1NL5A

Engineered high-affinity maltose-binding protein
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
366
structure length
366
Chain Sequence
KIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYGDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATAENAAKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTRITK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Maltose-binding periplasmic protein
publication title Insights into the Conformational Equilibria of Maltose-binding Protein by Analysis of High Affinity Mutants.
pubmed doi rcsb
source organism Escherichia coli
total genus 119
structure length 366
sequence length 366
ec nomenclature
pdb deposition date 2003-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1nl5A02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1nl5A01
4Z0IA 4KCDA 3UGWA 1IITA 3ONMA 4IB2A 4IY6A 4H8JA 3MVXA 3JZJA 1MXUA 2OCUA 4ELPA 3FV1A 2O1MA 1XVXA 4QSDA 4I1DA 1M5BA 3G7WA 3SERA 4OESA 1TFAA 1N7WA 4BDQA 2QS3A 1A8EA 1P1QA 4QHQA 2QS2A 3H3GA 3FVGA 3HPIA 3Q28A 1PBPA 2A5SA 5ELVA 3IOUA 1SD3A 1GR2A 4G68A 3ILUB 3CG1A 2Q2AA 2I3WA 1LSTA 1FTOA 1A55A 4G68B 4E0WA 2VD2A 2RC8A 2V93A 3C4MA 2ZNUA 4LVQA 2UVJA 1MPDA 4MH5A 1LLSA 1SW1A 2ZNTA 4WKMA 2Z22A 1DTGA 3FJ7A 3FVKA 4OVJA 1B7HA 1URGA 4THIA 1AIVA 1WVJA 1B1HA 1SDXA 3MUQA 3C34A 2Q88A 2NVUB 4KHZE 5ITPA 2F5XA 3IX1A 3S9LC 1MY1A 4U4XA 5KCJA 3TEPA 3KGCA 3PPQA 2PYYA 4JWOA 2ZNSA 1IXCA 4X1DA 3L6HA 2E1SA 3PD8A 3RQTA 4X48A 2D21A 5DVFA 1A8FA 3MZ1A 3PPNA 1MS7A 2YPNA 3CI8A 3K0VA 2DVCA 2X7PA 2XXWA 4N07A 5DVJA 3C32A 1B3FA 3IOTA 4OENA 4R6HA 2DS9A 2E0SA 1B6HA 1Q35A 1IXIA 3EQ1A 1QKBA 3IAZA 4C1TA 3UK4A 2RCBA 4X1BA 3G3IA 1M5FA 1N3XA 2XD2A 3K6UA 5BUUA 3UIFA 2FYIA 3K01A 2I48A 5JEIA 4QSEA 4PFYA 3K00A 1PEBA 3USDA 2B3FA 1Q1KA 4XKRA 3UORA 3ZSFA 1I6BA 4DDDA 3SEYA 2OBGA 5TP9B 4GQOA 4F2QA 3HHGA 3O6IA 3W15C 1P1UA 4IY5A 1I69A 4JSOA 3CSBA 4I9DA 3SEWA 3OSQA 1P1OA 3T96B 2VD3A 4DXUA 4Z7EA 4R2FA 3VE1B 3PPPA 3KN7A 2GRVA 4LZ5A 2XXQA 2HFBA 3ZS6A 2XXUA 1D9YA 4YKKA 4P0IA 1N76A 2H25A 1MM6A 4EXKA 1NL5A 1SQYA 2GH9A 2ZMBA 3IR1A 3KN3A 5DEXA 3LSLA 3IO4A 5DEXB 1ZJLA 4QSCA 1OQHA 4WXJA 3M8UA 2PBWA 1TXFA 4GWOA 5AA3A 1MY0A 4HS7A 2P2AA 2XXIA 4H1XA 4YMAA 4H6DA 1SI1A 2O51A 4KD5A 1MY2A 3BFUA 4LATA 4L17A 4PQJA 3S9MC 5CC2A 4I62A 2VOZA 3GXAA 1MRPA 3PV0E 2FA7A 3S2VA 4C0RA 3O9PA 5ITOA 3E3KA 1NNKA 1NH8A 3FXQA 3H03A 4IO3A 3SKPA 2H5YA 3PU5A 4GL8A 4PFWA 5DT6A 4YAHX 1LCFA 5AA2A 2GHAA 2HAVA 2DXRA 2O68A 2Y84A 2I3VA 3E13X 5H8HA 2O6AA 3C35A 2H98A 1USYE 1R1NA 3WAFA 3MP8A 4QFLA 1B40A 1F9BA 5H8HB 2ZYNA 1LB9A 2F7AA 5FHNA 1USYH 2UVHA 1M5DA 3G3HA 3MPKA 1LFIA 4G4PA 4JBZA 3T9HB 2KLFA 4XKPA 2G29A 3CIJA 5DTBA 1MXWA 1A54A 1EZOA 1EZ9A 3K1PA 3T9XB 1SYHA 1MG1A 4NTLA 2DVZA 2QSXA 3O6GA 4HCWA 1MXZA 2A5TA 1WDNA 3HCQA 3OEKA 1GGGA 2OWSA 3KSXA 4Q5TA 2PVUA 2UYEA 2DWHA 5H8NA 2Q8JA 3GBAA 4MF3A 3IL1B 3O6HA 4MLVA 4NF6A 3DP4A 4H0WA 3RT6B 3VLUA 4RYAA 4GF8A 2HXWA 5H8NB 1FTLA 3QK6A 5CI5A 4NF6B 1IQ7A 3R6UA 1OMPA 3MZBA 2Y7IA 5HM4B 3CFZA 2I4BA 2F7BA 3IORA 4DLDA 1YPNA 2D3IA 1JQFA 2F8DA 4KR5A 1MPCA 3T93B 1M5EA 5JTYA 5DYHA 1LGBC 3K6VA 2RINA 4OETA 3C9HA 3LC8A 3T66A 3TQWA 4ESXA 1IUDA 3U94A 3KSJA 5JTYB 3GBBA 2FNCA 2QL3A 3OO9A 5DVIA 3S9NC 2NUVA 5A5XA 4ELOA 4RPOA 3OO6A 1PDAA 3KOSA 3H6TA 2XXXA 2GFEA 4IO5A 5A5XB 4FORA 3B6WA 3IOWA 3GZGA 4H5GA 1H76A 2B3BA 3KEIA 3FATA 1PC3A 3TTLA 5CMMA 1Y4CA 1B4ZA 2ABHA 2OLBA 3RN8A 1O63A 1LFHA 3EHUA 1NFTA 2H99A 2Z8DA 3KOTA 3PUWE 2ONRA 1H45A 2XXRA 2QMXA 3FVOA 4MLQA 4X9TA 4NWDA 2XXTA 3I5OA 1GVCA 4FEBA 5AE4A 4KPTA 5TU0A 2Y7RA 2ZYKA 4QFOA 1SYIA 3EPEA 4U1ZA 1II5A 3VVEA 3K6XA 4U2RA 4F19A 4F3SA 4XIGQ 2DSFA 5AA2D 4AB5A 1B3LA 3N94A 1H44A 2HQ0A 1QUKA 1LCTA 4LZ7A 3ZKLA 3PMWA 2Q2CA 1PBQA 3RLFE 1VSOA 3DLNA 1MDP1 2V3UA 1M5CA 5I2NA 4FECA 4KFQA 3TPAA 3HSTA 1SW5A 3K02A 4IO2A 1R6ZA 3PUZE 3LR1A 4DXCA 3SESA 5I2NB 2ZYOA 5I57A 2CMOA 5CMKA 2PX1A 1FQDA 1MPBA 5IAIA 2QS4A 4U23A 4R6KA 1PB8A 5I57B 4DCXA 1N04A 4JDFA 2ONSA 1LAGE 1L5TA 4JXIA 3FJGA 4KYEA 2UXAA 3PD9A 3H6VA 3T9VA 1RYXA 5TPAA 1YCJA 4G77A 3RTWB 1IXHA 1N0TA 3SEXA 3TTMA 3F11A 2THIA 1SBPA 3TQLA 1LFGA 3QXMA 5TPAB 4POWA 4U21A 1O64A 3OXNA 4F39A 4YKIA 1A40A 2M8CA 4KYSA 2XX7A 4OYVA 3FXUA 1DTZA 1T0KA 2QPQA 2PT1A 2DYXA 1Z7NE 2VP1A 3HO7A 4NE4A 1OLCA 4FJPA 4ZEKA 4BDOA 1B5IA 1B05A 3LSXA 3G3FA 2AIXA 3H7MA 2DP8A 4KI0E 4MBPA 3KN8A 3D4GA 2X26A 3R26A 4P11A 4ZDMA 4OHNA 1GV8A 1B0LA 1LAXA 5H8SA 3TTNA 4R9FA 1D4NA 1NKXA 3JYRA 4JB7A 3MAMA 4FATA 1ELJA 3KBRA 2QJEA 3KFMA 4RK9A 3MBPA 5TP9A 2NWJA 1OLAA 5CBSA 3CFLA 2W7YA 2REJA 4LA9A 5H8QA 4F3GA 5K2YA 1UQWA 4XKQA 3MQ9A 2V84A 1MXXA 4XXUA 1HSJA 5I58A 4OFLA 5H8QB 2R9JA 1QW0A 1AMFA 3K4UA 1LAFE 5CM6A 5I58B 4LP2B 4N6PA 1FQFA 5I84A 4OQOA 4F1UA 3VVDA 3LSWA 1B52A 1MDQA 1B3HA 1B5JA 4R2BA 4RY1A 1JW5A 3L6GA 4IO7A 4FAJA 2XX8A 4YKPA 4O3AA 2I4CA 3N26A 2XD3A 3MP1A 2DE3A 3VDFA 3CSGA 4OEUA 4NMYA 4BDRA 3IB1A 3O28A 4OERA 1B9JA 1VR5A 5H8FA 5L8DA 1SW4A 1P1WA 1XT8A 4U4SA 3N5LA 3RGYA 2XHDA 1ZKBA 2HCAA 5H8FB 1DOTA 3RY3A 4YB6A 3PPRA 1N3WA 1P1NA 4OXVA 1EZPA 2VGQA 4ND9A 4ZEIA 1S9TA 2HZKA 3T22A 4ZECA 5EYFA 1LBBA 2AL4A 3RTFB 2F6GA 1S7YA 1Y20A 3PUYE 4POXA 3IB2A 1ZBMA 3TUSA 3H6UA 4LQ2A 2XXHA 2Y7PA 2O7IA 3OELA 1UIVA 4PFUA 4YB7A 1I6AA 4BLAA 1PB9A 3O66A 3TTRA 4M1VA 1BKAA 5KZTA 5IKBA 4F29A 4F1YA 4DIGA 4DXBA 1JW1A 3FASA 1VE4A 4YB5A 1YTVA 1Y3PA 2DE2A 2V3TA 3S4UA 2DQVA 1Y1MA 1QUJA 1MQHA 2HAUA 2V3QA 5ICTA 3ODBA 2OWTA 4RXLA 1FQBA 3SETA 3U8QA 4F22A 3DP6A 4ELQA 3VXCA 2REGA 4ZE9A 3Q27A 3PMXA 4Q0CA 4ZZAA 3EN3A 4NF8A 3MZ9A 3O2AA 2NXOA 1S50A 4LONB 2RKMA 4AQ4A 2Z8EA 4EDPA 2F36A 4KQPA 4YKJA 4R72A 3B6TA 3HV1A 4NF8B 1DMBA 1N7XA 1JVYA 4QRZA 3OENA 4H8IA 1BP5A 1VFEA 1FTMA 1FTJA 4EF1A 3HHFA 3SEVA 3RT8A 4PP0A 3DELB 3GLBA 1FCKA 3BBRA 1OIBA 4RJZA 3CRBA 3CFXA 2R71A 1JETA 3SEUA 4UACA 2O7UA 1MQIA 4M4GA 1R9LA 3B7DA 1MQJA 3M3KA 2ANJA 1D3KA 3Q25A 1QULA 1H43A 2H9BA 1MQDA 4OFOA 1R9QA 4R74A 5B70A 2GHBA 3BFTA 5EHMA 4BDLA 4Q8RA 1IXGA 4IO4A 1XHYA 4JWXA 1GTKA 1HSEA 4LUBA 1O7TA 3UN6A 3H06B 4JWYA 1B46A 2HEUA 5K2XA 1P99A 2YLNA 3SDFA 3W9WA 3IB0A 2V25A 2PMSA 2R6GE 3TTKA 3THIA 3MVWA 2IA4A 3QIMA 1B2HA 3FZVA 4EF2A 3RNNA 2OK2A 4H5FA 1KWHA 2ZYMA 4WEPA 4EQ9A 1SVXB 1B3GA 4PFTA 5ICQA 3W9VA 3O29A 1EH3A 4ZS9A 5FTIA 3RUMA 2O1LA 1NNFA 1B0HA 1XC1A 3OMBA 4GVOA 4IO6A 2DOJA 1FQCA 1B58A 1OVTA 4G2ZA 1TFDA 1QVSA 4O3BA 4F1VA 3OEMA 2WKYA 4GRKA 3FD3A 4IGRA 3TODA 3IJOB 3LBSA 4MFIA 3EF7A 4ZEDA 1VFDA 4GL0A 1UTBA 3DP8A 1OVBA 3KJTA 1NNTA 1XS5A 4Q30B 3VXBA 1UTBB 3CR9A 3FUZA 4FIMA 4P0GA 2P0SA 1UTHA 3RPWA 2G93A 4EXLA 3B6QA 4U1OA 3ECRA 2Z23A 5J1DA 1I6QA 1UTHB 4OWDA 1LBCA 1RKMA 3MPLA 2PT2A 4GD5A 2B65A 3U92A 3PUXE 2UVGA 3I3VA 1XVYA 1AOVA 5L9OA 3FXRA 3V8XB 4GXSB 1BTJA 1D9VA 1NH7A 1POY1 1YAEA 1XOCA 5LOMA 2RC9A 3MVYA 4R73A 4G8NA 4PE5B 1POTA 3FIRA 4F3BA 3QSLA 3MC2A 3FJMA 4NF5A 3O97A 1B7ZA 3TELA 1Y4TA 2X7QA 2F78A 4F3PA 3V89B 4NF5B 3VLWA 3IOVA 1Y3QA 3DM0A 3FGSA 3S9EA 3ILTB 4RK2A 4AB6A 4F2OA 4GOTA 1B1XA 4O3CA 1MXYA 2DXYA 2ONKE 4EQ7A 2Z8FA 4HTGA 3TCHA 1B32A 5CMBA 5FHMA 1IZ1A 1US5A 1N84A 3A3CA 4RPNA 3BKIB 4QFNA 3I6VA 3H4ZA 3CVGA 1UIUA 1TWYA 2XXPA 3AXFA 3Q29A 2UVIA 1ZMGA 3VFJA 1BLFA 5I56A 3OSRA 4F31B 2HZLA 3N6TA 4LZ8A 1EU8A 2AYSA 3WAEA 5KCJB 3OO8A 3KJ7A 5I56B 1JEVA 4KYDA 2NOOA 1CB6A 2XX9A 1CE2A 4RNSA 2UYFA 4YZZA 4TOZA 1H3DA 1TT1A 2Y7WA 1RYOA 3KZGA 2DWJA 2YJPA 4LQ5A 3M3FA 3LSFB 3PMVA 1URDA 4F18A 5CBRA 3T9UA 4ONYA 5EHSA 3G3KA 1LAHE 3IJXB 3OO7A 4YICA 4HW8A 4IGTA 3FVNA 4H65A 4G8MA 4U22A 2P1SA 5FHOA 1ZLQA 3EHTA 1SI0A 1QJMA 3QAXA 4NEDA 3QYTA 2QMWA 3C31A 1AL3A 2Q9TA 4OFJA 3OOAA 4BDNA 1QUIA 3V83A 4XKNA 2I58A 1SW2A 1B3EA 4OTEA 4R6YA 5CMCA 3HN0A 1B5HA 4YMBA 2F34A 3QUFA 2AL5A 1Z7ME 1ATGA 1WODA 2I49A 2ZXTA 2BJJX 4WEDA 1BIYA 3MJNA 1A7LA 1FQAA 1J1NA 2O69A 3CG3A 4ZEBA 3G3JA 4NF4A 4FE8A 1LB8A 3M3LA 5JK4A 5I2KA 1MM7A 4HCYA 5HBCA 5B7DA 5AA4A 4NF4B 4ZZEA 3ZKKA 2DE4A 2XXYA 4EQBA 4G8HA 3K6WA 2DWIA 5I2KB 1JEUA 4OZ9A 5AA4B 1ZTYA 3TCGA 5HPQA 1A99A 3N6UA 1MXVA 2XXVA 1Y9UA 4RA1A 1Y3NA 4YU0A 4JSDA 4ZE8A 1B51A 5L9SA 4DE8A 4OMBA 3E4RA 3U1OA 4PETA 2RCAA 1HSLA 5CRYA 4GFRA 1AH5A 2Q89A 2OJTA 5ISUA 3MP6A 1Y1ZA 2QRYA 4QFPA 2DWAA 4UA8A 4XTCQ 5AA2B 2QS1A 2F6PA 4K3FA 3OD7A 4ECFA 4GLIA 3TZAA 3KG2A 3U72A 3FV2A 1DPPA 3K1MA 2Y7KA 3C36A 4I8CA 1JNFA 2RC7A 4TLLB 3P7IA 4N13A 4ZEFA 4QFKA 1ANFA 2RF1A 3TDJA 4E0XA 1JW4A 4OEVA 5L9MA 1IEJA 1FQEA 3G3GA 4G68C 3MWBA 3A3UA 2A5TB 1NMUA 3EHSA 5F1QA 3H6WA 2I6EA 5FTHA 1QKAA 2D5WA 3R7XA 3TYHA 4C1UA 4DCYA 2F97A 3MVZA 2H4IA 4ELRA 3IO6A 2I0CA 1FW0A 1JVXA 3TMGA 3TCFA 1DSNA 3TAJA 1IIWA 4FEDA 4DZ1A 5M2VA 2LAOA 3VVFA 3A09A 3UP9A 5I59A 3U93A 1ZIUA 3Q26A 1MH3A 2VHAA 3LUYA 3E9XA 2F35A 3TKDA 2F7CA 3V5AA 2ESNA 5KDTA 2OZZA 5I59B 1MY4A 5F7VA 5AA1A 1NNPA 2I0BA 4ISUA 5KDTB 3QUJA 1ZU0A 4TLMB 3C33A 3K2DA 4H67A 1MY3A 3D4CA 3PUVE 4GIZA 4QF9A 4NWCA 3IK6B 1US4A 1URSA 1MH4A 1B4HA 3VLVA 1OQGA 5BWJA 2O84X 1MQGA 4R9GA 3JV9A 3TFLA 3UA8A 1PB7A 3MW0A 4KCCA 4ESWA 1FTKA 4GXAA 3K1NA 1DPEA 3VV5A 2ALUA 4EUOA 1B7UA 3PGFA 2CZLA 4BDMA 4TQUQ 4R75A 2IEEA 3PPOA
chains in the Genus database with same CATH superfamily
4Z0IA 4KCDA 3UGWA 1IITA 3ONMA 4IB2A 4IY6A 3LUZA 4H8JA 3MVXA 3JZJA 1MXUA 2OCUA 4ELPA 3FV1A 5EQAA 2O1MA 1XVXA 4QSDA 4I1DA 1M5BA 2WX9A 3G7WA 5T3JA 3SERA 4OESA 1TFAA 1N7WA 4BDQA 4PF8A 1RDZA 3B50A 2QS3A 4X04A 1A8EA 1P1QA 4QHQA 2QS2A 3H3GA 3FVGA 3HPIA 3Q28A 1G0IA 1PBPA 2A5SA 5ELVA 3IOUA 1SD3A 1GR2A 4G68A 3ILUB 3CG1A 2QFLA 2Q2AA 4GWWA 2I3WA 1LSTA 1FTOA 1A55A 4G68B 4E0WA 2VD2A 2RC8A 2V93A 2PCRA 1NV1A 3C4MA 2ZNUA 4LVQA 2UVJA 1MPDA 2P3NA 3CHGA 4MH5A 4N15A 1LLSA 1SW1A 2ZNTA 4WKMA 2Z22A 1DTGA 3FJ7A 1DBZA 3FVKA 4OVJA 1B7HA 1URGA 4THIA 1AIVA 4PGPA 1WVJA 2VT5A 1B1HA 1SDXA 3MUQA 3C34A 2Q88A 2NVUB 4KHZE 5ITPA 2F5XA 3IX1A 4QBAA 3S9LC 1MY1A 4U4XA 5KCJA 3TEPA 3KGCA 3PPQA 2PYYA 4JWOA 2ZNSA 1IXCA 4O8MA 1JP4A 4X1DA 2JJKA 1SPIA 3L6HA 2E1SA 3PD8A 5IZZA 3RQTA 4X48A 2D21A 5DVFA 1A8FA 3MZ1A 3PPNA 1MS7A 4MAGA 2YPNA 3CI8A 3K0VA 2DVCA 2X7PA 2XXWA 4N07A 1Q9DA 5DVJA 3C32A 1B3FA 3IOTA 2HXRA 4OENA 4R6HA 1NV2A 4N8YA 2DS9A 2E0SA 1B6HA 1Q35A 1IXIA 3EQ1A 1QKBA 3IAZA 4C1TA 1FBFA 3UK4A 2RCBA 4X1BA 3G3IA 1M5FA 1BK4A 1N3XA 2XD2A 3K6UA 5BUUA 3UIFA 2FYIA 2CEXA 3K01A 2I48A 5JEIA 4QSEA 4PFYA 1NV0A 3K00A 1PEBA 4P1LA 3USDA 4H46A 2B3FA 1Q1KA 4XKRA 3UORA 3ZSFA 1I6BA 4DDDA 3SEYA 2OBGA 5TP9B 2PFYA 4GQOA 4F2QA 3HHGA 3O6IA 3W15C 1P1UA 4IY5A 1I69A 4JSOA 3CSBA 4I9DA 3SEWA 3OSQA 1P1OA 2XXKA 3T96B 2VD3A 4DXUA 4Z7EA 4R2FA 3VE1B 3PPPA 3KN7A 2CEYA 2GRVA 4LZ5A 2XXQA 5LTCA 2HFBA 1NV7A 3ZS6A 1IMFA 2XWKA 2XXUA 1LBVA 1D9YA 4YKKA 4P0IA 1N76A 2H25A 1MM6A 4EXKA 1NL5A 1SQYA 2GH9A 2ZMBA 3IR1A 3KN3A 1LEVA 5DEXA 3MSTA 4QXDA 4MNCA 3LSLA 2HHMA 2F3BA 3IO4A 5DEXB 1ZJLA 4QSCA 1OQHA 4WXJA 4X8RA 3M8UA 2PBWA 1TXFA 4GWOA 4OVRA 5AA3A 1MY0A 2Q8MA 4HS7A 2P2AA 2XXIA 4H1XA 4YMAA 4H6DA 4XFEA 1SI1A 4FBPA 2O51A 4KD5A 1MY2A 3BFUA 1RDXA 4LATA 4L17A 4PQJA 3S9MC 3ROJA 2B4MA 5CC2A 4I62A 2VOZA 3GXAA 1MRPA 3PV0E 2FA7A 3S2VA 4C0RA 3O9PA 5ITOA 3E3KA 1NNKA 1NH8A 3FXQA 3H03A 4IO3A 3SKPA 2H5YA 3FXBA 3PU5A 4GL8A 4PFWA 1K9ZA 5DT6A 4YAHX 1LCFA 5AA2A 2GHAA 2HAVA 2DXRA 2O68A 2Y84A 2I3VA 3E13X 5H8HA 2O6AA 3C35A 2H98A 1USYE 1R1NA 3WAFA 4OA4A 3MP8A 4QFLA 1B40A 1F9BA 5H8HB 2ZYNA 1LB9A 2F7AA 5FHNA 1USYH 2UVHA 1M5DA 3G3HA 3MPKA 1LFIA 4G4PA 4JBZA 4P8BA 3T9HB 2KLFA 2FVZA 4XKPA 2G29A 3CIJA 5DTBA 1MXWA 1A54A 1EZOA 1EZ9A 2QVRA 4JVCA 3K1PA 3T9XB 1SYHA 2HPGA 1MG1A 4NTLA 2DVZA 2QSXA 3O6GA 4HCWA 1MXZA 2A5TA 1WDNA 3HCQA 3OEKA 1GGGA 2OWSA 3KSXA 4Q5TA 1FTAA 2PVUA 2UYEA 1DCUA 4PAIA 4OVQA 2DWHA 5H8NA 2Q8JA 5EYHA 1FBDA 3GBAA 3KBZA 1FJ9A 3IL1B 3O6HA 4MF3A 4MLVA 4NF6A 3DP4A 4H0WA 3RT6B 3VLUA 4RYAA 4GF8A 2HXWA 5H8NB 2XA5A 1FTLA 3QK6A 5CI5A 4NF6B 1IQ7A 3R6UA 1OMPA 3MZBA 2Y7IA 5HM4B 3CFZA 5IZ1A 2I4BA 2F7BA 3IORA 4DLDA 1YPNA 2D3IA 1JQFA 2F8DA 4KR5A 1MPCA 3T93B 1M5EA 5JTYA 5DYHA 1LGBC 3K6VA 2RINA 4OETA 3C9HA 3LC8A 3T66A 3TQWA 4ESXA 1IUDA 4I3EA 3U94A 3KSJA 5JTYB 3GBBA 2FNCA 2QL3A 3OO9A 5DVIA 3S9NC 2NUVA 5A5XA 4ELOA 4RPOA 3OO6A 1PDAA 4PBHA 4NGUA 4PDDA 3KOSA 3H6TA 2XXXA 2GFEA 4IO5A 5A5XB 4FORA 3B6WA 3IOWA 3GZGA 4DI4B 5J16A 1YXIA 4H5GA 1H76A 2B3BA 3KEIA 3FATA 1PC3A 3TTLA 5CMMA 1Y4CA 1B4ZA 2ABHA 2OLBA 3RN8A 5I7IA 1O63A 1LFHA 3EHUA 4PF6A 1NFTA 2H99A 1FPLA 2Z8DA 1NV3A 3KOTA 3PUWE 2ONRA 1H45A 4O7MA 2QMXA 2XXRA 3FVOA 1FBCA 4MLQA 4X9TA 4NWDA 1NUWA 2XXTA 3I5OA 1GVCA 4FEBA 5AE4A 2Y5LA 4KPTA 5TU0A 2Y7RA 2ZYKA 4QFOA 1SYIA 3EPEA 4U1ZA 1II5A 4NQ8A 3VVEA 3K6XA 4U2RA 4F19A 4F3SA 4XIGQ 2DSFA 4PCDA 1VDWA 5AA2D 4AB5A 2WYPA 1B3LA 4GWXA 3N94A 1IMDA 1H44A 2HQ0A 1QUKA 1LCTA 2KR0A 4LZ7A 3ZKLA 3PMWA 2Q2CA 4GWUA 1PBQA 3RLFE 1VSOA 5EYGA 3DLNA 2VPNA 1MDP1 2V3UA 1M5CA 5I2NA 4FECA 4KFQA 3TPAA 3HSTA 1SW5A 3K02A 2P3VA 4IO2A 4JVDA 4MMPA 1R6ZA 3PUZE 3LR1A 2KQZA 4DXCA 3SESA 5I2NB 2ZYOA 5I57A 2CMOA 5CMKA 2PX1A 1FQDA 1MPBA 5IAIA 2QS4A 4U23A 4R6KA 4JVIA 1PB8A 5I57B 4DCXA 1N04A 4JDFA 2ONSA 1LAGE 1L5TA 4JXIA 3FJGA 4KYEA 2UXAA 1INPA 3PD9A 3H6VA 3T9VA 1RYXA 5TPAA 1YCJA 4HE1A 4G77A 3RTWB 1IXHA 1N0TA 3SEXA 3TTMA 3F11A 2THIA 1SBPA 3TQLA 1LFGA 4N17A 3QXMA 5TPAB 1FPKA 4POWA 4U21A 1O64A 3OXNA 4F39A 4YKIA 1A40A 2M8CA 4KYSA 3E79A 2XX7A 4OYVA 3FXUA 4MEVA 1DTZA 3E78A 1T0KA 2Y5KA 2QPQA 2PT1A 2DYXA 1Z7NE 2VP1A 3HO7A 1CNQA 4NE4A 1OLCA 4FJPA 4ZEKA 4BDOA 1B5IA 1B05A 2WEFA 3LSXA 3G3FA 2AIXA 3H7MA 3KC0A 4MNIA 2DP8A 4KI0E 4MBPA 3NOHA 3KN8A 3D4GA 2X26A 3R26A 4P11A 4NN3A 3D1RA 4ZDMA 1FPFA 4OHNA 1GV8A 1B0LA 1LAXA 5H8SA 1NUZA 3TTNA 4R9FA 1D4NA 1NKXA 3JYRA 4JB7A 3MAMA 4FATA 1ELJA 3KBRA 1NUYA 2QJEA 3KFMA 4RK9A 3MBPA 4PBQA 5TP9A 2NWJA 1OLAA 5CBSA 2WBBA 3CFLA 5I3SA 4PFIA 2W7YA 2REJA 4LA9A 4PDHA 5H8QA 4F3GA 5K2YA 1NV4A 1UQWA 4XKQA 3MQ9A 2V84A 1MXXA 4XXUA 1HSJA 5I58A 4N8GA 2VPOA 4OFLA 5IM2A 5H8QB 2R9JA 1QW0A 1KZ8A 4N6KA 1AMFA 3K4UA 1LAFE 5CM6A 5I58B 4LP2B 4N6PA 1FQFA 5I84A 4OQOA 4F1UA 3VVDA 1FBHA 3LSWA 1B52A 1MDQA 4IR8A 1B3HA 1B5JA 4R2BA 4RY1A 1JW5A 3L6GA 4IO7A 4FAJA 2DDKA 2XX8A 4YKPA 4O3AA 2I4CA 3RPLA 3N26A 2XD3A 3MP1A 4PTKA 2DE3A 3VDFA 3CSGA 2FBPA 4OEUA 4NMYA 2Q74A 3RPLB 4BDRA 4N4UA 3IB1A 3O28A 5IGAA 4OERA 1B9JA 1VR5A 1FBGA 5H8FA 5L8DA 1SW4A 1P1WA 1XT8A 4U4SA 3N5LA 3T0JA 3RGYA 2XHDA 1ZKBA 2HCAA 5H8FB 4AS4A 1DOTA 3RY3A 4YB6A 5A5LA 3PPRA 1N3WA 1P1NA 4OXVA 1EZPA 2VGQA 4ND9A 4ZEIA 1S9TA 2HZKA 4PFRA 3T22A 4ZECA 5EYFA 1LBBA 2AL4A 3RTFB 2F6GA 1S7YA 1Y20A 3PUYE 4POXA 3IB2A 1ZBMA 3TUSA 3H6UA 4LQ2A 4NF0A 2XXHA 2Y7PA 2O7IA 3OELA 4PFBA 1NV5A 3LV0A 1UIVA 4PFUA 4YB7A 1I6AA 4BLAA 1PB9A 3O66A 3TTRA 4M1VA 1BKAA 5KZTA 5IKBA 4F29A 4F1YA 4DIGA 4GWZA 4DXBA 1JW1A 3FASA 1VE4A 4YB5A 1YTVA 1Y3PA 2DE2A 2V3TA 3S4UA 2DQVA 1Y1MA 1QUJA 1MQHA 2HAUA 2V3QA 5ICTA 3ODBA 2OWTA 4RXLA 1FPIA 1FQBA 3SETA 5I5PA 3U8QA 4F22A 3DP6A 4ELQA 3VXCA 2REGA 5EQ8A 4ZE9A 5FBPA 3Q27A 3PMXA 4Q0CA 4ZZAA 3EN3A 4NF8A 3MZ9A 3O2AA 2NXOA 1S50A 4LONB 2RKMA 4AQ4A 2Z8EA 4EDPA 1LBXA 2F36A 4KQPA 4YKJA 4R72A 3B6TA 2GQ1A 3HV1A 4NF8B 1DMBA 1N7XA 1JVYA 4QRZA 3OENA 4H8IA 2QVUA 4P9KA 1BP5A 1VFEA 1FTMA 1FTJA 4EF1A 3HHFA 3SEVA 3RT8A 4PP0A 3DELB 3GLBA 1FCKA 3BBRA 1OIBA 2CZIA 4P56A 4RJZA 3CRBA 3CFXA 2R71A 1JETA 3SEUA 4UACA 2O7UA 4XEQA 1MQIA 4M4GA 1FPEA 5EQ7A 1R9LA 3B7DA 1MQJA 3M3KA 1QGXA 2ANJA 1D3KA 3Q25A 1QULA 4NG7A 1H43A 2H9BA 1MQDA 4OFOA 1R9QA 4R74A 5B70A 2MKZA 2GHBA 3BFTA 5EHMA 4BDLA 4Q8RA 1IXGA 4IO4A 2XWOA 1XHYA 4JWXA 1GTKA 1HSEA 4LUBA 3RYDA 1O7TA 3UN6A 3H06B 4JWYA 1B46A 2FIEA 2HEUA 5K2XA 1P99A 2YLNA 3SDFA 3W9WA 4N81A 3IB0A 2V25A 2PMSA 2R6GE 3TTKA 2PFZA 3THIA 3MVWA 2IA4A 3QIMA 1B2HA 3FZVA 4EF2A 3RNNA 2OK2A 4H5FA 1KWHA 5IZ3A 3B8BA 2ZYMA 4WEPA 4EQ9A 1SVXB 1B3GA 4PFTA 5ICQA 3W9VA 1AWBA 3O29A 1EH3A 5IZ3B 4DI3D 4ZS9A 5FTIA 3RUMA 1LBWA 2O1LA 1NNFA 1B0HA 1XC1A 3OMBA 4GVOA 4IO6A 2DOJA 1FQCA 1B58A 1OVTA 4G2ZA 1TFDA 1QVSA 4O3BA 1KA0A 4F1VA 3OEMA 1NUXA 3MYUA 2WKYA 4GRKA 1LBYA 3FD3A 4IGRA 3TODA 1IMEA 3IJOB 3LBSA 4MFIA 3EF7A 4ZEDA 1VFDA 4MNPA 4GL0A 1UTBA 3DP8A 4PAKA 3FBPA 1OVBA 3KJTA 1NNTA 1XS5A 4Q30B 3VXBA 4P3LA 2FHYA 1UTBB 3CR9A 1KA1A 3FUZA 4FIMA 4P0GA 2P0SA 1UTHA 4PC9A 3RPWA 2G93A 4EXLA 3B6QA 4U1OA 3ECRA 2Z23A 2QVVA 5J1DA 1I6QA 1UTHB 4MJOA 4OWDA 1LBCA 1RKMA 3MPLA 2PT2A 3A29A 4GD5A 2B65A 3U92A 3PUXE 2UVGA 3I3VA 1XVYA 1AOVA 5ET7A 5L9OA 3FXRA 3V8XB 1FRPA 4GXSB 1BTJA 1D9VA 1NH7A 4MHFA 1POY1 1YAEA 1XOCA 5LOMA 4N6DA 4PAFA 3GYYA 2RC9A 2ZZWA 3MVYA 4R73A 4G8NA 2B4LA 4PE5B 1POTA 4MIJA 3FIRA 4F3BA 3QSLA 3MC2A 3FJMA 4NF5A 3O97A 1B7ZA 3TELA 1Y4TA 1NV6A 1G0HA 2X7QA 2F78A 4F3PA 3EKIA 3V89B 4NF5B 3VLWA 2CZKA 3IOVA 1Y3QA 3DM0A 3FGSA 3S9EA 3ILTB 4RK2A 4AB6A 4F2OA 4GOTA 1B1XA 4O3CA 4MCOA 1YYZA 1MXYA 2DXYA 2ONKE 4EQ7A 2Z8FA 4HTGA 3TCHA 5LDZA 4GWYA 1B32A 5CMBA 5FHMA 1IZ1A 1US5A 1N84A 3A3CA 4RPNA 3BKIB 4QFNA 3I6VA 3H4ZA 3CVGA 4N91A 4NAPA 1UIUA 4O94A 1TWYA 2XXPA 3AXFA 3Q29A 1YZ0A 2UVIA 1ZMGA 3VFJA 1BLFA 4GWSA 5I56A 3OSRA 4UABA 4F31B 2HZLA 5ET6A 3N6TA 4LZ8A 1EU8A 2AYSA 3WAEA 5KCJB 3OO8A 3KJ7A 5I56B 1JEVA 4KYDA 2NOOA 4PE3A 1FPBA 4P1EA 1CB6A 2XX9A 1CE2A 4RNSA 2UYFA 4YZZA 4TOZA 1H3DA 1TT1A 2Y7WA 1FSAA 1EYJA 4P47A 1FJ6A 5F24A 1RYOA 3KZGA 2DWJA 2YJPA 4LQ5A 3M3FA 4NHBA 3LSFB 3PMVA 1URDA 4I3YA 4F18A 5CBRA 3T9UA 4ONYA 2WBDA 5ET8A 4OVTA 5EHSA 3G3KA 1LAHE 3IJXB 5EQ9A 3OO7A 4YICA 4HW8A 4IGTA 3FVNA 1FBEA 4H65A 4G8MA 4U22A 3PTYA 2P1SA 5FHOA 1ZLQA 3EHTA 1SI0A 1QJMA 3QAXA 4GX3A 4NEDA 3QYTA 2QMWA 3C31A 1AL3A 1FPDA 2Q9TA 4OFJA 3OOAA 4BDNA 1QUIA 2CZHA 1IMAA 3V83A 4XKNA 2I58A 4OVPA 3BIGA 1SW2A 1B3EA 3IFCA 4OTEA 4R6YA 5CMCA 3HN0A 1B5HA 2OX3A 4YMBA 2F34A 1DK4A 3QUFA 4PGNA 2AL5A 1Z7ME 1ATGA 1WODA 2I49A 2ZXTA 4I40A 2BJJX 4WEDA 1BIYA 3MJNA 1A7LA 1FQAA 1J1NA 1XI6A 2O69A 3CG3A 4ZEBA 4HE2A 5DW8A 2R8TA 3G3JA 4NF4A 4FE8A 4GX6A 1LB8A 3M3LA 5JK4A 4G61A 3KC1A 5I2KA 1MM7A 4HCYA 2ZZVA 4NX1A 5HBCA 4XF5A 5B7DA 5AA4A 4NF4B 4ZZEA 3ZKKA 2DE4A 2XXYA 4EQBA 4G8HA 3K6WA 1IMCA 2DWIA 3IFAA 1JEUA 5I2KB 4OZ9A 5AA4B 1ZTYA 3TCGA 5HPQA 1A99A 3N6UA 1MXVA 2XXVA 1Y9UA 4RA1A 3QMFA 1Y3NA 4YU0A 4JSDA 4ZE8A 2XWVA 1B51A 5L9SA 4DE8A 4OMBA 4O7IA 3E4RA 3U1OA 1D9QA 4H45A 4PETA 2RCAA 2WYKA 1NI9A 1HSLA 5CRYA 4GFRA 2BJIA 1AH5A 2Q89A 2OJTA 5ISUA 3HFUA 3MP6A 1Y1ZA 2QRYA 4QFPA 2DWAA 4UA8A 4XTCQ 5AA2B 1K9YA 4AS5A 2QS1A 2F6PA 4K3FA 1LBZA 3OD7A 4ECFA 4GLIA 3TZAA 3KG2A 3U72A 3FV2A 1DPPA 3K1MA 2Y7KA 2V4CA 3C36A 4I8CA 1IMBA 4OANA 1JNFA 2RC7A 4TLLB 2F3DA 3P7IA 4N13A 3BIHA 4ZEFA 4QFKA 1ANFA 2RF1A 3TDJA 4E0XA 1JW4A 4GX4A 4OEVA 5L9MA 1IEJA 1FQEA 3T1BA 3G3GA 1FPJA 4G68C 2XWIA 3MWBA 3U65A 3A3UA 2A5TB 1NMUA 3ISPA 2L5VA 3EHSA 4LN5A 5ESYA 5F1QA 3H6WA 2I6EA 5FTHA 1QKAA 2D5WA 3R7XA 4OVSA 3TYHA 4C1UA 4DCYA 2F97A 3MVZA 2H4IA 5ET5A 4ELRA 3IO6A 3SZPA 2I0CA 1FW0A 1JVXA 2ZZXA 3TMGA 3TCFA 1DSNA 3TAJA 4GBVA 1IIWA 4FEDA 4DZ1A 5M2VA 2LAOA 3VVFA 3A09A 3UP9A 1FPGA 1FBPA 2OWZA 4KXPA 5I59A 3U93A 1ZIUA 3Q26A 1MH3A 2VHAA 3LUYA 3E9XA 4MX6A 2F35A 3TKDA 2FIXA 2F7CA 3V5AA 2ESNA 5KDTA 2OZZA 5I59B 1MY4A 5F7VA 5AA1A 1NNPA 2I0BA 4ISUA 5KDTB 3QUJA 4HE0A 1ZU0A 1EYKA 4GBWA 4TLMB 3C33A 3K2DA 4H67A 1MY3A 3D4CA 3PUVE 4GIZA 4QF9A 4NWCA 3IK6B 1US4A 1URSA 1MH4A 1B4HA 3VLVA 1RDYA 1OQGA 5BWJA 2O84X 1MQGA 4R9GA 3JV9A 3TFLA 3UA8A 1PB7A 3MW0A 4KCCA 4ESWA 1FTKA 4GXAA 4HXVA 3K1NA 1DPEA 3VV5A 2ALUA 4EUOA 1B7UA 1EYIA 2CZLA 3PGFA 4BDMA 4TQUQ 4R75A 2IEEA 3PPOA
chains in the Genus database with same CATH topology
4Z0IA 4KCDA 3UGWA 1IITA 3ONMA 4IB2A 4IY6A 4H8JA 3MVXA 3JZJA 1MXUA 2OCUA 4ELPA 3FV1A 2O1MA 1XVXA 4QSDA 4I1DA 1M5BA 3G7WA 3SERA 4OESA 1TFAA 1N7WA 4BDQA 2QS3A 1A8EA 1P1QA 4QHQA 2QS2A 3H3GA 3FVGA 3HPIA 3Q28A 1PBPA 2A5SA 5ELVA 3IOUA 1SD3A 1GR2A 4G68A 3ILUB 3CG1A 2Q2AA 2I3WA 1LSTA 1FTOA 1A55A 4G68B 4E0WA 2VD2A 2RC8A 2V93A 3C4MA 2ZNUA 4LVQA 2UVJA 1MPDA 4MH5A 1LLSA 1SW1A 2ZNTA 4WKMA 2Z22A 1DTGA 3FJ7A 3FVKA 4OVJA 1B7HA 1URGA 4THIA 1AIVA 1WVJA 1B1HA 1SDXA 3MUQA 3C34A 2Q88A 2NVUB 4KHZE 5ITPA 2F5XA 3IX1A 3S9LC 1MY1A 4U4XA 5KCJA 3TEPA 3KGCA 3PPQA 2PYYA 4JWOA 2ZNSA 1IXCA 4X1DA 3L6HA 2E1SA 3PD8A 3RQTA 4X48A 2D21A 5DVFA 1A8FA 3MZ1A 3PPNA 1MS7A 2YPNA 3CI8A 3K0VA 2DVCA 2X7PA 2XXWA 4N07A 5DVJA 3C32A 1B3FA 3IOTA 4OENA 4R6HA 2DS9A 2E0SA 1B6HA 1Q35A 1IXIA 3EQ1A 1QKBA 3IAZA 4C1TA 3UK4A 2RCBA 4X1BA 3G3IA 1M5FA 1N3XA 2XD2A 3K6UA 5BUUA 3UIFA 2FYIA 3K01A 2I48A 5JEIA 4QSEA 4PFYA 3K00A 1PEBA 3USDA 2B3FA 1Q1KA 4XKRA 3UORA 3ZSFA 1I6BA 4DDDA 3SEYA 2OBGA 5TP9B 4GQOA 4F2QA 3HHGA 3O6IA 3W15C 1P1UA 4IY5A 1I69A 4JSOA 3CSBA 4I9DA 3SEWA 3OSQA 1P1OA 3T96B 2VD3A 4DXUA 4Z7EA 4R2FA 3VE1B 3PPPA 3KN7A 2GRVA 4LZ5A 2XXQA 2HFBA 3ZS6A 2XXUA 1D9YA 4YKKA 4P0IA 1N76A 2H25A 1MM6A 4EXKA 1NL5A 1SQYA 2GH9A 2ZMBA 3IR1A 3KN3A 5DEXA 3LSLA 3IO4A 5DEXB 1ZJLA 4QSCA 1OQHA 4WXJA 3M8UA 2PBWA 1TXFA 4GWOA 5AA3A 1MY0A 4HS7A 2P2AA 2XXIA 4H1XA 4YMAA 4H6DA 1SI1A 2O51A 4KD5A 1MY2A 3BFUA 4LATA 4L17A 4PQJA 3S9MC 5CC2A 4I62A 2VOZA 3GXAA 1MRPA 3PV0E 2FA7A 3S2VA 4C0RA 3O9PA 5ITOA 3E3KA 1NNKA 1NH8A 3FXQA 3H03A 4IO3A 3SKPA 2H5YA 3PU5A 4GL8A 4PFWA 5DT6A 4YAHX 1LCFA 5AA2A 2GHAA 2HAVA 2DXRA 2O68A 2Y84A 2I3VA 3E13X 5H8HA 2O6AA 3C35A 2H98A 1USYE 1R1NA 3WAFA 3MP8A 4QFLA 1B40A 1F9BA 5H8HB 2ZYNA 1LB9A 2F7AA 5FHNA 1USYH 2UVHA 1M5DA 3G3HA 3MPKA 1LFIA 4G4PA 4JBZA 3T9HB 2KLFA 4XKPA 2G29A 3CIJA 5DTBA 1MXWA 1A54A 1EZOA 1EZ9A 3K1PA 3T9XB 1SYHA 1MG1A 4NTLA 2DVZA 2QSXA 3O6GA 4HCWA 1MXZA 2A5TA 1WDNA 3HCQA 3OEKA 1GGGA 2OWSA 3KSXA 4Q5TA 2PVUA 2UYEA 2DWHA 5H8NA 2Q8JA 3GBAA 4MF3A 3IL1B 3O6HA 4MLVA 4NF6A 3DP4A 4H0WA 3RT6B 3VLUA 4RYAA 4GF8A 2HXWA 5H8NB 1FTLA 3QK6A 5CI5A 4NF6B 1IQ7A 3R6UA 1OMPA 3MZBA 2Y7IA 5HM4B 3CFZA 2I4BA 2F7BA 3IORA 4DLDA 1YPNA 2D3IA 1JQFA 2F8DA 4KR5A 1MPCA 3T93B 1M5EA 5JTYA 5DYHA 1LGBC 3K6VA 2RINA 4OETA 3C9HA 3LC8A 3T66A 3TQWA 4ESXA 1IUDA 3U94A 3KSJA 5JTYB 3GBBA 2FNCA 2QL3A 3OO9A 5DVIA 3S9NC 2NUVA 5A5XA 4ELOA 4RPOA 3OO6A 1PDAA 3KOSA 3H6TA 2XXXA 2GFEA 4IO5A 5A5XB 4FORA 3B6WA 3IOWA 3GZGA 4H5GA 1H76A 2B3BA 3KEIA 3FATA 1PC3A 3TTLA 5CMMA 1Y4CA 1B4ZA 2ABHA 2OLBA 3RN8A 1O63A 1LFHA 3EHUA 1NFTA 2H99A 2Z8DA 3KOTA 3PUWE 2ONRA 1H45A 2XXRA 2QMXA 3FVOA 4MLQA 4X9TA 4NWDA 2XXTA 3I5OA 1GVCA 4FEBA 5AE4A 4KPTA 5TU0A 2Y7RA 2ZYKA 4QFOA 1SYIA 3EPEA 4U1ZA 1II5A 3VVEA 3K6XA 4U2RA 4F19A 4F3SA 4XIGQ 2DSFA 5AA2D 4AB5A 1B3LA 3N94A 1H44A 2HQ0A 1QUKA 1LCTA 4LZ7A 3ZKLA 3PMWA 2Q2CA 1PBQA 3RLFE 1VSOA 3DLNA 1MDP1 2V3UA 1M5CA 5I2NA 4FECA 4KFQA 3TPAA 3HSTA 1SW5A 3K02A 4IO2A 1R6ZA 3PUZE 3LR1A 4DXCA 3SESA 5I2NB 2ZYOA 5I57A 2CMOA 5CMKA 2PX1A 1FQDA 1MPBA 5IAIA 2QS4A 4U23A 4R6KA 1PB8A 5I57B 4DCXA 1N04A 4JDFA 2ONSA 1LAGE 1L5TA 4JXIA 3FJGA 4KYEA 2UXAA 3PD9A 3H6VA 3T9VA 1RYXA 5TPAA 1YCJA 4G77A 3RTWB 1IXHA 1N0TA 3SEXA 3TTMA 3F11A 2THIA 1SBPA 3TQLA 1LFGA 3QXMA 5TPAB 4POWA 4U21A 1O64A 3OXNA 4F39A 4YKIA 1A40A 2M8CA 4KYSA 2XX7A 4OYVA 3FXUA 1DTZA 1T0KA 2QPQA 2PT1A 2DYXA 1Z7NE 2VP1A 3HO7A 4NE4A 1OLCA 4FJPA 4ZEKA 4BDOA 1B5IA 1B05A 3LSXA 3G3FA 2AIXA 3H7MA 2DP8A 4KI0E 4MBPA 3KN8A 3D4GA 2X26A 3R26A 4P11A 4ZDMA 4OHNA 1GV8A 1B0LA 1LAXA 5H8SA 3TTNA 4R9FA 1D4NA 1NKXA 3JYRA 4JB7A 3MAMA 4FATA 1ELJA 3KBRA 2QJEA 3KFMA 4RK9A 3MBPA 5TP9A 2NWJA 1OLAA 5CBSA 3CFLA 2W7YA 2REJA 4LA9A 5H8QA 4F3GA 5K2YA 1UQWA 4XKQA 3MQ9A 2V84A 1MXXA 4XXUA 1HSJA 5I58A 4OFLA 5H8QB 2R9JA 1QW0A 1AMFA 3K4UA 1LAFE 5CM6A 5I58B 4LP2B 4N6PA 1FQFA 5I84A 4OQOA 4F1UA 3VVDA 3LSWA 1B52A 1MDQA 1B3HA 1B5JA 4R2BA 4RY1A 1JW5A 3L6GA 4IO7A 4FAJA 2XX8A 4YKPA 4O3AA 2I4CA 3N26A 2XD3A 3MP1A 2DE3A 3VDFA 3CSGA 4OEUA 4NMYA 4BDRA 3IB1A 3O28A 4OERA 1B9JA 1VR5A 5H8FA 5L8DA 1SW4A 1P1WA 1XT8A 4U4SA 3N5LA 3RGYA 2XHDA 1ZKBA 2HCAA 5H8FB 1DOTA 3RY3A 4YB6A 3PPRA 1N3WA 1P1NA 4OXVA 1EZPA 2VGQA 4ND9A 4ZEIA 1S9TA 2HZKA 3T22A 4ZECA 5EYFA 1LBBA 2AL4A 3RTFB 2F6GA 1S7YA 1Y20A 3PUYE 4POXA 3IB2A 1ZBMA 3TUSA 3H6UA 4LQ2A 2XXHA 2Y7PA 2O7IA 3OELA 1UIVA 4PFUA 4YB7A 1I6AA 4BLAA 1PB9A 3O66A 3TTRA 4M1VA 1BKAA 5KZTA 5IKBA 4F29A 4F1YA 4DIGA 4DXBA 1JW1A 3FASA 1VE4A 4YB5A 1YTVA 1Y3PA 2DE2A 2V3TA 3S4UA 2DQVA 1Y1MA 1QUJA 1MQHA 2HAUA 2V3QA 5ICTA 3ODBA 2OWTA 4RXLA 1FQBA 3SETA 3U8QA 4F22A 3DP6A 4ELQA 3VXCA 2REGA 4ZE9A 3Q27A 3PMXA 4Q0CA 4ZZAA 3EN3A 4NF8A 3MZ9A 3O2AA 2NXOA 1S50A 4LONB 2RKMA 4AQ4A 2Z8EA 4EDPA 2F36A 4KQPA 4YKJA 4R72A 3B6TA 3HV1A 4NF8B 1DMBA 1N7XA 1JVYA 4QRZA 3OENA 4H8IA 1BP5A 1VFEA 1FTMA 1FTJA 4EF1A 3HHFA 3SEVA 3RT8A 4PP0A 3DELB 3GLBA 1FCKA 3BBRA 1OIBA 4RJZA 3CRBA 3CFXA 2R71A 1JETA 3SEUA 4UACA 2O7UA 1MQIA 4M4GA 1R9LA 3B7DA 1MQJA 3M3KA 2ANJA 1D3KA 3Q25A 1QULA 1H43A 2H9BA 1MQDA 4OFOA 1R9QA 4R74A 5B70A 2GHBA 3BFTA 5EHMA 4BDLA 4Q8RA 1IXGA 4IO4A 1XHYA 4JWXA 1GTKA 1HSEA 4LUBA 1O7TA 3UN6A 3H06B 4JWYA 1B46A 2HEUA 5K2XA 1P99A 2YLNA 3SDFA 3W9WA 3IB0A 2V25A 2PMSA 2R6GE 3TTKA 3THIA 3MVWA 2IA4A 3QIMA 1B2HA 3FZVA 4EF2A 3RNNA 2OK2A 4H5FA 1KWHA 2ZYMA 4WEPA 4EQ9A 1SVXB 1B3GA 4PFTA 5ICQA 3W9VA 3O29A 1EH3A 4ZS9A 5FTIA 3RUMA 2O1LA 1NNFA 1B0HA 1XC1A 3OMBA 4GVOA 4IO6A 2DOJA 1FQCA 1B58A 1OVTA 4G2ZA 1TFDA 1QVSA 4O3BA 4F1VA 3OEMA 2WKYA 4GRKA 3FD3A 4IGRA 3TODA 3IJOB 3LBSA 4MFIA 3EF7A 4ZEDA 1VFDA 4GL0A 1UTBA 3DP8A 1OVBA 3KJTA 1NNTA 1XS5A 4Q30B 3VXBA 1UTBB 3CR9A 3FUZA 4FIMA 4P0GA 2P0SA 1UTHA 3RPWA 2G93A 4EXLA 3B6QA 4U1OA 3ECRA 2Z23A 5J1DA 1I6QA 1UTHB 4OWDA 1LBCA 1RKMA 3MPLA 2PT2A 4GD5A 2B65A 3U92A 3PUXE 2UVGA 3I3VA 1XVYA 1AOVA 5L9OA 3FXRA 3V8XB 4GXSB 1BTJA 1D9VA 1NH7A 1POY1 1YAEA 1XOCA 5LOMA 2RC9A 3MVYA 4R73A 4G8NA 4PE5B 1POTA 3FIRA 4F3BA 3QSLA 3MC2A 3FJMA 4NF5A 3O97A 1B7ZA 3TELA 1Y4TA 2X7QA 2F78A 4F3PA 3V89B 4NF5B 3VLWA 3IOVA 1Y3QA 3DM0A 3FGSA 3S9EA 3ILTB 4RK2A 4AB6A 4F2OA 4GOTA 1B1XA 4O3CA 1MXYA 2DXYA 2ONKE 4EQ7A 2Z8FA 4HTGA 3TCHA 1B32A 5CMBA 5FHMA 1IZ1A 1US5A 1N84A 3A3CA 4RPNA 3BKIB 4QFNA 3I6VA 3H4ZA 3CVGA 1UIUA 1TWYA 2XXPA 3AXFA 3Q29A 2UVIA 1ZMGA 3VFJA 1BLFA 5I56A 3OSRA 4F31B 2HZLA 3N6TA 4LZ8A 1EU8A 2AYSA 3WAEA 5KCJB 3OO8A 3KJ7A 5I56B 1JEVA 4KYDA 2NOOA 1CB6A 2XX9A 1CE2A 4RNSA 2UYFA 4YZZA 4TOZA 1H3DA 1TT1A 2Y7WA 1RYOA 3KZGA 2DWJA 2YJPA 4LQ5A 3M3FA 3LSFB 3PMVA 1URDA 4F18A 5CBRA 3T9UA 4ONYA 5EHSA 3G3KA 1LAHE 3IJXB 3OO7A 4YICA 4HW8A 4IGTA 3FVNA 4H65A 4G8MA 4U22A 2P1SA 5FHOA 1ZLQA 3EHTA 1SI0A 1QJMA 3QAXA 4NEDA 3QYTA 2QMWA 3C31A 1AL3A 2Q9TA 4OFJA 3OOAA 4BDNA 1QUIA 3V83A 4XKNA 2I58A 1SW2A 1B3EA 4OTEA 4R6YA 5CMCA 3HN0A 1B5HA 4YMBA 2F34A 3QUFA 2AL5A 1Z7ME 1ATGA 1WODA 2I49A 2ZXTA 2BJJX 4WEDA 1BIYA 3MJNA 1A7LA 1FQAA 1J1NA 2O69A 3CG3A 4ZEBA 3G3JA 4NF4A 4FE8A 1LB8A 3M3LA 5JK4A 5I2KA 1MM7A 4HCYA 5HBCA 5B7DA 5AA4A 4NF4B 4ZZEA 3ZKKA 2DE4A 2XXYA 4EQBA 4G8HA 3K6WA 2DWIA 5I2KB 1JEUA 4OZ9A 5AA4B 1ZTYA 3TCGA 5HPQA 1A99A 3N6UA 1MXVA 2XXVA 1Y9UA 4RA1A 1Y3NA 4YU0A 4JSDA 4ZE8A 1B51A 5L9SA 4DE8A 4OMBA 3E4RA 3U1OA 4PETA 2RCAA 1HSLA 5CRYA 4GFRA 1AH5A 2Q89A 2OJTA 5ISUA 3MP6A 1Y1ZA 2QRYA 4QFPA 2DWAA 4UA8A 4XTCQ 5AA2B 2QS1A 2F6PA 4K3FA 3OD7A 4ECFA 4GLIA 3TZAA 3KG2A 3U72A 3FV2A 1DPPA 3K1MA 2Y7KA 3C36A 4I8CA 1JNFA 2RC7A 4TLLB 3P7IA 4N13A 4ZEFA 4QFKA 1ANFA 2RF1A 3TDJA 4E0XA 1JW4A 4OEVA 5L9MA 1IEJA 1FQEA 3G3GA 4G68C 3MWBA 3A3UA 2A5TB 1NMUA 3EHSA 5F1QA 3H6WA 2I6EA 5FTHA 1QKAA 2D5WA 3R7XA 3TYHA 4C1UA 4DCYA 2F97A 3MVZA 2H4IA 4ELRA 3IO6A 2I0CA 1FW0A 1JVXA 3TMGA 3TCFA 1DSNA 3TAJA 1IIWA 4FEDA 4DZ1A 5M2VA 2LAOA 3VVFA 3A09A 3UP9A 5I59A 3U93A 1ZIUA 3Q26A 1MH3A 2VHAA 3LUYA 3E9XA 2F35A 3TKDA 2F7CA 3V5AA 2ESNA 5KDTA 2OZZA 5I59B 1MY4A 5F7VA 5AA1A 1NNPA 2I0BA 4ISUA 5KDTB 3QUJA 1ZU0A 4TLMB 3C33A 3K2DA 4H67A 1MY3A 3D4CA 3PUVE 4GIZA 4QF9A 4NWCA 3IK6B 1US4A 1URSA 1MH4A 1B4HA 3VLVA 1OQGA 5BWJA 2O84X 1MQGA 4R9GA 3JV9A 3TFLA 3UA8A 1PB7A 3MW0A 4KCCA 4ESWA 1FTKA 4GXAA 3K1NA 1DPEA 3VV5A 2ALUA 4EUOA 1B7UA 3PGFA 2CZLA 4BDMA 4TQUQ 4R75A 2IEEA 3PPOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z0I A;  4KCD A;  3UGW A;  1IIT A;  3ONM A;  4IB2 A;  4IY6 A;  4H8J A;  3MVX A;  3JZJ A;  1MXU A;  2OCU A;  4ELP A;  3FV1 A;  2O1M A;  1XVX A;  4QSD A;  4I1D A;  1M5B A;  3G7W A;  3SER A;  4OES A;  1TFA A;  1N7W A;  4BDQ A;  2QS3 A;  1A8E A;  1P1Q A;  4QHQ A;  2QS2 A;  3H3G A;  3FVG A;  3HPI A;  3Q28 A;  1PBP A;  2A5S A;  5ELV A;  3IOU A;  1SD3 A;  1GR2 A;  4G68 A;  3ILU B;  3CG1 A;  2Q2A A;  2I3W A;  1LST A;  1FTO A;  1A55 A;  4G68 B;  4E0W A;  2VD2 A;  2RC8 A;  2V93 A;  3C4M A;  2ZNU A;  4LVQ A;  2UVJ A;  1MPD A;  4MH5 A;  1LLS A;  1SW1 A;  2ZNT A;  4WKM A;  2Z22 A;  1DTG A;  3FJ7 A;  3FVK A;  4OVJ A;  1B7H A;  1URG A;  4THI A;  1AIV A;  1WVJ A;  1B1H A;  1SDX A;  3MUQ A;  3C34 A;  2Q88 A;  2NVU B;  4KHZ E;  5ITP A;  2F5X A;  3IX1 A;  3S9L C;  1MY1 A;  4U4X A;  5KCJ A;  3TEP A;  3KGC A;  3PPQ A;  2PYY A;  4JWO A;  2ZNS A;  1IXC A;  4X1D A;  3L6H A;  2E1S A;  3PD8 A;  3RQT A;  4X48 A;  2D21 A;  5DVF A;  1A8F A;  3MZ1 A;  3PPN A;  1MS7 A;  2YPN A;  3CI8 A;  3K0V A;  2DVC A;  2X7P A;  2XXW A;  4N07 A;  5DVJ A;  3C32 A;  1B3F A;  3IOT A;  4OEN A;  4R6H A;  2DS9 A;  2E0S A;  1B6H A;  1Q35 A;  1IXI A;  3EQ1 A;  1QKB A;  3IAZ A;  4C1T A;  3UK4 A;  2RCB A;  4X1B A;  3G3I A;  1M5F A;  1N3X A;  2XD2 A;  3K6U A;  5BUU A;  3UIF A;  2FYI A;  3K01 A;  2I48 A;  5JEI A;  4QSE A;  4PFY A;  3K00 A;  1PEB A;  3USD A;  2B3F A;  1Q1K A;  4XKR A;  3UOR A;  3ZSF A;  1I6B A;  4DDD A;  3SEY A;  2OBG A;  5TP9 B;  4GQO A;  4F2Q A;  3HHG A;  3O6I A;  3W15 C;  1P1U A;  4IY5 A;  1I69 A;  4JSO A;  3CSB A;  4I9D A;  3SEW A;  3OSQ A;  1P1O A;  3T96 B;  2VD3 A;  4DXU A;  4Z7E A;  4R2F A;  3VE1 B;  3PPP A;  3KN7 A;  2GRV A;  4LZ5 A;  2XXQ A;  2HFB A;  3ZS6 A;  2XXU A;  1D9Y A;  4YKK A;  4P0I A;  1N76 A;  2H25 A;  1MM6 A;  4EXK A;  1NL5 A;  1SQY A;  2GH9 A;  2ZMB A;  3IR1 A;  3KN3 A;  5DEX A;  3LSL A;  3IO4 A;  5DEX B;  1ZJL A;  4QSC A;  1OQH A;  4WXJ A;  3M8U A;  2PBW A;  1TXF A;  4GWO A;  5AA3 A;  1MY0 A;  4HS7 A;  2P2A A;  2XXI A;  4H1X A;  4YMA A;  4H6D A;  1SI1 A;  2O51 A;  4KD5 A;  1MY2 A;  3BFU A;  4LAT A;  4L17 A;  4PQJ A;  3S9M C;  5CC2 A;  4I62 A;  2VOZ A;  3GXA A;  1MRP A;  3PV0 E;  2FA7 A;  3S2V A;  4C0R A;  3O9P A;  5ITO A;  3E3K A;  1NNK A;  1NH8 A;  3FXQ A;  3H03 A;  4IO3 A;  3SKP A;  2H5Y A;  3PU5 A;  4GL8 A;  4PFW A;  5DT6 A;  4YAH X;  1LCF A;  5AA2 A;  2GHA A;  2HAV A;  2DXR A;  2O68 A;  2Y84 A;  2I3V A;  3E13 X;  5H8H A;  2O6A A;  3C35 A;  2H98 A;  1USY E;  1R1N A;  3WAF A;  3MP8 A;  4QFL A;  1B40 A;  1F9B A;  5H8H B;  2ZYN A;  1LB9 A;  2F7A A;  5FHN A;  1USY H;  2UVH A;  1M5D A;  3G3H A;  3MPK A;  1LFI A;  4G4P A;  4JBZ A;  3T9H B;  2KLF A;  4XKP A;  2G29 A;  3CIJ A;  5DTB A;  1MXW A;  1A54 A;  1EZO A;  1EZ9 A;  3K1P A;  3T9X B;  1SYH A;  1MG1 A;  4NTL A;  2DVZ A;  2QSX A;  3O6G A;  4HCW A;  1MXZ A;  2A5T A;  1WDN A;  3HCQ A;  3OEK A;  1GGG A;  2OWS A;  3KSX A;  4Q5T A;  2PVU A;  2UYE A;  2DWH A;  5H8N A;  2Q8J A;  3GBA A;  4MF3 A;  3IL1 B;  3O6H A;  4MLV A;  4NF6 A;  3DP4 A;  4H0W A;  3RT6 B;  3VLU A;  4RYA A;  4GF8 A;  2HXW A;  5H8N B;  1FTL A;  3QK6 A;  5CI5 A;  4NF6 B;  1IQ7 A;  3R6U A;  1OMP A;  3MZB A;  2Y7I A;  5HM4 B;  3CFZ A;  2I4B A;  2F7B A;  3IOR A;  4DLD A;  1YPN A;  2D3I A;  1JQF A;  2F8D A;  4KR5 A;  1MPC A;  3T93 B;  1M5E A;  5JTY A;  5DYH A;  1LGB C;  3K6V A;  2RIN A;  4OET A;  3C9H A;  3LC8 A;  3T66 A;  3TQW A;  4ESX A;  1IUD A;  3U94 A;  3KSJ A;  5JTY B;  3GBB A;  2FNC A;  2QL3 A;  3OO9 A;  5DVI A;  3S9N C;  2NUV A;  5A5X A;  4ELO A;  4RPO A;  3OO6 A;  1PDA A;  3KOS A;  3H6T A;  2XXX A;  2GFE A;  4IO5 A;  5A5X B;  4FOR A;  3B6W A;  3IOW A;  3GZG A;  4H5G A;  1H76 A;  2B3B A;  3KEI A;  3FAT A;  1PC3 A;  3TTL A;  5CMM A;  1Y4C A;  1B4Z A;  2ABH A;  2OLB A;  3RN8 A;  1O63 A;  1LFH A;  3EHU A;  1NFT A;  2H99 A;  2Z8D A;  3KOT A;  3PUW E;  2ONR A;  1H45 A;  2XXR A;  2QMX A;  3FVO A;  4MLQ A;  4X9T A;  4NWD A;  2XXT A;  3I5O A;  1GVC A;  4FEB A;  5AE4 A;  4KPT A;  5TU0 A;  2Y7R A;  2ZYK A;  4QFO A;  1SYI A;  3EPE A;  4U1Z A;  1II5 A;  3VVE A;  3K6X A;  4U2R A;  4F19 A;  4F3S A;  4XIG Q;  2DSF A;  5AA2 D;  4AB5 A;  1B3L A;  3N94 A;  1H44 A;  2HQ0 A;  1QUK A;  1LCT A;  4LZ7 A;  3ZKL A;  3PMW A;  2Q2C A;  1PBQ A;  3RLF E;  1VSO A;  3DLN A;  1MDP 1;  2V3U A;  1M5C A;  5I2N A;  4FEC A;  4KFQ A;  3TPA A;  3HST A;  1SW5 A;  3K02 A;  4IO2 A;  1R6Z A;  3PUZ E;  3LR1 A;  4DXC A;  3SES A;  5I2N B;  2ZYO A;  5I57 A;  2CMO A;  5CMK A;  2PX1 A;  1FQD A;  1MPB A;  5IAI A;  2QS4 A;  4U23 A;  4R6K A;  1PB8 A;  5I57 B;  4DCX A;  1N04 A;  4JDF A;  2ONS A;  1LAG E;  1L5T A;  4JXI A;  3FJG A;  4KYE A;  2UXA A;  3PD9 A;  3H6V A;  3T9V A;  1RYX A;  5TPA A;  1YCJ A;  4G77 A;  3RTW B;  1IXH A;  1N0T A;  3SEX A;  3TTM A;  3F11 A;  2THI A;  1SBP A;  3TQL A;  1LFG A;  3QXM A;  5TPA B;  4POW A;  4U21 A;  1O64 A;  3OXN A;  4F39 A;  4YKI A;  1A40 A;  2M8C A;  4KYS A;  2XX7 A;  4OYV A;  3FXU A;  1DTZ A;  1T0K A;  2QPQ A;  2PT1 A;  2DYX A;  1Z7N E;  2VP1 A;  3HO7 A;  4NE4 A;  1OLC A;  4FJP A;  4ZEK A;  4BDO A;  1B5I A;  1B05 A;  3LSX A;  3G3F A;  2AIX A;  3H7M A;  2DP8 A;  4KI0 E;  4MBP A;  3KN8 A;  3D4G A;  2X26 A;  3R26 A;  4P11 A;  4ZDM A;  4OHN A;  1GV8 A;  1B0L A;  1LAX A;  5H8S A;  3TTN A;  4R9F A;  1D4N A;  1NKX A;  3JYR A;  4JB7 A;  3MAM A;  4FAT A;  1ELJ A;  3KBR A;  2QJE A;  3KFM A;  4RK9 A;  3MBP A;  5TP9 A;  2NWJ A;  1OLA A;  5CBS A;  3CFL A;  2W7Y A;  2REJ A;  4LA9 A;  5H8Q A;  4F3G A;  5K2Y A;  1UQW A;  4XKQ A;  3MQ9 A;  2V84 A;  1MXX A;  4XXU A;  1HSJ A;  5I58 A;  4OFL A;  5H8Q B;  2R9J A;  1QW0 A;  1AMF A;  3K4U A;  1LAF E;  5CM6 A;  5I58 B;  4LP2 B;  4N6P A;  1FQF A;  5I84 A;  4OQO A;  4F1U A;  3VVD A;  3LSW A;  1B52 A;  1MDQ A;  1B3H A;  1B5J A;  4R2B A;  4RY1 A;  1JW5 A;  3L6G A;  4IO7 A;  4FAJ A;  2XX8 A;  4YKP A;  4O3A A;  2I4C A;  3N26 A;  2XD3 A;  3MP1 A;  2DE3 A;  3VDF A;  3CSG A;  4OEU A;  4NMY A;  4BDR A;  3IB1 A;  3O28 A;  4OER A;  1B9J A;  1VR5 A;  5H8F A;  5L8D A;  1SW4 A;  1P1W A;  1XT8 A;  4U4S A;  3N5L A;  3RGY A;  2XHD A;  1ZKB A;  2HCA A;  5H8F B;  1DOT A;  3RY3 A;  4YB6 A;  3PPR A;  1N3W A;  1P1N A;  4OXV A;  1EZP A;  2VGQ A;  4ND9 A;  4ZEI A;  1S9T A;  2HZK A;  3T22 A;  4ZEC A;  5EYF A;  1LBB A;  2AL4 A;  3RTF B;  2F6G A;  1S7Y A;  1Y20 A;  3PUY E;  4POX A;  3IB2 A;  1ZBM A;  3TUS A;  3H6U A;  4LQ2 A;  2XXH A;  2Y7P A;  2O7I A;  3OEL A;  1UIV A;  4PFU A;  4YB7 A;  1I6A A;  4BLA A;  1PB9 A;  3O66 A;  3TTR A;  4M1V A;  1BKA A;  5KZT A;  5IKB A;  4F29 A;  4F1Y A;  4DIG A;  4DXB A;  1JW1 A;  3FAS A;  1VE4 A;  4YB5 A;  1YTV A;  1Y3P A;  2DE2 A;  2V3T A;  3S4U A;  2DQV A;  1Y1M A;  1QUJ A;  1MQH A;  2HAU A;  2V3Q A;  5ICT A;  3ODB A;  2OWT A;  4RXL A;  1FQB A;  3SET A;  3U8Q A;  4F22 A;  3DP6 A;  4ELQ A;  3VXC A;  2REG A;  4ZE9 A;  3Q27 A;  3PMX A;  4Q0C A;  4ZZA A;  3EN3 A;  4NF8 A;  3MZ9 A;  3O2A A;  2NXO A;  1S50 A;  4LON B;  2RKM A;  4AQ4 A;  2Z8E A;  4EDP A;  2F36 A;  4KQP A;  4YKJ A;  4R72 A;  3B6T A;  3HV1 A;  4NF8 B;  1DMB A;  1N7X A;  1JVY A;  4QRZ A;  3OEN A;  4H8I A;  1BP5 A;  1VFE A;  1FTM A;  1FTJ A;  4EF1 A;  3HHF A;  3SEV A;  3RT8 A;  4PP0 A;  3DEL B;  3GLB A;  1FCK A;  3BBR A;  1OIB A;  4RJZ A;  3CRB A;  3CFX A;  2R71 A;  1JET A;  3SEU A;  4UAC A;  2O7U A;  1MQI A;  4M4G A;  1R9L A;  3B7D A;  1MQJ A;  3M3K A;  2ANJ A;  1D3K A;  3Q25 A;  1QUL A;  1H43 A;  2H9B A;  1MQD A;  4OFO A;  1R9Q A;  4R74 A;  5B70 A;  2GHB A;  3BFT A;  5EHM A;  4BDL A;  4Q8R A;  1IXG A;  4IO4 A;  1XHY A;  4JWX A;  1GTK A;  1HSE A;  4LUB A;  1O7T A;  3UN6 A;  3H06 B;  4JWY A;  1B46 A;  2HEU A;  5K2X A;  1P99 A;  2YLN A;  3SDF A;  3W9W A;  3IB0 A;  2V25 A;  2PMS A;  2R6G E;  3TTK A;  3THI A;  3MVW A;  2IA4 A;  3QIM A;  1B2H A;  3FZV A;  4EF2 A;  3RNN A;  2OK2 A;  4H5F A;  1KWH A;  2ZYM A;  4WEP A;  4EQ9 A;  1SVX B;  1B3G A;  4PFT A;  5ICQ A;  3W9V A;  3O29 A;  1EH3 A;  4ZS9 A;  5FTI A;  3RUM A;  2O1L A;  1NNF A;  1B0H A;  1XC1 A;  3OMB A;  4GVO A;  4IO6 A;  2DOJ A;  1FQC A;  1B58 A;  1OVT A;  4G2Z A;  1TFD A;  1QVS A;  4O3B A;  4F1V A;  3OEM A;  2WKY A;  4GRK A;  3FD3 A;  4IGR A;  3TOD A;  3IJO B;  3LBS A;  4MFI A;  3EF7 A;  4ZED A;  1VFD A;  4GL0 A;  1UTB A;  3DP8 A;  1OVB A;  3KJT A;  1NNT A;  1XS5 A;  4Q30 B;  3VXB A;  1UTB B;  3CR9 A;  3FUZ A;  4FIM A;  4P0G A;  2P0S A;  1UTH A;  3RPW A;  2G93 A;  4EXL A;  3B6Q A;  4U1O A;  3ECR A;  2Z23 A;  5J1D A;  1I6Q A;  1UTH B;  4OWD A;  1LBC A;  1RKM A;  3MPL A;  2PT2 A;  4GD5 A;  2B65 A;  3U92 A;  3PUX E;  2UVG A;  3I3V A;  1XVY A;  1AOV A;  5L9O A;  3FXR A;  3V8X B;  4GXS B;  1BTJ A;  1D9V A;  1NH7 A;  1POY 1;  1YAE A;  1XOC A;  5LOM A;  2RC9 A;  3MVY A;  4R73 A;  4G8N A;  4PE5 B;  1POT A;  3FIR A;  4F3B A;  3QSL A;  3MC2 A;  3FJM A;  4NF5 A;  3O97 A;  1B7Z A;  3TEL A;  1Y4T A;  2X7Q A;  2F78 A;  4F3P A;  3V89 B;  4NF5 B;  3VLW A;  3IOV A;  1Y3Q A;  3DM0 A;  3FGS A;  3S9E A;  3ILT B;  4RK2 A;  4AB6 A;  4F2O A;  4GOT A;  1B1X A;  4O3C A;  1MXY A;  2DXY A;  2ONK E;  4EQ7 A;  2Z8F A;  4HTG A;  3TCH A;  1B32 A;  5CMB A;  5FHM A;  1IZ1 A;  1US5 A;  1N84 A;  3A3C A;  4RPN A;  3BKI B;  4QFN A;  3I6V A;  3H4Z A;  3CVG A;  1UIU A;  1TWY A;  2XXP A;  3AXF A;  3Q29 A;  2UVI A;  1ZMG A;  3VFJ A;  1BLF A;  5I56 A;  3OSR A;  4F31 B;  2HZL A;  3N6T A;  4LZ8 A;  1EU8 A;  2AYS A;  3WAE A;  5KCJ B;  3OO8 A;  3KJ7 A;  5I56 B;  1JEV A;  4KYD A;  2NOO A;  1CB6 A;  2XX9 A;  1CE2 A;  4RNS A;  2UYF A;  4YZZ A;  4TOZ A;  1H3D A;  1TT1 A;  2Y7W A;  1RYO A;  3KZG A;  2DWJ A;  2YJP A;  4LQ5 A;  3M3F A;  3LSF B;  3PMV A;  1URD A;  4F18 A;  5CBR A;  3T9U A;  4ONY A;  5EHS A;  3G3K A;  1LAH E;  3IJX B;  3OO7 A;  4YIC A;  4HW8 A;  4IGT A;  3FVN A;  4H65 A;  4G8M A;  4U22 A;  2P1S A;  5FHO A;  1ZLQ A;  3EHT A;  1SI0 A;  1QJM A;  3QAX A;  4NED A;  3QYT A;  2QMW A;  3C31 A;  1AL3 A;  2Q9T A;  4OFJ A;  3OOA A;  4BDN A;  1QUI A;  3V83 A;  4XKN A;  2I58 A;  1SW2 A;  1B3E A;  4OTE A;  4R6Y A;  5CMC A;  3HN0 A;  1B5H A;  4YMB A;  2F34 A;  3QUF A;  2AL5 A;  1Z7M E;  1ATG A;  1WOD A;  2I49 A;  2ZXT A;  2BJJ X;  4WED A;  1BIY A;  3MJN A;  1A7L A;  1FQA A;  1J1N A;  2O69 A;  3CG3 A;  4ZEB A;  3G3J A;  4NF4 A;  4FE8 A;  1LB8 A;  3M3L A;  5JK4 A;  5I2K A;  1MM7 A;  4HCY A;  5HBC A;  5B7D A;  5AA4 A;  4NF4 B;  4ZZE A;  3ZKK A;  2DE4 A;  2XXY A;  4EQB A;  4G8H A;  3K6W A;  2DWI A;  5I2K B;  1JEU A;  4OZ9 A;  5AA4 B;  1ZTY A;  3TCG A;  5HPQ A;  1A99 A;  3N6U A;  1MXV A;  2XXV A;  1Y9U A;  4RA1 A;  1Y3N A;  4YU0 A;  4JSD A;  4ZE8 A;  1B51 A;  5L9S A;  4DE8 A;  4OMB A;  3E4R A;  3U1O A;  4PET A;  2RCA A;  1HSL A;  5CRY A;  4GFR A;  1AH5 A;  2Q89 A;  2OJT A;  5ISU A;  3MP6 A;  1Y1Z A;  2QRY A;  4QFP A;  2DWA A;  4UA8 A;  4XTC Q;  5AA2 B;  2QS1 A;  2F6P A;  4K3F A;  3OD7 A;  4ECF A;  4GLI A;  3TZA A;  3KG2 A;  3U72 A;  3FV2 A;  1DPP A;  3K1M A;  2Y7K A;  3C36 A;  4I8C A;  1JNF A;  2RC7 A;  4TLL B;  3P7I A;  4N13 A;  4ZEF A;  4QFK A;  1ANF A;  2RF1 A;  3TDJ A;  4E0X A;  1JW4 A;  4OEV A;  5L9M A;  1IEJ A;  1FQE A;  3G3G A;  4G68 C;  3MWB A;  3A3U A;  2A5T B;  1NMU A;  3EHS A;  5F1Q A;  3H6W A;  2I6E A;  5FTH A;  1QKA A;  2D5W A;  3R7X A;  3TYH A;  4C1U A;  4DCY A;  2F97 A;  3MVZ A;  2H4I A;  4ELR A;  3IO6 A;  2I0C A;  1FW0 A;  1JVX A;  3TMG A;  3TCF A;  1DSN A;  3TAJ A;  1IIW A;  4FED A;  4DZ1 A;  5M2V A;  2LAO A;  3VVF A;  3A09 A;  3UP9 A;  5I59 A;  3U93 A;  1ZIU A;  3Q26 A;  1MH3 A;  2VHA A;  3LUY A;  3E9X A;  2F35 A;  3TKD A;  2F7C A;  3V5A A;  2ESN A;  5KDT A;  2OZZ A;  5I59 B;  1MY4 A;  5F7V A;  5AA1 A;  1NNP A;  2I0B A;  4ISU A;  5KDT B;  3QUJ A;  1ZU0 A;  4TLM B;  3C33 A;  3K2D A;  4H67 A;  1MY3 A;  3D4C A;  3PUV E;  4GIZ A;  4QF9 A;  4NWC A;  3IK6 B;  1US4 A;  1URS A;  1MH4 A;  1B4H A;  3VLV A;  1OQG A;  5BWJ A;  2O84 X;  1MQG A;  4R9G A;  3JV9 A;  3TFL A;  3UA8 A;  1PB7 A;  3MW0 A;  4KCC A;  4ESW A;  1FTK A;  4GXA A;  3K1N A;  1DPE A;  3VV5 A;  2ALU A;  4EUO A;  1B7U A;  3PGF A;  2CZL A;  4BDM A;  4TQU Q;  4R75 A;  2IEE A;  3PPO A; 
#chains in the Genus database with same CATH topology
 4Z0I A;  4KCD A;  3UGW A;  1IIT A;  3ONM A;  4IB2 A;  4IY6 A;  3LUZ A;  4H8J A;  3MVX A;  3JZJ A;  1MXU A;  2OCU A;  4ELP A;  3FV1 A;  5EQA A;  2O1M A;  1XVX A;  4QSD A;  4I1D A;  1M5B A;  2WX9 A;  3G7W A;  5T3J A;  3SER A;  4OES A;  1TFA A;  1N7W A;  4BDQ A;  4PF8 A;  1RDZ A;  3B50 A;  2QS3 A;  4X04 A;  1A8E A;  1P1Q A;  4QHQ A;  2QS2 A;  3H3G A;  3FVG A;  3HPI A;  3Q28 A;  1G0I A;  1PBP A;  2A5S A;  5ELV A;  3IOU A;  1SD3 A;  1GR2 A;  4G68 A;  3ILU B;  3CG1 A;  2QFL A;  2Q2A A;  4GWW A;  2I3W A;  1LST A;  1FTO A;  1A55 A;  4G68 B;  4E0W A;  2VD2 A;  2RC8 A;  2V93 A;  2PCR A;  1NV1 A;  3C4M A;  2ZNU A;  4LVQ A;  2UVJ A;  1MPD A;  2P3N A;  3CHG A;  4MH5 A;  4N15 A;  1LLS A;  1SW1 A;  2ZNT A;  4WKM A;  2Z22 A;  1DTG A;  3FJ7 A;  1DBZ A;  3FVK A;  4OVJ A;  1B7H A;  1URG A;  4THI A;  1AIV A;  4PGP A;  1WVJ A;  2VT5 A;  1B1H A;  1SDX A;  3MUQ A;  3C34 A;  2Q88 A;  2NVU B;  4KHZ E;  5ITP A;  2F5X A;  3IX1 A;  4QBA A;  3S9L C;  1MY1 A;  4U4X A;  5KCJ A;  3TEP A;  3KGC A;  3PPQ A;  2PYY A;  4JWO A;  2ZNS A;  1IXC A;  4O8M A;  1JP4 A;  4X1D A;  2JJK A;  1SPI A;  3L6H A;  2E1S A;  3PD8 A;  5IZZ A;  3RQT A;  4X48 A;  2D21 A;  5DVF A;  1A8F A;  3MZ1 A;  3PPN A;  1MS7 A;  4MAG A;  2YPN A;  3CI8 A;  3K0V A;  2DVC A;  2X7P A;  2XXW A;  4N07 A;  1Q9D A;  5DVJ A;  3C32 A;  1B3F A;  3IOT A;  2HXR A;  4OEN A;  4R6H A;  1NV2 A;  4N8Y A;  2DS9 A;  2E0S A;  1B6H A;  1Q35 A;  1IXI A;  3EQ1 A;  1QKB A;  3IAZ A;  4C1T A;  1FBF A;  3UK4 A;  2RCB A;  4X1B A;  3G3I A;  1M5F A;  1BK4 A;  1N3X A;  2XD2 A;  3K6U A;  5BUU A;  3UIF A;  2FYI A;  2CEX A;  3K01 A;  2I48 A;  5JEI A;  4QSE A;  4PFY A;  1NV0 A;  3K00 A;  1PEB A;  4P1L A;  3USD A;  4H46 A;  2B3F A;  1Q1K A;  4XKR A;  3UOR A;  3ZSF A;  1I6B A;  4DDD A;  3SEY A;  2OBG A;  5TP9 B;  2PFY A;  4GQO A;  4F2Q A;  3HHG A;  3O6I A;  3W15 C;  1P1U A;  4IY5 A;  1I69 A;  4JSO A;  3CSB A;  4I9D A;  3SEW A;  3OSQ A;  1P1O A;  2XXK A;  3T96 B;  2VD3 A;  4DXU A;  4Z7E A;  4R2F A;  3VE1 B;  3PPP A;  3KN7 A;  2CEY A;  2GRV A;  4LZ5 A;  2XXQ A;  5LTC A;  2HFB A;  1NV7 A;  3ZS6 A;  1IMF A;  2XWK A;  2XXU A;  1LBV A;  1D9Y A;  4YKK A;  4P0I A;  1N76 A;  2H25 A;  1MM6 A;  4EXK A;  1NL5 A;  1SQY A;  2GH9 A;  2ZMB A;  3IR1 A;  3KN3 A;  1LEV A;  5DEX A;  3MST A;  4QXD A;  4MNC A;  3LSL A;  2HHM A;  2F3B A;  3IO4 A;  5DEX B;  1ZJL A;  4QSC A;  1OQH A;  4WXJ A;  4X8R A;  3M8U A;  2PBW A;  1TXF A;  4GWO A;  4OVR A;  5AA3 A;  1MY0 A;  2Q8M A;  4HS7 A;  2P2A A;  2XXI A;  4H1X A;  4YMA A;  4H6D A;  4XFE A;  1SI1 A;  4FBP A;  2O51 A;  4KD5 A;  1MY2 A;  3BFU A;  1RDX A;  4LAT A;  4L17 A;  4PQJ A;  3S9M C;  3ROJ A;  2B4M A;  5CC2 A;  4I62 A;  2VOZ A;  3GXA A;  1MRP A;  3PV0 E;  2FA7 A;  3S2V A;  4C0R A;  3O9P A;  5ITO A;  3E3K A;  1NNK A;  1NH8 A;  3FXQ A;  3H03 A;  4IO3 A;  3SKP A;  2H5Y A;  3FXB A;  3PU5 A;  4GL8 A;  4PFW A;  1K9Z A;  5DT6 A;  4YAH X;  1LCF A;  5AA2 A;  2GHA A;  2HAV A;  2DXR A;  2O68 A;  2Y84 A;  2I3V A;  3E13 X;  5H8H A;  2O6A A;  3C35 A;  2H98 A;  1USY E;  1R1N A;  3WAF A;  4OA4 A;  3MP8 A;  4QFL A;  1B40 A;  1F9B A;  5H8H B;  2ZYN A;  1LB9 A;  2F7A A;  5FHN A;  1USY H;  2UVH A;  1M5D A;  3G3H A;  3MPK A;  1LFI A;  4G4P A;  4JBZ A;  4P8B A;  3T9H B;  2KLF A;  2FVZ A;  4XKP A;  2G29 A;  3CIJ A;  5DTB A;  1MXW A;  1A54 A;  1EZO A;  1EZ9 A;  2QVR A;  4JVC A;  3K1P A;  3T9X B;  1SYH A;  2HPG A;  1MG1 A;  4NTL A;  2DVZ A;  2QSX A;  3O6G A;  4HCW A;  1MXZ A;  2A5T A;  1WDN A;  3HCQ A;  3OEK A;  1GGG A;  2OWS A;  3KSX A;  4Q5T A;  1FTA A;  2PVU A;  2UYE A;  1DCU A;  4PAI A;  4OVQ A;  2DWH A;  5H8N A;  2Q8J A;  5EYH A;  1FBD A;  3GBA A;  3KBZ A;  1FJ9 A;  3IL1 B;  3O6H A;  4MF3 A;  4MLV A;  4NF6 A;  3DP4 A;  4H0W A;  3RT6 B;  3VLU A;  4RYA A;  4GF8 A;  2HXW A;  5H8N B;  2XA5 A;  1FTL A;  3QK6 A;  5CI5 A;  4NF6 B;  1IQ7 A;  3R6U A;  1OMP A;  3MZB A;  2Y7I A;  5HM4 B;  3CFZ A;  5IZ1 A;  2I4B A;  2F7B A;  3IOR A;  4DLD A;  1YPN A;  2D3I A;  1JQF A;  2F8D A;  4KR5 A;  1MPC A;  3T93 B;  1M5E A;  5JTY A;  5DYH A;  1LGB C;  3K6V A;  2RIN A;  4OET A;  3C9H A;  3LC8 A;  3T66 A;  3TQW A;  4ESX A;  1IUD A;  4I3E A;  3U94 A;  3KSJ A;  5JTY B;  3GBB A;  2FNC A;  2QL3 A;  3OO9 A;  5DVI A;  3S9N C;  2NUV A;  5A5X A;  4ELO A;  4RPO A;  3OO6 A;  1PDA A;  4PBH A;  4NGU A;  4PDD A;  3KOS A;  3H6T A;  2XXX A;  2GFE A;  4IO5 A;  5A5X B;  4FOR A;  3B6W A;  3IOW A;  3GZG A;  4DI4 B;  5J16 A;  1YXI A;  4H5G A;  1H76 A;  2B3B A;  3KEI A;  3FAT A;  1PC3 A;  3TTL A;  5CMM A;  1Y4C A;  1B4Z A;  2ABH A;  2OLB A;  3RN8 A;  5I7I A;  1O63 A;  1LFH A;  3EHU A;  4PF6 A;  1NFT A;  2H99 A;  1FPL A;  2Z8D A;  1NV3 A;  3KOT A;  3PUW E;  2ONR A;  1H45 A;  4O7M A;  2QMX A;  2XXR A;  3FVO A;  1FBC A;  4MLQ A;  4X9T A;  4NWD A;  1NUW A;  2XXT A;  3I5O A;  1GVC A;  4FEB A;  5AE4 A;  2Y5L A;  4KPT A;  5TU0 A;  2Y7R A;  2ZYK A;  4QFO A;  1SYI A;  3EPE A;  4U1Z A;  1II5 A;  4NQ8 A;  3VVE A;  3K6X A;  4U2R A;  4F19 A;  4F3S A;  4XIG Q;  2DSF A;  4PCD A;  1VDW A;  5AA2 D;  4AB5 A;  2WYP A;  1B3L A;  4GWX A;  3N94 A;  1IMD A;  1H44 A;  2HQ0 A;  1QUK A;  1LCT A;  2KR0 A;  4LZ7 A;  3ZKL A;  3PMW A;  2Q2C A;  4GWU A;  1PBQ A;  3RLF E;  1VSO A;  5EYG A;  3DLN A;  2VPN A;  1MDP 1;  2V3U A;  1M5C A;  5I2N A;  4FEC A;  4KFQ A;  3TPA A;  3HST A;  1SW5 A;  3K02 A;  2P3V A;  4IO2 A;  4JVD A;  4MMP A;  1R6Z A;  3PUZ E;  3LR1 A;  2KQZ A;  4DXC A;  3SES A;  5I2N B;  2ZYO A;  5I57 A;  2CMO A;  5CMK A;  2PX1 A;  1FQD A;  1MPB A;  5IAI A;  2QS4 A;  4U23 A;  4R6K A;  4JVI A;  1PB8 A;  5I57 B;  4DCX A;  1N04 A;  4JDF A;  2ONS A;  1LAG E;  1L5T A;  4JXI A;  3FJG A;  4KYE A;  2UXA A;  1INP A;  3PD9 A;  3H6V A;  3T9V A;  1RYX A;  5TPA A;  1YCJ A;  4HE1 A;  4G77 A;  3RTW B;  1IXH A;  1N0T A;  3SEX A;  3TTM A;  3F11 A;  2THI A;  1SBP A;  3TQL A;  1LFG A;  4N17 A;  3QXM A;  5TPA B;  1FPK A;  4POW A;  4U21 A;  1O64 A;  3OXN A;  4F39 A;  4YKI A;  1A40 A;  2M8C A;  4KYS A;  3E79 A;  2XX7 A;  4OYV A;  3FXU A;  4MEV A;  1DTZ A;  3E78 A;  1T0K A;  2Y5K A;  2QPQ A;  2PT1 A;  2DYX A;  1Z7N E;  2VP1 A;  3HO7 A;  1CNQ A;  4NE4 A;  1OLC A;  4FJP A;  4ZEK A;  4BDO A;  1B5I A;  1B05 A;  2WEF A;  3LSX A;  3G3F A;  2AIX A;  3H7M A;  3KC0 A;  4MNI A;  2DP8 A;  4KI0 E;  4MBP A;  3NOH A;  3KN8 A;  3D4G A;  2X26 A;  3R26 A;  4P11 A;  4NN3 A;  3D1R A;  4ZDM A;  1FPF A;  4OHN A;  1GV8 A;  1B0L A;  1LAX A;  5H8S A;  1NUZ A;  3TTN A;  4R9F A;  1D4N A;  1NKX A;  3JYR A;  4JB7 A;  3MAM A;  4FAT A;  1ELJ A;  3KBR A;  1NUY A;  2QJE A;  3KFM A;  4RK9 A;  3MBP A;  4PBQ A;  5TP9 A;  2NWJ A;  1OLA A;  5CBS A;  2WBB A;  3CFL A;  5I3S A;  4PFI A;  2W7Y A;  2REJ A;  4LA9 A;  4PDH A;  5H8Q A;  4F3G A;  5K2Y A;  1NV4 A;  1UQW A;  4XKQ A;  3MQ9 A;  2V84 A;  1MXX A;  4XXU A;  1HSJ A;  5I58 A;  4N8G A;  2VPO A;  4OFL A;  5IM2 A;  5H8Q B;  2R9J A;  1QW0 A;  1KZ8 A;  4N6K A;  1AMF A;  3K4U A;  1LAF E;  5CM6 A;  5I58 B;  4LP2 B;  4N6P A;  1FQF A;  5I84 A;  4OQO A;  4F1U A;  3VVD A;  1FBH A;  3LSW A;  1B52 A;  1MDQ A;  4IR8 A;  1B3H A;  1B5J A;  4R2B A;  4RY1 A;  1JW5 A;  3L6G A;  4IO7 A;  4FAJ A;  2DDK A;  2XX8 A;  4YKP A;  4O3A A;  2I4C A;  3RPL A;  3N26 A;  2XD3 A;  3MP1 A;  4PTK A;  2DE3 A;  3VDF A;  3CSG A;  2FBP A;  4OEU A;  4NMY A;  2Q74 A;  3RPL B;  4BDR A;  4N4U A;  3IB1 A;  3O28 A;  5IGA A;  4OER A;  1B9J A;  1VR5 A;  1FBG A;  5H8F A;  5L8D A;  1SW4 A;  1P1W A;  1XT8 A;  4U4S A;  3N5L A;  3T0J A;  3RGY A;  2XHD A;  1ZKB A;  2HCA A;  5H8F B;  4AS4 A;  1DOT A;  3RY3 A;  4YB6 A;  5A5L A;  3PPR A;  1N3W A;  1P1N A;  4OXV A;  1EZP A;  2VGQ A;  4ND9 A;  4ZEI A;  1S9T A;  2HZK A;  4PFR A;  3T22 A;  4ZEC A;  5EYF A;  1LBB A;  2AL4 A;  3RTF B;  2F6G A;  1S7Y A;  1Y20 A;  3PUY E;  4POX A;  3IB2 A;  1ZBM A;  3TUS A;  3H6U A;  4LQ2 A;  4NF0 A;  2XXH A;  2Y7P A;  2O7I A;  3OEL A;  4PFB A;  1NV5 A;  3LV0 A;  1UIV A;  4PFU A;  4YB7 A;  1I6A A;  4BLA A;  1PB9 A;  3O66 A;  3TTR A;  4M1V A;  1BKA A;  5KZT A;  5IKB A;  4F29 A;  4F1Y A;  4DIG A;  4GWZ A;  4DXB A;  1JW1 A;  3FAS A;  1VE4 A;  4YB5 A;  1YTV A;  1Y3P A;  2DE2 A;  2V3T A;  3S4U A;  2DQV A;  1Y1M A;  1QUJ A;  1MQH A;  2HAU A;  2V3Q A;  5ICT A;  3ODB A;  2OWT A;  4RXL A;  1FPI A;  1FQB A;  3SET A;  5I5P A;  3U8Q A;  4F22 A;  3DP6 A;  4ELQ A;  3VXC A;  2REG A;  5EQ8 A;  4ZE9 A;  5FBP A;  3Q27 A;  3PMX A;  4Q0C A;  4ZZA A;  3EN3 A;  4NF8 A;  3MZ9 A;  3O2A A;  2NXO A;  1S50 A;  4LON B;  2RKM A;  4AQ4 A;  2Z8E A;  4EDP A;  1LBX A;  2F36 A;  4KQP A;  4YKJ A;  4R72 A;  3B6T A;  2GQ1 A;  3HV1 A;  4NF8 B;  1DMB A;  1N7X A;  1JVY A;  4QRZ A;  3OEN A;  4H8I A;  2QVU A;  4P9K A;  1BP5 A;  1VFE A;  1FTM A;  1FTJ A;  4EF1 A;  3HHF A;  3SEV A;  3RT8 A;  4PP0 A;  3DEL B;  3GLB A;  1FCK A;  3BBR A;  1OIB A;  2CZI A;  4P56 A;  4RJZ A;  3CRB A;  3CFX A;  2R71 A;  1JET A;  3SEU A;  4UAC A;  2O7U A;  4XEQ A;  1MQI A;  4M4G A;  1FPE A;  5EQ7 A;  1R9L A;  3B7D A;  1MQJ A;  3M3K A;  1QGX A;  2ANJ A;  1D3K A;  3Q25 A;  1QUL A;  4NG7 A;  1H43 A;  2H9B A;  1MQD A;  4OFO A;  1R9Q A;  4R74 A;  5B70 A;  2MKZ A;  2GHB A;  3BFT A;  5EHM A;  4BDL A;  4Q8R A;  1IXG A;  4IO4 A;  2XWO A;  1XHY A;  4JWX A;  1GTK A;  1HSE A;  4LUB A;  3RYD A;  1O7T A;  3UN6 A;  3H06 B;  4JWY A;  1B46 A;  2FIE A;  2HEU A;  5K2X A;  1P99 A;  2YLN A;  3SDF A;  3W9W A;  4N81 A;  3IB0 A;  2V25 A;  2PMS A;  2R6G E;  3TTK A;  2PFZ A;  3THI A;  3MVW A;  2IA4 A;  3QIM A;  1B2H A;  3FZV A;  4EF2 A;  3RNN A;  2OK2 A;  4H5F A;  1KWH A;  5IZ3 A;  3B8B A;  2ZYM A;  4WEP A;  4EQ9 A;  1SVX B;  1B3G A;  4PFT A;  5ICQ A;  3W9V A;  1AWB A;  3O29 A;  1EH3 A;  5IZ3 B;  4DI3 D;  4ZS9 A;  5FTI A;  3RUM A;  1LBW A;  2O1L A;  1NNF A;  1B0H A;  1XC1 A;  3OMB A;  4GVO A;  4IO6 A;  2DOJ A;  1FQC A;  1B58 A;  1OVT A;  4G2Z A;  1TFD A;  1QVS A;  4O3B A;  1KA0 A;  4F1V A;  3OEM A;  1NUX A;  3MYU A;  2WKY A;  4GRK A;  1LBY A;  3FD3 A;  4IGR A;  3TOD A;  1IME A;  3IJO B;  3LBS A;  4MFI A;  3EF7 A;  4ZED A;  1VFD A;  4MNP A;  4GL0 A;  1UTB A;  3DP8 A;  4PAK A;  3FBP A;  1OVB A;  3KJT A;  1NNT A;  1XS5 A;  4Q30 B;  3VXB A;  4P3L A;  2FHY A;  1UTB B;  3CR9 A;  1KA1 A;  3FUZ A;  4FIM A;  4P0G A;  2P0S A;  1UTH A;  4PC9 A;  3RPW A;  2G93 A;  4EXL A;  3B6Q A;  4U1O A;  3ECR A;  2Z23 A;  2QVV A;  5J1D A;  1I6Q A;  1UTH B;  4MJO A;  4OWD A;  1LBC A;  1RKM A;  3MPL A;  2PT2 A;  3A29 A;  4GD5 A;  2B65 A;  3U92 A;  3PUX E;  2UVG A;  3I3V A;  1XVY A;  1AOV A;  5ET7 A;  5L9O A;  3FXR A;  3V8X B;  1FRP A;  4GXS B;  1BTJ A;  1D9V A;  1NH7 A;  4MHF A;  1POY 1;  1YAE A;  1XOC A;  5LOM A;  4N6D A;  4PAF A;  3GYY A;  2RC9 A;  2ZZW A;  3MVY A;  4R73 A;  4G8N A;  2B4L A;  4PE5 B;  1POT A;  4MIJ A;  3FIR A;  4F3B A;  3QSL A;  3MC2 A;  3FJM A;  4NF5 A;  3O97 A;  1B7Z A;  3TEL A;  1Y4T A;  1NV6 A;  1G0H A;  2X7Q A;  2F78 A;  4F3P A;  3EKI A;  3V89 B;  4NF5 B;  3VLW A;  2CZK A;  3IOV A;  1Y3Q A;  3DM0 A;  3FGS A;  3S9E A;  3ILT B;  4RK2 A;  4AB6 A;  4F2O A;  4GOT A;  1B1X A;  4O3C A;  4MCO A;  1YYZ A;  1MXY A;  2DXY A;  2ONK E;  4EQ7 A;  2Z8F A;  4HTG A;  3TCH A;  5LDZ A;  4GWY A;  1B32 A;  5CMB A;  5FHM A;  1IZ1 A;  1US5 A;  1N84 A;  3A3C A;  4RPN A;  3BKI B;  4QFN A;  3I6V A;  3H4Z A;  3CVG A;  4N91 A;  4NAP A;  1UIU A;  4O94 A;  1TWY A;  2XXP A;  3AXF A;  3Q29 A;  1YZ0 A;  2UVI A;  1ZMG A;  3VFJ A;  1BLF A;  4GWS A;  5I56 A;  3OSR A;  4UAB A;  4F31 B;  2HZL A;  5ET6 A;  3N6T A;  4LZ8 A;  1EU8 A;  2AYS A;  3WAE A;  5KCJ B;  3OO8 A;  3KJ7 A;  5I56 B;  1JEV A;  4KYD A;  2NOO A;  4PE3 A;  1FPB A;  4P1E A;  1CB6 A;  2XX9 A;  1CE2 A;  4RNS A;  2UYF A;  4YZZ A;  4TOZ A;  1H3D A;  1TT1 A;  2Y7W A;  1FSA A;  1EYJ A;  4P47 A;  1FJ6 A;  5F24 A;  1RYO A;  3KZG A;  2DWJ A;  2YJP A;  4LQ5 A;  3M3F A;  4NHB A;  3LSF B;  3PMV A;  1URD A;  4I3Y A;  4F18 A;  5CBR A;  3T9U A;  4ONY A;  2WBD A;  5ET8 A;  4OVT A;  5EHS A;  3G3K A;  1LAH E;  3IJX B;  5EQ9 A;  3OO7 A;  4YIC A;  4HW8 A;  4IGT A;  3FVN A;  1FBE A;  4H65 A;  4G8M A;  4U22 A;  3PTY A;  2P1S A;  5FHO A;  1ZLQ A;  3EHT A;  1SI0 A;  1QJM A;  3QAX A;  4GX3 A;  4NED A;  3QYT A;  2QMW A;  3C31 A;  1AL3 A;  1FPD A;  2Q9T A;  4OFJ A;  3OOA A;  4BDN A;  1QUI A;  2CZH A;  1IMA A;  3V83 A;  4XKN A;  2I58 A;  4OVP A;  3BIG A;  1SW2 A;  1B3E A;  3IFC A;  4OTE A;  4R6Y A;  5CMC A;  3HN0 A;  1B5H A;  2OX3 A;  4YMB A;  2F34 A;  1DK4 A;  3QUF A;  4PGN A;  2AL5 A;  1Z7M E;  1ATG A;  1WOD A;  2I49 A;  2ZXT A;  4I40 A;  2BJJ X;  4WED A;  1BIY A;  3MJN A;  1A7L A;  1FQA A;  1J1N A;  1XI6 A;  2O69 A;  3CG3 A;  4ZEB A;  4HE2 A;  5DW8 A;  2R8T A;  3G3J A;  4NF4 A;  4FE8 A;  4GX6 A;  1LB8 A;  3M3L A;  5JK4 A;  4G61 A;  3KC1 A;  5I2K A;  1MM7 A;  4HCY A;  2ZZV A;  4NX1 A;  5HBC A;  4XF5 A;  5B7D A;  5AA4 A;  4NF4 B;  4ZZE A;  3ZKK A;  2DE4 A;  2XXY A;  4EQB A;  4G8H A;  3K6W A;  1IMC A;  2DWI A;  3IFA A;  1JEU A;  5I2K B;  4OZ9 A;  5AA4 B;  1ZTY A;  3TCG A;  5HPQ A;  1A99 A;  3N6U A;  1MXV A;  2XXV A;  1Y9U A;  4RA1 A;  3QMF A;  1Y3N A;  4YU0 A;  4JSD A;  4ZE8 A;  2XWV A;  1B51 A;  5L9S A;  4DE8 A;  4OMB A;  4O7I A;  3E4R A;  3U1O A;  1D9Q A;  4H45 A;  4PET A;  2RCA A;  2WYK A;  1NI9 A;  1HSL A;  5CRY A;  4GFR A;  2BJI A;  1AH5 A;  2Q89 A;  2OJT A;  5ISU A;  3HFU A;  3MP6 A;  1Y1Z A;  2QRY A;  4QFP A;  2DWA A;  4UA8 A;  4XTC Q;  5AA2 B;  1K9Y A;  4AS5 A;  2QS1 A;  2F6P A;  4K3F A;  1LBZ A;  3OD7 A;  4ECF A;  4GLI A;  3TZA A;  3KG2 A;  3U72 A;  3FV2 A;  1DPP A;  3K1M A;  2Y7K A;  2V4C A;  3C36 A;  4I8C A;  1IMB A;  4OAN A;  1JNF A;  2RC7 A;  4TLL B;  2F3D A;  3P7I A;  4N13 A;  3BIH A;  4ZEF A;  4QFK A;  1ANF A;  2RF1 A;  3TDJ A;  4E0X A;  1JW4 A;  4GX4 A;  4OEV A;  5L9M A;  1IEJ A;  1FQE A;  3T1B A;  3G3G A;  1FPJ A;  4G68 C;  2XWI A;  3MWB A;  3U65 A;  3A3U A;  2A5T B;  1NMU A;  3ISP A;  2L5V A;  3EHS A;  4LN5 A;  5ESY A;  5F1Q A;  3H6W A;  2I6E A;  5FTH A;  1QKA A;  2D5W A;  3R7X A;  4OVS A;  3TYH A;  4C1U A;  4DCY A;  2F97 A;  3MVZ A;  2H4I A;  5ET5 A;  4ELR A;  3IO6 A;  3SZP A;  2I0C A;  1FW0 A;  1JVX A;  2ZZX A;  3TMG A;  3TCF A;  1DSN A;  3TAJ A;  4GBV A;  1IIW A;  4FED A;  4DZ1 A;  5M2V A;  2LAO A;  3VVF A;  3A09 A;  3UP9 A;  1FPG A;  1FBP A;  2OWZ A;  4KXP A;  5I59 A;  3U93 A;  1ZIU A;  3Q26 A;  1MH3 A;  2VHA A;  3LUY A;  3E9X A;  4MX6 A;  2F35 A;  3TKD A;  2FIX A;  2F7C A;  3V5A A;  2ESN A;  5KDT A;  2OZZ A;  5I59 B;  1MY4 A;  5F7V A;  5AA1 A;  1NNP A;  2I0B A;  4ISU A;  5KDT B;  3QUJ A;  4HE0 A;  1ZU0 A;  1EYK A;  4GBW A;  4TLM B;  3C33 A;  3K2D A;  4H67 A;  1MY3 A;  3D4C A;  3PUV E;  4GIZ A;  4QF9 A;  4NWC A;  3IK6 B;  1US4 A;  1URS A;  1MH4 A;  1B4H A;  3VLV A;  1RDY A;  1OQG A;  5BWJ A;  2O84 X;  1MQG A;  4R9G A;  3JV9 A;  3TFL A;  3UA8 A;  1PB7 A;  3MW0 A;  4KCC A;  4ESW A;  1FTK A;  4GXA A;  4HXV A;  3K1N A;  1DPE A;  3VV5 A;  2ALU A;  4EUO A;  1B7U A;  1EYI A;  2CZL A;  3PGF A;  4BDM A;  4TQU Q;  4R75 A;  2IEE A;  3PPO A; 
#chains in the Genus database with same CATH homology
 4Z0I A;  4KCD A;  3UGW A;  1IIT A;  3ONM A;  4IB2 A;  4IY6 A;  4H8J A;  3MVX A;  3JZJ A;  1MXU A;  2OCU A;  4ELP A;  3FV1 A;  2O1M A;  1XVX A;  4QSD A;  4I1D A;  1M5B A;  3G7W A;  3SER A;  4OES A;  1TFA A;  1N7W A;  4BDQ A;  2QS3 A;  1A8E A;  1P1Q A;  4QHQ A;  2QS2 A;  3H3G A;  3FVG A;  3HPI A;  3Q28 A;  1PBP A;  2A5S A;  5ELV A;  3IOU A;  1SD3 A;  1GR2 A;  4G68 A;  3ILU B;  3CG1 A;  2Q2A A;  2I3W A;  1LST A;  1FTO A;  1A55 A;  4G68 B;  4E0W A;  2VD2 A;  2RC8 A;  2V93 A;  3C4M A;  2ZNU A;  4LVQ A;  2UVJ A;  1MPD A;  4MH5 A;  1LLS A;  1SW1 A;  2ZNT A;  4WKM A;  2Z22 A;  1DTG A;  3FJ7 A;  3FVK A;  4OVJ A;  1B7H A;  1URG A;  4THI A;  1AIV A;  1WVJ A;  1B1H A;  1SDX A;  3MUQ A;  3C34 A;  2Q88 A;  2NVU B;  4KHZ E;  5ITP A;  2F5X A;  3IX1 A;  3S9L C;  1MY1 A;  4U4X A;  5KCJ A;  3TEP A;  3KGC A;  3PPQ A;  2PYY A;  4JWO A;  2ZNS A;  1IXC A;  4X1D A;  3L6H A;  2E1S A;  3PD8 A;  3RQT A;  4X48 A;  2D21 A;  5DVF A;  1A8F A;  3MZ1 A;  3PPN A;  1MS7 A;  2YPN A;  3CI8 A;  3K0V A;  2DVC A;  2X7P A;  2XXW A;  4N07 A;  5DVJ A;  3C32 A;  1B3F A;  3IOT A;  4OEN A;  4R6H A;  2DS9 A;  2E0S A;  1B6H A;  1Q35 A;  1IXI A;  3EQ1 A;  1QKB A;  3IAZ A;  4C1T A;  3UK4 A;  2RCB A;  4X1B A;  3G3I A;  1M5F A;  1N3X A;  2XD2 A;  3K6U A;  5BUU A;  3UIF A;  2FYI A;  3K01 A;  2I48 A;  5JEI A;  4QSE A;  4PFY A;  3K00 A;  1PEB A;  3USD A;  2B3F A;  1Q1K A;  4XKR A;  3UOR A;  3ZSF A;  1I6B A;  4DDD A;  3SEY A;  2OBG A;  5TP9 B;  4GQO A;  4F2Q A;  3HHG A;  3O6I A;  3W15 C;  1P1U A;  4IY5 A;  1I69 A;  4JSO A;  3CSB A;  4I9D A;  3SEW A;  3OSQ A;  1P1O A;  3T96 B;  2VD3 A;  4DXU A;  4Z7E A;  4R2F A;  3VE1 B;  3PPP A;  3KN7 A;  2GRV A;  4LZ5 A;  2XXQ A;  2HFB A;  3ZS6 A;  2XXU A;  1D9Y A;  4YKK A;  4P0I A;  1N76 A;  2H25 A;  1MM6 A;  4EXK A;  1NL5 A;  1SQY A;  2GH9 A;  2ZMB A;  3IR1 A;  3KN3 A;  5DEX A;  3LSL A;  3IO4 A;  5DEX B;  1ZJL A;  4QSC A;  1OQH A;  4WXJ A;  3M8U A;  2PBW A;  1TXF A;  4GWO A;  5AA3 A;  1MY0 A;  4HS7 A;  2P2A A;  2XXI A;  4H1X A;  4YMA A;  4H6D A;  1SI1 A;  2O51 A;  4KD5 A;  1MY2 A;  3BFU A;  4LAT A;  4L17 A;  4PQJ A;  3S9M C;  5CC2 A;  4I62 A;  2VOZ A;  3GXA A;  1MRP A;  3PV0 E;  2FA7 A;  3S2V A;  4C0R A;  3O9P A;  5ITO A;  3E3K A;  1NNK A;  1NH8 A;  3FXQ A;  3H03 A;  4IO3 A;  3SKP A;  2H5Y A;  3PU5 A;  4GL8 A;  4PFW A;  5DT6 A;  4YAH X;  1LCF A;  5AA2 A;  2GHA A;  2HAV A;  2DXR A;  2O68 A;  2Y84 A;  2I3V A;  3E13 X;  5H8H A;  2O6A A;  3C35 A;  2H98 A;  1USY E;  1R1N A;  3WAF A;  3MP8 A;  4QFL A;  1B40 A;  1F9B A;  5H8H B;  2ZYN A;  1LB9 A;  2F7A A;  5FHN A;  1USY H;  2UVH A;  1M5D A;  3G3H A;  3MPK A;  1LFI A;  4G4P A;  4JBZ A;  3T9H B;  2KLF A;  4XKP A;  2G29 A;  3CIJ A;  5DTB A;  1MXW A;  1A54 A;  1EZO A;  1EZ9 A;  3K1P A;  3T9X B;  1SYH A;  1MG1 A;  4NTL A;  2DVZ A;  2QSX A;  3O6G A;  4HCW A;  1MXZ A;  2A5T A;  1WDN A;  3HCQ A;  3OEK A;  1GGG A;  2OWS A;  3KSX A;  4Q5T A;  2PVU A;  2UYE A;  2DWH A;  5H8N A;  2Q8J A;  3GBA A;  4MF3 A;  3IL1 B;  3O6H A;  4MLV A;  4NF6 A;  3DP4 A;  4H0W A;  3RT6 B;  3VLU A;  4RYA A;  4GF8 A;  2HXW A;  5H8N B;  1FTL A;  3QK6 A;  5CI5 A;  4NF6 B;  1IQ7 A;  3R6U A;  1OMP A;  3MZB A;  2Y7I A;  5HM4 B;  3CFZ A;  2I4B A;  2F7B A;  3IOR A;  4DLD A;  1YPN A;  2D3I A;  1JQF A;  2F8D A;  4KR5 A;  1MPC A;  3T93 B;  1M5E A;  5JTY A;  5DYH A;  1LGB C;  3K6V A;  2RIN A;  4OET A;  3C9H A;  3LC8 A;  3T66 A;  3TQW A;  4ESX A;  1IUD A;  3U94 A;  3KSJ A;  5JTY B;  3GBB A;  2FNC A;  2QL3 A;  3OO9 A;  5DVI A;  3S9N C;  2NUV A;  5A5X A;  4ELO A;  4RPO A;  3OO6 A;  1PDA A;  3KOS A;  3H6T A;  2XXX A;  2GFE A;  4IO5 A;  5A5X B;  4FOR A;  3B6W A;  3IOW A;  3GZG A;  4H5G A;  1H76 A;  2B3B A;  3KEI A;  3FAT A;  1PC3 A;  3TTL A;  5CMM A;  1Y4C A;  1B4Z A;  2ABH A;  2OLB A;  3RN8 A;  1O63 A;  1LFH A;  3EHU A;  1NFT A;  2H99 A;  2Z8D A;  3KOT A;  3PUW E;  2ONR A;  1H45 A;  2XXR A;  2QMX A;  3FVO A;  4MLQ A;  4X9T A;  4NWD A;  2XXT A;  3I5O A;  1GVC A;  4FEB A;  5AE4 A;  4KPT A;  5TU0 A;  2Y7R A;  2ZYK A;  4QFO A;  1SYI A;  3EPE A;  4U1Z A;  1II5 A;  3VVE A;  3K6X A;  4U2R A;  4F19 A;  4F3S A;  4XIG Q;  2DSF A;  5AA2 D;  4AB5 A;  1B3L A;  3N94 A;  1H44 A;  2HQ0 A;  1QUK A;  1LCT A;  4LZ7 A;  3ZKL A;  3PMW A;  2Q2C A;  1PBQ A;  3RLF E;  1VSO A;  3DLN A;  1MDP 1;  2V3U A;  1M5C A;  5I2N A;  4FEC A;  4KFQ A;  3TPA A;  3HST A;  1SW5 A;  3K02 A;  4IO2 A;  1R6Z A;  3PUZ E;  3LR1 A;  4DXC A;  3SES A;  5I2N B;  2ZYO A;  5I57 A;  2CMO A;  5CMK A;  2PX1 A;  1FQD A;  1MPB A;  5IAI A;  2QS4 A;  4U23 A;  4R6K A;  1PB8 A;  5I57 B;  4DCX A;  1N04 A;  4JDF A;  2ONS A;  1LAG E;  1L5T A;  4JXI A;  3FJG A;  4KYE A;  2UXA A;  3PD9 A;  3H6V A;  3T9V A;  1RYX A;  5TPA A;  1YCJ A;  4G77 A;  3RTW B;  1IXH A;  1N0T A;  3SEX A;  3TTM A;  3F11 A;  2THI A;  1SBP A;  3TQL A;  1LFG A;  3QXM A;  5TPA B;  4POW A;  4U21 A;  1O64 A;  3OXN A;  4F39 A;  4YKI A;  1A40 A;  2M8C A;  4KYS A;  2XX7 A;  4OYV A;  3FXU A;  1DTZ A;  1T0K A;  2QPQ A;  2PT1 A;  2DYX A;  1Z7N E;  2VP1 A;  3HO7 A;  4NE4 A;  1OLC A;  4FJP A;  4ZEK A;  4BDO A;  1B5I A;  1B05 A;  3LSX A;  3G3F A;  2AIX A;  3H7M A;  2DP8 A;  4KI0 E;  4MBP A;  3KN8 A;  3D4G A;  2X26 A;  3R26 A;  4P11 A;  4ZDM A;  4OHN A;  1GV8 A;  1B0L A;  1LAX A;  5H8S A;  3TTN A;  4R9F A;  1D4N A;  1NKX A;  3JYR A;  4JB7 A;  3MAM A;  4FAT A;  1ELJ A;  3KBR A;  2QJE A;  3KFM A;  4RK9 A;  3MBP A;  5TP9 A;  2NWJ A;  1OLA A;  5CBS A;  3CFL A;  2W7Y A;  2REJ A;  4LA9 A;  5H8Q A;  4F3G A;  5K2Y A;  1UQW A;  4XKQ A;  3MQ9 A;  2V84 A;  1MXX A;  4XXU A;  1HSJ A;  5I58 A;  4OFL A;  5H8Q B;  2R9J A;  1QW0 A;  1AMF A;  3K4U A;  1LAF E;  5CM6 A;  5I58 B;  4LP2 B;  4N6P A;  1FQF A;  5I84 A;  4OQO A;  4F1U A;  3VVD A;  3LSW A;  1B52 A;  1MDQ A;  1B3H A;  1B5J A;  4R2B A;  4RY1 A;  1JW5 A;  3L6G A;  4IO7 A;  4FAJ A;  2XX8 A;  4YKP A;  4O3A A;  2I4C A;  3N26 A;  2XD3 A;  3MP1 A;  2DE3 A;  3VDF A;  3CSG A;  4OEU A;  4NMY A;  4BDR A;  3IB1 A;  3O28 A;  4OER A;  1B9J A;  1VR5 A;  5H8F A;  5L8D A;  1SW4 A;  1P1W A;  1XT8 A;  4U4S A;  3N5L A;  3RGY A;  2XHD A;  1ZKB A;  2HCA A;  5H8F B;  1DOT A;  3RY3 A;  4YB6 A;  3PPR A;  1N3W A;  1P1N A;  4OXV A;  1EZP A;  2VGQ A;  4ND9 A;  4ZEI A;  1S9T A;  2HZK A;  3T22 A;  4ZEC A;  5EYF A;  1LBB A;  2AL4 A;  3RTF B;  2F6G A;  1S7Y A;  1Y20 A;  3PUY E;  4POX A;  3IB2 A;  1ZBM A;  3TUS A;  3H6U A;  4LQ2 A;  2XXH A;  2Y7P A;  2O7I A;  3OEL A;  1UIV A;  4PFU A;  4YB7 A;  1I6A A;  4BLA A;  1PB9 A;  3O66 A;  3TTR A;  4M1V A;  1BKA A;  5KZT A;  5IKB A;  4F29 A;  4F1Y A;  4DIG A;  4DXB A;  1JW1 A;  3FAS A;  1VE4 A;  4YB5 A;  1YTV A;  1Y3P A;  2DE2 A;  2V3T A;  3S4U A;  2DQV A;  1Y1M A;  1QUJ A;  1MQH A;  2HAU A;  2V3Q A;  5ICT A;  3ODB A;  2OWT A;  4RXL A;  1FQB A;  3SET A;  3U8Q A;  4F22 A;  3DP6 A;  4ELQ A;  3VXC A;  2REG A;  4ZE9 A;  3Q27 A;  3PMX A;  4Q0C A;  4ZZA A;  3EN3 A;  4NF8 A;  3MZ9 A;  3O2A A;  2NXO A;  1S50 A;  4LON B;  2RKM A;  4AQ4 A;  2Z8E A;  4EDP A;  2F36 A;  4KQP A;  4YKJ A;  4R72 A;  3B6T A;  3HV1 A;  4NF8 B;  1DMB A;  1N7X A;  1JVY A;  4QRZ A;  3OEN A;  4H8I A;  1BP5 A;  1VFE A;  1FTM A;  1FTJ A;  4EF1 A;  3HHF A;  3SEV A;  3RT8 A;  4PP0 A;  3DEL B;  3GLB A;  1FCK A;  3BBR A;  1OIB A;  4RJZ A;  3CRB A;  3CFX A;  2R71 A;  1JET A;  3SEU A;  4UAC A;  2O7U A;  1MQI A;  4M4G A;  1R9L A;  3B7D A;  1MQJ A;  3M3K A;  2ANJ A;  1D3K A;  3Q25 A;  1QUL A;  1H43 A;  2H9B A;  1MQD A;  4OFO A;  1R9Q A;  4R74 A;  5B70 A;  2GHB A;  3BFT A;  5EHM A;  4BDL A;  4Q8R A;  1IXG A;  4IO4 A;  1XHY A;  4JWX A;  1GTK A;  1HSE A;  4LUB A;  1O7T A;  3UN6 A;  3H06 B;  4JWY A;  1B46 A;  2HEU A;  5K2X A;  1P99 A;  2YLN A;  3SDF A;  3W9W A;  3IB0 A;  2V25 A;  2PMS A;  2R6G E;  3TTK A;  3THI A;  3MVW A;  2IA4 A;  3QIM A;  1B2H A;  3FZV A;  4EF2 A;  3RNN A;  2OK2 A;  4H5F A;  1KWH A;  2ZYM A;  4WEP A;  4EQ9 A;  1SVX B;  1B3G A;  4PFT A;  5ICQ A;  3W9V A;  3O29 A;  1EH3 A;  4ZS9 A;  5FTI A;  3RUM A;  2O1L A;  1NNF A;  1B0H A;  1XC1 A;  3OMB A;  4GVO A;  4IO6 A;  2DOJ A;  1FQC A;  1B58 A;  1OVT A;  4G2Z A;  1TFD A;  1QVS A;  4O3B A;  4F1V A;  3OEM A;  2WKY A;  4GRK A;  3FD3 A;  4IGR A;  3TOD A;  3IJO B;  3LBS A;  4MFI A;  3EF7 A;  4ZED A;  1VFD A;  4GL0 A;  1UTB A;  3DP8 A;  1OVB A;  3KJT A;  1NNT A;  1XS5 A;  4Q30 B;  3VXB A;  1UTB B;  3CR9 A;  3FUZ A;  4FIM A;  4P0G A;  2P0S A;  1UTH A;  3RPW A;  2G93 A;  4EXL A;  3B6Q A;  4U1O A;  3ECR A;  2Z23 A;  5J1D A;  1I6Q A;  1UTH B;  4OWD A;  1LBC A;  1RKM A;  3MPL A;  2PT2 A;  4GD5 A;  2B65 A;  3U92 A;  3PUX E;  2UVG A;  3I3V A;  1XVY A;  1AOV A;  5L9O A;  3FXR A;  3V8X B;  4GXS B;  1BTJ A;  1D9V A;  1NH7 A;  1POY 1;  1YAE A;  1XOC A;  5LOM A;  2RC9 A;  3MVY A;  4R73 A;  4G8N A;  4PE5 B;  1POT A;  3FIR A;  4F3B A;  3QSL A;  3MC2 A;  3FJM A;  4NF5 A;  3O97 A;  1B7Z A;  3TEL A;  1Y4T A;  2X7Q A;  2F78 A;  4F3P A;  3V89 B;  4NF5 B;  3VLW A;  3IOV A;  1Y3Q A;  3DM0 A;  3FGS A;  3S9E A;  3ILT B;  4RK2 A;  4AB6 A;  4F2O A;  4GOT A;  1B1X A;  4O3C A;  1MXY A;  2DXY A;  2ONK E;  4EQ7 A;  2Z8F A;  4HTG A;  3TCH A;  1B32 A;  5CMB A;  5FHM A;  1IZ1 A;  1US5 A;  1N84 A;  3A3C A;  4RPN A;  3BKI B;  4QFN A;  3I6V A;  3H4Z A;  3CVG A;  1UIU A;  1TWY A;  2XXP A;  3AXF A;  3Q29 A;  2UVI A;  1ZMG A;  3VFJ A;  1BLF A;  5I56 A;  3OSR A;  4F31 B;  2HZL A;  3N6T A;  4LZ8 A;  1EU8 A;  2AYS A;  3WAE A;  5KCJ B;  3OO8 A;  3KJ7 A;  5I56 B;  1JEV A;  4KYD A;  2NOO A;  1CB6 A;  2XX9 A;  1CE2 A;  4RNS A;  2UYF A;  4YZZ A;  4TOZ A;  1H3D A;  1TT1 A;  2Y7W A;  1RYO A;  3KZG A;  2DWJ A;  2YJP A;  4LQ5 A;  3M3F A;  3LSF B;  3PMV A;  1URD A;  4F18 A;  5CBR A;  3T9U A;  4ONY A;  5EHS A;  3G3K A;  1LAH E;  3IJX B;  3OO7 A;  4YIC A;  4HW8 A;  4IGT A;  3FVN A;  4H65 A;  4G8M A;  4U22 A;  2P1S A;  5FHO A;  1ZLQ A;  3EHT A;  1SI0 A;  1QJM A;  3QAX A;  4NED A;  3QYT A;  2QMW A;  3C31 A;  1AL3 A;  2Q9T A;  4OFJ A;  3OOA A;  4BDN A;  1QUI A;  3V83 A;  4XKN A;  2I58 A;  1SW2 A;  1B3E A;  4OTE A;  4R6Y A;  5CMC A;  3HN0 A;  1B5H A;  4YMB A;  2F34 A;  3QUF A;  2AL5 A;  1Z7M E;  1ATG A;  1WOD A;  2I49 A;  2ZXT A;  2BJJ X;  4WED A;  1BIY A;  3MJN A;  1A7L A;  1FQA A;  1J1N A;  2O69 A;  3CG3 A;  4ZEB A;  3G3J A;  4NF4 A;  4FE8 A;  1LB8 A;  3M3L A;  5JK4 A;  5I2K A;  1MM7 A;  4HCY A;  5HBC A;  5B7D A;  5AA4 A;  4NF4 B;  4ZZE A;  3ZKK A;  2DE4 A;  2XXY A;  4EQB A;  4G8H A;  3K6W A;  2DWI A;  5I2K B;  1JEU A;  4OZ9 A;  5AA4 B;  1ZTY A;  3TCG A;  5HPQ A;  1A99 A;  3N6U A;  1MXV A;  2XXV A;  1Y9U A;  4RA1 A;  1Y3N A;  4YU0 A;  4JSD A;  4ZE8 A;  1B51 A;  5L9S A;  4DE8 A;  4OMB A;  3E4R A;  3U1O A;  4PET A;  2RCA A;  1HSL A;  5CRY A;  4GFR A;  1AH5 A;  2Q89 A;  2OJT A;  5ISU A;  3MP6 A;  1Y1Z A;  2QRY A;  4QFP A;  2DWA A;  4UA8 A;  4XTC Q;  5AA2 B;  2QS1 A;  2F6P A;  4K3F A;  3OD7 A;  4ECF A;  4GLI A;  3TZA A;  3KG2 A;  3U72 A;  3FV2 A;  1DPP A;  3K1M A;  2Y7K A;  3C36 A;  4I8C A;  1JNF A;  2RC7 A;  4TLL B;  3P7I A;  4N13 A;  4ZEF A;  4QFK A;  1ANF A;  2RF1 A;  3TDJ A;  4E0X A;  1JW4 A;  4OEV A;  5L9M A;  1IEJ A;  1FQE A;  3G3G A;  4G68 C;  3MWB A;  3A3U A;  2A5T B;  1NMU A;  3EHS A;  5F1Q A;  3H6W A;  2I6E A;  5FTH A;  1QKA A;  2D5W A;  3R7X A;  3TYH A;  4C1U A;  4DCY A;  2F97 A;  3MVZ A;  2H4I A;  4ELR A;  3IO6 A;  2I0C A;  1FW0 A;  1JVX A;  3TMG A;  3TCF A;  1DSN A;  3TAJ A;  1IIW A;  4FED A;  4DZ1 A;  5M2V A;  2LAO A;  3VVF A;  3A09 A;  3UP9 A;  5I59 A;  3U93 A;  1ZIU A;  3Q26 A;  1MH3 A;  2VHA A;  3LUY A;  3E9X A;  2F35 A;  3TKD A;  2F7C A;  3V5A A;  2ESN A;  5KDT A;  2OZZ A;  5I59 B;  1MY4 A;  5F7V A;  5AA1 A;  1NNP A;  2I0B A;  4ISU A;  5KDT B;  3QUJ A;  1ZU0 A;  4TLM B;  3C33 A;  3K2D A;  4H67 A;  1MY3 A;  3D4C A;  3PUV E;  4GIZ A;  4QF9 A;  4NWC A;  3IK6 B;  1US4 A;  1URS A;  1MH4 A;  1B4H A;  3VLV A;  1OQG A;  5BWJ A;  2O84 X;  1MQG A;  4R9G A;  3JV9 A;  3TFL A;  3UA8 A;  1PB7 A;  3MW0 A;  4KCC A;  4ESW A;  1FTK A;  4GXA A;  3K1N A;  1DPE A;  3VV5 A;  2ALU A;  4EUO A;  1B7U A;  3PGF A;  2CZL A;  4BDM A;  4TQU Q;  4R75 A;  2IEE A;  3PPO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...