y1ZA 2F7BA 3IB0A 2XXTA 2DVCA 1ZJLA 1OVTA 3MVYA 5B7DA 3VV5A 5CMKA 2XXYA 3I5OA 4ZEKA 4YKJA 5I58A 4OVJA 4R6HA 4KCDA 4RPNA 1O7TA 2YLNA 4Q30B 5KCJA 4ZEFA 2QPQA 1SDXA 1OIBA 3W9VA 4ONYA 3AXFA 2F36A 3MW0A 4U21A 1B1XA 4ELQA 5HBCA 4FATA 4POXA 1B4ZA 3LSLA 1QJMA 2ONSA 1UTHA 1Z7ME 4NF6A 2O69A 4OHNA 5H8HA 5I2NA 3Q26A 3SESA 3MUQA 1MQHA 3SEUA 3FVKA 5AA4A 2PT2A 3OELA 1GVCA 1LFHA 2V25A 1NL5A 1QULA 2I58A 2DQVA 3H4ZA 2HAUA 3FASA 2DWIA 3C32A 4RA1A 2VD2A 4UACA 4NMYA 2OWTA 2Q2AA 3C9HA 1ZKBA 4QSCA 5TPAA 4LVQA 4EUOA 1Z7NE 1FQDA 4R74A 5L9MA 2XD2A 4ESWA 2I49A 5H8NB 5H8QB 1O64A 1XS5A 2LAOA 3H6WA 4MF3A 3KN7A 2ALUA 4FEDA 3T9VA 1MXYA 2I0CA 4F1VA 1PDAA 2NXOA 4H6DA 4PP0A 1T0KA 4NF4B 3SKPA 2ZYNA 3FVGA 1MXXA 1O63A 4IO3A 3K00A 1XC1A 4G68C 4QSEA 4TOZA 1CE2A 4AB6A 3LSXA 2XX7A 1ZBMA 4C1UA 3O2AA 3V89B 4PQJA 1B3HA 5KDTA 4FIMA 2O68A 1B3LA 2AL4A 2F6GA 2DYXA 2HCAA 2V3TA 4KPTA 1A8EA 1JW1A 2GHBA 4H67A 5CI5A 4GD5A 1QKAA 2GFEA 1ZTYA 3A3UA 3B6TA 3FIRA 4BDMA 2RKMA 1B58A 3K4UA 3PUWE 3MJNA 4YB6A 3FXRA 3EN3A 3RT8A 3IJOB 3KBRA 4LZ7A 4XKRA 4JWOA 4ZEIA 4R75A 4ISUA 1SW1A 2XXIA 3C36A
chains in the Genus database with same CATH superfamily
4QHQA 1UIVA 1XVYA 3CG3A 1R1NA 2F78A 4F1YA 2UVHA 5I2KA 1D9VA 3UK4A 1N76A 1SW5A 3P7IA 4I3YA 5CC2A 3TDJA 3ZKLA 2OZZA 3C34A 4NX1A 4NEDA 2ZYOA 1ZLQA 5J1DA 2UVJA 1FQCA 2UYEA 1II5A 4NWCA 3CI8A 3M3LA 5HM4B 5H8FB 1MQIA 2RF1A 1B5JA 3OSRA 3G3HA 4FORA 3FVOA 2HHMA 3HFUA 5KDTB 1DTGA 1POY1 3QSLA 1NNPA 4ZS9A 3RGYA 1FQAA 1RYXA 1M5BA 3CRBA 3PMXA 3ZS6A 2XWIA 3BIGA 3TYHA 2HXWA 1VDWA 3GXAA 2H5YA 3BKIB 5CMCA 3ROJA 2O1MA 4GOTA 2H4IA 1EYIA 5ESYA 4LZ8A 3MVZA 4IB2A 2B4LA 2Z8FA 1P1UA 1ZIUA 1MXWA 4Q5TA 3TCHA 1FBPA 1FPDA 1UQWA 1NUYA 1NV6A 5I2NB 4G8NA 4QFLA 3G3GA 3S9EA 3PU5A 4F3BA 3TZAA 3G3FA 3JYRA 1US4A 2E1SA 2QJEA 4FJPA 4OVRA 1MY1A 4RYAA 4F3SA 3TUSA 3DP8A 1B7ZA 2DXYA 4P47A 3DLNA 3H06B 3VXBA 2GRVA 5L8DA 5FHOA 3PUYE 4HS7A 2DOJA 1PEBA 4HCWA 3KSXA 4Z7EA 4YU0A 1Y20A 4GXSB 1Y3NA 4NQ8A 4DCXA 3PTYA 2IA4A 4KXPA 1POTA 1IITA 1P1WA 1YAEA 1MXVA 2XXVA 2XXUA 2AL5A 2HQ0A 5A5XA 1NV3A 2Q89A 2Y5KA 4OXVA 1FTOA 3JZJA 2YJPA 1FBCA 1RYOA 4NF0A 3ECRA 1RDXA 3H6VA 3PPQA 1USYE 2PMSA 3SEWA 5DTBA 1YCJA 3IFAA 3QAXA 4RK9A 1FSAA 1YPNA 4R2FA 3MP8A 4GIZA 4OERA 3LSWA 5H8QA 1N3WA 1B6HA 4OWDA 1H45A 4DI4B 1BIYA 5ET5A 3MAMA 1B46A 2WYKA 1NNFA 3IOTA 1A40A 4JSDA 1S7YA 2ONKE 2I6EA 3U92A 5ICQA 1K9ZA 4OYVA 1N04A 1D9YA 3CR9A 2I4BA 5ELVA 3QUFA 1MDP1 1JW5A 1MY0A 4P11A 1G0HA 3CVGA 2ZYMA 2ONRA 1MPCA 3GLBA 3B6WA 1UTHB 4N15A 4ZZEA 4TLMB 1URSA 4C1TA 5FTIA 3HHGA 4ZEDA 3PUVE 2ZNSA 5DW8A 3T1BA 3UORA 3PPNA 5DVJA 3K0VA 4OESA 3FJGA 1LGBC 3LBSA 1FTJA 2P2AA 2F6PA 3QK6A 3DP4A 3IX1A 3MP1A 3U8QA 2D5WA 3K1PA 4NF5A 1TT1A 1NV1A 2Y7RA 4G2ZA 3S2VA 1IMBA 2OK2A 1B5IA 1JP4A 3MVWA 3MVXA 1TXFA 3KZGA 1ATGA 1S9TA 2DWHA 1P99A 5H8NA 4UA8A 1EZ9A 2QMXA 2PX1A 3H03A 3R6UA 2FNCA 1Y3QA 1ZU0A 2HZKA 5TU0A 2NVUB 4H5FA 2WX9A 4LZ5A 4GBWA 3FUZA 1IXCA 4H5GA 5KCJB 1FTLA 1A7LA 4MMPA 3U1OA 4YMAA 4O3CA 4U4SA 4JB7A 4AQ4A 5ITOA 2DE3A 3U65A 2QS1A 2FVZA 4ZECA 1A8FA 3HV1A 4O94A 3K2DA 1M5EA 1P1NA 2Z23A 3RY3A 2XD3A 4RJZA 4RK2A 5DVIA 2P0SA 3IOUA 1MG1A 5AA3A 4GLIA 3H7MA 2RCAA 3SEVA 2HXRA 3IK6B 4Q8RA 1NKXA 4XTCQ 3K1NA 5FHMA 4IO5A 3KOSA 3A09A 3RNNA 4JVCA 1GGGA 4OVQA 4EQ9A 4F3PA 2O84X 2V84A 1R9QA 4KQPA 2V93A 4GFRA 4F22A 2ZZXA 1JVXA 1LSTA 5I84A 3KC1A 1FTMA 5EHSA 1NFTA 3LC8A 4PGNA 2DE4A 2F3DA 3MVYA 5EQ8A 2XXYA 4OVJA 1O7TA 5KCJA 2QPQA 4ONYA 5HBCA 4POXA 1Z7ME 4NF6A 1LFHA 2PT2A 1NL5A 4I3EA 3FASA 2VD2A 4NMYA 2OX3A 4EUOA 5L9MA 5H8NB 1XS5A 2ALUA 4FEDA 1MXYA 2I0CA 4F1VA 1PDAA 5I7IA 3SKPA 2ZYNA 1O63A 2OWZA 4N6DA 2XX7A 1ZBMA 4C1UA 4PF8A 5AA2D 4QFNA 2CZIA 2DYXA 1JW1A 1ZTYA 2VT5A 3B6TA 1B58A 3FXRA 3EN3A 4R75A 4ISUA 2XXIA 3C36A 2XXPA 3IJXB 1MXUA 3RUMA 4ELPA 2REJA 2ZMBA 4YKIA 5CMMA 3N26A 4WKMA 2GH9A 2YPNA 4F31B 4L17A 1EU8A 2M8CA 4R73A 1FPKA 1DK4A 3ILUB 2B3FA 3OOAA 3CG1A 5I58B 2FHYA 4GXAA 3UIFA 4TLLB 3E13X 3E79A 3NOHA 4ZE8A 3Q27A 3KJTA 4R72A 3BFTA 2O51A 3O6HA 3TTKA 2DDKA 2A5SA 3GBBA 2Y7IA 2G93A 4EF1A 5ET8A 4EQ7A 1INPA 4MFIA 2QSXA 3VFJA 1I6BA 4IY6A 5IZ1A 3HN0A 4FE8A 3S9NC 3KGCA 1FBFA 2ZXTA 4XKNA 4RY1A 3IOWA 3EHUA 4PC9A 2L5VA 3FBPA 3D4CA 1FPBA 1RDYA 5LDZA 3U93A 4NE4A 4DIGA 3C4MA 2Y84A 1LBVA 1MM6A 5AA2A 2Z22A 5CMBA 3TQLA 3G3JA 1ELJA 2ANJA 4ND9A 3TELA 4F18A 3OMBA 1R9LA 5ICTA 3PMVA 4QFPA 4OVPA 1XHYA 3IB2A 4QFOA 3EQ1A 1AMFA 3QIMA 5I3SA 2R71A 4IO2A 2OBGA 1CNQA 3RT6B 1TFAA 2VGQA 4H0WA 1IXGA 1MY2A 3FVNA 4BDRA 4GWSA 1JEVA 3PV0E 4QBAA 5FBPA 3IOVA 4QFKA 4MX6A 3TODA 4H46A 1PBQA 4DDDA 3HPIA 4AS4A 5I56A 1SW4A 1NV4A 2PBWA 4IO4A 4NF6B 3H6TA 4DXCA 4Q0CA 3TCGA 2XWOA 2QVVA 4DCYA 2JJKA 2DP8A 2ZNUA 4JWXA 1MQJA 1NV5A 1FBDA 1B52A 3T0JA 4HTGA 1XI6A 2QRYA 1VSOA 4OZ9A 2RCBA 1N84A 4PFRA 1LBYA 4MNPA 3S9MC 5T3JA 3L6HA 3TTNA 1D3KA 4OFJA 1JNFA 3B50A 2ZNTA 2ZYKA 2F7AA 1SBPA 3DP6A 2V4CA 2Q88A 4YAHX 4E0WA 3G7WA 4IR8A 3RTWB 4N91A 2FYIA 3BIHA 4PBHA 4OFOA 1TWYA 5L9SA 3N94A 2G29A 1OQGA 3ZSFA 4GWOA 1QUIA 3RYDA 4GL8A 1FBGA 2RC7A 3K6WA 4YICA 1JETA 2ESNA 3FJMA 2Q8MA 1WODA 1LB8A 2XHDA 1I69A 1G0IA 4XKQA 4F3GA 3PPPA 1B0HA 3SDFA 2THIA 2BJJX 4OEUA 3LUZA 1B3EA 3HO7A 3E4RA 5A5XB 4WEDA 2PYYA 3OEKA 1Q1KA 1B3GA 4JDFA 4OFLA 5IGAA 1D9QA 5EQ7A 5B70A 2CMOA 2QFLA 1Y4TA 3PMWA 5EHMA 1NV0A 4ELRA 3M8UA 1M5FA 3SESA 3T9XB 3RN8A 3EKIA 5I59A 3IO6A 3O29A 3TTRA 4LN5A 3O97A 1KA1A 1BLFA 3KN8A 1L5TA 3LR1A 4KYSA 3IFCA 3MP6A 5K2YA 3EF7A 4GWWA 1IIWA 1DPPA 2RINA 3U94A 5F7VA 3GBAA 5I59B 4N17A 1Y4CA 3PD9A 2QS3A 3CSGA 5LOMA 1I6QA 2WKYA 3CFLA 2HPGA 3TEPA 2VOZA 2O7IA 3IORA 2DSFA 2HZLA 5I56B 4PFBA 3R26A 2DXRA 1DMBA 3VVEA 4P1EA 4EQBA 1H43A 1Q35A 3V5AA 4I40A 2E0SA 3T22A 1EYKA 4PFYA 5I57B 2V3UA 1FRPA 3USDA 4G4PA 1IQ7A 4KYEA 4K3FA 1M5CA 1H3DA 2F7BA 3IB0A 2DVCA 1YYZA 3I5OA 4YKJA 4R6HA 4KCDA 4Q30B 2FIEA 5I5PA 1FPFA 3W9VA 1OIBA 4ELQA 3AXFA 2F36A 3MW0A 4U21A 5IZ3A 4FATA 1QJMA 3Q26A 3SEUA 2V25A 4RA1A 1LBZA 3C32A 4UACA 1ZKBA 4LVQA 1Z7NE 1IMDA 1FQDA 4MF3A 3H6WA 1MXXA 1FJ9A 4TOZA 4PGPA 3V89B 4FIMA 2Q8JA 2HCAA 4KPTA 2VPOA 4GD5A 4H45A 1NI9A 2GFEA 3MJNA 4YB6A 3IJOB 4ZEIA 3TAJA 3JV9A 1DSNA 4KI0E 4YKKA 4GWZA 2WBBA 4NWDA 3F11A 4G8HA 4NF4A 4FEBA 3V8XB 3M3FA 5IAIA 1IEJA 3EHSA 2R6GE 1P1OA 1A99A 4U23A 5BWJA 1USYH 4U22A 3SEYA 1FTAA 3FV1A 1MH4A 5JEIA 3C35A 3C31A 3IO4A 2KR0A 3RTFB 4ZDMA 2KLFA 3VVFA 2QVUA 3KEIA 4MLQA 4KR5A 4DZ1A 3MC2A 2UVGA 5TP9A 4PDHA 4JXIA 4P1LA 5EYGA 2I48A 1UTBA 2F3BA 3RLFE 1NUZA 4YZZA 1BTJA 1RKMA 3FV2A 1DPEA 1FBEA 1MY4A 3E3KA 1IMEA 4PDDA 1HSLA 1GV8A 2FIXA 4H1XA 5H8FA 1MS7A 1B05A 1LCFA 3KC0A 3IR1A 2IEEA 5K2XA 3OEMA 2QL3A 2AIXA 3OXNA 4MIJA 1PB9A 2CEXA 3VE1B 1AH5A 2PFYA 3UN6A 3TMGA 5JK4A 1SD3A 3B7DA 1FBHA 1HSEA 1LAGE 1NV2A 2AYSA 3A29A 3DELB 3W15C 1Y1MA 4XEQA 1B51A 1JEUA 4X8RA 3K01A 3HHFA 5DYHA 4RNSA 1TFDA 2QMWA 1MPDA 3K1MA 5IZZA 2Q2CA 3R7XA 1OLCA 4X9TA 2DWJA 1PB8A 1LAHE 4JVDA 4OVSA 2DVZA 5ITPA 3QYTA 4ESXA 1LAXA 1GTKA 3V83A 5JTYA 4MNIA 3K6VA 1EZPA 4C0RA 2OJTA 2UXAA 3T9HB 3N6UA 3TFLA 2XXXA 1D4NA 1MDQA 1FQFA 1M5DA 2CEYA 2RC8A 5TP9B 1B3FA 5H8HB 4XIGQ 1QUKA 2Y7PA 4YMBA 1A54A 3B6QA 2OWSA 4PFWA 4DXUA 1OQHA 2DWAA 1B7HA 3FZVA 4BDNA 1FQEA 1PB7A 2P3NA 4JWYA 1H76A 3E9XA 1QW0A 1LFGA 1R6ZA 4R9GA 3BFUA 4OMBA 3CHGA 1CB6A 4ZE9A 3FATA 4MHFA 4KHZE 4O7IA 4OEVA 4OQOA 4BDQA 3FXBA 2F97A 5DT6A 1NH8A 4JBZA 3N6TA 2Z8EA 5H8SA 4DXBA 4BLAA 2I4CA 2CZLA 3Q25A 3OO9A 4PAIA 4G8MA 2NWJA 4PAKA 5DVFA 1P1QA 4MH5A 4XKPA 4AB5A 2P3VA 1LAFE 2Q74A 4MEVA 1QVSA 1URDA 1YTVA 2KQZA 2F35A 4GX6A 3PGFA 2D3IA 3VVDA 3MQ9A 1LBBA 4EDPA 4F2QA 4N13A 2PFZA 4GQOA 3FXQA 3RPLB 5EQAA 3VLUA 4GL0A 4KCCA 3OENA 4U2RA 2XXRA 1NNTA 4GWXA 2BJIA 2I3WA 2GQ1A 3O6GA 4G68A 4NTLA 3D4GA 4BDOA 4YKPA 3FGSA 1IUDA 3SETA 4OVTA 4MJOA 5A5LA 4R6KA 3VDFA 4N07A 3KN3A 5M2VA 4LQ5A 1AOVA 1FPJA 3CFZA 4HE0A 1B2HA 2MKZA 2QVRA 4H8IA 4GWUA 3O66A 3ISPA 3EHTA 3ILTB 4ZEBA 2VHAA 2Z8DA 5HPQA 4U4XA 1LLSA 4UABA 4P0GA 4PFUA 2PT1A 4I62A 3O28A 4O3BA 1VE4A 2R9JA 4R9FA 2RC9A 4X1DA 4U1OA 4E0XA 2REGA 3MPKA 3I3VA 4IO6A 2X7QA 4OANA 3T66A 1J1NA 4MAGA 2B4MA 1URGA 1LBXA 3TTLA 2A5TB 2XX8A 5BUUA 3PUXE 2Y7WA 3ONMA 2H9BA 1EYJA 3PD8A 2FBPA 4QSDA 1NMUA 4G61A 1B32A 4FECA 2OLBA 1RDZA 4FAJA 4QXDA 2XX9A 2X26A 3LUYA 2NOOA 3PUZE 4P9KA 1LB9A 4BDLA 1B9JA 4MNCA 1IMCA 1FQBA 3MSTA 4LQ2A 4HE1A 1IMFA 3C33A 1NUXA 4KD5A 3FXUA 4DE8A 2F34A 1BKAA 2VD3A 1NNKA 4PCDA 1DCUA 2XXTA 1ZJLA 1OVTA 4P56A 2YLNA 3KBZA 4PE3A 1B1XA 3LSLA 2ONSA 5I2NA 1MQHA 3FVKA 2DQVA 1DBZA 2DWIA 2Q2AA 3C9HA 5TPAA 5H8QB 4PF6A 3T9VA 4H6DA 4P8BA 1T0KA 4IO3A 3K00A 4G68C 4QSEA 1CE2A 1YZ0A 5J16A 4NN3A 2O68A 2V3TA 2F6GA 4JVIA 5CI5A 4H67A 1QKAA 4BDMA 3K4UA 5EYHA 4LZ7A 4XKRA 4JWOA 1IZ1A 3SERA 3OO8A 1N3XA 1B1HA 1I6AA 1B5HA 3L6GA 2V3QA 1OLAA 4Z0IA 4N8YA 5TPAB 4LP2B 5IZ3B 2D21A 2F5XA 3KOTA 4IGTA 4WXJA 4ZZAA 4M1VA 4QF9A 2PCRA 3CIJA 4ELOA 1AIVA 4EXKA 1LBCA 1LCTA 1YXIA 5KZTA 1H44A 4HE2A 2B3BA 4OA4A 3TPAA 3DM0A 3T9UA 5I2KB 2WEFA 1NV7A 4N6PA 4LA9A 3QUJA 3ODBA 4NG7A 4PFTA 4PFIA 1XT8A 1JVYA 2ZZVA 2W7YA 2XXQA 1ZMGA 5AE4A 1SW2A 1AWBA 3RQTA 2R8TA 2F8DA 4NGUA 3I6VA 3K02A 3FJ7A 5ET7A 2DE2A 3WAEA 1IXIA 4F39A 1VR5A 1SVXB 1PBPA 4O8MA 3TQWA 4GF8A 4GWYA 2O1LA 3HCQA 3CSBA 4ECFA 1WVJA 3TCFA 1VFDA 2WYPA 3KG2A 2HFBA 2DS9A 2XXKA 3ZKKA 2I0BA 1F9BA 1B0LA 5CBRA 4XFEA 1IMAA 1N7WA 1EH3A 2UVIA 1Y3PA 3O9PA 1QKBA 5KDTA 1MH3A 3T93B 2P1SA 5JTYB 4G77A 3OO7A 4MLVA 2CZKA 4QRZA 2XXWA 4LATA 3PPRA 4IGRA 4M4GA 4F2OA 2OCUA 1MQGA 2H99A 1B40A 2H25A 3MZ9A 1WDNA 2UYFA 4N4UA 3SZPA 3WAFA 1ANFA 3KJ7A 4NAPA 3E78A 3S9LC 1MY3A 4OETA 1GR2A 1MXZA 3Q29A 3G3IA 1SI0A 3IB1A 4YB5A 5CMKA 2XWVA 3KFMA 4P0IA 3TTMA 4X1BA 4GRKA 5CM6A 4NF8B 1SYHA 2B65A 3UGWA 3VXCA 4GX4A 5AA1A 5L9OA 4H65A 3KSJA 3MPLA 5FTHA 1UIUA 3Q28A 2PVUA 4THIA 1S50A 1B4HA 4X04A 3RPLA 3D1RA 1PC3A 3MZ1A 4LONB 3THIA 3BBRA 3GYYA 1DTZA 4F19A 1DOTA 1Y9UA 2O6AA 3MYUA 1UTBB 5AA4B 5ISUA 1MM7A 3K6XA 1KWHA 1OVBA 4R6YA 1K9YA 4KYDA 3UP9A 1SI1A 5CRYA 1N7XA 5DEXB 1XOCA 4MCOA 3VLWA 2A5TA 2Y7KA 2HEUA 2O7UA 4F1UA 1NH7A 3CFXA 3S4UA 2NUVA 2VP1A 2HAVA 4TQUQ 4POWA 4RPOA 4N81A 3EPEA 3MBPA 1SQYA 4H8JA 4R2BA 1FW0A 3MWBA 1IXHA 3QMFA 4JSOA 4PE5B 3U72A 1JW4A 5IM2A 3SEXA 1LBWA 1QGXA 1US5A 2F7CA 4LUBA 1OMPA 3PPOA 2H98A 4AS5A 5DEXA 3UA8A 5FHNA 4YB7A 4I1DA 1XVXA 1BP5A 2QS4A 5IKBA 1VFEA 1N0TA 3OO6A 1FPLA 2GHAA 2XXHA 1FCKA 2FA7A 3IAZA 4P3LA 4KFQA 1BK4A 3MZBA 4MBPA 3LSFB 5F24A 2I3VA 4IO7A 1LFIA 2Y5LA 4O3AA 4X48A 1AL3A 1FJ6A 4G68B 3LV0A 4HW8A 4EF2A 4OTEA 4N8GA 1MPBA 4NF8A 4GX3A 4DLDA 1SYIA 3K6UA 5I57A 1EZOA 5AA2B 5LTCA 4N6KA 3O6IA 4OENA 2WBDA 3TKDA 4HXVA 4FBPA 3OSQA 1FPIA 3RPWA 1LEVA 3H3GA 4F29A 1QUJA 3M3KA 4I8CA 3A3CA 2Q9TA 4GVOA 4PBQA 4PTKA 3G3KA 1B7UA 4XXUA 2ABHA 1SPIA 1A55A 5EYFA 2QS2A 2CZHA 3W9WA 4I9DA 3H6UA 1HSJA 3T96B 4U1ZA 3N5LA 4IY5A 2X7PA 4NF5B 3OD7A 3FD3A 1JQFA 3HSTA 1MRPA 3IL1B 4PETA 4PAFA 5F1QA 5EQ9A 2XWKA 1FTKA 3QXMA 4RXLA 5CBSA 4HCYA 3VLVA 1MQDA 1Y1ZA 5B7DA 4GBVA 3VV5A 4NHBA 4ZEKA 5I58A 4RPNA 4ZEFA 1SDXA 2ZZWA 1B4ZA 1UTHA 3B8BA 2O69A 4OHNA 5H8HA 1KA0A 3MUQA 1Q9DA 5AA4A 3OELA 1GVCA 1QULA 3H4ZA 2I58A 1FPGA 2HAUA 1KZ8A 4DI3D 2OWTA 4QSCA 4R74A 5ET6A 2XD2A 4ESWA 2I49A 1O64A 2LAOA 2VPNA 3KN7A 2NXOA 4PP0A 4NF4B 2XA5A 3FVGA 1XC1A 4AB6A 3LSXA 3O2AA 4PQJA 1B3HA 1FPEA 4EXLA 1B3LA 4WEPA 1NUWA 2AL4A 4XF5A 1A8EA 2GHBA 3A3UA 3FIRA 2RKMA 3PUWE 4O7MA 3RT8A 3KBRA 1SW1A 3GZGA
chains in the Genus database with same CATH topology
3TAJA 2XXPA 1DSNA 3IJXB 1MXUA 3JV9A 4KI0E 4QHQA 4YKKA 3RUMA 1IZ1A 1UIVA 1XVYA 3CG3A 4NWDA 3F11A 4G8HA 4ELPA 3TUSA 1R1NA 2F78A 2REJA 4NF4A 3OO8A 1N3XA 3SERA 4F1YA 2UVHA 1B1HA 4FEBA 1I6AA 2ZMBA 3M3FA 5CMMA 3N26A 4YKIA 3V8XB 5I2KA 5IAIA 1IEJA 1B5HA 3L6GA 3EHSA 1D9VA 2R6GE 1N76A 1P1OA 3UK4A 1SW5A 2V3QA 1OLAA 3P7IA 4WKMA 2GH9A 2YPNA 1A99A 4U23A 4Z0IA 4LP2B 5TPAB 3TDJA 4F31B 3ZKLA 5CC2A 2D21A 2OZZA 2F5XA 3C34A 1EU8A 4L17A 2M8CA 4R73A 1USYH 4U22A 5BWJA 3SEYA 3KOTA 4IGTA 4NEDA 3ILUB 4WXJA 3FV1A 2ZYOA 2B3FA 1MH4A 3OOAA 3CG1A 1ZLQA 4ZZAA 5I58B 5J1DA 4M1VA 2UVJA 5JEIA 3C35A 4QF9A 4GXAA 3C31A 3UIFA 4TLLB 1FQCA 3IO4A 3RTFB 2UYEA 3E13X 4ZDMA 2KLFA 4F19A 3VVFA 1II5A 3CIJA 4NWCA 3CI8A 4ELOA 1AIVA 3M3LA 3KEIA 4EXKA 5HM4B 4ZE8A 1LBCA 1LCTA 4MLQA 3Q27A 4KR5A 3KJTA 4DZ1A 1H44A 3MC2A 5KZTA 2B3BA 2UVGA 1MQIA 5H8FB 2RF1A 4R72A 1B5JA 5TP9A 3BFTA 2O51A 3DM0A 3OSRA 4JXIA 5I2KB 3T9UA 3G3HA 2I48A 3O6HA 3TTKA 1UTBA 4FORA 3RLFE 3FVOA 4N6PA 4YZZA 1BTJA 1RKMA 4LA9A 4EXLA 3QUJA 5KDTB 2A5SA 3FV2A 3GBBA 3ODBA 2Y7IA 1DPEA 1DTGA 2G93A 4EF1A 4PFTA 1MY4A 1POY1 3QSLA 1NNPA 3E3KA 4EQ7A 1XT8A 1JVYA 3GZGA 4MFIA 4ZS9A 2W7YA 2QSXA 2XXQA 1ZMGA 5AE4A 3ZSFA 3VFJA 1HSLA 3RGYA 1SW2A 1I6BA 4IY6A 1FQAA 1RYXA 3RQTA 3HN0A 1M5BA 1GV8A 3CRBA 4FE8A 3PMXA 4H1XA 1MS7A 5H8FA 3ZS6A 3S9NC 1B05A 1LCFA 3KGCA 3TYHA 2F8DA 2ZXTA 3IR1A 2IEEA 4XKNA 5K2XA 4RY1A 3IOWA 2HXWA 3EHUA 3OEMA 3I6VA 3K02A 2QL3A 2AIXA 3FJ7A 3GXAA 3OXNA 2H5YA 3D4CA 3BKIB 1PB9A 5CMCA 3VE1B 2O1MA 4GOTA 3U93A 4NE4A 4DIGA 3C4MA 2DE2A 2H4IA 2Y84A 3WAEA 1IXIA 4F39A 1VR5A 1SVXB 1PBPA 1AH5A 3TQWA 4LZ8A 3UN6A 3MVZA 4IB2A 4GF8A 1MM6A 3TMGA 5JK4A 1SD3A 5AA2A 2Z8FA 1P1UA 2Z22A 5CMBA 3B7DA 2O1LA 3HCQA 1ZIUA 3TQLA 3G3JA 1HSEA 1ELJA 3CSBA 1LAGE 1MXWA 2AYSA 1WVJA 2ANJA 4ND9A 4Q5TA 3TCHA 3TCFA 3TELA 4ECFA 3DELB 3W15C 1VFDA 4F18A 3OMBA 1R9LA 1Y1MA 1UQWA 3KG2A 4G8NA 3PMVA 5I2NB 4QFLA 4QFPA 5ICTA 1XHYA 3IB2A 3G3GA 3S9EA 2HFBA 2DS9A 3PU5A 1B51A 1JEUA 4QFOA 3K01A 3ZKKA 3HHFA 5DYHA 4RNSA 3EQ1A 1AMFA 1TFDA 3TZAA 2QMWA 4F3BA 1MPDA 2I0BA 3K1MA 3G3FA 3QIMA 1F9BA 2R71A 3JYRA 1US4A 1B0LA 2E1SA 2Q2CA 3R7XA 5CBRA 1OLCA 4X9TA 2DWJA 1PB8A 1LAHE 2QJEA 4FJPA 1N7WA 2DVZA 5ITPA 3QYTA 4ESXA 1EH3A 2UVIA 4IO2A 2OBGA 1Y3PA 1LAXA 3O9PA 1MY1A 1QKBA 3RT6B 1TFAA 1MH3A 2VGQA 4H0WA 1GTKA 1IXGA 3DP8A 1B7ZA 4RYAA 3T93B 4F3SA 2DXYA 1MY2A 2P1SA 3V83A 3DLNA 3H06B 3VXBA 5JTYA 2GRVA 5JTYB 3FVNA 4G77A 3OO7A 4MLVA 4BDRA 4AB5A 3K6VA 4QRZA 2XXWA 5L8DA 5FHOA 1JEVA 3PUYE 2DOJA 3PPRA 3PV0E 4HS7A 4LATA 3IOVA 4QFKA 4IGRA 1PEBA 4HCWA 1EZPA 4C0RA 3KSXA 4Z7EA 2OJTA 2UXAA 4M4GA 3TODA 4F2OA 3T9HB 3N6UA 3TFLA 1PBQA 2XXXA 4DDDA 3HPIA 1D4NA 1MDQA 1Y20A 4YU0A 2OCUA 1FQFA 1M5DA 4GXSB 1Y3NA 1SW4A 1MQGA 2RC8A 5I56A 5TP9B 1B3FA 2PBWA 2H99A 4IO4A 4NF6B 3H6TA 5H8HB 4DCXA 4DXCA 1B40A 2H25A 2IA4A 4XIGQ 1QUKA 2Y7PA 4Q0CA 3MZ9A 1WDNA 2UYFA 3TCGA 4YMBA 1POTA 1IITA 1A54A 3WAFA 3B6QA 1P1WA 2OWSA 4PFWA 4DXUA 1YAEA 1MXVA 1ANFA 1OQHA 3KJ7A 2DWAA 4DCYA 3S9LC 2DP8A 2XXVA 2XXUA 1B7HA 1MY3A 2ZNUA 3FZVA 4JWXA 1MQJA 4BDNA 1FQEA 1PB7A 2AL5A 4JWYA 1H76A 3E9XA 1QW0A 1LFGA 1R6ZA 4OETA 1GR2A 1MXZA 3Q29A 4R9GA 3G3IA 1B52A 1SI0A 3IB1A 2HQ0A 4HTGA 4YB5A 5A5XA 2Q89A 3BFUA 4OMBA 3KFMA 4OXVA 4P0IA 1FTOA 2QRYA 1VSOA 1CB6A 3TTMA 3JZJA 5AA2D 4X1BA 2YJPA 4ZE9A 4GRKA 4OZ9A 2RCBA 1RYOA 3FATA 1N84A 5CM6A 3ECRA 4NF8B 3S9MC 1SYHA 3H6VA 4KHZE 3L6HA 2B65A 4OEVA 3TTNA 4OQOA 3UGWA 3VXCA 1D3KA 3PPQA 5AA1A 4BDQA 4OFJA 2F97A 5L9OA 1USYE 4H65A 2PMSA 1JNFA 3KSJA 2ZNTA 2ZYKA 5DT6A 3MPLA 1NH8A 2F7AA 5FTHA 3SEWA 1SBPA 1UIUA 3DP6A 5DTBA 4JBZA 1YCJA 3N6TA 2Q88A 2Z8EA 4RK9A 3QAXA 4YAHX 5H8SA 4E0WA 3G7WA 2PVUA 1YPNA 3Q28A 4R2FA 4THIA 1S50A 3RTWB 2FYIA 3MP8A 4GIZA 4OERA 1B4HA 3LSWA 5H8QA 4BLAA 4DXBA 2I4CA 2CZLA 3Q25A 1N3WA 3OO9A 1B6HA 4OWDA 4OFOA 1PC3A 1H45A 3MZ1A 4LONB 4G8MA 2NWJA 1TWYA 1BIYA 3MAMA 5DVFA 3BBRA 1B46A 3THIA 5L9SA 3N94A 1DTZA 2G29A 1P1QA 1NNFA 1OQGA 3IOTA 1A40A 4GWOA 1DOTA 1S7YA 2ONKE 1LAFE 1Y9UA 1QUIA 2I6EA 1UTBB 2O6AA 3U92A 5ICQA 5AA4B 5ISUA 4OYVA 1MM7A 1N04A 1QVSA 1D9YA 4GL8A 1URDA 3CR9A 2I4BA 1YTVA 2RC7A 3K6WA 4YICA 1JETA 2ESNA 1KWHA 1OVBA 3K6XA 2F35A 4R6YA 5ELVA 3QUFA 1MDP1 1JW5A 3PGFA 1MY0A 4KYDA 3UP9A 3FJMA 2D3IA 3VVDA 1SI1A 3MQ9A 4P11A 1LBBA 4EDPA 4F2QA 5CRYA 3CVGA 1WODA 1N7XA 2ZYMA 4N13A 1XOCA 2ONRA 4GQOA 3FXQA 5DEXB 3VLWA 1MPCA 4QFNA 1LB8A 3GLBA 3VLUA 2XHDA 3B6WA 2A5TA 4GL0A 4KCCA 3OENA 4U2RA 1UTHB 2Y7KA 2HEUA 2O7UA 2XXRA 1URSA 4TLMB 4ZZEA 1I69A 4F1UA 1NNTA 1NH7A 3CFXA 4C1TA 2I3WA 3S4UA 2NUVA 5FTIA 3HHGA 4ZEDA 2VP1A 2HAVA 3O6GA 4G68A 4MH5A 4XKPA 3PUVE 4NTLA 4TQUQ 3D4GA 4BDOA 4XKQA 2ZNSA 4YKPA 3FGSA 4F3GA 3UORA 4POWA 4RPOA 1IUDA 3PPNA 3PPPA 5DVJA 3SETA 1B0HA 3EPEA 3MBPA 3SDFA 2THIA 1SQYA 2BJJX 3K0VA 4OEUA 4OESA 4H8JA 4R2BA 4R6KA 1B3EA 3VDFA 1FW0A 3FJGA 1LGBC 3LBSA 4N07A 3KN3A 1FTJA 3HO7A 3MWBA 5M2VA 1IXHA 4LQ5A 2P2AA 2F6PA 3CFZA 3QK6A 3DP4A 3IX1A 1AOVA 4JSOA 3E4RA 3MP1A 4PE5B 3U72A 3U8QA 5A5XB 1B2HA 1JW4A 4WEDA 3SEXA 2PYYA 3OEKA 1US5A 2F7CA 2D5WA 3K1PA 4LUBA 4H8IA 1Q1KA 1TT1A 4NF5A 1OMPA 3PPOA 1B3GA 4JDFA 4OFLA 2H98A 3O66A 2Y7RA 4G2ZA 3S2VA 5DEXA 3EHTA 3UA8A 3ILTB 2OK2A 1B5IA 5FHNA 4YB7A 4ZEBA 2VHAA 3MVWA 5B70A 2Z8DA 2CMOA 3MVXA 1TXFA 5HPQA 1Y4TA 4U4XA 3KZGA 3PMWA 4I1DA 5EHMA 1ATGA 1LLSA 1S9TA 1XVXA 2DWHA 4P0GA 1P99A 1BP5A 2PT1A 2QS4A 4PFUA 5H8NA 4ELRA 5IKBA 4UA8A 4I62A 1VFEA 1EZ9A 1N0TA 2QMXA 3OO6A 3M8UA 1M5FA 3O28A 4O3BA 2PX1A 3H03A 3R6UA 1VE4A 1Y3QA 2FNCA 2R9JA 3RN8A 3T9XB 2GHAA 4R9FA 2XXHA 1ZU0A 2RC9A 2HZKA 4X1DA 5TU0A 5I59A 1FCKA 4U1OA 2FA7A 3IO6A 2NVUB 3IAZA 3O29A 3TTRA 4H5FA 4KFQA 4E0XA 2Q8JA 2REGA 3MZBA 3O97A 1BLFA 4MBPA 3KN8A 3LSFB 4LZ5A 1L5TA 3MPKA 2I3VA 4IO7A 3I3VA 3FUZA 1LFIA 3LR1A 4O3AA 1IXCA 4H5GA 4KYSA 4X48A 5KCJB 1FTLA 1AL3A 4IO6A 2X7QA 3MP6A 1J1NA 4G68B 3T66A 4HW8A 5K2YA 1URGA 3EF7A 4EF2A 1A7LA 3TTLA 3U1OA 1IIWA 1DPPA 4OTEA 4YMAA 4O3CA 2A5TB 4U4SA 4JB7A 4AQ4A 2RINA 2XX8A 5ITOA 5BUUA 1MPBA 3PUXE 4NF8A 2Y7WA 2DE3A 4DLDA 3U94A 5F7VA 3GBAA 1SYIA 3ONMA 4JSDA 5I59B 2QS1A 3K6UA 2H9BA 4ZECA 5I57A 4WEPA 1EZOA 1Y4CA 5AA2B 3PD9A 3PD8A 1A8FA 2QS3A 3HV1A 3O6IA 3K2DA 3CSGA 1NMUA 4OENA 4QSDA 1M5EA 3TKDA 1B32A 3OSQA 4FECA 1P1NA 2Z23A 3RY3A 2XD3A 5LOMA 3RPWA 1I6QA 2OLBA 2WKYA 3CFLA 4RJZA 4FAJA 3TEPA 3H3GA 4F29A 1QUJA 2O7IA 2VOZA 4RK2A 2XX9A 2X26A 3M3KA 3IORA 4I8CA 5DVIA 3A3CA 3LUYA 2P0SA 2Q9TA 4GVOA 3IOUA 1MG1A 3G3KA 2NOOA 3PUZE 2DSFA 5AA3A 2HZLA 4GLIA 4BDLA 1LB9A 2RCAA 3H7MA 3SEVA 3IK6B 5I56B 3TPAA 3R26A 1B7UA 1B9JA 2ABHA 4XXUA 4Q8RA 2DXRA 1DMBA 1NKXA 4XTCQ 1A55A 3K1NA 5FHMA 3VVEA 5EYFA 2QS2A 4IO5A 3KOSA 3W9WA 4EQBA 4I9DA 1H43A 3H6UA 1HSJA 3A09A 3T96B 4U1ZA 1Q35A 3RNNA 3V5AA 2E0SA 3N5LA 1FQBA 4IY5A 1GGGA 4LQ2A 2X7PA 4EQ9A 4NF5B 4F3PA 3OD7A 2O84X 2V84A 1R9QA 3C33A 4KQPA 4KD5A 2V93A 3T22A 3FXUA 4DE8A 4GFRA 2F34A 3FD3A 1BKAA 2VD3A 4PFYA 4F22A 1JQFA 5I57B 1NNKA 1JVXA 1LSTA 5I84A 2V3UA 3HSTA 1MRPA 3IL1B 1FTMA 4PETA 5EHSA 1NFTA 3USDA 4G4PA 5F1QA 3LC8A 1FTKA 3QXMA 1IQ7A 4RXLA 5CBSA 4HCYA 4KYEA 3VLVA 1MQDA 1M5CA 1H3DA 2DE4A 4K3FA 1Y1ZA 2F7BA 3IB0A 2XXTA 2DVCA 1ZJLA 1OVTA 3MVYA 5B7DA 3VV5A 5CMKA 2XXYA 3I5OA 4ZEKA 4YKJA 5I58A 4OVJA 4R6HA 4KCDA 4RPNA 1O7TA 2YLNA 4Q30B 5KCJA 4ZEFA 2QPQA 1SDXA 1OIBA 3W9VA 4ONYA 3AXFA 2F36A 3MW0A 4U21A 1B1XA 4ELQA 5HBCA 4FATA 4POXA 1B4ZA 3LSLA 1QJMA 2ONSA 1UTHA 1Z7ME 4NF6A 2O69A 4OHNA 5H8HA 5I2NA 3Q26A 3SESA 3MUQA 1MQHA 3SEUA 3FVKA 5AA4A 2PT2A 3OELA 1GVCA 1LFHA 2V25A 1NL5A 1QULA 2I58A 2DQVA 3H4ZA 2HAUA 3FASA 2DWIA 3C32A 4RA1A 2VD2A 4UACA 4NMYA 2OWTA 2Q2AA 3C9HA 1ZKBA 4QSCA 5TPAA 4LVQA 4EUOA 1Z7NE 1FQDA 4R74A 5L9MA 2XD2A 4ESWA 2I49A 5H8NB 5H8QB 1O64A 1XS5A 2LAOA 3H6WA 4MF3A 3KN7A 2ALUA 4FEDA 3T9VA 1MXYA 2I0CA 4F1VA 1PDAA 2NXOA 4H6DA 4PP0A 1T0KA 4NF4B 3SKPA 2ZYNA 3FVGA 1MXXA 1O63A 4IO3A 3K00A 1XC1A 4G68C 4QSEA 4TOZA 1CE2A 4AB6A 3LSXA 2XX7A 1ZBMA 4C1UA 3O2AA 3V89B 4PQJA 1B3HA 5KDTA 4FIMA 2O68A 1B3LA 2AL4A 2F6GA 2DYXA 2HCAA 2V3TA 4KPTA 1A8EA 1JW1A 2GHBA 4H67A 5CI5A 4GD5A 1QKAA 2GFEA 1ZTYA 3A3UA 3B6TA 3FIRA 4BDMA 2RKMA 1B58A 3K4UA 3PUWE 3MJNA 4YB6A 3FXRA 3EN3A 3RT8A 3IJOB 3KBRA 4LZ7A 4XKRA 4JWOA 4ZEIA 4R75A 4ISUA 1SW1A 2XXIA 3C36A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TAJ A;  2XXP A;  1DSN A;  3IJX B;  1MXU A;  3JV9 A;  4KI0 E;  4QHQ A;  4YKK A;  3RUM A;  1IZ1 A;  1UIV A;  1XVY A;  3CG3 A;  4NWD A;  3F11 A;  4G8H A;  4ELP A;  3TUS A;  1R1N A;  2F78 A;  2REJ A;  4NF4 A;  3OO8 A;  1N3X A;  3SER A;  4F1Y A;  2UVH A;  1B1H A;  4FEB A;  1I6A A;  2ZMB A;  3M3F A;  5CMM A;  3N26 A;  4YKI A;  3V8X B;  5I2K A;  5IAI A;  1IEJ A;  1B5H A;  3L6G A;  3EHS A;  1D9V A;  2R6G E;  1N76 A;  1P1O A;  3UK4 A;  1SW5 A;  2V3Q A;  1OLA A;  3P7I A;  4WKM A;  2GH9 A;  2YPN A;  1A99 A;  4U23 A;  4Z0I A;  4LP2 B;  5TPA B;  3TDJ A;  4F31 B;  3ZKL A;  5CC2 A;  2D21 A;  2OZZ A;  2F5X A;  3C34 A;  1EU8 A;  4L17 A;  2M8C A;  4R73 A;  1USY H;  4U22 A;  5BWJ A;  3SEY A;  3KOT A;  4IGT A;  4NED A;  3ILU B;  4WXJ A;  3FV1 A;  2ZYO A;  2B3F A;  1MH4 A;  3OOA A;  3CG1 A;  1ZLQ A;  4ZZA A;  5I58 B;  5J1D A;  4M1V A;  2UVJ A;  5JEI A;  3C35 A;  4QF9 A;  4GXA A;  3C31 A;  3UIF A;  4TLL B;  1FQC A;  3IO4 A;  3RTF B;  2UYE A;  3E13 X;  4ZDM A;  2KLF A;  4F19 A;  3VVF A;  1II5 A;  3CIJ A;  4NWC A;  3CI8 A;  4ELO A;  1AIV A;  3M3L A;  3KEI A;  4EXK A;  5HM4 B;  4ZE8 A;  1LBC A;  1LCT A;  4MLQ A;  3Q27 A;  4KR5 A;  3KJT A;  4DZ1 A;  1H44 A;  3MC2 A;  5KZT A;  2B3B A;  2UVG A;  1MQI A;  5H8F B;  2RF1 A;  4R72 A;  1B5J A;  5TP9 A;  3BFT A;  2O51 A;  3DM0 A;  3OSR A;  4JXI A;  5I2K B;  3T9U A;  3G3H A;  2I48 A;  3O6H A;  3TTK A;  1UTB A;  4FOR A;  3RLF E;  3FVO A;  4N6P A;  4YZZ A;  1BTJ A;  1RKM A;  4LA9 A;  4EXL A;  3QUJ A;  5KDT B;  2A5S A;  3FV2 A;  3GBB A;  3ODB A;  2Y7I A;  1DPE A;  1DTG A;  2G93 A;  4EF1 A;  4PFT A;  1MY4 A;  1POY 1;  3QSL A;  1NNP A;  3E3K A;  4EQ7 A;  1XT8 A;  1JVY A;  3GZG A;  4MFI A;  4ZS9 A;  2W7Y A;  2QSX A;  2XXQ A;  1ZMG A;  5AE4 A;  3ZSF A;  3VFJ A;  1HSL A;  3RGY A;  1SW2 A;  1I6B A;  4IY6 A;  1FQA A;  1RYX A;  3RQT A;  3HN0 A;  1M5B A;  1GV8 A;  3CRB A;  4FE8 A;  3PMX A;  4H1X A;  1MS7 A;  5H8F A;  3ZS6 A;  3S9N C;  1B05 A;  1LCF A;  3KGC A;  3TYH A;  2F8D A;  2ZXT A;  3IR1 A;  2IEE A;  4XKN A;  5K2X A;  4RY1 A;  3IOW A;  2HXW A;  3EHU A;  3OEM A;  3I6V A;  3K02 A;  2QL3 A;  2AIX A;  3FJ7 A;  3GXA A;  3OXN A;  2H5Y A;  3D4C A;  3BKI B;  1PB9 A;  5CMC A;  3VE1 B;  2O1M A;  4GOT A;  3U93 A;  4NE4 A;  4DIG A;  3C4M A;  2DE2 A;  2H4I A;  2Y84 A;  3WAE A;  1IXI A;  4F39 A;  1VR5 A;  1SVX B;  1PBP A;  1AH5 A;  3TQW A;  4LZ8 A;  3UN6 A;  3MVZ A;  4IB2 A;  4GF8 A;  1MM6 A;  3TMG A;  5JK4 A;  1SD3 A;  5AA2 A;  2Z8F A;  1P1U A;  2Z22 A;  5CMB A;  3B7D A;  2O1L A;  3HCQ A;  1ZIU A;  3TQL A;  3G3J A;  1HSE A;  1ELJ A;  3CSB A;  1LAG E;  1MXW A;  2AYS A;  1WVJ A;  2ANJ A;  4ND9 A;  4Q5T A;  3TCH A;  3TCF A;  3TEL A;  4ECF A;  3DEL B;  3W15 C;  1VFD A;  4F18 A;  3OMB A;  1R9L A;  1Y1M A;  1UQW A;  3KG2 A;  4G8N A;  3PMV A;  5I2N B;  4QFL A;  4QFP A;  5ICT A;  1XHY A;  3IB2 A;  3G3G A;  3S9E A;  2HFB A;  2DS9 A;  3PU5 A;  1B51 A;  1JEU A;  4QFO A;  3K01 A;  3ZKK A;  3HHF A;  5DYH A;  4RNS A;  3EQ1 A;  1AMF A;  1TFD A;  3TZA A;  2QMW A;  4F3B A;  1MPD A;  2I0B A;  3K1M A;  3G3F A;  3QIM A;  1F9B A;  2R71 A;  3JYR A;  1US4 A;  1B0L A;  2E1S A;  2Q2C A;  3R7X A;  5CBR A;  1OLC A;  4X9T A;  2DWJ A;  1PB8 A;  1LAH E;  2QJE A;  4FJP A;  1N7W A;  2DVZ A;  5ITP A;  3QYT A;  4ESX A;  1EH3 A;  2UVI A;  4IO2 A;  2OBG A;  1Y3P A;  1LAX A;  3O9P A;  1MY1 A;  1QKB A;  3RT6 B;  1TFA A;  1MH3 A;  2VGQ A;  4H0W A;  1GTK A;  1IXG A;  3DP8 A;  1B7Z A;  4RYA A;  3T93 B;  4F3S A;  2DXY A;  1MY2 A;  2P1S A;  3V83 A;  3DLN A;  3H06 B;  3VXB A;  5JTY A;  2GRV A;  5JTY B;  3FVN A;  4G77 A;  3OO7 A;  4MLV A;  4BDR A;  4AB5 A;  3K6V A;  4QRZ A;  2XXW A;  5L8D A;  5FHO A;  1JEV A;  3PUY E;  2DOJ A;  3PPR A;  3PV0 E;  4HS7 A;  4LAT A;  3IOV A;  4QFK A;  4IGR A;  1PEB A;  4HCW A;  1EZP A;  4C0R A;  3KSX A;  4Z7E A;  2OJT A;  2UXA A;  4M4G A;  3TOD A;  4F2O A;  3T9H B;  3N6U A;  3TFL A;  1PBQ A;  2XXX A;  4DDD A;  3HPI A;  1D4N A;  1MDQ A;  1Y20 A;  4YU0 A;  2OCU A;  1FQF A;  1M5D A;  4GXS B;  1Y3N A;  1SW4 A;  1MQG A;  2RC8 A;  5I56 A;  5TP9 B;  1B3F A;  2PBW A;  2H99 A;  4IO4 A;  4NF6 B;  3H6T A;  5H8H B;  4DCX A;  4DXC A;  1B40 A;  2H25 A;  2IA4 A;  4XIG Q;  1QUK A;  2Y7P A;  4Q0C A;  3MZ9 A;  1WDN A;  2UYF A;  3TCG A;  4YMB A;  1POT A;  1IIT A;  1A54 A;  3WAF A;  3B6Q A;  1P1W A;  2OWS A;  4PFW A;  4DXU A;  1YAE A;  1MXV A;  1ANF A;  1OQH A;  3KJ7 A;  2DWA A;  4DCY A;  3S9L C;  2DP8 A;  2XXV A;  2XXU A;  1B7H A;  1MY3 A;  2ZNU A;  3FZV A;  4JWX A;  1MQJ A;  4BDN A;  1FQE A;  1PB7 A;  2AL5 A;  4JWY A;  1H76 A;  3E9X A;  1QW0 A;  1LFG A;  1R6Z A;  4OET A;  1GR2 A;  1MXZ A;  3Q29 A;  4R9G A;  3G3I A;  1B52 A;  1SI0 A;  3IB1 A;  2HQ0 A;  4HTG A;  4YB5 A;  5A5X A;  2Q89 A;  3BFU A;  4OMB A;  3KFM A;  4OXV A;  4P0I A;  1FTO A;  2QRY A;  1VSO A;  1CB6 A;  3TTM A;  3JZJ A;  5AA2 D;  4X1B A;  2YJP A;  4ZE9 A;  4GRK A;  4OZ9 A;  2RCB A;  1RYO A;  3FAT A;  1N84 A;  5CM6 A;  3ECR A;  4NF8 B;  3S9M C;  1SYH A;  3H6V A;  4KHZ E;  3L6H A;  2B65 A;  4OEV A;  3TTN A;  4OQO A;  3UGW A;  3VXC A;  1D3K A;  3PPQ A;  5AA1 A;  4BDQ A;  4OFJ A;  2F97 A;  5L9O A;  1USY E;  4H65 A;  2PMS A;  1JNF A;  3KSJ A;  2ZNT A;  2ZYK A;  5DT6 A;  3MPL A;  1NH8 A;  2F7A A;  5FTH A;  3SEW A;  1SBP A;  1UIU A;  3DP6 A;  5DTB A;  4JBZ A;  1YCJ A;  3N6T A;  2Q88 A;  2Z8E A;  4RK9 A;  3QAX A;  4YAH X;  5H8S A;  4E0W A;  3G7W A;  2PVU A;  1YPN A;  3Q28 A;  4R2F A;  4THI A;  1S50 A;  3RTW B;  2FYI A;  3MP8 A;  4GIZ A;  4OER A;  1B4H A;  3LSW A;  5H8Q A;  4BLA A;  4DXB A;  2I4C A;  2CZL A;  3Q25 A;  1N3W A;  3OO9 A;  1B6H A;  4OWD A;  4OFO A;  1PC3 A;  1H45 A;  3MZ1 A;  4LON B;  4G8M A;  2NWJ A;  1TWY A;  1BIY A;  3MAM A;  5DVF A;  3BBR A;  1B46 A;  3THI A;  5L9S A;  3N94 A;  1DTZ A;  2G29 A;  1P1Q A;  1NNF A;  1OQG A;  3IOT A;  1A40 A;  4GWO A;  1DOT A;  1S7Y A;  2ONK E;  1LAF E;  1Y9U A;  1QUI A;  2I6E A;  1UTB B;  2O6A A;  3U92 A;  5ICQ A;  5AA4 B;  5ISU A;  4OYV A;  1MM7 A;  1N04 A;  1QVS A;  1D9Y A;  4GL8 A;  1URD A;  3CR9 A;  2I4B A;  1YTV A;  2RC7 A;  3K6W A;  4YIC A;  1JET A;  2ESN A;  1KWH A;  1OVB A;  3K6X A;  2F35 A;  4R6Y A;  5ELV A;  3QUF A;  1MDP 1;  1JW5 A;  3PGF A;  1MY0 A;  4KYD A;  3UP9 A;  3FJM A;  2D3I A;  3VVD A;  1SI1 A;  3MQ9 A;  4P11 A;  1LBB A;  4EDP A;  4F2Q A;  5CRY A;  3CVG A;  1WOD A;  1N7X A;  2ZYM A;  4N13 A;  1XOC A;  2ONR A;  4GQO A;  3FXQ A;  5DEX B;  3VLW A;  1MPC A;  4QFN A;  1LB8 A;  3GLB A;  3VLU A;  2XHD A;  3B6W A;  2A5T A;  4GL0 A;  4KCC A;  3OEN A;  4U2R A;  1UTH B;  2Y7K A;  2HEU A;  2O7U A;  2XXR A;  1URS A;  4TLM B;  4ZZE A;  1I69 A;  4F1U A;  1NNT A;  1NH7 A;  3CFX A;  4C1T A;  2I3W A;  3S4U A;  2NUV A;  5FTI A;  3HHG A;  4ZED A;  2VP1 A;  2HAV A;  3O6G A;  4G68 A;  4MH5 A;  4XKP A;  3PUV E;  4NTL A;  4TQU Q;  3D4G A;  4BDO A;  4XKQ A;  2ZNS A;  4YKP A;  3FGS A;  4F3G A;  3UOR A;  4POW A;  4RPO A;  1IUD A;  3PPN A;  3PPP A;  5DVJ A;  3SET A;  1B0H A;  3EPE A;  3MBP A;  3SDF A;  2THI A;  1SQY A;  2BJJ X;  3K0V A;  4OEU A;  4OES A;  4H8J A;  4R2B A;  4R6K A;  1B3E A;  3VDF A;  1FW0 A;  3FJG A;  1LGB C;  3LBS A;  4N07 A;  3KN3 A;  1FTJ A;  3HO7 A;  3MWB A;  5M2V A;  1IXH A;  4LQ5 A;  2P2A A;  2F6P A;  3CFZ A;  3QK6 A;  3DP4 A;  3IX1 A;  1AOV A;  4JSO A;  3E4R A;  3MP1 A;  4PE5 B;  3U72 A;  3U8Q A;  5A5X B;  1B2H A;  1JW4 A;  4WED A;  3SEX A;  2PYY A;  3OEK A;  1US5 A;  2F7C A;  2D5W A;  3K1P A;  4LUB A;  4H8I A;  1Q1K A;  1TT1 A;  4NF5 A;  1OMP A;  3PPO A;  1B3G A;  4JDF A;  4OFL A;  2H98 A;  3O66 A;  2Y7R A;  4G2Z A;  3S2V A;  5DEX A;  3EHT A;  3UA8 A;  3ILT B;  2OK2 A;  1B5I A;  5FHN A;  4YB7 A;  4ZEB A;  2VHA A;  3MVW A;  5B70 A;  2Z8D A;  2CMO A;  3MVX A;  1TXF A;  5HPQ A;  1Y4T A;  4U4X A;  3KZG A;  3PMW A;  4I1D A;  5EHM A;  1ATG A;  1LLS A;  1S9T A;  1XVX A;  2DWH A;  4P0G A;  1P99 A;  1BP5 A;  2PT1 A;  2QS4 A;  4PFU A;  5H8N A;  4ELR A;  5IKB A;  4UA8 A;  4I62 A;  1VFE A;  1EZ9 A;  1N0T A;  2QMX A;  3OO6 A;  3M8U A;  1M5F A;  3O28 A;  4O3B A;  2PX1 A;  3H03 A;  3R6U A;  1VE4 A;  1Y3Q A;  2FNC A;  2R9J A;  3RN8 A;  3T9X B;  2GHA A;  4R9F A;  2XXH A;  1ZU0 A;  2RC9 A;  2HZK A;  4X1D A;  5TU0 A;  5I59 A;  1FCK A;  4U1O A;  2FA7 A;  3IO6 A;  2NVU B;  3IAZ A;  3O29 A;  3TTR A;  4H5F A;  4KFQ A;  4E0X A;  2Q8J A;  2REG A;  3MZB A;  3O97 A;  1BLF A;  4MBP A;  3KN8 A;  3LSF B;  4LZ5 A;  1L5T A;  3MPK A;  2I3V A;  4IO7 A;  3I3V A;  3FUZ A;  1LFI A;  3LR1 A;  4O3A A;  1IXC A;  4H5G A;  4KYS A;  4X48 A;  5KCJ B;  1FTL A;  1AL3 A;  4IO6 A;  2X7Q A;  3MP6 A;  1J1N A;  4G68 B;  3T66 A;  4HW8 A;  5K2Y A;  1URG A;  3EF7 A;  4EF2 A;  1A7L A;  3TTL A;  3U1O A;  1IIW A;  1DPP A;  4OTE A;  4YMA A;  4O3C A;  2A5T B;  4U4S A;  4JB7 A;  4AQ4 A;  2RIN A;  2XX8 A;  5ITO A;  5BUU A;  1MPB A;  3PUX E;  4NF8 A;  2Y7W A;  2DE3 A;  4DLD A;  3U94 A;  5F7V A;  3GBA A;  1SYI A;  3ONM A;  4JSD A;  5I59 B;  2QS1 A;  3K6U A;  2H9B A;  4ZEC A;  5I57 A;  4WEP A;  1EZO A;  1Y4C A;  5AA2 B;  3PD9 A;  3PD8 A;  1A8F A;  2QS3 A;  3HV1 A;  3O6I A;  3K2D A;  3CSG A;  1NMU A;  4OEN A;  4QSD A;  1M5E A;  3TKD A;  1B32 A;  3OSQ A;  4FEC A;  1P1N A;  2Z23 A;  3RY3 A;  2XD3 A;  5LOM A;  3RPW A;  1I6Q A;  2OLB A;  2WKY A;  3CFL A;  4RJZ A;  4FAJ A;  3TEP A;  3H3G A;  4F29 A;  1QUJ A;  2O7I A;  2VOZ A;  4RK2 A;  2XX9 A;  2X26 A;  3M3K A;  3IOR A;  4I8C A;  5DVI A;  3A3C A;  3LUY A;  2P0S A;  2Q9T A;  4GVO A;  3IOU A;  1MG1 A;  3G3K A;  2NOO A;  3PUZ E;  2DSF A;  5AA3 A;  2HZL A;  4GLI A;  4BDL A;  1LB9 A;  2RCA A;  3H7M A;  3SEV A;  3IK6 B;  5I56 B;  3TPA A;  3R26 A;  1B7U A;  1B9J A;  2ABH A;  4XXU A;  4Q8R A;  2DXR A;  1DMB A;  1NKX A;  4XTC Q;  1A55 A;  3K1N A;  5FHM A;  3VVE A;  5EYF A;  2QS2 A;  4IO5 A;  3KOS A;  3W9W A;  4EQB A;  4I9D A;  1H43 A;  3H6U A;  1HSJ A;  3A09 A;  3T96 B;  4U1Z A;  1Q35 A;  3RNN A;  3V5A A;  2E0S A;  3N5L A;  1FQB A;  4IY5 A;  1GGG A;  4LQ2 A;  2X7P A;  4EQ9 A;  4NF5 B;  4F3P A;  3OD7 A;  2O84 X;  2V84 A;  1R9Q A;  3C33 A;  4KQP A;  4KD5 A;  2V93 A;  3T22 A;  3FXU A;  4DE8 A;  4GFR A;  2F34 A;  3FD3 A;  1BKA A;  2VD3 A;  4PFY A;  4F22 A;  1JQF A;  5I57 B;  1NNK A;  1JVX A;  1LST A;  5I84 A;  2V3U A;  3HST A;  1MRP A;  3IL1 B;  1FTM A;  4PET A;  5EHS A;  1NFT A;  3USD A;  4G4P A;  5F1Q A;  3LC8 A;  1FTK A;  3QXM A;  1IQ7 A;  4RXL A;  5CBS A;  4HCY A;  4KYE A;  3VLV A;  1MQD A;  1M5C A;  1H3D A;  2DE4 A;  4K3F A;  1Y1Z A;  2F7B A;  3IB0 A;  2XXT A;  2DVC A;  1ZJL A;  1OVT A;  3MVY A;  5B7D A;  3VV5 A;  5CMK A;  2XXY A;  3I5O A;  4ZEK A;  4YKJ A;  5I58 A;  4OVJ A;  4R6H A;  4KCD A;  4RPN A;  1O7T A;  2YLN A;  4Q30 B;  5KCJ A;  4ZEF A;  2QPQ A;  1SDX A;  1OIB A;  3W9V A;  4ONY A;  3AXF A;  2F36 A;  3MW0 A;  4U21 A;  1B1X A;  4ELQ A;  5HBC A;  4FAT A;  4POX A;  1B4Z A;  3LSL A;  1QJM A;  2ONS A;  1UTH A;  1Z7M E;  4NF6 A;  2O69 A;  4OHN A;  5H8H A;  5I2N A;  3Q26 A;  3SES A;  3MUQ A;  1MQH A;  3SEU A;  3FVK A;  5AA4 A;  2PT2 A;  3OEL A;  1GVC A;  1LFH A;  2V25 A;  1NL5 A;  1QUL A;  2I58 A;  2DQV A;  3H4Z A;  2HAU A;  3FAS A;  2DWI A;  3C32 A;  4RA1 A;  2VD2 A;  4UAC A;  4NMY A;  2OWT A;  2Q2A A;  3C9H A;  1ZKB A;  4QSC A;  5TPA A;  4LVQ A;  4EUO A;  1Z7N E;  1FQD A;  4R74 A;  5L9M A;  2XD2 A;  4ESW A;  2I49 A;  5H8N B;  5H8Q B;  1O64 A;  1XS5 A;  2LAO A;  3H6W A;  4MF3 A;  3KN7 A;  2ALU A;  4FED A;  3T9V A;  1MXY A;  2I0C A;  4F1V A;  1PDA A;  2NXO A;  4H6D A;  4PP0 A;  1T0K A;  4NF4 B;  3SKP A;  2ZYN A;  3FVG A;  1MXX A;  1O63 A;  4IO3 A;  3K00 A;  1XC1 A;  4G68 C;  4QSE A;  4TOZ A;  1CE2 A;  4AB6 A;  3LSX A;  2XX7 A;  1ZBM A;  4C1U A;  3O2A A;  3V89 B;  4PQJ A;  1B3H A;  5KDT A;  4FIM A;  2O68 A;  1B3L A;  2AL4 A;  2F6G A;  2DYX A;  2HCA A;  2V3T A;  4KPT A;  1A8E A;  1JW1 A;  2GHB A;  4H67 A;  5CI5 A;  4GD5 A;  1QKA A;  2GFE A;  1ZTY A;  3A3U A;  3B6T A;  3FIR A;  4BDM A;  2RKM A;  1B58 A;  3K4U A;  3PUW E;  3MJN A;  4YB6 A;  3FXR A;  3EN3 A;  3RT8 A;  3IJO B;  3KBR A;  4LZ7 A;  4XKR A;  4JWO A;  4ZEI A;  4R75 A;  4ISU A;  1SW1 A;  2XXI A;  3C36 A; 
#chains in the Genus database with same CATH topology
 4QHQ A;  1UIV A;  1XVY A;  3CG3 A;  1R1N A;  2F78 A;  4F1Y A;  2UVH A;  5I2K A;  1D9V A;  3UK4 A;  1N76 A;  1SW5 A;  3P7I A;  4I3Y A;  5CC2 A;  3TDJ A;  3ZKL A;  2OZZ A;  3C34 A;  4NX1 A;  4NED A;  2ZYO A;  1ZLQ A;  5J1D A;  2UVJ A;  1FQC A;  2UYE A;  1II5 A;  4NWC A;  3CI8 A;  3M3L A;  5HM4 B;  5H8F B;  1MQI A;  2RF1 A;  1B5J A;  3OSR A;  3G3H A;  4FOR A;  3FVO A;  2HHM A;  3HFU A;  5KDT B;  1DTG A;  1POY 1;  3QSL A;  1NNP A;  4ZS9 A;  3RGY A;  1FQA A;  1RYX A;  1M5B A;  3CRB A;  3PMX A;  3ZS6 A;  2XWI A;  3BIG A;  3TYH A;  2HXW A;  1VDW A;  3GXA A;  2H5Y A;  3BKI B;  5CMC A;  3ROJ A;  2O1M A;  4GOT A;  2H4I A;  1EYI A;  5ESY A;  4LZ8 A;  3MVZ A;  4IB2 A;  2B4L A;  2Z8F A;  1P1U A;  1ZIU A;  1MXW A;  4Q5T A;  3TCH A;  1FBP A;  1FPD A;  1UQW A;  1NUY A;  1NV6 A;  5I2N B;  4G8N A;  4QFL A;  3G3G A;  3S9E A;  3PU5 A;  4F3B A;  3TZA A;  3G3F A;  3JYR A;  1US4 A;  2E1S A;  2QJE A;  4FJP A;  4OVR A;  1MY1 A;  4RYA A;  4F3S A;  3TUS A;  3DP8 A;  1B7Z A;  2DXY A;  4P47 A;  3DLN A;  3H06 B;  3VXB A;  2GRV A;  5L8D A;  5FHO A;  3PUY E;  4HS7 A;  2DOJ A;  1PEB A;  4HCW A;  3KSX A;  4Z7E A;  4YU0 A;  1Y20 A;  4GXS B;  1Y3N A;  4NQ8 A;  4DCX A;  3PTY A;  2IA4 A;  4KXP A;  1POT A;  1IIT A;  1P1W A;  1YAE A;  1MXV A;  2XXV A;  2XXU A;  2AL5 A;  2HQ0 A;  5A5X A;  1NV3 A;  2Q89 A;  2Y5K A;  4OXV A;  1FTO A;  3JZJ A;  2YJP A;  1FBC A;  1RYO A;  4NF0 A;  3ECR A;  1RDX A;  3H6V A;  3PPQ A;  1USY E;  2PMS A;  3SEW A;  5DTB A;  1YCJ A;  3IFA A;  3QAX A;  4RK9 A;  1FSA A;  1YPN A;  4R2F A;  3MP8 A;  4GIZ A;  4OER A;  3LSW A;  5H8Q A;  1N3W A;  1B6H A;  4OWD A;  1H45 A;  4DI4 B;  1BIY A;  5ET5 A;  3MAM A;  1B46 A;  2WYK A;  1NNF A;  3IOT A;  1A40 A;  4JSD A;  1S7Y A;  2ONK E;  2I6E A;  3U92 A;  5ICQ A;  1K9Z A;  4OYV A;  1N04 A;  1D9Y A;  3CR9 A;  2I4B A;  5ELV A;  3QUF A;  1MDP 1;  1JW5 A;  1MY0 A;  4P11 A;  1G0H A;  3CVG A;  2ZYM A;  2ONR A;  1MPC A;  3GLB A;  3B6W A;  1UTH B;  4N15 A;  4ZZE A;  4TLM B;  1URS A;  4C1T A;  5FTI A;  3HHG A;  4ZED A;  3PUV E;  2ZNS A;  5DW8 A;  3T1B A;  3UOR A;  3PPN A;  5DVJ A;  3K0V A;  4OES A;  3FJG A;  1LGB C;  3LBS A;  1FTJ A;  2P2A A;  2F6P A;  3QK6 A;  3DP4 A;  3IX1 A;  3MP1 A;  3U8Q A;  2D5W A;  3K1P A;  4NF5 A;  1TT1 A;  1NV1 A;  2Y7R A;  4G2Z A;  3S2V A;  1IMB A;  2OK2 A;  1B5I A;  1JP4 A;  3MVW A;  3MVX A;  1TXF A;  3KZG A;  1ATG A;  1S9T A;  2DWH A;  1P99 A;  5H8N A;  4UA8 A;  1EZ9 A;  2QMX A;  2PX1 A;  3H03 A;  3R6U A;  2FNC A;  1Y3Q A;  1ZU0 A;  2HZK A;  5TU0 A;  2NVU B;  4H5F A;  2WX9 A;  4LZ5 A;  4GBW A;  3FUZ A;  1IXC A;  4H5G A;  5KCJ B;  1FTL A;  1A7L A;  4MMP A;  3U1O A;  4YMA A;  4O3C A;  4U4S A;  4JB7 A;  4AQ4 A;  5ITO A;  2DE3 A;  3U65 A;  2QS1 A;  2FVZ A;  4ZEC A;  1A8F A;  3HV1 A;  4O94 A;  3K2D A;  1M5E A;  1P1N A;  2Z23 A;  3RY3 A;  2XD3 A;  4RJZ A;  4RK2 A;  5DVI A;  2P0S A;  3IOU A;  1MG1 A;  5AA3 A;  4GLI A;  3H7M A;  2RCA A;  3SEV A;  2HXR A;  3IK6 B;  4Q8R A;  1NKX A;  4XTC Q;  3K1N A;  5FHM A;  4IO5 A;  3KOS A;  3A09 A;  3RNN A;  4JVC A;  1GGG A;  4OVQ A;  4EQ9 A;  4F3P A;  2O84 X;  2V84 A;  1R9Q A;  4KQP A;  2V93 A;  4GFR A;  4F22 A;  2ZZX A;  1JVX A;  1LST A;  5I84 A;  3KC1 A;  1FTM A;  5EHS A;  1NFT A;  3LC8 A;  4PGN A;  2DE4 A;  2F3D A;  3MVY A;  5EQ8 A;  2XXY A;  4OVJ A;  1O7T A;  5KCJ A;  2QPQ A;  4ONY A;  5HBC A;  4POX A;  1Z7M E;  4NF6 A;  1LFH A;  2PT2 A;  1NL5 A;  4I3E A;  3FAS A;  2VD2 A;  4NMY A;  2OX3 A;  4EUO A;  5L9M A;  5H8N B;  1XS5 A;  2ALU A;  4FED A;  1MXY A;  2I0C A;  4F1V A;  1PDA A;  5I7I A;  3SKP A;  2ZYN A;  1O63 A;  2OWZ A;  4N6D A;  2XX7 A;  1ZBM A;  4C1U A;  4PF8 A;  5AA2 D;  4QFN A;  2CZI A;  2DYX A;  1JW1 A;  1ZTY A;  2VT5 A;  3B6T A;  1B58 A;  3FXR A;  3EN3 A;  4R75 A;  4ISU A;  2XXI A;  3C36 A;  2XXP A;  3IJX B;  1MXU A;  3RUM A;  4ELP A;  2REJ A;  2ZMB A;  4YKI A;  5CMM A;  3N26 A;  4WKM A;  2GH9 A;  2YPN A;  4F31 B;  4L17 A;  1EU8 A;  2M8C A;  4R73 A;  1FPK A;  1DK4 A;  3ILU B;  2B3F A;  3OOA A;  3CG1 A;  5I58 B;  2FHY A;  4GXA A;  3UIF A;  4TLL B;  3E13 X;  3E79 A;  3NOH A;  4ZE8 A;  3Q27 A;  3KJT A;  4R72 A;  3BFT A;  2O51 A;  3O6H A;  3TTK A;  2DDK A;  2A5S A;  3GBB A;  2Y7I A;  2G93 A;  4EF1 A;  5ET8 A;  4EQ7 A;  1INP A;  4MFI A;  2QSX A;  3VFJ A;  1I6B A;  4IY6 A;  5IZ1 A;  3HN0 A;  4FE8 A;  3S9N C;  3KGC A;  1FBF A;  2ZXT A;  4XKN A;  4RY1 A;  3IOW A;  3EHU A;  4PC9 A;  2L5V A;  3FBP A;  3D4C A;  1FPB A;  1RDY A;  5LDZ A;  3U93 A;  4NE4 A;  4DIG A;  3C4M A;  2Y84 A;  1LBV A;  1MM6 A;  5AA2 A;  2Z22 A;  5CMB A;  3TQL A;  3G3J A;  1ELJ A;  2ANJ A;  4ND9 A;  3TEL A;  4F18 A;  3OMB A;  1R9L A;  5ICT A;  3PMV A;  4QFP A;  4OVP A;  1XHY A;  3IB2 A;  4QFO A;  3EQ1 A;  1AMF A;  3QIM A;  5I3S A;  2R71 A;  4IO2 A;  2OBG A;  1CNQ A;  3RT6 B;  1TFA A;  2VGQ A;  4H0W A;  1IXG A;  1MY2 A;  3FVN A;  4BDR A;  4GWS A;  1JEV A;  3PV0 E;  4QBA A;  5FBP A;  3IOV A;  4QFK A;  4MX6 A;  3TOD A;  4H46 A;  1PBQ A;  4DDD A;  3HPI A;  4AS4 A;  5I56 A;  1SW4 A;  1NV4 A;  2PBW A;  4IO4 A;  4NF6 B;  3H6T A;  4DXC A;  4Q0C A;  3TCG A;  2XWO A;  2QVV A;  4DCY A;  2JJK A;  2DP8 A;  2ZNU A;  4JWX A;  1MQJ A;  1NV5 A;  1FBD A;  1B52 A;  3T0J A;  4HTG A;  1XI6 A;  2QRY A;  1VSO A;  4OZ9 A;  2RCB A;  1N84 A;  4PFR A;  1LBY A;  4MNP A;  3S9M C;  5T3J A;  3L6H A;  3TTN A;  1D3K A;  4OFJ A;  1JNF A;  3B50 A;  2ZNT A;  2ZYK A;  2F7A A;  1SBP A;  3DP6 A;  2V4C A;  2Q88 A;  4YAH X;  4E0W A;  3G7W A;  4IR8 A;  3RTW B;  4N91 A;  2FYI A;  3BIH A;  4PBH A;  4OFO A;  1TWY A;  5L9S A;  3N94 A;  2G29 A;  1OQG A;  3ZSF A;  4GWO A;  1QUI A;  3RYD A;  4GL8 A;  1FBG A;  2RC7 A;  3K6W A;  4YIC A;  1JET A;  2ESN A;  3FJM A;  2Q8M A;  1WOD A;  1LB8 A;  2XHD A;  1I69 A;  1G0I A;  4XKQ A;  4F3G A;  3PPP A;  1B0H A;  3SDF A;  2THI A;  2BJJ X;  4OEU A;  3LUZ A;  1B3E A;  3HO7 A;  3E4R A;  5A5X B;  4WED A;  2PYY A;  3OEK A;  1Q1K A;  1B3G A;  4JDF A;  4OFL A;  5IGA A;  1D9Q A;  5EQ7 A;  5B70 A;  2CMO A;  2QFL A;  1Y4T A;  3PMW A;  5EHM A;  1NV0 A;  4ELR A;  3M8U A;  1M5F A;  3SES A;  3T9X B;  3RN8 A;  3EKI A;  5I59 A;  3IO6 A;  3O29 A;  3TTR A;  4LN5 A;  3O97 A;  1KA1 A;  1BLF A;  3KN8 A;  1L5T A;  3LR1 A;  4KYS A;  3IFC A;  3MP6 A;  5K2Y A;  3EF7 A;  4GWW A;  1IIW A;  1DPP A;  2RIN A;  3U94 A;  5F7V A;  3GBA A;  5I59 B;  4N17 A;  1Y4C A;  3PD9 A;  2QS3 A;  3CSG A;  5LOM A;  1I6Q A;  2WKY A;  3CFL A;  2HPG A;  3TEP A;  2VOZ A;  2O7I A;  3IOR A;  2DSF A;  2HZL A;  5I56 B;  4PFB A;  3R26 A;  2DXR A;  1DMB A;  3VVE A;  4P1E A;  4EQB A;  1H43 A;  1Q35 A;  3V5A A;  4I40 A;  2E0S A;  3T22 A;  1EYK A;  4PFY A;  5I57 B;  2V3U A;  1FRP A;  3USD A;  4G4P A;  1IQ7 A;  4KYE A;  4K3F A;  1M5C A;  1H3D A;  2F7B A;  3IB0 A;  2DVC A;  1YYZ A;  3I5O A;  4YKJ A;  4R6H A;  4KCD A;  4Q30 B;  2FIE A;  5I5P A;  1FPF A;  3W9V A;  1OIB A;  4ELQ A;  3AXF A;  2F36 A;  3MW0 A;  4U21 A;  5IZ3 A;  4FAT A;  1QJM A;  3Q26 A;  3SEU A;  2V25 A;  4RA1 A;  1LBZ A;  3C32 A;  4UAC A;  1ZKB A;  4LVQ A;  1Z7N E;  1IMD A;  1FQD A;  4MF3 A;  3H6W A;  1MXX A;  1FJ9 A;  4TOZ A;  4PGP A;  3V89 B;  4FIM A;  2Q8J A;  2HCA A;  4KPT A;  2VPO A;  4GD5 A;  4H45 A;  1NI9 A;  2GFE A;  3MJN A;  4YB6 A;  3IJO B;  4ZEI A;  3TAJ A;  3JV9 A;  1DSN A;  4KI0 E;  4YKK A;  4GWZ A;  2WBB A;  4NWD A;  3F11 A;  4G8H A;  4NF4 A;  4FEB A;  3V8X B;  3M3F A;  5IAI A;  1IEJ A;  3EHS A;  2R6G E;  1P1O A;  1A99 A;  4U23 A;  5BWJ A;  1USY H;  4U22 A;  3SEY A;  1FTA A;  3FV1 A;  1MH4 A;  5JEI A;  3C35 A;  3C31 A;  3IO4 A;  2KR0 A;  3RTF B;  4ZDM A;  2KLF A;  3VVF A;  2QVU A;  3KEI A;  4MLQ A;  4KR5 A;  4DZ1 A;  3MC2 A;  2UVG A;  5TP9 A;  4PDH A;  4JXI A;  4P1L A;  5EYG A;  2I48 A;  1UTB A;  2F3B A;  3RLF E;  1NUZ A;  4YZZ A;  1BTJ A;  1RKM A;  3FV2 A;  1DPE A;  1FBE A;  1MY4 A;  3E3K A;  1IME A;  4PDD A;  1HSL A;  1GV8 A;  2FIX A;  4H1X A;  5H8F A;  1MS7 A;  1B05 A;  1LCF A;  3KC0 A;  3IR1 A;  2IEE A;  5K2X A;  3OEM A;  2QL3 A;  2AIX A;  3OXN A;  4MIJ A;  1PB9 A;  2CEX A;  3VE1 B;  1AH5 A;  2PFY A;  3UN6 A;  3TMG A;  5JK4 A;  1SD3 A;  3B7D A;  1FBH A;  1HSE A;  1LAG E;  1NV2 A;  2AYS A;  3A29 A;  3DEL B;  3W15 C;  1Y1M A;  4XEQ A;  1B51 A;  1JEU A;  4X8R A;  3K01 A;  3HHF A;  5DYH A;  4RNS A;  1TFD A;  2QMW A;  1MPD A;  3K1M A;  5IZZ A;  2Q2C A;  3R7X A;  1OLC A;  4X9T A;  2DWJ A;  1PB8 A;  1LAH E;  4JVD A;  4OVS A;  2DVZ A;  5ITP A;  3QYT A;  4ESX A;  1LAX A;  1GTK A;  3V83 A;  5JTY A;  4MNI A;  3K6V A;  1EZP A;  4C0R A;  2OJT A;  2UXA A;  3T9H B;  3N6U A;  3TFL A;  2XXX A;  1D4N A;  1MDQ A;  1FQF A;  1M5D A;  2CEY A;  2RC8 A;  5TP9 B;  1B3F A;  5H8H B;  4XIG Q;  1QUK A;  2Y7P A;  4YMB A;  1A54 A;  3B6Q A;  2OWS A;  4PFW A;  4DXU A;  1OQH A;  2DWA A;  1B7H A;  3FZV A;  4BDN A;  1FQE A;  1PB7 A;  2P3N A;  4JWY A;  1H76 A;  3E9X A;  1QW0 A;  1LFG A;  1R6Z A;  4R9G A;  3BFU A;  4OMB A;  3CHG A;  1CB6 A;  4ZE9 A;  3FAT A;  4MHF A;  4KHZ E;  4O7I A;  4OEV A;  4OQO A;  4BDQ A;  3FXB A;  2F97 A;  5DT6 A;  1NH8 A;  4JBZ A;  3N6T A;  2Z8E A;  5H8S A;  4DXB A;  4BLA A;  2I4C A;  2CZL A;  3Q25 A;  3OO9 A;  4PAI A;  4G8M A;  2NWJ A;  4PAK A;  5DVF A;  1P1Q A;  4MH5 A;  4XKP A;  4AB5 A;  2P3V A;  1LAF E;  2Q74 A;  4MEV A;  1QVS A;  1URD A;  1YTV A;  2KQZ A;  2F35 A;  4GX6 A;  3PGF A;  2D3I A;  3VVD A;  3MQ9 A;  1LBB A;  4EDP A;  4F2Q A;  4N13 A;  2PFZ A;  4GQO A;  3FXQ A;  3RPL B;  5EQA A;  3VLU A;  4GL0 A;  4KCC A;  3OEN A;  4U2R A;  2XXR A;  1NNT A;  4GWX A;  2BJI A;  2I3W A;  2GQ1 A;  3O6G A;  4G68 A;  4NTL A;  3D4G A;  4BDO A;  4YKP A;  3FGS A;  1IUD A;  3SET A;  4OVT A;  4MJO A;  5A5L A;  4R6K A;  3VDF A;  4N07 A;  3KN3 A;  5M2V A;  4LQ5 A;  1AOV A;  1FPJ A;  3CFZ A;  4HE0 A;  1B2H A;  2MKZ A;  2QVR A;  4H8I A;  4GWU A;  3O66 A;  3ISP A;  3EHT A;  3ILT B;  4ZEB A;  2VHA A;  2Z8D A;  5HPQ A;  4U4X A;  1LLS A;  4UAB A;  4P0G A;  4PFU A;  2PT1 A;  4I62 A;  3O28 A;  4O3B A;  1VE4 A;  2R9J A;  4R9F A;  2RC9 A;  4X1D A;  4U1O A;  4E0X A;  2REG A;  3MPK A;  3I3V A;  4IO6 A;  2X7Q A;  4OAN A;  3T66 A;  1J1N A;  4MAG A;  2B4M A;  1URG A;  1LBX A;  3TTL A;  2A5T B;  2XX8 A;  5BUU A;  3PUX E;  2Y7W A;  3ONM A;  2H9B A;  1EYJ A;  3PD8 A;  2FBP A;  4QSD A;  1NMU A;  4G61 A;  1B32 A;  4FEC A;  2OLB A;  1RDZ A;  4FAJ A;  4QXD A;  2XX9 A;  2X26 A;  3LUY A;  2NOO A;  3PUZ E;  4P9K A;  1LB9 A;  4BDL A;  1B9J A;  4MNC A;  1IMC A;  1FQB A;  3MST A;  4LQ2 A;  4HE1 A;  1IMF A;  3C33 A;  1NUX A;  4KD5 A;  3FXU A;  4DE8 A;  2F34 A;  1BKA A;  2VD3 A;  1NNK A;  4PCD A;  1DCU A;  2XXT A;  1ZJL A;  1OVT A;  4P56 A;  2YLN A;  3KBZ A;  4PE3 A;  1B1X A;  3LSL A;  2ONS A;  5I2N A;  1MQH A;  3FVK A;  2DQV A;  1DBZ A;  2DWI A;  2Q2A A;  3C9H A;  5TPA A;  5H8Q B;  4PF6 A;  3T9V A;  4H6D A;  4P8B A;  1T0K A;  4IO3 A;  3K00 A;  4G68 C;  4QSE A;  1CE2 A;  1YZ0 A;  5J16 A;  4NN3 A;  2O68 A;  2V3T A;  2F6G A;  4JVI A;  5CI5 A;  4H67 A;  1QKA A;  4BDM A;  3K4U A;  5EYH A;  4LZ7 A;  4XKR A;  4JWO A;  1IZ1 A;  3SER A;  3OO8 A;  1N3X A;  1B1H A;  1I6A A;  1B5H A;  3L6G A;  2V3Q A;  1OLA A;  4Z0I A;  4N8Y A;  5TPA B;  4LP2 B;  5IZ3 B;  2D21 A;  2F5X A;  3KOT A;  4IGT A;  4WXJ A;  4ZZA A;  4M1V A;  4QF9 A;  2PCR A;  3CIJ A;  4ELO A;  1AIV A;  4EXK A;  1LBC A;  1LCT A;  1YXI A;  5KZT A;  1H44 A;  4HE2 A;  2B3B A;  4OA4 A;  3TPA A;  3DM0 A;  3T9U A;  5I2K B;  2WEF A;  1NV7 A;  4N6P A;  4LA9 A;  3QUJ A;  3ODB A;  4NG7 A;  4PFT A;  4PFI A;  1XT8 A;  1JVY A;  2ZZV A;  2W7Y A;  2XXQ A;  1ZMG A;  5AE4 A;  1SW2 A;  1AWB A;  3RQT A;  2R8T A;  2F8D A;  4NGU A;  3I6V A;  3K02 A;  3FJ7 A;  5ET7 A;  2DE2 A;  3WAE A;  1IXI A;  4F39 A;  1VR5 A;  1SVX B;  1PBP A;  4O8M A;  3TQW A;  4GF8 A;  4GWY A;  2O1L A;  3HCQ A;  3CSB A;  4ECF A;  1WVJ A;  3TCF A;  1VFD A;  2WYP A;  3KG2 A;  2HFB A;  2DS9 A;  2XXK A;  3ZKK A;  2I0B A;  1F9B A;  1B0L A;  5CBR A;  4XFE A;  1IMA A;  1N7W A;  1EH3 A;  2UVI A;  1Y3P A;  3O9P A;  1QKB A;  5KDT A;  1MH3 A;  3T93 B;  2P1S A;  5JTY B;  4G77 A;  3OO7 A;  4MLV A;  2CZK A;  4QRZ A;  2XXW A;  4LAT A;  3PPR A;  4IGR A;  4M4G A;  4F2O A;  2OCU A;  1MQG A;  2H99 A;  1B40 A;  2H25 A;  3MZ9 A;  1WDN A;  2UYF A;  4N4U A;  3SZP A;  3WAF A;  1ANF A;  3KJ7 A;  4NAP A;  3E78 A;  3S9L C;  1MY3 A;  4OET A;  1GR2 A;  1MXZ A;  3Q29 A;  3G3I A;  1SI0 A;  3IB1 A;  4YB5 A;  5CMK A;  2XWV A;  3KFM A;  4P0I A;  3TTM A;  4X1B A;  4GRK A;  5CM6 A;  4NF8 B;  1SYH A;  2B65 A;  3UGW A;  3VXC A;  4GX4 A;  5AA1 A;  5L9O A;  4H65 A;  3KSJ A;  3MPL A;  5FTH A;  1UIU A;  3Q28 A;  2PVU A;  4THI A;  1S50 A;  1B4H A;  4X04 A;  3RPL A;  3D1R A;  1PC3 A;  3MZ1 A;  4LON B;  3THI A;  3BBR A;  3GYY A;  1DTZ A;  4F19 A;  1DOT A;  1Y9U A;  2O6A A;  3MYU A;  1UTB B;  5AA4 B;  5ISU A;  1MM7 A;  3K6X A;  1KWH A;  1OVB A;  4R6Y A;  1K9Y A;  4KYD A;  3UP9 A;  1SI1 A;  5CRY A;  1N7X A;  5DEX B;  1XOC A;  4MCO A;  3VLW A;  2A5T A;  2Y7K A;  2HEU A;  2O7U A;  4F1U A;  1NH7 A;  3CFX A;  3S4U A;  2NUV A;  2VP1 A;  2HAV A;  4TQU Q;  4POW A;  4RPO A;  4N81 A;  3EPE A;  3MBP A;  1SQY A;  4H8J A;  4R2B A;  1FW0 A;  3MWB A;  1IXH A;  3QMF A;  4JSO A;  4PE5 B;  3U72 A;  1JW4 A;  5IM2 A;  3SEX A;  1LBW A;  1QGX A;  1US5 A;  2F7C A;  4LUB A;  1OMP A;  3PPO A;  2H98 A;  4AS5 A;  5DEX A;  3UA8 A;  5FHN A;  4YB7 A;  4I1D A;  1XVX A;  1BP5 A;  2QS4 A;  5IKB A;  1VFE A;  1N0T A;  3OO6 A;  1FPL A;  2GHA A;  2XXH A;  1FCK A;  2FA7 A;  3IAZ A;  4P3L A;  4KFQ A;  1BK4 A;  3MZB A;  4MBP A;  3LSF B;  5F24 A;  2I3V A;  4IO7 A;  1LFI A;  2Y5L A;  4O3A A;  4X48 A;  1AL3 A;  1FJ6 A;  4G68 B;  3LV0 A;  4HW8 A;  4EF2 A;  4OTE A;  4N8G A;  1MPB A;  4NF8 A;  4GX3 A;  4DLD A;  1SYI A;  3K6U A;  5I57 A;  1EZO A;  5AA2 B;  5LTC A;  4N6K A;  3O6I A;  4OEN A;  2WBD A;  3TKD A;  4HXV A;  4FBP A;  3OSQ A;  1FPI A;  3RPW A;  1LEV A;  3H3G A;  4F29 A;  1QUJ A;  3M3K A;  4I8C A;  3A3C A;  2Q9T A;  4GVO A;  4PBQ A;  4PTK A;  3G3K A;  1B7U A;  4XXU A;  2ABH A;  1SPI A;  1A55 A;  5EYF A;  2QS2 A;  2CZH A;  3W9W A;  4I9D A;  3H6U A;  1HSJ A;  3T96 B;  4U1Z A;  3N5L A;  4IY5 A;  2X7P A;  4NF5 B;  3OD7 A;  3FD3 A;  1JQF A;  3HST A;  1MRP A;  3IL1 B;  4PET A;  4PAF A;  5F1Q A;  5EQ9 A;  2XWK A;  1FTK A;  3QXM A;  4RXL A;  5CBS A;  4HCY A;  3VLV A;  1MQD A;  1Y1Z A;  5B7D A;  4GBV A;  3VV5 A;  4NHB A;  4ZEK A;  5I58 A;  4RPN A;  4ZEF A;  1SDX A;  2ZZW A;  1B4Z A;  1UTH A;  3B8B A;  2O69 A;  4OHN A;  5H8H A;  1KA0 A;  3MUQ A;  1Q9D A;  5AA4 A;  3OEL A;  1GVC A;  1QUL A;  3H4Z A;  2I58 A;  1FPG A;  2HAU A;  1KZ8 A;  4DI3 D;  2OWT A;  4QSC A;  4R74 A;  5ET6 A;  2XD2 A;  4ESW A;  2I49 A;  1O64 A;  2LAO A;  2VPN A;  3KN7 A;  2NXO A;  4PP0 A;  4NF4 B;  2XA5 A;  3FVG A;  1XC1 A;  4AB6 A;  3LSX A;  3O2A A;  4PQJ A;  1B3H A;  1FPE A;  4EXL A;  1B3L A;  4WEP A;  1NUW A;  2AL4 A;  4XF5 A;  1A8E A;  2GHB A;  3A3U A;  3FIR A;  2RKM A;  3PUW E;  4O7M A;  3RT8 A;  3KBR A;  1SW1 A;  3GZG A; 
#chains in the Genus database with same CATH homology
 3TAJ A;  2XXP A;  1DSN A;  3IJX B;  1MXU A;  3JV9 A;  4KI0 E;  4QHQ A;  4YKK A;  3RUM A;  1IZ1 A;  1UIV A;  1XVY A;  3CG3 A;  4NWD A;  3F11 A;  4G8H A;  4ELP A;  3TUS A;  1R1N A;  2F78 A;  2REJ A;  4NF4 A;  3OO8 A;  1N3X A;  3SER A;  4F1Y A;  2UVH A;  1B1H A;  4FEB A;  1I6A A;  2ZMB A;  3M3F A;  5CMM A;  3N26 A;  4YKI A;  3V8X B;  5I2K A;  5IAI A;  1IEJ A;  1B5H A;  3L6G A;  3EHS A;  1D9V A;  2R6G E;  1N76 A;  1P1O A;  3UK4 A;  1SW5 A;  2V3Q A;  1OLA A;  3P7I A;  4WKM A;  2GH9 A;  2YPN A;  1A99 A;  4U23 A;  4Z0I A;  4LP2 B;  5TPA B;  3TDJ A;  4F31 B;  3ZKL A;  5CC2 A;  2D21 A;  2OZZ A;  2F5X A;  3C34 A;  1EU8 A;  4L17 A;  2M8C A;  4R73 A;  1USY H;  4U22 A;  5BWJ A;  3SEY A;  3KOT A;  4IGT A;  4NED A;  3ILU B;  4WXJ A;  3FV1 A;  2ZYO A;  2B3F A;  1MH4 A;  3OOA A;  3CG1 A;  1ZLQ A;  4ZZA A;  5I58 B;  5J1D A;  4M1V A;  2UVJ A;  5JEI A;  3C35 A;  4QF9 A;  4GXA A;  3C31 A;  3UIF A;  4TLL B;  1FQC A;  3IO4 A;  3RTF B;  2UYE A;  3E13 X;  4ZDM A;  2KLF A;  4F19 A;  3VVF A;  1II5 A;  3CIJ A;  4NWC A;  3CI8 A;  4ELO A;  1AIV A;  3M3L A;  3KEI A;  4EXK A;  5HM4 B;  4ZE8 A;  1LBC A;  1LCT A;  4MLQ A;  3Q27 A;  4KR5 A;  3KJT A;  4DZ1 A;  1H44 A;  3MC2 A;  5KZT A;  2B3B A;  2UVG A;  1MQI A;  5H8F B;  2RF1 A;  4R72 A;  1B5J A;  5TP9 A;  3BFT A;  2O51 A;  3DM0 A;  3OSR A;  4JXI A;  5I2K B;  3T9U A;  3G3H A;  2I48 A;  3O6H A;  3TTK A;  1UTB A;  4FOR A;  3RLF E;  3FVO A;  4N6P A;  4YZZ A;  1BTJ A;  1RKM A;  4LA9 A;  4EXL A;  3QUJ A;  5KDT B;  2A5S A;  3FV2 A;  3GBB A;  3ODB A;  2Y7I A;  1DPE A;  1DTG A;  2G93 A;  4EF1 A;  4PFT A;  1MY4 A;  1POY 1;  3QSL A;  1NNP A;  3E3K A;  4EQ7 A;  1XT8 A;  1JVY A;  3GZG A;  4MFI A;  4ZS9 A;  2W7Y A;  2QSX A;  2XXQ A;  1ZMG A;  5AE4 A;  3ZSF A;  3VFJ A;  1HSL A;  3RGY A;  1SW2 A;  1I6B A;  4IY6 A;  1FQA A;  1RYX A;  3RQT A;  3HN0 A;  1M5B A;  1GV8 A;  3CRB A;  4FE8 A;  3PMX A;  4H1X A;  1MS7 A;  5H8F A;  3ZS6 A;  3S9N C;  1B05 A;  1LCF A;  3KGC A;  3TYH A;  2F8D A;  2ZXT A;  3IR1 A;  2IEE A;  4XKN A;  5K2X A;  4RY1 A;  3IOW A;  2HXW A;  3EHU A;  3OEM A;  3I6V A;  3K02 A;  2QL3 A;  2AIX A;  3FJ7 A;  3GXA A;  3OXN A;  2H5Y A;  3D4C A;  3BKI B;  1PB9 A;  5CMC A;  3VE1 B;  2O1M A;  4GOT A;  3U93 A;  4NE4 A;  4DIG A;  3C4M A;  2DE2 A;  2H4I A;  2Y84 A;  3WAE A;  1IXI A;  4F39 A;  1VR5 A;  1SVX B;  1PBP A;  1AH5 A;  3TQW A;  4LZ8 A;  3UN6 A;  3MVZ A;  4IB2 A;  4GF8 A;  1MM6 A;  3TMG A;  5JK4 A;  1SD3 A;  5AA2 A;  2Z8F A;  1P1U A;  2Z22 A;  5CMB A;  3B7D A;  2O1L A;  3HCQ A;  1ZIU A;  3TQL A;  3G3J A;  1HSE A;  1ELJ A;  3CSB A;  1LAG E;  1MXW A;  2AYS A;  1WVJ A;  2ANJ A;  4ND9 A;  4Q5T A;  3TCH A;  3TCF A;  3TEL A;  4ECF A;  3DEL B;  3W15 C;  1VFD A;  4F18 A;  3OMB A;  1R9L A;  1Y1M A;  1UQW A;  3KG2 A;  4G8N A;  3PMV A;  5I2N B;  4QFL A;  4QFP A;  5ICT A;  1XHY A;  3IB2 A;  3G3G A;  3S9E A;  2HFB A;  2DS9 A;  3PU5 A;  1B51 A;  1JEU A;  4QFO A;  3K01 A;  3ZKK A;  3HHF A;  5DYH A;  4RNS A;  3EQ1 A;  1AMF A;  1TFD A;  3TZA A;  2QMW A;  4F3B A;  1MPD A;  2I0B A;  3K1M A;  3G3F A;  3QIM A;  1F9B A;  2R71 A;  3JYR A;  1US4 A;  1B0L A;  2E1S A;  2Q2C A;  3R7X A;  5CBR A;  1OLC A;  4X9T A;  2DWJ A;  1PB8 A;  1LAH E;  2QJE A;  4FJP A;  1N7W A;  2DVZ A;  5ITP A;  3QYT A;  4ESX A;  1EH3 A;  2UVI A;  4IO2 A;  2OBG A;  1Y3P A;  1LAX A;  3O9P A;  1MY1 A;  1QKB A;  3RT6 B;  1TFA A;  1MH3 A;  2VGQ A;  4H0W A;  1GTK A;  1IXG A;  3DP8 A;  1B7Z A;  4RYA A;  3T93 B;  4F3S A;  2DXY A;  1MY2 A;  2P1S A;  3V83 A;  3DLN A;  3H06 B;  3VXB A;  5JTY A;  2GRV A;  5JTY B;  3FVN A;  4G77 A;  3OO7 A;  4MLV A;  4BDR A;  4AB5 A;  3K6V A;  4QRZ A;  2XXW A;  5L8D A;  5FHO A;  1JEV A;  3PUY E;  2DOJ A;  3PPR A;  3PV0 E;  4HS7 A;  4LAT A;  3IOV A;  4QFK A;  4IGR A;  1PEB A;  4HCW A;  1EZP A;  4C0R A;  3KSX A;  4Z7E A;  2OJT A;  2UXA A;  4M4G A;  3TOD A;  4F2O A;  3T9H B;  3N6U A;  3TFL A;  1PBQ A;  2XXX A;  4DDD A;  3HPI A;  1D4N A;  1MDQ A;  1Y20 A;  4YU0 A;  2OCU A;  1FQF A;  1M5D A;  4GXS B;  1Y3N A;  1SW4 A;  1MQG A;  2RC8 A;  5I56 A;  5TP9 B;  1B3F A;  2PBW A;  2H99 A;  4IO4 A;  4NF6 B;  3H6T A;  5H8H B;  4DCX A;  4DXC A;  1B40 A;  2H25 A;  2IA4 A;  4XIG Q;  1QUK A;  2Y7P A;  4Q0C A;  3MZ9 A;  1WDN A;  2UYF A;  3TCG A;  4YMB A;  1POT A;  1IIT A;  1A54 A;  3WAF A;  3B6Q A;  1P1W A;  2OWS A;  4PFW A;  4DXU A;  1YAE A;  1MXV A;  1ANF A;  1OQH A;  3KJ7 A;  2DWA A;  4DCY A;  3S9L C;  2DP8 A;  2XXV A;  2XXU A;  1B7H A;  1MY3 A;  2ZNU A;  3FZV A;  4JWX A;  1MQJ A;  4BDN A;  1FQE A;  1PB7 A;  2AL5 A;  4JWY A;  1H76 A;  3E9X A;  1QW0 A;  1LFG A;  1R6Z A;  4OET A;  1GR2 A;  1MXZ A;  3Q29 A;  4R9G A;  3G3I A;  1B52 A;  1SI0 A;  3IB1 A;  2HQ0 A;  4HTG A;  4YB5 A;  5A5X A;  2Q89 A;  3BFU A;  4OMB A;  3KFM A;  4OXV A;  4P0I A;  1FTO A;  2QRY A;  1VSO A;  1CB6 A;  3TTM A;  3JZJ A;  5AA2 D;  4X1B A;  2YJP A;  4ZE9 A;  4GRK A;  4OZ9 A;  2RCB A;  1RYO A;  3FAT A;  1N84 A;  5CM6 A;  3ECR A;  4NF8 B;  3S9M C;  1SYH A;  3H6V A;  4KHZ E;  3L6H A;  2B65 A;  4OEV A;  3TTN A;  4OQO A;  3UGW A;  3VXC A;  1D3K A;  3PPQ A;  5AA1 A;  4BDQ A;  4OFJ A;  2F97 A;  5L9O A;  1USY E;  4H65 A;  2PMS A;  1JNF A;  3KSJ A;  2ZNT A;  2ZYK A;  5DT6 A;  3MPL A;  1NH8 A;  2F7A A;  5FTH A;  3SEW A;  1SBP A;  1UIU A;  3DP6 A;  5DTB A;  4JBZ A;  1YCJ A;  3N6T A;  2Q88 A;  2Z8E A;  4RK9 A;  3QAX A;  4YAH X;  5H8S A;  4E0W A;  3G7W A;  2PVU A;  1YPN A;  3Q28 A;  4R2F A;  4THI A;  1S50 A;  3RTW B;  2FYI A;  3MP8 A;  4GIZ A;  4OER A;  1B4H A;  3LSW A;  5H8Q A;  4BLA A;  4DXB A;  2I4C A;  2CZL A;  3Q25 A;  1N3W A;  3OO9 A;  1B6H A;  4OWD A;  4OFO A;  1PC3 A;  1H45 A;  3MZ1 A;  4LON B;  4G8M A;  2NWJ A;  1TWY A;  1BIY A;  3MAM A;  5DVF A;  3BBR A;  1B46 A;  3THI A;  5L9S A;  3N94 A;  1DTZ A;  2G29 A;  1P1Q A;  1NNF A;  1OQG A;  3IOT A;  1A40 A;  4GWO A;  1DOT A;  1S7Y A;  2ONK E;  1LAF E;  1Y9U A;  1QUI A;  2I6E A;  1UTB B;  2O6A A;  3U92 A;  5ICQ A;  5AA4 B;  5ISU A;  4OYV A;  1MM7 A;  1N04 A;  1QVS A;  1D9Y A;  4GL8 A;  1URD A;  3CR9 A;  2I4B A;  1YTV A;  2RC7 A;  3K6W A;  4YIC A;  1JET A;  2ESN A;  1KWH A;  1OVB A;  3K6X A;  2F35 A;  4R6Y A;  5ELV A;  3QUF A;  1MDP 1;  1JW5 A;  3PGF A;  1MY0 A;  4KYD A;  3UP9 A;  3FJM A;  2D3I A;  3VVD A;  1SI1 A;  3MQ9 A;  4P11 A;  1LBB A;  4EDP A;  4F2Q A;  5CRY A;  3CVG A;  1WOD A;  1N7X A;  2ZYM A;  4N13 A;  1XOC A;  2ONR A;  4GQO A;  3FXQ A;  5DEX B;  3VLW A;  1MPC A;  4QFN A;  1LB8 A;  3GLB A;  3VLU A;  2XHD A;  3B6W A;  2A5T A;  4GL0 A;  4KCC A;  3OEN A;  4U2R A;  1UTH B;  2Y7K A;  2HEU A;  2O7U A;  2XXR A;  1URS A;  4TLM B;  4ZZE A;  1I69 A;  4F1U A;  1NNT A;  1NH7 A;  3CFX A;  4C1T A;  2I3W A;  3S4U A;  2NUV A;  5FTI A;  3HHG A;  4ZED A;  2VP1 A;  2HAV A;  3O6G A;  4G68 A;  4MH5 A;  4XKP A;  3PUV E;  4NTL A;  4TQU Q;  3D4G A;  4BDO A;  4XKQ A;  2ZNS A;  4YKP A;  3FGS A;  4F3G A;  3UOR A;  4POW A;  4RPO A;  1IUD A;  3PPN A;  3PPP A;  5DVJ A;  3SET A;  1B0H A;  3EPE A;  3MBP A;  3SDF A;  2THI A;  1SQY A;  2BJJ X;  3K0V A;  4OEU A;  4OES A;  4H8J A;  4R2B A;  4R6K A;  1B3E A;  3VDF A;  1FW0 A;  3FJG A;  1LGB C;  3LBS A;  4N07 A;  3KN3 A;  1FTJ A;  3HO7 A;  3MWB A;  5M2V A;  1IXH A;  4LQ5 A;  2P2A A;  2F6P A;  3CFZ A;  3QK6 A;  3DP4 A;  3IX1 A;  1AOV A;  4JSO A;  3E4R A;  3MP1 A;  4PE5 B;  3U72 A;  3U8Q A;  5A5X B;  1B2H A;  1JW4 A;  4WED A;  3SEX A;  2PYY A;  3OEK A;  1US5 A;  2F7C A;  2D5W A;  3K1P A;  4LUB A;  4H8I A;  1Q1K A;  1TT1 A;  4NF5 A;  1OMP A;  3PPO A;  1B3G A;  4JDF A;  4OFL A;  2H98 A;  3O66 A;  2Y7R A;  4G2Z A;  3S2V A;  5DEX A;  3EHT A;  3UA8 A;  3ILT B;  2OK2 A;  1B5I A;  5FHN A;  4YB7 A;  4ZEB A;  2VHA A;  3MVW A;  5B70 A;  2Z8D A;  2CMO A;  3MVX A;  1TXF A;  5HPQ A;  1Y4T A;  4U4X A;  3KZG A;  3PMW A;  4I1D A;  5EHM A;  1ATG A;  1LLS A;  1S9T A;  1XVX A;  2DWH A;  4P0G A;  1P99 A;  1BP5 A;  2PT1 A;  2QS4 A;  4PFU A;  5H8N A;  4ELR A;  5IKB A;  4UA8 A;  4I62 A;  1VFE A;  1EZ9 A;  1N0T A;  2QMX A;  3OO6 A;  3M8U A;  1M5F A;  3O28 A;  4O3B A;  2PX1 A;  3H03 A;  3R6U A;  1VE4 A;  1Y3Q A;  2FNC A;  2R9J A;  3RN8 A;  3T9X B;  2GHA A;  4R9F A;  2XXH A;  1ZU0 A;  2RC9 A;  2HZK A;  4X1D A;  5TU0 A;  5I59 A;  1FCK A;  4U1O A;  2FA7 A;  3IO6 A;  2NVU B;  3IAZ A;  3O29 A;  3TTR A;  4H5F A;  4KFQ A;  4E0X A;  2Q8J A;  2REG A;  3MZB A;  3O97 A;  1BLF A;  4MBP A;  3KN8 A;  3LSF B;  4LZ5 A;  1L5T A;  3MPK A;  2I3V A;  4IO7 A;  3I3V A;  3FUZ A;  1LFI A;  3LR1 A;  4O3A A;  1IXC A;  4H5G A;  4KYS A;  4X48 A;  5KCJ B;  1FTL A;  1AL3 A;  4IO6 A;  2X7Q A;  3MP6 A;  1J1N A;  4G68 B;  3T66 A;  4HW8 A;  5K2Y A;  1URG A;  3EF7 A;  4EF2 A;  1A7L A;  3TTL A;  3U1O A;  1IIW A;  1DPP A;  4OTE A;  4YMA A;  4O3C A;  2A5T B;  4U4S A;  4JB7 A;  4AQ4 A;  2RIN A;  2XX8 A;  5ITO A;  5BUU A;  1MPB A;  3PUX E;  4NF8 A;  2Y7W A;  2DE3 A;  4DLD A;  3U94 A;  5F7V A;  3GBA A;  1SYI A;  3ONM A;  4JSD A;  5I59 B;  2QS1 A;  3K6U A;  2H9B A;  4ZEC A;  5I57 A;  4WEP A;  1EZO A;  1Y4C A;  5AA2 B;  3PD9 A;  3PD8 A;  1A8F A;  2QS3 A;  3HV1 A;  3O6I A;  3K2D A;  3CSG A;  1NMU A;  4OEN A;  4QSD A;  1M5E A;  3TKD A;  1B32 A;  3OSQ A;  4FEC A;  1P1N A;  2Z23 A;  3RY3 A;  2XD3 A;  5LOM A;  3RPW A;  1I6Q A;  2OLB A;  2WKY A;  3CFL A;  4RJZ A;  4FAJ A;  3TEP A;  3H3G A;  4F29 A;  1QUJ A;  2O7I A;  2VOZ A;  4RK2 A;  2XX9 A;  2X26 A;  3M3K A;  3IOR A;  4I8C A;  5DVI A;  3A3C A;  3LUY A;  2P0S A;  2Q9T A;  4GVO A;  3IOU A;  1MG1 A;  3G3K A;  2NOO A;  3PUZ E;  2DSF A;  5AA3 A;  2HZL A;  4GLI A;  4BDL A;  1LB9 A;  2RCA A;  3H7M A;  3SEV A;  3IK6 B;  5I56 B;  3TPA A;  3R26 A;  1B7U A;  1B9J A;  2ABH A;  4XXU A;  4Q8R A;  2DXR A;  1DMB A;  1NKX A;  4XTC Q;  1A55 A;  3K1N A;  5FHM A;  3VVE A;  5EYF A;  2QS2 A;  4IO5 A;  3KOS A;  3W9W A;  4EQB A;  4I9D A;  1H43 A;  3H6U A;  1HSJ A;  3A09 A;  3T96 B;  4U1Z A;  1Q35 A;  3RNN A;  3V5A A;  2E0S A;  3N5L A;  1FQB A;  4IY5 A;  1GGG A;  4LQ2 A;  2X7P A;  4EQ9 A;  4NF5 B;  4F3P A;  3OD7 A;  2O84 X;  2V84 A;  1R9Q A;  3C33 A;  4KQP A;  4KD5 A;  2V93 A;  3T22 A;  3FXU A;  4DE8 A;  4GFR A;  2F34 A;  3FD3 A;  1BKA A;  2VD3 A;  4PFY A;  4F22 A;  1JQF A;  5I57 B;  1NNK A;  1JVX A;  1LST A;  5I84 A;  2V3U A;  3HST A;  1MRP A;  3IL1 B;  1FTM A;  4PET A;  5EHS A;  1NFT A;  3USD A;  4G4P A;  5F1Q A;  3LC8 A;  1FTK A;  3QXM A;  1IQ7 A;  4RXL A;  5CBS A;  4HCY A;  4KYE A;  3VLV A;  1MQD A;  1M5C A;  1H3D A;  2DE4 A;  4K3F A;  1Y1Z A;  2F7B A;  3IB0 A;  2XXT A;  2DVC A;  1ZJL A;  1OVT A;  3MVY A;  5B7D A;  3VV5 A;  5CMK A;  2XXY A;  3I5O A;  4ZEK A;  4YKJ A;  5I58 A;  4OVJ A;  4R6H A;  4KCD A;  4RPN A;  1O7T A;  2YLN A;  4Q30 B;  5KCJ A;  4ZEF A;  2QPQ A;  1SDX A;  1OIB A;  3W9V A;  4ONY A;  3AXF A;  2F36 A;  3MW0 A;  4U21 A;  1B1X A;  4ELQ A;  5HBC A;  4FAT A;  4POX A;  1B4Z A;  3LSL A;  1QJM A;  2ONS A;  1UTH A;  1Z7M E;  4NF6 A;  2O69 A;  4OHN A;  5H8H A;  5I2N A;  3Q26 A;  3SES A;  3MUQ A;  1MQH A;  3SEU A;  3FVK A;  5AA4 A;  2PT2 A;  3OEL A;  1GVC A;  1LFH A;  2V25 A;  1NL5 A;  1QUL A;  2I58 A;  2DQV A;  3H4Z A;  2HAU A;  3FAS A;  2DWI A;  3C32 A;  4RA1 A;  2VD2 A;  4UAC A;  4NMY A;  2OWT A;  2Q2A A;  3C9H A;  1ZKB A;  4QSC A;  5TPA A;  4LVQ A;  4EUO A;  1Z7N E;  1FQD A;  4R74 A;  5L9M A;  2XD2 A;  4ESW A;  2I49 A;  5H8N B;  5H8Q B;  1O64 A;  1XS5 A;  2LAO A;  3H6W A;  4MF3 A;  3KN7 A;  2ALU A;  4FED A;  3T9V A;  1MXY A;  2I0C A;  4F1V A;  1PDA A;  2NXO A;  4H6D A;  4PP0 A;  1T0K A;  4NF4 B;  3SKP A;  2ZYN A;  3FVG A;  1MXX A;  1O63 A;  4IO3 A;  3K00 A;  1XC1 A;  4G68 C;  4QSE A;  4TOZ A;  1CE2 A;  4AB6 A;  3LSX A;  2XX7 A;  1ZBM A;  4C1U A;  3O2A A;  3V89 B;  4PQJ A;  1B3H A;  5KDT A;  4FIM A;  2O68 A;  1B3L A;  2AL4 A;  2F6G A;  2DYX A;  2HCA A;  2V3T A;  4KPT A;  1A8E A;  1JW1 A;  2GHB A;  4H67 A;  5CI5 A;  4GD5 A;  1QKA A;  2GFE A;  1ZTY A;  3A3U A;  3B6T A;  3FIR A;  4BDM A;  2RKM A;  1B58 A;  3K4U A;  3PUW E;  3MJN A;  4YB6 A;  3FXR A;  3EN3 A;  3RT8 A;  3IJO B;  3KBR A;  4LZ7 A;  4XKR A;  4JWO A;  4ZEI A;  4R75 A;  4ISU A;  1SW1 A;  2XXI A;  3C36 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...