1SD3A

Crystal structure of the glur6 ligand binding core in complex with 2s,4r-4-methylglutamate at 1.8 angstrom resolution
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
251
structure length
251
Chain Sequence
NRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKGTPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Glutamate receptor, ionotropic kainate 2
publication title Crystal structures of the GluR5 and GluR6 ligand binding cores: molecular mechanisms underlying kainate receptor selectivity.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 83
structure length 251
sequence length 251
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-02-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1sd3A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1sd3A02
3H7MA 4NF6B 1GGGA 2V3QA 3MPKA 3IOUA 1OVBA 3EHUA 2F36A 1LBCA 4N07A 2H25A 3MVZA 3RLFE 1A8EA 3O6HA 4JBZA 4U22A 3FXQA 3UGWA 2IEEA 3JZJA 3IK6B 5L8DA 4ELPA 2Y7PA 4R6YA 5CBSA 3K4UA 5TP9A 3KOSA 1IXGA 3SERA 4ELQA 4OXVA 4GF8A 1D9VA 4FORA 3SESA 3ZKKA 2NWJA 1JQFA 1ZIUA 1H45A 4Q5TA 5B7DA 3GZGA 4BDNA 3PUZE 4F1YA 3PUYE 4LVQA 1B3GA 4EQ7A 2O7IA 3KJTA 5H8QB 4XKQA 4HS7A 4FIMA 3A3CA 4PFYA 2XXRA 3LSWA 4IB2A 1MS7A 5I59A 3KFMA 3B7DA 3IJOB 4MF3A 1Y3NA 2QS4A 4R9GA 2XXXA 2F78A 1GTKA 1QUIA 2LAOA 4WEPA 3W9VA 1MY3A 3CFLA 4ZZEA 3O2AA 3AXFA 3CI8A 3RT8A 3IB1A 3FVOA 4NF5A 3TCHA 2Q2CA 2A5TB 2PT2A 1O64A 4G8MA 1B9JA 4PE5B 4DCYA 5ISUA 3RNNA 3PMWA 1YCJA 3R26A 3N94A 4X48A 2Q2AA 4I9DA 3OO8A 4U2RA 1B58A 4Q30B 3PMXA 4PP0A 1A40A 3KSXA 1S7YA 2UVIA 1Y1ZA 1SBPA 4C0RA 1IZ1A 1MPCA 2I6EA 4F22A 2P2AA 4NF4B 4ZEBA 1DMBA 2QMWA 4ESXA 2NUVA 4YKIA 3TQLA 1D3KA 3O29A 1PB9A 4DXUA 3Q26A 1KWHA 4G8NA 4GXSB 1LSTA 3TEPA 2R71A 3KN3A 2DVZA 3H4ZA 3U1OA 2DXYA 2V25A 3H03A 3S4UA 1XOCA 2VD3A 5KDTA 2RCAA 1QW0A 3O97A 1MPBA 3GBBA 3G7WA 3C31A 4OENA 4F3PA 2R9JA 3TTNA 4H0WA 2VD2A 2UVHA 2GH9A 5I56B 2HZKA 3RTWB 3E3KA 1SYIA 3PMVA 1N0TA 4HCYA 3V5AA 3A09A 1PB8A 4XKRA 4MH5A 1IXHA 1XHYA 2XXUA 4RPOA 1VFEA 1MXZA 3ZSFA 1RYOA 2HXWA 3JV9A 4ZZAA 4QFPA 3N26A 3OENA 4OMBA 3I3VA 1JW1A 2THIA 1QJMA 1VE4A 4POXA 4NMYA 3SEUA 3FXRA 3K1NA 3OO7A 2OZZA 2M8CA 1N84A 2Q88A 2X7PA 3IJXB 3MZBA 3EPEA 3S9MC 3SDFA 1JEVA 5ITOA 3O6GA 2XXPA 4NWDA 1L5TA 2H9BA 3H6TA 3H3GA 4ECFA 2XX9A 4ND9A 2PYYA 4GRKA 4ZEIA 3C32A 3QIMA 2DWIA 1MY4A 3LR1A 1MPDA 1I69A 2ANJA 3DM0A 4RK9A 1AOVA 4H65A 5AA2A 1H43A 3HO7A 3VE1B 1IEJA 1R9QA 1BP5A 2RCBA 2RF1A 3D4CA 1MRPA 4F18A 2X26A 5AA4B 2F6PA 1OLAA 3MQ9A 1T0KA 1AL3A 4NWCA 4PQJA 3V89B 3A3UA 3QYTA 3FVKA 4Z0IA 3T96B 1VR5A 4G68C 3USDA 3TFLA 4KYEA 3FXUA 4OQOA 3IX1A 4NEDA 3TDJA 3TCGA 1ZJLA 4KYSA 1Q1KA 1QKAA 4YB6A 3K01A 1LCTA 3BFTA 1FQBA 1I6QA 1P1UA 2QPQA 1A55A 1FTMA 1XS5A 2ALUA 5H8HA 5I58B 1P1NA 1MY1A 2B3BA 2HQ0A 3VLVA 1MH4A 3O66A 4BDLA 5AE4A 4RPNA 2DE4A 3BFUA 1MXVA 4F3GA 1P1QA 5I57A 2O1MA 1FTLA 3FVNA 1Y20A 1ATGA 5TPAB 1FQAA 1II5A 2QJEA 4QSCA 2DWJA 1FCKA 3GLBA 1NMUA 4ZEKA 4FEDA 2ZNUA 1ELJA 3R6UA 4LZ7A 3ILUB 2REGA 4GL0A 2V3TA 3EQ1A 1LFIA 2QMXA 3HHFA 5K2XA 2G93A 3CRBA 5DEXA 2B65A 4ESWA 3M8UA 4TQUQ 3IOTA 1HSJA 4JDFA 4YB5A 4EXLA 2FYIA 2O69A 4M1VA 4L17A 4H5FA 1H3DA 3UORA 5CM6A 4G2ZA 3C9HA 4I1DA 1OVTA 1SD3A 4NF8A 1MXYA 2G29A 4QFKA 2I49A 2ZYMA 4LQ2A 3FJMA 1TXFA 1SI0A 3HV1A 2Z22A 2XXIA 4YKKA 1ANFA 1CB6A 1PDAA 1UTBA 2DWHA 5AA1A 3K6UA 2DXRA 3OEMA 3RN8A 2ONKE 4EXKA 2OBGA 4G77A 3KJ7A 1A8FA 2QSXA 4RNSA 3MVWA 3UP9A 3E4RA 3LC8A 3WAEA 1H76A 4N13A 1SI1A 3Q25A 3V83A 2DOJA 1Y4CA 3TPAA 2ONSA 3KN8A 3T66A 5TP9B 3VVFA 3ZKLA 1EZPA 5DVIA 1QVSA 3W15C 3Q28A 3VVEA 4EF1A 3S9LC 2DE2A 3RT6B 3W9WA 3FD3A 1M5DA 3IB2A 4KCCA 3MJNA 1TFAA 1M5CA 5H8FA 4YU0A 4ZEFA 2VOZA 1XVYA 4DE8A 4F1VA 1RKMA 2R6GE 3OELA 1B4HA 1GR2A 3SEWA 4EUOA 2I3VA 3HHGA 4EDPA 1OIBA 3MW0A 2OJTA 1B52A 2XXHA 3CR9A 3SKPA 1B2HA 4QHQA 1MQGA 1YAEA 3CFZA 3I5OA 4WXJA 4Q8RA 4NF5B 3MP1A 1B5HA 3DP8A 2V3UA 5ICQA 4M4GA 4ZECA 3TQWA 3SEVA 3PUWE 4XXUA 4LATA 1MQIA 2Y7RA 1ZU0A 1B5JA 1MDP1 1FQFA 5EHMA 3MVXA 4KPTA 2PMSA 4R2BA 1MG1A 1IIWA 3MAMA 3VV5A 2XD2A 3TTLA 1BKAA 1UIVA 3N6UA 1D9YA 4G68A 3QK6A 1SYHA 4YAHX 5I2NA 5CRYA 3K6WA 4LZ5A 1MQHA 4ZE8A 1AH5A 1MH3A 1B05A 3TYHA 2FA7A 5BUUA 4R2FA 4OETA 4MBPA 3IORA 4TLMB 3MC2A 1IITA 1PC3A 5KZTA 4TOZA 2NOOA 3EF7A 1US4A 2ZYKA 1LAFE 4H1XA 1Y9UA 2Y84A 5L9SA 1QUKA 2I0CA 4KFQA 2UVJA 2PVUA 4X1BA 3MVYA 1Y3QA 1IQ7A 1Z7ME 3T22A 4OEUA 3LBSA 4ZDMA 5JTYA 5KDTB 1A54A 4MLQA 1Q35A 3QUFA 1POY1 1MQJA 2F7BA 3QSLA 3FVGA 4U4SA 5TU0A 1N04A 4IO2A 1BIYA 1QUJA 2I0BA 4U1ZA 5FHMA 5I2KA 3IOVA 4PFTA 1IXCA 4QSEA 5DYHA 1B4ZA 1N3WA 3MWBA 1DTZA 1QULA 2QL3A 1R6ZA 1CE2A 5CMCA 1TFDA 2I3WA 3TTMA 5A5XA 3H6VA 1FQDA 1MXXA 1NH7A 1SW5A 3UN6A 3R7XA 4JWXA 4X1DA 4ISUA 1IUDA 3OO6A 2XXYA 2QRYA 4HCWA 2GHAA 3IOWA 5F1QA 2F6GA 3FJGA 3K00A 3HPIA 1UTHA 1H44A 3FASA 3GBAA 1FQCA 4GD5A 3S2VA 2V93A 4AB5A 4UA8A 1OQHA 5KCJB 1PEBA 2O6AA 2D21A 3B6WA 5AA2B 4H6DA 5FHNA 3O28A 4OEVA 3IO4A 1JVXA 3OSQA 3T93B 3T9HB 1EZOA 4XIGQ 3IL1B 4LP2B 2Y7KA 2PX1A 4F3SA 3KBRA 3O9PA 3PPNA 4ZEDA 1JEUA 1B7UA 5FTIA 5I56A 5L9MA 4C1TA 2GHBA 4GIZA 4DCXA 2XXVA 4HTGA 3C36A 4PFUA 4RXLA 4BDOA 1JETA 2Y7IA 4GOTA 5H8NA 4POWA 5JK4A 1URDA 1FTJA 1XC1A 5H8HB 2D3IA 3PUVE 2UYFA 2YJPA 3TZAA 3G3KA 2NXOA 1LB9A 3TUSA 3T9VA 1MM6A 1I6AA 4GL8A 2XX8A 4O3CA 4ONYA 1B1XA 3Q27A 3ECRA 4FJPA 4GVOA 1N7WA 1EU8A 3LSFB 3U72A 1D4NA 2FNCA 5IAIA 1WVJA 3VLUA 1I6BA 1A99A 5I57B 2D5WA 4BDQA 2Z8EA 2RC7A 3PPRA 2P0SA 2WKYA 2UXAA 3TELA 2X7QA 5ICTA 4P11A 3TTKA 4AB6A 4LONB 4G8HA 1QKBA 3BBRA 1DPEA 3PD8A 4E0XA 1B5IA 4FECA 4EQBA 3G3FA 1SDXA 2W7YA 5DEXB 1PB7A 4IO5A 4JWYA 1ZBMA 4F29A 3E9XA 5B70A 5CMMA 5AA4A 4MLVA 4GFRA 1PBPA 1AMFA 2B3FA 4U23A 4DIGA 4QF9A 4G4PA 4YZZA 1M5FA 3MBPA 4ELOA 4NF8B 2Y7WA 3M3KA 5I84A 1FTOA 4FE8A 4QRZA 3K2DA 3Q29A 4IO4A 3B6TA 3UA8A 2HEUA 1TT1A 1UTBB 3ILTB 2AL4A 3RUMA 2F7AA 1Y4TA 1WDNA 3N5LA 1WODA 3L6GA 3GXAA 4K3FA 2DSFA 2OWSA 1NFTA 3EHTA 5EHSA 2VHAA 1OQGA 2Q9TA 4AQ4A 2Z23A 1TWYA 3HN0A 4LZ8A 4YKPA 5J1DA 2DVCA 1NNTA 4BDRA 1B46A 4H5GA 3IO6A 1S9TA 4HW8A 2RINA 4DZ1A 3JYRA 5AA2D 3PU5A 2HAVA 1IXIA 3U92A 4F2OA 1SW2A 2YLNA 4FEBA 2RC9A 1VSOA 3WAFA 2F34A 2QS3A 5H8FB 5JEIA 1P1WA 1USYH 4BLAA 4H8JA 5EYFA 4JSOA 1FW0A 1NNFA 4U1OA 4OESA 3CFXA 3G3IA 3PD9A 3CG1A 5CBRA 4OFLA 2F5XA 3F11A 2ZYNA 4GQOA 5HPQA 1OLCA 4BDMA 3HCQA 2PBWA 3SEYA 3EHSA 4KHZE 1SW1A 5H8SA 4YMBA 2H5YA 2ESNA 2RC8A 1OMPA 2QS1A 3KOTA 2DWAA 3IR1A 2H4IA 4DXCA 2DE3A 1XVXA 1YPNA 1JW5A 3BKIB 3KG2A 1R9LA 4PFWA 3KN7A 2CZLA 5I59B 2XX7A 2ZNTA 3CSGA 3FATA 3LUYA 4IY5A 1B6HA 4G68B 1LAXA 4KI0E 3MZ1A 1B3EA 5I2NB 4OFOA 1MDQA 1Y3PA 4WKMA 3K6XA 4F2QA 4R9FA 5DT6A 3UIFA 1DPPA 3K0VA 4IGTA 4THIA 3TCFA 5ELVA 4KCDA 4F19A 3CG3A 4NF6A 4NE4A 3MPLA 1MXWA 2OLBA 1LFHA 2REJA 5JTYB 2XXWA 1MXUA 1NKXA 3VXBA 3OEKA 3ONMA 1B40A 2CMOA 4O3AA 2H99A 4QFNA 2O84X 2F97A 3TKDA 3OO9A 4YB7A 1R1NA 1VFDA 2HZLA 2DQVA 3DLNA 1GV8A 5I2KB 4MFIA 3FJ7A 4OZ9A 3VLWA 4OHNA 3OMBA 3C34A 3RQTA 2KLFA 3TTRA 4X9TA 1PBQA 4R75A 1N3XA 1URGA 2VGQA 2ONRA 4KD5A 3S9NC 3LSLA 5H8QA 5A5XB 1GVCA 3L6HA 1BTJA 1Y1MA 3U93A 4QFOA 3OXNA 3RTFB 2OK2A 1JNFA 1ZKBA 1FQEA 3C33A 4F1UA 2DYXA 5FHOA 1DTGA 2RKMA 3IB0A 1ZTYA 2HAUA 3K1MA 2OWTA 4ZE9A 2ABHA 3PPOA 4R6HA 1LB8A 4XTCQ 2VP1A 2A5TA 2GFEA 3VVDA 3G3JA 4O3BA 1UTHB 3U94A 4OFJA 4RJZA 1J1NA 2AYSA 3THIA 4H67A 2Q89A 1B3HA 1XT8A 1LAHE 2E1SA 2ZXTA 3K1PA 4RK2A 1M5BA 3MP6A 2I58A 4QFLA 5IKBA 1MY2A 3SEXA 3MZ9A 1JW4A 4NF4A 3C4MA 3QXMA 3P7IA 4P0IA 1YTVA 4YKJA 2Z8DA 4N6PA 1A7LA 2XHDA 1MY0A 4DDDA 4I62A 1SQYA 4F39A 1BLFA 2YPNA 1USYE 3U8QA 3S9EA 5H8NB 2AL5A 3OOAA 4R6KA 4NTLA 1M5EA 4JSDA 4GWOA 2P1SA 3O6IA 4JB7A 1FTKA 1SVXB 3D4GA 1SW4A 1EZ9A 1MM7A 4FAJA 1ZLQA 3PPPA 1B1HA 2O1LA 4EF2A 3TAJA 4IGRA 3CIJA 3MP8A 5LOMA 1LAGE 2XXTA 2F35A 2XXQA 3SETA 3OD7A 4RYAA 1B3FA 4F3BA 3ODBA 1B7ZA 3B6QA 2I48A 1DOTA 3VDFA 2GRVA 5KCJA 3KZGA 2ZYOA 4PETA 4GLIA 1B3LA 4EQ9A 5BWJA 3G3HA 1B7HA 1F9BA 1MQDA 2PT1A 3K6VA 2XD3A 3V8XB 3LSXA 4R74A 1N76A 1ZMGA 4Q0CA 2I4BA 4R73A 4IO6A 1HSLA 1US5A 3H6WA 2HFBA 3RPWA 4JXIA 4P0GA 4ELRA 3TODA 2HCAA 2IA4A 5HM4B 1LFGA 4QSDA 1NNKA 3OSRA 1HSEA 3PPQA 4FATA 3KSJA 4LUBA 5AA3A 2E0SA 3FV1A 3DP6A 2O68A 5FTHA 1LLSA 5L9OA 3K02A 5HBCA 4OTEA 4GXAA 4XKPA 4R72A 4RY1A 2O51A 4OWDA 3HSTA 3KEIA 3PGFA 2BJJX 3FGSA 3E13X 4U21A 1UIUA 4UACA 2NVUB 2V84A 3IAZA 4E0WA 1B0HA 1URSA 4I8CA 5CMKA 1UQWA 2F7CA 3RY3A 2ZNSA 3FUZA 3ZS6A 2DP8A 1DSNA 4DXBA 1LBBA 1B0LA 5DVFA 3UK4A 2OCUA 1AIVA 3FIRA 3H6UA 3KGCA 3CVGA 5K2YA 1LCFA 5I58A 3MUQA 4XKNA 1Z7NE 3DELB 2DS9A 5F7VA 4KR5A 3FV2A 5CC2A 4IY6A 3QUJA 3T9UA 4KQPA 2Q8JA 4ZS9A 4JWOA 4H8IA 1NNPA 3CSBA 4KYDA 1S50A 2H98A 4LQ5A 4OYVA 4TLLB 4WEDA 2QS2A 5TPAA 3C35A 1NL5A 3N6TA 1POTA 4U4XA 2ZMBA 4IO3A 4LA9A 3DP4A 5DVJA 4OVJA 1LGBC 1P1OA 1B51A 3VXCA 2I4CA 5ITPA 1NH8A 4IO7A 5DTBA 3PV0E 1RYXA 5CI5A 3M3FA 4Z7EA 1EH3A 1P99A 3PUXE 5M2VA 4YICA 3RGYA 3EN3A 3TMGA 4DLDA 3I6VA 4C1UA 1O7TA 5CMBA 4OERA 3H06B 4RA1A 1B32A 1N7XA 3QAXA 1O63A 2UVGA 2AIXA 2UYEA 2F8DA 3T9XB 3G3GA 4F31B 3M3LA 2Z8FA 3VFJA 2O7UA 4YMAA 1JVYA 2A5SA 3FZVA
chains in the Genus database with same CATH superfamily
2PFYA 3H7MA 4NF6B 1GGGA 4GWYA 2V3QA 3MPKA 3IOUA 1OVBA 1SPIA 3EHUA 2F36A 1LBCA 4N07A 1LBWA 2H25A 3MVZA 3RLFE 1A8EA 3O6HA 4JBZA 4U22A 3FXQA 3UGWA 2IEEA 3JZJA 3IK6B 5L8DA 4ELPA 4GWSA 2Y7PA 4R6YA 4PAKA 5CBSA 3K4UA 1LBXA 5TP9A 3KOSA 1IXGA 3SERA 4ELQA 4OXVA 4GF8A 1D9VA 4FORA 3SESA 2FIXA 3ZKKA 2NWJA 1JQFA 1ZIUA 1H45A 4X04A 1DK4A 4Q5TA 5B7DA 2FIEA 3GZGA 4BDNA 3PUZE 4F1YA 3PUYE 4XFEA 4LVQA 1B3GA 4EQ7A 2O7IA 3KJTA 5H8QB 4XKQA 4HS7A 4N6KA 4FIMA 3A3CA 4PFYA 2XXRA 3LSWA 4IB2A 1MS7A 5I59A 3KFMA 3B7DA 3IJOB 4MF3A 1Y3NA 2QS4A 4R9GA 2DDKA 2XXXA 2F78A 1GTKA 1QUIA 2LAOA 4WEPA 3W9VA 1MY3A 3CFLA 4ZZEA 3O2AA 1NV4A 3AXFA 3CI8A 3RT8A 4O7IA 3IB1A 3FVOA 4NF5A 3TCHA 1D9QA 5EQ8A 5IGAA 2Q2CA 2A5TB 4DI4B 2PT2A 4NG7A 1O64A 4G8MA 2HHMA 1B9JA 4PE5B 4DCYA 5ISUA 3RNNA 3PMWA 1YCJA 3R26A 3N94A 4X48A 1G0IA 2Q2AA 4I9DA 3OO8A 5I3SA 4HE1A 3FXBA 4U2RA 1B58A 4Q30B 3PMXA 4PP0A 1A40A 3KSXA 1S7YA 2UVIA 1Y1ZA 1SBPA 4C0RA 1IZ1A 4OA4A 1MPCA 2I6EA 4F22A 2P2AA 4NF4B 4ZEBA 4O94A 1DMBA 2QMWA 4ESXA 5ET7A 2NUVA 4YKIA 3TQLA 1D3KA 3O29A 1PB9A 3EKIA 4DXUA 3Q26A 1KWHA 4G8NA 4GXSB 1LSTA 3TEPA 2R71A 3KN3A 2DVZA 3H4ZA 3U1OA 2DXYA 2V25A 3H03A 3S4UA 1XOCA 1FBHA 2VD3A 5LDZA 4UABA 5KDTA 2RCAA 1QW0A 2VPNA 3O97A 4I3EA 1MPBA 3GBBA 3G7WA 3C31A 3D1RA 4OENA 4F3PA 2R9JA 3TTNA 4H0WA 4P47A 2VD2A 2UVHA 2GH9A 5I56B 2HZKA 3E78A 3RTWB 3B50A 3E3KA 1SYIA 3PMVA 1N0TA 4HCYA 3V5AA 3A09A 1PB8A 2ZZWA 4XKRA 4MH5A 1IXHA 1XHYA 2XXUA 4RPOA 1VFEA 1MXZA 3ZSFA 1RYOA 2HXWA 3JV9A 1FBGA 4ZZAA 3BIHA 4LN5A 4GWXA 4QFPA 3N26A 3OENA 4OMBA 3I3VA 1JW1A 2THIA 1QJMA 1VE4A 4PE3A 4POXA 4NMYA 3SEUA 3FXRA 3K1NA 3OO7A 2OZZA 2M8CA 1N84A 2Q88A 2X7PA 3IJXB 3MZBA 3EPEA 3S9MC 3SDFA 1JEVA 5ITOA 3O6GA 2F3BA 2XXPA 4NWDA 1L5TA 4GWWA 2H9BA 1AWBA 3H6TA 3H3GA 4ECFA 2XX9A 4ND9A 2GQ1A 2PYYA 4GRKA 1KA0A 4ZEIA 3C32A 3QIMA 5IZ1A 2DWIA 1MY4A 3LR1A 1MPDA 1I69A 2ANJA 3DM0A 4RK9A 1AOVA 4H65A 5AA2A 1H43A 3HO7A 3VE1B 1IEJA 3T1BA 1R9QA 1BP5A 2RCBA 2RF1A 3D4CA 1MRPA 4F18A 2X26A 5AA4B 2F6PA 1OLAA 3MQ9A 1T0KA 1AL3A 4NWCA 4PQJA 2Q8MA 3V89B 3A3UA 1YZ0A 3FVKA 3QYTA 4Z0IA 3T96B 1VR5A 4G68C 3USDA 3TFLA 2MKZA 4KYEA 3FXUA 4N8GA 4OQOA 3IX1A 1NUZA 1CNQA 4NEDA 3TDJA 3TCGA 1FPEA 1ZJLA 4KYSA 1Q1KA 1QKAA 4QXDA 4YB6A 3K01A 1LCTA 3BFTA 1FJ6A 1FQBA 1I6QA 1P1UA 4I40A 2QPQA 1A55A 1FTMA 1XS5A 2ALUA 2VT5A 5H8HA 5I58B 1P1NA 1MY1A 2R8TA 2B3BA 2HQ0A 3VLVA 1MH4A 3O66A 4JVIA 4BDLA 5AE4A 4RPNA 2DE4A 1INPA 3BFUA 1MXVA 4F3GA 2VPOA 1P1QA 1K9ZA 1NV6A 5I57A 2O1MA 1FTLA 3FVNA 1Y20A 1ATGA 5TPAB 1FQAA 1II5A 4OANA 2QJEA 4QSCA 2DWJA 1FCKA 4PFBA 3GLBA 1NMUA 4ZEKA 4FEDA 2ZNUA 1ELJA 3R6UA 4LZ7A 3ILUB 3LUZA 2REGA 4GL0A 2V3TA 3EQ1A 1LFIA 2QMXA 4PAFA 3HHFA 5K2XA 2G93A 3CRBA 5DEXA 1NV2A 2B65A 4ESWA 3M8UA 4TQUQ 3IOTA 1HSJA 4JDFA 4YB5A 4EXLA 2FYIA 3HFUA 4GWUA 2O69A 4M1VA 4L17A 4H5FA 1H3DA 3UORA 5CM6A 4G2ZA 4QBAA 3C9HA 4OVPA 4N91A 4I1DA 1OVTA 1SD3A 4NF8A 1MXYA 2G29A 4QFKA 4PFIA 2I49A 2ZYMA 5A5LA 4LQ2A 3FJMA 1TXFA 1SI0A 3HV1A 2Z22A 2XXIA 4YKKA 1BK4A 4NHBA 1ANFA 1CB6A 1PDAA 1UTBA 2DWHA 4OVQA 5AA1A 2XWVA 3K6UA 2DXRA 4PFRA 3OEMA 3RN8A 2ONKE 1IMCA 3E79A 4EXKA 2OBGA 1YXIA 1FRPA 4G77A 3KJ7A 1A8FA 2QSXA 4RNSA 3MVWA 3UP9A 3E4RA 3LC8A 3WAEA 1IMEA 1H76A 4N13A 1SI1A 3Q25A 3V83A 4PGPA 2DOJA 1Y4CA 3TPAA 2ONSA 3KN8A 3T66A 5TP9B 3VVFA 3ZKLA 1EZPA 5DVIA 1FTAA 1QVSA 3W15C 3Q28A 3VVEA 1FBFA 4EF1A 5J16A 3S9LC 2DE2A 3RT6B 3W9WA 3FD3A 1M5DA 4GBWA 3IB2A 1LEVA 4KCCA 3MJNA 1TFAA 1M5CA 1FBEA 5H8FA 4YU0A 4ZEFA 2VOZA 1XVYA 4DE8A 4F1VA 1RKMA 1JP4A 2R6GE 3OELA 1B4HA 1GR2A 3SEWA 4EUOA 1EYJA 2Q74A 1NV5A 1VDWA 2I3VA 3HHGA 4EDPA 1OIBA 2WYKA 3MW0A 2OJTA 1B52A 1IMFA 2XXHA 3CR9A 3SKPA 1B2HA 4QHQA 1MQGA 4HE2A 1YAEA 3CFZA 3I5OA 4WXJA 4Q8RA 4NF5B 4NGUA 3MP1A 1IMBA 1B5HA 3DP8A 2V3UA 5ICQA 4M4GA 4ZECA 3TQWA 3SEVA 3PUWE 4XXUA 4LATA 1MQIA 2Y7RA 1B5JA 1ZU0A 1MDP1 3KBZA 1NV1A 1FQFA 5EHMA 3MVXA 4KPTA 2PMSA 4R2BA 1MG1A 1IIWA 3MAMA 3VV5A 2XD2A 3TTLA 1BKAA 2FBPA 1UIVA 4PTKA 2ZZVA 3N6UA 1D9YA 4G68A 3QK6A 1SYHA 4YAHX 4GX3A 5I2NA 2F3DA 5CRYA 3K6WA 2CZHA 4LZ5A 1MQHA 4ZE8A 1AH5A 1MH3A 3RYDA 1B05A 3TYHA 2FA7A 5BUUA 4R2FA 4OETA 4MBPA 3IORA 2CEYA 4TLMB 2XXKA 3MC2A 1IITA 1PC3A 5KZTA 4TOZA 2NOOA 4NX1A 3EF7A 1US4A 2ZYKA 4N17A 1LAFE 4H1XA 1Y9UA 2Y84A 4N8YA 5L9SA 1QUKA 2I0CA 4KFQA 2UVJA 2PVUA 4X1BA 3MVYA 1Y3QA 3QMFA 1IQ7A 1Z7ME 4O7MA 3T22A 4OEUA 4PBQA 3LBSA 4ZDMA 5JTYA 5KDTB 1A54A 1NUXA 4MLQA 1KA1A 1Q35A 3QUFA 1POY1 1MQJA 2F7BA 3QSLA 3FVGA 3U65A 4H46A 4U4SA 5TU0A 3SZPA 1N04A 4IO2A 1BIYA 1QUJA 2I0BA 4U1ZA 5FHMA 5I2KA 1FSAA 3IOVA 4KXPA 4PF8A 1NV7A 4PFTA 3ISPA 4N6DA 4OVSA 1IXCA 4QSEA 5DYHA 3PTYA 1B4ZA 1N3WA 3MWBA 1DTZA 1QULA 2QL3A 1R6ZA 1CE2A 5CMCA 1TFDA 2I3WA 4NAPA 3TTMA 3IFAA 5A5XA 3H6VA 1FQDA 1MXXA 1NH7A 1SW5A 3UN6A 3R7XA 1FPJA 4JWXA 4X1DA 4PGNA 4ISUA 1IUDA 3OO6A 2XXYA 2QRYA 4HCWA 1YYZA 2GHAA 3IOWA 5F1QA 2F6GA 3FJGA 3K00A 3HPIA 5ET6A 1UTHA 1H44A 3FASA 3GBAA 1FQCA 4GD5A 4P3LA 3S2VA 2V93A 4AB5A 4P1EA 4UA8A 1KZ8A 1OQHA 5KCJB 1PEBA 2O6AA 5ESYA 2D21A 3B6WA 5AA2B 4OEVA 4H6DA 3O28A 4MMPA 3IO4A 5FHNA 1JVXA 3OSQA 3T93B 1Q9DA 4GWZA 3T9HB 1EZOA 4XIGQ 3IL1B 4LP2B 1G0HA 3NOHA 2Y7KA 2PX1A 4F3SA 3CHGA 2QVVA 1NUWA 3FBPA 4P1LA 3KBRA 3O9PA 3PPNA 4ZEDA 1JEUA 2WBDA 1B7UA 3BIGA 5FTIA 5I56A 5L9MA 1NUYA 4MIJA 4C1TA 2GHBA 4GIZA 4DCXA 2XXVA 4HTGA 3C36A 4PFUA 4RXLA 4BDOA 1JETA 2Y7IA 4GOTA 5H8NA 4POWA 5JK4A 1URDA 1FTJA 1XC1A 5H8HB 2D3IA 3PUVE 2UYFA 3B8BA 2YJPA 3TZAA 4XEQA 3G3KA 2NXOA 1LB9A 3TUSA 3T9VA 1MM6A 1I6AA 4GL8A 2XX8A 4O3CA 4ONYA 1B1XA 3Q27A 3ECRA 4FJPA 4GVOA 1N7WA 2PCRA 1EU8A 3LSFB 3U72A 1D4NA 2FNCA 5I5PA 1WVJA 5IAIA 3VLUA 1I6BA 1A99A 5I57B 2D5WA 4BDQA 2Z8EA 2RC7A 3PPRA 2P0SA 2WKYA 2UXAA 3TELA 2X7QA 5ICTA 4P11A 3TTKA 4AB6A 4PC9A 4LONB 4G8HA 1QKBA 3BBRA 1DPEA 3PD8A 4E0XA 1B5IA 3A29A 4FECA 4EQBA 4PDHA 3G3FA 1SDXA 2W7YA 4P56A 4PCDA 5DEXB 1PB7A 5FBPA 4IO5A 4JWYA 1ZBMA 4F29A 2KQZA 3E9XA 5B70A 5CMMA 3ROJA 5AA4A 4MLVA 4MNPA 4GFRA 1PBPA 1AMFA 4O8MA 2B3FA 4P8BA 4U23A 4MCOA 4DIGA 4QF9A 4G4PA 4YZZA 1XI6A 1M5FA 3MBPA 4ELOA 4GX4A 4NF8B 2Y7WA 3M3KA 5I84A 1FTOA 4FE8A 4QRZA 3K2DA 3Q29A 1IMAA 4IO4A 3B6TA 3UA8A 1NI9A 2HEUA 1TT1A 1UTBB 5EYHA 3ILTB 2AL4A 5EQAA 3RUMA 2F7AA 1Y4TA 1WDNA 3N5LA 1WODA 3L6GA 3GXAA 4K3FA 2DSFA 2OWSA 1NFTA 3EHTA 5EHSA 3RPLA 2VHAA 1OQGA 2Q9TA 4AQ4A 5T3JA 2Z23A 1TWYA 3KC1A 3HN0A 4LZ8A 4YKPA 5J1DA 2DVCA 1NNTA 4BDRA 1B46A 4H5GA 3IO6A 1S9TA 2PFZA 4HW8A 2FVZA 2RINA 1FBCA 2XWKA 5IZ3A 1FBDA 4DZ1A 3JYRA 4N4UA 5AA2D 3PU5A 2HAVA 1IXIA 2XA5A 3U92A 4F2OA 2QFLA 1SW2A 2YLNA 4FEBA 2RC9A 1VSOA 3WAFA 2F34A 2QS3A 1FPLA 4GBVA 5H8FB 5JEIA 1P1WA 1USYH 4BLAA 4H8JA 5EYFA 4JSOA 1FW0A 1NNFA 4U1OA 4OESA 3CFXA 3G3IA 4MEVA 3PD9A 3CG1A 5CBRA 4OFLA 2F5XA 3F11A 2ZYNA 4GQOA 1DBZA 5HPQA 1OLCA 4BDMA 1FPFA 3HCQA 2PBWA 3SEYA 3EHSA 4KHZE 5IM2A 1SW1A 2H5YA 2ESNA 5H8SA 4YMBA 2RC8A 1OMPA 2JJKA 2QS1A 3KOTA 2DWAA 3IR1A 2H4IA 4DXCA 2DE3A 1XVXA 1YPNA 1JW5A 5DW8A 3BKIB 3KG2A 1R9LA 3KC0A 2Y5KA 1LBYA 2Y5LA 4JVDA 3KN7A 4PFWA 2CZLA 4N81A 5I59B 2XX7A 2FHYA 4G61A 2ZNTA 3CSGA 3FATA 3LUYA 4IY5A 1LBZA 1B6HA 4G68B 1LAXA 4KI0E 3MZ1A 1B3EA 5I2NB 4OFOA 1MDQA 1Y3PA 4WKMA 3K6XA 4F2QA 2L5VA 4R9FA 5EQ7A 5DT6A 3UIFA 1DPPA 3K0VA 4IGTA 4THIA 3TCFA 5ELVA 4KCDA 4F19A 3CG3A 4NF6A 4NE4A 3MPLA 1MXWA 2OLBA 1LFHA 1NV0A 1FBPA 2REJA 2CZIA 5JTYB 2XXWA 1NV3A 1MXUA 1NKXA 3VXBA 3OEKA 3ONMA 1B40A 2CMOA 4O3AA 2H99A 4QFNA 2O84X 4HE0A 1EYKA 2F97A 2XWIA 3TKDA 3OO9A 4YB7A 1R1NA 1VFDA 2HZLA 2DQVA 2WEFA 3DLNA 1GV8A 5I2KB 4MFIA 3FJ7A 4OZ9A 3VLWA 4OHNA 3OMBA 3C34A 1FPGA 3RQTA 2KLFA 3TTRA 4X9TA 1FPKA 1PBQA 4R75A 1N3XA 1URGA 4KD5A 2VGQA 2ONRA 3S9NC 4PF6A 3LSLA 5H8QA 5LTCA 5A5XB 1GVCA 3L6HA 1BTJA 3MYUA 1Y1MA 3U93A 4QFOA 3OXNA 1FJ9A 3RTFB 2OK2A 1FPIA 1JNFA 1ZKBA 2CEXA 4H45A 1FQEA 3C33A 4F1UA 2DYXA 5FHOA 2ZZXA 1DTGA 2RKMA 3IB0A 1ZTYA 2HAUA 3K1MA 4PDDA 2OWTA 4ZE9A 2ABHA 3PPOA 4R6HA 1LB8A 3GYYA 4XTCQ 2VP1A 2A5TA 2GFEA 3VVDA 3G3JA 4O3BA 4X8RA 1UTHB 3U94A 4OFJA 4RJZA 1J1NA 2AYSA 3THIA 4H67A 2Q89A 1B3HA 1XT8A 1LAHE 2E1SA 2ZXTA 3K1PA 4RK2A 2KR0A 1M5BA 3MP6A 2I58A 4QFLA 5IKBA 1MY2A 3SEXA 3MZ9A 1JW4A 4NF4A 3C4MA 1QGXA 3QXMA 3P7IA 4P0IA 4HXVA 4GX6A 3LV0A 1YTVA 4YKJA 2B4LA 2Z8DA 4N6PA 1A7LA 4MJOA 2XHDA 4N15A 1MY0A 4IR8A 4DDDA 4I62A 1SQYA 4F39A 1BLFA 2YPNA 1USYE 3U8QA 3S9EA 5H8NB 2AL5A 3OOAA 4R6KA 4NTLA 1M5EA 4JSDA 4GWOA 5EYGA 2P1SA 3O6IA 4JB7A 1FTKA 1LBVA 1SVXB 4OVTA 3MSTA 3D4GA 1SW4A 2V4CA 1EZ9A 1MM7A 4FAJA 1ZLQA 3PPPA 1B1HA 2O1LA 4OVRA 4EF2A 3TAJA 4IGRA 1EYIA 4MHFA 3CIJA 3MP8A 5LOMA 1LAGE 2XXTA 2F35A 2XXQA 3SETA 2P3NA 4I3YA 3OD7A 4RYAA 1B3FA 1RDYA 4F3BA 3ODBA 1B7ZA 3B6QA 2I48A 1DOTA 3VDFA 2GRVA 5KCJA 4NN3A 3KZGA 4PBHA 2ZYOA 4PETA 5ET5A 4GLIA 1B3LA 4EQ9A 5BWJA 3G3HA 1B7HA 1F9BA 1MQDA 2PT1A 3K6VA 4JVCA 2XD3A 3V8XB 3LSXA 4R74A 1N76A 1RDXA 1ZMGA 4Q0CA 2I4BA 4R73A 4IO6A 5F24A 1HSLA 1US5A 3H6WA 2HFBA 4MNCA 4MNIA 3RPWA 4JXIA 4P0GA 4ELRA 3TODA 2HCAA 2IA4A 5HM4B 1LFGA 4P9KA 4MX6A 4QSDA 1NNKA 3OSRA 1HSEA 3PPQA 2WX9A 4FATA 3KSJA 4LUBA 5AA3A 2QVUA 2E0SA 2WYPA 3FV1A 2OWZA 3DP6A 2O68A 4FBPA 5FTHA 1LLSA 1K9YA 5L9OA 3K02A 5HBCA 4XF5A 1FPDA 4OTEA 1RDZA 4GXAA 4XKPA 5IZZA 4R72A 3RPLB 4RY1A 2O51A 2B4MA 4OWDA 1FPBA 3HSTA 3KEIA 3PGFA 2BJJX 3FGSA 2QVRA 4U21A 3E13X 1UIUA 4UACA 2NVUB 2V84A 3IAZA 4E0WA 1B0HA 2WBBA 1URSA 2OX3A 5I7IA 4I8CA 5CMKA 1UQWA 2F7CA 3RY3A 5IZ3B 4NF0A 2ZNSA 3FUZA 3ZS6A 2DP8A 1DSNA 4DXBA 1LBBA 1B0LA 5DVFA 3UK4A 2OCUA 1AIVA 3FIRA 3H6UA 3KGCA 3CVGA 5K2YA 1LCFA 5I58A 3MUQA 4XKNA 1Z7NE 1DCUA 4AS4A 3DELB 2DS9A 5F7VA 4KR5A 3FV2A 5CC2A 4IY6A 3QUJA 3T9UA 4KQPA 2Q8JA 2CZKA 4ZS9A 5ET8A 4DI3D 4JWOA 4H8IA 1NNPA 3CSBA 4KYDA 1S50A 2H98A 4LQ5A 4OYVA 4NQ8A 4TLLB 4WEDA 2QS2A 5TPAA 2HPGA 3C35A 1NL5A 3N6TA 5EQ9A 1POTA 4U4XA 2ZMBA 4IO3A 4LA9A 2P3VA 3DP4A 5DVJA 4OVJA 1LGBC 1P1OA 1B51A 3VXCA 2I4CA 3T0JA 5ITPA 1NH8A 4IO7A 5DTBA 3PV0E 4MAGA 1RYXA 5CI5A 3M3FA 4Z7EA 1EH3A 1P99A 2BJIA 1IMDA 3PUXE 5M2VA 4YICA 3RGYA 3EN3A 3TMGA 2HXRA 3I6VA 4DLDA 4AS5A 1O7TA 4C1UA 5CMBA 4OERA 3H06B 4RA1A 1B32A 1N7XA 3QAXA 4PAIA 2XWOA 1O63A 2UVGA 2AIXA 2UYEA 2F8DA 3T9XB 3G3GA 4F31B 3M3LA 2Z8FA 3IFCA 3VFJA 2O7UA 4YMAA 1JVYA 2A5SA 3FZVA
chains in the Genus database with same CATH topology
3H7MA 4NF6B 1GGGA 2V3QA 3MPKA 3IOUA 1OVBA 3EHUA 2F36A 1LBCA 4N07A 2H25A 3MVZA 3RLFE 1A8EA 3O6HA 4JBZA 4U22A 3FXQA 3UGWA 2IEEA 3JZJA 3IK6B 5L8DA 4ELPA 2Y7PA 4R6YA 5CBSA 3K4UA 5TP9A 3KOSA 1IXGA 3SERA 4ELQA 4OXVA 4GF8A 1D9VA 4FORA 3SESA 3ZKKA 2NWJA 1JQFA 1ZIUA 1H45A 4Q5TA 5B7DA 3GZGA 4BDNA 3PUZE 4F1YA 3PUYE 4LVQA 1B3GA 4EQ7A 2O7IA 3KJTA 5H8QB 4XKQA 4HS7A 4FIMA 3A3CA 4PFYA 2XXRA 3LSWA 4IB2A 1MS7A 5I59A 3KFMA 3B7DA 3IJOB 4MF3A 1Y3NA 2QS4A 4R9GA 2XXXA 2F78A 1GTKA 1QUIA 2LAOA 4WEPA 3W9VA 1MY3A 3CFLA 4ZZEA 3O2AA 3AXFA 3CI8A 3RT8A 3IB1A 3FVOA 4NF5A 3TCHA 2Q2CA 2A5TB 2PT2A 1O64A 4G8MA 1B9JA 4PE5B 4DCYA 5ISUA 3RNNA 3PMWA 1YCJA 3R26A 3N94A 4X48A 2Q2AA 4I9DA 3OO8A 4U2RA 1B58A 4Q30B 3PMXA 4PP0A 1A40A 3KSXA 1S7YA 2UVIA 1Y1ZA 1SBPA 4C0RA 1IZ1A 1MPCA 2I6EA 4F22A 2P2AA 4NF4B 4ZEBA 1DMBA 2QMWA 4ESXA 2NUVA 4YKIA 3TQLA 1D3KA 3O29A 1PB9A 4DXUA 3Q26A 1KWHA 4G8NA 4GXSB 1LSTA 3TEPA 2R71A 3KN3A 2DVZA 3H4ZA 3U1OA 2DXYA 2V25A 3H03A 3S4UA 1XOCA 2VD3A 5KDTA 2RCAA 1QW0A 3O97A 1MPBA 3GBBA 3G7WA 3C31A 4OENA 4F3PA 2R9JA 3TTNA 4H0WA 2VD2A 2UVHA 2GH9A 5I56B 2HZKA 3RTWB 3E3KA 1SYIA 3PMVA 1N0TA 4HCYA 3V5AA 3A09A 1PB8A 4XKRA 4MH5A 1IXHA 1XHYA 2XXUA 4RPOA 1VFEA 1MXZA 3ZSFA 1RYOA 2HXWA 3JV9A 4ZZAA 4QFPA 3N26A 3OENA 4OMBA 3I3VA 1JW1A 2THIA 1QJMA 1VE4A 4POXA 4NMYA 3SEUA 3FXRA 3K1NA 3OO7A 2OZZA 2M8CA 1N84A 2Q88A 2X7PA 3IJXB 3MZBA 3EPEA 3S9MC 3SDFA 1JEVA 5ITOA 3O6GA 2XXPA 4NWDA 1L5TA 2H9BA 3H6TA 3H3GA 4ECFA 2XX9A 4ND9A 2PYYA 4GRKA 4ZEIA 3C32A 3QIMA 2DWIA 1MY4A 3LR1A 1MPDA 1I69A 2ANJA 3DM0A 4RK9A 1AOVA 4H65A 5AA2A 1H43A 3HO7A 3VE1B 1IEJA 1R9QA 1BP5A 2RCBA 2RF1A 3D4CA 1MRPA 4F18A 2X26A 5AA4B 2F6PA 1OLAA 3MQ9A 1T0KA 1AL3A 4NWCA 4PQJA 3V89B 3A3UA 3QYTA 3FVKA 4Z0IA 3T96B 1VR5A 4G68C 3USDA 3TFLA 4KYEA 3FXUA 4OQOA 3IX1A 4NEDA 3TDJA 3TCGA 1ZJLA 4KYSA 1Q1KA 1QKAA 4YB6A 3K01A 1LCTA 3BFTA 1FQBA 1I6QA 1P1UA 2QPQA 1A55A 1FTMA 1XS5A 2ALUA 5H8HA 5I58B 1P1NA 1MY1A 2B3BA 2HQ0A 3VLVA 1MH4A 3O66A 4BDLA 5AE4A 4RPNA 2DE4A 3BFUA 1MXVA 4F3GA 1P1QA 5I57A 2O1MA 1FTLA 3FVNA 1Y20A 1ATGA 5TPAB 1FQAA 1II5A 2QJEA 4QSCA 2DWJA 1FCKA 3GLBA 1NMUA 4ZEKA 4FEDA 2ZNUA 1ELJA 3R6UA 4LZ7A 3ILUB 2REGA 4GL0A 2V3TA 3EQ1A 1LFIA 2QMXA 3HHFA 5K2XA 2G93A 3CRBA 5DEXA 2B65A 4ESWA 3M8UA 4TQUQ 3IOTA 1HSJA 4JDFA 4YB5A 4EXLA 2FYIA 2O69A 4M1VA 4L17A 4H5FA 1H3DA 3UORA 5CM6A 4G2ZA 3C9HA 4I1DA 1OVTA 1SD3A 4NF8A 1MXYA 2G29A 4QFKA 2I49A 2ZYMA 4LQ2A 3FJMA 1TXFA 1SI0A 3HV1A 2Z22A 2XXIA 4YKKA 1ANFA 1CB6A 1PDAA 1UTBA 2DWHA 5AA1A 3K6UA 2DXRA 3OEMA 3RN8A 2ONKE 4EXKA 2OBGA 4G77A 3KJ7A 1A8FA 2QSXA 4RNSA 3MVWA 3UP9A 3E4RA 3LC8A 3WAEA 1H76A 4N13A 1SI1A 3Q25A 3V83A 2DOJA 1Y4CA 3TPAA 2ONSA 3KN8A 3T66A 5TP9B 3VVFA 3ZKLA 1EZPA 5DVIA 1QVSA 3W15C 3Q28A 3VVEA 4EF1A 3S9LC 2DE2A 3RT6B 3W9WA 3FD3A 1M5DA 3IB2A 4KCCA 3MJNA 1TFAA 1M5CA 5H8FA 4YU0A 4ZEFA 2VOZA 1XVYA 4DE8A 4F1VA 1RKMA 2R6GE 3OELA 1B4HA 1GR2A 3SEWA 4EUOA 2I3VA 3HHGA 4EDPA 1OIBA 3MW0A 2OJTA 1B52A 2XXHA 3CR9A 3SKPA 1B2HA 4QHQA 1MQGA 1YAEA 3CFZA 3I5OA 4WXJA 4Q8RA 4NF5B 3MP1A 1B5HA 3DP8A 2V3UA 5ICQA 4M4GA 4ZECA 3TQWA 3SEVA 3PUWE 4XXUA 4LATA 1MQIA 2Y7RA 1ZU0A 1B5JA 1MDP1 1FQFA 5EHMA 3MVXA 4KPTA 2PMSA 4R2BA 1MG1A 1IIWA 3MAMA 3VV5A 2XD2A 3TTLA 1BKAA 1UIVA 3N6UA 1D9YA 4G68A 3QK6A 1SYHA 4YAHX 5I2NA 5CRYA 3K6WA 4LZ5A 1MQHA 4ZE8A 1AH5A 1MH3A 1B05A 3TYHA 2FA7A 5BUUA 4R2FA 4OETA 4MBPA 3IORA 4TLMB 3MC2A 1IITA 1PC3A 5KZTA 4TOZA 2NOOA 3EF7A 1US4A 2ZYKA 1LAFE 4H1XA 1Y9UA 2Y84A 5L9SA 1QUKA 2I0CA 4KFQA 2UVJA 2PVUA 4X1BA 3MVYA 1Y3QA 1IQ7A 1Z7ME 3T22A 4OEUA 3LBSA 4ZDMA 5JTYA 5KDTB 1A54A 4MLQA 1Q35A 3QUFA 1POY1 1MQJA 2F7BA 3QSLA 3FVGA 4U4SA 5TU0A 1N04A 4IO2A 1BIYA 1QUJA 2I0BA 4U1ZA 5FHMA 5I2KA 3IOVA 4PFTA 1IXCA 4QSEA 5DYHA 1B4ZA 1N3WA 3MWBA 1DTZA 1QULA 2QL3A 1R6ZA 1CE2A 5CMCA 1TFDA 2I3WA 3TTMA 5A5XA 3H6VA 1FQDA 1MXXA 1NH7A 1SW5A 3UN6A 3R7XA 4JWXA 4X1DA 4ISUA 1IUDA 3OO6A 2XXYA 2QRYA 4HCWA 2GHAA 3IOWA 5F1QA 2F6GA 3FJGA 3K00A 3HPIA 1UTHA 1H44A 3FASA 3GBAA 1FQCA 4GD5A 3S2VA 2V93A 4AB5A 4UA8A 1OQHA 5KCJB 1PEBA 2O6AA 2D21A 3B6WA 5AA2B 4H6DA 5FHNA 3O28A 4OEVA 3IO4A 1JVXA 3OSQA 3T93B 3T9HB 1EZOA 4XIGQ 3IL1B 4LP2B 2Y7KA 2PX1A 4F3SA 3KBRA 3O9PA 3PPNA 4ZEDA 1JEUA 1B7UA 5FTIA 5I56A 5L9MA 4C1TA 2GHBA 4GIZA 4DCXA 2XXVA 4HTGA 3C36A 4PFUA 4RXLA 4BDOA 1JETA 2Y7IA 4GOTA 5H8NA 4POWA 5JK4A 1URDA 1FTJA 1XC1A 5H8HB 2D3IA 3PUVE 2UYFA 2YJPA 3TZAA 3G3KA 2NXOA 1LB9A 3TUSA 3T9VA 1MM6A 1I6AA 4GL8A 2XX8A 4O3CA 4ONYA 1B1XA 3Q27A 3ECRA 4FJPA 4GVOA 1N7WA 1EU8A 3LSFB 3U72A 1D4NA 2FNCA 5IAIA 1WVJA 3VLUA 1I6BA 1A99A 5I57B 2D5WA 4BDQA 2Z8EA 2RC7A 3PPRA 2P0SA 2WKYA 2UXAA 3TELA 2X7QA 5ICTA 4P11A 3TTKA 4AB6A 4LONB 4G8HA 1QKBA 3BBRA 1DPEA 3PD8A 4E0XA 1B5IA 4FECA 4EQBA 3G3FA 1SDXA 2W7YA 5DEXB 1PB7A 4IO5A 4JWYA 1ZBMA 4F29A 3E9XA 5B70A 5CMMA 5AA4A 4MLVA 4GFRA 1PBPA 1AMFA 2B3FA 4U23A 4DIGA 4QF9A 4G4PA 4YZZA 1M5FA 3MBPA 4ELOA 4NF8B 2Y7WA 3M3KA 5I84A 1FTOA 4FE8A 4QRZA 3K2DA 3Q29A 4IO4A 3B6TA 3UA8A 2HEUA 1TT1A 1UTBB 3ILTB 2AL4A 3RUMA 2F7AA 1Y4TA 1WDNA 3N5LA 1WODA 3L6GA 3GXAA 4K3FA 2DSFA 2OWSA 1NFTA 3EHTA 5EHSA 2VHAA 1OQGA 2Q9TA 4AQ4A 2Z23A 1TWYA 3HN0A 4LZ8A 4YKPA 5J1DA 2DVCA 1NNTA 4BDRA 1B46A 4H5GA 3IO6A 1S9TA 4HW8A 2RINA 4DZ1A 3JYRA 5AA2D 3PU5A 2HAVA 1IXIA 3U92A 4F2OA 1SW2A 2YLNA 4FEBA 2RC9A 1VSOA 3WAFA 2F34A 2QS3A 5H8FB 5JEIA 1P1WA 1USYH 4BLAA 4H8JA 5EYFA 4JSOA 1FW0A 1NNFA 4U1OA 4OESA 3CFXA 3G3IA 3PD9A 3CG1A 5CBRA 4OFLA 2F5XA 3F11A 2ZYNA 4GQOA 5HPQA 1OLCA 4BDMA 3HCQA 2PBWA 3SEYA 3EHSA 4KHZE 1SW1A 5H8SA 4YMBA 2H5YA 2ESNA 2RC8A 1OMPA 2QS1A 3KOTA 2DWAA 3IR1A 2H4IA 4DXCA 2DE3A 1XVXA 1YPNA 1JW5A 3BKIB 3KG2A 1R9LA 4PFWA 3KN7A 2CZLA 5I59B 2XX7A 2ZNTA 3CSGA 3FATA 3LUYA 4IY5A 1B6HA 4G68B 1LAXA 4KI0E 3MZ1A 1B3EA 5I2NB 4OFOA 1MDQA 1Y3PA 4WKMA 3K6XA 4F2QA 4R9FA 5DT6A 3UIFA 1DPPA 3K0VA 4IGTA 4THIA 3TCFA 5ELVA 4KCDA 4F19A 3CG3A 4NF6A 4NE4A 3MPLA 1MXWA 2OLBA 1LFHA 2REJA 5JTYB 2XXWA 1MXUA 1NKXA 3VXBA 3OEKA 3ONMA 1B40A 2CMOA 4O3AA 2H99A 4QFNA 2O84X 2F97A 3TKDA 3OO9A 4YB7A 1R1NA 1VFDA 2HZLA 2DQVA 3DLNA 1GV8A 5I2KB 4MFIA 3FJ7A 4OZ9A 3VLWA 4OHNA 3OMBA 3C34A 3RQTA 2KLFA 3TTRA 4X9TA 1PBQA 4R75A 1N3XA 1URGA 2VGQA 2ONRA 4KD5A 3S9NC 3LSLA 5H8QA 5A5XB 1GVCA 3L6HA 1BTJA 1Y1MA 3U93A 4QFOA 3OXNA 3RTFB 2OK2A 1JNFA 1ZKBA 1FQEA 3C33A 4F1UA 2DYXA 5FHOA 1DTGA 2RKMA 3IB0A 1ZTYA 2HAUA 3K1MA 2OWTA 4ZE9A 2ABHA 3PPOA 4R6HA 1LB8A 4XTCQ 2VP1A 2A5TA 2GFEA 3VVDA 3G3JA 4O3BA 1UTHB 3U94A 4OFJA 4RJZA 1J1NA 2AYSA 3THIA 4H67A 2Q89A 1B3HA 1XT8A 1LAHE 2E1SA 2ZXTA 3K1PA 4RK2A 1M5BA 3MP6A 2I58A 4QFLA 5IKBA 1MY2A 3SEXA 3MZ9A 1JW4A 4NF4A 3C4MA 3QXMA 3P7IA 4P0IA 1YTVA 4YKJA 2Z8DA 4N6PA 1A7LA 2XHDA 1MY0A 4DDDA 4I62A 1SQYA 4F39A 1BLFA 2YPNA 1USYE 3U8QA 3S9EA 5H8NB 2AL5A 3OOAA 4R6KA 4NTLA 1M5EA 4JSDA 4GWOA 2P1SA 3O6IA 4JB7A 1FTKA 1SVXB 3D4GA 1SW4A 1EZ9A 1MM7A 4FAJA 1ZLQA 3PPPA 1B1HA 2O1LA 4EF2A 3TAJA 4IGRA 3CIJA 3MP8A 5LOMA 1LAGE 2XXTA 2F35A 2XXQA 3SETA 3OD7A 4RYAA 1B3FA 4F3BA 3ODBA 1B7ZA 3B6QA 2I48A 1DOTA 3VDFA 2GRVA 5KCJA 3KZGA 2ZYOA 4PETA 4GLIA 1B3LA 4EQ9A 5BWJA 3G3HA 1B7HA 1F9BA 1MQDA 2PT1A 3K6VA 2XD3A 3V8XB 3LSXA 4R74A 1N76A 1ZMGA 4Q0CA 2I4BA 4R73A 4IO6A 1HSLA 1US5A 3H6WA 2HFBA 3RPWA 4JXIA 4P0GA 4ELRA 3TODA 2HCAA 2IA4A 5HM4B 1LFGA 4QSDA 1NNKA 3OSRA 1HSEA 3PPQA 4FATA 3KSJA 4LUBA 5AA3A 2E0SA 3FV1A 3DP6A 2O68A 5FTHA 1LLSA 5L9OA 3K02A 5HBCA 4OTEA 4GXAA 4XKPA 4R72A 4RY1A 2O51A 4OWDA 3HSTA 3KEIA 3PGFA 2BJJX 3FGSA 3E13X 4U21A 1UIUA 4UACA 2NVUB 2V84A 3IAZA 4E0WA 1B0HA 1URSA 4I8CA 5CMKA 1UQWA 2F7CA 3RY3A 2ZNSA 3FUZA 3ZS6A 2DP8A 1DSNA 4DXBA 1LBBA 1B0LA 5DVFA 3UK4A 2OCUA 1AIVA 3FIRA 3H6UA 3KGCA 3CVGA 5K2YA 1LCFA 5I58A 3MUQA 4XKNA 1Z7NE 3DELB 2DS9A 5F7VA 4KR5A 3FV2A 5CC2A 4IY6A 3QUJA 3T9UA 4KQPA 2Q8JA 4ZS9A 4JWOA 4H8IA 1NNPA 3CSBA 4KYDA 1S50A 2H98A 4LQ5A 4OYVA 4TLLB 4WEDA 2QS2A 5TPAA 3C35A 1NL5A 3N6TA 1POTA 4U4XA 2ZMBA 4IO3A 4LA9A 3DP4A 5DVJA 4OVJA 1LGBC 1P1OA 1B51A 3VXCA 2I4CA 5ITPA 1NH8A 4IO7A 5DTBA 3PV0E 1RYXA 5CI5A 3M3FA 4Z7EA 1EH3A 1P99A 3PUXE 5M2VA 4YICA 3RGYA 3EN3A 3TMGA 4DLDA 3I6VA 4C1UA 1O7TA 5CMBA 4OERA 3H06B 4RA1A 1B32A 1N7XA 3QAXA 1O63A 2UVGA 2AIXA 2UYEA 2F8DA 3T9XB 3G3GA 4F31B 3M3LA 2Z8FA 3VFJA 2O7UA 4YMAA 1JVYA 2A5SA 3FZVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H7M A;  4NF6 B;  1GGG A;  2V3Q A;  3MPK A;  3IOU A;  1OVB A;  3EHU A;  2F36 A;  1LBC A;  4N07 A;  2H25 A;  3MVZ A;  3RLF E;  1A8E A;  3O6H A;  4JBZ A;  4U22 A;  3FXQ A;  3UGW A;  2IEE A;  3JZJ A;  3IK6 B;  5L8D A;  4ELP A;  2Y7P A;  4R6Y A;  5CBS A;  3K4U A;  5TP9 A;  3KOS A;  1IXG A;  3SER A;  4ELQ A;  4OXV A;  4GF8 A;  1D9V A;  4FOR A;  3SES A;  3ZKK A;  2NWJ A;  1JQF A;  1ZIU A;  1H45 A;  4Q5T A;  5B7D A;  3GZG A;  4BDN A;  3PUZ E;  4F1Y A;  3PUY E;  4LVQ A;  1B3G A;  4EQ7 A;  2O7I A;  3KJT A;  5H8Q B;  4XKQ A;  4HS7 A;  4FIM A;  3A3C A;  4PFY A;  2XXR A;  3LSW A;  4IB2 A;  1MS7 A;  5I59 A;  3KFM A;  3B7D A;  3IJO B;  4MF3 A;  1Y3N A;  2QS4 A;  4R9G A;  2XXX A;  2F78 A;  1GTK A;  1QUI A;  2LAO A;  4WEP A;  3W9V A;  1MY3 A;  3CFL A;  4ZZE A;  3O2A A;  3AXF A;  3CI8 A;  3RT8 A;  3IB1 A;  3FVO A;  4NF5 A;  3TCH A;  2Q2C A;  2A5T B;  2PT2 A;  1O64 A;  4G8M A;  1B9J A;  4PE5 B;  4DCY A;  5ISU A;  3RNN A;  3PMW A;  1YCJ A;  3R26 A;  3N94 A;  4X48 A;  2Q2A A;  4I9D A;  3OO8 A;  4U2R A;  1B58 A;  4Q30 B;  3PMX A;  4PP0 A;  1A40 A;  3KSX A;  1S7Y A;  2UVI A;  1Y1Z A;  1SBP A;  4C0R A;  1IZ1 A;  1MPC A;  2I6E A;  4F22 A;  2P2A A;  4NF4 B;  4ZEB A;  1DMB A;  2QMW A;  4ESX A;  2NUV A;  4YKI A;  3TQL A;  1D3K A;  3O29 A;  1PB9 A;  4DXU A;  3Q26 A;  1KWH A;  4G8N A;  4GXS B;  1LST A;  3TEP A;  2R71 A;  3KN3 A;  2DVZ A;  3H4Z A;  3U1O A;  2DXY A;  2V25 A;  3H03 A;  3S4U A;  1XOC A;  2VD3 A;  5KDT A;  2RCA A;  1QW0 A;  3O97 A;  1MPB A;  3GBB A;  3G7W A;  3C31 A;  4OEN A;  4F3P A;  2R9J A;  3TTN A;  4H0W A;  2VD2 A;  2UVH A;  2GH9 A;  5I56 B;  2HZK A;  3RTW B;  3E3K A;  1SYI A;  3PMV A;  1N0T A;  4HCY A;  3V5A A;  3A09 A;  1PB8 A;  4XKR A;  4MH5 A;  1IXH A;  1XHY A;  2XXU A;  4RPO A;  1VFE A;  1MXZ A;  3ZSF A;  1RYO A;  2HXW A;  3JV9 A;  4ZZA A;  4QFP A;  3N26 A;  3OEN A;  4OMB A;  3I3V A;  1JW1 A;  2THI A;  1QJM A;  1VE4 A;  4POX A;  4NMY A;  3SEU A;  3FXR A;  3K1N A;  3OO7 A;  2OZZ A;  2M8C A;  1N84 A;  2Q88 A;  2X7P A;  3IJX B;  3MZB A;  3EPE A;  3S9M C;  3SDF A;  1JEV A;  5ITO A;  3O6G A;  2XXP A;  4NWD A;  1L5T A;  2H9B A;  3H6T A;  3H3G A;  4ECF A;  2XX9 A;  4ND9 A;  2PYY A;  4GRK A;  4ZEI A;  3C32 A;  3QIM A;  2DWI A;  1MY4 A;  3LR1 A;  1MPD A;  1I69 A;  2ANJ A;  3DM0 A;  4RK9 A;  1AOV A;  4H65 A;  5AA2 A;  1H43 A;  3HO7 A;  3VE1 B;  1IEJ A;  1R9Q A;  1BP5 A;  2RCB A;  2RF1 A;  3D4C A;  1MRP A;  4F18 A;  2X26 A;  5AA4 B;  2F6P A;  1OLA A;  3MQ9 A;  1T0K A;  1AL3 A;  4NWC A;  4PQJ A;  3V89 B;  3A3U A;  3QYT A;  3FVK A;  4Z0I A;  3T96 B;  1VR5 A;  4G68 C;  3USD A;  3TFL A;  4KYE A;  3FXU A;  4OQO A;  3IX1 A;  4NED A;  3TDJ A;  3TCG A;  1ZJL A;  4KYS A;  1Q1K A;  1QKA A;  4YB6 A;  3K01 A;  1LCT A;  3BFT A;  1FQB A;  1I6Q A;  1P1U A;  2QPQ A;  1A55 A;  1FTM A;  1XS5 A;  2ALU A;  5H8H A;  5I58 B;  1P1N A;  1MY1 A;  2B3B A;  2HQ0 A;  3VLV A;  1MH4 A;  3O66 A;  4BDL A;  5AE4 A;  4RPN A;  2DE4 A;  3BFU A;  1MXV A;  4F3G A;  1P1Q A;  5I57 A;  2O1M A;  1FTL A;  3FVN A;  1Y20 A;  1ATG A;  5TPA B;  1FQA A;  1II5 A;  2QJE A;  4QSC A;  2DWJ A;  1FCK A;  3GLB A;  1NMU A;  4ZEK A;  4FED A;  2ZNU A;  1ELJ A;  3R6U A;  4LZ7 A;  3ILU B;  2REG A;  4GL0 A;  2V3T A;  3EQ1 A;  1LFI A;  2QMX A;  3HHF A;  5K2X A;  2G93 A;  3CRB A;  5DEX A;  2B65 A;  4ESW A;  3M8U A;  4TQU Q;  3IOT A;  1HSJ A;  4JDF A;  4YB5 A;  4EXL A;  2FYI A;  2O69 A;  4M1V A;  4L17 A;  4H5F A;  1H3D A;  3UOR A;  5CM6 A;  4G2Z A;  3C9H A;  4I1D A;  1OVT A;  1SD3 A;  4NF8 A;  1MXY A;  2G29 A;  4QFK A;  2I49 A;  2ZYM A;  4LQ2 A;  3FJM A;  1TXF A;  1SI0 A;  3HV1 A;  2Z22 A;  2XXI A;  4YKK A;  1ANF A;  1CB6 A;  1PDA A;  1UTB A;  2DWH A;  5AA1 A;  3K6U A;  2DXR A;  3OEM A;  3RN8 A;  2ONK E;  4EXK A;  2OBG A;  4G77 A;  3KJ7 A;  1A8F A;  2QSX A;  4RNS A;  3MVW A;  3UP9 A;  3E4R A;  3LC8 A;  3WAE A;  1H76 A;  4N13 A;  1SI1 A;  3Q25 A;  3V83 A;  2DOJ A;  1Y4C A;  3TPA A;  2ONS A;  3KN8 A;  3T66 A;  5TP9 B;  3VVF A;  3ZKL A;  1EZP A;  5DVI A;  1QVS A;  3W15 C;  3Q28 A;  3VVE A;  4EF1 A;  3S9L C;  2DE2 A;  3RT6 B;  3W9W A;  3FD3 A;  1M5D A;  3IB2 A;  4KCC A;  3MJN A;  1TFA A;  1M5C A;  5H8F A;  4YU0 A;  4ZEF A;  2VOZ A;  1XVY A;  4DE8 A;  4F1V A;  1RKM A;  2R6G E;  3OEL A;  1B4H A;  1GR2 A;  3SEW A;  4EUO A;  2I3V A;  3HHG A;  4EDP A;  1OIB A;  3MW0 A;  2OJT A;  1B52 A;  2XXH A;  3CR9 A;  3SKP A;  1B2H A;  4QHQ A;  1MQG A;  1YAE A;  3CFZ A;  3I5O A;  4WXJ A;  4Q8R A;  4NF5 B;  3MP1 A;  1B5H A;  3DP8 A;  2V3U A;  5ICQ A;  4M4G A;  4ZEC A;  3TQW A;  3SEV A;  3PUW E;  4XXU A;  4LAT A;  1MQI A;  2Y7R A;  1ZU0 A;  1B5J A;  1MDP 1;  1FQF A;  5EHM A;  3MVX A;  4KPT A;  2PMS A;  4R2B A;  1MG1 A;  1IIW A;  3MAM A;  3VV5 A;  2XD2 A;  3TTL A;  1BKA A;  1UIV A;  3N6U A;  1D9Y A;  4G68 A;  3QK6 A;  1SYH A;  4YAH X;  5I2N A;  5CRY A;  3K6W A;  4LZ5 A;  1MQH A;  4ZE8 A;  1AH5 A;  1MH3 A;  1B05 A;  3TYH A;  2FA7 A;  5BUU A;  4R2F A;  4OET A;  4MBP A;  3IOR A;  4TLM B;  3MC2 A;  1IIT A;  1PC3 A;  5KZT A;  4TOZ A;  2NOO A;  3EF7 A;  1US4 A;  2ZYK A;  1LAF E;  4H1X A;  1Y9U A;  2Y84 A;  5L9S A;  1QUK A;  2I0C A;  4KFQ A;  2UVJ A;  2PVU A;  4X1B A;  3MVY A;  1Y3Q A;  1IQ7 A;  1Z7M E;  3T22 A;  4OEU A;  3LBS A;  4ZDM A;  5JTY A;  5KDT B;  1A54 A;  4MLQ A;  1Q35 A;  3QUF A;  1POY 1;  1MQJ A;  2F7B A;  3QSL A;  3FVG A;  4U4S A;  5TU0 A;  1N04 A;  4IO2 A;  1BIY A;  1QUJ A;  2I0B A;  4U1Z A;  5FHM A;  5I2K A;  3IOV A;  4PFT A;  1IXC A;  4QSE A;  5DYH A;  1B4Z A;  1N3W A;  3MWB A;  1DTZ A;  1QUL A;  2QL3 A;  1R6Z A;  1CE2 A;  5CMC A;  1TFD A;  2I3W A;  3TTM A;  5A5X A;  3H6V A;  1FQD A;  1MXX A;  1NH7 A;  1SW5 A;  3UN6 A;  3R7X A;  4JWX A;  4X1D A;  4ISU A;  1IUD A;  3OO6 A;  2XXY A;  2QRY A;  4HCW A;  2GHA A;  3IOW A;  5F1Q A;  2F6G A;  3FJG A;  3K00 A;  3HPI A;  1UTH A;  1H44 A;  3FAS A;  3GBA A;  1FQC A;  4GD5 A;  3S2V A;  2V93 A;  4AB5 A;  4UA8 A;  1OQH A;  5KCJ B;  1PEB A;  2O6A A;  2D21 A;  3B6W A;  5AA2 B;  4H6D A;  5FHN A;  3O28 A;  4OEV A;  3IO4 A;  1JVX A;  3OSQ A;  3T93 B;  3T9H B;  1EZO A;  4XIG Q;  3IL1 B;  4LP2 B;  2Y7K A;  2PX1 A;  4F3S A;  3KBR A;  3O9P A;  3PPN A;  4ZED A;  1JEU A;  1B7U A;  5FTI A;  5I56 A;  5L9M A;  4C1T A;  2GHB A;  4GIZ A;  4DCX A;  2XXV A;  4HTG A;  3C36 A;  4PFU A;  4RXL A;  4BDO A;  1JET A;  2Y7I A;  4GOT A;  5H8N A;  4POW A;  5JK4 A;  1URD A;  1FTJ A;  1XC1 A;  5H8H B;  2D3I A;  3PUV E;  2UYF A;  2YJP A;  3TZA A;  3G3K A;  2NXO A;  1LB9 A;  3TUS A;  3T9V A;  1MM6 A;  1I6A A;  4GL8 A;  2XX8 A;  4O3C A;  4ONY A;  1B1X A;  3Q27 A;  3ECR A;  4FJP A;  4GVO A;  1N7W A;  1EU8 A;  3LSF B;  3U72 A;  1D4N A;  2FNC A;  5IAI A;  1WVJ A;  3VLU A;  1I6B A;  1A99 A;  5I57 B;  2D5W A;  4BDQ A;  2Z8E A;  2RC7 A;  3PPR A;  2P0S A;  2WKY A;  2UXA A;  3TEL A;  2X7Q A;  5ICT A;  4P11 A;  3TTK A;  4AB6 A;  4LON B;  4G8H A;  1QKB A;  3BBR A;  1DPE A;  3PD8 A;  4E0X A;  1B5I A;  4FEC A;  4EQB A;  3G3F A;  1SDX A;  2W7Y A;  5DEX B;  1PB7 A;  4IO5 A;  4JWY A;  1ZBM A;  4F29 A;  3E9X A;  5B70 A;  5CMM A;  5AA4 A;  4MLV A;  4GFR A;  1PBP A;  1AMF A;  2B3F A;  4U23 A;  4DIG A;  4QF9 A;  4G4P A;  4YZZ A;  1M5F A;  3MBP A;  4ELO A;  4NF8 B;  2Y7W A;  3M3K A;  5I84 A;  1FTO A;  4FE8 A;  4QRZ A;  3K2D A;  3Q29 A;  4IO4 A;  3B6T A;  3UA8 A;  2HEU A;  1TT1 A;  1UTB B;  3ILT B;  2AL4 A;  3RUM A;  2F7A A;  1Y4T A;  1WDN A;  3N5L A;  1WOD A;  3L6G A;  3GXA A;  4K3F A;  2DSF A;  2OWS A;  1NFT A;  3EHT A;  5EHS A;  2VHA A;  1OQG A;  2Q9T A;  4AQ4 A;  2Z23 A;  1TWY A;  3HN0 A;  4LZ8 A;  4YKP A;  5J1D A;  2DVC A;  1NNT A;  4BDR A;  1B46 A;  4H5G A;  3IO6 A;  1S9T A;  4HW8 A;  2RIN A;  4DZ1 A;  3JYR A;  5AA2 D;  3PU5 A;  2HAV A;  1IXI A;  3U92 A;  4F2O A;  1SW2 A;  2YLN A;  4FEB A;  2RC9 A;  1VSO A;  3WAF A;  2F34 A;  2QS3 A;  5H8F B;  5JEI A;  1P1W A;  1USY H;  4BLA A;  4H8J A;  5EYF A;  4JSO A;  1FW0 A;  1NNF A;  4U1O A;  4OES A;  3CFX A;  3G3I A;  3PD9 A;  3CG1 A;  5CBR A;  4OFL A;  2F5X A;  3F11 A;  2ZYN A;  4GQO A;  5HPQ A;  1OLC A;  4BDM A;  3HCQ A;  2PBW A;  3SEY A;  3EHS A;  4KHZ E;  1SW1 A;  5H8S A;  4YMB A;  2H5Y A;  2ESN A;  2RC8 A;  1OMP A;  2QS1 A;  3KOT A;  2DWA A;  3IR1 A;  2H4I A;  4DXC A;  2DE3 A;  1XVX A;  1YPN A;  1JW5 A;  3BKI B;  3KG2 A;  1R9L A;  4PFW A;  3KN7 A;  2CZL A;  5I59 B;  2XX7 A;  2ZNT A;  3CSG A;  3FAT A;  3LUY A;  4IY5 A;  1B6H A;  4G68 B;  1LAX A;  4KI0 E;  3MZ1 A;  1B3E A;  5I2N B;  4OFO A;  1MDQ A;  1Y3P A;  4WKM A;  3K6X A;  4F2Q A;  4R9F A;  5DT6 A;  3UIF A;  1DPP A;  3K0V A;  4IGT A;  4THI A;  3TCF A;  5ELV A;  4KCD A;  4F19 A;  3CG3 A;  4NF6 A;  4NE4 A;  3MPL A;  1MXW A;  2OLB A;  1LFH A;  2REJ A;  5JTY B;  2XXW A;  1MXU A;  1NKX A;  3VXB A;  3OEK A;  3ONM A;  1B40 A;  2CMO A;  4O3A A;  2H99 A;  4QFN A;  2O84 X;  2F97 A;  3TKD A;  3OO9 A;  4YB7 A;  1R1N A;  1VFD A;  2HZL A;  2DQV A;  3DLN A;  1GV8 A;  5I2K B;  4MFI A;  3FJ7 A;  4OZ9 A;  3VLW A;  4OHN A;  3OMB A;  3C34 A;  3RQT A;  2KLF A;  3TTR A;  4X9T A;  1PBQ A;  4R75 A;  1N3X A;  1URG A;  2VGQ A;  2ONR A;  4KD5 A;  3S9N C;  3LSL A;  5H8Q A;  5A5X B;  1GVC A;  3L6H A;  1BTJ A;  1Y1M A;  3U93 A;  4QFO A;  3OXN A;  3RTF B;  2OK2 A;  1JNF A;  1ZKB A;  1FQE A;  3C33 A;  4F1U A;  2DYX A;  5FHO A;  1DTG A;  2RKM A;  3IB0 A;  1ZTY A;  2HAU A;  3K1M A;  2OWT A;  4ZE9 A;  2ABH A;  3PPO A;  4R6H A;  1LB8 A;  4XTC Q;  2VP1 A;  2A5T A;  2GFE A;  3VVD A;  3G3J A;  4O3B A;  1UTH B;  3U94 A;  4OFJ A;  4RJZ A;  1J1N A;  2AYS A;  3THI A;  4H67 A;  2Q89 A;  1B3H A;  1XT8 A;  1LAH E;  2E1S A;  2ZXT A;  3K1P A;  4RK2 A;  1M5B A;  3MP6 A;  2I58 A;  4QFL A;  5IKB A;  1MY2 A;  3SEX A;  3MZ9 A;  1JW4 A;  4NF4 A;  3C4M A;  3QXM A;  3P7I A;  4P0I A;  1YTV A;  4YKJ A;  2Z8D A;  4N6P A;  1A7L A;  2XHD A;  1MY0 A;  4DDD A;  4I62 A;  1SQY A;  4F39 A;  1BLF A;  2YPN A;  1USY E;  3U8Q A;  3S9E A;  5H8N B;  2AL5 A;  3OOA A;  4R6K A;  4NTL A;  1M5E A;  4JSD A;  4GWO A;  2P1S A;  3O6I A;  4JB7 A;  1FTK A;  1SVX B;  3D4G A;  1SW4 A;  1EZ9 A;  1MM7 A;  4FAJ A;  1ZLQ A;  3PPP A;  1B1H A;  2O1L A;  4EF2 A;  3TAJ A;  4IGR A;  3CIJ A;  3MP8 A;  5LOM A;  1LAG E;  2XXT A;  2F35 A;  2XXQ A;  3SET A;  3OD7 A;  4RYA A;  1B3F A;  4F3B A;  3ODB A;  1B7Z A;  3B6Q A;  2I48 A;  1DOT A;  3VDF A;  2GRV A;  5KCJ A;  3KZG A;  2ZYO A;  4PET A;  4GLI A;  1B3L A;  4EQ9 A;  5BWJ A;  3G3H A;  1B7H A;  1F9B A;  1MQD A;  2PT1 A;  3K6V A;  2XD3 A;  3V8X B;  3LSX A;  4R74 A;  1N76 A;  1ZMG A;  4Q0C A;  2I4B A;  4R73 A;  4IO6 A;  1HSL A;  1US5 A;  3H6W A;  2HFB A;  3RPW A;  4JXI A;  4P0G A;  4ELR A;  3TOD A;  2HCA A;  2IA4 A;  5HM4 B;  1LFG A;  4QSD A;  1NNK A;  3OSR A;  1HSE A;  3PPQ A;  4FAT A;  3KSJ A;  4LUB A;  5AA3 A;  2E0S A;  3FV1 A;  3DP6 A;  2O68 A;  5FTH A;  1LLS A;  5L9O A;  3K02 A;  5HBC A;  4OTE A;  4GXA A;  4XKP A;  4R72 A;  4RY1 A;  2O51 A;  4OWD A;  3HST A;  3KEI A;  3PGF A;  2BJJ X;  3FGS A;  3E13 X;  4U21 A;  1UIU A;  4UAC A;  2NVU B;  2V84 A;  3IAZ A;  4E0W A;  1B0H A;  1URS A;  4I8C A;  5CMK A;  1UQW A;  2F7C A;  3RY3 A;  2ZNS A;  3FUZ A;  3ZS6 A;  2DP8 A;  1DSN A;  4DXB A;  1LBB A;  1B0L A;  5DVF A;  3UK4 A;  2OCU A;  1AIV A;  3FIR A;  3H6U A;  3KGC A;  3CVG A;  5K2Y A;  1LCF A;  5I58 A;  3MUQ A;  4XKN A;  1Z7N E;  3DEL B;  2DS9 A;  5F7V A;  4KR5 A;  3FV2 A;  5CC2 A;  4IY6 A;  3QUJ A;  3T9U A;  4KQP A;  2Q8J A;  4ZS9 A;  4JWO A;  4H8I A;  1NNP A;  3CSB A;  4KYD A;  1S50 A;  2H98 A;  4LQ5 A;  4OYV A;  4TLL B;  4WED A;  2QS2 A;  5TPA A;  3C35 A;  1NL5 A;  3N6T A;  1POT A;  4U4X A;  2ZMB A;  4IO3 A;  4LA9 A;  3DP4 A;  5DVJ A;  4OVJ A;  1LGB C;  1P1O A;  1B51 A;  3VXC A;  2I4C A;  5ITP A;  1NH8 A;  4IO7 A;  5DTB A;  3PV0 E;  1RYX A;  5CI5 A;  3M3F A;  4Z7E A;  1EH3 A;  1P99 A;  3PUX E;  5M2V A;  4YIC A;  3RGY A;  3EN3 A;  3TMG A;  4DLD A;  3I6V A;  4C1U A;  1O7T A;  5CMB A;  4OER A;  3H06 B;  4RA1 A;  1B32 A;  1N7X A;  3QAX A;  1O63 A;  2UVG A;  2AIX A;  2UYE A;  2F8D A;  3T9X B;  3G3G A;  4F31 B;  3M3L A;  2Z8F A;  3VFJ A;  2O7U A;  4YMA A;  1JVY A;  2A5S A;  3FZV A; 
#chains in the Genus database with same CATH topology
 2PFY A;  3H7M A;  4NF6 B;  1GGG A;  4GWY A;  2V3Q A;  3MPK A;  3IOU A;  1OVB A;  1SPI A;  3EHU A;  2F36 A;  1LBC A;  4N07 A;  1LBW A;  2H25 A;  3MVZ A;  3RLF E;  1A8E A;  3O6H A;  4JBZ A;  4U22 A;  3FXQ A;  3UGW A;  2IEE A;  3JZJ A;  3IK6 B;  5L8D A;  4ELP A;  4GWS A;  2Y7P A;  4R6Y A;  4PAK A;  5CBS A;  3K4U A;  1LBX A;  5TP9 A;  3KOS A;  1IXG A;  3SER A;  4ELQ A;  4OXV A;  4GF8 A;  1D9V A;  4FOR A;  3SES A;  2FIX A;  3ZKK A;  2NWJ A;  1JQF A;  1ZIU A;  1H45 A;  4X04 A;  1DK4 A;  4Q5T A;  5B7D A;  2FIE A;  3GZG A;  4BDN A;  3PUZ E;  4F1Y A;  3PUY E;  4XFE A;  4LVQ A;  1B3G A;  4EQ7 A;  2O7I A;  3KJT A;  5H8Q B;  4XKQ A;  4HS7 A;  4N6K A;  4FIM A;  3A3C A;  4PFY A;  2XXR A;  3LSW A;  4IB2 A;  1MS7 A;  5I59 A;  3KFM A;  3B7D A;  3IJO B;  4MF3 A;  1Y3N A;  2QS4 A;  4R9G A;  2DDK A;  2XXX A;  2F78 A;  1GTK A;  1QUI A;  2LAO A;  4WEP A;  3W9V A;  1MY3 A;  3CFL A;  4ZZE A;  3O2A A;  1NV4 A;  3AXF A;  3CI8 A;  3RT8 A;  4O7I A;  3IB1 A;  3FVO A;  4NF5 A;  3TCH A;  1D9Q A;  5EQ8 A;  5IGA A;  2Q2C A;  2A5T B;  4DI4 B;  2PT2 A;  4NG7 A;  1O64 A;  4G8M A;  2HHM A;  1B9J A;  4PE5 B;  4DCY A;  5ISU A;  3RNN A;  3PMW A;  1YCJ A;  3R26 A;  3N94 A;  4X48 A;  1G0I A;  2Q2A A;  4I9D A;  3OO8 A;  5I3S A;  4HE1 A;  3FXB A;  4U2R A;  1B58 A;  4Q30 B;  3PMX A;  4PP0 A;  1A40 A;  3KSX A;  1S7Y A;  2UVI A;  1Y1Z A;  1SBP A;  4C0R A;  1IZ1 A;  4OA4 A;  1MPC A;  2I6E A;  4F22 A;  2P2A A;  4NF4 B;  4ZEB A;  4O94 A;  1DMB A;  2QMW A;  4ESX A;  5ET7 A;  2NUV A;  4YKI A;  3TQL A;  1D3K A;  3O29 A;  1PB9 A;  3EKI A;  4DXU A;  3Q26 A;  1KWH A;  4G8N A;  4GXS B;  1LST A;  3TEP A;  2R71 A;  3KN3 A;  2DVZ A;  3H4Z A;  3U1O A;  2DXY A;  2V25 A;  3H03 A;  3S4U A;  1XOC A;  1FBH A;  2VD3 A;  5LDZ A;  4UAB A;  5KDT A;  2RCA A;  1QW0 A;  2VPN A;  3O97 A;  4I3E A;  1MPB A;  3GBB A;  3G7W A;  3C31 A;  3D1R A;  4OEN A;  4F3P A;  2R9J A;  3TTN A;  4H0W A;  4P47 A;  2VD2 A;  2UVH A;  2GH9 A;  5I56 B;  2HZK A;  3E78 A;  3RTW B;  3B50 A;  3E3K A;  1SYI A;  3PMV A;  1N0T A;  4HCY A;  3V5A A;  3A09 A;  1PB8 A;  2ZZW A;  4XKR A;  4MH5 A;  1IXH A;  1XHY A;  2XXU A;  4RPO A;  1VFE A;  1MXZ A;  3ZSF A;  1RYO A;  2HXW A;  3JV9 A;  1FBG A;  4ZZA A;  3BIH A;  4LN5 A;  4GWX A;  4QFP A;  3N26 A;  3OEN A;  4OMB A;  3I3V A;  1JW1 A;  2THI A;  1QJM A;  1VE4 A;  4PE3 A;  4POX A;  4NMY A;  3SEU A;  3FXR A;  3K1N A;  3OO7 A;  2OZZ A;  2M8C A;  1N84 A;  2Q88 A;  2X7P A;  3IJX B;  3MZB A;  3EPE A;  3S9M C;  3SDF A;  1JEV A;  5ITO A;  3O6G A;  2F3B A;  2XXP A;  4NWD A;  1L5T A;  4GWW A;  2H9B A;  1AWB A;  3H6T A;  3H3G A;  4ECF A;  2XX9 A;  4ND9 A;  2GQ1 A;  2PYY A;  4GRK A;  1KA0 A;  4ZEI A;  3C32 A;  3QIM A;  5IZ1 A;  2DWI A;  1MY4 A;  3LR1 A;  1MPD A;  1I69 A;  2ANJ A;  3DM0 A;  4RK9 A;  1AOV A;  4H65 A;  5AA2 A;  1H43 A;  3HO7 A;  3VE1 B;  1IEJ A;  3T1B A;  1R9Q A;  1BP5 A;  2RCB A;  2RF1 A;  3D4C A;  1MRP A;  4F18 A;  2X26 A;  5AA4 B;  2F6P A;  1OLA A;  3MQ9 A;  1T0K A;  1AL3 A;  4NWC A;  4PQJ A;  2Q8M A;  3V89 B;  3A3U A;  1YZ0 A;  3FVK A;  3QYT A;  4Z0I A;  3T96 B;  1VR5 A;  4G68 C;  3USD A;  3TFL A;  2MKZ A;  4KYE A;  3FXU A;  4N8G A;  4OQO A;  3IX1 A;  1NUZ A;  1CNQ A;  4NED A;  3TDJ A;  3TCG A;  1FPE A;  1ZJL A;  4KYS A;  1Q1K A;  1QKA A;  4QXD A;  4YB6 A;  3K01 A;  1LCT A;  3BFT A;  1FJ6 A;  1FQB A;  1I6Q A;  1P1U A;  4I40 A;  2QPQ A;  1A55 A;  1FTM A;  1XS5 A;  2ALU A;  2VT5 A;  5H8H A;  5I58 B;  1P1N A;  1MY1 A;  2R8T A;  2B3B A;  2HQ0 A;  3VLV A;  1MH4 A;  3O66 A;  4JVI A;  4BDL A;  5AE4 A;  4RPN A;  2DE4 A;  1INP A;  3BFU A;  1MXV A;  4F3G A;  2VPO A;  1P1Q A;  1K9Z A;  1NV6 A;  5I57 A;  2O1M A;  1FTL A;  3FVN A;  1Y20 A;  1ATG A;  5TPA B;  1FQA A;  1II5 A;  4OAN A;  2QJE A;  4QSC A;  2DWJ A;  1FCK A;  4PFB A;  3GLB A;  1NMU A;  4ZEK A;  4FED A;  2ZNU A;  1ELJ A;  3R6U A;  4LZ7 A;  3ILU B;  3LUZ A;  2REG A;  4GL0 A;  2V3T A;  3EQ1 A;  1LFI A;  2QMX A;  4PAF A;  3HHF A;  5K2X A;  2G93 A;  3CRB A;  5DEX A;  1NV2 A;  2B65 A;  4ESW A;  3M8U A;  4TQU Q;  3IOT A;  1HSJ A;  4JDF A;  4YB5 A;  4EXL A;  2FYI A;  3HFU A;  4GWU A;  2O69 A;  4M1V A;  4L17 A;  4H5F A;  1H3D A;  3UOR A;  5CM6 A;  4G2Z A;  4QBA A;  3C9H A;  4OVP A;  4N91 A;  4I1D A;  1OVT A;  1SD3 A;  4NF8 A;  1MXY A;  2G29 A;  4QFK A;  4PFI A;  2I49 A;  2ZYM A;  5A5L A;  4LQ2 A;  3FJM A;  1TXF A;  1SI0 A;  3HV1 A;  2Z22 A;  2XXI A;  4YKK A;  1BK4 A;  4NHB A;  1ANF A;  1CB6 A;  1PDA A;  1UTB A;  2DWH A;  4OVQ A;  5AA1 A;  2XWV A;  3K6U A;  2DXR A;  4PFR A;  3OEM A;  3RN8 A;  2ONK E;  1IMC A;  3E79 A;  4EXK A;  2OBG A;  1YXI A;  1FRP A;  4G77 A;  3KJ7 A;  1A8F A;  2QSX A;  4RNS A;  3MVW A;  3UP9 A;  3E4R A;  3LC8 A;  3WAE A;  1IME A;  1H76 A;  4N13 A;  1SI1 A;  3Q25 A;  3V83 A;  4PGP A;  2DOJ A;  1Y4C A;  3TPA A;  2ONS A;  3KN8 A;  3T66 A;  5TP9 B;  3VVF A;  3ZKL A;  1EZP A;  5DVI A;  1FTA A;  1QVS A;  3W15 C;  3Q28 A;  3VVE A;  1FBF A;  4EF1 A;  5J16 A;  3S9L C;  2DE2 A;  3RT6 B;  3W9W A;  3FD3 A;  1M5D A;  4GBW A;  3IB2 A;  1LEV A;  4KCC A;  3MJN A;  1TFA A;  1M5C A;  1FBE A;  5H8F A;  4YU0 A;  4ZEF A;  2VOZ A;  1XVY A;  4DE8 A;  4F1V A;  1RKM A;  1JP4 A;  2R6G E;  3OEL A;  1B4H A;  1GR2 A;  3SEW A;  4EUO A;  1EYJ A;  2Q74 A;  1NV5 A;  1VDW A;  2I3V A;  3HHG A;  4EDP A;  1OIB A;  2WYK A;  3MW0 A;  2OJT A;  1B52 A;  1IMF A;  2XXH A;  3CR9 A;  3SKP A;  1B2H A;  4QHQ A;  1MQG A;  4HE2 A;  1YAE A;  3CFZ A;  3I5O A;  4WXJ A;  4Q8R A;  4NF5 B;  4NGU A;  3MP1 A;  1IMB A;  1B5H A;  3DP8 A;  2V3U A;  5ICQ A;  4M4G A;  4ZEC A;  3TQW A;  3SEV A;  3PUW E;  4XXU A;  4LAT A;  1MQI A;  2Y7R A;  1B5J A;  1ZU0 A;  1MDP 1;  3KBZ A;  1NV1 A;  1FQF A;  5EHM A;  3MVX A;  4KPT A;  2PMS A;  4R2B A;  1MG1 A;  1IIW A;  3MAM A;  3VV5 A;  2XD2 A;  3TTL A;  1BKA A;  2FBP A;  1UIV A;  4PTK A;  2ZZV A;  3N6U A;  1D9Y A;  4G68 A;  3QK6 A;  1SYH A;  4YAH X;  4GX3 A;  5I2N A;  2F3D A;  5CRY A;  3K6W A;  2CZH A;  4LZ5 A;  1MQH A;  4ZE8 A;  1AH5 A;  1MH3 A;  3RYD A;  1B05 A;  3TYH A;  2FA7 A;  5BUU A;  4R2F A;  4OET A;  4MBP A;  3IOR A;  2CEY A;  4TLM B;  2XXK A;  3MC2 A;  1IIT A;  1PC3 A;  5KZT A;  4TOZ A;  2NOO A;  4NX1 A;  3EF7 A;  1US4 A;  2ZYK A;  4N17 A;  1LAF E;  4H1X A;  1Y9U A;  2Y84 A;  4N8Y A;  5L9S A;  1QUK A;  2I0C A;  4KFQ A;  2UVJ A;  2PVU A;  4X1B A;  3MVY A;  1Y3Q A;  3QMF A;  1IQ7 A;  1Z7M E;  4O7M A;  3T22 A;  4OEU A;  4PBQ A;  3LBS A;  4ZDM A;  5JTY A;  5KDT B;  1A54 A;  1NUX A;  4MLQ A;  1KA1 A;  1Q35 A;  3QUF A;  1POY 1;  1MQJ A;  2F7B A;  3QSL A;  3FVG A;  3U65 A;  4H46 A;  4U4S A;  5TU0 A;  3SZP A;  1N04 A;  4IO2 A;  1BIY A;  1QUJ A;  2I0B A;  4U1Z A;  5FHM A;  5I2K A;  1FSA A;  3IOV A;  4KXP A;  4PF8 A;  1NV7 A;  4PFT A;  3ISP A;  4N6D A;  4OVS A;  1IXC A;  4QSE A;  5DYH A;  3PTY A;  1B4Z A;  1N3W A;  3MWB A;  1DTZ A;  1QUL A;  2QL3 A;  1R6Z A;  1CE2 A;  5CMC A;  1TFD A;  2I3W A;  4NAP A;  3TTM A;  3IFA A;  5A5X A;  3H6V A;  1FQD A;  1MXX A;  1NH7 A;  1SW5 A;  3UN6 A;  3R7X A;  1FPJ A;  4JWX A;  4X1D A;  4PGN A;  4ISU A;  1IUD A;  3OO6 A;  2XXY A;  2QRY A;  4HCW A;  1YYZ A;  2GHA A;  3IOW A;  5F1Q A;  2F6G A;  3FJG A;  3K00 A;  3HPI A;  5ET6 A;  1UTH A;  1H44 A;  3FAS A;  3GBA A;  1FQC A;  4GD5 A;  4P3L A;  3S2V A;  2V93 A;  4AB5 A;  4P1E A;  4UA8 A;  1KZ8 A;  1OQH A;  5KCJ B;  1PEB A;  2O6A A;  5ESY A;  2D21 A;  3B6W A;  5AA2 B;  4OEV A;  4H6D A;  3O28 A;  4MMP A;  3IO4 A;  5FHN A;  1JVX A;  3OSQ A;  3T93 B;  1Q9D A;  4GWZ A;  3T9H B;  1EZO A;  4XIG Q;  3IL1 B;  4LP2 B;  1G0H A;  3NOH A;  2Y7K A;  2PX1 A;  4F3S A;  3CHG A;  2QVV A;  1NUW A;  3FBP A;  4P1L A;  3KBR A;  3O9P A;  3PPN A;  4ZED A;  1JEU A;  2WBD A;  1B7U A;  3BIG A;  5FTI A;  5I56 A;  5L9M A;  1NUY A;  4MIJ A;  4C1T A;  2GHB A;  4GIZ A;  4DCX A;  2XXV A;  4HTG A;  3C36 A;  4PFU A;  4RXL A;  4BDO A;  1JET A;  2Y7I A;  4GOT A;  5H8N A;  4POW A;  5JK4 A;  1URD A;  1FTJ A;  1XC1 A;  5H8H B;  2D3I A;  3PUV E;  2UYF A;  3B8B A;  2YJP A;  3TZA A;  4XEQ A;  3G3K A;  2NXO A;  1LB9 A;  3TUS A;  3T9V A;  1MM6 A;  1I6A A;  4GL8 A;  2XX8 A;  4O3C A;  4ONY A;  1B1X A;  3Q27 A;  3ECR A;  4FJP A;  4GVO A;  1N7W A;  2PCR A;  1EU8 A;  3LSF B;  3U72 A;  1D4N A;  2FNC A;  5I5P A;  1WVJ A;  5IAI A;  3VLU A;  1I6B A;  1A99 A;  5I57 B;  2D5W A;  4BDQ A;  2Z8E A;  2RC7 A;  3PPR A;  2P0S A;  2WKY A;  2UXA A;  3TEL A;  2X7Q A;  5ICT A;  4P11 A;  3TTK A;  4AB6 A;  4PC9 A;  4LON B;  4G8H A;  1QKB A;  3BBR A;  1DPE A;  3PD8 A;  4E0X A;  1B5I A;  3A29 A;  4FEC A;  4EQB A;  4PDH A;  3G3F A;  1SDX A;  2W7Y A;  4P56 A;  4PCD A;  5DEX B;  1PB7 A;  5FBP A;  4IO5 A;  4JWY A;  1ZBM A;  4F29 A;  2KQZ A;  3E9X A;  5B70 A;  5CMM A;  3ROJ A;  5AA4 A;  4MLV A;  4MNP A;  4GFR A;  1PBP A;  1AMF A;  4O8M A;  2B3F A;  4P8B A;  4U23 A;  4MCO A;  4DIG A;  4QF9 A;  4G4P A;  4YZZ A;  1XI6 A;  1M5F A;  3MBP A;  4ELO A;  4GX4 A;  4NF8 B;  2Y7W A;  3M3K A;  5I84 A;  1FTO A;  4FE8 A;  4QRZ A;  3K2D A;  3Q29 A;  1IMA A;  4IO4 A;  3B6T A;  3UA8 A;  1NI9 A;  2HEU A;  1TT1 A;  1UTB B;  5EYH A;  3ILT B;  2AL4 A;  5EQA A;  3RUM A;  2F7A A;  1Y4T A;  1WDN A;  3N5L A;  1WOD A;  3L6G A;  3GXA A;  4K3F A;  2DSF A;  2OWS A;  1NFT A;  3EHT A;  5EHS A;  3RPL A;  2VHA A;  1OQG A;  2Q9T A;  4AQ4 A;  5T3J A;  2Z23 A;  1TWY A;  3KC1 A;  3HN0 A;  4LZ8 A;  4YKP A;  5J1D A;  2DVC A;  1NNT A;  4BDR A;  1B46 A;  4H5G A;  3IO6 A;  1S9T A;  2PFZ A;  4HW8 A;  2FVZ A;  2RIN A;  1FBC A;  2XWK A;  5IZ3 A;  1FBD A;  4DZ1 A;  3JYR A;  4N4U A;  5AA2 D;  3PU5 A;  2HAV A;  1IXI A;  2XA5 A;  3U92 A;  4F2O A;  2QFL A;  1SW2 A;  2YLN A;  4FEB A;  2RC9 A;  1VSO A;  3WAF A;  2F34 A;  2QS3 A;  1FPL A;  4GBV A;  5H8F B;  5JEI A;  1P1W A;  1USY H;  4BLA A;  4H8J A;  5EYF A;  4JSO A;  1FW0 A;  1NNF A;  4U1O A;  4OES A;  3CFX A;  3G3I A;  4MEV A;  3PD9 A;  3CG1 A;  5CBR A;  4OFL A;  2F5X A;  3F11 A;  2ZYN A;  4GQO A;  1DBZ A;  5HPQ A;  1OLC A;  4BDM A;  1FPF A;  3HCQ A;  2PBW A;  3SEY A;  3EHS A;  4KHZ E;  5IM2 A;  1SW1 A;  2H5Y A;  2ESN A;  5H8S A;  4YMB A;  2RC8 A;  1OMP A;  2JJK A;  2QS1 A;  3KOT A;  2DWA A;  3IR1 A;  2H4I A;  4DXC A;  2DE3 A;  1XVX A;  1YPN A;  1JW5 A;  5DW8 A;  3BKI B;  3KG2 A;  1R9L A;  3KC0 A;  2Y5K A;  1LBY A;  2Y5L A;  4JVD A;  3KN7 A;  4PFW A;  2CZL A;  4N81 A;  5I59 B;  2XX7 A;  2FHY A;  4G61 A;  2ZNT A;  3CSG A;  3FAT A;  3LUY A;  4IY5 A;  1LBZ A;  1B6H A;  4G68 B;  1LAX A;  4KI0 E;  3MZ1 A;  1B3E A;  5I2N B;  4OFO A;  1MDQ A;  1Y3P A;  4WKM A;  3K6X A;  4F2Q A;  2L5V A;  4R9F A;  5EQ7 A;  5DT6 A;  3UIF A;  1DPP A;  3K0V A;  4IGT A;  4THI A;  3TCF A;  5ELV A;  4KCD A;  4F19 A;  3CG3 A;  4NF6 A;  4NE4 A;  3MPL A;  1MXW A;  2OLB A;  1LFH A;  1NV0 A;  1FBP A;  2REJ A;  2CZI A;  5JTY B;  2XXW A;  1NV3 A;  1MXU A;  1NKX A;  3VXB A;  3OEK A;  3ONM A;  1B40 A;  2CMO A;  4O3A A;  2H99 A;  4QFN A;  2O84 X;  4HE0 A;  1EYK A;  2F97 A;  2XWI A;  3TKD A;  3OO9 A;  4YB7 A;  1R1N A;  1VFD A;  2HZL A;  2DQV A;  2WEF A;  3DLN A;  1GV8 A;  5I2K B;  4MFI A;  3FJ7 A;  4OZ9 A;  3VLW A;  4OHN A;  3OMB A;  3C34 A;  1FPG A;  3RQT A;  2KLF A;  3TTR A;  4X9T A;  1FPK A;  1PBQ A;  4R75 A;  1N3X A;  1URG A;  4KD5 A;  2VGQ A;  2ONR A;  3S9N C;  4PF6 A;  3LSL A;  5H8Q A;  5LTC A;  5A5X B;  1GVC A;  3L6H A;  1BTJ A;  3MYU A;  1Y1M A;  3U93 A;  4QFO A;  3OXN A;  1FJ9 A;  3RTF B;  2OK2 A;  1FPI A;  1JNF A;  1ZKB A;  2CEX A;  4H45 A;  1FQE A;  3C33 A;  4F1U A;  2DYX A;  5FHO A;  2ZZX A;  1DTG A;  2RKM A;  3IB0 A;  1ZTY A;  2HAU A;  3K1M A;  4PDD A;  2OWT A;  4ZE9 A;  2ABH A;  3PPO A;  4R6H A;  1LB8 A;  3GYY A;  4XTC Q;  2VP1 A;  2A5T A;  2GFE A;  3VVD A;  3G3J A;  4O3B A;  4X8R A;  1UTH B;  3U94 A;  4OFJ A;  4RJZ A;  1J1N A;  2AYS A;  3THI A;  4H67 A;  2Q89 A;  1B3H A;  1XT8 A;  1LAH E;  2E1S A;  2ZXT A;  3K1P A;  4RK2 A;  2KR0 A;  1M5B A;  3MP6 A;  2I58 A;  4QFL A;  5IKB A;  1MY2 A;  3SEX A;  3MZ9 A;  1JW4 A;  4NF4 A;  3C4M A;  1QGX A;  3QXM A;  3P7I A;  4P0I A;  4HXV A;  4GX6 A;  3LV0 A;  1YTV A;  4YKJ A;  2B4L A;  2Z8D A;  4N6P A;  1A7L A;  4MJO A;  2XHD A;  4N15 A;  1MY0 A;  4IR8 A;  4DDD A;  4I62 A;  1SQY A;  4F39 A;  1BLF A;  2YPN A;  1USY E;  3U8Q A;  3S9E A;  5H8N B;  2AL5 A;  3OOA A;  4R6K A;  4NTL A;  1M5E A;  4JSD A;  4GWO A;  5EYG A;  2P1S A;  3O6I A;  4JB7 A;  1FTK A;  1LBV A;  1SVX B;  4OVT A;  3MST A;  3D4G A;  1SW4 A;  2V4C A;  1EZ9 A;  1MM7 A;  4FAJ A;  1ZLQ A;  3PPP A;  1B1H A;  2O1L A;  4OVR A;  4EF2 A;  3TAJ A;  4IGR A;  1EYI A;  4MHF A;  3CIJ A;  3MP8 A;  5LOM A;  1LAG E;  2XXT A;  2F35 A;  2XXQ A;  3SET A;  2P3N A;  4I3Y A;  3OD7 A;  4RYA A;  1B3F A;  1RDY A;  4F3B A;  3ODB A;  1B7Z A;  3B6Q A;  2I48 A;  1DOT A;  3VDF A;  2GRV A;  5KCJ A;  4NN3 A;  3KZG A;  4PBH A;  2ZYO A;  4PET A;  5ET5 A;  4GLI A;  1B3L A;  4EQ9 A;  5BWJ A;  3G3H A;  1B7H A;  1F9B A;  1MQD A;  2PT1 A;  3K6V A;  4JVC A;  2XD3 A;  3V8X B;  3LSX A;  4R74 A;  1N76 A;  1RDX A;  1ZMG A;  4Q0C A;  2I4B A;  4R73 A;  4IO6 A;  5F24 A;  1HSL A;  1US5 A;  3H6W A;  2HFB A;  4MNC A;  4MNI A;  3RPW A;  4JXI A;  4P0G A;  4ELR A;  3TOD A;  2HCA A;  2IA4 A;  5HM4 B;  1LFG A;  4P9K A;  4MX6 A;  4QSD A;  1NNK A;  3OSR A;  1HSE A;  3PPQ A;  2WX9 A;  4FAT A;  3KSJ A;  4LUB A;  5AA3 A;  2QVU A;  2E0S A;  2WYP A;  3FV1 A;  2OWZ A;  3DP6 A;  2O68 A;  4FBP A;  5FTH A;  1LLS A;  1K9Y A;  5L9O A;  3K02 A;  5HBC A;  4XF5 A;  1FPD A;  4OTE A;  1RDZ A;  4GXA A;  4XKP A;  5IZZ A;  4R72 A;  3RPL B;  4RY1 A;  2O51 A;  2B4M A;  4OWD A;  1FPB A;  3HST A;  3KEI A;  3PGF A;  2BJJ X;  3FGS A;  2QVR A;  4U21 A;  3E13 X;  1UIU A;  4UAC A;  2NVU B;  2V84 A;  3IAZ A;  4E0W A;  1B0H A;  2WBB A;  1URS A;  2OX3 A;  5I7I A;  4I8C A;  5CMK A;  1UQW A;  2F7C A;  3RY3 A;  5IZ3 B;  4NF0 A;  2ZNS A;  3FUZ A;  3ZS6 A;  2DP8 A;  1DSN A;  4DXB A;  1LBB A;  1B0L A;  5DVF A;  3UK4 A;  2OCU A;  1AIV A;  3FIR A;  3H6U A;  3KGC A;  3CVG A;  5K2Y A;  1LCF A;  5I58 A;  3MUQ A;  4XKN A;  1Z7N E;  1DCU A;  4AS4 A;  3DEL B;  2DS9 A;  5F7V A;  4KR5 A;  3FV2 A;  5CC2 A;  4IY6 A;  3QUJ A;  3T9U A;  4KQP A;  2Q8J A;  2CZK A;  4ZS9 A;  5ET8 A;  4DI3 D;  4JWO A;  4H8I A;  1NNP A;  3CSB A;  4KYD A;  1S50 A;  2H98 A;  4LQ5 A;  4OYV A;  4NQ8 A;  4TLL B;  4WED A;  2QS2 A;  5TPA A;  2HPG A;  3C35 A;  1NL5 A;  3N6T A;  5EQ9 A;  1POT A;  4U4X A;  2ZMB A;  4IO3 A;  4LA9 A;  2P3V A;  3DP4 A;  5DVJ A;  4OVJ A;  1LGB C;  1P1O A;  1B51 A;  3VXC A;  2I4C A;  3T0J A;  5ITP A;  1NH8 A;  4IO7 A;  5DTB A;  3PV0 E;  4MAG A;  1RYX A;  5CI5 A;  3M3F A;  4Z7E A;  1EH3 A;  1P99 A;  2BJI A;  1IMD A;  3PUX E;  5M2V A;  4YIC A;  3RGY A;  3EN3 A;  3TMG A;  2HXR A;  3I6V A;  4DLD A;  4AS5 A;  1O7T A;  4C1U A;  5CMB A;  4OER A;  3H06 B;  4RA1 A;  1B32 A;  1N7X A;  3QAX A;  4PAI A;  2XWO A;  1O63 A;  2UVG A;  2AIX A;  2UYE A;  2F8D A;  3T9X B;  3G3G A;  4F31 B;  3M3L A;  2Z8F A;  3IFC A;  3VFJ A;  2O7U A;  4YMA A;  1JVY A;  2A5S A;  3FZV A; 
#chains in the Genus database with same CATH homology
 3H7M A;  4NF6 B;  1GGG A;  2V3Q A;  3MPK A;  3IOU A;  1OVB A;  3EHU A;  2F36 A;  1LBC A;  4N07 A;  2H25 A;  3MVZ A;  3RLF E;  1A8E A;  3O6H A;  4JBZ A;  4U22 A;  3FXQ A;  3UGW A;  2IEE A;  3JZJ A;  3IK6 B;  5L8D A;  4ELP A;  2Y7P A;  4R6Y A;  5CBS A;  3K4U A;  5TP9 A;  3KOS A;  1IXG A;  3SER A;  4ELQ A;  4OXV A;  4GF8 A;  1D9V A;  4FOR A;  3SES A;  3ZKK A;  2NWJ A;  1JQF A;  1ZIU A;  1H45 A;  4Q5T A;  5B7D A;  3GZG A;  4BDN A;  3PUZ E;  4F1Y A;  3PUY E;  4LVQ A;  1B3G A;  4EQ7 A;  2O7I A;  3KJT A;  5H8Q B;  4XKQ A;  4HS7 A;  4FIM A;  3A3C A;  4PFY A;  2XXR A;  3LSW A;  4IB2 A;  1MS7 A;  5I59 A;  3KFM A;  3B7D A;  3IJO B;  4MF3 A;  1Y3N A;  2QS4 A;  4R9G A;  2XXX A;  2F78 A;  1GTK A;  1QUI A;  2LAO A;  4WEP A;  3W9V A;  1MY3 A;  3CFL A;  4ZZE A;  3O2A A;  3AXF A;  3CI8 A;  3RT8 A;  3IB1 A;  3FVO A;  4NF5 A;  3TCH A;  2Q2C A;  2A5T B;  2PT2 A;  1O64 A;  4G8M A;  1B9J A;  4PE5 B;  4DCY A;  5ISU A;  3RNN A;  3PMW A;  1YCJ A;  3R26 A;  3N94 A;  4X48 A;  2Q2A A;  4I9D A;  3OO8 A;  4U2R A;  1B58 A;  4Q30 B;  3PMX A;  4PP0 A;  1A40 A;  3KSX A;  1S7Y A;  2UVI A;  1Y1Z A;  1SBP A;  4C0R A;  1IZ1 A;  1MPC A;  2I6E A;  4F22 A;  2P2A A;  4NF4 B;  4ZEB A;  1DMB A;  2QMW A;  4ESX A;  2NUV A;  4YKI A;  3TQL A;  1D3K A;  3O29 A;  1PB9 A;  4DXU A;  3Q26 A;  1KWH A;  4G8N A;  4GXS B;  1LST A;  3TEP A;  2R71 A;  3KN3 A;  2DVZ A;  3H4Z A;  3U1O A;  2DXY A;  2V25 A;  3H03 A;  3S4U A;  1XOC A;  2VD3 A;  5KDT A;  2RCA A;  1QW0 A;  3O97 A;  1MPB A;  3GBB A;  3G7W A;  3C31 A;  4OEN A;  4F3P A;  2R9J A;  3TTN A;  4H0W A;  2VD2 A;  2UVH A;  2GH9 A;  5I56 B;  2HZK A;  3RTW B;  3E3K A;  1SYI A;  3PMV A;  1N0T A;  4HCY A;  3V5A A;  3A09 A;  1PB8 A;  4XKR A;  4MH5 A;  1IXH A;  1XHY A;  2XXU A;  4RPO A;  1VFE A;  1MXZ A;  3ZSF A;  1RYO A;  2HXW A;  3JV9 A;  4ZZA A;  4QFP A;  3N26 A;  3OEN A;  4OMB A;  3I3V A;  1JW1 A;  2THI A;  1QJM A;  1VE4 A;  4POX A;  4NMY A;  3SEU A;  3FXR A;  3K1N A;  3OO7 A;  2OZZ A;  2M8C A;  1N84 A;  2Q88 A;  2X7P A;  3IJX B;  3MZB A;  3EPE A;  3S9M C;  3SDF A;  1JEV A;  5ITO A;  3O6G A;  2XXP A;  4NWD A;  1L5T A;  2H9B A;  3H6T A;  3H3G A;  4ECF A;  2XX9 A;  4ND9 A;  2PYY A;  4GRK A;  4ZEI A;  3C32 A;  3QIM A;  2DWI A;  1MY4 A;  3LR1 A;  1MPD A;  1I69 A;  2ANJ A;  3DM0 A;  4RK9 A;  1AOV A;  4H65 A;  5AA2 A;  1H43 A;  3HO7 A;  3VE1 B;  1IEJ A;  1R9Q A;  1BP5 A;  2RCB A;  2RF1 A;  3D4C A;  1MRP A;  4F18 A;  2X26 A;  5AA4 B;  2F6P A;  1OLA A;  3MQ9 A;  1T0K A;  1AL3 A;  4NWC A;  4PQJ A;  3V89 B;  3A3U A;  3QYT A;  3FVK A;  4Z0I A;  3T96 B;  1VR5 A;  4G68 C;  3USD A;  3TFL A;  4KYE A;  3FXU A;  4OQO A;  3IX1 A;  4NED A;  3TDJ A;  3TCG A;  1ZJL A;  4KYS A;  1Q1K A;  1QKA A;  4YB6 A;  3K01 A;  1LCT A;  3BFT A;  1FQB A;  1I6Q A;  1P1U A;  2QPQ A;  1A55 A;  1FTM A;  1XS5 A;  2ALU A;  5H8H A;  5I58 B;  1P1N A;  1MY1 A;  2B3B A;  2HQ0 A;  3VLV A;  1MH4 A;  3O66 A;  4BDL A;  5AE4 A;  4RPN A;  2DE4 A;  3BFU A;  1MXV A;  4F3G A;  1P1Q A;  5I57 A;  2O1M A;  1FTL A;  3FVN A;  1Y20 A;  1ATG A;  5TPA B;  1FQA A;  1II5 A;  2QJE A;  4QSC A;  2DWJ A;  1FCK A;  3GLB A;  1NMU A;  4ZEK A;  4FED A;  2ZNU A;  1ELJ A;  3R6U A;  4LZ7 A;  3ILU B;  2REG A;  4GL0 A;  2V3T A;  3EQ1 A;  1LFI A;  2QMX A;  3HHF A;  5K2X A;  2G93 A;  3CRB A;  5DEX A;  2B65 A;  4ESW A;  3M8U A;  4TQU Q;  3IOT A;  1HSJ A;  4JDF A;  4YB5 A;  4EXL A;  2FYI A;  2O69 A;  4M1V A;  4L17 A;  4H5F A;  1H3D A;  3UOR A;  5CM6 A;  4G2Z A;  3C9H A;  4I1D A;  1OVT A;  1SD3 A;  4NF8 A;  1MXY A;  2G29 A;  4QFK A;  2I49 A;  2ZYM A;  4LQ2 A;  3FJM A;  1TXF A;  1SI0 A;  3HV1 A;  2Z22 A;  2XXI A;  4YKK A;  1ANF A;  1CB6 A;  1PDA A;  1UTB A;  2DWH A;  5AA1 A;  3K6U A;  2DXR A;  3OEM A;  3RN8 A;  2ONK E;  4EXK A;  2OBG A;  4G77 A;  3KJ7 A;  1A8F A;  2QSX A;  4RNS A;  3MVW A;  3UP9 A;  3E4R A;  3LC8 A;  3WAE A;  1H76 A;  4N13 A;  1SI1 A;  3Q25 A;  3V83 A;  2DOJ A;  1Y4C A;  3TPA A;  2ONS A;  3KN8 A;  3T66 A;  5TP9 B;  3VVF A;  3ZKL A;  1EZP A;  5DVI A;  1QVS A;  3W15 C;  3Q28 A;  3VVE A;  4EF1 A;  3S9L C;  2DE2 A;  3RT6 B;  3W9W A;  3FD3 A;  1M5D A;  3IB2 A;  4KCC A;  3MJN A;  1TFA A;  1M5C A;  5H8F A;  4YU0 A;  4ZEF A;  2VOZ A;  1XVY A;  4DE8 A;  4F1V A;  1RKM A;  2R6G E;  3OEL A;  1B4H A;  1GR2 A;  3SEW A;  4EUO A;  2I3V A;  3HHG A;  4EDP A;  1OIB A;  3MW0 A;  2OJT A;  1B52 A;  2XXH A;  3CR9 A;  3SKP A;  1B2H A;  4QHQ A;  1MQG A;  1YAE A;  3CFZ A;  3I5O A;  4WXJ A;  4Q8R A;  4NF5 B;  3MP1 A;  1B5H A;  3DP8 A;  2V3U A;  5ICQ A;  4M4G A;  4ZEC A;  3TQW A;  3SEV A;  3PUW E;  4XXU A;  4LAT A;  1MQI A;  2Y7R A;  1ZU0 A;  1B5J A;  1MDP 1;  1FQF A;  5EHM A;  3MVX A;  4KPT A;  2PMS A;  4R2B A;  1MG1 A;  1IIW A;  3MAM A;  3VV5 A;  2XD2 A;  3TTL A;  1BKA A;  1UIV A;  3N6U A;  1D9Y A;  4G68 A;  3QK6 A;  1SYH A;  4YAH X;  5I2N A;  5CRY A;  3K6W A;  4LZ5 A;  1MQH A;  4ZE8 A;  1AH5 A;  1MH3 A;  1B05 A;  3TYH A;  2FA7 A;  5BUU A;  4R2F A;  4OET A;  4MBP A;  3IOR A;  4TLM B;  3MC2 A;  1IIT A;  1PC3 A;  5KZT A;  4TOZ A;  2NOO A;  3EF7 A;  1US4 A;  2ZYK A;  1LAF E;  4H1X A;  1Y9U A;  2Y84 A;  5L9S A;  1QUK A;  2I0C A;  4KFQ A;  2UVJ A;  2PVU A;  4X1B A;  3MVY A;  1Y3Q A;  1IQ7 A;  1Z7M E;  3T22 A;  4OEU A;  3LBS A;  4ZDM A;  5JTY A;  5KDT B;  1A54 A;  4MLQ A;  1Q35 A;  3QUF A;  1POY 1;  1MQJ A;  2F7B A;  3QSL A;  3FVG A;  4U4S A;  5TU0 A;  1N04 A;  4IO2 A;  1BIY A;  1QUJ A;  2I0B A;  4U1Z A;  5FHM A;  5I2K A;  3IOV A;  4PFT A;  1IXC A;  4QSE A;  5DYH A;  1B4Z A;  1N3W A;  3MWB A;  1DTZ A;  1QUL A;  2QL3 A;  1R6Z A;  1CE2 A;  5CMC A;  1TFD A;  2I3W A;  3TTM A;  5A5X A;  3H6V A;  1FQD A;  1MXX A;  1NH7 A;  1SW5 A;  3UN6 A;  3R7X A;  4JWX A;  4X1D A;  4ISU A;  1IUD A;  3OO6 A;  2XXY A;  2QRY A;  4HCW A;  2GHA A;  3IOW A;  5F1Q A;  2F6G A;  3FJG A;  3K00 A;  3HPI A;  1UTH A;  1H44 A;  3FAS A;  3GBA A;  1FQC A;  4GD5 A;  3S2V A;  2V93 A;  4AB5 A;  4UA8 A;  1OQH A;  5KCJ B;  1PEB A;  2O6A A;  2D21 A;  3B6W A;  5AA2 B;  4H6D A;  5FHN A;  3O28 A;  4OEV A;  3IO4 A;  1JVX A;  3OSQ A;  3T93 B;  3T9H B;  1EZO A;  4XIG Q;  3IL1 B;  4LP2 B;  2Y7K A;  2PX1 A;  4F3S A;  3KBR A;  3O9P A;  3PPN A;  4ZED A;  1JEU A;  1B7U A;  5FTI A;  5I56 A;  5L9M A;  4C1T A;  2GHB A;  4GIZ A;  4DCX A;  2XXV A;  4HTG A;  3C36 A;  4PFU A;  4RXL A;  4BDO A;  1JET A;  2Y7I A;  4GOT A;  5H8N A;  4POW A;  5JK4 A;  1URD A;  1FTJ A;  1XC1 A;  5H8H B;  2D3I A;  3PUV E;  2UYF A;  2YJP A;  3TZA A;  3G3K A;  2NXO A;  1LB9 A;  3TUS A;  3T9V A;  1MM6 A;  1I6A A;  4GL8 A;  2XX8 A;  4O3C A;  4ONY A;  1B1X A;  3Q27 A;  3ECR A;  4FJP A;  4GVO A;  1N7W A;  1EU8 A;  3LSF B;  3U72 A;  1D4N A;  2FNC A;  5IAI A;  1WVJ A;  3VLU A;  1I6B A;  1A99 A;  5I57 B;  2D5W A;  4BDQ A;  2Z8E A;  2RC7 A;  3PPR A;  2P0S A;  2WKY A;  2UXA A;  3TEL A;  2X7Q A;  5ICT A;  4P11 A;  3TTK A;  4AB6 A;  4LON B;  4G8H A;  1QKB A;  3BBR A;  1DPE A;  3PD8 A;  4E0X A;  1B5I A;  4FEC A;  4EQB A;  3G3F A;  1SDX A;  2W7Y A;  5DEX B;  1PB7 A;  4IO5 A;  4JWY A;  1ZBM A;  4F29 A;  3E9X A;  5B70 A;  5CMM A;  5AA4 A;  4MLV A;  4GFR A;  1PBP A;  1AMF A;  2B3F A;  4U23 A;  4DIG A;  4QF9 A;  4G4P A;  4YZZ A;  1M5F A;  3MBP A;  4ELO A;  4NF8 B;  2Y7W A;  3M3K A;  5I84 A;  1FTO A;  4FE8 A;  4QRZ A;  3K2D A;  3Q29 A;  4IO4 A;  3B6T A;  3UA8 A;  2HEU A;  1TT1 A;  1UTB B;  3ILT B;  2AL4 A;  3RUM A;  2F7A A;  1Y4T A;  1WDN A;  3N5L A;  1WOD A;  3L6G A;  3GXA A;  4K3F A;  2DSF A;  2OWS A;  1NFT A;  3EHT A;  5EHS A;  2VHA A;  1OQG A;  2Q9T A;  4AQ4 A;  2Z23 A;  1TWY A;  3HN0 A;  4LZ8 A;  4YKP A;  5J1D A;  2DVC A;  1NNT A;  4BDR A;  1B46 A;  4H5G A;  3IO6 A;  1S9T A;  4HW8 A;  2RIN A;  4DZ1 A;  3JYR A;  5AA2 D;  3PU5 A;  2HAV A;  1IXI A;  3U92 A;  4F2O A;  1SW2 A;  2YLN A;  4FEB A;  2RC9 A;  1VSO A;  3WAF A;  2F34 A;  2QS3 A;  5H8F B;  5JEI A;  1P1W A;  1USY H;  4BLA A;  4H8J A;  5EYF A;  4JSO A;  1FW0 A;  1NNF A;  4U1O A;  4OES A;  3CFX A;  3G3I A;  3PD9 A;  3CG1 A;  5CBR A;  4OFL A;  2F5X A;  3F11 A;  2ZYN A;  4GQO A;  5HPQ A;  1OLC A;  4BDM A;  3HCQ A;  2PBW A;  3SEY A;  3EHS A;  4KHZ E;  1SW1 A;  5H8S A;  4YMB A;  2H5Y A;  2ESN A;  2RC8 A;  1OMP A;  2QS1 A;  3KOT A;  2DWA A;  3IR1 A;  2H4I A;  4DXC A;  2DE3 A;  1XVX A;  1YPN A;  1JW5 A;  3BKI B;  3KG2 A;  1R9L A;  4PFW A;  3KN7 A;  2CZL A;  5I59 B;  2XX7 A;  2ZNT A;  3CSG A;  3FAT A;  3LUY A;  4IY5 A;  1B6H A;  4G68 B;  1LAX A;  4KI0 E;  3MZ1 A;  1B3E A;  5I2N B;  4OFO A;  1MDQ A;  1Y3P A;  4WKM A;  3K6X A;  4F2Q A;  4R9F A;  5DT6 A;  3UIF A;  1DPP A;  3K0V A;  4IGT A;  4THI A;  3TCF A;  5ELV A;  4KCD A;  4F19 A;  3CG3 A;  4NF6 A;  4NE4 A;  3MPL A;  1MXW A;  2OLB A;  1LFH A;  2REJ A;  5JTY B;  2XXW A;  1MXU A;  1NKX A;  3VXB A;  3OEK A;  3ONM A;  1B40 A;  2CMO A;  4O3A A;  2H99 A;  4QFN A;  2O84 X;  2F97 A;  3TKD A;  3OO9 A;  4YB7 A;  1R1N A;  1VFD A;  2HZL A;  2DQV A;  3DLN A;  1GV8 A;  5I2K B;  4MFI A;  3FJ7 A;  4OZ9 A;  3VLW A;  4OHN A;  3OMB A;  3C34 A;  3RQT A;  2KLF A;  3TTR A;  4X9T A;  1PBQ A;  4R75 A;  1N3X A;  1URG A;  2VGQ A;  2ONR A;  4KD5 A;  3S9N C;  3LSL A;  5H8Q A;  5A5X B;  1GVC A;  3L6H A;  1BTJ A;  1Y1M A;  3U93 A;  4QFO A;  3OXN A;  3RTF B;  2OK2 A;  1JNF A;  1ZKB A;  1FQE A;  3C33 A;  4F1U A;  2DYX A;  5FHO A;  1DTG A;  2RKM A;  3IB0 A;  1ZTY A;  2HAU A;  3K1M A;  2OWT A;  4ZE9 A;  2ABH A;  3PPO A;  4R6H A;  1LB8 A;  4XTC Q;  2VP1 A;  2A5T A;  2GFE A;  3VVD A;  3G3J A;  4O3B A;  1UTH B;  3U94 A;  4OFJ A;  4RJZ A;  1J1N A;  2AYS A;  3THI A;  4H67 A;  2Q89 A;  1B3H A;  1XT8 A;  1LAH E;  2E1S A;  2ZXT A;  3K1P A;  4RK2 A;  1M5B A;  3MP6 A;  2I58 A;  4QFL A;  5IKB A;  1MY2 A;  3SEX A;  3MZ9 A;  1JW4 A;  4NF4 A;  3C4M A;  3QXM A;  3P7I A;  4P0I A;  1YTV A;  4YKJ A;  2Z8D A;  4N6P A;  1A7L A;  2XHD A;  1MY0 A;  4DDD A;  4I62 A;  1SQY A;  4F39 A;  1BLF A;  2YPN A;  1USY E;  3U8Q A;  3S9E A;  5H8N B;  2AL5 A;  3OOA A;  4R6K A;  4NTL A;  1M5E A;  4JSD A;  4GWO A;  2P1S A;  3O6I A;  4JB7 A;  1FTK A;  1SVX B;  3D4G A;  1SW4 A;  1EZ9 A;  1MM7 A;  4FAJ A;  1ZLQ A;  3PPP A;  1B1H A;  2O1L A;  4EF2 A;  3TAJ A;  4IGR A;  3CIJ A;  3MP8 A;  5LOM A;  1LAG E;  2XXT A;  2F35 A;  2XXQ A;  3SET A;  3OD7 A;  4RYA A;  1B3F A;  4F3B A;  3ODB A;  1B7Z A;  3B6Q A;  2I48 A;  1DOT A;  3VDF A;  2GRV A;  5KCJ A;  3KZG A;  2ZYO A;  4PET A;  4GLI A;  1B3L A;  4EQ9 A;  5BWJ A;  3G3H A;  1B7H A;  1F9B A;  1MQD A;  2PT1 A;  3K6V A;  2XD3 A;  3V8X B;  3LSX A;  4R74 A;  1N76 A;  1ZMG A;  4Q0C A;  2I4B A;  4R73 A;  4IO6 A;  1HSL A;  1US5 A;  3H6W A;  2HFB A;  3RPW A;  4JXI A;  4P0G A;  4ELR A;  3TOD A;  2HCA A;  2IA4 A;  5HM4 B;  1LFG A;  4QSD A;  1NNK A;  3OSR A;  1HSE A;  3PPQ A;  4FAT A;  3KSJ A;  4LUB A;  5AA3 A;  2E0S A;  3FV1 A;  3DP6 A;  2O68 A;  5FTH A;  1LLS A;  5L9O A;  3K02 A;  5HBC A;  4OTE A;  4GXA A;  4XKP A;  4R72 A;  4RY1 A;  2O51 A;  4OWD A;  3HST A;  3KEI A;  3PGF A;  2BJJ X;  3FGS A;  3E13 X;  4U21 A;  1UIU A;  4UAC A;  2NVU B;  2V84 A;  3IAZ A;  4E0W A;  1B0H A;  1URS A;  4I8C A;  5CMK A;  1UQW A;  2F7C A;  3RY3 A;  2ZNS A;  3FUZ A;  3ZS6 A;  2DP8 A;  1DSN A;  4DXB A;  1LBB A;  1B0L A;  5DVF A;  3UK4 A;  2OCU A;  1AIV A;  3FIR A;  3H6U A;  3KGC A;  3CVG A;  5K2Y A;  1LCF A;  5I58 A;  3MUQ A;  4XKN A;  1Z7N E;  3DEL B;  2DS9 A;  5F7V A;  4KR5 A;  3FV2 A;  5CC2 A;  4IY6 A;  3QUJ A;  3T9U A;  4KQP A;  2Q8J A;  4ZS9 A;  4JWO A;  4H8I A;  1NNP A;  3CSB A;  4KYD A;  1S50 A;  2H98 A;  4LQ5 A;  4OYV A;  4TLL B;  4WED A;  2QS2 A;  5TPA A;  3C35 A;  1NL5 A;  3N6T A;  1POT A;  4U4X A;  2ZMB A;  4IO3 A;  4LA9 A;  3DP4 A;  5DVJ A;  4OVJ A;  1LGB C;  1P1O A;  1B51 A;  3VXC A;  2I4C A;  5ITP A;  1NH8 A;  4IO7 A;  5DTB A;  3PV0 E;  1RYX A;  5CI5 A;  3M3F A;  4Z7E A;  1EH3 A;  1P99 A;  3PUX E;  5M2V A;  4YIC A;  3RGY A;  3EN3 A;  3TMG A;  4DLD A;  3I6V A;  4C1U A;  1O7T A;  5CMB A;  4OER A;  3H06 B;  4RA1 A;  1B32 A;  1N7X A;  3QAX A;  1O63 A;  2UVG A;  2AIX A;  2UYE A;  2F8D A;  3T9X B;  3G3G A;  4F31 B;  3M3L A;  2Z8F A;  3VFJ A;  2O7U A;  4YMA A;  1JVY A;  2A5S A;  3FZV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...