1SD3A

Crystal structure of the glur6 ligand binding core in complex with 2s,4r-4-methylglutamate at 1.8 angstrom resolution
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
251
structure length
251
Chain Sequence
NRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKGTPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamate receptor, ionotropic kainate 2
publication title Crystal structures of the GluR5 and GluR6 ligand binding cores: molecular mechanisms underlying kainate receptor selectivity.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Membrane protein
total genus 83
structure length 251
sequence length 251
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-02-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1sd3A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1sd3A02
4OHNA 4F3PA 3K6VA 4E0WA 1B3LA 4YMBA 3L6HA 3UA8A 1JEVA 1EH3A 2I3VA 4M1VA 1B7ZA 1TFAA 4BDRA 5FTHA 4G68A 1QUKA 3PPRA 3MVWA 1Z7NE 5JK4A 2RCBA 3OOAA 4GOTA 3RNNA 4TOZA 4PETA 2Z22A 4O3BA 5CMKA 1B3FA 4FAJA 3O6GA 1VE4A 2VHAA 1WDNA 3ONMA 3RTFB 1B9JA 1PB8A 2F8DA 4U4XA 3R6UA 4ZS9A 3U8QA 3MP8A 1SI0A 1B3EA 3M3LA 4F1YA 3G3KA 3SETA 3I6VA 2A5TB 1PB9A 2HZLA 1SW5A 4POWA 3PPPA 4U2RA 3OEKA 5H8QA 3C33A 3FXQA 4FECA 5ITPA 5DTBA 4M4GA 3M3FA 5DVIA 2X7QA 2QMXA 1B52A 1OIBA 1OQGA 2XHDA 3TODA 1MXWA 3H06B 4OESA 3KGCA 4IO3A 4LUBA 2O7IA 5A5XB 3KN7A 4ZECA 4LZ5A 1FTMA 1GGGA 1B4HA 3IJXB 2O7UA 1PEBA 3KFMA 3MP6A 5H8NB 5JTYA 4BDNA 3SDFA 2XXVA 1FTJA 1JQFA 2CMOA 2XXRA 3S9LC 4XKRA 3G3HA 2XX8A 3IJOB 2GHAA 2OWSA 1XOCA 1B5IA 3QUJA 2Q2AA 3VXBA 3O9PA 3HCQA 3FXUA 5TP9A 3DLNA 1B0LA 1UIVA 2ABHA 3PGFA 3VLWA 1S50A 1MPBA 3PD9A 1JVYA 1H43A 3EHTA 4U1OA 4I1DA 4ELRA 3PUYE 2OLBA 3QAXA 1XT8A 4GIZA 3RY3A 5TPAA 2F5XA 5DT6A 4OETA 4FORA 3H6WA 1VSOA 5KCJB 3IOUA 1SQYA 4MLQA 4XIGQ 5HBCA 4X1BA 1JETA 3EN3A 4DE8A 1QJMA 2O1MA 1JEUA 3PD8A 1MY3A 1I6QA 2NWJA 3K0VA 4ND9A 2UYEA 5KDTB 1FQEA 1ANFA 1UTBB 1TFDA 2F97A 3Q26A 1BTJA 4MBPA 3TDJA 4WXJA 3H7MA 1MH4A 1IIWA 3TELA 3FATA 4ZEKA 4G8HA 1B1XA 4OFLA 1Z7ME 4EF1A 2XXUA 2QS3A 4QFPA 2REJA 2YPNA 1O64A 2CZLA 3C35A 3DELB 3IL1B 3SKPA 4DCYA 3FASA 3KN3A 5AA2B 1FQBA 2BJJX 4IO7A 5BWJA 2HXWA 2X7PA 2Q88A 4TLMB 1MM6A 1MDP1 4ELQA 4NTLA 2ZXTA 3W9VA 3IOWA 3G3GA 3QYTA 5I59A 2V3UA 3B7DA 5B70A 5H8FB 3OEMA 3MWBA 1ZKBA 1MXUA 1HSEA 2HAUA 1L5TA 2PT2A 3EHUA 4LATA 2FNCA 4DIGA 1A55A 3GBBA 3EF7A 4IO5A 2WKYA 4X48A 4R72A 3FUZA 1LAXA 3RLFE 4R75A 3OD7A 3VFJA 1O63A 3VLUA 3RPWA 3TEPA 2H98A 4TLLB 4YB6A 4XKNA 4MF3A 4LONB 3K6UA 3H6UA 1UTHA 1KWHA 4YB5A 3T9XB 1DPEA 1J1NA 4KD5A 4F2OA 1I6AA 4H65A 3TUSA 4LQ2A 3MP1A 1DTZA 3LR1A 3LUYA 3VE1B 4QHQA 4F39A 4X1DA 1B0HA 2IEEA 4H1XA 4FEDA 4ISUA 4BDMA 2VD2A 4XTCQ 5CBRA 3RTWB 1ZU0A 1H3DA 5FHOA 3M8UA 1XHYA 2IA4A 2ONKE 1JW5A 3K00A 1A8EA 4KFQA 3VVDA 2H4IA 4MFIA 5HM4B 1MQJA 3N6UA 1QUIA 3GXAA 4R74A 1A99A 3TKDA 1EZOA 3SEUA 3Q28A 4QSEA 1AOVA 3TAJA 4DCXA 3K1NA 4G8NA 1SW2A 3TQWA 3KOSA 4ZZEA 4U22A 3V8XB 5EHSA 2ANJA 3G3IA 4IGTA 3RQTA 1IXGA 1MM7A 3W15C 1P1OA 4I8CA 2DE2A 1P1NA 1A7LA 3OO9A 4OTEA 4NF4B 1SVXB 4PP0A 2NOOA 2Y7RA 2HAVA 2ZYMA 1LFGA 1R9QA 4LZ8A 5ELVA 5I58B 3GLBA 4DXBA 3OSQA 4HTGA 2GRVA 4GXAA 1HSLA 2VP1A 5CBSA 2Z23A 4Z0IA 3FV1A 4NF8B 2ZMBA 5KZTA 2QJEA 2RC7A 4WEPA 1Q1KA 1BLFA 1B46A 4GL0A 3USDA 2XX9A 3PPOA 2F6PA 5AA4A 2DQVA 2B3BA 1MXXA 3LBSA 1LB8A 3KG2A 5I2NB 1I6BA 1PC3A 3E9XA 4ONYA 4JXIA 1ZJLA 5CMCA 5IKBA 2GHBA 2Y7KA 3MVYA 4OYVA 4QFOA 2I4CA 3C9HA 1POY1 2I0BA 2QPQA 3LSXA 3TMGA 4G2ZA 1RYOA 3UN6A 4LZ7A 5L9MA 3IOVA 3CG1A 5I2KA 3C36A 2DE3A 4YAHX 3O28A 3RGYA 1ZLQA 4H5GA 5FHNA 3TTLA 3G3JA 3PPNA 4PE5B 3IR1A 2V93A 3PV0E 3H03A 2Z8DA 2ZNTA 4KQPA 4FEBA 3S9EA 1H45A 4QFLA 4R2BA 1SD3A 3VVFA 2E0SA 1ATGA 1MS7A 2DWIA 5LOMA 4P11A 4EUOA 4FATA 3VDFA 4EQ9A 4RJZA 1NFTA 1A54A 1USYH 3MJNA 4ESXA 4EDPA 5JEIA 5DVFA 1FTKA 1IZ1A 1N84A 2AL4A 4NEDA 1EU8A 3Q29A 1GTKA 4PQJA 5DEXB 5CI5A 4K3FA 2XXYA 4GLIA 3KBRA 1B5HA 3M3KA 1BKAA 3TTMA 4YU0A 1EZPA 4NF6B 2D21A 1Y3PA 3KSJA 3TTKA 1EZ9A 5BUUA 4KR5A 1LGBC 1JNFA 4R9FA 3QK6A 1MQHA 4N6PA 1SBPA 3QIMA 2UXAA 3IO6A 2QS2A 3UORA 4WKMA 3CIJA 4ZE8A 2QS4A 2R6GE 3QUFA 5CC2A 1D9YA 3EHSA 1CE2A 1IEJA 5L9OA 4R6YA 3T93B 3MBPA 4FIMA 4L17A 2RC9A 2OBGA 5AA2D 1GV8A 3SEXA 2B65A 1LAGE 4DLDA 5F7VA 2UYFA 1US5A 3TTNA 1ZIUA 3OXNA 2I3WA 1B51A 3H6TA 5H8HA 2VOZA 1S7YA 5EYFA 1R6ZA 3S9NC 1RKMA 4R9GA 4F3BA 1UQWA 1FQCA 3SEYA 4IY6A 2ESNA 2XXQA 3U92A 2O84X 1MPDA 3N94A 3T9HB 2Z8EA 1NNPA 4KHZE 2I6EA 4U4SA 3CR9A 5B7DA 3BBRA 3HO7A 4OMBA 1XS5A 1P1QA 3KZGA 5I56B 3RT6B 3PUWE 3DM0A 3IORA 5J1DA 1N3XA 3A3CA 3DP8A 2I58A 3MUQA 4IY5A 1T0KA 2DVZA 3PUXE 1YCJA 4UACA 3FJMA 4F19A 4OXVA 4F3SA 3R26A 3K4UA 2DP8A 1OLAA 4ZEDA 4NF5B 2RINA 2HEUA 1Y20A 1WVJA 3MQ9A 1B7HA 4H5FA 3ZSFA 1AL3A 2FYIA 4AB5A 1OVTA 3U93A 1LFHA 2I0CA 1B5JA 1OQHA 2V25A 4NWCA 3TQLA 1SW1A 4MLVA 5I57B 3FVKA 2PX1A 4KYDA 1N3WA 2Y7IA 3GZGA 3TCHA 1MY0A 3T22A 1HSJA 2ZNUA 4ESWA 1N0TA 2P1SA 2DE4A 4F29A 2NUVA 3PMWA 4LQ5A 5FHMA 4I62A 4BLAA 3MVZA 4F31B 1URGA 1N04A 1ZTYA 1MG1A 4QFKA 2V84A 5DVJA 3FGSA 5AA3A 2A5TA 3FXRA 1AIVA 2DXYA 1ZMGA 3C4MA 3HV1A 4RPNA 2R71A 1FTOA 3TPAA 2Q8JA 1JW4A 3O97A 1N7WA 1IITA 3MPKA 1IQ7A 2DWHA 2XXIA 1LLSA 3H3GA 2F7BA 4G8MA 1SI1A 2Q2CA 5A5XA 4QFNA 1LAFE 4FJPA 3A09A 3UGWA 1B32A 1OVBA 1QKAA 5H8NA 1ZBMA 5H8QB 3W9WA 1B4ZA 4MH5A 2HQ0A 3A3UA 1TXFA 3RN8A 3CI8A 4RXLA 1B2HA 3OO7A 4X9TA 4KYSA 4EXLA 1NH8A 3VLVA 1PBQA 4RY1A 1VR5A 1R1NA 5TU0A 4H67A 2QMWA 1LFIA 1ELJA 1H76A 1NNKA 2RF1A 4TQUQ 1M5FA 5ITOA 3O29A 3CSGA 1NL5A 3OENA 4YKPA 3C34A 3B6TA 5JTYB 3K6WA 1A40A 1JVXA 1D9VA 1MY1A 2Q9TA 2FA7A 3CSBA 1NKXA 1FTLA 5M2VA 4DXUA 1SDXA 4OEVA 3AXFA 3K6XA 5KCJA 1P99A 2XXWA 5TP9B 1MXVA 1S9TA 3FVNA 1DOTA 5KDTA 1UTBA 2Z8FA 2QS1A 3D4GA 4DXCA 1OMPA 4EXKA 4JBZA 1TWYA 4HCWA 1SYHA 1GR2A 5HPQA 5ISUA 1N7XA 5TPAB 1B1HA 1MQDA 3H6VA 2ZNSA 3DP6A 3IB1A 3MC2A 3PMVA 3MPLA 2F35A 3HN0A 3N6TA 3O6IA 3FIRA 1MXZA 5AA2A 2O51A 4BDLA 1Q35A 3P7IA 2OK2A 3WAEA 3E13X 1GVCA 2DXRA 5H8FA 4NMYA 4OEUA 2ONRA 4R73A 3FV2A 4QF9A 2GFEA 3G3FA 3SEWA 5DYHA 1R9LA 2G93A 4KCCA 5CMMA 2ALUA 3O6HA 2PT1A 4THIA 3TYHA 1Y4TA 4RNSA 3ZKKA 4GFRA 4G77A 5AA1A 3L6GA 4P0IA 3HSTA 3LC8A 5I59B 4GD5A 3IAZA 4DDDA 3S4UA 1LCFA 2RC8A 4C1UA 3ILUB 3H4ZA 2XXTA 4IB2A 4ZEFA 1D4NA 3KSXA 3E3KA 4KI0E 4O3CA 2O6AA 1NNFA 4F1VA 1FQDA 4ZEBA 4R6KA 1NMUA 4U23A 1TT1A 1B3GA 2DVCA 1LBCA 4NWDA 1Y4CA 2Y84A 1I69A 2O68A 2UVHA 1DTGA 2E1SA 4C0RA 4N07A 2OZZA 3O66A 4HS7A 3ILTB 4EQBA 4LA9A 3SEVA 4OWDA 3K01A 2RCAA 4G4PA 5L8DA 2XXPA 5K2XA 3THIA 2O1LA 3LSLA 1UTHB 3V83A 1NNTA 3U94A 2THIA 1IXHA 1POTA 3MAMA 3U1OA 2DWJA 3N26A 4PFYA 3Q27A 2F36A 2LAOA 1FCKA 2V3QA 1JW1A 2H25A 4YMAA 1QW0A 2ZYNA 1B58A 1B40A 4YKKA 4JDFA 3IOTA 1Y3NA 3FVOA 2I4BA 3E4RA 1YPNA 2Y7WA 1XVXA 3JV9A 3TTRA 1FQFA 4HCYA 1BIYA 3SESA 2X26A 2XX7A 3HHGA 1PDAA 1MPCA 1Y1MA 5CMBA 2XXHA 3IX1A 4RK2A 1YTVA 1URSA 1B3HA 1DPPA 3MW0A 4QSCA 2XD3A 3EPEA 4I9DA 2F6GA 3JYRA 4NF4A 4LVQA 1B05A 1XC1A 2M8CA 4F3GA 2PMSA 2HFBA 1P1WA 3TCGA 4ZEIA 5I58A 3R7XA 1H44A 1QKBA 4U21A 1II5A 4OFOA 4IO6A 1IXIA 2UVGA 1LBBA 4PFWA 3FD3A 3IK6B 3O2AA 1AMFA 4NF8A 3ZS6A 2UVIA 4BDOA 3C32A 1SYIA 3CFLA 3ECRA 1FQAA 1MXYA 1YAEA 3CVGA 3C31A 2QSXA 4IGRA 3B6QA 2PVUA 1A8FA 5I2NA 3HHFA 3BFTA 4ZE9A 1B6HA 1MQGA 4IO4A 2H9BA 4JSOA 2DWAA 4DZ1A 3FJGA 3SERA 4EQ7A 1NH7A 3Q25A 4JSDA 4JWXA 5AA4B 5AE4A 2DSFA 4FE8A 3LSFB 2D3IA 1CB6A 1MQIA 1MY2A 2VGQA 3PU5A 4JWYA 3VV5A 2H5YA 3CFXA 4PFTA 1LCTA 1VFDA 4OVJA 2F7CA 3K1PA 5EHMA 2XD2A 5L9SA 4GXSB 2YLNA 1MY4A 4ELOA 4OFJA 2OWTA 3CG3A 4GQOA 2OJTA 3MZ1A 4R6HA 4RPOA 3T9VA 2XXXA 4OENA 2AIXA 3TZAA 1WODA 3CFZA 4IO2A 4F18A 3OO8A 3U72A 5FTIA 4KYEA 2AL5A 4UA8A 3B6WA 5I2KB 2I49A 4GF8A 4G68C 4Q0CA 1F9BA 2RKMA 2KLFA 3EQ1A 4EF2A 3IB0A 2YJPA 3FJ7A 3VXCA 4G68B 4PFUA 1D3KA 4NE4A 4Z7EA 4C1TA 5DEXA 3ODBA 3ZKLA 1IXCA 2PBWA 3UP9A 4F22A 4O3AA 4LP2B 2NVUB 2DOJA 4AQ4A 1OLCA 2I48A 1O7TA 1PBPA 4U1ZA 1QVSA 1Y3QA 3FZVA 3I5OA 3RT8A 4NF6A 3KJTA 3N5LA 4QSDA 4XXUA 3UK4A 4ECFA 2F78A 3K1MA 2G29A 3QSLA 4RA1A 2W7YA 2GH9A 4ELPA 1QUJA 2UVJA 4AB6A 1M5DA 1M5CA 3I3VA 4BDQA 3OSRA 4XKQA 3F11A 2H99A 3WAFA 1PB7A 4GWOA 1Y9UA 4POXA 1VFEA 1P1UA 3PMXA 5H8SA 3MVXA 4R2FA 2R9JA 1Y1ZA 3CRBA 3T9UA 3LSWA 1LSTA 2ONSA 2ZYKA 3JZJA 2P0SA 1M5EA 4ZDMA 4OQOA 4E0XA 5I84A 5F1QA 4OZ9A 1MH3A 2REGA 2AYSA 3K2DA 1MRPA 4Q30B 1N76A 2HCAA 4F1UA 3RUMA 1BP5A 3T96B 3BFUA 3TFLA 2F7AA 4YB7A 4YKJA 2QL3A 4YZZA 4RYAA 2NXOA 4GL8A 3S9MC 5K2YA 1M5BA 3KN8A 1XVYA 2Y7PA 4YKIA 3MZBA 3PPQA 1QULA 3PUVE 3IB2A 2VD3A 2V3TA 3OO6A 1RYXA 5H8HB 4YICA 5ICTA 4H0WA 4QRZA 1FW0A 4KCDA 5I56A 1US4A 3T66A 1USYE 2D5WA 4JWOA 3UIFA 3G7WA 3DP4A 4N13A 3V5AA 5CRYA 4GVOA 2HZKA 1B7UA 1SW4A 3IO4A 4JB7A 1DSNA 4ZZAA 3D4CA 2A5SA 3VVEA 3K02A 3V89B 3TCFA 2OCUA 3PUZE 4GRKA 4NF5A 4Q5TA 2ZYOA 2QRYA 2PYYA 4OERA 3KOTA 3BKIB 4H6DA 4HW8A 3HPIA 1IUDA 3OELA 5CM6A 4KPTA 3QXMA 4Q8RA 1LAHE 2DS9A 3KJ7A 3GBAA 4F2QA 3MZ9A 2B3FA 1AH5A 4RK9A 3FVGA 3KEIA 4H8IA 2Q89A 4XKPA 4P0GA 1LB9A 2DYXA 3S2VA 1UIUA 2F34A 1MDQA 2P2AA 5I57A 3OMBA 2O69A 1URDA 1DMBA 5ICQA 4WEDA 4H8JA 5IAIA
chains in the Genus database with same CATH superfamily
4OHNA 4F3PA 3K6VA 4E0WA 1B3LA 4YMBA 3L6HA 3UA8A 1JEVA 1EH3A 2I3VA 4M1VA 1B7ZA 1TFAA 4BDRA 5FTHA 4G68A 1QUKA 3PPRA 3MVWA 1Z7NE 5JK4A 2CZIA 2RCBA 3OOAA 4GOTA 3RNNA 4TOZA 4PETA 2JJKA 2Z22A 4O3BA 5CMKA 1B3FA 4OVTA 4FAJA 3O6GA 1IMDA 4MMPA 1VE4A 2VHAA 1WDNA 3ONMA 3RTFB 1B9JA 1PB8A 2F8DA 2FBPA 4U4XA 3R6UA 4ZS9A 3U8QA 2OWZA 1SI0A 3MP8A 1B3EA 3M3LA 4F1YA 4GWYA 3G3KA 3SETA 4AS5A 3I6VA 2A5TB 1PB9A 2HZLA 1SW5A 4POWA 4PTKA 3PPPA 4U2RA 3OEKA 5H8QA 3C33A 3FXQA 4FECA 5ITPA 5DTBA 4M4GA 3M3FA 5DVIA 2X7QA 2QMXA 1FJ6A 4DI4B 1LBVA 1B52A 1OIBA 1OQGA 2XHDA 3TODA 4PGPA 1MXWA 3H06B 4OESA 3KGCA 4IO3A 4LUBA 2O7IA 2R8TA 5A5XB 3KN7A 4ZECA 4LZ5A 1FTMA 1GGGA 1B4HA 3IJXB 4FBPA 2O7UA 1PEBA 3KFMA 3MP6A 5H8NB 5JTYA 4JVIA 3FXBA 4BDNA 3SDFA 4GWWA 2XXVA 1XI6A 4P9KA 1FTJA 1JQFA 2CMOA 2XXRA 2HPGA 3S9LC 4XKRA 3G3HA 2XX8A 3IJOB 4PF6A 2GHAA 2OWSA 5IZ3B 1XOCA 1B5IA 3QUJA 2Q2AA 3VXBA 3O9PA 3HCQA 3FXUA 5TP9A 3DLNA 1B0LA 1UIVA 2ABHA 3PGFA 1IMBA 3VLWA 1S50A 1MPBA 3PD9A 2FIXA 1JVYA 1H43A 3EHTA 4U1OA 4I1DA 4ELRA 3PUYE 2OLBA 3QAXA 1XT8A 4GIZA 3RY3A 2XWIA 5TPAA 2F5XA 5DT6A 1NV2A 4OETA 4FORA 4MNIA 3H6WA 1VSOA 5KCJB 3IOUA 1SQYA 4MLQA 4XIGQ 4H45A 5HBCA 4X1BA 1JETA 3EN3A 4DE8A 1QJMA 2O1MA 1JEUA 3PD8A 1MY3A 1I6QA 2NWJA 3K0VA 4ND9A 2UYEA 5KDTB 1FQEA 1ANFA 1UTBB 1TFDA 2F97A 3Q26A 1BTJA 4MBPA 3TDJA 4WXJA 3H7MA 1MH4A 1IIWA 3TELA 3PTYA 3FATA 4ZEKA 1G0HA 4G8HA 1B1XA 1YZ0A 4OFLA 1Z7ME 4EF1A 1KA0A 2XXUA 2QS3A 2XWOA 4QFPA 4P8BA 2REJA 5DW8A 4NN3A 4OVRA 2YPNA 1QGXA 4QXDA 1O64A 2CZLA 3C35A 3DELB 3IL1B 3SKPA 4DCYA 3FASA 3KN3A 5AA2B 1FQBA 2BJJX 4IO7A 5BWJA 2HXWA 2X7PA 2Q88A 4TLMB 4UABA 1MM6A 1MDP1 4ELQA 2Q8MA 2KR0A 4NTLA 2ZXTA 3W9VA 3IOWA 4G61A 3G3GA 3QYTA 5I59A 2V3UA 3B7DA 5B70A 5H8FB 3OEMA 3MWBA 1FPLA 1ZKBA 1MXUA 1HSEA 2HAUA 4XFEA 1L5TA 2PT2A 3EHUA 3MSTA 4LATA 2FNCA 4GBWA 4DIGA 1A55A 3GBBA 3EF7A 4IO5A 2WKYA 4X48A 4R72A 3FUZA 3E78A 4N81A 5IZ1A 1JP4A 1LAXA 3RLFE 4PDDA 4R75A 3OD7A 3VFJA 1FBGA 1NV4A 1EYKA 1O63A 3VLUA 4P1LA 3RPWA 3TEPA 2H98A 2WX9A 4TLLB 4YB6A 4XKNA 4MF3A 4OVSA 4LONB 3K6UA 2B4MA 3H6UA 1UTHA 1KWHA 4YB5A 3T9XB 1DPEA 1J1NA 5I3SA 4KD5A 4F2OA 1I6AA 4H65A 3TUSA 4LQ2A 4GX4A 2PFYA 2XWVA 3MP1A 1DTZA 2CZHA 3LR1A 1LBXA 3LUYA 3VE1B 4QHQA 4F39A 4X1DA 4P56A 1B0HA 2IEEA 4H1XA 4FEDA 4ISUA 4BDMA 1FJ9A 4P1EA 2VD2A 4XTCQ 5CBRA 3RTWB 1ZU0A 1H3DA 5FHOA 1AWBA 3M8UA 2WEFA 1XHYA 2IA4A 2ONKE 1JW5A 3K00A 1A8EA 4KFQA 5EQAA 3VVDA 4NAPA 2H4IA 4MFIA 4OA4A 5HM4B 1MQJA 3N6UA 1QUIA 2MKZA 3GXAA 4R74A 1A99A 3TKDA 1EZOA 3SEUA 3Q28A 4QSEA 1AOVA 1IMFA 3TAJA 4DCXA 3K1NA 4G8NA 1SW2A 3TQWA 3KOSA 4ZZEA 4U22A 5EQ7A 3V8XB 4MCOA 5EHSA 2ANJA 3U65A 3G3IA 4IGTA 3RQTA 1IXGA 1MM7A 4PC9A 3W15C 1P1OA 4I8CA 2DE2A 1P1NA 1A7LA 3OO9A 4OTEA 4NF4B 1SVXB 4PP0A 2NOOA 2Y7RA 2HAVA 4QBAA 2ZYMA 1LFGA 1R9QA 4LZ8A 5ELVA 1NI9A 5I58B 1DBZA 3GLBA 4DXBA 3OSQA 4HTGA 2GRVA 4GXAA 1HSLA 2VP1A 5CBSA 2Z23A 4Z0IA 3FV1A 4NF8B 2ZMBA 5KZTA 2KQZA 4PAIA 2QJEA 2RC7A 4WEPA 1NUWA 1BLFA 1Q1KA 1B46A 1FBEA 4GL0A 3USDA 2XX9A 3PPOA 3MYUA 2F6PA 5AA4A 2DQVA 2B3BA 1MXXA 3LBSA 1LB8A 3KG2A 5I2NB 1YYZA 1I6BA 1PC3A 3E9XA 4ONYA 4JXIA 1ZJLA 5CMCA 5IKBA 1EYIA 2GHBA 2Y7KA 3MVYA 4OYVA 4QFOA 2I4CA 3C9HA 4GBVA 4MNCA 1POY1 2I0BA 2QPQA 3LSXA 3TMGA 1FPKA 4G2ZA 1RYOA 4MHFA 3UN6A 4LZ7A 5L9MA 1FPGA 3IOVA 3CG1A 5I2KA 3C36A 2DE3A 4YAHX 3O28A 4H5GA 1ZLQA 5FHNA 3RGYA 3TTLA 3G3JA 3PPNA 4PE5B 3IR1A 2V93A 3PV0E 3H03A 2Z8DA 2ZNTA 4GWUA 4KQPA 4FEBA 3S9EA 1H45A 4QFLA 2VPOA 3BIHA 4R2BA 1SD3A 3VVFA 2E0SA 1ATGA 1MS7A 4N8GA 2DWIA 5LOMA 4O7IA 4P11A 4EUOA 4FATA 3VDFA 4EQ9A 4RJZA 1NFTA 1A54A 4PAKA 1USYH 3MJNA 4ESXA 4EDPA 3RPLB 5JEIA 5DVFA 1FTKA 1IZ1A 1N84A 2AL4A 4NEDA 1EU8A 3Q29A 2V4CA 1GTKA 4PQJA 5DEXB 5CI5A 4K3FA 2XXYA 4GLIA 3KBRA 1B5HA 4MEVA 3M3KA 1BKAA 3TTMA 4YU0A 1EZPA 4NF6B 2D21A 1Y3PA 3KSJA 3TTKA 1EZ9A 5BUUA 4KR5A 1LGBC 1JNFA 4R9FA 3QK6A 1MQHA 4N6PA 1SBPA 3QIMA 2UXAA 3IO6A 2QS2A 3UORA 4WKMA 3CIJA 4NHBA 4ZE8A 2QS4A 2R6GE 3QUFA 5CC2A 1D9YA 3EHSA 2PCRA 1CE2A 1Q9DA 1IEJA 5L9OA 4R6YA 3T93B 4PAFA 3MBPA 4FIMA 4L17A 4GWSA 2RC9A 2OBGA 5AA2D 1GV8A 3SEXA 2B65A 1LAGE 4DLDA 4MJOA 5F7VA 2QVUA 2UYFA 1US5A 3TTNA 1ZIUA 3OXNA 2I3WA 1B51A 3H6TA 5H8HA 2CEYA 2VOZA 1FPEA 1S7YA 5EYFA 1LBWA 1R6ZA 3S9NC 1RKMA 4R9GA 4F3BA 1UQWA 1FQCA 3SEYA 4IY6A 2ESNA 2XXQA 3U92A 2O84X 4O8MA 1MPDA 3KC0A 3N94A 3T9HB 4MX6A 2Z8EA 1NNPA 4KHZE 2I6EA 4U4SA 3CR9A 5B7DA 3BBRA 3HO7A 3EKIA 3ROJA 4OMBA 1XS5A 1P1QA 3KZGA 5I56B 1FPFA 3RT6B 3PUWE 3DM0A 3IORA 5J1DA 1N3XA 3A3CA 3DP8A 2I58A 3MUQA 3BIGA 1KA1A 4IY5A 1T0KA 2DVZA 3PUXE 1YCJA 4N91A 4UACA 3FJMA 4F19A 4OXVA 4MNPA 4F3SA 3R26A 2ZZXA 3K4UA 4I40A 2DP8A 1OLAA 4ZEDA 4X04A 4NF5B 2RINA 2XXKA 2HEUA 1Y20A 4MIJA 1G0IA 1WVJA 3MQ9A 5T3JA 1B7HA 4H5FA 3ZSFA 1AL3A 2FYIA 4AB5A 1YXIA 1OVTA 3GYYA 3U93A 1LFHA 2I0CA 1B5JA 1OQHA 2V25A 4NWCA 3TQLA 1D9QA 4I3YA 1SW1A 4MLVA 5I57B 4GX3A 4P47A 2HXRA 3FVKA 2PX1A 4KYDA 1N3WA 4N15A 2Y7IA 3GZGA 3TCHA 1MY0A 3T22A 1HSJA 1NV1A 2ZNUA 4I3EA 4ESWA 1N0TA 2P1SA 2DE4A 4F29A 2NUVA 3PMWA 4LQ5A 5FHMA 4I62A 2L5VA 4BLAA 2WYKA 3MVZA 4F31B 1URGA 2WBBA 1N04A 1ZTYA 1LBZA 1MG1A 4QFKA 2V84A 5DVJA 3FGSA 5AA3A 2A5TA 3FXRA 1AIVA 2DXYA 1ZMGA 3C4MA 3HV1A 4RPNA 2R71A 1FTOA 3TPAA 4PCDA 2Q8JA 4NGUA 5I7IA 1JW4A 3O97A 4N6KA 1N7WA 4N8YA 1IITA 3MPKA 1IQ7A 2DWHA 2XXIA 1LLSA 2HHMA 3H3GA 2F7BA 4G8MA 1SI1A 5IM2A 2Q2CA 5A5XA 4QFNA 1LAFE 4FJPA 3A09A 2VT5A 3UGWA 1B32A 1OVBA 1QKAA 5H8NA 1ZBMA 4IR8A 5H8QB 3W9WA 1B4ZA 4MH5A 2HQ0A 3A3UA 1TXFA 3RN8A 3CI8A 4RXLA 1B2HA 3KC1A 3OO7A 4X9TA 4KYSA 4EXLA 1NH8A 3VLVA 5IZ3A 1PBQA 4RY1A 1VR5A 4XF5A 1R1NA 5TU0A 3T0JA 4H67A 2QMWA 1LFIA 1ELJA 1H76A 1NNKA 1NUXA 2RF1A 4TQUQ 1M5FA 4OANA 5ITOA 3O29A 3CSGA 5IZZA 1NL5A 3OENA 4YKPA 3C34A 3B6TA 5JTYB 3K6WA 1A40A 1JVXA 1D9VA 1MY1A 2Q9TA 2FA7A 3CSBA 1NKXA 1FPDA 1FTLA 5M2VA 4DXUA 1SDXA 4OEVA 1DCUA 3AXFA 3K6XA 4PFRA 5KCJA 1P99A 2XXWA 2ZZWA 5TP9B 1MXVA 4DI3D 1S9TA 2FIEA 3FVNA 1DOTA 5KDTA 3E79A 1UTBA 2Z8FA 2QS1A 3D4GA 4GWZA 4DXCA 3T1BA 1OMPA 4EXKA 4JBZA 1TWYA 4NX1A 4HCWA 1RDYA 4PGNA 1SYHA 5FBPA 1GR2A 4XEQA 5HPQA 5ISUA 1N7XA 5TPAB 1B1HA 1MQDA 3H6VA 1NUYA 2ZNSA 3DP6A 4OVQA 2P3NA 1FBCA 3IB1A 3MC2A 3PMVA 3MPLA 2F35A 3HN0A 3N6TA 3O6IA 3FIRA 1MXZA 5AA2A 2O51A 4BDLA 1FPJA 1Q35A 3P7IA 2OK2A 3WAEA 3E13X 5LTCA 1EYJA 1GVCA 2DXRA 5H8FA 4NMYA 4OEUA 2ONRA 4R73A 3FV2A 4PFBA 4QF9A 2GFEA 3G3FA 3SEWA 5DYHA 1R9LA 2G93A 4KCCA 5CMMA 2ALUA 3O6HA 2PT1A 4THIA 1IMCA 3TYHA 1Y4TA 4RNSA 3ZKKA 4GFRA 4G77A 5EYHA 2QVVA 5AA1A 3L6GA 4P0IA 3HSTA 3LC8A 3HFUA 5I59B 4GD5A 3IAZA 4DDDA 3S4UA 1LCFA 2RC8A 4C1UA 3ILUB 1KZ8A 3H4ZA 2XXTA 4IB2A 4ZEFA 1D4NA 3KSXA 3E3KA 1FBFA 4KI0E 4O3CA 2O6AA 5A5LA 1NNFA 4F1VA 1FQDA 4ZEBA 4R6KA 1NMUA 4U23A 1TT1A 1B3GA 2DVCA 1NV7A 3KBZA 1LBCA 4NWDA 1Y4CA 2Y84A 1I69A 2O68A 2UVHA 1DTGA 2E1SA 4C0RA 4N07A 2OZZA 3O66A 3FBPA 1NV6A 4HS7A 3ILTB 4EQBA 4LA9A 3SEVA 4OWDA 3K01A 2RCAA 4G4PA 5L8DA 2XXPA 5K2XA 3THIA 2O1LA 3LSLA 1UTHB 3V83A 1NNTA 3U94A 5I5PA 2THIA 1IXHA 1POTA 3MAMA 3U1OA 2WBDA 2DWJA 3N26A 2B4LA 4PFYA 3Q27A 4GWXA 4MAGA 2F36A 2LAOA 1FBPA 1FCKA 1JW1A 2H25A 2V3QA 4YMAA 1QW0A 2ZYNA 1B58A 1B40A 4YKKA 4JDFA 3IOTA 1Y3NA 3FVOA 2I4BA 3E4RA 1IMAA 1YPNA 1FRPA 2Y7WA 1XVXA 3JV9A 3TTRA 1FQFA 4HCYA 2Q74A 1BIYA 3SESA 2X26A 2XX7A 4X8RA 3HHGA 1NV0A 1LBYA 1PDAA 1MPCA 1Y1MA 5CMBA 4PE3A 5ESYA 2XXHA 3IX1A 4PFIA 4RK2A 1YTVA 1URSA 2FVZA 1B3HA 1DPPA 3MW0A 4QSCA 2XD3A 3EPEA 4I9DA 2F6GA 3JYRA 4NF4A 4LVQA 5EQ9A 1B05A 1XC1A 2M8CA 4F3GA 2PMSA 2HFBA 1NV3A 4PF8A 1P1WA 3TCGA 4ZEIA 5I58A 3R7XA 1H44A 1QKBA 4U21A 1II5A 4OFOA 4IO6A 1IXIA 2QFLA 2UVGA 1LBBA 4PFWA 3FD3A 3IK6B 3O2AA 1AMFA 4NF8A 3ZS6A 2UVIA 4BDOA 3C32A 2Y5KA 1SYIA 3CFLA 3ECRA 1FQAA 1MXYA 1RDZA 1YAEA 3CVGA 3C31A 2QSXA 4IGRA 1SPIA 3B6QA 2PVUA 1CNQA 1A8FA 5I2NA 3HHFA 3BFTA 4ZE9A 1B6HA 2DDKA 1MQGA 4IO4A 2H9BA 4JSOA 4NF0A 3SZPA 2DWAA 4DZ1A 3FJGA 3SERA 2F3BA 4EQ7A 1NH7A 3Q25A 1K9ZA 4JSDA 4JWXA 5AA4B 5AE4A 2DSFA 4FE8A 3LSFB 2D3IA 1CB6A 1MQIA 1MY2A 2VGQA 3PU5A 4JWYA 3VV5A 2H5YA 3CFXA 4PFTA 1LCTA 1VFDA 4OVJA 2F7CA 2CZKA 3K1PA 2XA5A 2WYPA 4N17A 3LUZA 2XD2A 5EHMA 5L9SA 4GXSB 2YLNA 1MY4A 4ELOA 4OFJA 2OWTA 3CG3A 4GQOA 2OJTA 3MZ1A 4R6HA 4RPOA 3T9VA 1NUZA 1FPIA 2XXXA 4OENA 2AIXA 3TZAA 1WODA 3CFZA 1DK4A 4IO2A 4F18A 3OO8A 3U72A 5FTIA 2CEXA 4P3LA 4KYEA 2AL5A 4UA8A 3B6WA 5I2KB 2I49A 3NOHA 4HXVA 4LN5A 5F24A 4GF8A 4G68C 4Q0CA 1F9BA 4KXPA 2RKMA 2KLFA 5ET5A 3RPLA 3EQ1A 2VPNA 4EF2A 2XWKA 3IB0A 2YJPA 3FJ7A 2OX3A 3VXCA 4G68B 4PFUA 1D3KA 4NE4A 4Z7EA 4C1TA 5DEXA 3ODBA 3ZKLA 1FBHA 1IXCA 2PBWA 3UP9A 4F22A 4O3AA 4LP2B 2NVUB 2DOJA 4AQ4A 1OLCA 2I48A 1O7TA 1PBPA 4JVDA 4U1ZA 1QVSA 1Y3QA 3FZVA 3I5OA 3RT8A 2P3VA 4NF6A 3KJTA 3N5LA 4QSDA 4XXUA 3UK4A 2F78A 3K1MA 3QSLA 2G29A 4ECFA 4GX6A 4RA1A 2W7YA 2GH9A 4ELPA 1QUJA 2UVJA 4PBQA 4AB6A 1M5DA 2F3DA 1M5CA 3I3VA 4BDQA 5EQ8A 1BK4A 3OSRA 4XKQA 3F11A 2H99A 3WAFA 1PB7A 4HE0A 4GWOA 1Y9UA 4POXA 1VFEA 5ET7A 1P1UA 3PMXA 5H8SA 5IGAA 2GQ1A 3MVXA 3IFAA 4R2FA 2R9JA 1Y1ZA 5LDZA 2ZZVA 3CRBA 3T9UA 1FSAA 3LSWA 1LSTA 2QVRA 2ONSA 4PDHA 2ZYKA 3JZJA 3RYDA 1INPA 2P0SA 1M5EA 4ZDMA 4OQOA 4E0XA 5I84A 5F1QA 4OZ9A 4N6DA 1MH3A 2REGA 1FBDA 2AYSA 3K2DA 1MRPA 4Q30B 1N76A 2HCAA 4F1UA 3RUMA 1BP5A 1RDXA 4NQ8A 3T96B 3BFUA 3TFLA 2F7AA 4YB7A 3D1RA 3ISPA 4YKJA 2QL3A 1FTAA 4YZZA 4RYAA 2NXOA 4GL8A 3S9MC 5K2YA 1M5BA 3KN8A 1XVYA 2Y7PA 4YKIA 2PFZA 3MZBA 3PPQA 1QULA 3PUVE 3IB2A 5ET6A 3A29A 3QMFA 2VD3A 2V3TA 1K9YA 2FHYA 1VDWA 3OO6A 4HE2A 1RYXA 5H8HB 4YICA 5ICTA 4H0WA 4QRZA 1FW0A 4H46A 4KCDA 5I56A 1US4A 3T66A 1USYE 2D5WA 4JWOA 3UIFA 3G7WA 5ET8A 3DP4A 4N13A 3B50A 3V5AA 5CRYA 2Y5LA 4GVOA 4OVPA 2HZKA 1B7UA 1LEVA 1SW4A 3IO4A 4JB7A 1DSNA 4ZZAA 3D4CA 2A5SA 3VVEA 3K02A 3V89B 3TCFA 2OCUA 3PUZE 3LV0A 4GRKA 4NF5A 4Q5TA 2ZYOA 2QRYA 4N4UA 2PYYA 4PBHA 4OERA 3KOTA 3BKIB 4H6DA 4HW8A 3HPIA 1IUDA 1IMEA 3OELA 5CM6A 4KPTA 3QXMA 4Q8RA 1LAHE 3CHGA 2DS9A 5EYGA 4NG7A 4HE1A 3KJ7A 3GBAA 4F2QA 3MZ9A 2B3FA 1AH5A 4JVCA 4RK9A 4O94A 3FVGA 3KEIA 4H8IA 3IFCA 2Q89A 4XKPA 4P0GA 1FPBA 1LB9A 2DYXA 3S2VA 1UIUA 2F34A 1MDQA 2P2AA 5I57A 3OMBA 1NV5A 2O69A 5J16A 1URDA 1DMBA 5ICQA 4AS4A 2BJIA 4WEDA 4O7MA 4H8JA 3B8BA 5IAIA
chains in the Genus database with same CATH topology
4OHNA 4F3PA 3K6VA 4E0WA 1B3LA 4YMBA 3L6HA 3UA8A 1JEVA 1EH3A 2I3VA 4M1VA 1B7ZA 1TFAA 4BDRA 5FTHA 4G68A 1QUKA 3PPRA 3MVWA 1Z7NE 5JK4A 2RCBA 3OOAA 4GOTA 3RNNA 4TOZA 4PETA 2Z22A 4O3BA 5CMKA 1B3FA 4FAJA 3O6GA 1VE4A 2VHAA 1WDNA 3ONMA 3RTFB 1B9JA 1PB8A 2F8DA 4U4XA 3R6UA 4ZS9A 3U8QA 3MP8A 1SI0A 1B3EA 3M3LA 4F1YA 3G3KA 3SETA 3I6VA 2A5TB 1PB9A 2HZLA 1SW5A 4POWA 3PPPA 4U2RA 3OEKA 5H8QA 3C33A 3FXQA 4FECA 5ITPA 5DTBA 4M4GA 3M3FA 5DVIA 2X7QA 2QMXA 1B52A 1OIBA 1OQGA 2XHDA 3TODA 1MXWA 3H06B 4OESA 3KGCA 4IO3A 4LUBA 2O7IA 5A5XB 3KN7A 4ZECA 4LZ5A 1FTMA 1GGGA 1B4HA 3IJXB 2O7UA 1PEBA 3KFMA 3MP6A 5H8NB 5JTYA 4BDNA 3SDFA 2XXVA 1FTJA 1JQFA 2CMOA 2XXRA 3S9LC 4XKRA 3G3HA 2XX8A 3IJOB 2GHAA 2OWSA 1XOCA 1B5IA 3QUJA 2Q2AA 3VXBA 3O9PA 3HCQA 3FXUA 5TP9A 3DLNA 1B0LA 1UIVA 2ABHA 3PGFA 3VLWA 1S50A 1MPBA 3PD9A 1JVYA 1H43A 3EHTA 4U1OA 4I1DA 4ELRA 3PUYE 2OLBA 3QAXA 1XT8A 4GIZA 3RY3A 5TPAA 2F5XA 5DT6A 4OETA 4FORA 3H6WA 1VSOA 5KCJB 3IOUA 1SQYA 4MLQA 4XIGQ 5HBCA 4X1BA 1JETA 3EN3A 4DE8A 1QJMA 2O1MA 1JEUA 3PD8A 1MY3A 1I6QA 2NWJA 3K0VA 4ND9A 2UYEA 5KDTB 1FQEA 1ANFA 1UTBB 1TFDA 2F97A 3Q26A 1BTJA 4MBPA 3TDJA 4WXJA 3H7MA 1MH4A 1IIWA 3TELA 3FATA 4ZEKA 4G8HA 1B1XA 4OFLA 1Z7ME 4EF1A 2XXUA 2QS3A 4QFPA 2REJA 2YPNA 1O64A 2CZLA 3C35A 3DELB 3IL1B 3SKPA 4DCYA 3FASA 3KN3A 5AA2B 1FQBA 2BJJX 4IO7A 5BWJA 2HXWA 2X7PA 2Q88A 4TLMB 1MM6A 1MDP1 4ELQA 4NTLA 2ZXTA 3W9VA 3IOWA 3G3GA 3QYTA 5I59A 2V3UA 3B7DA 5B70A 5H8FB 3OEMA 3MWBA 1ZKBA 1MXUA 1HSEA 2HAUA 1L5TA 2PT2A 3EHUA 4LATA 2FNCA 4DIGA 1A55A 3GBBA 3EF7A 4IO5A 2WKYA 4X48A 4R72A 3FUZA 1LAXA 3RLFE 4R75A 3OD7A 3VFJA 1O63A 3VLUA 3RPWA 3TEPA 2H98A 4TLLB 4YB6A 4XKNA 4MF3A 4LONB 3K6UA 3H6UA 1UTHA 1KWHA 4YB5A 3T9XB 1DPEA 1J1NA 4KD5A 4F2OA 1I6AA 4H65A 3TUSA 4LQ2A 3MP1A 1DTZA 3LR1A 3LUYA 3VE1B 4QHQA 4F39A 4X1DA 1B0HA 2IEEA 4H1XA 4FEDA 4ISUA 4BDMA 2VD2A 4XTCQ 5CBRA 3RTWB 1ZU0A 1H3DA 5FHOA 3M8UA 1XHYA 2IA4A 2ONKE 1JW5A 3K00A 1A8EA 4KFQA 3VVDA 2H4IA 4MFIA 5HM4B 1MQJA 3N6UA 1QUIA 3GXAA 4R74A 1A99A 3TKDA 1EZOA 3SEUA 3Q28A 4QSEA 1AOVA 3TAJA 4DCXA 3K1NA 4G8NA 1SW2A 3TQWA 3KOSA 4ZZEA 4U22A 3V8XB 5EHSA 2ANJA 3G3IA 4IGTA 3RQTA 1IXGA 1MM7A 3W15C 1P1OA 4I8CA 2DE2A 1P1NA 1A7LA 3OO9A 4OTEA 4NF4B 1SVXB 4PP0A 2NOOA 2Y7RA 2HAVA 2ZYMA 1LFGA 1R9QA 4LZ8A 5ELVA 5I58B 3GLBA 4DXBA 3OSQA 4HTGA 2GRVA 4GXAA 1HSLA 2VP1A 5CBSA 2Z23A 4Z0IA 3FV1A 4NF8B 2ZMBA 5KZTA 2QJEA 2RC7A 4WEPA 1Q1KA 1BLFA 1B46A 4GL0A 3USDA 2XX9A 3PPOA 2F6PA 5AA4A 2DQVA 2B3BA 1MXXA 3LBSA 1LB8A 3KG2A 5I2NB 1I6BA 1PC3A 3E9XA 4ONYA 4JXIA 1ZJLA 5CMCA 5IKBA 2GHBA 2Y7KA 3MVYA 4OYVA 4QFOA 2I4CA 3C9HA 1POY1 2I0BA 2QPQA 3LSXA 3TMGA 4G2ZA 1RYOA 3UN6A 4LZ7A 5L9MA 3IOVA 3CG1A 5I2KA 3C36A 2DE3A 4YAHX 3O28A 3RGYA 1ZLQA 4H5GA 5FHNA 3TTLA 3G3JA 3PPNA 4PE5B 3IR1A 2V93A 3PV0E 3H03A 2Z8DA 2ZNTA 4KQPA 4FEBA 3S9EA 1H45A 4QFLA 4R2BA 1SD3A 3VVFA 2E0SA 1ATGA 1MS7A 2DWIA 5LOMA 4P11A 4EUOA 4FATA 3VDFA 4EQ9A 4RJZA 1NFTA 1A54A 1USYH 3MJNA 4ESXA 4EDPA 5JEIA 5DVFA 1FTKA 1IZ1A 1N84A 2AL4A 4NEDA 1EU8A 3Q29A 1GTKA 4PQJA 5DEXB 5CI5A 4K3FA 2XXYA 4GLIA 3KBRA 1B5HA 3M3KA 1BKAA 3TTMA 4YU0A 1EZPA 4NF6B 2D21A 1Y3PA 3KSJA 3TTKA 1EZ9A 5BUUA 4KR5A 1LGBC 1JNFA 4R9FA 3QK6A 1MQHA 4N6PA 1SBPA 3QIMA 2UXAA 3IO6A 2QS2A 3UORA 4WKMA 3CIJA 4ZE8A 2QS4A 2R6GE 3QUFA 5CC2A 1D9YA 3EHSA 1CE2A 1IEJA 5L9OA 4R6YA 3T93B 3MBPA 4FIMA 4L17A 2RC9A 2OBGA 5AA2D 1GV8A 3SEXA 2B65A 1LAGE 4DLDA 5F7VA 2UYFA 1US5A 3TTNA 1ZIUA 3OXNA 2I3WA 1B51A 3H6TA 5H8HA 2VOZA 1S7YA 5EYFA 1R6ZA 3S9NC 1RKMA 4R9GA 4F3BA 1UQWA 1FQCA 3SEYA 4IY6A 2ESNA 2XXQA 3U92A 2O84X 1MPDA 3N94A 3T9HB 2Z8EA 1NNPA 4KHZE 2I6EA 4U4SA 3CR9A 5B7DA 3BBRA 3HO7A 4OMBA 1XS5A 1P1QA 3KZGA 5I56B 3RT6B 3PUWE 3DM0A 3IORA 5J1DA 1N3XA 3A3CA 3DP8A 2I58A 3MUQA 4IY5A 1T0KA 2DVZA 3PUXE 1YCJA 4UACA 3FJMA 4F19A 4OXVA 4F3SA 3R26A 3K4UA 2DP8A 1OLAA 4ZEDA 4NF5B 2RINA 2HEUA 1Y20A 1WVJA 3MQ9A 1B7HA 4H5FA 3ZSFA 1AL3A 2FYIA 4AB5A 1OVTA 3U93A 1LFHA 2I0CA 1B5JA 1OQHA 2V25A 4NWCA 3TQLA 1SW1A 4MLVA 5I57B 3FVKA 2PX1A 4KYDA 1N3WA 2Y7IA 3GZGA 3TCHA 1MY0A 3T22A 1HSJA 2ZNUA 4ESWA 1N0TA 2P1SA 2DE4A 4F29A 2NUVA 3PMWA 4LQ5A 5FHMA 4I62A 4BLAA 3MVZA 4F31B 1URGA 1N04A 1ZTYA 1MG1A 4QFKA 2V84A 5DVJA 3FGSA 5AA3A 2A5TA 3FXRA 1AIVA 2DXYA 1ZMGA 3C4MA 3HV1A 4RPNA 2R71A 1FTOA 3TPAA 2Q8JA 1JW4A 3O97A 1N7WA 1IITA 3MPKA 1IQ7A 2DWHA 2XXIA 1LLSA 3H3GA 2F7BA 4G8MA 1SI1A 2Q2CA 5A5XA 4QFNA 1LAFE 4FJPA 3A09A 3UGWA 1B32A 1OVBA 1QKAA 5H8NA 1ZBMA 5H8QB 3W9WA 1B4ZA 4MH5A 2HQ0A 3A3UA 1TXFA 3RN8A 3CI8A 4RXLA 1B2HA 3OO7A 4X9TA 4KYSA 4EXLA 1NH8A 3VLVA 1PBQA 4RY1A 1VR5A 1R1NA 5TU0A 4H67A 2QMWA 1LFIA 1ELJA 1H76A 1NNKA 2RF1A 4TQUQ 1M5FA 5ITOA 3O29A 3CSGA 1NL5A 3OENA 4YKPA 3C34A 3B6TA 5JTYB 3K6WA 1A40A 1JVXA 1D9VA 1MY1A 2Q9TA 2FA7A 3CSBA 1NKXA 1FTLA 5M2VA 4DXUA 1SDXA 4OEVA 3AXFA 3K6XA 5KCJA 1P99A 2XXWA 5TP9B 1MXVA 1S9TA 3FVNA 1DOTA 5KDTA 1UTBA 2Z8FA 2QS1A 3D4GA 4DXCA 1OMPA 4EXKA 4JBZA 1TWYA 4HCWA 1SYHA 1GR2A 5HPQA 5ISUA 1N7XA 5TPAB 1B1HA 1MQDA 3H6VA 2ZNSA 3DP6A 3IB1A 3MC2A 3PMVA 3MPLA 2F35A 3HN0A 3N6TA 3O6IA 3FIRA 1MXZA 5AA2A 2O51A 4BDLA 1Q35A 3P7IA 2OK2A 3WAEA 3E13X 1GVCA 2DXRA 5H8FA 4NMYA 4OEUA 2ONRA 4R73A 3FV2A 4QF9A 2GFEA 3G3FA 3SEWA 5DYHA 1R9LA 2G93A 4KCCA 5CMMA 2ALUA 3O6HA 2PT1A 4THIA 3TYHA 1Y4TA 4RNSA 3ZKKA 4GFRA 4G77A 5AA1A 3L6GA 4P0IA 3HSTA 3LC8A 5I59B 4GD5A 3IAZA 4DDDA 3S4UA 1LCFA 2RC8A 4C1UA 3ILUB 3H4ZA 2XXTA 4IB2A 4ZEFA 1D4NA 3KSXA 3E3KA 4KI0E 4O3CA 2O6AA 1NNFA 4F1VA 1FQDA 4ZEBA 4R6KA 1NMUA 4U23A 1TT1A 1B3GA 2DVCA 1LBCA 4NWDA 1Y4CA 2Y84A 1I69A 2O68A 2UVHA 1DTGA 2E1SA 4C0RA 4N07A 2OZZA 3O66A 4HS7A 3ILTB 4EQBA 4LA9A 3SEVA 4OWDA 3K01A 2RCAA 4G4PA 5L8DA 2XXPA 5K2XA 3THIA 2O1LA 3LSLA 1UTHB 3V83A 1NNTA 3U94A 2THIA 1IXHA 1POTA 3MAMA 3U1OA 2DWJA 3N26A 4PFYA 3Q27A 2F36A 2LAOA 1FCKA 2V3QA 1JW1A 2H25A 4YMAA 1QW0A 2ZYNA 1B58A 1B40A 4YKKA 4JDFA 3IOTA 1Y3NA 3FVOA 2I4BA 3E4RA 1YPNA 2Y7WA 1XVXA 3JV9A 3TTRA 1FQFA 4HCYA 1BIYA 3SESA 2X26A 2XX7A 3HHGA 1PDAA 1MPCA 1Y1MA 5CMBA 2XXHA 3IX1A 4RK2A 1YTVA 1URSA 1B3HA 1DPPA 3MW0A 4QSCA 2XD3A 3EPEA 4I9DA 2F6GA 3JYRA 4NF4A 4LVQA 1B05A 1XC1A 2M8CA 4F3GA 2PMSA 2HFBA 1P1WA 3TCGA 4ZEIA 5I58A 3R7XA 1H44A 1QKBA 4U21A 1II5A 4OFOA 4IO6A 1IXIA 2UVGA 1LBBA 4PFWA 3FD3A 3IK6B 3O2AA 1AMFA 4NF8A 3ZS6A 2UVIA 4BDOA 3C32A 1SYIA 3CFLA 3ECRA 1FQAA 1MXYA 1YAEA 3CVGA 3C31A 2QSXA 4IGRA 3B6QA 2PVUA 1A8FA 5I2NA 3HHFA 3BFTA 4ZE9A 1B6HA 1MQGA 4IO4A 2H9BA 4JSOA 2DWAA 4DZ1A 3FJGA 3SERA 4EQ7A 1NH7A 3Q25A 4JSDA 4JWXA 5AA4B 5AE4A 2DSFA 4FE8A 3LSFB 2D3IA 1CB6A 1MQIA 1MY2A 2VGQA 3PU5A 4JWYA 3VV5A 2H5YA 3CFXA 4PFTA 1LCTA 1VFDA 4OVJA 2F7CA 3K1PA 5EHMA 2XD2A 5L9SA 4GXSB 2YLNA 1MY4A 4ELOA 4OFJA 2OWTA 3CG3A 4GQOA 2OJTA 3MZ1A 4R6HA 4RPOA 3T9VA 2XXXA 4OENA 2AIXA 3TZAA 1WODA 3CFZA 4IO2A 4F18A 3OO8A 3U72A 5FTIA 4KYEA 2AL5A 4UA8A 3B6WA 5I2KB 2I49A 4GF8A 4G68C 4Q0CA 1F9BA 2RKMA 2KLFA 3EQ1A 4EF2A 3IB0A 2YJPA 3FJ7A 3VXCA 4G68B 4PFUA 1D3KA 4NE4A 4Z7EA 4C1TA 5DEXA 3ODBA 3ZKLA 1IXCA 2PBWA 3UP9A 4F22A 4O3AA 4LP2B 2NVUB 2DOJA 4AQ4A 1OLCA 2I48A 1O7TA 1PBPA 4U1ZA 1QVSA 1Y3QA 3FZVA 3I5OA 3RT8A 4NF6A 3KJTA 3N5LA 4QSDA 4XXUA 3UK4A 4ECFA 2F78A 3K1MA 2G29A 3QSLA 4RA1A 2W7YA 2GH9A 4ELPA 1QUJA 2UVJA 4AB6A 1M5DA 1M5CA 3I3VA 4BDQA 3OSRA 4XKQA 3F11A 2H99A 3WAFA 1PB7A 4GWOA 1Y9UA 4POXA 1VFEA 1P1UA 3PMXA 5H8SA 3MVXA 4R2FA 2R9JA 1Y1ZA 3CRBA 3T9UA 3LSWA 1LSTA 2ONSA 2ZYKA 3JZJA 2P0SA 1M5EA 4ZDMA 4OQOA 4E0XA 5I84A 5F1QA 4OZ9A 1MH3A 2REGA 2AYSA 3K2DA 1MRPA 4Q30B 1N76A 2HCAA 4F1UA 3RUMA 1BP5A 3T96B 3BFUA 3TFLA 2F7AA 4YB7A 4YKJA 2QL3A 4YZZA 4RYAA 2NXOA 4GL8A 3S9MC 5K2YA 1M5BA 3KN8A 1XVYA 2Y7PA 4YKIA 3MZBA 3PPQA 1QULA 3PUVE 3IB2A 2VD3A 2V3TA 3OO6A 1RYXA 5H8HB 4YICA 5ICTA 4H0WA 4QRZA 1FW0A 4KCDA 5I56A 1US4A 3T66A 1USYE 2D5WA 4JWOA 3UIFA 3G7WA 3DP4A 4N13A 3V5AA 5CRYA 4GVOA 2HZKA 1B7UA 1SW4A 3IO4A 4JB7A 1DSNA 4ZZAA 3D4CA 2A5SA 3VVEA 3K02A 3V89B 3TCFA 2OCUA 3PUZE 4GRKA 4NF5A 4Q5TA 2ZYOA 2QRYA 2PYYA 4OERA 3KOTA 3BKIB 4H6DA 4HW8A 3HPIA 1IUDA 3OELA 5CM6A 4KPTA 3QXMA 4Q8RA 1LAHE 2DS9A 3KJ7A 3GBAA 4F2QA 3MZ9A 2B3FA 1AH5A 4RK9A 3FVGA 3KEIA 4H8IA 2Q89A 4XKPA 4P0GA 1LB9A 2DYXA 3S2VA 1UIUA 2F34A 1MDQA 2P2AA 5I57A 3OMBA 2O69A 1URDA 1DMBA 5ICQA 4WEDA 4H8JA 5IAIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OHN A;  4F3P A;  3K6V A;  4E0W A;  1B3L A;  4YMB A;  3L6H A;  3UA8 A;  1JEV A;  1EH3 A;  2I3V A;  4M1V A;  1B7Z A;  1TFA A;  4BDR A;  5FTH A;  4G68 A;  1QUK A;  3PPR A;  3MVW A;  1Z7N E;  5JK4 A;  2RCB A;  3OOA A;  4GOT A;  3RNN A;  4TOZ A;  4PET A;  2Z22 A;  4O3B A;  5CMK A;  1B3F A;  4FAJ A;  3O6G A;  1VE4 A;  2VHA A;  1WDN A;  3ONM A;  3RTF B;  1B9J A;  1PB8 A;  2F8D A;  4U4X A;  3R6U A;  4ZS9 A;  3U8Q A;  3MP8 A;  1SI0 A;  1B3E A;  3M3L A;  4F1Y A;  3G3K A;  3SET A;  3I6V A;  2A5T B;  1PB9 A;  2HZL A;  1SW5 A;  4POW A;  3PPP A;  4U2R A;  3OEK A;  5H8Q A;  3C33 A;  3FXQ A;  4FEC A;  5ITP A;  5DTB A;  4M4G A;  3M3F A;  5DVI A;  2X7Q A;  2QMX A;  1B52 A;  1OIB A;  1OQG A;  2XHD A;  3TOD A;  1MXW A;  3H06 B;  4OES A;  3KGC A;  4IO3 A;  4LUB A;  2O7I A;  5A5X B;  3KN7 A;  4ZEC A;  4LZ5 A;  1FTM A;  1GGG A;  1B4H A;  3IJX B;  2O7U A;  1PEB A;  3KFM A;  3MP6 A;  5H8N B;  5JTY A;  4BDN A;  3SDF A;  2XXV A;  1FTJ A;  1JQF A;  2CMO A;  2XXR A;  3S9L C;  4XKR A;  3G3H A;  2XX8 A;  3IJO B;  2GHA A;  2OWS A;  1XOC A;  1B5I A;  3QUJ A;  2Q2A A;  3VXB A;  3O9P A;  3HCQ A;  3FXU A;  5TP9 A;  3DLN A;  1B0L A;  1UIV A;  2ABH A;  3PGF A;  3VLW A;  1S50 A;  1MPB A;  3PD9 A;  1JVY A;  1H43 A;  3EHT A;  4U1O A;  4I1D A;  4ELR A;  3PUY E;  2OLB A;  3QAX A;  1XT8 A;  4GIZ A;  3RY3 A;  5TPA A;  2F5X A;  5DT6 A;  4OET A;  4FOR A;  3H6W A;  1VSO A;  5KCJ B;  3IOU A;  1SQY A;  4MLQ A;  4XIG Q;  5HBC A;  4X1B A;  1JET A;  3EN3 A;  4DE8 A;  1QJM A;  2O1M A;  1JEU A;  3PD8 A;  1MY3 A;  1I6Q A;  2NWJ A;  3K0V A;  4ND9 A;  2UYE A;  5KDT B;  1FQE A;  1ANF A;  1UTB B;  1TFD A;  2F97 A;  3Q26 A;  1BTJ A;  4MBP A;  3TDJ A;  4WXJ A;  3H7M A;  1MH4 A;  1IIW A;  3TEL A;  3FAT A;  4ZEK A;  4G8H A;  1B1X A;  4OFL A;  1Z7M E;  4EF1 A;  2XXU A;  2QS3 A;  4QFP A;  2REJ A;  2YPN A;  1O64 A;  2CZL A;  3C35 A;  3DEL B;  3IL1 B;  3SKP A;  4DCY A;  3FAS A;  3KN3 A;  5AA2 B;  1FQB A;  2BJJ X;  4IO7 A;  5BWJ A;  2HXW A;  2X7P A;  2Q88 A;  4TLM B;  1MM6 A;  1MDP 1;  4ELQ A;  4NTL A;  2ZXT A;  3W9V A;  3IOW A;  3G3G A;  3QYT A;  5I59 A;  2V3U A;  3B7D A;  5B70 A;  5H8F B;  3OEM A;  3MWB A;  1ZKB A;  1MXU A;  1HSE A;  2HAU A;  1L5T A;  2PT2 A;  3EHU A;  4LAT A;  2FNC A;  4DIG A;  1A55 A;  3GBB A;  3EF7 A;  4IO5 A;  2WKY A;  4X48 A;  4R72 A;  3FUZ A;  1LAX A;  3RLF E;  4R75 A;  3OD7 A;  3VFJ A;  1O63 A;  3VLU A;  3RPW A;  3TEP A;  2H98 A;  4TLL B;  4YB6 A;  4XKN A;  4MF3 A;  4LON B;  3K6U A;  3H6U A;  1UTH A;  1KWH A;  4YB5 A;  3T9X B;  1DPE A;  1J1N A;  4KD5 A;  4F2O A;  1I6A A;  4H65 A;  3TUS A;  4LQ2 A;  3MP1 A;  1DTZ A;  3LR1 A;  3LUY A;  3VE1 B;  4QHQ A;  4F39 A;  4X1D A;  1B0H A;  2IEE A;  4H1X A;  4FED A;  4ISU A;  4BDM A;  2VD2 A;  4XTC Q;  5CBR A;  3RTW B;  1ZU0 A;  1H3D A;  5FHO A;  3M8U A;  1XHY A;  2IA4 A;  2ONK E;  1JW5 A;  3K00 A;  1A8E A;  4KFQ A;  3VVD A;  2H4I A;  4MFI A;  5HM4 B;  1MQJ A;  3N6U A;  1QUI A;  3GXA A;  4R74 A;  1A99 A;  3TKD A;  1EZO A;  3SEU A;  3Q28 A;  4QSE A;  1AOV A;  3TAJ A;  4DCX A;  3K1N A;  4G8N A;  1SW2 A;  3TQW A;  3KOS A;  4ZZE A;  4U22 A;  3V8X B;  5EHS A;  2ANJ A;  3G3I A;  4IGT A;  3RQT A;  1IXG A;  1MM7 A;  3W15 C;  1P1O A;  4I8C A;  2DE2 A;  1P1N A;  1A7L A;  3OO9 A;  4OTE A;  4NF4 B;  1SVX B;  4PP0 A;  2NOO A;  2Y7R A;  2HAV A;  2ZYM A;  1LFG A;  1R9Q A;  4LZ8 A;  5ELV A;  5I58 B;  3GLB A;  4DXB A;  3OSQ A;  4HTG A;  2GRV A;  4GXA A;  1HSL A;  2VP1 A;  5CBS A;  2Z23 A;  4Z0I A;  3FV1 A;  4NF8 B;  2ZMB A;  5KZT A;  2QJE A;  2RC7 A;  4WEP A;  1Q1K A;  1BLF A;  1B46 A;  4GL0 A;  3USD A;  2XX9 A;  3PPO A;  2F6P A;  5AA4 A;  2DQV A;  2B3B A;  1MXX A;  3LBS A;  1LB8 A;  3KG2 A;  5I2N B;  1I6B A;  1PC3 A;  3E9X A;  4ONY A;  4JXI A;  1ZJL A;  5CMC A;  5IKB A;  2GHB A;  2Y7K A;  3MVY A;  4OYV A;  4QFO A;  2I4C A;  3C9H A;  1POY 1;  2I0B A;  2QPQ A;  3LSX A;  3TMG A;  4G2Z A;  1RYO A;  3UN6 A;  4LZ7 A;  5L9M A;  3IOV A;  3CG1 A;  5I2K A;  3C36 A;  2DE3 A;  4YAH X;  3O28 A;  3RGY A;  1ZLQ A;  4H5G A;  5FHN A;  3TTL A;  3G3J A;  3PPN A;  4PE5 B;  3IR1 A;  2V93 A;  3PV0 E;  3H03 A;  2Z8D A;  2ZNT A;  4KQP A;  4FEB A;  3S9E A;  1H45 A;  4QFL A;  4R2B A;  1SD3 A;  3VVF A;  2E0S A;  1ATG A;  1MS7 A;  2DWI A;  5LOM A;  4P11 A;  4EUO A;  4FAT A;  3VDF A;  4EQ9 A;  4RJZ A;  1NFT A;  1A54 A;  1USY H;  3MJN A;  4ESX A;  4EDP A;  5JEI A;  5DVF A;  1FTK A;  1IZ1 A;  1N84 A;  2AL4 A;  4NED A;  1EU8 A;  3Q29 A;  1GTK A;  4PQJ A;  5DEX B;  5CI5 A;  4K3F A;  2XXY A;  4GLI A;  3KBR A;  1B5H A;  3M3K A;  1BKA A;  3TTM A;  4YU0 A;  1EZP A;  4NF6 B;  2D21 A;  1Y3P A;  3KSJ A;  3TTK A;  1EZ9 A;  5BUU A;  4KR5 A;  1LGB C;  1JNF A;  4R9F A;  3QK6 A;  1MQH A;  4N6P A;  1SBP A;  3QIM A;  2UXA A;  3IO6 A;  2QS2 A;  3UOR A;  4WKM A;  3CIJ A;  4ZE8 A;  2QS4 A;  2R6G E;  3QUF A;  5CC2 A;  1D9Y A;  3EHS A;  1CE2 A;  1IEJ A;  5L9O A;  4R6Y A;  3T93 B;  3MBP A;  4FIM A;  4L17 A;  2RC9 A;  2OBG A;  5AA2 D;  1GV8 A;  3SEX A;  2B65 A;  1LAG E;  4DLD A;  5F7V A;  2UYF A;  1US5 A;  3TTN A;  1ZIU A;  3OXN A;  2I3W A;  1B51 A;  3H6T A;  5H8H A;  2VOZ A;  1S7Y A;  5EYF A;  1R6Z A;  3S9N C;  1RKM A;  4R9G A;  4F3B A;  1UQW A;  1FQC A;  3SEY A;  4IY6 A;  2ESN A;  2XXQ A;  3U92 A;  2O84 X;  1MPD A;  3N94 A;  3T9H B;  2Z8E A;  1NNP A;  4KHZ E;  2I6E A;  4U4S A;  3CR9 A;  5B7D A;  3BBR A;  3HO7 A;  4OMB A;  1XS5 A;  1P1Q A;  3KZG A;  5I56 B;  3RT6 B;  3PUW E;  3DM0 A;  3IOR A;  5J1D A;  1N3X A;  3A3C A;  3DP8 A;  2I58 A;  3MUQ A;  4IY5 A;  1T0K A;  2DVZ A;  3PUX E;  1YCJ A;  4UAC A;  3FJM A;  4F19 A;  4OXV A;  4F3S A;  3R26 A;  3K4U A;  2DP8 A;  1OLA A;  4ZED A;  4NF5 B;  2RIN A;  2HEU A;  1Y20 A;  1WVJ A;  3MQ9 A;  1B7H A;  4H5F A;  3ZSF A;  1AL3 A;  2FYI A;  4AB5 A;  1OVT A;  3U93 A;  1LFH A;  2I0C A;  1B5J A;  1OQH A;  2V25 A;  4NWC A;  3TQL A;  1SW1 A;  4MLV A;  5I57 B;  3FVK A;  2PX1 A;  4KYD A;  1N3W A;  2Y7I A;  3GZG A;  3TCH A;  1MY0 A;  3T22 A;  1HSJ A;  2ZNU A;  4ESW A;  1N0T A;  2P1S A;  2DE4 A;  4F29 A;  2NUV A;  3PMW A;  4LQ5 A;  5FHM A;  4I62 A;  4BLA A;  3MVZ A;  4F31 B;  1URG A;  1N04 A;  1ZTY A;  1MG1 A;  4QFK A;  2V84 A;  5DVJ A;  3FGS A;  5AA3 A;  2A5T A;  3FXR A;  1AIV A;  2DXY A;  1ZMG A;  3C4M A;  3HV1 A;  4RPN A;  2R71 A;  1FTO A;  3TPA A;  2Q8J A;  1JW4 A;  3O97 A;  1N7W A;  1IIT A;  3MPK A;  1IQ7 A;  2DWH A;  2XXI A;  1LLS A;  3H3G A;  2F7B A;  4G8M A;  1SI1 A;  2Q2C A;  5A5X A;  4QFN A;  1LAF E;  4FJP A;  3A09 A;  3UGW A;  1B32 A;  1OVB A;  1QKA A;  5H8N A;  1ZBM A;  5H8Q B;  3W9W A;  1B4Z A;  4MH5 A;  2HQ0 A;  3A3U A;  1TXF A;  3RN8 A;  3CI8 A;  4RXL A;  1B2H A;  3OO7 A;  4X9T A;  4KYS A;  4EXL A;  1NH8 A;  3VLV A;  1PBQ A;  4RY1 A;  1VR5 A;  1R1N A;  5TU0 A;  4H67 A;  2QMW A;  1LFI A;  1ELJ A;  1H76 A;  1NNK A;  2RF1 A;  4TQU Q;  1M5F A;  5ITO A;  3O29 A;  3CSG A;  1NL5 A;  3OEN A;  4YKP A;  3C34 A;  3B6T A;  5JTY B;  3K6W A;  1A40 A;  1JVX A;  1D9V A;  1MY1 A;  2Q9T A;  2FA7 A;  3CSB A;  1NKX A;  1FTL A;  5M2V A;  4DXU A;  1SDX A;  4OEV A;  3AXF A;  3K6X A;  5KCJ A;  1P99 A;  2XXW A;  5TP9 B;  1MXV A;  1S9T A;  3FVN A;  1DOT A;  5KDT A;  1UTB A;  2Z8F A;  2QS1 A;  3D4G A;  4DXC A;  1OMP A;  4EXK A;  4JBZ A;  1TWY A;  4HCW A;  1SYH A;  1GR2 A;  5HPQ A;  5ISU A;  1N7X A;  5TPA B;  1B1H A;  1MQD A;  3H6V A;  2ZNS A;  3DP6 A;  3IB1 A;  3MC2 A;  3PMV A;  3MPL A;  2F35 A;  3HN0 A;  3N6T A;  3O6I A;  3FIR A;  1MXZ A;  5AA2 A;  2O51 A;  4BDL A;  1Q35 A;  3P7I A;  2OK2 A;  3WAE A;  3E13 X;  1GVC A;  2DXR A;  5H8F A;  4NMY A;  4OEU A;  2ONR A;  4R73 A;  3FV2 A;  4QF9 A;  2GFE A;  3G3F A;  3SEW A;  5DYH A;  1R9L A;  2G93 A;  4KCC A;  5CMM A;  2ALU A;  3O6H A;  2PT1 A;  4THI A;  3TYH A;  1Y4T A;  4RNS A;  3ZKK A;  4GFR A;  4G77 A;  5AA1 A;  3L6G A;  4P0I A;  3HST A;  3LC8 A;  5I59 B;  4GD5 A;  3IAZ A;  4DDD A;  3S4U A;  1LCF A;  2RC8 A;  4C1U A;  3ILU B;  3H4Z A;  2XXT A;  4IB2 A;  4ZEF A;  1D4N A;  3KSX A;  3E3K A;  4KI0 E;  4O3C A;  2O6A A;  1NNF A;  4F1V A;  1FQD A;  4ZEB A;  4R6K A;  1NMU A;  4U23 A;  1TT1 A;  1B3G A;  2DVC A;  1LBC A;  4NWD A;  1Y4C A;  2Y84 A;  1I69 A;  2O68 A;  2UVH A;  1DTG A;  2E1S A;  4C0R A;  4N07 A;  2OZZ A;  3O66 A;  4HS7 A;  3ILT B;  4EQB A;  4LA9 A;  3SEV A;  4OWD A;  3K01 A;  2RCA A;  4G4P A;  5L8D A;  2XXP A;  5K2X A;  3THI A;  2O1L A;  3LSL A;  1UTH B;  3V83 A;  1NNT A;  3U94 A;  2THI A;  1IXH A;  1POT A;  3MAM A;  3U1O A;  2DWJ A;  3N26 A;  4PFY A;  3Q27 A;  2F36 A;  2LAO A;  1FCK A;  2V3Q A;  1JW1 A;  2H25 A;  4YMA A;  1QW0 A;  2ZYN A;  1B58 A;  1B40 A;  4YKK A;  4JDF A;  3IOT A;  1Y3N A;  3FVO A;  2I4B A;  3E4R A;  1YPN A;  2Y7W A;  1XVX A;  3JV9 A;  3TTR A;  1FQF A;  4HCY A;  1BIY A;  3SES A;  2X26 A;  2XX7 A;  3HHG A;  1PDA A;  1MPC A;  1Y1M A;  5CMB A;  2XXH A;  3IX1 A;  4RK2 A;  1YTV A;  1URS A;  1B3H A;  1DPP A;  3MW0 A;  4QSC A;  2XD3 A;  3EPE A;  4I9D A;  2F6G A;  3JYR A;  4NF4 A;  4LVQ A;  1B05 A;  1XC1 A;  2M8C A;  4F3G A;  2PMS A;  2HFB A;  1P1W A;  3TCG A;  4ZEI A;  5I58 A;  3R7X A;  1H44 A;  1QKB A;  4U21 A;  1II5 A;  4OFO A;  4IO6 A;  1IXI A;  2UVG A;  1LBB A;  4PFW A;  3FD3 A;  3IK6 B;  3O2A A;  1AMF A;  4NF8 A;  3ZS6 A;  2UVI A;  4BDO A;  3C32 A;  1SYI A;  3CFL A;  3ECR A;  1FQA A;  1MXY A;  1YAE A;  3CVG A;  3C31 A;  2QSX A;  4IGR A;  3B6Q A;  2PVU A;  1A8F A;  5I2N A;  3HHF A;  3BFT A;  4ZE9 A;  1B6H A;  1MQG A;  4IO4 A;  2H9B A;  4JSO A;  2DWA A;  4DZ1 A;  3FJG A;  3SER A;  4EQ7 A;  1NH7 A;  3Q25 A;  4JSD A;  4JWX A;  5AA4 B;  5AE4 A;  2DSF A;  4FE8 A;  3LSF B;  2D3I A;  1CB6 A;  1MQI A;  1MY2 A;  2VGQ A;  3PU5 A;  4JWY A;  3VV5 A;  2H5Y A;  3CFX A;  4PFT A;  1LCT A;  1VFD A;  4OVJ A;  2F7C A;  3K1P A;  5EHM A;  2XD2 A;  5L9S A;  4GXS B;  2YLN A;  1MY4 A;  4ELO A;  4OFJ A;  2OWT A;  3CG3 A;  4GQO A;  2OJT A;  3MZ1 A;  4R6H A;  4RPO A;  3T9V A;  2XXX A;  4OEN A;  2AIX A;  3TZA A;  1WOD A;  3CFZ A;  4IO2 A;  4F18 A;  3OO8 A;  3U72 A;  5FTI A;  4KYE A;  2AL5 A;  4UA8 A;  3B6W A;  5I2K B;  2I49 A;  4GF8 A;  4G68 C;  4Q0C A;  1F9B A;  2RKM A;  2KLF A;  3EQ1 A;  4EF2 A;  3IB0 A;  2YJP A;  3FJ7 A;  3VXC A;  4G68 B;  4PFU A;  1D3K A;  4NE4 A;  4Z7E A;  4C1T A;  5DEX A;  3ODB A;  3ZKL A;  1IXC A;  2PBW A;  3UP9 A;  4F22 A;  4O3A A;  4LP2 B;  2NVU B;  2DOJ A;  4AQ4 A;  1OLC A;  2I48 A;  1O7T A;  1PBP A;  4U1Z A;  1QVS A;  1Y3Q A;  3FZV A;  3I5O A;  3RT8 A;  4NF6 A;  3KJT A;  3N5L A;  4QSD A;  4XXU A;  3UK4 A;  4ECF A;  2F78 A;  3K1M A;  2G29 A;  3QSL A;  4RA1 A;  2W7Y A;  2GH9 A;  4ELP A;  1QUJ A;  2UVJ A;  4AB6 A;  1M5D A;  1M5C A;  3I3V A;  4BDQ A;  3OSR A;  4XKQ A;  3F11 A;  2H99 A;  3WAF A;  1PB7 A;  4GWO A;  1Y9U A;  4POX A;  1VFE A;  1P1U A;  3PMX A;  5H8S A;  3MVX A;  4R2F A;  2R9J A;  1Y1Z A;  3CRB A;  3T9U A;  3LSW A;  1LST A;  2ONS A;  2ZYK A;  3JZJ A;  2P0S A;  1M5E A;  4ZDM A;  4OQO A;  4E0X A;  5I84 A;  5F1Q A;  4OZ9 A;  1MH3 A;  2REG A;  2AYS A;  3K2D A;  1MRP A;  4Q30 B;  1N76 A;  2HCA A;  4F1U A;  3RUM A;  1BP5 A;  3T96 B;  3BFU A;  3TFL A;  2F7A A;  4YB7 A;  4YKJ A;  2QL3 A;  4YZZ A;  4RYA A;  2NXO A;  4GL8 A;  3S9M C;  5K2Y A;  1M5B A;  3KN8 A;  1XVY A;  2Y7P A;  4YKI A;  3MZB A;  3PPQ A;  1QUL A;  3PUV E;  3IB2 A;  2VD3 A;  2V3T A;  3OO6 A;  1RYX A;  5H8H B;  4YIC A;  5ICT A;  4H0W A;  4QRZ A;  1FW0 A;  4KCD A;  5I56 A;  1US4 A;  3T66 A;  1USY E;  2D5W A;  4JWO A;  3UIF A;  3G7W A;  3DP4 A;  4N13 A;  3V5A A;  5CRY A;  4GVO A;  2HZK A;  1B7U A;  1SW4 A;  3IO4 A;  4JB7 A;  1DSN A;  4ZZA A;  3D4C A;  2A5S A;  3VVE A;  3K02 A;  3V89 B;  3TCF A;  2OCU A;  3PUZ E;  4GRK A;  4NF5 A;  4Q5T A;  2ZYO A;  2QRY A;  2PYY A;  4OER A;  3KOT A;  3BKI B;  4H6D A;  4HW8 A;  3HPI A;  1IUD A;  3OEL A;  5CM6 A;  4KPT A;  3QXM A;  4Q8R A;  1LAH E;  2DS9 A;  3KJ7 A;  3GBA A;  4F2Q A;  3MZ9 A;  2B3F A;  1AH5 A;  4RK9 A;  3FVG A;  3KEI A;  4H8I A;  2Q89 A;  4XKP A;  4P0G A;  1LB9 A;  2DYX A;  3S2V A;  1UIU A;  2F34 A;  1MDQ A;  2P2A A;  5I57 A;  3OMB A;  2O69 A;  1URD A;  1DMB A;  5ICQ A;  4WED A;  4H8J A;  5IAI A; 
#chains in the Genus database with same CATH topology
 4OHN A;  4F3P A;  3K6V A;  4E0W A;  1B3L A;  4YMB A;  3L6H A;  3UA8 A;  1JEV A;  1EH3 A;  2I3V A;  4M1V A;  1B7Z A;  1TFA A;  4BDR A;  5FTH A;  4G68 A;  1QUK A;  3PPR A;  3MVW A;  1Z7N E;  5JK4 A;  2CZI A;  2RCB A;  3OOA A;  4GOT A;  3RNN A;  4TOZ A;  4PET A;  2JJK A;  2Z22 A;  4O3B A;  5CMK A;  1B3F A;  4OVT A;  4FAJ A;  3O6G A;  1IMD A;  4MMP A;  1VE4 A;  2VHA A;  1WDN A;  3ONM A;  3RTF B;  1B9J A;  1PB8 A;  2F8D A;  2FBP A;  4U4X A;  3R6U A;  4ZS9 A;  3U8Q A;  2OWZ A;  1SI0 A;  3MP8 A;  1B3E A;  3M3L A;  4F1Y A;  4GWY A;  3G3K A;  3SET A;  4AS5 A;  3I6V A;  2A5T B;  1PB9 A;  2HZL A;  1SW5 A;  4POW A;  4PTK A;  3PPP A;  4U2R A;  3OEK A;  5H8Q A;  3C33 A;  3FXQ A;  4FEC A;  5ITP A;  5DTB A;  4M4G A;  3M3F A;  5DVI A;  2X7Q A;  2QMX A;  1FJ6 A;  4DI4 B;  1LBV A;  1B52 A;  1OIB A;  1OQG A;  2XHD A;  3TOD A;  4PGP A;  1MXW A;  3H06 B;  4OES A;  3KGC A;  4IO3 A;  4LUB A;  2O7I A;  2R8T A;  5A5X B;  3KN7 A;  4ZEC A;  4LZ5 A;  1FTM A;  1GGG A;  1B4H A;  3IJX B;  4FBP A;  2O7U A;  1PEB A;  3KFM A;  3MP6 A;  5H8N B;  5JTY A;  4JVI A;  3FXB A;  4BDN A;  3SDF A;  4GWW A;  2XXV A;  1XI6 A;  4P9K A;  1FTJ A;  1JQF A;  2CMO A;  2XXR A;  2HPG A;  3S9L C;  4XKR A;  3G3H A;  2XX8 A;  3IJO B;  4PF6 A;  2GHA A;  2OWS A;  5IZ3 B;  1XOC A;  1B5I A;  3QUJ A;  2Q2A A;  3VXB A;  3O9P A;  3HCQ A;  3FXU A;  5TP9 A;  3DLN A;  1B0L A;  1UIV A;  2ABH A;  3PGF A;  1IMB A;  3VLW A;  1S50 A;  1MPB A;  3PD9 A;  2FIX A;  1JVY A;  1H43 A;  3EHT A;  4U1O A;  4I1D A;  4ELR A;  3PUY E;  2OLB A;  3QAX A;  1XT8 A;  4GIZ A;  3RY3 A;  2XWI A;  5TPA A;  2F5X A;  5DT6 A;  1NV2 A;  4OET A;  4FOR A;  4MNI A;  3H6W A;  1VSO A;  5KCJ B;  3IOU A;  1SQY A;  4MLQ A;  4XIG Q;  4H45 A;  5HBC A;  4X1B A;  1JET A;  3EN3 A;  4DE8 A;  1QJM A;  2O1M A;  1JEU A;  3PD8 A;  1MY3 A;  1I6Q A;  2NWJ A;  3K0V A;  4ND9 A;  2UYE A;  5KDT B;  1FQE A;  1ANF A;  1UTB B;  1TFD A;  2F97 A;  3Q26 A;  1BTJ A;  4MBP A;  3TDJ A;  4WXJ A;  3H7M A;  1MH4 A;  1IIW A;  3TEL A;  3PTY A;  3FAT A;  4ZEK A;  1G0H A;  4G8H A;  1B1X A;  1YZ0 A;  4OFL A;  1Z7M E;  4EF1 A;  1KA0 A;  2XXU A;  2QS3 A;  2XWO A;  4QFP A;  4P8B A;  2REJ A;  5DW8 A;  4NN3 A;  4OVR A;  2YPN A;  1QGX A;  4QXD A;  1O64 A;  2CZL A;  3C35 A;  3DEL B;  3IL1 B;  3SKP A;  4DCY A;  3FAS A;  3KN3 A;  5AA2 B;  1FQB A;  2BJJ X;  4IO7 A;  5BWJ A;  2HXW A;  2X7P A;  2Q88 A;  4TLM B;  4UAB A;  1MM6 A;  1MDP 1;  4ELQ A;  2Q8M A;  2KR0 A;  4NTL A;  2ZXT A;  3W9V A;  3IOW A;  4G61 A;  3G3G A;  3QYT A;  5I59 A;  2V3U A;  3B7D A;  5B70 A;  5H8F B;  3OEM A;  3MWB A;  1FPL A;  1ZKB A;  1MXU A;  1HSE A;  2HAU A;  4XFE A;  1L5T A;  2PT2 A;  3EHU A;  3MST A;  4LAT A;  2FNC A;  4GBW A;  4DIG A;  1A55 A;  3GBB A;  3EF7 A;  4IO5 A;  2WKY A;  4X48 A;  4R72 A;  3FUZ A;  3E78 A;  4N81 A;  5IZ1 A;  1JP4 A;  1LAX A;  3RLF E;  4PDD A;  4R75 A;  3OD7 A;  3VFJ A;  1FBG A;  1NV4 A;  1EYK A;  1O63 A;  3VLU A;  4P1L A;  3RPW A;  3TEP A;  2H98 A;  2WX9 A;  4TLL B;  4YB6 A;  4XKN A;  4MF3 A;  4OVS A;  4LON B;  3K6U A;  2B4M A;  3H6U A;  1UTH A;  1KWH A;  4YB5 A;  3T9X B;  1DPE A;  1J1N A;  5I3S A;  4KD5 A;  4F2O A;  1I6A A;  4H65 A;  3TUS A;  4LQ2 A;  4GX4 A;  2PFY A;  2XWV A;  3MP1 A;  1DTZ A;  2CZH A;  3LR1 A;  1LBX A;  3LUY A;  3VE1 B;  4QHQ A;  4F39 A;  4X1D A;  4P56 A;  1B0H A;  2IEE A;  4H1X A;  4FED A;  4ISU A;  4BDM A;  1FJ9 A;  4P1E A;  2VD2 A;  4XTC Q;  5CBR A;  3RTW B;  1ZU0 A;  1H3D A;  5FHO A;  1AWB A;  3M8U A;  2WEF A;  1XHY A;  2IA4 A;  2ONK E;  1JW5 A;  3K00 A;  1A8E A;  4KFQ A;  5EQA A;  3VVD A;  4NAP A;  2H4I A;  4MFI A;  4OA4 A;  5HM4 B;  1MQJ A;  3N6U A;  1QUI A;  2MKZ A;  3GXA A;  4R74 A;  1A99 A;  3TKD A;  1EZO A;  3SEU A;  3Q28 A;  4QSE A;  1AOV A;  1IMF A;  3TAJ A;  4DCX A;  3K1N A;  4G8N A;  1SW2 A;  3TQW A;  3KOS A;  4ZZE A;  4U22 A;  5EQ7 A;  3V8X B;  4MCO A;  5EHS A;  2ANJ A;  3U65 A;  3G3I A;  4IGT A;  3RQT A;  1IXG A;  1MM7 A;  4PC9 A;  3W15 C;  1P1O A;  4I8C A;  2DE2 A;  1P1N A;  1A7L A;  3OO9 A;  4OTE A;  4NF4 B;  1SVX B;  4PP0 A;  2NOO A;  2Y7R A;  2HAV A;  4QBA A;  2ZYM A;  1LFG A;  1R9Q A;  4LZ8 A;  5ELV A;  1NI9 A;  5I58 B;  1DBZ A;  3GLB A;  4DXB A;  3OSQ A;  4HTG A;  2GRV A;  4GXA A;  1HSL A;  2VP1 A;  5CBS A;  2Z23 A;  4Z0I A;  3FV1 A;  4NF8 B;  2ZMB A;  5KZT A;  2KQZ A;  4PAI A;  2QJE A;  2RC7 A;  4WEP A;  1NUW A;  1BLF A;  1Q1K A;  1B46 A;  1FBE A;  4GL0 A;  3USD A;  2XX9 A;  3PPO A;  3MYU A;  2F6P A;  5AA4 A;  2DQV A;  2B3B A;  1MXX A;  3LBS A;  1LB8 A;  3KG2 A;  5I2N B;  1YYZ A;  1I6B A;  1PC3 A;  3E9X A;  4ONY A;  4JXI A;  1ZJL A;  5CMC A;  5IKB A;  1EYI A;  2GHB A;  2Y7K A;  3MVY A;  4OYV A;  4QFO A;  2I4C A;  3C9H A;  4GBV A;  4MNC A;  1POY 1;  2I0B A;  2QPQ A;  3LSX A;  3TMG A;  1FPK A;  4G2Z A;  1RYO A;  4MHF A;  3UN6 A;  4LZ7 A;  5L9M A;  1FPG A;  3IOV A;  3CG1 A;  5I2K A;  3C36 A;  2DE3 A;  4YAH X;  3O28 A;  4H5G A;  1ZLQ A;  5FHN A;  3RGY A;  3TTL A;  3G3J A;  3PPN A;  4PE5 B;  3IR1 A;  2V93 A;  3PV0 E;  3H03 A;  2Z8D A;  2ZNT A;  4GWU A;  4KQP A;  4FEB A;  3S9E A;  1H45 A;  4QFL A;  2VPO A;  3BIH A;  4R2B A;  1SD3 A;  3VVF A;  2E0S A;  1ATG A;  1MS7 A;  4N8G A;  2DWI A;  5LOM A;  4O7I A;  4P11 A;  4EUO A;  4FAT A;  3VDF A;  4EQ9 A;  4RJZ A;  1NFT A;  1A54 A;  4PAK A;  1USY H;  3MJN A;  4ESX A;  4EDP A;  3RPL B;  5JEI A;  5DVF A;  1FTK A;  1IZ1 A;  1N84 A;  2AL4 A;  4NED A;  1EU8 A;  3Q29 A;  2V4C A;  1GTK A;  4PQJ A;  5DEX B;  5CI5 A;  4K3F A;  2XXY A;  4GLI A;  3KBR A;  1B5H A;  4MEV A;  3M3K A;  1BKA A;  3TTM A;  4YU0 A;  1EZP A;  4NF6 B;  2D21 A;  1Y3P A;  3KSJ A;  3TTK A;  1EZ9 A;  5BUU A;  4KR5 A;  1LGB C;  1JNF A;  4R9F A;  3QK6 A;  1MQH A;  4N6P A;  1SBP A;  3QIM A;  2UXA A;  3IO6 A;  2QS2 A;  3UOR A;  4WKM A;  3CIJ A;  4NHB A;  4ZE8 A;  2QS4 A;  2R6G E;  3QUF A;  5CC2 A;  1D9Y A;  3EHS A;  2PCR A;  1CE2 A;  1Q9D A;  1IEJ A;  5L9O A;  4R6Y A;  3T93 B;  4PAF A;  3MBP A;  4FIM A;  4L17 A;  4GWS A;  2RC9 A;  2OBG A;  5AA2 D;  1GV8 A;  3SEX A;  2B65 A;  1LAG E;  4DLD A;  4MJO A;  5F7V A;  2QVU A;  2UYF A;  1US5 A;  3TTN A;  1ZIU A;  3OXN A;  2I3W A;  1B51 A;  3H6T A;  5H8H A;  2CEY A;  2VOZ A;  1FPE A;  1S7Y A;  5EYF A;  1LBW A;  1R6Z A;  3S9N C;  1RKM A;  4R9G A;  4F3B A;  1UQW A;  1FQC A;  3SEY A;  4IY6 A;  2ESN A;  2XXQ A;  3U92 A;  2O84 X;  4O8M A;  1MPD A;  3KC0 A;  3N94 A;  3T9H B;  4MX6 A;  2Z8E A;  1NNP A;  4KHZ E;  2I6E A;  4U4S A;  3CR9 A;  5B7D A;  3BBR A;  3HO7 A;  3EKI A;  3ROJ A;  4OMB A;  1XS5 A;  1P1Q A;  3KZG A;  5I56 B;  1FPF A;  3RT6 B;  3PUW E;  3DM0 A;  3IOR A;  5J1D A;  1N3X A;  3A3C A;  3DP8 A;  2I58 A;  3MUQ A;  3BIG A;  1KA1 A;  4IY5 A;  1T0K A;  2DVZ A;  3PUX E;  1YCJ A;  4N91 A;  4UAC A;  3FJM A;  4F19 A;  4OXV A;  4MNP A;  4F3S A;  3R26 A;  2ZZX A;  3K4U A;  4I40 A;  2DP8 A;  1OLA A;  4ZED A;  4X04 A;  4NF5 B;  2RIN A;  2XXK A;  2HEU A;  1Y20 A;  4MIJ A;  1G0I A;  1WVJ A;  3MQ9 A;  5T3J A;  1B7H A;  4H5F A;  3ZSF A;  1AL3 A;  2FYI A;  4AB5 A;  1YXI A;  1OVT A;  3GYY A;  3U93 A;  1LFH A;  2I0C A;  1B5J A;  1OQH A;  2V25 A;  4NWC A;  3TQL A;  1D9Q A;  4I3Y A;  1SW1 A;  4MLV A;  5I57 B;  4GX3 A;  4P47 A;  2HXR A;  3FVK A;  2PX1 A;  4KYD A;  1N3W A;  4N15 A;  2Y7I A;  3GZG A;  3TCH A;  1MY0 A;  3T22 A;  1HSJ A;  1NV1 A;  2ZNU A;  4I3E A;  4ESW A;  1N0T A;  2P1S A;  2DE4 A;  4F29 A;  2NUV A;  3PMW A;  4LQ5 A;  5FHM A;  4I62 A;  2L5V A;  4BLA A;  2WYK A;  3MVZ A;  4F31 B;  1URG A;  2WBB A;  1N04 A;  1ZTY A;  1LBZ A;  1MG1 A;  4QFK A;  2V84 A;  5DVJ A;  3FGS A;  5AA3 A;  2A5T A;  3FXR A;  1AIV A;  2DXY A;  1ZMG A;  3C4M A;  3HV1 A;  4RPN A;  2R71 A;  1FTO A;  3TPA A;  4PCD A;  2Q8J A;  4NGU A;  5I7I A;  1JW4 A;  3O97 A;  4N6K A;  1N7W A;  4N8Y A;  1IIT A;  3MPK A;  1IQ7 A;  2DWH A;  2XXI A;  1LLS A;  2HHM A;  3H3G A;  2F7B A;  4G8M A;  1SI1 A;  5IM2 A;  2Q2C A;  5A5X A;  4QFN A;  1LAF E;  4FJP A;  3A09 A;  2VT5 A;  3UGW A;  1B32 A;  1OVB A;  1QKA A;  5H8N A;  1ZBM A;  4IR8 A;  5H8Q B;  3W9W A;  1B4Z A;  4MH5 A;  2HQ0 A;  3A3U A;  1TXF A;  3RN8 A;  3CI8 A;  4RXL A;  1B2H A;  3KC1 A;  3OO7 A;  4X9T A;  4KYS A;  4EXL A;  1NH8 A;  3VLV A;  5IZ3 A;  1PBQ A;  4RY1 A;  1VR5 A;  4XF5 A;  1R1N A;  5TU0 A;  3T0J A;  4H67 A;  2QMW A;  1LFI A;  1ELJ A;  1H76 A;  1NNK A;  1NUX A;  2RF1 A;  4TQU Q;  1M5F A;  4OAN A;  5ITO A;  3O29 A;  3CSG A;  5IZZ A;  1NL5 A;  3OEN A;  4YKP A;  3C34 A;  3B6T A;  5JTY B;  3K6W A;  1A40 A;  1JVX A;  1D9V A;  1MY1 A;  2Q9T A;  2FA7 A;  3CSB A;  1NKX A;  1FPD A;  1FTL A;  5M2V A;  4DXU A;  1SDX A;  4OEV A;  1DCU A;  3AXF A;  3K6X A;  4PFR A;  5KCJ A;  1P99 A;  2XXW A;  2ZZW A;  5TP9 B;  1MXV A;  4DI3 D;  1S9T A;  2FIE A;  3FVN A;  1DOT A;  5KDT A;  3E79 A;  1UTB A;  2Z8F A;  2QS1 A;  3D4G A;  4GWZ A;  4DXC A;  3T1B A;  1OMP A;  4EXK A;  4JBZ A;  1TWY A;  4NX1 A;  4HCW A;  1RDY A;  4PGN A;  1SYH A;  5FBP A;  1GR2 A;  4XEQ A;  5HPQ A;  5ISU A;  1N7X A;  5TPA B;  1B1H A;  1MQD A;  3H6V A;  1NUY A;  2ZNS A;  3DP6 A;  4OVQ A;  2P3N A;  1FBC A;  3IB1 A;  3MC2 A;  3PMV A;  3MPL A;  2F35 A;  3HN0 A;  3N6T A;  3O6I A;  3FIR A;  1MXZ A;  5AA2 A;  2O51 A;  4BDL A;  1FPJ A;  1Q35 A;  3P7I A;  2OK2 A;  3WAE A;  3E13 X;  5LTC A;  1EYJ A;  1GVC A;  2DXR A;  5H8F A;  4NMY A;  4OEU A;  2ONR A;  4R73 A;  3FV2 A;  4PFB A;  4QF9 A;  2GFE A;  3G3F A;  3SEW A;  5DYH A;  1R9L A;  2G93 A;  4KCC A;  5CMM A;  2ALU A;  3O6H A;  2PT1 A;  4THI A;  1IMC A;  3TYH A;  1Y4T A;  4RNS A;  3ZKK A;  4GFR A;  4G77 A;  5EYH A;  2QVV A;  5AA1 A;  3L6G A;  4P0I A;  3HST A;  3LC8 A;  3HFU A;  5I59 B;  4GD5 A;  3IAZ A;  4DDD A;  3S4U A;  1LCF A;  2RC8 A;  4C1U A;  3ILU B;  1KZ8 A;  3H4Z A;  2XXT A;  4IB2 A;  4ZEF A;  1D4N A;  3KSX A;  3E3K A;  1FBF A;  4KI0 E;  4O3C A;  2O6A A;  5A5L A;  1NNF A;  4F1V A;  1FQD A;  4ZEB A;  4R6K A;  1NMU A;  4U23 A;  1TT1 A;  1B3G A;  2DVC A;  1NV7 A;  3KBZ A;  1LBC A;  4NWD A;  1Y4C A;  2Y84 A;  1I69 A;  2O68 A;  2UVH A;  1DTG A;  2E1S A;  4C0R A;  4N07 A;  2OZZ A;  3O66 A;  3FBP A;  1NV6 A;  4HS7 A;  3ILT B;  4EQB A;  4LA9 A;  3SEV A;  4OWD A;  3K01 A;  2RCA A;  4G4P A;  5L8D A;  2XXP A;  5K2X A;  3THI A;  2O1L A;  3LSL A;  1UTH B;  3V83 A;  1NNT A;  3U94 A;  5I5P A;  2THI A;  1IXH A;  1POT A;  3MAM A;  3U1O A;  2WBD A;  2DWJ A;  3N26 A;  2B4L A;  4PFY A;  3Q27 A;  4GWX A;  4MAG A;  2F36 A;  2LAO A;  1FBP A;  1FCK A;  1JW1 A;  2H25 A;  2V3Q A;  4YMA A;  1QW0 A;  2ZYN A;  1B58 A;  1B40 A;  4YKK A;  4JDF A;  3IOT A;  1Y3N A;  3FVO A;  2I4B A;  3E4R A;  1IMA A;  1YPN A;  1FRP A;  2Y7W A;  1XVX A;  3JV9 A;  3TTR A;  1FQF A;  4HCY A;  2Q74 A;  1BIY A;  3SES A;  2X26 A;  2XX7 A;  4X8R A;  3HHG A;  1NV0 A;  1LBY A;  1PDA A;  1MPC A;  1Y1M A;  5CMB A;  4PE3 A;  5ESY A;  2XXH A;  3IX1 A;  4PFI A;  4RK2 A;  1YTV A;  1URS A;  2FVZ A;  1B3H A;  1DPP A;  3MW0 A;  4QSC A;  2XD3 A;  3EPE A;  4I9D A;  2F6G A;  3JYR A;  4NF4 A;  4LVQ A;  5EQ9 A;  1B05 A;  1XC1 A;  2M8C A;  4F3G A;  2PMS A;  2HFB A;  1NV3 A;  4PF8 A;  1P1W A;  3TCG A;  4ZEI A;  5I58 A;  3R7X A;  1H44 A;  1QKB A;  4U21 A;  1II5 A;  4OFO A;  4IO6 A;  1IXI A;  2QFL A;  2UVG A;  1LBB A;  4PFW A;  3FD3 A;  3IK6 B;  3O2A A;  1AMF A;  4NF8 A;  3ZS6 A;  2UVI A;  4BDO A;  3C32 A;  2Y5K A;  1SYI A;  3CFL A;  3ECR A;  1FQA A;  1MXY A;  1RDZ A;  1YAE A;  3CVG A;  3C31 A;  2QSX A;  4IGR A;  1SPI A;  3B6Q A;  2PVU A;  1CNQ A;  1A8F A;  5I2N A;  3HHF A;  3BFT A;  4ZE9 A;  1B6H A;  2DDK A;  1MQG A;  4IO4 A;  2H9B A;  4JSO A;  4NF0 A;  3SZP A;  2DWA A;  4DZ1 A;  3FJG A;  3SER A;  2F3B A;  4EQ7 A;  1NH7 A;  3Q25 A;  1K9Z A;  4JSD A;  4JWX A;  5AA4 B;  5AE4 A;  2DSF A;  4FE8 A;  3LSF B;  2D3I A;  1CB6 A;  1MQI A;  1MY2 A;  2VGQ A;  3PU5 A;  4JWY A;  3VV5 A;  2H5Y A;  3CFX A;  4PFT A;  1LCT A;  1VFD A;  4OVJ A;  2F7C A;  2CZK A;  3K1P A;  2XA5 A;  2WYP A;  4N17 A;  3LUZ A;  2XD2 A;  5EHM A;  5L9S A;  4GXS B;  2YLN A;  1MY4 A;  4ELO A;  4OFJ A;  2OWT A;  3CG3 A;  4GQO A;  2OJT A;  3MZ1 A;  4R6H A;  4RPO A;  3T9V A;  1NUZ A;  1FPI A;  2XXX A;  4OEN A;  2AIX A;  3TZA A;  1WOD A;  3CFZ A;  1DK4 A;  4IO2 A;  4F18 A;  3OO8 A;  3U72 A;  5FTI A;  2CEX A;  4P3L A;  4KYE A;  2AL5 A;  4UA8 A;  3B6W A;  5I2K B;  2I49 A;  3NOH A;  4HXV A;  4LN5 A;  5F24 A;  4GF8 A;  4G68 C;  4Q0C A;  1F9B A;  4KXP A;  2RKM A;  2KLF A;  5ET5 A;  3RPL A;  3EQ1 A;  2VPN A;  4EF2 A;  2XWK A;  3IB0 A;  2YJP A;  3FJ7 A;  2OX3 A;  3VXC A;  4G68 B;  4PFU A;  1D3K A;  4NE4 A;  4Z7E A;  4C1T A;  5DEX A;  3ODB A;  3ZKL A;  1FBH A;  1IXC A;  2PBW A;  3UP9 A;  4F22 A;  4O3A A;  4LP2 B;  2NVU B;  2DOJ A;  4AQ4 A;  1OLC A;  2I48 A;  1O7T A;  1PBP A;  4JVD A;  4U1Z A;  1QVS A;  1Y3Q A;  3FZV A;  3I5O A;  3RT8 A;  2P3V A;  4NF6 A;  3KJT A;  3N5L A;  4QSD A;  4XXU A;  3UK4 A;  2F78 A;  3K1M A;  3QSL A;  2G29 A;  4ECF A;  4GX6 A;  4RA1 A;  2W7Y A;  2GH9 A;  4ELP A;  1QUJ A;  2UVJ A;  4PBQ A;  4AB6 A;  1M5D A;  2F3D A;  1M5C A;  3I3V A;  4BDQ A;  5EQ8 A;  1BK4 A;  3OSR A;  4XKQ A;  3F11 A;  2H99 A;  3WAF A;  1PB7 A;  4HE0 A;  4GWO A;  1Y9U A;  4POX A;  1VFE A;  5ET7 A;  1P1U A;  3PMX A;  5H8S A;  5IGA A;  2GQ1 A;  3MVX A;  3IFA A;  4R2F A;  2R9J A;  1Y1Z A;  5LDZ A;  2ZZV A;  3CRB A;  3T9U A;  1FSA A;  3LSW A;  1LST A;  2QVR A;  2ONS A;  4PDH A;  2ZYK A;  3JZJ A;  3RYD A;  1INP A;  2P0S A;  1M5E A;  4ZDM A;  4OQO A;  4E0X A;  5I84 A;  5F1Q A;  4OZ9 A;  4N6D A;  1MH3 A;  2REG A;  1FBD A;  2AYS A;  3K2D A;  1MRP A;  4Q30 B;  1N76 A;  2HCA A;  4F1U A;  3RUM A;  1BP5 A;  1RDX A;  4NQ8 A;  3T96 B;  3BFU A;  3TFL A;  2F7A A;  4YB7 A;  3D1R A;  3ISP A;  4YKJ A;  2QL3 A;  1FTA A;  4YZZ A;  4RYA A;  2NXO A;  4GL8 A;  3S9M C;  5K2Y A;  1M5B A;  3KN8 A;  1XVY A;  2Y7P A;  4YKI A;  2PFZ A;  3MZB A;  3PPQ A;  1QUL A;  3PUV E;  3IB2 A;  5ET6 A;  3A29 A;  3QMF A;  2VD3 A;  2V3T A;  1K9Y A;  2FHY A;  1VDW A;  3OO6 A;  4HE2 A;  1RYX A;  5H8H B;  4YIC A;  5ICT A;  4H0W A;  4QRZ A;  1FW0 A;  4H46 A;  4KCD A;  5I56 A;  1US4 A;  3T66 A;  1USY E;  2D5W A;  4JWO A;  3UIF A;  3G7W A;  5ET8 A;  3DP4 A;  4N13 A;  3B50 A;  3V5A A;  5CRY A;  2Y5L A;  4GVO A;  4OVP A;  2HZK A;  1B7U A;  1LEV A;  1SW4 A;  3IO4 A;  4JB7 A;  1DSN A;  4ZZA A;  3D4C A;  2A5S A;  3VVE A;  3K02 A;  3V89 B;  3TCF A;  2OCU A;  3PUZ E;  3LV0 A;  4GRK A;  4NF5 A;  4Q5T A;  2ZYO A;  2QRY A;  4N4U A;  2PYY A;  4PBH A;  4OER A;  3KOT A;  3BKI B;  4H6D A;  4HW8 A;  3HPI A;  1IUD A;  1IME A;  3OEL A;  5CM6 A;  4KPT A;  3QXM A;  4Q8R A;  1LAH E;  3CHG A;  2DS9 A;  5EYG A;  4NG7 A;  4HE1 A;  3KJ7 A;  3GBA A;  4F2Q A;  3MZ9 A;  2B3F A;  1AH5 A;  4JVC A;  4RK9 A;  4O94 A;  3FVG A;  3KEI A;  4H8I A;  3IFC A;  2Q89 A;  4XKP A;  4P0G A;  1FPB A;  1LB9 A;  2DYX A;  3S2V A;  1UIU A;  2F34 A;  1MDQ A;  2P2A A;  5I57 A;  3OMB A;  1NV5 A;  2O69 A;  5J16 A;  1URD A;  1DMB A;  5ICQ A;  4AS4 A;  2BJI A;  4WED A;  4O7M A;  4H8J A;  3B8B A;  5IAI A; 
#chains in the Genus database with same CATH homology
 4OHN A;  4F3P A;  3K6V A;  4E0W A;  1B3L A;  4YMB A;  3L6H A;  3UA8 A;  1JEV A;  1EH3 A;  2I3V A;  4M1V A;  1B7Z A;  1TFA A;  4BDR A;  5FTH A;  4G68 A;  1QUK A;  3PPR A;  3MVW A;  1Z7N E;  5JK4 A;  2RCB A;  3OOA A;  4GOT A;  3RNN A;  4TOZ A;  4PET A;  2Z22 A;  4O3B A;  5CMK A;  1B3F A;  4FAJ A;  3O6G A;  1VE4 A;  2VHA A;  1WDN A;  3ONM A;  3RTF B;  1B9J A;  1PB8 A;  2F8D A;  4U4X A;  3R6U A;  4ZS9 A;  3U8Q A;  3MP8 A;  1SI0 A;  1B3E A;  3M3L A;  4F1Y A;  3G3K A;  3SET A;  3I6V A;  2A5T B;  1PB9 A;  2HZL A;  1SW5 A;  4POW A;  3PPP A;  4U2R A;  3OEK A;  5H8Q A;  3C33 A;  3FXQ A;  4FEC A;  5ITP A;  5DTB A;  4M4G A;  3M3F A;  5DVI A;  2X7Q A;  2QMX A;  1B52 A;  1OIB A;  1OQG A;  2XHD A;  3TOD A;  1MXW A;  3H06 B;  4OES A;  3KGC A;  4IO3 A;  4LUB A;  2O7I A;  5A5X B;  3KN7 A;  4ZEC A;  4LZ5 A;  1FTM A;  1GGG A;  1B4H A;  3IJX B;  2O7U A;  1PEB A;  3KFM A;  3MP6 A;  5H8N B;  5JTY A;  4BDN A;  3SDF A;  2XXV A;  1FTJ A;  1JQF A;  2CMO A;  2XXR A;  3S9L C;  4XKR A;  3G3H A;  2XX8 A;  3IJO B;  2GHA A;  2OWS A;  1XOC A;  1B5I A;  3QUJ A;  2Q2A A;  3VXB A;  3O9P A;  3HCQ A;  3FXU A;  5TP9 A;  3DLN A;  1B0L A;  1UIV A;  2ABH A;  3PGF A;  3VLW A;  1S50 A;  1MPB A;  3PD9 A;  1JVY A;  1H43 A;  3EHT A;  4U1O A;  4I1D A;  4ELR A;  3PUY E;  2OLB A;  3QAX A;  1XT8 A;  4GIZ A;  3RY3 A;  5TPA A;  2F5X A;  5DT6 A;  4OET A;  4FOR A;  3H6W A;  1VSO A;  5KCJ B;  3IOU A;  1SQY A;  4MLQ A;  4XIG Q;  5HBC A;  4X1B A;  1JET A;  3EN3 A;  4DE8 A;  1QJM A;  2O1M A;  1JEU A;  3PD8 A;  1MY3 A;  1I6Q A;  2NWJ A;  3K0V A;  4ND9 A;  2UYE A;  5KDT B;  1FQE A;  1ANF A;  1UTB B;  1TFD A;  2F97 A;  3Q26 A;  1BTJ A;  4MBP A;  3TDJ A;  4WXJ A;  3H7M A;  1MH4 A;  1IIW A;  3TEL A;  3FAT A;  4ZEK A;  4G8H A;  1B1X A;  4OFL A;  1Z7M E;  4EF1 A;  2XXU A;  2QS3 A;  4QFP A;  2REJ A;  2YPN A;  1O64 A;  2CZL A;  3C35 A;  3DEL B;  3IL1 B;  3SKP A;  4DCY A;  3FAS A;  3KN3 A;  5AA2 B;  1FQB A;  2BJJ X;  4IO7 A;  5BWJ A;  2HXW A;  2X7P A;  2Q88 A;  4TLM B;  1MM6 A;  1MDP 1;  4ELQ A;  4NTL A;  2ZXT A;  3W9V A;  3IOW A;  3G3G A;  3QYT A;  5I59 A;  2V3U A;  3B7D A;  5B70 A;  5H8F B;  3OEM A;  3MWB A;  1ZKB A;  1MXU A;  1HSE A;  2HAU A;  1L5T A;  2PT2 A;  3EHU A;  4LAT A;  2FNC A;  4DIG A;  1A55 A;  3GBB A;  3EF7 A;  4IO5 A;  2WKY A;  4X48 A;  4R72 A;  3FUZ A;  1LAX A;  3RLF E;  4R75 A;  3OD7 A;  3VFJ A;  1O63 A;  3VLU A;  3RPW A;  3TEP A;  2H98 A;  4TLL B;  4YB6 A;  4XKN A;  4MF3 A;  4LON B;  3K6U A;  3H6U A;  1UTH A;  1KWH A;  4YB5 A;  3T9X B;  1DPE A;  1J1N A;  4KD5 A;  4F2O A;  1I6A A;  4H65 A;  3TUS A;  4LQ2 A;  3MP1 A;  1DTZ A;  3LR1 A;  3LUY A;  3VE1 B;  4QHQ A;  4F39 A;  4X1D A;  1B0H A;  2IEE A;  4H1X A;  4FED A;  4ISU A;  4BDM A;  2VD2 A;  4XTC Q;  5CBR A;  3RTW B;  1ZU0 A;  1H3D A;  5FHO A;  3M8U A;  1XHY A;  2IA4 A;  2ONK E;  1JW5 A;  3K00 A;  1A8E A;  4KFQ A;  3VVD A;  2H4I A;  4MFI A;  5HM4 B;  1MQJ A;  3N6U A;  1QUI A;  3GXA A;  4R74 A;  1A99 A;  3TKD A;  1EZO A;  3SEU A;  3Q28 A;  4QSE A;  1AOV A;  3TAJ A;  4DCX A;  3K1N A;  4G8N A;  1SW2 A;  3TQW A;  3KOS A;  4ZZE A;  4U22 A;  3V8X B;  5EHS A;  2ANJ A;  3G3I A;  4IGT A;  3RQT A;  1IXG A;  1MM7 A;  3W15 C;  1P1O A;  4I8C A;  2DE2 A;  1P1N A;  1A7L A;  3OO9 A;  4OTE A;  4NF4 B;  1SVX B;  4PP0 A;  2NOO A;  2Y7R A;  2HAV A;  2ZYM A;  1LFG A;  1R9Q A;  4LZ8 A;  5ELV A;  5I58 B;  3GLB A;  4DXB A;  3OSQ A;  4HTG A;  2GRV A;  4GXA A;  1HSL A;  2VP1 A;  5CBS A;  2Z23 A;  4Z0I A;  3FV1 A;  4NF8 B;  2ZMB A;  5KZT A;  2QJE A;  2RC7 A;  4WEP A;  1Q1K A;  1BLF A;  1B46 A;  4GL0 A;  3USD A;  2XX9 A;  3PPO A;  2F6P A;  5AA4 A;  2DQV A;  2B3B A;  1MXX A;  3LBS A;  1LB8 A;  3KG2 A;  5I2N B;  1I6B A;  1PC3 A;  3E9X A;  4ONY A;  4JXI A;  1ZJL A;  5CMC A;  5IKB A;  2GHB A;  2Y7K A;  3MVY A;  4OYV A;  4QFO A;  2I4C A;  3C9H A;  1POY 1;  2I0B A;  2QPQ A;  3LSX A;  3TMG A;  4G2Z A;  1RYO A;  3UN6 A;  4LZ7 A;  5L9M A;  3IOV A;  3CG1 A;  5I2K A;  3C36 A;  2DE3 A;  4YAH X;  3O28 A;  3RGY A;  1ZLQ A;  4H5G A;  5FHN A;  3TTL A;  3G3J A;  3PPN A;  4PE5 B;  3IR1 A;  2V93 A;  3PV0 E;  3H03 A;  2Z8D A;  2ZNT A;  4KQP A;  4FEB A;  3S9E A;  1H45 A;  4QFL A;  4R2B A;  1SD3 A;  3VVF A;  2E0S A;  1ATG A;  1MS7 A;  2DWI A;  5LOM A;  4P11 A;  4EUO A;  4FAT A;  3VDF A;  4EQ9 A;  4RJZ A;  1NFT A;  1A54 A;  1USY H;  3MJN A;  4ESX A;  4EDP A;  5JEI A;  5DVF A;  1FTK A;  1IZ1 A;  1N84 A;  2AL4 A;  4NED A;  1EU8 A;  3Q29 A;  1GTK A;  4PQJ A;  5DEX B;  5CI5 A;  4K3F A;  2XXY A;  4GLI A;  3KBR A;  1B5H A;  3M3K A;  1BKA A;  3TTM A;  4YU0 A;  1EZP A;  4NF6 B;  2D21 A;  1Y3P A;  3KSJ A;  3TTK A;  1EZ9 A;  5BUU A;  4KR5 A;  1LGB C;  1JNF A;  4R9F A;  3QK6 A;  1MQH A;  4N6P A;  1SBP A;  3QIM A;  2UXA A;  3IO6 A;  2QS2 A;  3UOR A;  4WKM A;  3CIJ A;  4ZE8 A;  2QS4 A;  2R6G E;  3QUF A;  5CC2 A;  1D9Y A;  3EHS A;  1CE2 A;  1IEJ A;  5L9O A;  4R6Y A;  3T93 B;  3MBP A;  4FIM A;  4L17 A;  2RC9 A;  2OBG A;  5AA2 D;  1GV8 A;  3SEX A;  2B65 A;  1LAG E;  4DLD A;  5F7V A;  2UYF A;  1US5 A;  3TTN A;  1ZIU A;  3OXN A;  2I3W A;  1B51 A;  3H6T A;  5H8H A;  2VOZ A;  1S7Y A;  5EYF A;  1R6Z A;  3S9N C;  1RKM A;  4R9G A;  4F3B A;  1UQW A;  1FQC A;  3SEY A;  4IY6 A;  2ESN A;  2XXQ A;  3U92 A;  2O84 X;  1MPD A;  3N94 A;  3T9H B;  2Z8E A;  1NNP A;  4KHZ E;  2I6E A;  4U4S A;  3CR9 A;  5B7D A;  3BBR A;  3HO7 A;  4OMB A;  1XS5 A;  1P1Q A;  3KZG A;  5I56 B;  3RT6 B;  3PUW E;  3DM0 A;  3IOR A;  5J1D A;  1N3X A;  3A3C A;  3DP8 A;  2I58 A;  3MUQ A;  4IY5 A;  1T0K A;  2DVZ A;  3PUX E;  1YCJ A;  4UAC A;  3FJM A;  4F19 A;  4OXV A;  4F3S A;  3R26 A;  3K4U A;  2DP8 A;  1OLA A;  4ZED A;  4NF5 B;  2RIN A;  2HEU A;  1Y20 A;  1WVJ A;  3MQ9 A;  1B7H A;  4H5F A;  3ZSF A;  1AL3 A;  2FYI A;  4AB5 A;  1OVT A;  3U93 A;  1LFH A;  2I0C A;  1B5J A;  1OQH A;  2V25 A;  4NWC A;  3TQL A;  1SW1 A;  4MLV A;  5I57 B;  3FVK A;  2PX1 A;  4KYD A;  1N3W A;  2Y7I A;  3GZG A;  3TCH A;  1MY0 A;  3T22 A;  1HSJ A;  2ZNU A;  4ESW A;  1N0T A;  2P1S A;  2DE4 A;  4F29 A;  2NUV A;  3PMW A;  4LQ5 A;  5FHM A;  4I62 A;  4BLA A;  3MVZ A;  4F31 B;  1URG A;  1N04 A;  1ZTY A;  1MG1 A;  4QFK A;  2V84 A;  5DVJ A;  3FGS A;  5AA3 A;  2A5T A;  3FXR A;  1AIV A;  2DXY A;  1ZMG A;  3C4M A;  3HV1 A;  4RPN A;  2R71 A;  1FTO A;  3TPA A;  2Q8J A;  1JW4 A;  3O97 A;  1N7W A;  1IIT A;  3MPK A;  1IQ7 A;  2DWH A;  2XXI A;  1LLS A;  3H3G A;  2F7B A;  4G8M A;  1SI1 A;  2Q2C A;  5A5X A;  4QFN A;  1LAF E;  4FJP A;  3A09 A;  3UGW A;  1B32 A;  1OVB A;  1QKA A;  5H8N A;  1ZBM A;  5H8Q B;  3W9W A;  1B4Z A;  4MH5 A;  2HQ0 A;  3A3U A;  1TXF A;  3RN8 A;  3CI8 A;  4RXL A;  1B2H A;  3OO7 A;  4X9T A;  4KYS A;  4EXL A;  1NH8 A;  3VLV A;  1PBQ A;  4RY1 A;  1VR5 A;  1R1N A;  5TU0 A;  4H67 A;  2QMW A;  1LFI A;  1ELJ A;  1H76 A;  1NNK A;  2RF1 A;  4TQU Q;  1M5F A;  5ITO A;  3O29 A;  3CSG A;  1NL5 A;  3OEN A;  4YKP A;  3C34 A;  3B6T A;  5JTY B;  3K6W A;  1A40 A;  1JVX A;  1D9V A;  1MY1 A;  2Q9T A;  2FA7 A;  3CSB A;  1NKX A;  1FTL A;  5M2V A;  4DXU A;  1SDX A;  4OEV A;  3AXF A;  3K6X A;  5KCJ A;  1P99 A;  2XXW A;  5TP9 B;  1MXV A;  1S9T A;  3FVN A;  1DOT A;  5KDT A;  1UTB A;  2Z8F A;  2QS1 A;  3D4G A;  4DXC A;  1OMP A;  4EXK A;  4JBZ A;  1TWY A;  4HCW A;  1SYH A;  1GR2 A;  5HPQ A;  5ISU A;  1N7X A;  5TPA B;  1B1H A;  1MQD A;  3H6V A;  2ZNS A;  3DP6 A;  3IB1 A;  3MC2 A;  3PMV A;  3MPL A;  2F35 A;  3HN0 A;  3N6T A;  3O6I A;  3FIR A;  1MXZ A;  5AA2 A;  2O51 A;  4BDL A;  1Q35 A;  3P7I A;  2OK2 A;  3WAE A;  3E13 X;  1GVC A;  2DXR A;  5H8F A;  4NMY A;  4OEU A;  2ONR A;  4R73 A;  3FV2 A;  4QF9 A;  2GFE A;  3G3F A;  3SEW A;  5DYH A;  1R9L A;  2G93 A;  4KCC A;  5CMM A;  2ALU A;  3O6H A;  2PT1 A;  4THI A;  3TYH A;  1Y4T A;  4RNS A;  3ZKK A;  4GFR A;  4G77 A;  5AA1 A;  3L6G A;  4P0I A;  3HST A;  3LC8 A;  5I59 B;  4GD5 A;  3IAZ A;  4DDD A;  3S4U A;  1LCF A;  2RC8 A;  4C1U A;  3ILU B;  3H4Z A;  2XXT A;  4IB2 A;  4ZEF A;  1D4N A;  3KSX A;  3E3K A;  4KI0 E;  4O3C A;  2O6A A;  1NNF A;  4F1V A;  1FQD A;  4ZEB A;  4R6K A;  1NMU A;  4U23 A;  1TT1 A;  1B3G A;  2DVC A;  1LBC A;  4NWD A;  1Y4C A;  2Y84 A;  1I69 A;  2O68 A;  2UVH A;  1DTG A;  2E1S A;  4C0R A;  4N07 A;  2OZZ A;  3O66 A;  4HS7 A;  3ILT B;  4EQB A;  4LA9 A;  3SEV A;  4OWD A;  3K01 A;  2RCA A;  4G4P A;  5L8D A;  2XXP A;  5K2X A;  3THI A;  2O1L A;  3LSL A;  1UTH B;  3V83 A;  1NNT A;  3U94 A;  2THI A;  1IXH A;  1POT A;  3MAM A;  3U1O A;  2DWJ A;  3N26 A;  4PFY A;  3Q27 A;  2F36 A;  2LAO A;  1FCK A;  2V3Q A;  1JW1 A;  2H25 A;  4YMA A;  1QW0 A;  2ZYN A;  1B58 A;  1B40 A;  4YKK A;  4JDF A;  3IOT A;  1Y3N A;  3FVO A;  2I4B A;  3E4R A;  1YPN A;  2Y7W A;  1XVX A;  3JV9 A;  3TTR A;  1FQF A;  4HCY A;  1BIY A;  3SES A;  2X26 A;  2XX7 A;  3HHG A;  1PDA A;  1MPC A;  1Y1M A;  5CMB A;  2XXH A;  3IX1 A;  4RK2 A;  1YTV A;  1URS A;  1B3H A;  1DPP A;  3MW0 A;  4QSC A;  2XD3 A;  3EPE A;  4I9D A;  2F6G A;  3JYR A;  4NF4 A;  4LVQ A;  1B05 A;  1XC1 A;  2M8C A;  4F3G A;  2PMS A;  2HFB A;  1P1W A;  3TCG A;  4ZEI A;  5I58 A;  3R7X A;  1H44 A;  1QKB A;  4U21 A;  1II5 A;  4OFO A;  4IO6 A;  1IXI A;  2UVG A;  1LBB A;  4PFW A;  3FD3 A;  3IK6 B;  3O2A A;  1AMF A;  4NF8 A;  3ZS6 A;  2UVI A;  4BDO A;  3C32 A;  1SYI A;  3CFL A;  3ECR A;  1FQA A;  1MXY A;  1YAE A;  3CVG A;  3C31 A;  2QSX A;  4IGR A;  3B6Q A;  2PVU A;  1A8F A;  5I2N A;  3HHF A;  3BFT A;  4ZE9 A;  1B6H A;  1MQG A;  4IO4 A;  2H9B A;  4JSO A;  2DWA A;  4DZ1 A;  3FJG A;  3SER A;  4EQ7 A;  1NH7 A;  3Q25 A;  4JSD A;  4JWX A;  5AA4 B;  5AE4 A;  2DSF A;  4FE8 A;  3LSF B;  2D3I A;  1CB6 A;  1MQI A;  1MY2 A;  2VGQ A;  3PU5 A;  4JWY A;  3VV5 A;  2H5Y A;  3CFX A;  4PFT A;  1LCT A;  1VFD A;  4OVJ A;  2F7C A;  3K1P A;  5EHM A;  2XD2 A;  5L9S A;  4GXS B;  2YLN A;  1MY4 A;  4ELO A;  4OFJ A;  2OWT A;  3CG3 A;  4GQO A;  2OJT A;  3MZ1 A;  4R6H A;  4RPO A;  3T9V A;  2XXX A;  4OEN A;  2AIX A;  3TZA A;  1WOD A;  3CFZ A;  4IO2 A;  4F18 A;  3OO8 A;  3U72 A;  5FTI A;  4KYE A;  2AL5 A;  4UA8 A;  3B6W A;  5I2K B;  2I49 A;  4GF8 A;  4G68 C;  4Q0C A;  1F9B A;  2RKM A;  2KLF A;  3EQ1 A;  4EF2 A;  3IB0 A;  2YJP A;  3FJ7 A;  3VXC A;  4G68 B;  4PFU A;  1D3K A;  4NE4 A;  4Z7E A;  4C1T A;  5DEX A;  3ODB A;  3ZKL A;  1IXC A;  2PBW A;  3UP9 A;  4F22 A;  4O3A A;  4LP2 B;  2NVU B;  2DOJ A;  4AQ4 A;  1OLC A;  2I48 A;  1O7T A;  1PBP A;  4U1Z A;  1QVS A;  1Y3Q A;  3FZV A;  3I5O A;  3RT8 A;  4NF6 A;  3KJT A;  3N5L A;  4QSD A;  4XXU A;  3UK4 A;  4ECF A;  2F78 A;  3K1M A;  2G29 A;  3QSL A;  4RA1 A;  2W7Y A;  2GH9 A;  4ELP A;  1QUJ A;  2UVJ A;  4AB6 A;  1M5D A;  1M5C A;  3I3V A;  4BDQ A;  3OSR A;  4XKQ A;  3F11 A;  2H99 A;  3WAF A;  1PB7 A;  4GWO A;  1Y9U A;  4POX A;  1VFE A;  1P1U A;  3PMX A;  5H8S A;  3MVX A;  4R2F A;  2R9J A;  1Y1Z A;  3CRB A;  3T9U A;  3LSW A;  1LST A;  2ONS A;  2ZYK A;  3JZJ A;  2P0S A;  1M5E A;  4ZDM A;  4OQO A;  4E0X A;  5I84 A;  5F1Q A;  4OZ9 A;  1MH3 A;  2REG A;  2AYS A;  3K2D A;  1MRP A;  4Q30 B;  1N76 A;  2HCA A;  4F1U A;  3RUM A;  1BP5 A;  3T96 B;  3BFU A;  3TFL A;  2F7A A;  4YB7 A;  4YKJ A;  2QL3 A;  4YZZ A;  4RYA A;  2NXO A;  4GL8 A;  3S9M C;  5K2Y A;  1M5B A;  3KN8 A;  1XVY A;  2Y7P A;  4YKI A;  3MZB A;  3PPQ A;  1QUL A;  3PUV E;  3IB2 A;  2VD3 A;  2V3T A;  3OO6 A;  1RYX A;  5H8H B;  4YIC A;  5ICT A;  4H0W A;  4QRZ A;  1FW0 A;  4KCD A;  5I56 A;  1US4 A;  3T66 A;  1USY E;  2D5W A;  4JWO A;  3UIF A;  3G7W A;  3DP4 A;  4N13 A;  3V5A A;  5CRY A;  4GVO A;  2HZK A;  1B7U A;  1SW4 A;  3IO4 A;  4JB7 A;  1DSN A;  4ZZA A;  3D4C A;  2A5S A;  3VVE A;  3K02 A;  3V89 B;  3TCF A;  2OCU A;  3PUZ E;  4GRK A;  4NF5 A;  4Q5T A;  2ZYO A;  2QRY A;  2PYY A;  4OER A;  3KOT A;  3BKI B;  4H6D A;  4HW8 A;  3HPI A;  1IUD A;  3OEL A;  5CM6 A;  4KPT A;  3QXM A;  4Q8R A;  1LAH E;  2DS9 A;  3KJ7 A;  3GBA A;  4F2Q A;  3MZ9 A;  2B3F A;  1AH5 A;  4RK9 A;  3FVG A;  3KEI A;  4H8I A;  2Q89 A;  4XKP A;  4P0G A;  1LB9 A;  2DYX A;  3S2V A;  1UIU A;  2F34 A;  1MDQ A;  2P2A A;  5I57 A;  3OMB A;  2O69 A;  1URD A;  1DMB A;  5ICQ A;  4WED A;  4H8J A;  5IAI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...