3MPLA

Crystal structure of bordetella pertussis bvgs vft2 domain (double mutant f375e/q461e)
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
235
structure length
233
Chain Sequence
HPAYSAREQQWMADHPVVKVAVLNLFAPFTLFREQFGGISAAVLQLLQLRTGLDFEIIGVDTVEELIAKLRSGEADMAGALEVNSARESFLSFSRPYVRNGMVIVTRQDPDAPVDADHLDGRTVALVRNSAAIPLLQRRYPQAKVVTADNPSEAMLMVANGQADAVVETQISASYYVNRYFAGKLRIASALDLPPAEIALATTRGQTELMSILNKALYSISNDELASIISRWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Virulence sensor protein bvgS
publication title Periplasmic domain of the sensor-kinase BvgS reveals a new paradigm for the Venus flytrap mechanism.
pubmed doi rcsb
source organism Bordetella pertussis
total genus 70
structure length 233
sequence length 235
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2010-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3mplA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3mplA02
4YKIA 1FQAA 2I48A 4RK2A 2YLNA 2PX1A 1Z7ME 4RPNA 3M3LA 1PB7A 4KQPA 4P0GA 3OXNA 1JEVA 3B6QA 2DYXA 4GVOA 4ZEBA 1BLFA 1I6AA 3O97A 4GXAA 4KPTA 2HAVA 2YPNA 1LBBA 3O6HA 1NH8A 2HZLA 2OCUA 1QKBA 1II5A 4O3CA 3C35A 3O2AA 2DE4A 2KLFA 3KOSA 5F7VA 4N6PA 1AMFA 2F78A 2F35A 3DP4A 4KCCA 1FQCA 1P1QA 5H8FB 2XXTA 3TDJA 3RTFB 4HW8A 2XXWA 1MG1A 3PMVA 1M5DA 3MWBA 3IL1B 4BDRA 1NMUA 5J1DA 3IB0A 4GFRA 5CM6A 5FTIA 3TTMA 1DPPA 5HBCA 3IAZA 1MXXA 4RYAA 4F1VA 3IJXB 3R26A 4GF8A 2P1SA 3V83A 3MP6A 3PUWE 2X26A 3MZ1A 3KN8A 3H6TA 2QSXA 2UVHA 4RA1A 1I6BA 4LQ5A 2RINA 4DXBA 4OQOA 4EXKA 2B3FA 3N6TA 4KCDA 1H45A 4JWYA 1SD3A 2R71A 5JK4A 2DOJA 3IB1A 4FORA 3FASA 1LGBC 3CG3A 1YAEA 5IAIA 4H6DA 1QULA 1N3WA 4AB5A 3EF7A 3OEMA 4I8CA 3SKPA 3L6GA 4ND9A 5H8QB 1BIYA 3IK6B 4U21A 5AA4B 1LFIA 3IR1A 1JEUA 4ZZEA 4PFYA 4NF8A 1QUKA 2VP1A 4KYDA 2D3IA 1VR5A 4OEUA 1AL3A 3K1NA 4MLVA 4IY6A 5DEXA 1RKMA 4Z0IA 3MVYA 4F29A 5IKBA 2I4CA 3MVZA 2HQ0A 4YB6A 1SYHA 3K0VA 2B65A 5H8HB 5I57B 2O84X 4R6YA 3MJNA 1S7YA 2XXUA 1B4HA 1R9QA 1Y4CA 5AA2B 1NL5A 1KWHA 1PB9A 5CI5A 3W9VA 3WAEA 2QS1A 3MP8A 4FIMA 3FJGA 1B3HA 4AQ4A 4XKNA 1B3FA 4PE5B 1NNKA 1LAGE 1XC1A 4KR5A 2DVCA 3QXMA 5CRYA 1M5FA 3BFTA 3KJ7A 2I49A 1UTBB 2M8CA 2FA7A 3MUQA 3QK6A 5I56B 1M5CA 2QMWA 3SEYA 4LONB 4YZZA 4BDOA 1HSEA 3JV9A 3PUXE 2NOOA 3TPAA 5L9SA 3SERA 1OMPA 4GQOA 4E0XA 1XT8A 2DE2A 2CZLA 1MY4A 1FCKA 1MS7A 3TCGA 3OO8A 5DT6A 4DLDA 3MPKA 1B7UA 4GD5A 4GXSB 3E9XA 3O6IA 1ATGA 4QSCA 2DVZA 4U4XA 2OWTA 4U4SA 1N7WA 5HPQA 5BWJA 3TQLA 3M3FA 1QUJA 3ONMA 2Q8JA 4L17A 3SESA 2HCAA 2XHDA 2F97A 2OK2A 2ZNSA 1QKAA 2HFBA 1Y9UA 4H65A 2BJJX 2OLBA 3A09A 4QFNA 3PPNA 2GHAA 1P1UA 2H9BA 1B7ZA 3I3VA 5CMKA 4H5GA 5ICQA 5TP9A 4EQ9A 5KZTA 3G3JA 2ZYOA 1LLSA 5A5XA 3ILTB 1B1XA 2O7UA 2XXXA 2V84A 4NF5B 1H76A 2X7PA 4DDDA 4RXLA 4X9TA 4JWXA 1SW1A 4GOTA 2ALUA 3PMWA 4YKPA 2GH9A 1IZ1A 1VFDA 3LBSA 4YMAA 4JSOA 5FHNA 4H67A 4QFLA 4BDLA 4PP0A 4R6HA 1TFAA 4R2FA 2NUVA 3O6GA 3HHFA 3MPLA 1B0HA 1MQDA 2DWHA 4F19A 1FW0A 3FV1A 3W15C 4JDFA 3UORA 2DS9A 4LUBA 1P1NA 4R9FA 3ZS6A 3VVDA 1UTHB 3S9EA 1MDQA 3U8QA 3FATA 5I2NA 1RYXA 2RF1A 4RK9A 5CMBA 4KD5A 1A40A 1H44A 3CFXA 3TTLA 5CC2A 3OSRA 3O9PA 3FJ7A 1SW2A 4EF2A 4FEBA 4DXUA 5I2KA 3RLFE 2W7YA 3OD7A 3FJMA 3KSXA 3QIMA 5L9MA 1O7TA 2PYYA 5DVFA 3KG2A 3UN6A 3OOAA 2VHAA 2PMSA 2Z23A 4AB6A 4YMBA 2O6AA 3QYTA 3CIJA 2Q89A 5ITPA 3RNNA 4R9GA 3RT6B 1LCFA 4XKRA 1JVXA 1B0LA 3VVEA 4E0WA 3KEIA 2Z8DA 3TZAA 3EHUA 3A3UA 3THIA 1D3KA 1H3DA 1OLCA 1MXWA 3M3KA 4UA8A 2A5TB 1FTLA 1B1HA 1N84A 1H43A 1F9BA 3T9UA 3CSBA 3I5OA 1P1WA 3IOWA 1B40A 2H5YA 1XS5A 1MPDA 1CB6A 3BFUA 3KSJA 3DP8A 1MH4A 4H8IA 4DCXA 5H8NA 2UVGA 2QMXA 2F7CA 1WODA 1NNTA 4GWOA 2R6GE 3GLBA 1OVBA 4EUOA 3TMGA 1ZJLA 2QS3A 1IXIA 4RPOA 1MPBA 4NF4B 3HCQA 3C31A 3FVNA 2DSFA 3D4GA 1SI1A 1J1NA 3D4CA 4OENA 2Z8EA 3FD3A 2QPQA 4DIGA 3PV0E 5FHMA 1GV8A 2UVIA 4JXIA 4MH5A 1TWYA 5AA1A 1WVJA 2G29A 1MXYA 3PPPA 2XXVA 3OSQA 4NMYA 3GBBA 2F8DA 3U1OA 2ABHA 2XX9A 3FXQA 2I3WA 5DVIA 2ONRA 3PPRA 4FEDA 5CMCA 5K2YA 3HSTA 2XXQA 4IGRA 3C32A 3OMBA 5CMMA 2UYFA 3H6UA 1BKAA 1I6QA 1TFDA 4RY1A 5AA2A 3DELB 1B6HA 1US5A 4H8JA 2FYIA 5I58A 4WXJA 4F18A 1MPCA 3PD8A 2LAOA 1EU8A 1IIWA 3SDFA 3SEXA 4R74A 2V93A 4FECA 1HSJA 4HTGA 2XD2A 3ZKKA 5JTYB 1Y1ZA 3B7DA 3K00A 3N94A 3IO4A 2OBGA 1Y3QA 2Q88A 4PETA 1FQDA 3OELA 4G8MA 4GLIA 4U2RA 4I9DA 3AXFA 3KN3A 2ZNTA 4GL8A 5I59B 4C0RA 4THIA 2HAUA 3TAJA 2ONKE 5ISUA 2DWIA 3T9HB 2ESNA 2A5SA 4F1YA 4QSEA 1B5JA 3PD9A 2E1SA 5AE4A 3C36A 4MF3A 4YKJA 5CBSA 4QFPA 3C34A 2OJTA 3RGYA 4X48A 3HPIA 1S9TA 3IOTA 4KI0E 5KDTB 2ZXTA 2RC8A 4RJZA 5K2XA 1WDNA 2XX7A 5B7DA 4C1TA 1JW5A 3KZGA 4QSDA 3CRBA 1ELJA 4Q30B 1IXGA 3DM0A 4XKPA 3K6WA 4JWOA 1LSTA 3KFMA 1LFHA 3K6UA 2AL5A 4ONYA 3I6VA 5B70A 1M5EA 3FGSA 2V3QA 3IB2A 1JETA 1P1OA 3QUFA 4OESA 3H06B 3RTWB 4ESXA 1ZTYA 1B3EA 3RQTA 1PB8A 3K1MA 2XXPA 2UYEA 3DLNA 1D9YA 3O28A 4ZDMA 2AL4A 3CFZA 1JW1A 2H99A 3CVGA 4N13A 2H4IA 4X1DA 3Q27A 5KCJB 4ZZAA 1URDA 3QAXA 2Z8FA 4U1OA 1M5BA 3PPOA 2V3TA 1B52A 4NF6A 1ZBMA 4U22A 3VXBA 2FNCA 3IJOB 3FVKA 2REJA 4ZEKA 3T93B 1LCTA 4OFJA 1MRPA 1MQIA 3CG1A 2G93A 3EPEA 2XX8A 3PGFA 3O29A 4IO3A 1VE4A 1IXCA 4IGTA 4LA9A 4PQJA 3MBPA 1D4NA 4XIGQ 4QRZA 4IB2A 1XHYA 3OO9A 1JVYA 1TXFA 3U72A 3KGCA 1DSNA 4YU0A 1MXUA 4ZEDA 3M8UA 4KHZE 3V5AA 3FVGA 1B9JA 4Q0CA 4PFWA 1ZIUA 3Q29A 4KYEA 2UVJA 1JQFA 1QVSA 3VV5A 3G3HA 3G3FA 2F7BA 1EZPA 3S4UA 1O64A 4JSDA 4LP2B 1QW0A 2V25A 4QFOA 3B6WA 1Y3PA 4YB7A 3FV2A 4XTCQ 4IO2A 4NF8B 3CSGA 2DXYA 2F7AA 3LSLA 3HV1A 2VGQA 1N04A 4TLMB 4NE4A 2Q2CA 4G68A 1UQWA 3S9MC 3EHTA 3TCFA 5DEXB 1FQFA 3T96B 2F6GA 3UA8A 2O1LA 3H6VA 3PUYE 1QJMA 2I4BA 4TLLB 1SBPA 4BDNA 4DXCA 3TTKA 1MXVA 2XD3A 3HHGA 1B5HA 4TQUQ 3DP6A 4G4PA 3ZSFA 1PBQA 4LQ2A 2P2AA 1MY2A 1P99A 4LATA 3UK4A 3GBAA 3HO7A 3W9WA 4HS7A 3U94A 4FAJA 4ELOA 4IO5A 1A8FA 4U1ZA 4F3GA 2ZMBA 1N7XA 4ZEFA 2QRYA 1DOTA 3KN7A 5CBRA 2ZYNA 1Y4TA 1B3GA 2XXHA 3N6UA 3LSXA 2OZZA 3S9LC 4NTLA 4PFTA 1ZLQA 3VFJA 1B58A 2NVUB 2Y7WA 3MZ9A 4NWDA 1YTVA 2E0SA 1A8EA 1B2HA 1MY1A 2PT2A 5H8FA 3PUVE 2HZKA 4FE8A 4EXLA 4X1BA 4I62A 2UXAA 1Y1MA 2ZNUA 2ZYKA 4OVJA 4FJPA 3K1PA 3EHSA 1LBCA 2VD3A 1POY1 3OENA 3E13X 1OLAA 3Q26A 1JW4A 3N26A 2F5XA 1B32A 2ANJA 4M4GA 4ELPA 3LSFB 2PVUA 1URGA 1USYH 3V8XB 3BBRA 4G2ZA 3K6VA 1UIVA 4EQ7A 2QS2A 3IX1A 4OFLA 2XXIA 4ELRA 5TP9B 3ZKLA 1PBPA 4ISUA 4EQBA 3K02A 4IO7A 1N3XA 3TTNA 3H4ZA 5ITOA 2F34A 4WEDA 1DMBA 4ESWA 2XXYA 4LVQA 3VXCA 2I58A 3TCHA 2H25A 3ECRA 3IO6A 5JEIA 1TT1A 1FTKA 2NXOA 3LR1A 4BLAA 4ZEIA 5AA3A 1DTGA 5H8QA 5AA4A 1EZ9A 1IQ7A 3E3KA 5M2VA 4KYSA 1LAHE 4Q8RA 3EQ1A 2D21A 3S9NC 1B4ZA 2F36A 5I2NB 1SW5A 1R6ZA 3KOTA 5H8SA 1FTOA 1A99A 3TKDA 5F1QA 1RYOA 3S2VA 4F22A 3JZJA 3K6XA 1AH5A 1OQGA 3K01A 4LZ5A 5H8HA 5I57A 5I2KB 4QFKA 2ONSA 1US4A 4IO4A 3E4RA 2GHBA 2Y7IA 1PDAA 4G8NA 1PC3A 4ECFA 1SVXB 1SQYA 1SI0A 3MC2A 4G68C 1Z7NE 1UTBA 5KCJA 3CR9A 1B05A 5I56A 1FTJA 4MFIA 3MVXA 3T22A 1GTKA 4POWA 2O51A 3FVOA 4U23A 2ZYMA 3KJTA 4M1VA 2RC9A 1LFGA 3N5LA 4H5FA 2F6PA 4ZE8A 3L6HA 1JNFA 1BTJA 3TYHA 4OFOA 2QJEA 1L5TA 5I84A 1UIUA 3FUZA 3RT8A 2IA4A 2AYSA 3SEUA 1A7LA 3UIFA 3FXUA 1NNFA 3Q28A 2RCAA 3GZGA 5EHSA 2IEEA 3MZBA 2V3UA 2RKMA 4OETA 2QL3A 4UACA 4GIZA 5H8NB 1XOCA 3IOVA 4F3SA 3PU5A 3G3GA 2Y7RA 5TPAB 5AA2D 3PMXA 3UGWA 2XXRA 4DZ1A 3Q25A 3K4UA 1IUDA 1LB8A 4F39A 2H98A 2I0BA 4GRKA 2DWJA 4MBPA 4OEVA 4G77A 4LZ7A 4OERA 4F2OA 2RC7A 3H03A 4JBZA 4EDPA 2I6EA 4WEPA 4NF5A 1LB9A 4QF9A 1MY3A 3LUYA 1MY0A 4G8HA 3TTRA 5ELVA 4PFUA 1DPEA 1MQJA 3TUSA 4TOZA 1LAFE 1B7HA 1O63A 5ICTA 5DTBA 4N07A 5I58B 4DCYA 1UTHA 1SYIA 4F3PA 1FQEA 3MP1A 3RN8A 4OZ9A 3G3KA 4R2BA 3F11A 1MQHA 4LZ8A 3USDA 3TQWA 3SETA 4DE8A 1YCJA 1NH7A 4OTEA 2O1MA 1VFEA 4K3FA 4Z7EA 1R9LA 3JYRA 1MXZA 3TEPA 2HXWA 1ZU0A 1HSLA 3SEVA 2D5WA 3PUZE 3TFLA 1ANFA 1MDP1 4O3BA 3B6TA 4POXA 1ZMGA 3FXRA 4YKKA 3VVFA 4P0IA 2DQVA 4FATA 4OHNA 3VDFA 1R1NA 4GL0A 4EF1A 2VD2A 1PEBA 1GVCA 2NWJA 3SEWA 1MM6A 4ZECA 5HM4B 1B3LA 1GR2A 2Y7PA 1AOVA 2O7IA 2OWSA 3A3CA 4IY5A 4ELQA 4OYVA 2A5TA 1Y3NA 1Q35A 3BKIB 1XVXA 1NKXA 3K2DA 3MVWA 1N76A 1OVTA 2I0CA 1N0TA 2O68A 4R75A 1YPNA 3C4MA 1FTMA 5BUUA 3T9VA 3VLUA 1FQBA 4IO6A 1S50A 1OQHA 2PBWA 3H6WA 1AIVA 3U92A 5L9OA 1URSA 3VE1B 4ZS9A 1NFTA 2DP8A 3MAMA 3CFLA 4C1UA 3WAFA 4BDQA 1T0KA 4F2QA 1VSOA 3MW0A 1I69A 4R72A 4NF4A 2RCBA 3P7IA 4JB7A 1D9VA 1B46A 4NWCA 4OXVA 1NNPA 3RY3A 4WKMA 5FTHA 5DYHA 3R7XA 1A55A 4QHQA 4NEDA 4MLQA 3LSWA 5L8DA 3OO7A 2WKYA 2Z22A 2DE3A 1MQGA 4NF6B 3O66A 3RPWA 4I1DA 3G7WA 3LC8A 5DVJA 4HCYA 1USYE 3CI8A 1IEJA 3TODA 4BDMA 4XKQA 2REGA 5EHMA 4YB5A 4OMBA 2AIXA 3C9HA 1Y20A 1Q1KA 3TELA 2Q2AA 1OIBA 2P0SA 3OO6A 3FIRA 4H0WA 1MM7A 2GFEA 5EYFA 3V89B 3U93A 1B5IA 3EN3A 2DXRA 3UP9A 4O3AA 4F3BA 3R6UA 3H7MA 4YICA 3GXAA 3ILUB 3IORA 3QSLA 1A54A 1ZKBA 2Q9TA 3PPQA 1IXHA 1DTZA 3RUMA 5JTYA 1XVYA 4RNSA 4HCWA 3VLVA 2QS4A 3KBRA 2VOZA 2B3BA 5LOMA 3ODBA 4YAHX 2THIA 2HEUA 4F1UA 4XXUA 1POTA 1SDXA 1MH3A 1LAXA 5I59A 1SW4A 2CMOA 2GRVA 1CE2A 2Y84A 4KFQA 2YJPA 3C33A 5A5XB 1BP5A 1QUIA 2O69A 4H1XA 2X7QA 4G68B 3IOUA 1B51A 3T9XB 4ZE9A 4R73A 2DWAA 1GGGA 4F31B 3G3IA 3MQ9A 2PT1A 3T66A 1IITA 4P11A 4OWDA 5FHOA 4R6KA 1EH3A 3QUJA 2R9JA 4Q5TA 3OEKA 1EZOA 5TPAA 5KDTA 3FZVA 2Y7KA 3VLWA 2I3VA 5TU0A 3H3GA 3HN0A
chains in the Genus database with same CATH superfamily
4YKIA 3RYDA 1FQAA 2I48A 4RK2A 2YLNA 2PX1A 1Z7ME 4GWSA 4RPNA 3M3LA 1PB7A 4KQPA 4P0GA 3OXNA 1EYIA 1JEVA 2CEYA 3B6QA 2DYXA 5J16A 4MX6A 4GVOA 4ZEBA 1BLFA 1I6AA 3O97A 4GXAA 1IMCA 4KPTA 2HAVA 2YPNA 1LBBA 3O6HA 4N91A 1NH8A 3E79A 2HZLA 2OCUA 2R8TA 1QKBA 1II5A 4O3CA 3C35A 3O2AA 2DE4A 2KLFA 3KOSA 5F7VA 4N6PA 1AMFA 2F78A 3ISPA 2F35A 4XF5A 2PFZA 3DP4A 4KCCA 2XWIA 1FQCA 1P1QA 5H8FB 1D9QA 2XXTA 3TDJA 3RTFB 1LBWA 4HW8A 2XXWA 1IMBA 1MG1A 3PMVA 1M5DA 3MWBA 3IL1B 4BDRA 1NMUA 5J1DA 3IB0A 4GFRA 5CM6A 5FTIA 3TTMA 1DPPA 5HBCA 1FBGA 3IAZA 1MXXA 4RYAA 3HFUA 4F1VA 3IJXB 3R26A 4GF8A 2P1SA 3V83A 3MP6A 3PUWE 4PDDA 2X26A 4H45A 3MZ1A 3KN8A 3H6TA 2QSXA 5ET7A 2UVHA 4RA1A 1FBEA 4H46A 1I6BA 4LQ5A 2RINA 1LBYA 4DXBA 4OQOA 4EXKA 2B3FA 3N6TA 3NOHA 4KCDA 1H45A 2MKZA 4P56A 4JWYA 1SD3A 2R71A 5JK4A 2DOJA 3IB1A 4FORA 4N6KA 2HPGA 3FASA 1LGBC 2F3DA 3CG3A 1YAEA 5IAIA 3RPLB 1VDWA 4H6DA 4I3YA 1QULA 4PDHA 1N3WA 4P9KA 4AB5A 4N4UA 3EF7A 3OEMA 4I8CA 3SKPA 3L6GA 4ND9A 5H8QB 1BIYA 3IK6B 4U21A 5AA4B 3BIGA 4OANA 2HXRA 4UABA 1LFIA 1FSAA 3IR1A 1JEUA 4ZZEA 4PFYA 4NF8A 1QUKA 2VP1A 4KYDA 2D3IA 3B8BA 4KXPA 1VR5A 4OEUA 5I5PA 1AL3A 3K1NA 2CEXA 4MLVA 4IY6A 5DEXA 1RKMA 4Z0IA 3MVYA 4F29A 5IKBA 2I4CA 3MVZA 2HQ0A 4YB6A 1SYHA 3K0VA 2B65A 1G0HA 5H8HB 5I57B 2O84X 4AS5A 4R6YA 3MJNA 1S7YA 2XXUA 1B4HA 1R9QA 1Y4CA 5AA2B 1NL5A 1KWHA 1PB9A 5CI5A 3W9VA 3WAEA 2QS1A 3MP8A 4FIMA 3FJGA 1B3HA 4AQ4A 4XKNA 1B3FA 4PE5B 1NNKA 1LEVA 1LAGE 1XC1A 4KR5A 2DVCA 3QXMA 5CRYA 1M5FA 3BFTA 3KJ7A 2I49A 1UTBB 2M8CA 2FA7A 3MUQA 2JJKA 3QK6A 5I56B 1M5CA 5F24A 2QMWA 3SEYA 4LONB 4YZZA 4BDOA 1HSEA 3JV9A 3PUXE 4FBPA 2NOOA 3TPAA 5L9SA 3SERA 1OMPA 4GQOA 4HE2A 1FBPA 4E0XA 1XT8A 2DE2A 2XWKA 2CZLA 1MY4A 1FCKA 1MS7A 3TCGA 4JVDA 3OO8A 5DT6A 4N81A 4DLDA 5EYGA 3MPKA 5I3SA 1B7UA 4NF0A 4GD5A 4GXSB 3E9XA 3O6IA 1ATGA 4QSCA 2DVZA 4U4XA 2OWTA 4U4SA 1N7WA 5HPQA 5BWJA 3TQLA 3M3FA 1QUJA 4HXVA 3ONMA 2Q8JA 1RDZA 2Q8MA 4OA4A 4L17A 3SESA 2HCAA 2XHDA 2F97A 2OK2A 2ZNSA 1QKAA 2HFBA 1Y9UA 4H65A 2BJJX 2OLBA 3A09A 4QFNA 3PPNA 1DCUA 2GHAA 1P1UA 2H9BA 1B7ZA 3I3VA 5CMKA 4H5GA 5ICQA 5TP9A 3ROJA 4EQ9A 5KZTA 2VT5A 3G3JA 2ZYOA 1LLSA 4GX6A 4MNIA 5A5XA 3ILTB 1B1XA 2O7UA 2QVVA 2XXXA 2V84A 2WX9A 4NF5B 1H76A 4PF6A 2X7PA 4DDDA 4RXLA 4X9TA 4JWXA 1SW1A 4GOTA 4IR8A 2ALUA 3LUZA 3PMWA 4YKPA 2GH9A 1FJ6A 1IZ1A 1VFDA 3LBSA 4YMAA 4JSOA 5FHNA 4H67A 4QFLA 4BDLA 4PP0A 4R6HA 3MYUA 1TFAA 4R2FA 2NUVA 3O6GA 3HHFA 1FBHA 3MPLA 1B0HA 1MQDA 2DWHA 4F19A 1FW0A 3FV1A 3W15C 4JDFA 3UORA 2DS9A 4LUBA 4OVPA 1P1NA 4R9FA 3ZS6A 3VVDA 1UTHB 3S9EA 1MDQA 3U8QA 3FATA 5I2NA 1RYXA 2RF1A 4RK9A 5CMBA 4KD5A 1A40A 1H44A 4GWYA 4MIJA 1FPFA 3CFXA 3TTLA 5CC2A 3OSRA 3O9PA 1LBVA 3FJ7A 1SW2A 4MEVA 4EF2A 2FBPA 4FEBA 4DXUA 5I2KA 3RLFE 2W7YA 3OD7A 3FJMA 3KSXA 3QIMA 5L9MA 1O7TA 2PYYA 5DVFA 3KG2A 2FIXA 3UN6A 3OOAA 2VHAA 2PMSA 2Z23A 4PGPA 4AB6A 2WYPA 4YMBA 4N17A 4GWWA 1FBDA 2O6AA 3QYTA 3CIJA 2Q89A 5ITPA 3RNNA 4R9GA 3RT6B 1LCFA 4XKRA 1JVXA 1B0LA 3VVEA 4E0WA 1FPKA 3KEIA 2Z8DA 3EHUA 3THIA 3A3UA 3TZAA 1D3KA 1EYJA 1H3DA 1OLCA 1MXWA 3M3KA 4UA8A 2A5TB 1FTLA 1B1HA 4P8BA 1N84A 1H43A 1F9BA 3T9UA 3CSBA 3I5OA 1P1WA 3IOWA 1B40A 2H5YA 1XS5A 1MPDA 1CB6A 3BFUA 3KSJA 3DP8A 1MH4A 4H8IA 4DCXA 5H8NA 2UVGA 2QMXA 2F7CA 4O7IA 2WBDA 1LBZA 1WODA 1NNTA 4GWOA 2Y5LA 2R6GE 2HHMA 3GLBA 1OVBA 4EUOA 3TMGA 1ZJLA 2QS3A 1IXIA 2OWZA 4RPOA 1MPBA 4NF4B 3HCQA 3C31A 3FVNA 2DSFA 3D4GA 3LV0A 1SI1A 1J1NA 3D4CA 4OENA 2Z8EA 3FD3A 2QPQA 4DIGA 3PV0E 1NV1A 5FHMA 1GV8A 2UVIA 4JXIA 4MH5A 1TWYA 5AA1A 3FBPA 1WVJA 2G29A 1MXYA 1KA1A 1XI6A 1FPLA 2VPNA 3GYYA 3PPPA 1NUZA 2BJIA 2XXVA 3OSQA 4NMYA 1INPA 3GBBA 4O8MA 2CZIA 2F8DA 3U1OA 2ABHA 2XX9A 3FXQA 2I3WA 5DVIA 2ONRA 3PPRA 4FEDA 5CMCA 5K2YA 3HSTA 2XXQA 4IGRA 3C32A 3OMBA 5CMMA 2UYFA 3H6UA 2B4LA 1BKAA 1NI9A 1I6QA 1FPDA 1TFDA 4RY1A 5AA2A 3DELB 4PE3A 1B6HA 1US5A 4H8JA 4N8GA 2FYIA 3BIHA 5A5LA 4WXJA 5I58A 4F18A 1MPCA 3PD8A 4PAKA 2LAOA 2WEFA 1EU8A 1IIWA 3SDFA 3SEXA 4R74A 5IZ3B 2V93A 2Y5KA 4FECA 2FHYA 1HSJA 4HTGA 1RDXA 2XD2A 3ZKKA 5JTYB 1FPJA 1FJ9A 1Y1ZA 3B7DA 3K00A 3N94A 3IO4A 2OBGA 1Y3QA 2Q88A 4PETA 1FQDA 3OELA 4G8MA 4GLIA 4U2RA 4I9DA 3AXFA 4GX4A 3KN3A 2ZNTA 4GL8A 4GBVA 5I59B 4C0RA 4THIA 2XWVA 5T3JA 2HAUA 4LN5A 3TAJA 2ONKE 5ISUA 2DWIA 3T9HB 2ESNA 2A5SA 4F1YA 4QSEA 1B5JA 3PD9A 4HE1A 2E1SA 5AE4A 5EQAA 3C36A 4MF3A 4P47A 4YKJA 5CBSA 4QFPA 3C34A 2OJTA 3RGYA 4X48A 3HPIA 1S9TA 4N8YA 3IOTA 4KI0E 5KDTB 2ZXTA 2RC8A 2QVUA 4RJZA 5K2XA 1WDNA 4MHFA 2XX7A 5B7DA 4C1TA 1JW5A 3KZGA 4QSDA 3CRBA 1ELJA 4Q30B 1NV4A 1IXGA 3DM0A 4XKPA 1NV0A 3K6WA 4JWOA 1LSTA 5LTCA 3KFMA 1LFHA 3K6UA 2AL5A 4ONYA 3I6VA 5B70A 1M5EA 3FGSA 2V3QA 3IB2A 1JETA 1P1OA 3QUFA 4OESA 3H06B 3RTWB 4ESXA 1ZTYA 1B3EA 3RQTA 1PB8A 3K1MA 2XXPA 2UYEA 3DLNA 3D1RA 1D9YA 2P3NA 3O28A 4ZDMA 2AL4A 3KC0A 3CFZA 4NQ8A 1JW1A 2H99A 3CVGA 4N13A 2H4IA 2QVRA 4X1DA 3Q27A 5KCJB 4NN3A 4ZZAA 1URDA 3QAXA 2Z8FA 4U1OA 1M5BA 3PPOA 2V3TA 1B52A 4OVRA 4NF6A 1ZBMA 4U22A 3VXBA 2FNCA 3IJOB 3FVKA 2REJA 4ZEKA 3IFAA 5ET6A 3T93B 1LCTA 4OFJA 1MRPA 1MQIA 5IZ1A 3CG1A 4X04A 2G93A 3EPEA 2XX8A 3PGFA 5EQ8A 3O29A 4IO3A 1VE4A 1IXCA 4IGTA 4LA9A 4O7MA 4PQJA 5EQ9A 1DBZA 3MBPA 1D4NA 4XIGQ 3T1BA 4QRZA 4IB2A 1XHYA 3OO9A 2F3BA 1NV6A 1JVYA 1TXFA 3U72A 3KGCA 1DSNA 4YU0A 1MXUA 4ZEDA 3M8UA 4KHZE 3V5AA 3FVGA 1B9JA 4Q0CA 4PFWA 1ZIUA 3Q29A 4KYEA 2UVJA 1JQFA 1QVSA 2ZZXA 1IMAA 2WYKA 3VV5A 3G3HA 2DDKA 3G3FA 2F7BA 1EZPA 1FRPA 3S4UA 1O64A 4JSDA 4LP2B 1QW0A 2V25A 4QFOA 2QFLA 3B6WA 1Y3PA 4YB7A 3FV2A 4XTCQ 4IO2A 4NF8B 3CSGA 2DXYA 2F7AA 3LSLA 3HV1A 2VGQA 1N04A 4TLMB 4NE4A 2Q2CA 4G68A 1UQWA 3S9MC 4PFRA 3EHTA 5IGAA 3TCFA 5DEXB 1FQFA 3T96B 2F6GA 4GX3A 3UA8A 2O1LA 3H6VA 4DI4B 3QMFA 3PUYE 1QJMA 1NUXA 2I4BA 2XWOA 1FBCA 4TLLB 1SBPA 5FBPA 4BDNA 4DXCA 3TTKA 1NUYA 2FIEA 1MXVA 2XD3A 3HHGA 4TQUQ 1B5HA 4I3EA 3DP6A 4G4PA 3ZSFA 5ESYA 1PBQA 4LQ2A 1SPIA 2P2AA 1MY2A 1P99A 4LATA 3UK4A 3GBAA 3HO7A 2CZHA 3W9WA 4HS7A 3U94A 4FAJA 4ELOA 4XEQA 4QXDA 4IO5A 3IFCA 1A8FA 4U1ZA 4F3GA 2WBBA 1N7XA 2ZMBA 4ZEFA 2QRYA 1DOTA 3KN7A 5CBRA 2ZYNA 1Y4TA 1B3GA 2ZZVA 2XXHA 3N6UA 3LSXA 4PCDA 2OZZA 3S9LC 4NTLA 4PFTA 1ZLQA 3VFJA 1B58A 2NVUB 2Y7WA 3MZ9A 4NWDA 1YTVA 2E0SA 3KC1A 1A8EA 3A29A 1B2HA 1MY1A 2PT2A 4PF8A 5H8FA 3EKIA 3PUVE 2HZKA 4FE8A 4EXLA 4X1BA 4I62A 2UXAA 1Y1MA 2L5VA 2ZNUA 1NUWA 2ZYKA 4OVJA 4FJPA 3K1PA 3U65A 3EHSA 1LBCA 2VD3A 2VPOA 1POY1 3OENA 3E13X 1OLAA 3Q26A 1JW4A 3N26A 2F5XA 1B32A 2ANJA 4M4GA 4ELPA 3LSFB 2PVUA 1URGA 1IMDA 1USYH 3V8XB 3BBRA 4G2ZA 3K6VA 1UIVA 4EQ7A 2QS2A 3IX1A 4OFLA 2XXIA 4ELRA 5TP9B 3ZKLA 1AWBA 1PBPA 4ISUA 4EQBA 3K02A 4IO7A 1N3XA 2GQ1A 4NGUA 3TTNA 3H4ZA 4DI3D 5ITOA 2F34A 4WEDA 1DMBA 4MNCA 2XXYA 4ESWA 2CZKA 4LVQA 3VXCA 2I58A 3TCHA 3T0JA 2H25A 4MAGA 3ECRA 3IO6A 3RPLA 5JEIA 1QGXA 1CNQA 1BK4A 4MNPA 1TT1A 1FTKA 2NXOA 4XFEA 3LR1A 2OX3A 4BLAA 1NV7A 4ZEIA 2XA5A 1DTGA 1FPBA 5AA3A 5H8QA 5AA4A 1JP4A 1EZ9A 1IQ7A 3E3KA 5M2VA 4KYSA 1LAHE 4Q8RA 3EQ1A 2D21A 3S9NC 1B4ZA 2F36A 5I2NB 1SW5A 1R6ZA 3KOTA 5H8SA 1EYKA 1LBXA 1FTAA 1FTOA 1A99A 3TKDA 5F1QA 1RYOA 3S2VA 4F22A 3JZJA 3K6XA 1AH5A 1OQGA 3K01A 4LZ5A 5H8HA 5I57A 5I2KB 4QFKA 2ONSA 1US4A 4IO4A 3E4RA 2GHBA 2Y7IA 1PDAA 4G8NA 1PC3A 4ECFA 4O94A 1SVXB 1SQYA 1SI0A 4PFIA 3MC2A 4G68C 1Z7NE 1UTBA 1DK4A 5KCJA 3CR9A 1B05A 5I56A 1FTJA 4MFIA 3MVXA 1YXIA 3T22A 4PBHA 1GTKA 4POWA 2O51A 3FVOA 4U23A 2ZYMA 3KJTA 4M1VA 2RC9A 1LFGA 3N5LA 4H5FA 2F6PA 4ZE8A 4OVTA 3L6HA 1JNFA 1BTJA 3TYHA 4OFOA 2QJEA 1L5TA 2PFYA 5I84A 1UIUA 3FUZA 3RT8A 2IA4A 2Q74A 2AYSA 3SEUA 1A7LA 3UIFA 3FXUA 1NNFA 3Q28A 2RCAA 3GZGA 5EHSA 2IEEA 3MZBA 2V3UA 2RKMA 4OETA 2QL3A 4UACA 4GIZA 5H8NB 2KQZA 1XOCA 1RDYA 3IOVA 4F3SA 2FVZA 3PU5A 3G3GA 2Y7RA 3CHGA 5TPAB 5AA2D 3PMXA 3UGWA 2XXRA 2XXKA 5ET5A 4DZ1A 3Q25A 3K4UA 1IUDA 4PBQA 1LB8A 4F39A 2H98A 2I0BA 4GRKA 2DWJA 4AS4A 4MBPA 1K9ZA 4PTKA 4OEVA 4G77A 1Q9DA 4LZ7A 4OERA 4PC9A 1KA0A 4F2OA 2RC7A 3H03A 4JBZA 4NG7A 4EDPA 2I6EA 4WEPA 1G0IA 4NF5A 3SZPA 1LB9A 4NX1A 4QF9A 1MY3A 3LUYA 5IM2A 1MY0A 4G8HA 4MCOA 3TTRA 5ELVA 5LDZA 5IZZA 5I7IA 4PFUA 3FXBA 3MSTA 4JVIA 1DPEA 1MQJA 3TUSA 2KR0A 4TOZA 1LAFE 1B7HA 1O63A 4NHBA 5ICTA 5DTBA 4N07A 5I58B 4DCYA 1UTHA 4OVSA 1SYIA 4F3PA 1YYZA 1FQEA 3MP1A 3RN8A 4OZ9A 3G3KA 4QBAA 4R2BA 3F11A 1NV5A 1MQHA 4LZ8A 3USDA 3TQWA 3SETA 4DE8A 1YCJA 1NH7A 4OTEA 2O1MA 1VFEA 4K3FA 4Z7EA 1R9LA 5EYHA 3JYRA 1MXZA 3TEPA 2HXWA 3PTYA 1ZU0A 1FPIA 4P3LA 4GBWA 4GWZA 1HSLA 3SEVA 2D5WA 3PUZE 3TFLA 1NV3A 1ANFA 1MDP1 4O3BA 3B6TA 4POXA 4NAPA 1ZMGA 3FXRA 4YKKA 3VVFA 4P0IA 2DQVA 4FATA 4G61A 4OHNA 3VDFA 1R1NA 4GL0A 4EF1A 2VD2A 1PEBA 1GVCA 2NWJA 3SEWA 1MM6A 4ZECA 4X8RA 5HM4B 1B3LA 1GR2A 2Y7PA 1AOVA 2O7IA 4PGNA 2OWSA 3A3CA 4IY5A 4ELQA 4OYVA 2A5TA 3E78A 1Y3NA 4OVQA 1Q35A 3BKIB 4I40A 1XVXA 1NKXA 3K2DA 3MVWA 1KZ8A 1N76A 1OVTA 5ET8A 2I0CA 1N0TA 2O68A 4R75A 1YPNA 3C4MA 1FTMA 5BUUA 3T9VA 1IMFA 3VLUA 1FQBA 4IO6A 1S50A 1OQHA 2PBWA 3H6WA 1AIVA 3U92A 5L9OA 1URSA 3VE1B 4ZS9A 1NFTA 2DP8A 3MAMA 4PFBA 3CFLA 4C1UA 3WAFA 4BDQA 4HE0A 1T0KA 4F2QA 2B4MA 1VSOA 3MW0A 1I69A 4R72A 4NF4A 2RCBA 3P7IA 4JB7A 1D9VA 1B46A 4NWCA 4OXVA 1NNPA 3RY3A 4WKMA 4MJOA 5FTHA 5DYHA 3R7XA 1A55A 1IMEA 4QHQA 4NEDA 4MLQA 4N6DA 2P3VA 3LSWA 5L8DA 3OO7A 2WKYA 2Z22A 2DE3A 1MQGA 2PCRA 4NF6B 3O66A 3RPWA 4I1DA 3G7WA 3LC8A 5DVJA 4HCYA 1USYE 3CI8A 1IEJA 3TODA 4BDMA 4XKQA 2REGA 4GWUA 5EHMA 4YB5A 4JVCA 4OMBA 3B50A 1YZ0A 2AIXA 3C9HA 5EQ7A 1Y20A 1Q1KA 3TELA 2Q2AA 1OIBA 2P0SA 3OO6A 3FIRA 4H0WA 1MM7A 2GFEA 5EYFA 3V89B 3U93A 1B5IA 3EN3A 2DXRA 3UP9A 4O3AA 4F3BA 3R6UA 3H7MA 4YICA 3GXAA 3ILUB 3IORA 5IZ3A 3QSLA 1A54A 1ZKBA 2Q9TA 3PPQA 1IXHA 1DTZA 3RUMA 5JTYA 1XVYA 4RNSA 4HCWA 5DW8A 3VLVA 1FPGA 2QS4A 3KBRA 2V4CA 2VOZA 2B3BA 5LOMA 3ODBA 4YAHX 1K9YA 2THIA 2HEUA 4F1UA 4XXUA 1POTA 1SDXA 1MH3A 1LAXA 4P1LA 5I59A 1SW4A 2CMOA 2GRVA 1CE2A 2Y84A 4KFQA 2YJPA 3C33A 5A5XB 4PAFA 2ZZWA 1BP5A 1QUIA 2O69A 4H1XA 4PAIA 2X7QA 1NV2A 4G68B 3IOUA 1B51A 4P1EA 3T9XB 4ZE9A 4R73A 3KBZA 2DWAA 1FBFA 1FPEA 1GGGA 4F31B 3G3IA 3MQ9A 4GWXA 2PT1A 3T66A 1IITA 4P11A 4OWDA 5FHOA 4R6KA 4MMPA 1EH3A 3QUJA 2R9JA 4Q5TA 3OEKA 4N15A 1EZOA 5TPAA 5KDTA 3FZVA 2Y7KA 3VLWA 2I3VA 5TU0A 3H3GA 3HN0A
chains in the Genus database with same CATH topology
4YKIA 1FQAA 2I48A 4RK2A 2YLNA 2PX1A 1Z7ME 4RPNA 3M3LA 1PB7A 4KQPA 4P0GA 3OXNA 1JEVA 3B6QA 2DYXA 4GVOA 4ZEBA 1BLFA 1I6AA 3O97A 4GXAA 4KPTA 2HAVA 2YPNA 1LBBA 3O6HA 1NH8A 2HZLA 2OCUA 1QKBA 1II5A 4O3CA 3C35A 3O2AA 2DE4A 2KLFA 3KOSA 5F7VA 4N6PA 1AMFA 2F78A 2F35A 3DP4A 4KCCA 1FQCA 1P1QA 5H8FB 2XXTA 3TDJA 3RTFB 4HW8A 2XXWA 1MG1A 3PMVA 1M5DA 3MWBA 3IL1B 4BDRA 1NMUA 5J1DA 3IB0A 4GFRA 5CM6A 5FTIA 3TTMA 1DPPA 5HBCA 3IAZA 1MXXA 4RYAA 4F1VA 3IJXB 3R26A 4GF8A 2P1SA 3V83A 3MP6A 3PUWE 2X26A 3MZ1A 3KN8A 3H6TA 2QSXA 2UVHA 4RA1A 1I6BA 4LQ5A 2RINA 4DXBA 4OQOA 4EXKA 2B3FA 3N6TA 4KCDA 1H45A 4JWYA 1SD3A 2R71A 5JK4A 2DOJA 3IB1A 4FORA 3FASA 1LGBC 3CG3A 1YAEA 5IAIA 4H6DA 1QULA 1N3WA 4AB5A 3EF7A 3OEMA 4I8CA 3SKPA 3L6GA 4ND9A 5H8QB 1BIYA 3IK6B 4U21A 5AA4B 1LFIA 3IR1A 1JEUA 4ZZEA 4PFYA 4NF8A 1QUKA 2VP1A 4KYDA 2D3IA 1VR5A 4OEUA 1AL3A 3K1NA 4MLVA 4IY6A 5DEXA 1RKMA 4Z0IA 3MVYA 4F29A 5IKBA 2I4CA 3MVZA 2HQ0A 4YB6A 1SYHA 3K0VA 2B65A 5H8HB 5I57B 2O84X 4R6YA 3MJNA 1S7YA 2XXUA 1B4HA 1R9QA 1Y4CA 5AA2B 1NL5A 1KWHA 1PB9A 5CI5A 3W9VA 3WAEA 2QS1A 3MP8A 4FIMA 3FJGA 1B3HA 4AQ4A 4XKNA 1B3FA 4PE5B 1NNKA 1LAGE 1XC1A 4KR5A 2DVCA 3QXMA 5CRYA 1M5FA 3BFTA 3KJ7A 2I49A 1UTBB 2M8CA 2FA7A 3MUQA 3QK6A 5I56B 1M5CA 2QMWA 3SEYA 4LONB 4YZZA 4BDOA 1HSEA 3JV9A 3PUXE 2NOOA 3TPAA 5L9SA 3SERA 1OMPA 4GQOA 4E0XA 1XT8A 2DE2A 2CZLA 1MY4A 1FCKA 1MS7A 3TCGA 3OO8A 5DT6A 4DLDA 3MPKA 1B7UA 4GD5A 4GXSB 3E9XA 3O6IA 1ATGA 4QSCA 2DVZA 4U4XA 2OWTA 4U4SA 1N7WA 5HPQA 5BWJA 3TQLA 3M3FA 1QUJA 3ONMA 2Q8JA 4L17A 3SESA 2HCAA 2XHDA 2F97A 2OK2A 2ZNSA 1QKAA 2HFBA 1Y9UA 4H65A 2BJJX 2OLBA 3A09A 4QFNA 3PPNA 2GHAA 1P1UA 2H9BA 1B7ZA 3I3VA 5CMKA 4H5GA 5ICQA 5TP9A 4EQ9A 5KZTA 3G3JA 2ZYOA 1LLSA 5A5XA 3ILTB 1B1XA 2O7UA 2XXXA 2V84A 4NF5B 1H76A 2X7PA 4DDDA 4RXLA 4X9TA 4JWXA 1SW1A 4GOTA 2ALUA 3PMWA 4YKPA 2GH9A 1IZ1A 1VFDA 3LBSA 4YMAA 4JSOA 5FHNA 4H67A 4QFLA 4BDLA 4PP0A 4R6HA 1TFAA 4R2FA 2NUVA 3O6GA 3HHFA 3MPLA 1B0HA 1MQDA 2DWHA 4F19A 1FW0A 3FV1A 3W15C 4JDFA 3UORA 2DS9A 4LUBA 1P1NA 4R9FA 3ZS6A 3VVDA 1UTHB 3S9EA 1MDQA 3U8QA 3FATA 5I2NA 1RYXA 2RF1A 4RK9A 5CMBA 4KD5A 1A40A 1H44A 3CFXA 3TTLA 5CC2A 3OSRA 3O9PA 3FJ7A 1SW2A 4EF2A 4FEBA 4DXUA 5I2KA 3RLFE 2W7YA 3OD7A 3FJMA 3KSXA 3QIMA 5L9MA 1O7TA 2PYYA 5DVFA 3KG2A 3UN6A 3OOAA 2VHAA 2PMSA 2Z23A 4AB6A 4YMBA 2O6AA 3QYTA 3CIJA 2Q89A 5ITPA 3RNNA 4R9GA 3RT6B 1LCFA 4XKRA 1JVXA 1B0LA 3VVEA 4E0WA 3KEIA 2Z8DA 3TZAA 3EHUA 3A3UA 3THIA 1D3KA 1H3DA 1OLCA 1MXWA 3M3KA 4UA8A 2A5TB 1FTLA 1B1HA 1N84A 1H43A 1F9BA 3T9UA 3CSBA 3I5OA 1P1WA 3IOWA 1B40A 2H5YA 1XS5A 1MPDA 1CB6A 3BFUA 3KSJA 3DP8A 1MH4A 4H8IA 4DCXA 5H8NA 2UVGA 2QMXA 2F7CA 1WODA 1NNTA 4GWOA 2R6GE 3GLBA 1OVBA 4EUOA 3TMGA 1ZJLA 2QS3A 1IXIA 4RPOA 1MPBA 4NF4B 3HCQA 3C31A 3FVNA 2DSFA 3D4GA 1SI1A 1J1NA 3D4CA 4OENA 2Z8EA 3FD3A 2QPQA 4DIGA 3PV0E 5FHMA 1GV8A 2UVIA 4JXIA 4MH5A 1TWYA 5AA1A 1WVJA 2G29A 1MXYA 3PPPA 2XXVA 3OSQA 4NMYA 3GBBA 2F8DA 3U1OA 2ABHA 2XX9A 3FXQA 2I3WA 5DVIA 2ONRA 3PPRA 4FEDA 5CMCA 5K2YA 3HSTA 2XXQA 4IGRA 3C32A 3OMBA 5CMMA 2UYFA 3H6UA 1BKAA 1I6QA 1TFDA 4RY1A 5AA2A 3DELB 1B6HA 1US5A 4H8JA 2FYIA 5I58A 4WXJA 4F18A 1MPCA 3PD8A 2LAOA 1EU8A 1IIWA 3SDFA 3SEXA 4R74A 2V93A 4FECA 1HSJA 4HTGA 2XD2A 3ZKKA 5JTYB 1Y1ZA 3B7DA 3K00A 3N94A 3IO4A 2OBGA 1Y3QA 2Q88A 4PETA 1FQDA 3OELA 4G8MA 4GLIA 4U2RA 4I9DA 3AXFA 3KN3A 2ZNTA 4GL8A 5I59B 4C0RA 4THIA 2HAUA 3TAJA 2ONKE 5ISUA 2DWIA 3T9HB 2ESNA 2A5SA 4F1YA 4QSEA 1B5JA 3PD9A 2E1SA 5AE4A 3C36A 4MF3A 4YKJA 5CBSA 4QFPA 3C34A 2OJTA 3RGYA 4X48A 3HPIA 1S9TA 3IOTA 4KI0E 5KDTB 2ZXTA 2RC8A 4RJZA 5K2XA 1WDNA 2XX7A 5B7DA 4C1TA 1JW5A 3KZGA 4QSDA 3CRBA 1ELJA 4Q30B 1IXGA 3DM0A 4XKPA 3K6WA 4JWOA 1LSTA 3KFMA 1LFHA 3K6UA 2AL5A 4ONYA 3I6VA 5B70A 1M5EA 3FGSA 2V3QA 3IB2A 1JETA 1P1OA 3QUFA 4OESA 3H06B 3RTWB 4ESXA 1ZTYA 1B3EA 3RQTA 1PB8A 3K1MA 2XXPA 2UYEA 3DLNA 1D9YA 3O28A 4ZDMA 2AL4A 3CFZA 1JW1A 2H99A 3CVGA 4N13A 2H4IA 4X1DA 3Q27A 5KCJB 4ZZAA 1URDA 3QAXA 2Z8FA 4U1OA 1M5BA 3PPOA 2V3TA 1B52A 4NF6A 1ZBMA 4U22A 3VXBA 2FNCA 3IJOB 3FVKA 2REJA 4ZEKA 3T93B 1LCTA 4OFJA 1MRPA 1MQIA 3CG1A 2G93A 3EPEA 2XX8A 3PGFA 3O29A 4IO3A 1VE4A 1IXCA 4IGTA 4LA9A 4PQJA 3MBPA 1D4NA 4XIGQ 4QRZA 4IB2A 1XHYA 3OO9A 1JVYA 1TXFA 3U72A 3KGCA 1DSNA 4YU0A 1MXUA 4ZEDA 3M8UA 4KHZE 3V5AA 3FVGA 1B9JA 4Q0CA 4PFWA 1ZIUA 3Q29A 4KYEA 2UVJA 1JQFA 1QVSA 3VV5A 3G3HA 3G3FA 2F7BA 1EZPA 3S4UA 1O64A 4JSDA 4LP2B 1QW0A 2V25A 4QFOA 3B6WA 1Y3PA 4YB7A 3FV2A 4XTCQ 4IO2A 4NF8B 3CSGA 2DXYA 2F7AA 3LSLA 3HV1A 2VGQA 1N04A 4TLMB 4NE4A 2Q2CA 4G68A 1UQWA 3S9MC 3EHTA 3TCFA 5DEXB 1FQFA 3T96B 2F6GA 3UA8A 2O1LA 3H6VA 3PUYE 1QJMA 2I4BA 4TLLB 1SBPA 4BDNA 4DXCA 3TTKA 1MXVA 2XD3A 3HHGA 1B5HA 4TQUQ 3DP6A 4G4PA 3ZSFA 1PBQA 4LQ2A 2P2AA 1MY2A 1P99A 4LATA 3UK4A 3GBAA 3HO7A 3W9WA 4HS7A 3U94A 4FAJA 4ELOA 4IO5A 1A8FA 4U1ZA 4F3GA 2ZMBA 1N7XA 4ZEFA 2QRYA 1DOTA 3KN7A 5CBRA 2ZYNA 1Y4TA 1B3GA 2XXHA 3N6UA 3LSXA 2OZZA 3S9LC 4NTLA 4PFTA 1ZLQA 3VFJA 1B58A 2NVUB 2Y7WA 3MZ9A 4NWDA 1YTVA 2E0SA 1A8EA 1B2HA 1MY1A 2PT2A 5H8FA 3PUVE 2HZKA 4FE8A 4EXLA 4X1BA 4I62A 2UXAA 1Y1MA 2ZNUA 2ZYKA 4OVJA 4FJPA 3K1PA 3EHSA 1LBCA 2VD3A 1POY1 3OENA 3E13X 1OLAA 3Q26A 1JW4A 3N26A 2F5XA 1B32A 2ANJA 4M4GA 4ELPA 3LSFB 2PVUA 1URGA 1USYH 3V8XB 3BBRA 4G2ZA 3K6VA 1UIVA 4EQ7A 2QS2A 3IX1A 4OFLA 2XXIA 4ELRA 5TP9B 3ZKLA 1PBPA 4ISUA 4EQBA 3K02A 4IO7A 1N3XA 3TTNA 3H4ZA 5ITOA 2F34A 4WEDA 1DMBA 4ESWA 2XXYA 4LVQA 3VXCA 2I58A 3TCHA 2H25A 3ECRA 3IO6A 5JEIA 1TT1A 1FTKA 2NXOA 3LR1A 4BLAA 4ZEIA 5AA3A 1DTGA 5H8QA 5AA4A 1EZ9A 1IQ7A 3E3KA 5M2VA 4KYSA 1LAHE 4Q8RA 3EQ1A 2D21A 3S9NC 1B4ZA 2F36A 5I2NB 1SW5A 1R6ZA 3KOTA 5H8SA 1FTOA 1A99A 3TKDA 5F1QA 1RYOA 3S2VA 4F22A 3JZJA 3K6XA 1AH5A 1OQGA 3K01A 4LZ5A 5H8HA 5I57A 5I2KB 4QFKA 2ONSA 1US4A 4IO4A 3E4RA 2GHBA 2Y7IA 1PDAA 4G8NA 1PC3A 4ECFA 1SVXB 1SQYA 1SI0A 3MC2A 4G68C 1Z7NE 1UTBA 5KCJA 3CR9A 1B05A 5I56A 1FTJA 4MFIA 3MVXA 3T22A 1GTKA 4POWA 2O51A 3FVOA 4U23A 2ZYMA 3KJTA 4M1VA 2RC9A 1LFGA 3N5LA 4H5FA 2F6PA 4ZE8A 3L6HA 1JNFA 1BTJA 3TYHA 4OFOA 2QJEA 1L5TA 5I84A 1UIUA 3FUZA 3RT8A 2IA4A 2AYSA 3SEUA 1A7LA 3UIFA 3FXUA 1NNFA 3Q28A 2RCAA 3GZGA 5EHSA 2IEEA 3MZBA 2V3UA 2RKMA 4OETA 2QL3A 4UACA 4GIZA 5H8NB 1XOCA 3IOVA 4F3SA 3PU5A 3G3GA 2Y7RA 5TPAB 5AA2D 3PMXA 3UGWA 2XXRA 4DZ1A 3Q25A 3K4UA 1IUDA 1LB8A 4F39A 2H98A 2I0BA 4GRKA 2DWJA 4MBPA 4OEVA 4G77A 4LZ7A 4OERA 4F2OA 2RC7A 3H03A 4JBZA 4EDPA 2I6EA 4WEPA 4NF5A 1LB9A 4QF9A 1MY3A 3LUYA 1MY0A 4G8HA 3TTRA 5ELVA 4PFUA 1DPEA 1MQJA 3TUSA 4TOZA 1LAFE 1B7HA 1O63A 5ICTA 5DTBA 4N07A 5I58B 4DCYA 1UTHA 1SYIA 4F3PA 1FQEA 3MP1A 3RN8A 4OZ9A 3G3KA 4R2BA 3F11A 1MQHA 4LZ8A 3USDA 3TQWA 3SETA 4DE8A 1YCJA 1NH7A 4OTEA 2O1MA 1VFEA 4K3FA 4Z7EA 1R9LA 3JYRA 1MXZA 3TEPA 2HXWA 1ZU0A 1HSLA 3SEVA 2D5WA 3PUZE 3TFLA 1ANFA 1MDP1 4O3BA 3B6TA 4POXA 1ZMGA 3FXRA 4YKKA 3VVFA 4P0IA 2DQVA 4FATA 4OHNA 3VDFA 1R1NA 4GL0A 4EF1A 2VD2A 1PEBA 1GVCA 2NWJA 3SEWA 1MM6A 4ZECA 5HM4B 1B3LA 1GR2A 2Y7PA 1AOVA 2O7IA 2OWSA 3A3CA 4IY5A 4ELQA 4OYVA 2A5TA 1Y3NA 1Q35A 3BKIB 1XVXA 1NKXA 3K2DA 3MVWA 1N76A 1OVTA 2I0CA 1N0TA 2O68A 4R75A 1YPNA 3C4MA 1FTMA 5BUUA 3T9VA 3VLUA 1FQBA 4IO6A 1S50A 1OQHA 2PBWA 3H6WA 1AIVA 3U92A 5L9OA 1URSA 3VE1B 4ZS9A 1NFTA 2DP8A 3MAMA 3CFLA 4C1UA 3WAFA 4BDQA 1T0KA 4F2QA 1VSOA 3MW0A 1I69A 4R72A 4NF4A 2RCBA 3P7IA 4JB7A 1D9VA 1B46A 4NWCA 4OXVA 1NNPA 3RY3A 4WKMA 5FTHA 5DYHA 3R7XA 1A55A 4QHQA 4NEDA 4MLQA 3LSWA 5L8DA 3OO7A 2WKYA 2Z22A 2DE3A 1MQGA 4NF6B 3O66A 3RPWA 4I1DA 3G7WA 3LC8A 5DVJA 4HCYA 1USYE 3CI8A 1IEJA 3TODA 4BDMA 4XKQA 2REGA 5EHMA 4YB5A 4OMBA 2AIXA 3C9HA 1Y20A 1Q1KA 3TELA 2Q2AA 1OIBA 2P0SA 3OO6A 3FIRA 4H0WA 1MM7A 2GFEA 5EYFA 3V89B 3U93A 1B5IA 3EN3A 2DXRA 3UP9A 4O3AA 4F3BA 3R6UA 3H7MA 4YICA 3GXAA 3ILUB 3IORA 3QSLA 1A54A 1ZKBA 2Q9TA 3PPQA 1IXHA 1DTZA 3RUMA 5JTYA 1XVYA 4RNSA 4HCWA 3VLVA 2QS4A 3KBRA 2VOZA 2B3BA 5LOMA 3ODBA 4YAHX 2THIA 2HEUA 4F1UA 4XXUA 1POTA 1SDXA 1MH3A 1LAXA 5I59A 1SW4A 2CMOA 2GRVA 1CE2A 2Y84A 4KFQA 2YJPA 3C33A 5A5XB 1BP5A 1QUIA 2O69A 4H1XA 2X7QA 4G68B 3IOUA 1B51A 3T9XB 4ZE9A 4R73A 2DWAA 1GGGA 4F31B 3G3IA 3MQ9A 2PT1A 3T66A 1IITA 4P11A 4OWDA 5FHOA 4R6KA 1EH3A 3QUJA 2R9JA 4Q5TA 3OEKA 1EZOA 5TPAA 5KDTA 3FZVA 2Y7KA 3VLWA 2I3VA 5TU0A 3H3GA 3HN0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YKI A;  1FQA A;  2I48 A;  4RK2 A;  2YLN A;  2PX1 A;  1Z7M E;  4RPN A;  3M3L A;  1PB7 A;  4KQP A;  4P0G A;  3OXN A;  1JEV A;  3B6Q A;  2DYX A;  4GVO A;  4ZEB A;  1BLF A;  1I6A A;  3O97 A;  4GXA A;  4KPT A;  2HAV A;  2YPN A;  1LBB A;  3O6H A;  1NH8 A;  2HZL A;  2OCU A;  1QKB A;  1II5 A;  4O3C A;  3C35 A;  3O2A A;  2DE4 A;  2KLF A;  3KOS A;  5F7V A;  4N6P A;  1AMF A;  2F78 A;  2F35 A;  3DP4 A;  4KCC A;  1FQC A;  1P1Q A;  5H8F B;  2XXT A;  3TDJ A;  3RTF B;  4HW8 A;  2XXW A;  1MG1 A;  3PMV A;  1M5D A;  3MWB A;  3IL1 B;  4BDR A;  1NMU A;  5J1D A;  3IB0 A;  4GFR A;  5CM6 A;  5FTI A;  3TTM A;  1DPP A;  5HBC A;  3IAZ A;  1MXX A;  4RYA A;  4F1V A;  3IJX B;  3R26 A;  4GF8 A;  2P1S A;  3V83 A;  3MP6 A;  3PUW E;  2X26 A;  3MZ1 A;  3KN8 A;  3H6T A;  2QSX A;  2UVH A;  4RA1 A;  1I6B A;  4LQ5 A;  2RIN A;  4DXB A;  4OQO A;  4EXK A;  2B3F A;  3N6T A;  4KCD A;  1H45 A;  4JWY A;  1SD3 A;  2R71 A;  5JK4 A;  2DOJ A;  3IB1 A;  4FOR A;  3FAS A;  1LGB C;  3CG3 A;  1YAE A;  5IAI A;  4H6D A;  1QUL A;  1N3W A;  4AB5 A;  3EF7 A;  3OEM A;  4I8C A;  3SKP A;  3L6G A;  4ND9 A;  5H8Q B;  1BIY A;  3IK6 B;  4U21 A;  5AA4 B;  1LFI A;  3IR1 A;  1JEU A;  4ZZE A;  4PFY A;  4NF8 A;  1QUK A;  2VP1 A;  4KYD A;  2D3I A;  1VR5 A;  4OEU A;  1AL3 A;  3K1N A;  4MLV A;  4IY6 A;  5DEX A;  1RKM A;  4Z0I A;  3MVY A;  4F29 A;  5IKB A;  2I4C A;  3MVZ A;  2HQ0 A;  4YB6 A;  1SYH A;  3K0V A;  2B65 A;  5H8H B;  5I57 B;  2O84 X;  4R6Y A;  3MJN A;  1S7Y A;  2XXU A;  1B4H A;  1R9Q A;  1Y4C A;  5AA2 B;  1NL5 A;  1KWH A;  1PB9 A;  5CI5 A;  3W9V A;  3WAE A;  2QS1 A;  3MP8 A;  4FIM A;  3FJG A;  1B3H A;  4AQ4 A;  4XKN A;  1B3F A;  4PE5 B;  1NNK A;  1LAG E;  1XC1 A;  4KR5 A;  2DVC A;  3QXM A;  5CRY A;  1M5F A;  3BFT A;  3KJ7 A;  2I49 A;  1UTB B;  2M8C A;  2FA7 A;  3MUQ A;  3QK6 A;  5I56 B;  1M5C A;  2QMW A;  3SEY A;  4LON B;  4YZZ A;  4BDO A;  1HSE A;  3JV9 A;  3PUX E;  2NOO A;  3TPA A;  5L9S A;  3SER A;  1OMP A;  4GQO A;  4E0X A;  1XT8 A;  2DE2 A;  2CZL A;  1MY4 A;  1FCK A;  1MS7 A;  3TCG A;  3OO8 A;  5DT6 A;  4DLD A;  3MPK A;  1B7U A;  4GD5 A;  4GXS B;  3E9X A;  3O6I A;  1ATG A;  4QSC A;  2DVZ A;  4U4X A;  2OWT A;  4U4S A;  1N7W A;  5HPQ A;  5BWJ A;  3TQL A;  3M3F A;  1QUJ A;  3ONM A;  2Q8J A;  4L17 A;  3SES A;  2HCA A;  2XHD A;  2F97 A;  2OK2 A;  2ZNS A;  1QKA A;  2HFB A;  1Y9U A;  4H65 A;  2BJJ X;  2OLB A;  3A09 A;  4QFN A;  3PPN A;  2GHA A;  1P1U A;  2H9B A;  1B7Z A;  3I3V A;  5CMK A;  4H5G A;  5ICQ A;  5TP9 A;  4EQ9 A;  5KZT A;  3G3J A;  2ZYO A;  1LLS A;  5A5X A;  3ILT B;  1B1X A;  2O7U A;  2XXX A;  2V84 A;  4NF5 B;  1H76 A;  2X7P A;  4DDD A;  4RXL A;  4X9T A;  4JWX A;  1SW1 A;  4GOT A;  2ALU A;  3PMW A;  4YKP A;  2GH9 A;  1IZ1 A;  1VFD A;  3LBS A;  4YMA A;  4JSO A;  5FHN A;  4H67 A;  4QFL A;  4BDL A;  4PP0 A;  4R6H A;  1TFA A;  4R2F A;  2NUV A;  3O6G A;  3HHF A;  3MPL A;  1B0H A;  1MQD A;  2DWH A;  4F19 A;  1FW0 A;  3FV1 A;  3W15 C;  4JDF A;  3UOR A;  2DS9 A;  4LUB A;  1P1N A;  4R9F A;  3ZS6 A;  3VVD A;  1UTH B;  3S9E A;  1MDQ A;  3U8Q A;  3FAT A;  5I2N A;  1RYX A;  2RF1 A;  4RK9 A;  5CMB A;  4KD5 A;  1A40 A;  1H44 A;  3CFX A;  3TTL A;  5CC2 A;  3OSR A;  3O9P A;  3FJ7 A;  1SW2 A;  4EF2 A;  4FEB A;  4DXU A;  5I2K A;  3RLF E;  2W7Y A;  3OD7 A;  3FJM A;  3KSX A;  3QIM A;  5L9M A;  1O7T A;  2PYY A;  5DVF A;  3KG2 A;  3UN6 A;  3OOA A;  2VHA A;  2PMS A;  2Z23 A;  4AB6 A;  4YMB A;  2O6A A;  3QYT A;  3CIJ A;  2Q89 A;  5ITP A;  3RNN A;  4R9G A;  3RT6 B;  1LCF A;  4XKR A;  1JVX A;  1B0L A;  3VVE A;  4E0W A;  3KEI A;  2Z8D A;  3TZA A;  3EHU A;  3A3U A;  3THI A;  1D3K A;  1H3D A;  1OLC A;  1MXW A;  3M3K A;  4UA8 A;  2A5T B;  1FTL A;  1B1H A;  1N84 A;  1H43 A;  1F9B A;  3T9U A;  3CSB A;  3I5O A;  1P1W A;  3IOW A;  1B40 A;  2H5Y A;  1XS5 A;  1MPD A;  1CB6 A;  3BFU A;  3KSJ A;  3DP8 A;  1MH4 A;  4H8I A;  4DCX A;  5H8N A;  2UVG A;  2QMX A;  2F7C A;  1WOD A;  1NNT A;  4GWO A;  2R6G E;  3GLB A;  1OVB A;  4EUO A;  3TMG A;  1ZJL A;  2QS3 A;  1IXI A;  4RPO A;  1MPB A;  4NF4 B;  3HCQ A;  3C31 A;  3FVN A;  2DSF A;  3D4G A;  1SI1 A;  1J1N A;  3D4C A;  4OEN A;  2Z8E A;  3FD3 A;  2QPQ A;  4DIG A;  3PV0 E;  5FHM A;  1GV8 A;  2UVI A;  4JXI A;  4MH5 A;  1TWY A;  5AA1 A;  1WVJ A;  2G29 A;  1MXY A;  3PPP A;  2XXV A;  3OSQ A;  4NMY A;  3GBB A;  2F8D A;  3U1O A;  2ABH A;  2XX9 A;  3FXQ A;  2I3W A;  5DVI A;  2ONR A;  3PPR A;  4FED A;  5CMC A;  5K2Y A;  3HST A;  2XXQ A;  4IGR A;  3C32 A;  3OMB A;  5CMM A;  2UYF A;  3H6U A;  1BKA A;  1I6Q A;  1TFD A;  4RY1 A;  5AA2 A;  3DEL B;  1B6H A;  1US5 A;  4H8J A;  2FYI A;  5I58 A;  4WXJ A;  4F18 A;  1MPC A;  3PD8 A;  2LAO A;  1EU8 A;  1IIW A;  3SDF A;  3SEX A;  4R74 A;  2V93 A;  4FEC A;  1HSJ A;  4HTG A;  2XD2 A;  3ZKK A;  5JTY B;  1Y1Z A;  3B7D A;  3K00 A;  3N94 A;  3IO4 A;  2OBG A;  1Y3Q A;  2Q88 A;  4PET A;  1FQD A;  3OEL A;  4G8M A;  4GLI A;  4U2R A;  4I9D A;  3AXF A;  3KN3 A;  2ZNT A;  4GL8 A;  5I59 B;  4C0R A;  4THI A;  2HAU A;  3TAJ A;  2ONK E;  5ISU A;  2DWI A;  3T9H B;  2ESN A;  2A5S A;  4F1Y A;  4QSE A;  1B5J A;  3PD9 A;  2E1S A;  5AE4 A;  3C36 A;  4MF3 A;  4YKJ A;  5CBS A;  4QFP A;  3C34 A;  2OJT A;  3RGY A;  4X48 A;  3HPI A;  1S9T A;  3IOT A;  4KI0 E;  5KDT B;  2ZXT A;  2RC8 A;  4RJZ A;  5K2X A;  1WDN A;  2XX7 A;  5B7D A;  4C1T A;  1JW5 A;  3KZG A;  4QSD A;  3CRB A;  1ELJ A;  4Q30 B;  1IXG A;  3DM0 A;  4XKP A;  3K6W A;  4JWO A;  1LST A;  3KFM A;  1LFH A;  3K6U A;  2AL5 A;  4ONY A;  3I6V A;  5B70 A;  1M5E A;  3FGS A;  2V3Q A;  3IB2 A;  1JET A;  1P1O A;  3QUF A;  4OES A;  3H06 B;  3RTW B;  4ESX A;  1ZTY A;  1B3E A;  3RQT A;  1PB8 A;  3K1M A;  2XXP A;  2UYE A;  3DLN A;  1D9Y A;  3O28 A;  4ZDM A;  2AL4 A;  3CFZ A;  1JW1 A;  2H99 A;  3CVG A;  4N13 A;  2H4I A;  4X1D A;  3Q27 A;  5KCJ B;  4ZZA A;  1URD A;  3QAX A;  2Z8F A;  4U1O A;  1M5B A;  3PPO A;  2V3T A;  1B52 A;  4NF6 A;  1ZBM A;  4U22 A;  3VXB A;  2FNC A;  3IJO B;  3FVK A;  2REJ A;  4ZEK A;  3T93 B;  1LCT A;  4OFJ A;  1MRP A;  1MQI A;  3CG1 A;  2G93 A;  3EPE A;  2XX8 A;  3PGF A;  3O29 A;  4IO3 A;  1VE4 A;  1IXC A;  4IGT A;  4LA9 A;  4PQJ A;  3MBP A;  1D4N A;  4XIG Q;  4QRZ A;  4IB2 A;  1XHY A;  3OO9 A;  1JVY A;  1TXF A;  3U72 A;  3KGC A;  1DSN A;  4YU0 A;  1MXU A;  4ZED A;  3M8U A;  4KHZ E;  3V5A A;  3FVG A;  1B9J A;  4Q0C A;  4PFW A;  1ZIU A;  3Q29 A;  4KYE A;  2UVJ A;  1JQF A;  1QVS A;  3VV5 A;  3G3H A;  3G3F A;  2F7B A;  1EZP A;  3S4U A;  1O64 A;  4JSD A;  4LP2 B;  1QW0 A;  2V25 A;  4QFO A;  3B6W A;  1Y3P A;  4YB7 A;  3FV2 A;  4XTC Q;  4IO2 A;  4NF8 B;  3CSG A;  2DXY A;  2F7A A;  3LSL A;  3HV1 A;  2VGQ A;  1N04 A;  4TLM B;  4NE4 A;  2Q2C A;  4G68 A;  1UQW A;  3S9M C;  3EHT A;  3TCF A;  5DEX B;  1FQF A;  3T96 B;  2F6G A;  3UA8 A;  2O1L A;  3H6V A;  3PUY E;  1QJM A;  2I4B A;  4TLL B;  1SBP A;  4BDN A;  4DXC A;  3TTK A;  1MXV A;  2XD3 A;  3HHG A;  1B5H A;  4TQU Q;  3DP6 A;  4G4P A;  3ZSF A;  1PBQ A;  4LQ2 A;  2P2A A;  1MY2 A;  1P99 A;  4LAT A;  3UK4 A;  3GBA A;  3HO7 A;  3W9W A;  4HS7 A;  3U94 A;  4FAJ A;  4ELO A;  4IO5 A;  1A8F A;  4U1Z A;  4F3G A;  2ZMB A;  1N7X A;  4ZEF A;  2QRY A;  1DOT A;  3KN7 A;  5CBR A;  2ZYN A;  1Y4T A;  1B3G A;  2XXH A;  3N6U A;  3LSX A;  2OZZ A;  3S9L C;  4NTL A;  4PFT A;  1ZLQ A;  3VFJ A;  1B58 A;  2NVU B;  2Y7W A;  3MZ9 A;  4NWD A;  1YTV A;  2E0S A;  1A8E A;  1B2H A;  1MY1 A;  2PT2 A;  5H8F A;  3PUV E;  2HZK A;  4FE8 A;  4EXL A;  4X1B A;  4I62 A;  2UXA A;  1Y1M A;  2ZNU A;  2ZYK A;  4OVJ A;  4FJP A;  3K1P A;  3EHS A;  1LBC A;  2VD3 A;  1POY 1;  3OEN A;  3E13 X;  1OLA A;  3Q26 A;  1JW4 A;  3N26 A;  2F5X A;  1B32 A;  2ANJ A;  4M4G A;  4ELP A;  3LSF B;  2PVU A;  1URG A;  1USY H;  3V8X B;  3BBR A;  4G2Z A;  3K6V A;  1UIV A;  4EQ7 A;  2QS2 A;  3IX1 A;  4OFL A;  2XXI A;  4ELR A;  5TP9 B;  3ZKL A;  1PBP A;  4ISU A;  4EQB A;  3K02 A;  4IO7 A;  1N3X A;  3TTN A;  3H4Z A;  5ITO A;  2F34 A;  4WED A;  1DMB A;  4ESW A;  2XXY A;  4LVQ A;  3VXC A;  2I58 A;  3TCH A;  2H25 A;  3ECR A;  3IO6 A;  5JEI A;  1TT1 A;  1FTK A;  2NXO A;  3LR1 A;  4BLA A;  4ZEI A;  5AA3 A;  1DTG A;  5H8Q A;  5AA4 A;  1EZ9 A;  1IQ7 A;  3E3K A;  5M2V A;  4KYS A;  1LAH E;  4Q8R A;  3EQ1 A;  2D21 A;  3S9N C;  1B4Z A;  2F36 A;  5I2N B;  1SW5 A;  1R6Z A;  3KOT A;  5H8S A;  1FTO A;  1A99 A;  3TKD A;  5F1Q A;  1RYO A;  3S2V A;  4F22 A;  3JZJ A;  3K6X A;  1AH5 A;  1OQG A;  3K01 A;  4LZ5 A;  5H8H A;  5I57 A;  5I2K B;  4QFK A;  2ONS A;  1US4 A;  4IO4 A;  3E4R A;  2GHB A;  2Y7I A;  1PDA A;  4G8N A;  1PC3 A;  4ECF A;  1SVX B;  1SQY A;  1SI0 A;  3MC2 A;  4G68 C;  1Z7N E;  1UTB A;  5KCJ A;  3CR9 A;  1B05 A;  5I56 A;  1FTJ A;  4MFI A;  3MVX A;  3T22 A;  1GTK A;  4POW A;  2O51 A;  3FVO A;  4U23 A;  2ZYM A;  3KJT A;  4M1V A;  2RC9 A;  1LFG A;  3N5L A;  4H5F A;  2F6P A;  4ZE8 A;  3L6H A;  1JNF A;  1BTJ A;  3TYH A;  4OFO A;  2QJE A;  1L5T A;  5I84 A;  1UIU A;  3FUZ A;  3RT8 A;  2IA4 A;  2AYS A;  3SEU A;  1A7L A;  3UIF A;  3FXU A;  1NNF A;  3Q28 A;  2RCA A;  3GZG A;  5EHS A;  2IEE A;  3MZB A;  2V3U A;  2RKM A;  4OET A;  2QL3 A;  4UAC A;  4GIZ A;  5H8N B;  1XOC A;  3IOV A;  4F3S A;  3PU5 A;  3G3G A;  2Y7R A;  5TPA B;  5AA2 D;  3PMX A;  3UGW A;  2XXR A;  4DZ1 A;  3Q25 A;  3K4U A;  1IUD A;  1LB8 A;  4F39 A;  2H98 A;  2I0B A;  4GRK A;  2DWJ A;  4MBP A;  4OEV A;  4G77 A;  4LZ7 A;  4OER A;  4F2O A;  2RC7 A;  3H03 A;  4JBZ A;  4EDP A;  2I6E A;  4WEP A;  4NF5 A;  1LB9 A;  4QF9 A;  1MY3 A;  3LUY A;  1MY0 A;  4G8H A;  3TTR A;  5ELV A;  4PFU A;  1DPE A;  1MQJ A;  3TUS A;  4TOZ A;  1LAF E;  1B7H A;  1O63 A;  5ICT A;  5DTB A;  4N07 A;  5I58 B;  4DCY A;  1UTH A;  1SYI A;  4F3P A;  1FQE A;  3MP1 A;  3RN8 A;  4OZ9 A;  3G3K A;  4R2B A;  3F11 A;  1MQH A;  4LZ8 A;  3USD A;  3TQW A;  3SET A;  4DE8 A;  1YCJ A;  1NH7 A;  4OTE A;  2O1M A;  1VFE A;  4K3F A;  4Z7E A;  1R9L A;  3JYR A;  1MXZ A;  3TEP A;  2HXW A;  1ZU0 A;  1HSL A;  3SEV A;  2D5W A;  3PUZ E;  3TFL A;  1ANF A;  1MDP 1;  4O3B A;  3B6T A;  4POX A;  1ZMG A;  3FXR A;  4YKK A;  3VVF A;  4P0I A;  2DQV A;  4FAT A;  4OHN A;  3VDF A;  1R1N A;  4GL0 A;  4EF1 A;  2VD2 A;  1PEB A;  1GVC A;  2NWJ A;  3SEW A;  1MM6 A;  4ZEC A;  5HM4 B;  1B3L A;  1GR2 A;  2Y7P A;  1AOV A;  2O7I A;  2OWS A;  3A3C A;  4IY5 A;  4ELQ A;  4OYV A;  2A5T A;  1Y3N A;  1Q35 A;  3BKI B;  1XVX A;  1NKX A;  3K2D A;  3MVW A;  1N76 A;  1OVT A;  2I0C A;  1N0T A;  2O68 A;  4R75 A;  1YPN A;  3C4M A;  1FTM A;  5BUU A;  3T9V A;  3VLU A;  1FQB A;  4IO6 A;  1S50 A;  1OQH A;  2PBW A;  3H6W A;  1AIV A;  3U92 A;  5L9O A;  1URS A;  3VE1 B;  4ZS9 A;  1NFT A;  2DP8 A;  3MAM A;  3CFL A;  4C1U A;  3WAF A;  4BDQ A;  1T0K A;  4F2Q A;  1VSO A;  3MW0 A;  1I69 A;  4R72 A;  4NF4 A;  2RCB A;  3P7I A;  4JB7 A;  1D9V A;  1B46 A;  4NWC A;  4OXV A;  1NNP A;  3RY3 A;  4WKM A;  5FTH A;  5DYH A;  3R7X A;  1A55 A;  4QHQ A;  4NED A;  4MLQ A;  3LSW A;  5L8D A;  3OO7 A;  2WKY A;  2Z22 A;  2DE3 A;  1MQG A;  4NF6 B;  3O66 A;  3RPW A;  4I1D A;  3G7W A;  3LC8 A;  5DVJ A;  4HCY A;  1USY E;  3CI8 A;  1IEJ A;  3TOD A;  4BDM A;  4XKQ A;  2REG A;  5EHM A;  4YB5 A;  4OMB A;  2AIX A;  3C9H A;  1Y20 A;  1Q1K A;  3TEL A;  2Q2A A;  1OIB A;  2P0S A;  3OO6 A;  3FIR A;  4H0W A;  1MM7 A;  2GFE A;  5EYF A;  3V89 B;  3U93 A;  1B5I A;  3EN3 A;  2DXR A;  3UP9 A;  4O3A A;  4F3B A;  3R6U A;  3H7M A;  4YIC A;  3GXA A;  3ILU B;  3IOR A;  3QSL A;  1A54 A;  1ZKB A;  2Q9T A;  3PPQ A;  1IXH A;  1DTZ A;  3RUM A;  5JTY A;  1XVY A;  4RNS A;  4HCW A;  3VLV A;  2QS4 A;  3KBR A;  2VOZ A;  2B3B A;  5LOM A;  3ODB A;  4YAH X;  2THI A;  2HEU A;  4F1U A;  4XXU A;  1POT A;  1SDX A;  1MH3 A;  1LAX A;  5I59 A;  1SW4 A;  2CMO A;  2GRV A;  1CE2 A;  2Y84 A;  4KFQ A;  2YJP A;  3C33 A;  5A5X B;  1BP5 A;  1QUI A;  2O69 A;  4H1X A;  2X7Q A;  4G68 B;  3IOU A;  1B51 A;  3T9X B;  4ZE9 A;  4R73 A;  2DWA A;  1GGG A;  4F31 B;  3G3I A;  3MQ9 A;  2PT1 A;  3T66 A;  1IIT A;  4P11 A;  4OWD A;  5FHO A;  4R6K A;  1EH3 A;  3QUJ A;  2R9J A;  4Q5T A;  3OEK A;  1EZO A;  5TPA A;  5KDT A;  3FZV A;  2Y7K A;  3VLW A;  2I3V A;  5TU0 A;  3H3G A;  3HN0 A; 
#chains in the Genus database with same CATH topology
 4YKI A;  3RYD A;  1FQA A;  2I48 A;  4RK2 A;  2YLN A;  2PX1 A;  1Z7M E;  4GWS A;  4RPN A;  3M3L A;  1PB7 A;  4KQP A;  4P0G A;  3OXN A;  1EYI A;  1JEV A;  2CEY A;  3B6Q A;  2DYX A;  5J16 A;  4MX6 A;  4GVO A;  4ZEB A;  1BLF A;  1I6A A;  3O97 A;  4GXA A;  1IMC A;  4KPT A;  2HAV A;  2YPN A;  1LBB A;  3O6H A;  4N91 A;  1NH8 A;  3E79 A;  2HZL A;  2OCU A;  2R8T A;  1QKB A;  1II5 A;  4O3C A;  3C35 A;  3O2A A;  2DE4 A;  2KLF A;  3KOS A;  5F7V A;  4N6P A;  1AMF A;  2F78 A;  3ISP A;  2F35 A;  4XF5 A;  2PFZ A;  3DP4 A;  4KCC A;  2XWI A;  1FQC A;  1P1Q A;  5H8F B;  1D9Q A;  2XXT A;  3TDJ A;  3RTF B;  1LBW A;  4HW8 A;  2XXW A;  1IMB A;  1MG1 A;  3PMV A;  1M5D A;  3MWB A;  3IL1 B;  4BDR A;  1NMU A;  5J1D A;  3IB0 A;  4GFR A;  5CM6 A;  5FTI A;  3TTM A;  1DPP A;  5HBC A;  1FBG A;  3IAZ A;  1MXX A;  4RYA A;  3HFU A;  4F1V A;  3IJX B;  3R26 A;  4GF8 A;  2P1S A;  3V83 A;  3MP6 A;  3PUW E;  4PDD A;  2X26 A;  4H45 A;  3MZ1 A;  3KN8 A;  3H6T A;  2QSX A;  5ET7 A;  2UVH A;  4RA1 A;  1FBE A;  4H46 A;  1I6B A;  4LQ5 A;  2RIN A;  1LBY A;  4DXB A;  4OQO A;  4EXK A;  2B3F A;  3N6T A;  3NOH A;  4KCD A;  1H45 A;  2MKZ A;  4P56 A;  4JWY A;  1SD3 A;  2R71 A;  5JK4 A;  2DOJ A;  3IB1 A;  4FOR A;  4N6K A;  2HPG A;  3FAS A;  1LGB C;  2F3D A;  3CG3 A;  1YAE A;  5IAI A;  3RPL B;  1VDW A;  4H6D A;  4I3Y A;  1QUL A;  4PDH A;  1N3W A;  4P9K A;  4AB5 A;  4N4U A;  3EF7 A;  3OEM A;  4I8C A;  3SKP A;  3L6G A;  4ND9 A;  5H8Q B;  1BIY A;  3IK6 B;  4U21 A;  5AA4 B;  3BIG A;  4OAN A;  2HXR A;  4UAB A;  1LFI A;  1FSA A;  3IR1 A;  1JEU A;  4ZZE A;  4PFY A;  4NF8 A;  1QUK A;  2VP1 A;  4KYD A;  2D3I A;  3B8B A;  4KXP A;  1VR5 A;  4OEU A;  5I5P A;  1AL3 A;  3K1N A;  2CEX A;  4MLV A;  4IY6 A;  5DEX A;  1RKM A;  4Z0I A;  3MVY A;  4F29 A;  5IKB A;  2I4C A;  3MVZ A;  2HQ0 A;  4YB6 A;  1SYH A;  3K0V A;  2B65 A;  1G0H A;  5H8H B;  5I57 B;  2O84 X;  4AS5 A;  4R6Y A;  3MJN A;  1S7Y A;  2XXU A;  1B4H A;  1R9Q A;  1Y4C A;  5AA2 B;  1NL5 A;  1KWH A;  1PB9 A;  5CI5 A;  3W9V A;  3WAE A;  2QS1 A;  3MP8 A;  4FIM A;  3FJG A;  1B3H A;  4AQ4 A;  4XKN A;  1B3F A;  4PE5 B;  1NNK A;  1LEV A;  1LAG E;  1XC1 A;  4KR5 A;  2DVC A;  3QXM A;  5CRY A;  1M5F A;  3BFT A;  3KJ7 A;  2I49 A;  1UTB B;  2M8C A;  2FA7 A;  3MUQ A;  2JJK A;  3QK6 A;  5I56 B;  1M5C A;  5F24 A;  2QMW A;  3SEY A;  4LON B;  4YZZ A;  4BDO A;  1HSE A;  3JV9 A;  3PUX E;  4FBP A;  2NOO A;  3TPA A;  5L9S A;  3SER A;  1OMP A;  4GQO A;  4HE2 A;  1FBP A;  4E0X A;  1XT8 A;  2DE2 A;  2XWK A;  2CZL A;  1MY4 A;  1FCK A;  1MS7 A;  3TCG A;  4JVD A;  3OO8 A;  5DT6 A;  4N81 A;  4DLD A;  5EYG A;  3MPK A;  5I3S A;  1B7U A;  4NF0 A;  4GD5 A;  4GXS B;  3E9X A;  3O6I A;  1ATG A;  4QSC A;  2DVZ A;  4U4X A;  2OWT A;  4U4S A;  1N7W A;  5HPQ A;  5BWJ A;  3TQL A;  3M3F A;  1QUJ A;  4HXV A;  3ONM A;  2Q8J A;  1RDZ A;  2Q8M A;  4OA4 A;  4L17 A;  3SES A;  2HCA A;  2XHD A;  2F97 A;  2OK2 A;  2ZNS A;  1QKA A;  2HFB A;  1Y9U A;  4H65 A;  2BJJ X;  2OLB A;  3A09 A;  4QFN A;  3PPN A;  1DCU A;  2GHA A;  1P1U A;  2H9B A;  1B7Z A;  3I3V A;  5CMK A;  4H5G A;  5ICQ A;  5TP9 A;  3ROJ A;  4EQ9 A;  5KZT A;  2VT5 A;  3G3J A;  2ZYO A;  1LLS A;  4GX6 A;  4MNI A;  5A5X A;  3ILT B;  1B1X A;  2O7U A;  2QVV A;  2XXX A;  2V84 A;  2WX9 A;  4NF5 B;  1H76 A;  4PF6 A;  2X7P A;  4DDD A;  4RXL A;  4X9T A;  4JWX A;  1SW1 A;  4GOT A;  4IR8 A;  2ALU A;  3LUZ A;  3PMW A;  4YKP A;  2GH9 A;  1FJ6 A;  1IZ1 A;  1VFD A;  3LBS A;  4YMA A;  4JSO A;  5FHN A;  4H67 A;  4QFL A;  4BDL A;  4PP0 A;  4R6H A;  3MYU A;  1TFA A;  4R2F A;  2NUV A;  3O6G A;  3HHF A;  1FBH A;  3MPL A;  1B0H A;  1MQD A;  2DWH A;  4F19 A;  1FW0 A;  3FV1 A;  3W15 C;  4JDF A;  3UOR A;  2DS9 A;  4LUB A;  4OVP A;  1P1N A;  4R9F A;  3ZS6 A;  3VVD A;  1UTH B;  3S9E A;  1MDQ A;  3U8Q A;  3FAT A;  5I2N A;  1RYX A;  2RF1 A;  4RK9 A;  5CMB A;  4KD5 A;  1A40 A;  1H44 A;  4GWY A;  4MIJ A;  1FPF A;  3CFX A;  3TTL A;  5CC2 A;  3OSR A;  3O9P A;  1LBV A;  3FJ7 A;  1SW2 A;  4MEV A;  4EF2 A;  2FBP A;  4FEB A;  4DXU A;  5I2K A;  3RLF E;  2W7Y A;  3OD7 A;  3FJM A;  3KSX A;  3QIM A;  5L9M A;  1O7T A;  2PYY A;  5DVF A;  3KG2 A;  2FIX A;  3UN6 A;  3OOA A;  2VHA A;  2PMS A;  2Z23 A;  4PGP A;  4AB6 A;  2WYP A;  4YMB A;  4N17 A;  4GWW A;  1FBD A;  2O6A A;  3QYT A;  3CIJ A;  2Q89 A;  5ITP A;  3RNN A;  4R9G A;  3RT6 B;  1LCF A;  4XKR A;  1JVX A;  1B0L A;  3VVE A;  4E0W A;  1FPK A;  3KEI A;  2Z8D A;  3EHU A;  3THI A;  3A3U A;  3TZA A;  1D3K A;  1EYJ A;  1H3D A;  1OLC A;  1MXW A;  3M3K A;  4UA8 A;  2A5T B;  1FTL A;  1B1H A;  4P8B A;  1N84 A;  1H43 A;  1F9B A;  3T9U A;  3CSB A;  3I5O A;  1P1W A;  3IOW A;  1B40 A;  2H5Y A;  1XS5 A;  1MPD A;  1CB6 A;  3BFU A;  3KSJ A;  3DP8 A;  1MH4 A;  4H8I A;  4DCX A;  5H8N A;  2UVG A;  2QMX A;  2F7C A;  4O7I A;  2WBD A;  1LBZ A;  1WOD A;  1NNT A;  4GWO A;  2Y5L A;  2R6G E;  2HHM A;  3GLB A;  1OVB A;  4EUO A;  3TMG A;  1ZJL A;  2QS3 A;  1IXI A;  2OWZ A;  4RPO A;  1MPB A;  4NF4 B;  3HCQ A;  3C31 A;  3FVN A;  2DSF A;  3D4G A;  3LV0 A;  1SI1 A;  1J1N A;  3D4C A;  4OEN A;  2Z8E A;  3FD3 A;  2QPQ A;  4DIG A;  3PV0 E;  1NV1 A;  5FHM A;  1GV8 A;  2UVI A;  4JXI A;  4MH5 A;  1TWY A;  5AA1 A;  3FBP A;  1WVJ A;  2G29 A;  1MXY A;  1KA1 A;  1XI6 A;  1FPL A;  2VPN A;  3GYY A;  3PPP A;  1NUZ A;  2BJI A;  2XXV A;  3OSQ A;  4NMY A;  1INP A;  3GBB A;  4O8M A;  2CZI A;  2F8D A;  3U1O A;  2ABH A;  2XX9 A;  3FXQ A;  2I3W A;  5DVI A;  2ONR A;  3PPR A;  4FED A;  5CMC A;  5K2Y A;  3HST A;  2XXQ A;  4IGR A;  3C32 A;  3OMB A;  5CMM A;  2UYF A;  3H6U A;  2B4L A;  1BKA A;  1NI9 A;  1I6Q A;  1FPD A;  1TFD A;  4RY1 A;  5AA2 A;  3DEL B;  4PE3 A;  1B6H A;  1US5 A;  4H8J A;  4N8G A;  2FYI A;  3BIH A;  5A5L A;  4WXJ A;  5I58 A;  4F18 A;  1MPC A;  3PD8 A;  4PAK A;  2LAO A;  2WEF A;  1EU8 A;  1IIW A;  3SDF A;  3SEX A;  4R74 A;  5IZ3 B;  2V93 A;  2Y5K A;  4FEC A;  2FHY A;  1HSJ A;  4HTG A;  1RDX A;  2XD2 A;  3ZKK A;  5JTY B;  1FPJ A;  1FJ9 A;  1Y1Z A;  3B7D A;  3K00 A;  3N94 A;  3IO4 A;  2OBG A;  1Y3Q A;  2Q88 A;  4PET A;  1FQD A;  3OEL A;  4G8M A;  4GLI A;  4U2R A;  4I9D A;  3AXF A;  4GX4 A;  3KN3 A;  2ZNT A;  4GL8 A;  4GBV A;  5I59 B;  4C0R A;  4THI A;  2XWV A;  5T3J A;  2HAU A;  4LN5 A;  3TAJ A;  2ONK E;  5ISU A;  2DWI A;  3T9H B;  2ESN A;  2A5S A;  4F1Y A;  4QSE A;  1B5J A;  3PD9 A;  4HE1 A;  2E1S A;  5AE4 A;  5EQA A;  3C36 A;  4MF3 A;  4P47 A;  4YKJ A;  5CBS A;  4QFP A;  3C34 A;  2OJT A;  3RGY A;  4X48 A;  3HPI A;  1S9T A;  4N8Y A;  3IOT A;  4KI0 E;  5KDT B;  2ZXT A;  2RC8 A;  2QVU A;  4RJZ A;  5K2X A;  1WDN A;  4MHF A;  2XX7 A;  5B7D A;  4C1T A;  1JW5 A;  3KZG A;  4QSD A;  3CRB A;  1ELJ A;  4Q30 B;  1NV4 A;  1IXG A;  3DM0 A;  4XKP A;  1NV0 A;  3K6W A;  4JWO A;  1LST A;  5LTC A;  3KFM A;  1LFH A;  3K6U A;  2AL5 A;  4ONY A;  3I6V A;  5B70 A;  1M5E A;  3FGS A;  2V3Q A;  3IB2 A;  1JET A;  1P1O A;  3QUF A;  4OES A;  3H06 B;  3RTW B;  4ESX A;  1ZTY A;  1B3E A;  3RQT A;  1PB8 A;  3K1M A;  2XXP A;  2UYE A;  3DLN A;  3D1R A;  1D9Y A;  2P3N A;  3O28 A;  4ZDM A;  2AL4 A;  3KC0 A;  3CFZ A;  4NQ8 A;  1JW1 A;  2H99 A;  3CVG A;  4N13 A;  2H4I A;  2QVR A;  4X1D A;  3Q27 A;  5KCJ B;  4NN3 A;  4ZZA A;  1URD A;  3QAX A;  2Z8F A;  4U1O A;  1M5B A;  3PPO A;  2V3T A;  1B52 A;  4OVR A;  4NF6 A;  1ZBM A;  4U22 A;  3VXB A;  2FNC A;  3IJO B;  3FVK A;  2REJ A;  4ZEK A;  3IFA A;  5ET6 A;  3T93 B;  1LCT A;  4OFJ A;  1MRP A;  1MQI A;  5IZ1 A;  3CG1 A;  4X04 A;  2G93 A;  3EPE A;  2XX8 A;  3PGF A;  5EQ8 A;  3O29 A;  4IO3 A;  1VE4 A;  1IXC A;  4IGT A;  4LA9 A;  4O7M A;  4PQJ A;  5EQ9 A;  1DBZ A;  3MBP A;  1D4N A;  4XIG Q;  3T1B A;  4QRZ A;  4IB2 A;  1XHY A;  3OO9 A;  2F3B A;  1NV6 A;  1JVY A;  1TXF A;  3U72 A;  3KGC A;  1DSN A;  4YU0 A;  1MXU A;  4ZED A;  3M8U A;  4KHZ E;  3V5A A;  3FVG A;  1B9J A;  4Q0C A;  4PFW A;  1ZIU A;  3Q29 A;  4KYE A;  2UVJ A;  1JQF A;  1QVS A;  2ZZX A;  1IMA A;  2WYK A;  3VV5 A;  3G3H A;  2DDK A;  3G3F A;  2F7B A;  1EZP A;  1FRP A;  3S4U A;  1O64 A;  4JSD A;  4LP2 B;  1QW0 A;  2V25 A;  4QFO A;  2QFL A;  3B6W A;  1Y3P A;  4YB7 A;  3FV2 A;  4XTC Q;  4IO2 A;  4NF8 B;  3CSG A;  2DXY A;  2F7A A;  3LSL A;  3HV1 A;  2VGQ A;  1N04 A;  4TLM B;  4NE4 A;  2Q2C A;  4G68 A;  1UQW A;  3S9M C;  4PFR A;  3EHT A;  5IGA A;  3TCF A;  5DEX B;  1FQF A;  3T96 B;  2F6G A;  4GX3 A;  3UA8 A;  2O1L A;  3H6V A;  4DI4 B;  3QMF A;  3PUY E;  1QJM A;  1NUX A;  2I4B A;  2XWO A;  1FBC A;  4TLL B;  1SBP A;  5FBP A;  4BDN A;  4DXC A;  3TTK A;  1NUY A;  2FIE A;  1MXV A;  2XD3 A;  3HHG A;  4TQU Q;  1B5H A;  4I3E A;  3DP6 A;  4G4P A;  3ZSF A;  5ESY A;  1PBQ A;  4LQ2 A;  1SPI A;  2P2A A;  1MY2 A;  1P99 A;  4LAT A;  3UK4 A;  3GBA A;  3HO7 A;  2CZH A;  3W9W A;  4HS7 A;  3U94 A;  4FAJ A;  4ELO A;  4XEQ A;  4QXD A;  4IO5 A;  3IFC A;  1A8F A;  4U1Z A;  4F3G A;  2WBB A;  1N7X A;  2ZMB A;  4ZEF A;  2QRY A;  1DOT A;  3KN7 A;  5CBR A;  2ZYN A;  1Y4T A;  1B3G A;  2ZZV A;  2XXH A;  3N6U A;  3LSX A;  4PCD A;  2OZZ A;  3S9L C;  4NTL A;  4PFT A;  1ZLQ A;  3VFJ A;  1B58 A;  2NVU B;  2Y7W A;  3MZ9 A;  4NWD A;  1YTV A;  2E0S A;  3KC1 A;  1A8E A;  3A29 A;  1B2H A;  1MY1 A;  2PT2 A;  4PF8 A;  5H8F A;  3EKI A;  3PUV E;  2HZK A;  4FE8 A;  4EXL A;  4X1B A;  4I62 A;  2UXA A;  1Y1M A;  2L5V A;  2ZNU A;  1NUW A;  2ZYK A;  4OVJ A;  4FJP A;  3K1P A;  3U65 A;  3EHS A;  1LBC A;  2VD3 A;  2VPO A;  1POY 1;  3OEN A;  3E13 X;  1OLA A;  3Q26 A;  1JW4 A;  3N26 A;  2F5X A;  1B32 A;  2ANJ A;  4M4G A;  4ELP A;  3LSF B;  2PVU A;  1URG A;  1IMD A;  1USY H;  3V8X B;  3BBR A;  4G2Z A;  3K6V A;  1UIV A;  4EQ7 A;  2QS2 A;  3IX1 A;  4OFL A;  2XXI A;  4ELR A;  5TP9 B;  3ZKL A;  1AWB A;  1PBP A;  4ISU A;  4EQB A;  3K02 A;  4IO7 A;  1N3X A;  2GQ1 A;  4NGU A;  3TTN A;  3H4Z A;  4DI3 D;  5ITO A;  2F34 A;  4WED A;  1DMB A;  4MNC A;  2XXY A;  4ESW A;  2CZK A;  4LVQ A;  3VXC A;  2I58 A;  3TCH A;  3T0J A;  2H25 A;  4MAG A;  3ECR A;  3IO6 A;  3RPL A;  5JEI A;  1QGX A;  1CNQ A;  1BK4 A;  4MNP A;  1TT1 A;  1FTK A;  2NXO A;  4XFE A;  3LR1 A;  2OX3 A;  4BLA A;  1NV7 A;  4ZEI A;  2XA5 A;  1DTG A;  1FPB A;  5AA3 A;  5H8Q A;  5AA4 A;  1JP4 A;  1EZ9 A;  1IQ7 A;  3E3K A;  5M2V A;  4KYS A;  1LAH E;  4Q8R A;  3EQ1 A;  2D21 A;  3S9N C;  1B4Z A;  2F36 A;  5I2N B;  1SW5 A;  1R6Z A;  3KOT A;  5H8S A;  1EYK A;  1LBX A;  1FTA A;  1FTO A;  1A99 A;  3TKD A;  5F1Q A;  1RYO A;  3S2V A;  4F22 A;  3JZJ A;  3K6X A;  1AH5 A;  1OQG A;  3K01 A;  4LZ5 A;  5H8H A;  5I57 A;  5I2K B;  4QFK A;  2ONS A;  1US4 A;  4IO4 A;  3E4R A;  2GHB A;  2Y7I A;  1PDA A;  4G8N A;  1PC3 A;  4ECF A;  4O94 A;  1SVX B;  1SQY A;  1SI0 A;  4PFI A;  3MC2 A;  4G68 C;  1Z7N E;  1UTB A;  1DK4 A;  5KCJ A;  3CR9 A;  1B05 A;  5I56 A;  1FTJ A;  4MFI A;  3MVX A;  1YXI A;  3T22 A;  4PBH A;  1GTK A;  4POW A;  2O51 A;  3FVO A;  4U23 A;  2ZYM A;  3KJT A;  4M1V A;  2RC9 A;  1LFG A;  3N5L A;  4H5F A;  2F6P A;  4ZE8 A;  4OVT A;  3L6H A;  1JNF A;  1BTJ A;  3TYH A;  4OFO A;  2QJE A;  1L5T A;  2PFY A;  5I84 A;  1UIU A;  3FUZ A;  3RT8 A;  2IA4 A;  2Q74 A;  2AYS A;  3SEU A;  1A7L A;  3UIF A;  3FXU A;  1NNF A;  3Q28 A;  2RCA A;  3GZG A;  5EHS A;  2IEE A;  3MZB A;  2V3U A;  2RKM A;  4OET A;  2QL3 A;  4UAC A;  4GIZ A;  5H8N B;  2KQZ A;  1XOC A;  1RDY A;  3IOV A;  4F3S A;  2FVZ A;  3PU5 A;  3G3G A;  2Y7R A;  3CHG A;  5TPA B;  5AA2 D;  3PMX A;  3UGW A;  2XXR A;  2XXK A;  5ET5 A;  4DZ1 A;  3Q25 A;  3K4U A;  1IUD A;  4PBQ A;  1LB8 A;  4F39 A;  2H98 A;  2I0B A;  4GRK A;  2DWJ A;  4AS4 A;  4MBP A;  1K9Z A;  4PTK A;  4OEV A;  4G77 A;  1Q9D A;  4LZ7 A;  4OER A;  4PC9 A;  1KA0 A;  4F2O A;  2RC7 A;  3H03 A;  4JBZ A;  4NG7 A;  4EDP A;  2I6E A;  4WEP A;  1G0I A;  4NF5 A;  3SZP A;  1LB9 A;  4NX1 A;  4QF9 A;  1MY3 A;  3LUY A;  5IM2 A;  1MY0 A;  4G8H A;  4MCO A;  3TTR A;  5ELV A;  5LDZ A;  5IZZ A;  5I7I A;  4PFU A;  3FXB A;  3MST A;  4JVI A;  1DPE A;  1MQJ A;  3TUS A;  2KR0 A;  4TOZ A;  1LAF E;  1B7H A;  1O63 A;  4NHB A;  5ICT A;  5DTB A;  4N07 A;  5I58 B;  4DCY A;  1UTH A;  4OVS A;  1SYI A;  4F3P A;  1YYZ A;  1FQE A;  3MP1 A;  3RN8 A;  4OZ9 A;  3G3K A;  4QBA A;  4R2B A;  3F11 A;  1NV5 A;  1MQH A;  4LZ8 A;  3USD A;  3TQW A;  3SET A;  4DE8 A;  1YCJ A;  1NH7 A;  4OTE A;  2O1M A;  1VFE A;  4K3F A;  4Z7E A;  1R9L A;  5EYH A;  3JYR A;  1MXZ A;  3TEP A;  2HXW A;  3PTY A;  1ZU0 A;  1FPI A;  4P3L A;  4GBW A;  4GWZ A;  1HSL A;  3SEV A;  2D5W A;  3PUZ E;  3TFL A;  1NV3 A;  1ANF A;  1MDP 1;  4O3B A;  3B6T A;  4POX A;  4NAP A;  1ZMG A;  3FXR A;  4YKK A;  3VVF A;  4P0I A;  2DQV A;  4FAT A;  4G61 A;  4OHN A;  3VDF A;  1R1N A;  4GL0 A;  4EF1 A;  2VD2 A;  1PEB A;  1GVC A;  2NWJ A;  3SEW A;  1MM6 A;  4ZEC A;  4X8R A;  5HM4 B;  1B3L A;  1GR2 A;  2Y7P A;  1AOV A;  2O7I A;  4PGN A;  2OWS A;  3A3C A;  4IY5 A;  4ELQ A;  4OYV A;  2A5T A;  3E78 A;  1Y3N A;  4OVQ A;  1Q35 A;  3BKI B;  4I40 A;  1XVX A;  1NKX A;  3K2D A;  3MVW A;  1KZ8 A;  1N76 A;  1OVT A;  5ET8 A;  2I0C A;  1N0T A;  2O68 A;  4R75 A;  1YPN A;  3C4M A;  1FTM A;  5BUU A;  3T9V A;  1IMF A;  3VLU A;  1FQB A;  4IO6 A;  1S50 A;  1OQH A;  2PBW A;  3H6W A;  1AIV A;  3U92 A;  5L9O A;  1URS A;  3VE1 B;  4ZS9 A;  1NFT A;  2DP8 A;  3MAM A;  4PFB A;  3CFL A;  4C1U A;  3WAF A;  4BDQ A;  4HE0 A;  1T0K A;  4F2Q A;  2B4M A;  1VSO A;  3MW0 A;  1I69 A;  4R72 A;  4NF4 A;  2RCB A;  3P7I A;  4JB7 A;  1D9V A;  1B46 A;  4NWC A;  4OXV A;  1NNP A;  3RY3 A;  4WKM A;  4MJO A;  5FTH A;  5DYH A;  3R7X A;  1A55 A;  1IME A;  4QHQ A;  4NED A;  4MLQ A;  4N6D A;  2P3V A;  3LSW A;  5L8D A;  3OO7 A;  2WKY A;  2Z22 A;  2DE3 A;  1MQG A;  2PCR A;  4NF6 B;  3O66 A;  3RPW A;  4I1D A;  3G7W A;  3LC8 A;  5DVJ A;  4HCY A;  1USY E;  3CI8 A;  1IEJ A;  3TOD A;  4BDM A;  4XKQ A;  2REG A;  4GWU A;  5EHM A;  4YB5 A;  4JVC A;  4OMB A;  3B50 A;  1YZ0 A;  2AIX A;  3C9H A;  5EQ7 A;  1Y20 A;  1Q1K A;  3TEL A;  2Q2A A;  1OIB A;  2P0S A;  3OO6 A;  3FIR A;  4H0W A;  1MM7 A;  2GFE A;  5EYF A;  3V89 B;  3U93 A;  1B5I A;  3EN3 A;  2DXR A;  3UP9 A;  4O3A A;  4F3B A;  3R6U A;  3H7M A;  4YIC A;  3GXA A;  3ILU B;  3IOR A;  5IZ3 A;  3QSL A;  1A54 A;  1ZKB A;  2Q9T A;  3PPQ A;  1IXH A;  1DTZ A;  3RUM A;  5JTY A;  1XVY A;  4RNS A;  4HCW A;  5DW8 A;  3VLV A;  1FPG A;  2QS4 A;  3KBR A;  2V4C A;  2VOZ A;  2B3B A;  5LOM A;  3ODB A;  4YAH X;  1K9Y A;  2THI A;  2HEU A;  4F1U A;  4XXU A;  1POT A;  1SDX A;  1MH3 A;  1LAX A;  4P1L A;  5I59 A;  1SW4 A;  2CMO A;  2GRV A;  1CE2 A;  2Y84 A;  4KFQ A;  2YJP A;  3C33 A;  5A5X B;  4PAF A;  2ZZW A;  1BP5 A;  1QUI A;  2O69 A;  4H1X A;  4PAI A;  2X7Q A;  1NV2 A;  4G68 B;  3IOU A;  1B51 A;  4P1E A;  3T9X B;  4ZE9 A;  4R73 A;  3KBZ A;  2DWA A;  1FBF A;  1FPE A;  1GGG A;  4F31 B;  3G3I A;  3MQ9 A;  4GWX A;  2PT1 A;  3T66 A;  1IIT A;  4P11 A;  4OWD A;  5FHO A;  4R6K A;  4MMP A;  1EH3 A;  3QUJ A;  2R9J A;  4Q5T A;  3OEK A;  4N15 A;  1EZO A;  5TPA A;  5KDT A;  3FZV A;  2Y7K A;  3VLW A;  2I3V A;  5TU0 A;  3H3G A;  3HN0 A; 
#chains in the Genus database with same CATH homology
 4YKI A;  1FQA A;  2I48 A;  4RK2 A;  2YLN A;  2PX1 A;  1Z7M E;  4RPN A;  3M3L A;  1PB7 A;  4KQP A;  4P0G A;  3OXN A;  1JEV A;  3B6Q A;  2DYX A;  4GVO A;  4ZEB A;  1BLF A;  1I6A A;  3O97 A;  4GXA A;  4KPT A;  2HAV A;  2YPN A;  1LBB A;  3O6H A;  1NH8 A;  2HZL A;  2OCU A;  1QKB A;  1II5 A;  4O3C A;  3C35 A;  3O2A A;  2DE4 A;  2KLF A;  3KOS A;  5F7V A;  4N6P A;  1AMF A;  2F78 A;  2F35 A;  3DP4 A;  4KCC A;  1FQC A;  1P1Q A;  5H8F B;  2XXT A;  3TDJ A;  3RTF B;  4HW8 A;  2XXW A;  1MG1 A;  3PMV A;  1M5D A;  3MWB A;  3IL1 B;  4BDR A;  1NMU A;  5J1D A;  3IB0 A;  4GFR A;  5CM6 A;  5FTI A;  3TTM A;  1DPP A;  5HBC A;  3IAZ A;  1MXX A;  4RYA A;  4F1V A;  3IJX B;  3R26 A;  4GF8 A;  2P1S A;  3V83 A;  3MP6 A;  3PUW E;  2X26 A;  3MZ1 A;  3KN8 A;  3H6T A;  2QSX A;  2UVH A;  4RA1 A;  1I6B A;  4LQ5 A;  2RIN A;  4DXB A;  4OQO A;  4EXK A;  2B3F A;  3N6T A;  4KCD A;  1H45 A;  4JWY A;  1SD3 A;  2R71 A;  5JK4 A;  2DOJ A;  3IB1 A;  4FOR A;  3FAS A;  1LGB C;  3CG3 A;  1YAE A;  5IAI A;  4H6D A;  1QUL A;  1N3W A;  4AB5 A;  3EF7 A;  3OEM A;  4I8C A;  3SKP A;  3L6G A;  4ND9 A;  5H8Q B;  1BIY A;  3IK6 B;  4U21 A;  5AA4 B;  1LFI A;  3IR1 A;  1JEU A;  4ZZE A;  4PFY A;  4NF8 A;  1QUK A;  2VP1 A;  4KYD A;  2D3I A;  1VR5 A;  4OEU A;  1AL3 A;  3K1N A;  4MLV A;  4IY6 A;  5DEX A;  1RKM A;  4Z0I A;  3MVY A;  4F29 A;  5IKB A;  2I4C A;  3MVZ A;  2HQ0 A;  4YB6 A;  1SYH A;  3K0V A;  2B65 A;  5H8H B;  5I57 B;  2O84 X;  4R6Y A;  3MJN A;  1S7Y A;  2XXU A;  1B4H A;  1R9Q A;  1Y4C A;  5AA2 B;  1NL5 A;  1KWH A;  1PB9 A;  5CI5 A;  3W9V A;  3WAE A;  2QS1 A;  3MP8 A;  4FIM A;  3FJG A;  1B3H A;  4AQ4 A;  4XKN A;  1B3F A;  4PE5 B;  1NNK A;  1LAG E;  1XC1 A;  4KR5 A;  2DVC A;  3QXM A;  5CRY A;  1M5F A;  3BFT A;  3KJ7 A;  2I49 A;  1UTB B;  2M8C A;  2FA7 A;  3MUQ A;  3QK6 A;  5I56 B;  1M5C A;  2QMW A;  3SEY A;  4LON B;  4YZZ A;  4BDO A;  1HSE A;  3JV9 A;  3PUX E;  2NOO A;  3TPA A;  5L9S A;  3SER A;  1OMP A;  4GQO A;  4E0X A;  1XT8 A;  2DE2 A;  2CZL A;  1MY4 A;  1FCK A;  1MS7 A;  3TCG A;  3OO8 A;  5DT6 A;  4DLD A;  3MPK A;  1B7U A;  4GD5 A;  4GXS B;  3E9X A;  3O6I A;  1ATG A;  4QSC A;  2DVZ A;  4U4X A;  2OWT A;  4U4S A;  1N7W A;  5HPQ A;  5BWJ A;  3TQL A;  3M3F A;  1QUJ A;  3ONM A;  2Q8J A;  4L17 A;  3SES A;  2HCA A;  2XHD A;  2F97 A;  2OK2 A;  2ZNS A;  1QKA A;  2HFB A;  1Y9U A;  4H65 A;  2BJJ X;  2OLB A;  3A09 A;  4QFN A;  3PPN A;  2GHA A;  1P1U A;  2H9B A;  1B7Z A;  3I3V A;  5CMK A;  4H5G A;  5ICQ A;  5TP9 A;  4EQ9 A;  5KZT A;  3G3J A;  2ZYO A;  1LLS A;  5A5X A;  3ILT B;  1B1X A;  2O7U A;  2XXX A;  2V84 A;  4NF5 B;  1H76 A;  2X7P A;  4DDD A;  4RXL A;  4X9T A;  4JWX A;  1SW1 A;  4GOT A;  2ALU A;  3PMW A;  4YKP A;  2GH9 A;  1IZ1 A;  1VFD A;  3LBS A;  4YMA A;  4JSO A;  5FHN A;  4H67 A;  4QFL A;  4BDL A;  4PP0 A;  4R6H A;  1TFA A;  4R2F A;  2NUV A;  3O6G A;  3HHF A;  3MPL A;  1B0H A;  1MQD A;  2DWH A;  4F19 A;  1FW0 A;  3FV1 A;  3W15 C;  4JDF A;  3UOR A;  2DS9 A;  4LUB A;  1P1N A;  4R9F A;  3ZS6 A;  3VVD A;  1UTH B;  3S9E A;  1MDQ A;  3U8Q A;  3FAT A;  5I2N A;  1RYX A;  2RF1 A;  4RK9 A;  5CMB A;  4KD5 A;  1A40 A;  1H44 A;  3CFX A;  3TTL A;  5CC2 A;  3OSR A;  3O9P A;  3FJ7 A;  1SW2 A;  4EF2 A;  4FEB A;  4DXU A;  5I2K A;  3RLF E;  2W7Y A;  3OD7 A;  3FJM A;  3KSX A;  3QIM A;  5L9M A;  1O7T A;  2PYY A;  5DVF A;  3KG2 A;  3UN6 A;  3OOA A;  2VHA A;  2PMS A;  2Z23 A;  4AB6 A;  4YMB A;  2O6A A;  3QYT A;  3CIJ A;  2Q89 A;  5ITP A;  3RNN A;  4R9G A;  3RT6 B;  1LCF A;  4XKR A;  1JVX A;  1B0L A;  3VVE A;  4E0W A;  3KEI A;  2Z8D A;  3TZA A;  3EHU A;  3A3U A;  3THI A;  1D3K A;  1H3D A;  1OLC A;  1MXW A;  3M3K A;  4UA8 A;  2A5T B;  1FTL A;  1B1H A;  1N84 A;  1H43 A;  1F9B A;  3T9U A;  3CSB A;  3I5O A;  1P1W A;  3IOW A;  1B40 A;  2H5Y A;  1XS5 A;  1MPD A;  1CB6 A;  3BFU A;  3KSJ A;  3DP8 A;  1MH4 A;  4H8I A;  4DCX A;  5H8N A;  2UVG A;  2QMX A;  2F7C A;  1WOD A;  1NNT A;  4GWO A;  2R6G E;  3GLB A;  1OVB A;  4EUO A;  3TMG A;  1ZJL A;  2QS3 A;  1IXI A;  4RPO A;  1MPB A;  4NF4 B;  3HCQ A;  3C31 A;  3FVN A;  2DSF A;  3D4G A;  1SI1 A;  1J1N A;  3D4C A;  4OEN A;  2Z8E A;  3FD3 A;  2QPQ A;  4DIG A;  3PV0 E;  5FHM A;  1GV8 A;  2UVI A;  4JXI A;  4MH5 A;  1TWY A;  5AA1 A;  1WVJ A;  2G29 A;  1MXY A;  3PPP A;  2XXV A;  3OSQ A;  4NMY A;  3GBB A;  2F8D A;  3U1O A;  2ABH A;  2XX9 A;  3FXQ A;  2I3W A;  5DVI A;  2ONR A;  3PPR A;  4FED A;  5CMC A;  5K2Y A;  3HST A;  2XXQ A;  4IGR A;  3C32 A;  3OMB A;  5CMM A;  2UYF A;  3H6U A;  1BKA A;  1I6Q A;  1TFD A;  4RY1 A;  5AA2 A;  3DEL B;  1B6H A;  1US5 A;  4H8J A;  2FYI A;  5I58 A;  4WXJ A;  4F18 A;  1MPC A;  3PD8 A;  2LAO A;  1EU8 A;  1IIW A;  3SDF A;  3SEX A;  4R74 A;  2V93 A;  4FEC A;  1HSJ A;  4HTG A;  2XD2 A;  3ZKK A;  5JTY B;  1Y1Z A;  3B7D A;  3K00 A;  3N94 A;  3IO4 A;  2OBG A;  1Y3Q A;  2Q88 A;  4PET A;  1FQD A;  3OEL A;  4G8M A;  4GLI A;  4U2R A;  4I9D A;  3AXF A;  3KN3 A;  2ZNT A;  4GL8 A;  5I59 B;  4C0R A;  4THI A;  2HAU A;  3TAJ A;  2ONK E;  5ISU A;  2DWI A;  3T9H B;  2ESN A;  2A5S A;  4F1Y A;  4QSE A;  1B5J A;  3PD9 A;  2E1S A;  5AE4 A;  3C36 A;  4MF3 A;  4YKJ A;  5CBS A;  4QFP A;  3C34 A;  2OJT A;  3RGY A;  4X48 A;  3HPI A;  1S9T A;  3IOT A;  4KI0 E;  5KDT B;  2ZXT A;  2RC8 A;  4RJZ A;  5K2X A;  1WDN A;  2XX7 A;  5B7D A;  4C1T A;  1JW5 A;  3KZG A;  4QSD A;  3CRB A;  1ELJ A;  4Q30 B;  1IXG A;  3DM0 A;  4XKP A;  3K6W A;  4JWO A;  1LST A;  3KFM A;  1LFH A;  3K6U A;  2AL5 A;  4ONY A;  3I6V A;  5B70 A;  1M5E A;  3FGS A;  2V3Q A;  3IB2 A;  1JET A;  1P1O A;  3QUF A;  4OES A;  3H06 B;  3RTW B;  4ESX A;  1ZTY A;  1B3E A;  3RQT A;  1PB8 A;  3K1M A;  2XXP A;  2UYE A;  3DLN A;  1D9Y A;  3O28 A;  4ZDM A;  2AL4 A;  3CFZ A;  1JW1 A;  2H99 A;  3CVG A;  4N13 A;  2H4I A;  4X1D A;  3Q27 A;  5KCJ B;  4ZZA A;  1URD A;  3QAX A;  2Z8F A;  4U1O A;  1M5B A;  3PPO A;  2V3T A;  1B52 A;  4NF6 A;  1ZBM A;  4U22 A;  3VXB A;  2FNC A;  3IJO B;  3FVK A;  2REJ A;  4ZEK A;  3T93 B;  1LCT A;  4OFJ A;  1MRP A;  1MQI A;  3CG1 A;  2G93 A;  3EPE A;  2XX8 A;  3PGF A;  3O29 A;  4IO3 A;  1VE4 A;  1IXC A;  4IGT A;  4LA9 A;  4PQJ A;  3MBP A;  1D4N A;  4XIG Q;  4QRZ A;  4IB2 A;  1XHY A;  3OO9 A;  1JVY A;  1TXF A;  3U72 A;  3KGC A;  1DSN A;  4YU0 A;  1MXU A;  4ZED A;  3M8U A;  4KHZ E;  3V5A A;  3FVG A;  1B9J A;  4Q0C A;  4PFW A;  1ZIU A;  3Q29 A;  4KYE A;  2UVJ A;  1JQF A;  1QVS A;  3VV5 A;  3G3H A;  3G3F A;  2F7B A;  1EZP A;  3S4U A;  1O64 A;  4JSD A;  4LP2 B;  1QW0 A;  2V25 A;  4QFO A;  3B6W A;  1Y3P A;  4YB7 A;  3FV2 A;  4XTC Q;  4IO2 A;  4NF8 B;  3CSG A;  2DXY A;  2F7A A;  3LSL A;  3HV1 A;  2VGQ A;  1N04 A;  4TLM B;  4NE4 A;  2Q2C A;  4G68 A;  1UQW A;  3S9M C;  3EHT A;  3TCF A;  5DEX B;  1FQF A;  3T96 B;  2F6G A;  3UA8 A;  2O1L A;  3H6V A;  3PUY E;  1QJM A;  2I4B A;  4TLL B;  1SBP A;  4BDN A;  4DXC A;  3TTK A;  1MXV A;  2XD3 A;  3HHG A;  1B5H A;  4TQU Q;  3DP6 A;  4G4P A;  3ZSF A;  1PBQ A;  4LQ2 A;  2P2A A;  1MY2 A;  1P99 A;  4LAT A;  3UK4 A;  3GBA A;  3HO7 A;  3W9W A;  4HS7 A;  3U94 A;  4FAJ A;  4ELO A;  4IO5 A;  1A8F A;  4U1Z A;  4F3G A;  2ZMB A;  1N7X A;  4ZEF A;  2QRY A;  1DOT A;  3KN7 A;  5CBR A;  2ZYN A;  1Y4T A;  1B3G A;  2XXH A;  3N6U A;  3LSX A;  2OZZ A;  3S9L C;  4NTL A;  4PFT A;  1ZLQ A;  3VFJ A;  1B58 A;  2NVU B;  2Y7W A;  3MZ9 A;  4NWD A;  1YTV A;  2E0S A;  1A8E A;  1B2H A;  1MY1 A;  2PT2 A;  5H8F A;  3PUV E;  2HZK A;  4FE8 A;  4EXL A;  4X1B A;  4I62 A;  2UXA A;  1Y1M A;  2ZNU A;  2ZYK A;  4OVJ A;  4FJP A;  3K1P A;  3EHS A;  1LBC A;  2VD3 A;  1POY 1;  3OEN A;  3E13 X;  1OLA A;  3Q26 A;  1JW4 A;  3N26 A;  2F5X A;  1B32 A;  2ANJ A;  4M4G A;  4ELP A;  3LSF B;  2PVU A;  1URG A;  1USY H;  3V8X B;  3BBR A;  4G2Z A;  3K6V A;  1UIV A;  4EQ7 A;  2QS2 A;  3IX1 A;  4OFL A;  2XXI A;  4ELR A;  5TP9 B;  3ZKL A;  1PBP A;  4ISU A;  4EQB A;  3K02 A;  4IO7 A;  1N3X A;  3TTN A;  3H4Z A;  5ITO A;  2F34 A;  4WED A;  1DMB A;  4ESW A;  2XXY A;  4LVQ A;  3VXC A;  2I58 A;  3TCH A;  2H25 A;  3ECR A;  3IO6 A;  5JEI A;  1TT1 A;  1FTK A;  2NXO A;  3LR1 A;  4BLA A;  4ZEI A;  5AA3 A;  1DTG A;  5H8Q A;  5AA4 A;  1EZ9 A;  1IQ7 A;  3E3K A;  5M2V A;  4KYS A;  1LAH E;  4Q8R A;  3EQ1 A;  2D21 A;  3S9N C;  1B4Z A;  2F36 A;  5I2N B;  1SW5 A;  1R6Z A;  3KOT A;  5H8S A;  1FTO A;  1A99 A;  3TKD A;  5F1Q A;  1RYO A;  3S2V A;  4F22 A;  3JZJ A;  3K6X A;  1AH5 A;  1OQG A;  3K01 A;  4LZ5 A;  5H8H A;  5I57 A;  5I2K B;  4QFK A;  2ONS A;  1US4 A;  4IO4 A;  3E4R A;  2GHB A;  2Y7I A;  1PDA A;  4G8N A;  1PC3 A;  4ECF A;  1SVX B;  1SQY A;  1SI0 A;  3MC2 A;  4G68 C;  1Z7N E;  1UTB A;  5KCJ A;  3CR9 A;  1B05 A;  5I56 A;  1FTJ A;  4MFI A;  3MVX A;  3T22 A;  1GTK A;  4POW A;  2O51 A;  3FVO A;  4U23 A;  2ZYM A;  3KJT A;  4M1V A;  2RC9 A;  1LFG A;  3N5L A;  4H5F A;  2F6P A;  4ZE8 A;  3L6H A;  1JNF A;  1BTJ A;  3TYH A;  4OFO A;  2QJE A;  1L5T A;  5I84 A;  1UIU A;  3FUZ A;  3RT8 A;  2IA4 A;  2AYS A;  3SEU A;  1A7L A;  3UIF A;  3FXU A;  1NNF A;  3Q28 A;  2RCA A;  3GZG A;  5EHS A;  2IEE A;  3MZB A;  2V3U A;  2RKM A;  4OET A;  2QL3 A;  4UAC A;  4GIZ A;  5H8N B;  1XOC A;  3IOV A;  4F3S A;  3PU5 A;  3G3G A;  2Y7R A;  5TPA B;  5AA2 D;  3PMX A;  3UGW A;  2XXR A;  4DZ1 A;  3Q25 A;  3K4U A;  1IUD A;  1LB8 A;  4F39 A;  2H98 A;  2I0B A;  4GRK A;  2DWJ A;  4MBP A;  4OEV A;  4G77 A;  4LZ7 A;  4OER A;  4F2O A;  2RC7 A;  3H03 A;  4JBZ A;  4EDP A;  2I6E A;  4WEP A;  4NF5 A;  1LB9 A;  4QF9 A;  1MY3 A;  3LUY A;  1MY0 A;  4G8H A;  3TTR A;  5ELV A;  4PFU A;  1DPE A;  1MQJ A;  3TUS A;  4TOZ A;  1LAF E;  1B7H A;  1O63 A;  5ICT A;  5DTB A;  4N07 A;  5I58 B;  4DCY A;  1UTH A;  1SYI A;  4F3P A;  1FQE A;  3MP1 A;  3RN8 A;  4OZ9 A;  3G3K A;  4R2B A;  3F11 A;  1MQH A;  4LZ8 A;  3USD A;  3TQW A;  3SET A;  4DE8 A;  1YCJ A;  1NH7 A;  4OTE A;  2O1M A;  1VFE A;  4K3F A;  4Z7E A;  1R9L A;  3JYR A;  1MXZ A;  3TEP A;  2HXW A;  1ZU0 A;  1HSL A;  3SEV A;  2D5W A;  3PUZ E;  3TFL A;  1ANF A;  1MDP 1;  4O3B A;  3B6T A;  4POX A;  1ZMG A;  3FXR A;  4YKK A;  3VVF A;  4P0I A;  2DQV A;  4FAT A;  4OHN A;  3VDF A;  1R1N A;  4GL0 A;  4EF1 A;  2VD2 A;  1PEB A;  1GVC A;  2NWJ A;  3SEW A;  1MM6 A;  4ZEC A;  5HM4 B;  1B3L A;  1GR2 A;  2Y7P A;  1AOV A;  2O7I A;  2OWS A;  3A3C A;  4IY5 A;  4ELQ A;  4OYV A;  2A5T A;  1Y3N A;  1Q35 A;  3BKI B;  1XVX A;  1NKX A;  3K2D A;  3MVW A;  1N76 A;  1OVT A;  2I0C A;  1N0T A;  2O68 A;  4R75 A;  1YPN A;  3C4M A;  1FTM A;  5BUU A;  3T9V A;  3VLU A;  1FQB A;  4IO6 A;  1S50 A;  1OQH A;  2PBW A;  3H6W A;  1AIV A;  3U92 A;  5L9O A;  1URS A;  3VE1 B;  4ZS9 A;  1NFT A;  2DP8 A;  3MAM A;  3CFL A;  4C1U A;  3WAF A;  4BDQ A;  1T0K A;  4F2Q A;  1VSO A;  3MW0 A;  1I69 A;  4R72 A;  4NF4 A;  2RCB A;  3P7I A;  4JB7 A;  1D9V A;  1B46 A;  4NWC A;  4OXV A;  1NNP A;  3RY3 A;  4WKM A;  5FTH A;  5DYH A;  3R7X A;  1A55 A;  4QHQ A;  4NED A;  4MLQ A;  3LSW A;  5L8D A;  3OO7 A;  2WKY A;  2Z22 A;  2DE3 A;  1MQG A;  4NF6 B;  3O66 A;  3RPW A;  4I1D A;  3G7W A;  3LC8 A;  5DVJ A;  4HCY A;  1USY E;  3CI8 A;  1IEJ A;  3TOD A;  4BDM A;  4XKQ A;  2REG A;  5EHM A;  4YB5 A;  4OMB A;  2AIX A;  3C9H A;  1Y20 A;  1Q1K A;  3TEL A;  2Q2A A;  1OIB A;  2P0S A;  3OO6 A;  3FIR A;  4H0W A;  1MM7 A;  2GFE A;  5EYF A;  3V89 B;  3U93 A;  1B5I A;  3EN3 A;  2DXR A;  3UP9 A;  4O3A A;  4F3B A;  3R6U A;  3H7M A;  4YIC A;  3GXA A;  3ILU B;  3IOR A;  3QSL A;  1A54 A;  1ZKB A;  2Q9T A;  3PPQ A;  1IXH A;  1DTZ A;  3RUM A;  5JTY A;  1XVY A;  4RNS A;  4HCW A;  3VLV A;  2QS4 A;  3KBR A;  2VOZ A;  2B3B A;  5LOM A;  3ODB A;  4YAH X;  2THI A;  2HEU A;  4F1U A;  4XXU A;  1POT A;  1SDX A;  1MH3 A;  1LAX A;  5I59 A;  1SW4 A;  2CMO A;  2GRV A;  1CE2 A;  2Y84 A;  4KFQ A;  2YJP A;  3C33 A;  5A5X B;  1BP5 A;  1QUI A;  2O69 A;  4H1X A;  2X7Q A;  4G68 B;  3IOU A;  1B51 A;  3T9X B;  4ZE9 A;  4R73 A;  2DWA A;  1GGG A;  4F31 B;  3G3I A;  3MQ9 A;  2PT1 A;  3T66 A;  1IIT A;  4P11 A;  4OWD A;  5FHO A;  4R6K A;  1EH3 A;  3QUJ A;  2R9J A;  4Q5T A;  3OEK A;  1EZO A;  5TPA A;  5KDT A;  3FZV A;  2Y7K A;  3VLW A;  2I3V A;  5TU0 A;  3H3G A;  3HN0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...