3HHFA

Structure of crga regulatory domain, a lysr-type transcriptional regulator from neisseria meningitidis.
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
204
structure length
204
Chain Sequence
PQGVLSVDSAMPMVLHLLAPLAAKFNERYPHIRLSLVSSEGYINLIERKVDIALRAGELDDSGLRARHLFDSRFRVIASPEYLAKHGTPQSTEELAGHQCLGFTEPGSLNTWAVLDAQGNPYKISPHFTASSGEILRSLCLSGCGIVCLSDFLVDNDIAEGKLIPLLAEQTSDKTHPFNAVYYSDKAVNLRLRVFLDFLVEELG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Transcriptional regulator, LysR family
publication title The structure of CrgA from Neisseria meningitidis reveals a new octameric assembly state for LysR transcriptional regulators
pubmed doi rcsb
source organism Neisseria meningitidis serogroup b
total genus 52
structure length 204
sequence length 204
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3hhfA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3hhfA01
1MXYA 4C0RA 4BLAA 5L9MA 4R75A 3R6UA 5FHMA 3HO7A 3QUFA 3IB0A 2H99A 3LSWA 1VR5A 3RY3A 1SVXB 1MH3A 1AH5A 4GXSB 4H0WA 3FJMA 5DVIA 1MY2A 3USDA 1OLCA 1FTKA 3TTLA 1ZTYA 2VGQA 2OZZA 4MLVA 2Z23A 3S9LC 3CG3A 3W9WA 4YKPA 1JW1A 5F1QA 2RCAA 3FATA 2XD2A 1ZBMA 4O3CA 3PPPA 4KD5A 1F9BA 5CC2A 1JEVA 2REGA 3FVNA 4G2ZA 1RKMA 4UA8A 3O6GA 4AB5A 2Q2AA 5AE4A 4RPOA 3RUMA 5CMCA 3DM0A 1OMPA 1NL5A 4X1DA 1M5EA 3FV2A 3OENA 3BFTA 3PPOA 4FAJA 3JV9A 1BKAA 5JK4A 3FZVA 3E9XA 4PFYA 3KSJA 3G3FA 5EHSA 3OO9A 5I2KB 1D4NA 3VXBA 2RINA 3H6VA 3RQTA 3C34A 3FD3A 3TCGA 2O1LA 4KYSA 4K3FA 1AL3A 4ONYA 1MH4A 4PFUA 4G68B 3SERA 2D3IA 5AA4B 1SW5A 3PUYE 3T22A 5DYHA 1HSJA 1MY3A 1SW4A 5H8QB 3MUQA 3KOSA 2CZLA 2X7PA 4F2OA 3M3LA 5KCJA 2IEEA 3E13X 2GH9A 3K6UA 5L8DA 1LCFA 4LONB 4P0IA 1LFIA 1UQWA 3QAXA 4RK2A 1OQGA 3AXFA 1O7TA 1URGA 2XXHA 1B0HA 4NF5A 1PB7A 3IOUA 3B6QA 4U1OA 4YMAA 1UTBA 3C31A 2YLNA 1RYXA 1UIUA 2OWSA 2AIXA 1N7WA 2DP8A 1MM7A 3MPKA 5FTIA 2O1MA 1BTJA 3U72A 4JSOA 2QL3A 3TMGA 4ESWA 4OWDA 3ILTB 1JW5A 4DIGA 4R6KA 4ZEIA 2E1SA 1B40A 3N94A 2I4CA 2D5WA 4ISUA 4OEUA 3PUVE 4U21A 4YKKA 1YPNA 3G3IA 1PC3A 2F36A 4NEDA 3GBBA 3IK6B 3N6UA 4EF2A 1R6ZA 3DP8A 1MXUA 3T9VA 3UP9A 4GL0A 1ZKBA 2Z22A 3PMXA 3SEWA 2O7IA 1EU8A 1MQGA 3SDFA 4JWXA 2XXTA 3JZJA 4JBZA 3LSLA 3UK4A 2XXUA 4TLMB 3IORA 1NNKA 4LQ2A 1JQFA 4KCCA 2UVHA 3EF7A 4NF4A 4LZ8A 3PPRA 5I2KA 2ZNUA 1MY1A 3RPWA 1S9TA 2V3QA 1N3WA 3IB1A 1EZ9A 1RYOA 3QIMA 3LC8A 2HAVA 4G68A 4NWCA 1S50A 4POXA 3Q29A 4LATA 5ELVA 4F29A 1MDQA 1SW1A 1ZIUA 3QXMA 2O84X 3CI8A 1MPCA 4H8IA 4OVJA 3T93B 3O6IA 4GFRA 4F22A 3IR1A 4QSCA 2F97A 1UTHA 2QMXA 2WKYA 2H25A 1P1NA 3TUSA 2A5SA 5ICTA 5I2NB 1Y3QA 2VHAA 3ONMA 3FJ7A 3S9EA 1M5CA 3MVYA 1DPEA 5KDTA 1TFAA 1I6QA 2Y84A 2G29A 4IGTA 4U4SA 2DOJA 4N6PA 4OHNA 5AA2A 1P1OA 4YKIA 1DSNA 1S7YA 1PBPA 4OERA 4LZ7A 2W7YA 3MZ1A 4EF1A 3TKDA 3FVKA 4H8JA 3PD9A 2Z8DA 3FJGA 1LLSA 4THIA 4NMYA 1SDXA 1NNTA 1MDP1 1NH7A 4BDQA 3D4CA 1T0KA 1P1QA 4NWDA 1B4ZA 1MS7A 1R9QA 3EHSA 4QFPA 3TTMA 3SEYA 1BLFA 2VOZA 1VE4A 4ND9A 2X26A 4P11A 1MXWA 4KHZE 1YCJA 4IO5A 2X7QA 2XX9A 3G3HA 3WAFA 4LUBA 1ZLQA 4QSDA 1Q1KA 3EQ1A 4LP2B 1LFGA 3DELB 5CI5A 1A40A 3JYRA 3HSTA 4GD5A 3O9PA 1MM6A 5FHOA 2Z8FA 4HW8A 3DLNA 1QKAA 4H5GA 1UIVA 1A55A 4YAHX 4O3AA 3P7IA 5KZTA 1FTOA 3OEKA 1B5HA 3U94A 4RK9A 3PUXE 1AIVA 3N26A 3T96B 3MZ9A 4G77A 2F7BA 3G3KA 3QYTA 4EQBA 3SEUA 3C35A 1CB6A 4XXUA 1FQBA 3DP4A 2YJPA 5I84A 1I69A 1PB8A 4HS7A 1Y1ZA 3M3KA 4IY6A 1N0TA 4ZEFA 3CG1A 3WAEA 3K6XA 5DEXA 4DCYA 4Q8RA 3LSFB 4NF5B 4OMBA 3E3KA 3MP1A 4DCXA 3QUJA 1UTBB 3Q27A 5I2NA 1NH8A 3C9HA 4F1YA 4R73A 3FASA 4F3SA 2Z8EA 4ZDMA 1B52A 5TU0A 1R1NA 3ZSFA 1ZMGA 2PMSA 3SEXA 2ALUA 2E0SA 4ZEBA 4I9DA 3UGWA 4H6DA 2Q89A 3TODA 2NXOA 1R9LA 5CM6A 3L6HA 2OBGA 3KG2A 1HSLA 1KWHA 1H3DA 2M8CA 4RYAA 2G93A 2AYSA 3TEPA 1LGBC 4U22A 5BUUA 1QUIA 2P1SA 1N04A 1YAEA 4EXLA 3FUZA 4MLQA 3TCFA 1VFEA 4QRZA 1IZ1A 4GVOA 1BP5A 3H6UA 4LZ5A 1AMFA 4ZZEA 4PP0A 1US5A 3EN3A 3IO4A 3W9VA 2DE2A 3RT8A 3B6WA 4OESA 2Q2CA 1DTGA 1EZOA 3ILUB 5TP9A 1LSTA 4I8CA 4G4PA 4U1ZA 2B65A 4NF4B 1FCKA 4PFWA 1FQFA 5LOMA 2OJTA 1LFHA 3K1MA 1OLAA 1IUDA 1B58A 4ZZAA 1VSOA 2ONSA 2HCAA 3GLBA 4RPNA 5HM4B 4F1UA 3E4RA 3KN3A 4RY1A 3MVWA 3CFZA 3RTFB 3S4UA 4QFOA 3R26A 1LAFE 3OELA 2QPQA 2ESNA 2ZNTA 2I4BA 3FVOA 3CSGA 2F34A 3OEMA 2O68A 3C32A 4RXLA 4F3PA 3MJNA 5I59A 2ONKE 3CR9A 4OXVA 2HFBA 4JWYA 1UTHB 1XC1A 3T9XB 1O64A 4F2QA 3PU5A 1PBQA 4XKQA 2HXWA 1QUJA 4XTCQ 3KOTA 3MC2A 3G3GA 3SEVA 5KDTB 3LBSA 5AA2B 4E0XA 3RN8A 3I6VA 1IEJA 5CMMA 3BKIB 1B1HA 1B4HA 4YB6A 4QF9A 4BDMA 1QKBA 4FEDA 5CBRA 2ZNSA 3K1NA 3FXRA 4MBPA 2THIA 4OQOA 3VFJA 3H6TA 3BBRA 4JWOA 1XT8A 1LAGE 4N07A 1OVBA 3MQ9A 2QMWA 3HN0A 4WKMA 4ELPA 2XHDA 5A5XA 2DE3A 1WODA 5H8NB 2RCBA 5DVFA 1D3KA 4NE4A 3PUWE 1H45A 4TOZA 3H03A 1JNFA 2NUVA 3TDJA 3HV1A 1B7HA 4LQ5A 3N5LA 5M2VA 4R9FA 5EHMA 4IGRA 2H4IA 4ECFA 1FTMA 4IO3A 4P0GA 4QSEA 5ITPA 4RNSA 3LR1A 3S2VA 4Q5TA 3OO8A 1FQEA 4PE5B 3O97A 3I3VA 1FTJA 3CIJA 1MQJA 3ODBA 4H1XA 3Q26A 2UXAA 2R9JA 3EHUA 5FHNA 1A54A 1MXVA 4KCDA 3CFXA 1Y9UA 4E0WA 4JSDA 4H65A 2DWAA 4IB2A 4N13A 3GBAA 1JEUA 4AB6A 4HCWA 4M1VA 1DOTA 1LB8A 1BIYA 4GF8A 4QFNA 3K4UA 2QSXA 4IO2A 3RT6B 2DVZA 4EQ7A 2HEUA 4Q0CA 3UA8A 3A3UA 2KLFA 5AA1A 5AA2D 2QS4A 3ZKLA 3KJTA 4ZEDA 2B3BA 5CMBA 1POY1 1DMBA 3RTWB 3ECRA 1IIWA 4ELOA 5JEIA 1B3LA 4ZEKA 2OCUA 3VDFA 4R6YA 3C36A 3RGYA 3IOVA 1MPDA 2FYIA 1B3EA 3MAMA 2ZYOA 1TT1A 3FGSA 2ZYKA 2DXYA 1IITA 3PPNA 4KYDA 4YMBA 4WEPA 1NMUA 5DEXB 4X48A 2ZYNA 4PFTA 1B46A 3CSBA 3D4GA 1B32A 4JDFA 3UN6A 2DQVA 1A8EA 4RA1A 4GWOA 3TTKA 2OK2A 5L9OA 2F7CA 4QFKA 1OQHA 4ESXA 4YKJA 2OWTA 4DXUA 1POTA 4GLIA 2F5XA 3C33A 4GXAA 1Z7ME 1HSEA 1JVYA 4KFQA 3C4MA 4G8HA 1IXHA 3IX1A 1II5A 4TLLB 3TQLA 5K2XA 4ZS9A 5H8SA 3U8QA 5HBCA 5H8FA 1Y3PA 4DXBA 3VXCA 3FVGA 2RC7A 4FE8A 2PBWA 2HZLA 4QFLA 1LBBA 3KFMA 3S9NC 2ABHA 5H8NA 2DYXA 4KPTA 2F6PA 2PX1A 1QJMA 1IXGA 1B9JA 4F3BA 2I0BA 1J1NA 4JB7A 2UYFA 1PDAA 3OSQA 2XX8A 1Q35A 3OOAA 4OFLA 4U2RA 4H5FA 1LCTA 5I58B 3F11A 3K1PA 1PB9A 3U1OA 4DXCA 2XD3A 3SKPA 1GV8A 2FA7A 4HTGA 2UVGA 1SQYA 4PETA 5TP9B 3IAZA 4DE8A 2H5YA 3LUYA 3TQWA 5TPAA 4FJPA 2O6AA 3OSRA 3B7DA 3OXNA 1Y20A 4YB5A 2F78A 2Q8JA 1P99A 4R6HA 5ICQA 3O29A 4LA9A 4U23A 5I57A 4ELQA 4FATA 3UORA 3CRBA 3VLVA 1B1XA 1I6AA 2PVUA 4O3BA 2VD3A 2QRYA 1ELJA 2XX7A 5FTHA 2XXQA 3KEIA 5JTYB 3VVEA 5I59B 5DTBA 3VVFA 4KYEA 2ONRA 3OD7A 3VLUA 1SI1A 1JVXA 2VD2A 2XXPA 3IB2A 2P0SA 3I5OA 1QVSA 3IJOB 3MZBA 3ZKKA 4KI0E 3A3CA 2Y7PA 1MQHA 3O6HA 3TAJA 4G8MA 2V3UA 3FIRA 4EXKA 1H43A 1XVXA 5F7VA 1A8FA 2AL5A 4FIMA 4F19A 4XKPA 4GOTA 2DSFA 3KN7A 2Y7KA 1B0LA 2QJEA 1TXFA 3M3FA 3PUZE 1XVYA 4OETA 3K01A 4GL8A 3IL1B 2RF1A 3PGFA 1N76A 4GIZA 1NNPA 1OIBA 5A5XB 4YICA 4OENA 2H98A 5H8HB 1DPPA 3G7WA 3MP8A 4IO4A 4WEDA 4MH5A 4JXIA 3MWBA 3K6VA 1NFTA 2YPNA 1WVJA 1VFDA 1N3XA 1B3GA 1EH3A 2UVJA 4F3GA 5I58A 2REJA 3TFLA 2A5TB 4G68C 1GGGA 4POWA 3V89B 2I6EA 5J1DA 3HHGA 2I48A 2XXVA 2ANJA 2PT1A 1QUKA 3Q28A 1Z7NE 1IXCA 1URSA 1P1UA 2I58A 1TWYA 1MPBA 5IAIA 1FQAA 3TCHA 1Y4CA 2XXWA 1FQDA 3H7MA 2RKMA 2XXXA 4YZZA 2NVUB 4IO6A 1GVCA 1GTKA 3K02A 2ZYMA 3IO6A 1SYIA 2B3FA 3SESA 3VVDA 1Y1MA 4X9TA 3H6WA 2ZMBA 3GXAA 3TPAA 4XKNA 2F35A 4FECA 2GFEA 2NWJA 1XHYA 5JTYA 3S9MC 3B6TA 1SD3A 1LBCA 1USYE 4XIGQ 4NF6B 1I6BA 3H3GA 4PQJA 3GZGA 3G3JA 3VV5A 2QS2A 1FQCA 3Q25A 1LB9A 4R72A 5IKBA 4F18A 4Z0IA 2F6GA 3ZS6A 3SETA 4YB7A 2CMOA 4MF3A 1L5TA 3BFUA 4OEVA 1MRPA 4HCYA 4X1BA 4MFIA 1Y4TA 2F7AA 4R74A 4FEBA 2OLBA 3PMWA 5H8FB 4KR5A 4OZ9A 2AL4A 2O69A 1QULA 1A7LA 2HAUA 4C1TA 2R6GE 3K6WA 1IXIA 2V93A 1SW2A 2RC8A 4NF8B 1MQDA 4OFOA 2ZXTA 3RNNA 1QW0A 2V25A 5H8HA 1B3HA 3CFLA 2UYEA 1TFDA 1LAHE 2D21A 2DXRA 5I56B 1B2HA 2GHAA 2O51A 3QK6A 3M8UA 1SI0A 1ATGA 1MXZA 4Z7EA 3LSXA 5CBSA 3PV0E 2P2AA 1ZU0A 2I3WA 3PPQA 2A5TA 4I1DA 4IY5A 1US4A 2GRVA 2FNCA 4F39A 5B70A 4BDRA 3FXQA 3TTNA 5CRYA 3MP6A 4OFJA 1JW4A 2Y7IA 3L6GA 4NTLA 5TPAB 4GRKA 4OTEA 2DE4A 5ITOA 3O2AA 4EUOA 3KZGA 3N6TA 4GQOA 4F1VA 3MVXA 1Y3NA 1MXXA 3IOTA 3O28A 4QHQA 5I57B 4KQPA 4LVQA 2QS1A 3IOWA 1A99A 5AA3A 3OO6A 1IQ7A 2GHBA 5L9SA 3TTRA 4EDPA 4OYVA 4U4XA 4ZE8A 3EPEA 1FTLA 2DWIA 4ZECA 3TYHA 2DS9A 3R7XA 3HCQA 5AA4A 1FW0A 3DP6A 5H8QA 3TZAA 4NF6A 1B7UA 2BJJX 1DTZA 1OVTA 1B51A 1B05A 3O66A 4DZ1A 2HZKA 3KN8A 3U92A 2DVCA 2Y7RA 3EHTA 1B5JA 3T9UA 1MY0A 3K00A 4I62A 3HHFA 2IA4A 2F8DA 1LAXA 4BDOA 1ANFA 3UIFA 2DWJA 1M5DA 1GR2A 3QSLA 4DLDA 3MVZA 4M4GA 3HPIA 5BWJA 1WDNA 2VP1A 5CMKA 1URDA 4RJZA 3V5AA 1O63A 2O7UA 4NF8A 1MY4A 4C1UA 5EYFA 1SYHA 3IJXB 4DDDA 1MQIA 1PEBA 2I3VA 3H4ZA 2XXRA 1AOVA 5I56A 3CVGA 2DWHA 3MPLA 3OO7A 2H9BA 4YU0A 2Q88A 2PT2A 1B5IA 1M5BA 2HQ0A 1D9VA 4L17A 5HPQA 4BDNA 3T9HB 2V84A 2R71A 3H06B 4H67A 2RC9A 4EQ9A 5DVJA 1NKXA 4AQ4A 3KJ7A 3W15C 3U93A 5ISUA 4R2BA 4XKRA 5B7DA 3THIA 3K2DA 1YTVA 4Q30B 1B3FA 3PMVA 3KSXA 1SBPA 3A09A 1N84A 2NOOA 3KGCA 2XXYA 1JETA 1P1WA 1XS5A 2Q9TA 2I0CA 2LAOA 4TQUQ 2Y7WA 1CE2A 1EZPA 5K2YA 3VE1B 4R2FA 3FV1A 1NNFA 3VLWA 4UACA 3V8XB 4G8NA 1ZJLA 2V3TA 4FORA 3RLFE 3PD8A 2XXIA 5KCJB 5DT6A 2UVIA 3TELA 3MBPA 2I49A 1XOCA 3K0VA 4IO7A 4F31B 1N7XA 1MG1A 3FXUA 1D9YA 4R9GA 3OMBA 2PYYA 3V83A 1USYH 4WXJA 4BDLA 1M5FA 1B7ZA 4ELRA 1H76A 3KBRA 2QS3A 3T66A 1H44A 3MW0A 4ZE9A 1B6HA
chains in the Genus database with same CATH superfamily
1MXYA 4C0RA 4BLAA 5L9MA 4R75A 3R6UA 5FHMA 3HO7A 2P3VA 3QUFA 3IB0A 2H99A 3LSWA 1VR5A 1K9ZA 3RY3A 1SVXB 1MH3A 1AH5A 4GXSB 4H0WA 3FJMA 5DVIA 1MY2A 4PBQA 1EYIA 3USDA 1OLCA 1FTKA 3TTLA 1ZTYA 2VGQA 4P9KA 2OZZA 4MLVA 2Z23A 3S9LC 3CG3A 2CEXA 5I5PA 3W9WA 4JVCA 4YKPA 1JW1A 2WYKA 5F1QA 2RCAA 3FATA 2XD2A 1ZBMA 4O3CA 3PPPA 4KD5A 1F9BA 5CC2A 1JEVA 2REGA 3FVNA 4G2ZA 1RKMA 4UA8A 3O6GA 4AB5A 2Q2AA 5AE4A 4H45A 4RPOA 3RUMA 1NUZA 5CMCA 3DM0A 1OMPA 1NL5A 4X1DA 1M5EA 3FV2A 3OENA 3BFTA 4JVIA 4PE3A 3PPOA 4FAJA 3JV9A 1BKAA 1EYKA 5JK4A 4MIJA 3FZVA 3E9XA 4PFYA 3KSJA 1NV2A 3G3FA 5EHSA 3OO9A 5I2KB 1D4NA 3VXBA 2RINA 4N15A 3H6VA 3RQTA 3C34A 3FD3A 3TCGA 2O1LA 4KYSA 4K3FA 1AL3A 4MNIA 4ONYA 1MH4A 4PFUA 4G68B 4HE0A 3SERA 2D3IA 1SW5A 5AA4B 3PUYE 3T22A 5DYHA 1HSJA 1MY3A 1SW4A 5H8QB 3MUQA 2QVVA 3FBPA 3KOSA 2CZLA 2X7PA 4F2OA 3M3LA 5KCJA 2IEEA 3E13X 2GH9A 3K6UA 4O7MA 5L8DA 3T0JA 1LCFA 3RPLB 4LONB 4P0IA 1LFIA 1UQWA 3QAXA 4N6DA 4RK2A 1OQGA 4NAPA 3AXFA 1O7TA 1URGA 2XXHA 1B0HA 4NF5A 2XWOA 1PB7A 3IOUA 4I40A 3B6QA 4PTKA 4U1OA 4YMAA 1UTBA 3C31A 5I7IA 2YLNA 1RYXA 1UIUA 2OWSA 2AIXA 1N7WA 1G0IA 5EQ7A 2DP8A 1MM7A 3MPKA 5EYHA 5FTIA 2O1MA 1BTJA 5ET5A 3U72A 4JSOA 2QL3A 3TMGA 4ESWA 4OWDA 3ILTB 1JW5A 4DIGA 4R6KA 4ZEIA 2E1SA 1B40A 3N94A 2I4CA 2D5WA 3PTYA 4IR8A 4ISUA 4OEUA 3PUVE 4PGNA 4U21A 4YKKA 1YPNA 3G3IA 1PC3A 2F36A 4NEDA 3GBBA 3IK6B 5IM2A 3N6UA 4EF2A 1R6ZA 2WX9A 3DP8A 1MXUA 3T9VA 3UP9A 4GL0A 1ZKBA 2Z22A 3PMXA 3SEWA 2O7IA 4P1LA 1EU8A 1MQGA 3SDFA 4P56A 4JWXA 2XXTA 3JZJA 4JBZA 3LSLA 3UK4A 2XXUA 4TLMB 3IORA 1NV0A 1NNKA 4LQ2A 1JQFA 4KCCA 2FBPA 2UVHA 3EF7A 4NF4A 4LZ8A 4PDHA 3PPRA 5DW8A 5I2KA 2ZNUA 1MY1A 3RPWA 1S9TA 2V3QA 1N3WA 3IB1A 3LV0A 1EZ9A 1RYOA 3QIMA 3LC8A 2HAVA 4G68A 4NWCA 1S50A 1VDWA 4POXA 4GBWA 3Q29A 4LATA 5ELVA 4F29A 3HFUA 1MDQA 1SW1A 1ZIUA 3QXMA 2O84X 3CI8A 1MPCA 4H8IA 4OVJA 3T93B 3RPLA 2QFLA 3O6IA 4GFRA 4F22A 3IR1A 4QSCA 2F97A 1UTHA 2CEYA 2QMXA 2WKYA 1NV3A 2H25A 1P1NA 3TUSA 2A5SA 5ICTA 5I2NB 1Y3QA 2VHAA 3ONMA 3FJ7A 3S9EA 1M5CA 3MVYA 1DPEA 5KDTA 1TFAA 1I6QA 4G61A 2Y84A 2G29A 4IGTA 4U4SA 2DOJA 4N17A 4N6PA 4OHNA 5AA2A 1G0HA 4N6KA 2FIXA 1P1OA 4YKIA 1DSNA 1YYZA 1S7YA 1PBPA 4OERA 4LZ7A 2W7YA 3MZ1A 4EF1A 3TKDA 4GX3A 3FVKA 4H8JA 3PD9A 2Z8DA 3FJGA 1LLSA 4THIA 4NMYA 5IZ1A 1FRPA 1LBZA 1SDXA 1NNTA 1MDP1 1NH7A 4BDQA 3D4CA 1T0KA 1P1QA 4NWDA 1B4ZA 2V4CA 1MS7A 1R9QA 3EHSA 4QFPA 1LBYA 3TTMA 3SEYA 1BLFA 2VOZA 1VE4A 4ND9A 2X26A 4P11A 1MXWA 4KHZE 1NV7A 1YCJA 4IO5A 2X7QA 2XX9A 3G3HA 3WAFA 4LUBA 1AWBA 1ZLQA 4QSDA 1Q1KA 1FJ6A 3EQ1A 4LP2B 1LFGA 3DELB 5CI5A 1A40A 3JYRA 3HSTA 4GD5A 3O9PA 4GWXA 1MM6A 5FHOA 2Z8FA 4HW8A 5J16A 3ISPA 3DLNA 4GBVA 1QKAA 4H5GA 1UIVA 1IMAA 1A55A 4O3AA 4YAHX 3P7IA 5KZTA 1FTOA 3OEKA 1B5HA 3U94A 4RK9A 3PUXE 3FXBA 5ET8A 2CZHA 1AIVA 3N26A 3T96B 2CZKA 4NQ8A 3MZ9A 4G77A 2F7BA 3G3KA 3QYTA 4EQBA 3SEUA 4JVDA 2QVRA 3C35A 1CB6A 4XXUA 1FQBA 2GQ1A 3DP4A 2YJPA 5I84A 1I69A 1PB8A 4HS7A 1Y1ZA 3M3KA 4IY6A 1N0TA 4ZEFA 3CG1A 3WAEA 3K6XA 5DEXA 4DCYA 4Q8RA 3LSFB 4NF5B 4OMBA 3E3KA 1FPEA 3MP1A 2VPOA 1IMDA 4DCXA 3QUJA 1UTBB 3Q27A 5I2NA 4H46A 1NH8A 3C9HA 4F1YA 4R73A 3FASA 2Z8EA 4F3SA 1K9YA 4ZDMA 1B52A 1EYJA 5TU0A 1R1NA 3ZSFA 1NV5A 1ZMGA 2PMSA 3SEXA 1FPJA 2ALUA 2E0SA 1INPA 4MX6A 1FPFA 4QBAA 4ZEBA 1FPKA 4I9DA 3UGWA 4H6DA 2Q89A 3TODA 2NXOA 1R9LA 1XI6A 2L5VA 5CM6A 3L6HA 2OBGA 3KG2A 1HSLA 1KWHA 1H3DA 2M8CA 4RYAA 2G93A 2AYSA 3TEPA 1LGBC 4U22A 5BUUA 1QUIA 2P1SA 1N04A 1YAEA 2Y5LA 4OVSA 4EXLA 2KR0A 1FBFA 3LUZA 3FUZA 4MLQA 3TCFA 1NV1A 1VFEA 4QRZA 1IZ1A 4GVOA 1BP5A 3H6UA 4LZ5A 1AMFA 4ZZEA 4PAKA 4PP0A 1US5A 3EN3A 3IO4A 3W9VA 2DE2A 3RT8A 3B6WA 4OESA 2Q2CA 1DTGA 1EZOA 1LBWA 3ILUB 5TP9A 5EQ9A 1LSTA 2WEFA 3D1RA 4I8CA 4G4PA 4U1ZA 2PCRA 2B65A 4NF4B 1FCKA 4PFWA 1FQFA 5LOMA 2OJTA 2WBDA 1LFHA 3K1MA 1OLAA 1IUDA 1B58A 4ZZAA 1VSOA 2ONSA 2HCAA 3GLBA 5ESYA 5LTCA 4RPNA 5HM4B 4F1UA 3E4RA 3KN3A 4RY1A 3MVWA 3CFZA 3RTFB 3S4UA 4MAGA 3R26A 4QFOA 1LAFE 3OELA 2QPQA 2ESNA 2ZNTA 2I4BA 3FVOA 3CSGA 2F34A 3OEMA 2O68A 3C32A 4RXLA 4F3PA 3MJNA 4NN3A 5I59A 1FSAA 2ONKE 4PF6A 5IZ3A 3CR9A 4OXVA 4GWSA 2HFBA 4JWYA 1UTHB 3RYDA 1XC1A 3T9XB 1FPIA 1FTAA 1O64A 4F2QA 3PU5A 1PBQA 4XKQA 2HXWA 1QUJA 1NUXA 4XTCQ 3KOTA 3MC2A 3G3GA 3SEVA 5KDTB 5F24A 3LBSA 5AA2B 4XEQA 4E0XA 3RN8A 4X8RA 3I6VA 1IEJA 1NUWA 5CMMA 2F3BA 3BKIB 5IZZA 1B1HA 1B4HA 4YB6A 5T3JA 4QF9A 4BDMA 1QKBA 2HHMA 5ET7A 4FEDA 5CBRA 2ZNSA 3K1NA 3FXRA 4MBPA 4MHFA 2THIA 4OQOA 3VFJA 3H6TA 3BBRA 4JWOA 2B4MA 1XT8A 1LAGE 4N07A 1OVBA 3MQ9A 2QMWA 3HN0A 4WKMA 4ELPA 2XHDA 5A5XA 2DE3A 1WODA 5H8NB 1BK4A 2RCBA 5DVFA 1D3KA 4NE4A 4OANA 3PUWE 1H45A 4AS4A 4XF5A 4TOZA 3H03A 1JNFA 2NUVA 3TDJA 4GX4A 4O7IA 3HV1A 1LEVA 4PFRA 1B7HA 4LQ5A 3N5LA 5M2VA 4R9FA 5EHMA 4IGRA 2H4IA 4ECFA 1FTMA 4IO3A 4P0GA 4QSEA 5ITPA 4RNSA 3LR1A 3S2VA 4PFIA 4Q5TA 3OO8A 5A5LA 4QXDA 1FQEA 2Y5KA 4PE5B 1D9QA 3O97A 3I3VA 1FTJA 3CIJA 1MQJA 3ODBA 4H1XA 3Q26A 2UXAA 2R9JA 3EHUA 5FHNA 1A54A 1MXVA 4KCDA 3CFXA 1Y9UA 4E0WA 4JSDA 4H65A 2DWAA 4IB2A 4N13A 3GBAA 1JEUA 4M1VA 4HCWA 4AB6A 1DOTA 1LB8A 1BIYA 4GF8A 4QFNA 3K4UA 2QSXA 4IO2A 3RT6B 1KA1A 2DVZA 4EQ7A 4MNCA 2HEUA 4Q0CA 3UA8A 2XA5A 3A3UA 4NHBA 2KLFA 4MNPA 5AA1A 5AA2D 5LDZA 2QS4A 1NV6A 3ZKLA 3KJTA 4ZEDA 2B3BA 5CMBA 1POY1 1DMBA 3RTWB 3ECRA 4N8GA 1IIWA 4ELOA 5JEIA 1B3LA 4ZEKA 2OCUA 3VDFA 4R6YA 3C36A 3RGYA 3IOVA 1MPDA 2FYIA 1B3EA 3MAMA 2ZYOA 1TT1A 4OA4A 3FGSA 2ZYKA 2DXYA 1IITA 3PPNA 4KYDA 4YMBA 4WEPA 2P3NA 1NMUA 5DEXB 4X48A 2ZYNA 4PFTA 5EYGA 1B46A 3CSBA 3D4GA 1B32A 4JDFA 3UN6A 2DQVA 1QGXA 1A8EA 4RA1A 4GWOA 3TTKA 2OK2A 5L9OA 2F7CA 4QFKA 2WBBA 3MSTA 1OQHA 4ESXA 4YKJA 2OWTA 4DXUA 1POTA 4GLIA 2F5XA 3C33A 1Q9DA 4GXAA 4FBPA 4XFEA 2OWZA 1FPBA 1FPLA 1Z7ME 1HSEA 1JVYA 4KFQA 3C4MA 4G8HA 1IXHA 3IX1A 1II5A 4TLLB 3TQLA 5K2XA 4ZS9A 5H8SA 3U8QA 4P8BA 5HBCA 5H8FA 1Y3PA 4DXBA 3VXCA 3FVGA 2RC7A 4FE8A 2PBWA 2HZLA 4QFLA 1LBBA 3KFMA 3S9NC 2ABHA 5H8NA 2DYXA 4KPTA 2F6PA 2PX1A 1QJMA 1IXGA 2FHYA 1B9JA 4F3BA 1LBXA 2I0BA 1J1NA 4JB7A 2UYFA 1PDAA 5I3SA 3OSQA 2XX8A 4MJOA 1Q35A 3OOAA 4OFLA 2XWVA 3EKIA 3BIGA 4U2RA 4H5FA 1LCTA 5I58B 3F11A 4AS5A 3KBZA 3K1PA 1PB9A 3U1OA 4N4UA 1IMBA 2FVZA 4DXCA 2XD3A 3SKPA 5ET6A 1GV8A 2FA7A 4HTGA 2UVGA 1SQYA 4PETA 5TP9B 3IAZA 2PFZA 4GWYA 4DE8A 2H5YA 3LUYA 3TQWA 5TPAA 4FJPA 3MYUA 4PAIA 2O6AA 3OSRA 3B7DA 3OXNA 2MKZA 4MCOA 1Y20A 4YB5A 2F78A 2Q8JA 1P99A 4R6HA 5ICQA 3O29A 4LA9A 4U23A 5I57A 4ELQA 4FATA 3UORA 3CRBA 3VLVA 1B1XA 1I6AA 2PVUA 4O3BA 2VD3A 2QRYA 1ELJA 2XX7A 5FBPA 5FTHA 2XXQA 3KEIA 5JTYB 3VVEA 5I59B 5DTBA 3VVFA 4KYEA 5IZ3B 4N8YA 2ONRA 1FBDA 3OD7A 3VLUA 1SI1A 1JVXA 4N91A 1FBPA 1IMFA 2VD2A 2XXPA 3IB2A 2P0SA 3I5OA 4HE2A 1QVSA 1YXIA 2VPNA 3IJOB 3MZBA 3ZKKA 5EQ8A 4KI0E 3A3CA 2Y7PA 1MQHA 3O6HA 3TAJA 4G8MA 2V3UA 3FIRA 4EXKA 1H43A 1XVXA 1NV4A 5F7VA 1A8FA 2ZZVA 2AL5A 1CNQA 4FIMA 4F19A 4XKPA 4GOTA 2DSFA 3KN7A 2Y7KA 1B0LA 2QJEA 1TXFA 3M3FA 3PUZE 1XVYA 4OETA 5IGAA 3K01A 4GL8A 1NI9A 2XWKA 3IL1B 2RF1A 3PGFA 2HXRA 1N76A 4GIZA 1NNPA 2PFYA 1OIBA 5A5XB 4PBHA 4YICA 4OENA 2H98A 5H8HB 1DPPA 3G7WA 1FBHA 3MP8A 4IO4A 2BJIA 4WEDA 4NF0A 4MH5A 4JXIA 4PF8A 3MWBA 3K6VA 1NFTA 2YPNA 1WVJA 1VFDA 1N3XA 1B3GA 2WYPA 4PAFA 1EH3A 2UVJA 4F3GA 5I58A 2REJA 3KC1A 4G68C 2A5TB 4POWA 1GGGA 3TFLA 3V89B 2QVUA 2I6EA 5J1DA 2HPGA 3HHGA 2I48A 2XXVA 2ANJA 2PT1A 1QUKA 3Q28A 4P1EA 1Z7NE 1IXCA 1URSA 1P1UA 2I58A 1TWYA 4O94A 1MPBA 5IAIA 1FQAA 3TCHA 1Y4CA 1IMCA 2XXWA 1FQDA 3H7MA 2RKMA 2XXXA 3B8BA 3T1BA 4YZZA 1RDZA 2R8TA 2NVUB 4IO6A 1GVCA 1GTKA 3K02A 2ZYMA 3IO6A 1SYIA 2B3FA 3SESA 3VVDA 4X04A 1FBGA 1Y1MA 4X9TA 3H6WA 2ZMBA 1DK4A 3GXAA 3TPAA 4XKNA 2F35A 4FECA 2GFEA 2NWJA 1XHYA 5JTYA 1SPIA 3S9MC 3B6TA 1SD3A 3A29A 1LBCA 2Q74A 1USYE 4XIGQ 4NF6B 1I6BA 3H3GA 4PC9A 4GWUA 4PQJA 3GZGA 3G3JA 2F3DA 3VV5A 2QS2A 1FQCA 4PGPA 4DI3D 3Q25A 1LB9A 4R72A 5IKBA 4F18A 4UABA 4Z0IA 2F6GA 3ZS6A 3SETA 4YB7A 2CMOA 4MF3A 1L5TA 3BFUA 4OEVA 1MRPA 1FJ9A 4HCYA 4X1BA 4MFIA 1Y4TA 2F7AA 4R74A 4I3YA 4FEBA 2OLBA 3PMWA 5H8FB 4KR5A 4OZ9A 2AL4A 2O69A 1QULA 1A7LA 5EQAA 2HAUA 4C1TA 1LBVA 4OVRA 2R6GE 4I3EA 3K6WA 1IXIA 2V93A 1SW2A 2RC8A 1FBCA 4NF8B 1MQDA 4OFOA 1DBZA 2ZXTA 3RNNA 1QW0A 2V25A 5H8HA 4LN5A 1FPDA 1B3HA 3CFLA 2UYEA 1TFDA 1LAHE 4PFBA 3E78A 2D21A 2DXRA 5I56B 1B2HA 2GHAA 2O51A 4OVQA 3QK6A 1KA0A 3M8UA 1SI0A 1ATGA 1MXZA 4Z7EA 3LSXA 3BIHA 5CBSA 3PV0E 2P2AA 1ZU0A 2I3WA 3B50A 3PPQA 2A5TA 4N81A 4I1DA 4IY5A 1US4A 2GRVA 2FNCA 4NG7A 4F39A 5B70A 4BDRA 3FXQA 2B4LA 3TTNA 3MP6A 4OFJA 5CRYA 1JW4A 1FBEA 2Y7IA 3L6GA 1RDXA 4NTLA 5TPAB 4GRKA 4OTEA 2DE4A 5ITOA 3O2AA 4EUOA 3KZGA 3N6TA 4GQOA 4F1VA 3ROJA 1RDYA 3MVXA 1Y3NA 1MXXA 3IOTA 1DCUA 3O28A 4QHQA 5I57B 4KQPA 4LVQA 2QS1A 3IOWA 4MEVA 1A99A 5AA3A 3OO6A 1IQ7A 2GHBA 5L9SA 3TTRA 4EDPA 4OYVA 4U4XA 2OX3A 4ZE8A 3EPEA 1FTLA 2DWIA 4ZECA 3TYHA 2DS9A 3GYYA 1IMEA 3R7XA 3SZPA 3HCQA 5AA4A 1FW0A 3DP6A 5H8QA 3TZAA 4NF6A 1B7UA 2BJJX 1DTZA 1OVTA 1B51A 1B05A 3O66A 4DZ1A 2HZKA 3KN8A 3U92A 2DVCA 2Y7RA 3IFCA 3EHTA 3U65A 1B5JA 3T9UA 1MY0A 3K00A 4NGUA 1JP4A 2DDKA 4I62A 4DI4B 3HHFA 2IA4A 2F8DA 1LAXA 4BDOA 1ANFA 3UIFA 3NOHA 2DWJA 1M5DA 2Q8MA 3QMFA 1GR2A 3QSLA 4DLDA 3MVZA 4M4GA 3HPIA 5BWJA 2ZZWA 1WDNA 2VP1A 5CMKA 1URDA 4RJZA 3V5AA 1O63A 2XXKA 4HE1A 2O7UA 4OVPA 4NF8A 1MY4A 1NUYA 4PCDA 4C1UA 5EYFA 4GWZA 1SYHA 3IJXB 4DDDA 1PEBA 1MQIA 2I3VA 3H4ZA 2XXRA 1AOVA 3E79A 5I56A 3CVGA 1FPGA 2DWHA 3CHGA 4HXVA 3MPLA 4P3LA 3OO7A 2H9BA 4YU0A 2Q88A 2KQZA 2FIEA 2PT2A 1KZ8A 1B5IA 2XWIA 4GWWA 2ZZXA 4GX6A 1M5BA 2CZIA 2HQ0A 1D9VA 4L17A 5HPQA 4BDNA 3T9HB 2V84A 2R71A 3H06B 3IFAA 4H67A 1YZ0A 2RC9A 4EQ9A 5DVJA 1NKXA 4AQ4A 3KJ7A 3W15C 3U93A 4P47A 5ISUA 4R2BA 4XKRA 5B7DA 3THIA 3K2DA 1YTVA 4Q30B 1B3FA 2VT5A 3PMVA 3KSXA 1SBPA 3A09A 1N84A 2NOOA 3KGCA 2XXYA 1JETA 1P1WA 1XS5A 2Q9TA 2I0CA 2LAOA 4TQUQ 2Y7WA 1CE2A 3KC0A 4NX1A 1EZPA 4KXPA 5K2YA 3VE1B 4R2FA 3FV1A 4OVTA 1NNFA 3VLWA 4UACA 3V8XB 4G8NA 1ZJLA 2V3TA 4FORA 3RLFE 3PD8A 2XXIA 5KCJB 5DT6A 2UVIA 3TELA 3MBPA 2I49A 1XOCA 3K0VA 4IO7A 4F31B 1N7XA 1MG1A 4MMPA 3FXUA 1D9YA 4PDDA 4R9GA 3OMBA 2PYYA 3V83A 1USYH 4WXJA 4BDLA 1M5FA 1B7ZA 4ELRA 1H76A 2JJKA 3KBRA 2QS3A 3T66A 1H44A 3MW0A 4O8MA 4ZE9A 1B6HA
chains in the Genus database with same CATH topology
1MXYA 4C0RA 4BLAA 5L9MA 4R75A 3R6UA 5FHMA 3HO7A 3QUFA 3IB0A 2H99A 3LSWA 1VR5A 3RY3A 1SVXB 1MH3A 1AH5A 4GXSB 4H0WA 3FJMA 5DVIA 1MY2A 3USDA 1OLCA 1FTKA 3TTLA 1ZTYA 2VGQA 2OZZA 4MLVA 2Z23A 3S9LC 3CG3A 3W9WA 4YKPA 1JW1A 5F1QA 2RCAA 3FATA 2XD2A 1ZBMA 4O3CA 3PPPA 4KD5A 1F9BA 5CC2A 1JEVA 2REGA 3FVNA 4G2ZA 1RKMA 4UA8A 3O6GA 4AB5A 2Q2AA 5AE4A 4RPOA 3RUMA 5CMCA 3DM0A 1OMPA 1NL5A 4X1DA 1M5EA 3FV2A 3OENA 3BFTA 3PPOA 4FAJA 3JV9A 1BKAA 5JK4A 3FZVA 3E9XA 4PFYA 3KSJA 3G3FA 5EHSA 3OO9A 5I2KB 1D4NA 3VXBA 2RINA 3H6VA 3RQTA 3C34A 3FD3A 3TCGA 2O1LA 4KYSA 4K3FA 1AL3A 4ONYA 1MH4A 4PFUA 4G68B 3SERA 2D3IA 5AA4B 1SW5A 3PUYE 3T22A 5DYHA 1HSJA 1MY3A 1SW4A 5H8QB 3MUQA 3KOSA 2CZLA 2X7PA 4F2OA 3M3LA 5KCJA 2IEEA 3E13X 2GH9A 3K6UA 5L8DA 1LCFA 4LONB 4P0IA 1LFIA 1UQWA 3QAXA 4RK2A 1OQGA 3AXFA 1O7TA 1URGA 2XXHA 1B0HA 4NF5A 1PB7A 3IOUA 3B6QA 4U1OA 4YMAA 1UTBA 3C31A 2YLNA 1RYXA 1UIUA 2OWSA 2AIXA 1N7WA 2DP8A 1MM7A 3MPKA 5FTIA 2O1MA 1BTJA 3U72A 4JSOA 2QL3A 3TMGA 4ESWA 4OWDA 3ILTB 1JW5A 4DIGA 4R6KA 4ZEIA 2E1SA 1B40A 3N94A 2I4CA 2D5WA 4ISUA 4OEUA 3PUVE 4U21A 4YKKA 1YPNA 3G3IA 1PC3A 2F36A 4NEDA 3GBBA 3IK6B 3N6UA 4EF2A 1R6ZA 3DP8A 1MXUA 3T9VA 3UP9A 4GL0A 1ZKBA 2Z22A 3PMXA 3SEWA 2O7IA 1EU8A 1MQGA 3SDFA 4JWXA 2XXTA 3JZJA 4JBZA 3LSLA 3UK4A 2XXUA 4TLMB 3IORA 1NNKA 4LQ2A 1JQFA 4KCCA 2UVHA 3EF7A 4NF4A 4LZ8A 3PPRA 5I2KA 2ZNUA 1MY1A 3RPWA 1S9TA 2V3QA 1N3WA 3IB1A 1EZ9A 1RYOA 3QIMA 3LC8A 2HAVA 4G68A 4NWCA 1S50A 4POXA 3Q29A 4LATA 5ELVA 4F29A 1MDQA 1SW1A 1ZIUA 3QXMA 2O84X 3CI8A 1MPCA 4H8IA 4OVJA 3T93B 3O6IA 4GFRA 4F22A 3IR1A 4QSCA 2F97A 1UTHA 2QMXA 2WKYA 2H25A 1P1NA 3TUSA 2A5SA 5ICTA 5I2NB 1Y3QA 2VHAA 3ONMA 3FJ7A 3S9EA 1M5CA 3MVYA 1DPEA 5KDTA 1TFAA 1I6QA 2Y84A 2G29A 4IGTA 4U4SA 2DOJA 4N6PA 4OHNA 5AA2A 1P1OA 4YKIA 1DSNA 1S7YA 1PBPA 4OERA 4LZ7A 2W7YA 3MZ1A 4EF1A 3TKDA 3FVKA 4H8JA 3PD9A 2Z8DA 3FJGA 1LLSA 4THIA 4NMYA 1SDXA 1NNTA 1MDP1 1NH7A 4BDQA 3D4CA 1T0KA 1P1QA 4NWDA 1B4ZA 1MS7A 1R9QA 3EHSA 4QFPA 3TTMA 3SEYA 1BLFA 2VOZA 1VE4A 4ND9A 2X26A 4P11A 1MXWA 4KHZE 1YCJA 4IO5A 2X7QA 2XX9A 3G3HA 3WAFA 4LUBA 1ZLQA 4QSDA 1Q1KA 3EQ1A 4LP2B 1LFGA 3DELB 5CI5A 1A40A 3JYRA 3HSTA 4GD5A 3O9PA 1MM6A 5FHOA 2Z8FA 4HW8A 3DLNA 1QKAA 4H5GA 1UIVA 1A55A 4YAHX 4O3AA 3P7IA 5KZTA 1FTOA 3OEKA 1B5HA 3U94A 4RK9A 3PUXE 1AIVA 3N26A 3T96B 3MZ9A 4G77A 2F7BA 3G3KA 3QYTA 4EQBA 3SEUA 3C35A 1CB6A 4XXUA 1FQBA 3DP4A 2YJPA 5I84A 1I69A 1PB8A 4HS7A 1Y1ZA 3M3KA 4IY6A 1N0TA 4ZEFA 3CG1A 3WAEA 3K6XA 5DEXA 4DCYA 4Q8RA 3LSFB 4NF5B 4OMBA 3E3KA 3MP1A 4DCXA 3QUJA 1UTBB 3Q27A 5I2NA 1NH8A 3C9HA 4F1YA 4R73A 3FASA 4F3SA 2Z8EA 4ZDMA 1B52A 5TU0A 1R1NA 3ZSFA 1ZMGA 2PMSA 3SEXA 2ALUA 2E0SA 4ZEBA 4I9DA 3UGWA 4H6DA 2Q89A 3TODA 2NXOA 1R9LA 5CM6A 3L6HA 2OBGA 3KG2A 1HSLA 1KWHA 1H3DA 2M8CA 4RYAA 2G93A 2AYSA 3TEPA 1LGBC 4U22A 5BUUA 1QUIA 2P1SA 1N04A 1YAEA 4EXLA 3FUZA 4MLQA 3TCFA 1VFEA 4QRZA 1IZ1A 4GVOA 1BP5A 3H6UA 4LZ5A 1AMFA 4ZZEA 4PP0A 1US5A 3EN3A 3IO4A 3W9VA 2DE2A 3RT8A 3B6WA 4OESA 2Q2CA 1DTGA 1EZOA 3ILUB 5TP9A 1LSTA 4I8CA 4G4PA 4U1ZA 2B65A 4NF4B 1FCKA 4PFWA 1FQFA 5LOMA 2OJTA 1LFHA 3K1MA 1OLAA 1IUDA 1B58A 4ZZAA 1VSOA 2ONSA 2HCAA 3GLBA 4RPNA 5HM4B 4F1UA 3E4RA 3KN3A 4RY1A 3MVWA 3CFZA 3RTFB 3S4UA 4QFOA 3R26A 1LAFE 3OELA 2QPQA 2ESNA 2ZNTA 2I4BA 3FVOA 3CSGA 2F34A 3OEMA 2O68A 3C32A 4RXLA 4F3PA 3MJNA 5I59A 2ONKE 3CR9A 4OXVA 2HFBA 4JWYA 1UTHB 1XC1A 3T9XB 1O64A 4F2QA 3PU5A 1PBQA 4XKQA 2HXWA 1QUJA 4XTCQ 3KOTA 3MC2A 3G3GA 3SEVA 5KDTB 3LBSA 5AA2B 4E0XA 3RN8A 3I6VA 1IEJA 5CMMA 3BKIB 1B1HA 1B4HA 4YB6A 4QF9A 4BDMA 1QKBA 4FEDA 5CBRA 2ZNSA 3K1NA 3FXRA 4MBPA 2THIA 4OQOA 3VFJA 3H6TA 3BBRA 4JWOA 1XT8A 1LAGE 4N07A 1OVBA 3MQ9A 2QMWA 3HN0A 4WKMA 4ELPA 2XHDA 5A5XA 2DE3A 1WODA 5H8NB 2RCBA 5DVFA 1D3KA 4NE4A 3PUWE 1H45A 4TOZA 3H03A 1JNFA 2NUVA 3TDJA 3HV1A 1B7HA 4LQ5A 3N5LA 5M2VA 4R9FA 5EHMA 4IGRA 2H4IA 4ECFA 1FTMA 4IO3A 4P0GA 4QSEA 5ITPA 4RNSA 3LR1A 3S2VA 4Q5TA 3OO8A 1FQEA 4PE5B 3O97A 3I3VA 1FTJA 3CIJA 1MQJA 3ODBA 4H1XA 3Q26A 2UXAA 2R9JA 3EHUA 5FHNA 1A54A 1MXVA 4KCDA 3CFXA 1Y9UA 4E0WA 4JSDA 4H65A 2DWAA 4IB2A 4N13A 3GBAA 1JEUA 4AB6A 4HCWA 4M1VA 1DOTA 1LB8A 1BIYA 4GF8A 4QFNA 3K4UA 2QSXA 4IO2A 3RT6B 2DVZA 4EQ7A 2HEUA 4Q0CA 3UA8A 3A3UA 2KLFA 5AA1A 5AA2D 2QS4A 3ZKLA 3KJTA 4ZEDA 2B3BA 5CMBA 1POY1 1DMBA 3RTWB 3ECRA 1IIWA 4ELOA 5JEIA 1B3LA 4ZEKA 2OCUA 3VDFA 4R6YA 3C36A 3RGYA 3IOVA 1MPDA 2FYIA 1B3EA 3MAMA 2ZYOA 1TT1A 3FGSA 2ZYKA 2DXYA 1IITA 3PPNA 4KYDA 4YMBA 4WEPA 1NMUA 5DEXB 4X48A 2ZYNA 4PFTA 1B46A 3CSBA 3D4GA 1B32A 4JDFA 3UN6A 2DQVA 1A8EA 4RA1A 4GWOA 3TTKA 2OK2A 5L9OA 2F7CA 4QFKA 1OQHA 4ESXA 4YKJA 2OWTA 4DXUA 1POTA 4GLIA 2F5XA 3C33A 4GXAA 1Z7ME 1HSEA 1JVYA 4KFQA 3C4MA 4G8HA 1IXHA 3IX1A 1II5A 4TLLB 3TQLA 5K2XA 4ZS9A 5H8SA 3U8QA 5HBCA 5H8FA 1Y3PA 4DXBA 3VXCA 3FVGA 2RC7A 4FE8A 2PBWA 2HZLA 4QFLA 1LBBA 3KFMA 3S9NC 2ABHA 5H8NA 2DYXA 4KPTA 2F6PA 2PX1A 1QJMA 1IXGA 1B9JA 4F3BA 2I0BA 1J1NA 4JB7A 2UYFA 1PDAA 3OSQA 2XX8A 1Q35A 3OOAA 4OFLA 4U2RA 4H5FA 1LCTA 5I58B 3F11A 3K1PA 1PB9A 3U1OA 4DXCA 2XD3A 3SKPA 1GV8A 2FA7A 4HTGA 2UVGA 1SQYA 4PETA 5TP9B 3IAZA 4DE8A 2H5YA 3LUYA 3TQWA 5TPAA 4FJPA 2O6AA 3OSRA 3B7DA 3OXNA 1Y20A 4YB5A 2F78A 2Q8JA 1P99A 4R6HA 5ICQA 3O29A 4LA9A 4U23A 5I57A 4ELQA 4FATA 3UORA 3CRBA 3VLVA 1B1XA 1I6AA 2PVUA 4O3BA 2VD3A 2QRYA 1ELJA 2XX7A 5FTHA 2XXQA 3KEIA 5JTYB 3VVEA 5I59B 5DTBA 3VVFA 4KYEA 2ONRA 3OD7A 3VLUA 1SI1A 1JVXA 2VD2A 2XXPA 3IB2A 2P0SA 3I5OA 1QVSA 3IJOB 3MZBA 3ZKKA 4KI0E 3A3CA 2Y7PA 1MQHA 3O6HA 3TAJA 4G8MA 2V3UA 3FIRA 4EXKA 1H43A 1XVXA 5F7VA 1A8FA 2AL5A 4FIMA 4F19A 4XKPA 4GOTA 2DSFA 3KN7A 2Y7KA 1B0LA 2QJEA 1TXFA 3M3FA 3PUZE 1XVYA 4OETA 3K01A 4GL8A 3IL1B 2RF1A 3PGFA 1N76A 4GIZA 1NNPA 1OIBA 5A5XB 4YICA 4OENA 2H98A 5H8HB 1DPPA 3G7WA 3MP8A 4IO4A 4WEDA 4MH5A 4JXIA 3MWBA 3K6VA 1NFTA 2YPNA 1WVJA 1VFDA 1N3XA 1B3GA 1EH3A 2UVJA 4F3GA 5I58A 2REJA 3TFLA 2A5TB 4G68C 1GGGA 4POWA 3V89B 2I6EA 5J1DA 3HHGA 2I48A 2XXVA 2ANJA 2PT1A 1QUKA 3Q28A 1Z7NE 1IXCA 1URSA 1P1UA 2I58A 1TWYA 1MPBA 5IAIA 1FQAA 3TCHA 1Y4CA 2XXWA 1FQDA 3H7MA 2RKMA 2XXXA 4YZZA 2NVUB 4IO6A 1GVCA 1GTKA 3K02A 2ZYMA 3IO6A 1SYIA 2B3FA 3SESA 3VVDA 1Y1MA 4X9TA 3H6WA 2ZMBA 3GXAA 3TPAA 4XKNA 2F35A 4FECA 2GFEA 2NWJA 1XHYA 5JTYA 3S9MC 3B6TA 1SD3A 1LBCA 1USYE 4XIGQ 4NF6B 1I6BA 3H3GA 4PQJA 3GZGA 3G3JA 3VV5A 2QS2A 1FQCA 3Q25A 1LB9A 4R72A 5IKBA 4F18A 4Z0IA 2F6GA 3ZS6A 3SETA 4YB7A 2CMOA 4MF3A 1L5TA 3BFUA 4OEVA 1MRPA 4HCYA 4X1BA 4MFIA 1Y4TA 2F7AA 4R74A 4FEBA 2OLBA 3PMWA 5H8FB 4KR5A 4OZ9A 2AL4A 2O69A 1QULA 1A7LA 2HAUA 4C1TA 2R6GE 3K6WA 1IXIA 2V93A 1SW2A 2RC8A 4NF8B 1MQDA 4OFOA 2ZXTA 3RNNA 1QW0A 2V25A 5H8HA 1B3HA 3CFLA 2UYEA 1TFDA 1LAHE 2D21A 2DXRA 5I56B 1B2HA 2GHAA 2O51A 3QK6A 3M8UA 1SI0A 1ATGA 1MXZA 4Z7EA 3LSXA 5CBSA 3PV0E 2P2AA 1ZU0A 2I3WA 3PPQA 2A5TA 4I1DA 4IY5A 1US4A 2GRVA 2FNCA 4F39A 5B70A 4BDRA 3FXQA 3TTNA 5CRYA 3MP6A 4OFJA 1JW4A 2Y7IA 3L6GA 4NTLA 5TPAB 4GRKA 4OTEA 2DE4A 5ITOA 3O2AA 4EUOA 3KZGA 3N6TA 4GQOA 4F1VA 3MVXA 1Y3NA 1MXXA 3IOTA 3O28A 4QHQA 5I57B 4KQPA 4LVQA 2QS1A 3IOWA 1A99A 5AA3A 3OO6A 1IQ7A 2GHBA 5L9SA 3TTRA 4EDPA 4OYVA 4U4XA 4ZE8A 3EPEA 1FTLA 2DWIA 4ZECA 3TYHA 2DS9A 3R7XA 3HCQA 5AA4A 1FW0A 3DP6A 5H8QA 3TZAA 4NF6A 1B7UA 2BJJX 1DTZA 1OVTA 1B51A 1B05A 3O66A 4DZ1A 2HZKA 3KN8A 3U92A 2DVCA 2Y7RA 3EHTA 1B5JA 3T9UA 1MY0A 3K00A 4I62A 3HHFA 2IA4A 2F8DA 1LAXA 4BDOA 1ANFA 3UIFA 2DWJA 1M5DA 1GR2A 3QSLA 4DLDA 3MVZA 4M4GA 3HPIA 5BWJA 1WDNA 2VP1A 5CMKA 1URDA 4RJZA 3V5AA 1O63A 2O7UA 4NF8A 1MY4A 4C1UA 5EYFA 1SYHA 3IJXB 4DDDA 1MQIA 1PEBA 2I3VA 3H4ZA 2XXRA 1AOVA 5I56A 3CVGA 2DWHA 3MPLA 3OO7A 2H9BA 4YU0A 2Q88A 2PT2A 1B5IA 1M5BA 2HQ0A 1D9VA 4L17A 5HPQA 4BDNA 3T9HB 2V84A 2R71A 3H06B 4H67A 2RC9A 4EQ9A 5DVJA 1NKXA 4AQ4A 3KJ7A 3W15C 3U93A 5ISUA 4R2BA 4XKRA 5B7DA 3THIA 3K2DA 1YTVA 4Q30B 1B3FA 3PMVA 3KSXA 1SBPA 3A09A 1N84A 2NOOA 3KGCA 2XXYA 1JETA 1P1WA 1XS5A 2Q9TA 2I0CA 2LAOA 4TQUQ 2Y7WA 1CE2A 1EZPA 5K2YA 3VE1B 4R2FA 3FV1A 1NNFA 3VLWA 4UACA 3V8XB 4G8NA 1ZJLA 2V3TA 4FORA 3RLFE 3PD8A 2XXIA 5KCJB 5DT6A 2UVIA 3TELA 3MBPA 2I49A 1XOCA 3K0VA 4IO7A 4F31B 1N7XA 1MG1A 3FXUA 1D9YA 4R9GA 3OMBA 2PYYA 3V83A 1USYH 4WXJA 4BDLA 1M5FA 1B7ZA 4ELRA 1H76A 3KBRA 2QS3A 3T66A 1H44A 3MW0A 4ZE9A 1B6HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MXY A;  4C0R A;  4BLA A;  5L9M A;  4R75 A;  3R6U A;  5FHM A;  3HO7 A;  3QUF A;  3IB0 A;  2H99 A;  3LSW A;  1VR5 A;  3RY3 A;  1SVX B;  1MH3 A;  1AH5 A;  4GXS B;  4H0W A;  3FJM A;  5DVI A;  1MY2 A;  3USD A;  1OLC A;  1FTK A;  3TTL A;  1ZTY A;  2VGQ A;  2OZZ A;  4MLV A;  2Z23 A;  3S9L C;  3CG3 A;  3W9W A;  4YKP A;  1JW1 A;  5F1Q A;  2RCA A;  3FAT A;  2XD2 A;  1ZBM A;  4O3C A;  3PPP A;  4KD5 A;  1F9B A;  5CC2 A;  1JEV A;  2REG A;  3FVN A;  4G2Z A;  1RKM A;  4UA8 A;  3O6G A;  4AB5 A;  2Q2A A;  5AE4 A;  4RPO A;  3RUM A;  5CMC A;  3DM0 A;  1OMP A;  1NL5 A;  4X1D A;  1M5E A;  3FV2 A;  3OEN A;  3BFT A;  3PPO A;  4FAJ A;  3JV9 A;  1BKA A;  5JK4 A;  3FZV A;  3E9X A;  4PFY A;  3KSJ A;  3G3F A;  5EHS A;  3OO9 A;  5I2K B;  1D4N A;  3VXB A;  2RIN A;  3H6V A;  3RQT A;  3C34 A;  3FD3 A;  3TCG A;  2O1L A;  4KYS A;  4K3F A;  1AL3 A;  4ONY A;  1MH4 A;  4PFU A;  4G68 B;  3SER A;  2D3I A;  5AA4 B;  1SW5 A;  3PUY E;  3T22 A;  5DYH A;  1HSJ A;  1MY3 A;  1SW4 A;  5H8Q B;  3MUQ A;  3KOS A;  2CZL A;  2X7P A;  4F2O A;  3M3L A;  5KCJ A;  2IEE A;  3E13 X;  2GH9 A;  3K6U A;  5L8D A;  1LCF A;  4LON B;  4P0I A;  1LFI A;  1UQW A;  3QAX A;  4RK2 A;  1OQG A;  3AXF A;  1O7T A;  1URG A;  2XXH A;  1B0H A;  4NF5 A;  1PB7 A;  3IOU A;  3B6Q A;  4U1O A;  4YMA A;  1UTB A;  3C31 A;  2YLN A;  1RYX A;  1UIU A;  2OWS A;  2AIX A;  1N7W A;  2DP8 A;  1MM7 A;  3MPK A;  5FTI A;  2O1M A;  1BTJ A;  3U72 A;  4JSO A;  2QL3 A;  3TMG A;  4ESW A;  4OWD A;  3ILT B;  1JW5 A;  4DIG A;  4R6K A;  4ZEI A;  2E1S A;  1B40 A;  3N94 A;  2I4C A;  2D5W A;  4ISU A;  4OEU A;  3PUV E;  4U21 A;  4YKK A;  1YPN A;  3G3I A;  1PC3 A;  2F36 A;  4NED A;  3GBB A;  3IK6 B;  3N6U A;  4EF2 A;  1R6Z A;  3DP8 A;  1MXU A;  3T9V A;  3UP9 A;  4GL0 A;  1ZKB A;  2Z22 A;  3PMX A;  3SEW A;  2O7I A;  1EU8 A;  1MQG A;  3SDF A;  4JWX A;  2XXT A;  3JZJ A;  4JBZ A;  3LSL A;  3UK4 A;  2XXU A;  4TLM B;  3IOR A;  1NNK A;  4LQ2 A;  1JQF A;  4KCC A;  2UVH A;  3EF7 A;  4NF4 A;  4LZ8 A;  3PPR A;  5I2K A;  2ZNU A;  1MY1 A;  3RPW A;  1S9T A;  2V3Q A;  1N3W A;  3IB1 A;  1EZ9 A;  1RYO A;  3QIM A;  3LC8 A;  2HAV A;  4G68 A;  4NWC A;  1S50 A;  4POX A;  3Q29 A;  4LAT A;  5ELV A;  4F29 A;  1MDQ A;  1SW1 A;  1ZIU A;  3QXM A;  2O84 X;  3CI8 A;  1MPC A;  4H8I A;  4OVJ A;  3T93 B;  3O6I A;  4GFR A;  4F22 A;  3IR1 A;  4QSC A;  2F97 A;  1UTH A;  2QMX A;  2WKY A;  2H25 A;  1P1N A;  3TUS A;  2A5S A;  5ICT A;  5I2N B;  1Y3Q A;  2VHA A;  3ONM A;  3FJ7 A;  3S9E A;  1M5C A;  3MVY A;  1DPE A;  5KDT A;  1TFA A;  1I6Q A;  2Y84 A;  2G29 A;  4IGT A;  4U4S A;  2DOJ A;  4N6P A;  4OHN A;  5AA2 A;  1P1O A;  4YKI A;  1DSN A;  1S7Y A;  1PBP A;  4OER A;  4LZ7 A;  2W7Y A;  3MZ1 A;  4EF1 A;  3TKD A;  3FVK A;  4H8J A;  3PD9 A;  2Z8D A;  3FJG A;  1LLS A;  4THI A;  4NMY A;  1SDX A;  1NNT A;  1MDP 1;  1NH7 A;  4BDQ A;  3D4C A;  1T0K A;  1P1Q A;  4NWD A;  1B4Z A;  1MS7 A;  1R9Q A;  3EHS A;  4QFP A;  3TTM A;  3SEY A;  1BLF A;  2VOZ A;  1VE4 A;  4ND9 A;  2X26 A;  4P11 A;  1MXW A;  4KHZ E;  1YCJ A;  4IO5 A;  2X7Q A;  2XX9 A;  3G3H A;  3WAF A;  4LUB A;  1ZLQ A;  4QSD A;  1Q1K A;  3EQ1 A;  4LP2 B;  1LFG A;  3DEL B;  5CI5 A;  1A40 A;  3JYR A;  3HST A;  4GD5 A;  3O9P A;  1MM6 A;  5FHO A;  2Z8F A;  4HW8 A;  3DLN A;  1QKA A;  4H5G A;  1UIV A;  1A55 A;  4YAH X;  4O3A A;  3P7I A;  5KZT A;  1FTO A;  3OEK A;  1B5H A;  3U94 A;  4RK9 A;  3PUX E;  1AIV A;  3N26 A;  3T96 B;  3MZ9 A;  4G77 A;  2F7B A;  3G3K A;  3QYT A;  4EQB A;  3SEU A;  3C35 A;  1CB6 A;  4XXU A;  1FQB A;  3DP4 A;  2YJP A;  5I84 A;  1I69 A;  1PB8 A;  4HS7 A;  1Y1Z A;  3M3K A;  4IY6 A;  1N0T A;  4ZEF A;  3CG1 A;  3WAE A;  3K6X A;  5DEX A;  4DCY A;  4Q8R A;  3LSF B;  4NF5 B;  4OMB A;  3E3K A;  3MP1 A;  4DCX A;  3QUJ A;  1UTB B;  3Q27 A;  5I2N A;  1NH8 A;  3C9H A;  4F1Y A;  4R73 A;  3FAS A;  4F3S A;  2Z8E A;  4ZDM A;  1B52 A;  5TU0 A;  1R1N A;  3ZSF A;  1ZMG A;  2PMS A;  3SEX A;  2ALU A;  2E0S A;  4ZEB A;  4I9D A;  3UGW A;  4H6D A;  2Q89 A;  3TOD A;  2NXO A;  1R9L A;  5CM6 A;  3L6H A;  2OBG A;  3KG2 A;  1HSL A;  1KWH A;  1H3D A;  2M8C A;  4RYA A;  2G93 A;  2AYS A;  3TEP A;  1LGB C;  4U22 A;  5BUU A;  1QUI A;  2P1S A;  1N04 A;  1YAE A;  4EXL A;  3FUZ A;  4MLQ A;  3TCF A;  1VFE A;  4QRZ A;  1IZ1 A;  4GVO A;  1BP5 A;  3H6U A;  4LZ5 A;  1AMF A;  4ZZE A;  4PP0 A;  1US5 A;  3EN3 A;  3IO4 A;  3W9V A;  2DE2 A;  3RT8 A;  3B6W A;  4OES A;  2Q2C A;  1DTG A;  1EZO A;  3ILU B;  5TP9 A;  1LST A;  4I8C A;  4G4P A;  4U1Z A;  2B65 A;  4NF4 B;  1FCK A;  4PFW A;  1FQF A;  5LOM A;  2OJT A;  1LFH A;  3K1M A;  1OLA A;  1IUD A;  1B58 A;  4ZZA A;  1VSO A;  2ONS A;  2HCA A;  3GLB A;  4RPN A;  5HM4 B;  4F1U A;  3E4R A;  3KN3 A;  4RY1 A;  3MVW A;  3CFZ A;  3RTF B;  3S4U A;  4QFO A;  3R26 A;  1LAF E;  3OEL A;  2QPQ A;  2ESN A;  2ZNT A;  2I4B A;  3FVO A;  3CSG A;  2F34 A;  3OEM A;  2O68 A;  3C32 A;  4RXL A;  4F3P A;  3MJN A;  5I59 A;  2ONK E;  3CR9 A;  4OXV A;  2HFB A;  4JWY A;  1UTH B;  1XC1 A;  3T9X B;  1O64 A;  4F2Q A;  3PU5 A;  1PBQ A;  4XKQ A;  2HXW A;  1QUJ A;  4XTC Q;  3KOT A;  3MC2 A;  3G3G A;  3SEV A;  5KDT B;  3LBS A;  5AA2 B;  4E0X A;  3RN8 A;  3I6V A;  1IEJ A;  5CMM A;  3BKI B;  1B1H A;  1B4H A;  4YB6 A;  4QF9 A;  4BDM A;  1QKB A;  4FED A;  5CBR A;  2ZNS A;  3K1N A;  3FXR A;  4MBP A;  2THI A;  4OQO A;  3VFJ A;  3H6T A;  3BBR A;  4JWO A;  1XT8 A;  1LAG E;  4N07 A;  1OVB A;  3MQ9 A;  2QMW A;  3HN0 A;  4WKM A;  4ELP A;  2XHD A;  5A5X A;  2DE3 A;  1WOD A;  5H8N B;  2RCB A;  5DVF A;  1D3K A;  4NE4 A;  3PUW E;  1H45 A;  4TOZ A;  3H03 A;  1JNF A;  2NUV A;  3TDJ A;  3HV1 A;  1B7H A;  4LQ5 A;  3N5L A;  5M2V A;  4R9F A;  5EHM A;  4IGR A;  2H4I A;  4ECF A;  1FTM A;  4IO3 A;  4P0G A;  4QSE A;  5ITP A;  4RNS A;  3LR1 A;  3S2V A;  4Q5T A;  3OO8 A;  1FQE A;  4PE5 B;  3O97 A;  3I3V A;  1FTJ A;  3CIJ A;  1MQJ A;  3ODB A;  4H1X A;  3Q26 A;  2UXA A;  2R9J A;  3EHU A;  5FHN A;  1A54 A;  1MXV A;  4KCD A;  3CFX A;  1Y9U A;  4E0W A;  4JSD A;  4H65 A;  2DWA A;  4IB2 A;  4N13 A;  3GBA A;  1JEU A;  4AB6 A;  4HCW A;  4M1V A;  1DOT A;  1LB8 A;  1BIY A;  4GF8 A;  4QFN A;  3K4U A;  2QSX A;  4IO2 A;  3RT6 B;  2DVZ A;  4EQ7 A;  2HEU A;  4Q0C A;  3UA8 A;  3A3U A;  2KLF A;  5AA1 A;  5AA2 D;  2QS4 A;  3ZKL A;  3KJT A;  4ZED A;  2B3B A;  5CMB A;  1POY 1;  1DMB A;  3RTW B;  3ECR A;  1IIW A;  4ELO A;  5JEI A;  1B3L A;  4ZEK A;  2OCU A;  3VDF A;  4R6Y A;  3C36 A;  3RGY A;  3IOV A;  1MPD A;  2FYI A;  1B3E A;  3MAM A;  2ZYO A;  1TT1 A;  3FGS A;  2ZYK A;  2DXY A;  1IIT A;  3PPN A;  4KYD A;  4YMB A;  4WEP A;  1NMU A;  5DEX B;  4X48 A;  2ZYN A;  4PFT A;  1B46 A;  3CSB A;  3D4G A;  1B32 A;  4JDF A;  3UN6 A;  2DQV A;  1A8E A;  4RA1 A;  4GWO A;  3TTK A;  2OK2 A;  5L9O A;  2F7C A;  4QFK A;  1OQH A;  4ESX A;  4YKJ A;  2OWT A;  4DXU A;  1POT A;  4GLI A;  2F5X A;  3C33 A;  4GXA A;  1Z7M E;  1HSE A;  1JVY A;  4KFQ A;  3C4M A;  4G8H A;  1IXH A;  3IX1 A;  1II5 A;  4TLL B;  3TQL A;  5K2X A;  4ZS9 A;  5H8S A;  3U8Q A;  5HBC A;  5H8F A;  1Y3P A;  4DXB A;  3VXC A;  3FVG A;  2RC7 A;  4FE8 A;  2PBW A;  2HZL A;  4QFL A;  1LBB A;  3KFM A;  3S9N C;  2ABH A;  5H8N A;  2DYX A;  4KPT A;  2F6P A;  2PX1 A;  1QJM A;  1IXG A;  1B9J A;  4F3B A;  2I0B A;  1J1N A;  4JB7 A;  2UYF A;  1PDA A;  3OSQ A;  2XX8 A;  1Q35 A;  3OOA A;  4OFL A;  4U2R A;  4H5F A;  1LCT A;  5I58 B;  3F11 A;  3K1P A;  1PB9 A;  3U1O A;  4DXC A;  2XD3 A;  3SKP A;  1GV8 A;  2FA7 A;  4HTG A;  2UVG A;  1SQY A;  4PET A;  5TP9 B;  3IAZ A;  4DE8 A;  2H5Y A;  3LUY A;  3TQW A;  5TPA A;  4FJP A;  2O6A A;  3OSR A;  3B7D A;  3OXN A;  1Y20 A;  4YB5 A;  2F78 A;  2Q8J A;  1P99 A;  4R6H A;  5ICQ A;  3O29 A;  4LA9 A;  4U23 A;  5I57 A;  4ELQ A;  4FAT A;  3UOR A;  3CRB A;  3VLV A;  1B1X A;  1I6A A;  2PVU A;  4O3B A;  2VD3 A;  2QRY A;  1ELJ A;  2XX7 A;  5FTH A;  2XXQ A;  3KEI A;  5JTY B;  3VVE A;  5I59 B;  5DTB A;  3VVF A;  4KYE A;  2ONR A;  3OD7 A;  3VLU A;  1SI1 A;  1JVX A;  2VD2 A;  2XXP A;  3IB2 A;  2P0S A;  3I5O A;  1QVS A;  3IJO B;  3MZB A;  3ZKK A;  4KI0 E;  3A3C A;  2Y7P A;  1MQH A;  3O6H A;  3TAJ A;  4G8M A;  2V3U A;  3FIR A;  4EXK A;  1H43 A;  1XVX A;  5F7V A;  1A8F A;  2AL5 A;  4FIM A;  4F19 A;  4XKP A;  4GOT A;  2DSF A;  3KN7 A;  2Y7K A;  1B0L A;  2QJE A;  1TXF A;  3M3F A;  3PUZ E;  1XVY A;  4OET A;  3K01 A;  4GL8 A;  3IL1 B;  2RF1 A;  3PGF A;  1N76 A;  4GIZ A;  1NNP A;  1OIB A;  5A5X B;  4YIC A;  4OEN A;  2H98 A;  5H8H B;  1DPP A;  3G7W A;  3MP8 A;  4IO4 A;  4WED A;  4MH5 A;  4JXI A;  3MWB A;  3K6V A;  1NFT A;  2YPN A;  1WVJ A;  1VFD A;  1N3X A;  1B3G A;  1EH3 A;  2UVJ A;  4F3G A;  5I58 A;  2REJ A;  3TFL A;  2A5T B;  4G68 C;  1GGG A;  4POW A;  3V89 B;  2I6E A;  5J1D A;  3HHG A;  2I48 A;  2XXV A;  2ANJ A;  2PT1 A;  1QUK A;  3Q28 A;  1Z7N E;  1IXC A;  1URS A;  1P1U A;  2I58 A;  1TWY A;  1MPB A;  5IAI A;  1FQA A;  3TCH A;  1Y4C A;  2XXW A;  1FQD A;  3H7M A;  2RKM A;  2XXX A;  4YZZ A;  2NVU B;  4IO6 A;  1GVC A;  1GTK A;  3K02 A;  2ZYM A;  3IO6 A;  1SYI A;  2B3F A;  3SES A;  3VVD A;  1Y1M A;  4X9T A;  3H6W A;  2ZMB A;  3GXA A;  3TPA A;  4XKN A;  2F35 A;  4FEC A;  2GFE A;  2NWJ A;  1XHY A;  5JTY A;  3S9M C;  3B6T A;  1SD3 A;  1LBC A;  1USY E;  4XIG Q;  4NF6 B;  1I6B A;  3H3G A;  4PQJ A;  3GZG A;  3G3J A;  3VV5 A;  2QS2 A;  1FQC A;  3Q25 A;  1LB9 A;  4R72 A;  5IKB A;  4F18 A;  4Z0I A;  2F6G A;  3ZS6 A;  3SET A;  4YB7 A;  2CMO A;  4MF3 A;  1L5T A;  3BFU A;  4OEV A;  1MRP A;  4HCY A;  4X1B A;  4MFI A;  1Y4T A;  2F7A A;  4R74 A;  4FEB A;  2OLB A;  3PMW A;  5H8F B;  4KR5 A;  4OZ9 A;  2AL4 A;  2O69 A;  1QUL A;  1A7L A;  2HAU A;  4C1T A;  2R6G E;  3K6W A;  1IXI A;  2V93 A;  1SW2 A;  2RC8 A;  4NF8 B;  1MQD A;  4OFO A;  2ZXT A;  3RNN A;  1QW0 A;  2V25 A;  5H8H A;  1B3H A;  3CFL A;  2UYE A;  1TFD A;  1LAH E;  2D21 A;  2DXR A;  5I56 B;  1B2H A;  2GHA A;  2O51 A;  3QK6 A;  3M8U A;  1SI0 A;  1ATG A;  1MXZ A;  4Z7E A;  3LSX A;  5CBS A;  3PV0 E;  2P2A A;  1ZU0 A;  2I3W A;  3PPQ A;  2A5T A;  4I1D A;  4IY5 A;  1US4 A;  2GRV A;  2FNC A;  4F39 A;  5B70 A;  4BDR A;  3FXQ A;  3TTN A;  5CRY A;  3MP6 A;  4OFJ A;  1JW4 A;  2Y7I A;  3L6G A;  4NTL A;  5TPA B;  4GRK A;  4OTE A;  2DE4 A;  5ITO A;  3O2A A;  4EUO A;  3KZG A;  3N6T A;  4GQO A;  4F1V A;  3MVX A;  1Y3N A;  1MXX A;  3IOT A;  3O28 A;  4QHQ A;  5I57 B;  4KQP A;  4LVQ A;  2QS1 A;  3IOW A;  1A99 A;  5AA3 A;  3OO6 A;  1IQ7 A;  2GHB A;  5L9S A;  3TTR A;  4EDP A;  4OYV A;  4U4X A;  4ZE8 A;  3EPE A;  1FTL A;  2DWI A;  4ZEC A;  3TYH A;  2DS9 A;  3R7X A;  3HCQ A;  5AA4 A;  1FW0 A;  3DP6 A;  5H8Q A;  3TZA A;  4NF6 A;  1B7U A;  2BJJ X;  1DTZ A;  1OVT A;  1B51 A;  1B05 A;  3O66 A;  4DZ1 A;  2HZK A;  3KN8 A;  3U92 A;  2DVC A;  2Y7R A;  3EHT A;  1B5J A;  3T9U A;  1MY0 A;  3K00 A;  4I62 A;  3HHF A;  2IA4 A;  2F8D A;  1LAX A;  4BDO A;  1ANF A;  3UIF A;  2DWJ A;  1M5D A;  1GR2 A;  3QSL A;  4DLD A;  3MVZ A;  4M4G A;  3HPI A;  5BWJ A;  1WDN A;  2VP1 A;  5CMK A;  1URD A;  4RJZ A;  3V5A A;  1O63 A;  2O7U A;  4NF8 A;  1MY4 A;  4C1U A;  5EYF A;  1SYH A;  3IJX B;  4DDD A;  1MQI A;  1PEB A;  2I3V A;  3H4Z A;  2XXR A;  1AOV A;  5I56 A;  3CVG A;  2DWH A;  3MPL A;  3OO7 A;  2H9B A;  4YU0 A;  2Q88 A;  2PT2 A;  1B5I A;  1M5B A;  2HQ0 A;  1D9V A;  4L17 A;  5HPQ A;  4BDN A;  3T9H B;  2V84 A;  2R71 A;  3H06 B;  4H67 A;  2RC9 A;  4EQ9 A;  5DVJ A;  1NKX A;  4AQ4 A;  3KJ7 A;  3W15 C;  3U93 A;  5ISU A;  4R2B A;  4XKR A;  5B7D A;  3THI A;  3K2D A;  1YTV A;  4Q30 B;  1B3F A;  3PMV A;  3KSX A;  1SBP A;  3A09 A;  1N84 A;  2NOO A;  3KGC A;  2XXY A;  1JET A;  1P1W A;  1XS5 A;  2Q9T A;  2I0C A;  2LAO A;  4TQU Q;  2Y7W A;  1CE2 A;  1EZP A;  5K2Y A;  3VE1 B;  4R2F A;  3FV1 A;  1NNF A;  3VLW A;  4UAC A;  3V8X B;  4G8N A;  1ZJL A;  2V3T A;  4FOR A;  3RLF E;  3PD8 A;  2XXI A;  5KCJ B;  5DT6 A;  2UVI A;  3TEL A;  3MBP A;  2I49 A;  1XOC A;  3K0V A;  4IO7 A;  4F31 B;  1N7X A;  1MG1 A;  3FXU A;  1D9Y A;  4R9G A;  3OMB A;  2PYY A;  3V83 A;  1USY H;  4WXJ A;  4BDL A;  1M5F A;  1B7Z A;  4ELR A;  1H76 A;  3KBR A;  2QS3 A;  3T66 A;  1H44 A;  3MW0 A;  4ZE9 A;  1B6H A; 
#chains in the Genus database with same CATH topology
 1MXY A;  4C0R A;  4BLA A;  5L9M A;  4R75 A;  3R6U A;  5FHM A;  3HO7 A;  2P3V A;  3QUF A;  3IB0 A;  2H99 A;  3LSW A;  1VR5 A;  1K9Z A;  3RY3 A;  1SVX B;  1MH3 A;  1AH5 A;  4GXS B;  4H0W A;  3FJM A;  5DVI A;  1MY2 A;  4PBQ A;  1EYI A;  3USD A;  1OLC A;  1FTK A;  3TTL A;  1ZTY A;  2VGQ A;  4P9K A;  2OZZ A;  4MLV A;  2Z23 A;  3S9L C;  3CG3 A;  2CEX A;  5I5P A;  3W9W A;  4JVC A;  4YKP A;  1JW1 A;  2WYK A;  5F1Q A;  2RCA A;  3FAT A;  2XD2 A;  1ZBM A;  4O3C A;  3PPP A;  4KD5 A;  1F9B A;  5CC2 A;  1JEV A;  2REG A;  3FVN A;  4G2Z A;  1RKM A;  4UA8 A;  3O6G A;  4AB5 A;  2Q2A A;  5AE4 A;  4H45 A;  4RPO A;  3RUM A;  1NUZ A;  5CMC A;  3DM0 A;  1OMP A;  1NL5 A;  4X1D A;  1M5E A;  3FV2 A;  3OEN A;  3BFT A;  4JVI A;  4PE3 A;  3PPO A;  4FAJ A;  3JV9 A;  1BKA A;  1EYK A;  5JK4 A;  4MIJ A;  3FZV A;  3E9X A;  4PFY A;  3KSJ A;  1NV2 A;  3G3F A;  5EHS A;  3OO9 A;  5I2K B;  1D4N A;  3VXB A;  2RIN A;  4N15 A;  3H6V A;  3RQT A;  3C34 A;  3FD3 A;  3TCG A;  2O1L A;  4KYS A;  4K3F A;  1AL3 A;  4MNI A;  4ONY A;  1MH4 A;  4PFU A;  4G68 B;  4HE0 A;  3SER A;  2D3I A;  1SW5 A;  5AA4 B;  3PUY E;  3T22 A;  5DYH A;  1HSJ A;  1MY3 A;  1SW4 A;  5H8Q B;  3MUQ A;  2QVV A;  3FBP A;  3KOS A;  2CZL A;  2X7P A;  4F2O A;  3M3L A;  5KCJ A;  2IEE A;  3E13 X;  2GH9 A;  3K6U A;  4O7M A;  5L8D A;  3T0J A;  1LCF A;  3RPL B;  4LON B;  4P0I A;  1LFI A;  1UQW A;  3QAX A;  4N6D A;  4RK2 A;  1OQG A;  4NAP A;  3AXF A;  1O7T A;  1URG A;  2XXH A;  1B0H A;  4NF5 A;  2XWO A;  1PB7 A;  3IOU A;  4I40 A;  3B6Q A;  4PTK A;  4U1O A;  4YMA A;  1UTB A;  3C31 A;  5I7I A;  2YLN A;  1RYX A;  1UIU A;  2OWS A;  2AIX A;  1N7W A;  1G0I A;  5EQ7 A;  2DP8 A;  1MM7 A;  3MPK A;  5EYH A;  5FTI A;  2O1M A;  1BTJ A;  5ET5 A;  3U72 A;  4JSO A;  2QL3 A;  3TMG A;  4ESW A;  4OWD A;  3ILT B;  1JW5 A;  4DIG A;  4R6K A;  4ZEI A;  2E1S A;  1B40 A;  3N94 A;  2I4C A;  2D5W A;  3PTY A;  4IR8 A;  4ISU A;  4OEU A;  3PUV E;  4PGN A;  4U21 A;  4YKK A;  1YPN A;  3G3I A;  1PC3 A;  2F36 A;  4NED A;  3GBB A;  3IK6 B;  5IM2 A;  3N6U A;  4EF2 A;  1R6Z A;  2WX9 A;  3DP8 A;  1MXU A;  3T9V A;  3UP9 A;  4GL0 A;  1ZKB A;  2Z22 A;  3PMX A;  3SEW A;  2O7I A;  4P1L A;  1EU8 A;  1MQG A;  3SDF A;  4P56 A;  4JWX A;  2XXT A;  3JZJ A;  4JBZ A;  3LSL A;  3UK4 A;  2XXU A;  4TLM B;  3IOR A;  1NV0 A;  1NNK A;  4LQ2 A;  1JQF A;  4KCC A;  2FBP A;  2UVH A;  3EF7 A;  4NF4 A;  4LZ8 A;  4PDH A;  3PPR A;  5DW8 A;  5I2K A;  2ZNU A;  1MY1 A;  3RPW A;  1S9T A;  2V3Q A;  1N3W A;  3IB1 A;  3LV0 A;  1EZ9 A;  1RYO A;  3QIM A;  3LC8 A;  2HAV A;  4G68 A;  4NWC A;  1S50 A;  1VDW A;  4POX A;  4GBW A;  3Q29 A;  4LAT A;  5ELV A;  4F29 A;  3HFU A;  1MDQ A;  1SW1 A;  1ZIU A;  3QXM A;  2O84 X;  3CI8 A;  1MPC A;  4H8I A;  4OVJ A;  3T93 B;  3RPL A;  2QFL A;  3O6I A;  4GFR A;  4F22 A;  3IR1 A;  4QSC A;  2F97 A;  1UTH A;  2CEY A;  2QMX A;  2WKY A;  1NV3 A;  2H25 A;  1P1N A;  3TUS A;  2A5S A;  5ICT A;  5I2N B;  1Y3Q A;  2VHA A;  3ONM A;  3FJ7 A;  3S9E A;  1M5C A;  3MVY A;  1DPE A;  5KDT A;  1TFA A;  1I6Q A;  4G61 A;  2Y84 A;  2G29 A;  4IGT A;  4U4S A;  2DOJ A;  4N17 A;  4N6P A;  4OHN A;  5AA2 A;  1G0H A;  4N6K A;  2FIX A;  1P1O A;  4YKI A;  1DSN A;  1YYZ A;  1S7Y A;  1PBP A;  4OER A;  4LZ7 A;  2W7Y A;  3MZ1 A;  4EF1 A;  3TKD A;  4GX3 A;  3FVK A;  4H8J A;  3PD9 A;  2Z8D A;  3FJG A;  1LLS A;  4THI A;  4NMY A;  5IZ1 A;  1FRP A;  1LBZ A;  1SDX A;  1NNT A;  1MDP 1;  1NH7 A;  4BDQ A;  3D4C A;  1T0K A;  1P1Q A;  4NWD A;  1B4Z A;  2V4C A;  1MS7 A;  1R9Q A;  3EHS A;  4QFP A;  1LBY A;  3TTM A;  3SEY A;  1BLF A;  2VOZ A;  1VE4 A;  4ND9 A;  2X26 A;  4P11 A;  1MXW A;  4KHZ E;  1NV7 A;  1YCJ A;  4IO5 A;  2X7Q A;  2XX9 A;  3G3H A;  3WAF A;  4LUB A;  1AWB A;  1ZLQ A;  4QSD A;  1Q1K A;  1FJ6 A;  3EQ1 A;  4LP2 B;  1LFG A;  3DEL B;  5CI5 A;  1A40 A;  3JYR A;  3HST A;  4GD5 A;  3O9P A;  4GWX A;  1MM6 A;  5FHO A;  2Z8F A;  4HW8 A;  5J16 A;  3ISP A;  3DLN A;  4GBV A;  1QKA A;  4H5G A;  1UIV A;  1IMA A;  1A55 A;  4O3A A;  4YAH X;  3P7I A;  5KZT A;  1FTO A;  3OEK A;  1B5H A;  3U94 A;  4RK9 A;  3PUX E;  3FXB A;  5ET8 A;  2CZH A;  1AIV A;  3N26 A;  3T96 B;  2CZK A;  4NQ8 A;  3MZ9 A;  4G77 A;  2F7B A;  3G3K A;  3QYT A;  4EQB A;  3SEU A;  4JVD A;  2QVR A;  3C35 A;  1CB6 A;  4XXU A;  1FQB A;  2GQ1 A;  3DP4 A;  2YJP A;  5I84 A;  1I69 A;  1PB8 A;  4HS7 A;  1Y1Z A;  3M3K A;  4IY6 A;  1N0T A;  4ZEF A;  3CG1 A;  3WAE A;  3K6X A;  5DEX A;  4DCY A;  4Q8R A;  3LSF B;  4NF5 B;  4OMB A;  3E3K A;  1FPE A;  3MP1 A;  2VPO A;  1IMD A;  4DCX A;  3QUJ A;  1UTB B;  3Q27 A;  5I2N A;  4H46 A;  1NH8 A;  3C9H A;  4F1Y A;  4R73 A;  3FAS A;  2Z8E A;  4F3S A;  1K9Y A;  4ZDM A;  1B52 A;  1EYJ A;  5TU0 A;  1R1N A;  3ZSF A;  1NV5 A;  1ZMG A;  2PMS A;  3SEX A;  1FPJ A;  2ALU A;  2E0S A;  1INP A;  4MX6 A;  1FPF A;  4QBA A;  4ZEB A;  1FPK A;  4I9D A;  3UGW A;  4H6D A;  2Q89 A;  3TOD A;  2NXO A;  1R9L A;  1XI6 A;  2L5V A;  5CM6 A;  3L6H A;  2OBG A;  3KG2 A;  1HSL A;  1KWH A;  1H3D A;  2M8C A;  4RYA A;  2G93 A;  2AYS A;  3TEP A;  1LGB C;  4U22 A;  5BUU A;  1QUI A;  2P1S A;  1N04 A;  1YAE A;  2Y5L A;  4OVS A;  4EXL A;  2KR0 A;  1FBF A;  3LUZ A;  3FUZ A;  4MLQ A;  3TCF A;  1NV1 A;  1VFE A;  4QRZ A;  1IZ1 A;  4GVO A;  1BP5 A;  3H6U A;  4LZ5 A;  1AMF A;  4ZZE A;  4PAK A;  4PP0 A;  1US5 A;  3EN3 A;  3IO4 A;  3W9V A;  2DE2 A;  3RT8 A;  3B6W A;  4OES A;  2Q2C A;  1DTG A;  1EZO A;  1LBW A;  3ILU B;  5TP9 A;  5EQ9 A;  1LST A;  2WEF A;  3D1R A;  4I8C A;  4G4P A;  4U1Z A;  2PCR A;  2B65 A;  4NF4 B;  1FCK A;  4PFW A;  1FQF A;  5LOM A;  2OJT A;  2WBD A;  1LFH A;  3K1M A;  1OLA A;  1IUD A;  1B58 A;  4ZZA A;  1VSO A;  2ONS A;  2HCA A;  3GLB A;  5ESY A;  5LTC A;  4RPN A;  5HM4 B;  4F1U A;  3E4R A;  3KN3 A;  4RY1 A;  3MVW A;  3CFZ A;  3RTF B;  3S4U A;  4MAG A;  3R26 A;  4QFO A;  1LAF E;  3OEL A;  2QPQ A;  2ESN A;  2ZNT A;  2I4B A;  3FVO A;  3CSG A;  2F34 A;  3OEM A;  2O68 A;  3C32 A;  4RXL A;  4F3P A;  3MJN A;  4NN3 A;  5I59 A;  1FSA A;  2ONK E;  4PF6 A;  5IZ3 A;  3CR9 A;  4OXV A;  4GWS A;  2HFB A;  4JWY A;  1UTH B;  3RYD A;  1XC1 A;  3T9X B;  1FPI A;  1FTA A;  1O64 A;  4F2Q A;  3PU5 A;  1PBQ A;  4XKQ A;  2HXW A;  1QUJ A;  1NUX A;  4XTC Q;  3KOT A;  3MC2 A;  3G3G A;  3SEV A;  5KDT B;  5F24 A;  3LBS A;  5AA2 B;  4XEQ A;  4E0X A;  3RN8 A;  4X8R A;  3I6V A;  1IEJ A;  1NUW A;  5CMM A;  2F3B A;  3BKI B;  5IZZ A;  1B1H A;  1B4H A;  4YB6 A;  5T3J A;  4QF9 A;  4BDM A;  1QKB A;  2HHM A;  5ET7 A;  4FED A;  5CBR A;  2ZNS A;  3K1N A;  3FXR A;  4MBP A;  4MHF A;  2THI A;  4OQO A;  3VFJ A;  3H6T A;  3BBR A;  4JWO A;  2B4M A;  1XT8 A;  1LAG E;  4N07 A;  1OVB A;  3MQ9 A;  2QMW A;  3HN0 A;  4WKM A;  4ELP A;  2XHD A;  5A5X A;  2DE3 A;  1WOD A;  5H8N B;  1BK4 A;  2RCB A;  5DVF A;  1D3K A;  4NE4 A;  4OAN A;  3PUW E;  1H45 A;  4AS4 A;  4XF5 A;  4TOZ A;  3H03 A;  1JNF A;  2NUV A;  3TDJ A;  4GX4 A;  4O7I A;  3HV1 A;  1LEV A;  4PFR A;  1B7H A;  4LQ5 A;  3N5L A;  5M2V A;  4R9F A;  5EHM A;  4IGR A;  2H4I A;  4ECF A;  1FTM A;  4IO3 A;  4P0G A;  4QSE A;  5ITP A;  4RNS A;  3LR1 A;  3S2V A;  4PFI A;  4Q5T A;  3OO8 A;  5A5L A;  4QXD A;  1FQE A;  2Y5K A;  4PE5 B;  1D9Q A;  3O97 A;  3I3V A;  1FTJ A;  3CIJ A;  1MQJ A;  3ODB A;  4H1X A;  3Q26 A;  2UXA A;  2R9J A;  3EHU A;  5FHN A;  1A54 A;  1MXV A;  4KCD A;  3CFX A;  1Y9U A;  4E0W A;  4JSD A;  4H65 A;  2DWA A;  4IB2 A;  4N13 A;  3GBA A;  1JEU A;  4M1V A;  4HCW A;  4AB6 A;  1DOT A;  1LB8 A;  1BIY A;  4GF8 A;  4QFN A;  3K4U A;  2QSX A;  4IO2 A;  3RT6 B;  1KA1 A;  2DVZ A;  4EQ7 A;  4MNC A;  2HEU A;  4Q0C A;  3UA8 A;  2XA5 A;  3A3U A;  4NHB A;  2KLF A;  4MNP A;  5AA1 A;  5AA2 D;  5LDZ A;  2QS4 A;  1NV6 A;  3ZKL A;  3KJT A;  4ZED A;  2B3B A;  5CMB A;  1POY 1;  1DMB A;  3RTW B;  3ECR A;  4N8G A;  1IIW A;  4ELO A;  5JEI A;  1B3L A;  4ZEK A;  2OCU A;  3VDF A;  4R6Y A;  3C36 A;  3RGY A;  3IOV A;  1MPD A;  2FYI A;  1B3E A;  3MAM A;  2ZYO A;  1TT1 A;  4OA4 A;  3FGS A;  2ZYK A;  2DXY A;  1IIT A;  3PPN A;  4KYD A;  4YMB A;  4WEP A;  2P3N A;  1NMU A;  5DEX B;  4X48 A;  2ZYN A;  4PFT A;  5EYG A;  1B46 A;  3CSB A;  3D4G A;  1B32 A;  4JDF A;  3UN6 A;  2DQV A;  1QGX A;  1A8E A;  4RA1 A;  4GWO A;  3TTK A;  2OK2 A;  5L9O A;  2F7C A;  4QFK A;  2WBB A;  3MST A;  1OQH A;  4ESX A;  4YKJ A;  2OWT A;  4DXU A;  1POT A;  4GLI A;  2F5X A;  3C33 A;  1Q9D A;  4GXA A;  4FBP A;  4XFE A;  2OWZ A;  1FPB A;  1FPL A;  1Z7M E;  1HSE A;  1JVY A;  4KFQ A;  3C4M A;  4G8H A;  1IXH A;  3IX1 A;  1II5 A;  4TLL B;  3TQL A;  5K2X A;  4ZS9 A;  5H8S A;  3U8Q A;  4P8B A;  5HBC A;  5H8F A;  1Y3P A;  4DXB A;  3VXC A;  3FVG A;  2RC7 A;  4FE8 A;  2PBW A;  2HZL A;  4QFL A;  1LBB A;  3KFM A;  3S9N C;  2ABH A;  5H8N A;  2DYX A;  4KPT A;  2F6P A;  2PX1 A;  1QJM A;  1IXG A;  2FHY A;  1B9J A;  4F3B A;  1LBX A;  2I0B A;  1J1N A;  4JB7 A;  2UYF A;  1PDA A;  5I3S A;  3OSQ A;  2XX8 A;  4MJO A;  1Q35 A;  3OOA A;  4OFL A;  2XWV A;  3EKI A;  3BIG A;  4U2R A;  4H5F A;  1LCT A;  5I58 B;  3F11 A;  4AS5 A;  3KBZ A;  3K1P A;  1PB9 A;  3U1O A;  4N4U A;  1IMB A;  2FVZ A;  4DXC A;  2XD3 A;  3SKP A;  5ET6 A;  1GV8 A;  2FA7 A;  4HTG A;  2UVG A;  1SQY A;  4PET A;  5TP9 B;  3IAZ A;  2PFZ A;  4GWY A;  4DE8 A;  2H5Y A;  3LUY A;  3TQW A;  5TPA A;  4FJP A;  3MYU A;  4PAI A;  2O6A A;  3OSR A;  3B7D A;  3OXN A;  2MKZ A;  4MCO A;  1Y20 A;  4YB5 A;  2F78 A;  2Q8J A;  1P99 A;  4R6H A;  5ICQ A;  3O29 A;  4LA9 A;  4U23 A;  5I57 A;  4ELQ A;  4FAT A;  3UOR A;  3CRB A;  3VLV A;  1B1X A;  1I6A A;  2PVU A;  4O3B A;  2VD3 A;  2QRY A;  1ELJ A;  2XX7 A;  5FBP A;  5FTH A;  2XXQ A;  3KEI A;  5JTY B;  3VVE A;  5I59 B;  5DTB A;  3VVF A;  4KYE A;  5IZ3 B;  4N8Y A;  2ONR A;  1FBD A;  3OD7 A;  3VLU A;  1SI1 A;  1JVX A;  4N91 A;  1FBP A;  1IMF A;  2VD2 A;  2XXP A;  3IB2 A;  2P0S A;  3I5O A;  4HE2 A;  1QVS A;  1YXI A;  2VPN A;  3IJO B;  3MZB A;  3ZKK A;  5EQ8 A;  4KI0 E;  3A3C A;  2Y7P A;  1MQH A;  3O6H A;  3TAJ A;  4G8M A;  2V3U A;  3FIR A;  4EXK A;  1H43 A;  1XVX A;  1NV4 A;  5F7V A;  1A8F A;  2ZZV A;  2AL5 A;  1CNQ A;  4FIM A;  4F19 A;  4XKP A;  4GOT A;  2DSF A;  3KN7 A;  2Y7K A;  1B0L A;  2QJE A;  1TXF A;  3M3F A;  3PUZ E;  1XVY A;  4OET A;  5IGA A;  3K01 A;  4GL8 A;  1NI9 A;  2XWK A;  3IL1 B;  2RF1 A;  3PGF A;  2HXR A;  1N76 A;  4GIZ A;  1NNP A;  2PFY A;  1OIB A;  5A5X B;  4PBH A;  4YIC A;  4OEN A;  2H98 A;  5H8H B;  1DPP A;  3G7W A;  1FBH A;  3MP8 A;  4IO4 A;  2BJI A;  4WED A;  4NF0 A;  4MH5 A;  4JXI A;  4PF8 A;  3MWB A;  3K6V A;  1NFT A;  2YPN A;  1WVJ A;  1VFD A;  1N3X A;  1B3G A;  2WYP A;  4PAF A;  1EH3 A;  2UVJ A;  4F3G A;  5I58 A;  2REJ A;  3KC1 A;  4G68 C;  2A5T B;  4POW A;  1GGG A;  3TFL A;  3V89 B;  2QVU A;  2I6E A;  5J1D A;  2HPG A;  3HHG A;  2I48 A;  2XXV A;  2ANJ A;  2PT1 A;  1QUK A;  3Q28 A;  4P1E A;  1Z7N E;  1IXC A;  1URS A;  1P1U A;  2I58 A;  1TWY A;  4O94 A;  1MPB A;  5IAI A;  1FQA A;  3TCH A;  1Y4C A;  1IMC A;  2XXW A;  1FQD A;  3H7M A;  2RKM A;  2XXX A;  3B8B A;  3T1B A;  4YZZ A;  1RDZ A;  2R8T A;  2NVU B;  4IO6 A;  1GVC A;  1GTK A;  3K02 A;  2ZYM A;  3IO6 A;  1SYI A;  2B3F A;  3SES A;  3VVD A;  4X04 A;  1FBG A;  1Y1M A;  4X9T A;  3H6W A;  2ZMB A;  1DK4 A;  3GXA A;  3TPA A;  4XKN A;  2F35 A;  4FEC A;  2GFE A;  2NWJ A;  1XHY A;  5JTY A;  1SPI A;  3S9M C;  3B6T A;  1SD3 A;  3A29 A;  1LBC A;  2Q74 A;  1USY E;  4XIG Q;  4NF6 B;  1I6B A;  3H3G A;  4PC9 A;  4GWU A;  4PQJ A;  3GZG A;  3G3J A;  2F3D A;  3VV5 A;  2QS2 A;  1FQC A;  4PGP A;  4DI3 D;  3Q25 A;  1LB9 A;  4R72 A;  5IKB A;  4F18 A;  4UAB A;  4Z0I A;  2F6G A;  3ZS6 A;  3SET A;  4YB7 A;  2CMO A;  4MF3 A;  1L5T A;  3BFU A;  4OEV A;  1MRP A;  1FJ9 A;  4HCY A;  4X1B A;  4MFI A;  1Y4T A;  2F7A A;  4R74 A;  4I3Y A;  4FEB A;  2OLB A;  3PMW A;  5H8F B;  4KR5 A;  4OZ9 A;  2AL4 A;  2O69 A;  1QUL A;  1A7L A;  5EQA A;  2HAU A;  4C1T A;  1LBV A;  4OVR A;  2R6G E;  4I3E A;  3K6W A;  1IXI A;  2V93 A;  1SW2 A;  2RC8 A;  1FBC A;  4NF8 B;  1MQD A;  4OFO A;  1DBZ A;  2ZXT A;  3RNN A;  1QW0 A;  2V25 A;  5H8H A;  4LN5 A;  1FPD A;  1B3H A;  3CFL A;  2UYE A;  1TFD A;  1LAH E;  4PFB A;  3E78 A;  2D21 A;  2DXR A;  5I56 B;  1B2H A;  2GHA A;  2O51 A;  4OVQ A;  3QK6 A;  1KA0 A;  3M8U A;  1SI0 A;  1ATG A;  1MXZ A;  4Z7E A;  3LSX A;  3BIH A;  5CBS A;  3PV0 E;  2P2A A;  1ZU0 A;  2I3W A;  3B50 A;  3PPQ A;  2A5T A;  4N81 A;  4I1D A;  4IY5 A;  1US4 A;  2GRV A;  2FNC A;  4NG7 A;  4F39 A;  5B70 A;  4BDR A;  3FXQ A;  2B4L A;  3TTN A;  3MP6 A;  4OFJ A;  5CRY A;  1JW4 A;  1FBE A;  2Y7I A;  3L6G A;  1RDX A;  4NTL A;  5TPA B;  4GRK A;  4OTE A;  2DE4 A;  5ITO A;  3O2A A;  4EUO A;  3KZG A;  3N6T A;  4GQO A;  4F1V A;  3ROJ A;  1RDY A;  3MVX A;  1Y3N A;  1MXX A;  3IOT A;  1DCU A;  3O28 A;  4QHQ A;  5I57 B;  4KQP A;  4LVQ A;  2QS1 A;  3IOW A;  4MEV A;  1A99 A;  5AA3 A;  3OO6 A;  1IQ7 A;  2GHB A;  5L9S A;  3TTR A;  4EDP A;  4OYV A;  4U4X A;  2OX3 A;  4ZE8 A;  3EPE A;  1FTL A;  2DWI A;  4ZEC A;  3TYH A;  2DS9 A;  3GYY A;  1IME A;  3R7X A;  3SZP A;  3HCQ A;  5AA4 A;  1FW0 A;  3DP6 A;  5H8Q A;  3TZA A;  4NF6 A;  1B7U A;  2BJJ X;  1DTZ A;  1OVT A;  1B51 A;  1B05 A;  3O66 A;  4DZ1 A;  2HZK A;  3KN8 A;  3U92 A;  2DVC A;  2Y7R A;  3IFC A;  3EHT A;  3U65 A;  1B5J A;  3T9U A;  1MY0 A;  3K00 A;  4NGU A;  1JP4 A;  2DDK A;  4I62 A;  4DI4 B;  3HHF A;  2IA4 A;  2F8D A;  1LAX A;  4BDO A;  1ANF A;  3UIF A;  3NOH A;  2DWJ A;  1M5D A;  2Q8M A;  3QMF A;  1GR2 A;  3QSL A;  4DLD A;  3MVZ A;  4M4G A;  3HPI A;  5BWJ A;  2ZZW A;  1WDN A;  2VP1 A;  5CMK A;  1URD A;  4RJZ A;  3V5A A;  1O63 A;  2XXK A;  4HE1 A;  2O7U A;  4OVP A;  4NF8 A;  1MY4 A;  1NUY A;  4PCD A;  4C1U A;  5EYF A;  4GWZ A;  1SYH A;  3IJX B;  4DDD A;  1PEB A;  1MQI A;  2I3V A;  3H4Z A;  2XXR A;  1AOV A;  3E79 A;  5I56 A;  3CVG A;  1FPG A;  2DWH A;  3CHG A;  4HXV A;  3MPL A;  4P3L A;  3OO7 A;  2H9B A;  4YU0 A;  2Q88 A;  2KQZ A;  2FIE A;  2PT2 A;  1KZ8 A;  1B5I A;  2XWI A;  4GWW A;  2ZZX A;  4GX6 A;  1M5B A;  2CZI A;  2HQ0 A;  1D9V A;  4L17 A;  5HPQ A;  4BDN A;  3T9H B;  2V84 A;  2R71 A;  3H06 B;  3IFA A;  4H67 A;  1YZ0 A;  2RC9 A;  4EQ9 A;  5DVJ A;  1NKX A;  4AQ4 A;  3KJ7 A;  3W15 C;  3U93 A;  4P47 A;  5ISU A;  4R2B A;  4XKR A;  5B7D A;  3THI A;  3K2D A;  1YTV A;  4Q30 B;  1B3F A;  2VT5 A;  3PMV A;  3KSX A;  1SBP A;  3A09 A;  1N84 A;  2NOO A;  3KGC A;  2XXY A;  1JET A;  1P1W A;  1XS5 A;  2Q9T A;  2I0C A;  2LAO A;  4TQU Q;  2Y7W A;  1CE2 A;  3KC0 A;  4NX1 A;  1EZP A;  4KXP A;  5K2Y A;  3VE1 B;  4R2F A;  3FV1 A;  4OVT A;  1NNF A;  3VLW A;  4UAC A;  3V8X B;  4G8N A;  1ZJL A;  2V3T A;  4FOR A;  3RLF E;  3PD8 A;  2XXI A;  5KCJ B;  5DT6 A;  2UVI A;  3TEL A;  3MBP A;  2I49 A;  1XOC A;  3K0V A;  4IO7 A;  4F31 B;  1N7X A;  1MG1 A;  4MMP A;  3FXU A;  1D9Y A;  4PDD A;  4R9G A;  3OMB A;  2PYY A;  3V83 A;  1USY H;  4WXJ A;  4BDL A;  1M5F A;  1B7Z A;  4ELR A;  1H76 A;  2JJK A;  3KBR A;  2QS3 A;  3T66 A;  1H44 A;  3MW0 A;  4O8M A;  4ZE9 A;  1B6H A; 
#chains in the Genus database with same CATH homology
 1MXY A;  4C0R A;  4BLA A;  5L9M A;  4R75 A;  3R6U A;  5FHM A;  3HO7 A;  3QUF A;  3IB0 A;  2H99 A;  3LSW A;  1VR5 A;  3RY3 A;  1SVX B;  1MH3 A;  1AH5 A;  4GXS B;  4H0W A;  3FJM A;  5DVI A;  1MY2 A;  3USD A;  1OLC A;  1FTK A;  3TTL A;  1ZTY A;  2VGQ A;  2OZZ A;  4MLV A;  2Z23 A;  3S9L C;  3CG3 A;  3W9W A;  4YKP A;  1JW1 A;  5F1Q A;  2RCA A;  3FAT A;  2XD2 A;  1ZBM A;  4O3C A;  3PPP A;  4KD5 A;  1F9B A;  5CC2 A;  1JEV A;  2REG A;  3FVN A;  4G2Z A;  1RKM A;  4UA8 A;  3O6G A;  4AB5 A;  2Q2A A;  5AE4 A;  4RPO A;  3RUM A;  5CMC A;  3DM0 A;  1OMP A;  1NL5 A;  4X1D A;  1M5E A;  3FV2 A;  3OEN A;  3BFT A;  3PPO A;  4FAJ A;  3JV9 A;  1BKA A;  5JK4 A;  3FZV A;  3E9X A;  4PFY A;  3KSJ A;  3G3F A;  5EHS A;  3OO9 A;  5I2K B;  1D4N A;  3VXB A;  2RIN A;  3H6V A;  3RQT A;  3C34 A;  3FD3 A;  3TCG A;  2O1L A;  4KYS A;  4K3F A;  1AL3 A;  4ONY A;  1MH4 A;  4PFU A;  4G68 B;  3SER A;  2D3I A;  5AA4 B;  1SW5 A;  3PUY E;  3T22 A;  5DYH A;  1HSJ A;  1MY3 A;  1SW4 A;  5H8Q B;  3MUQ A;  3KOS A;  2CZL A;  2X7P A;  4F2O A;  3M3L A;  5KCJ A;  2IEE A;  3E13 X;  2GH9 A;  3K6U A;  5L8D A;  1LCF A;  4LON B;  4P0I A;  1LFI A;  1UQW A;  3QAX A;  4RK2 A;  1OQG A;  3AXF A;  1O7T A;  1URG A;  2XXH A;  1B0H A;  4NF5 A;  1PB7 A;  3IOU A;  3B6Q A;  4U1O A;  4YMA A;  1UTB A;  3C31 A;  2YLN A;  1RYX A;  1UIU A;  2OWS A;  2AIX A;  1N7W A;  2DP8 A;  1MM7 A;  3MPK A;  5FTI A;  2O1M A;  1BTJ A;  3U72 A;  4JSO A;  2QL3 A;  3TMG A;  4ESW A;  4OWD A;  3ILT B;  1JW5 A;  4DIG A;  4R6K A;  4ZEI A;  2E1S A;  1B40 A;  3N94 A;  2I4C A;  2D5W A;  4ISU A;  4OEU A;  3PUV E;  4U21 A;  4YKK A;  1YPN A;  3G3I A;  1PC3 A;  2F36 A;  4NED A;  3GBB A;  3IK6 B;  3N6U A;  4EF2 A;  1R6Z A;  3DP8 A;  1MXU A;  3T9V A;  3UP9 A;  4GL0 A;  1ZKB A;  2Z22 A;  3PMX A;  3SEW A;  2O7I A;  1EU8 A;  1MQG A;  3SDF A;  4JWX A;  2XXT A;  3JZJ A;  4JBZ A;  3LSL A;  3UK4 A;  2XXU A;  4TLM B;  3IOR A;  1NNK A;  4LQ2 A;  1JQF A;  4KCC A;  2UVH A;  3EF7 A;  4NF4 A;  4LZ8 A;  3PPR A;  5I2K A;  2ZNU A;  1MY1 A;  3RPW A;  1S9T A;  2V3Q A;  1N3W A;  3IB1 A;  1EZ9 A;  1RYO A;  3QIM A;  3LC8 A;  2HAV A;  4G68 A;  4NWC A;  1S50 A;  4POX A;  3Q29 A;  4LAT A;  5ELV A;  4F29 A;  1MDQ A;  1SW1 A;  1ZIU A;  3QXM A;  2O84 X;  3CI8 A;  1MPC A;  4H8I A;  4OVJ A;  3T93 B;  3O6I A;  4GFR A;  4F22 A;  3IR1 A;  4QSC A;  2F97 A;  1UTH A;  2QMX A;  2WKY A;  2H25 A;  1P1N A;  3TUS A;  2A5S A;  5ICT A;  5I2N B;  1Y3Q A;  2VHA A;  3ONM A;  3FJ7 A;  3S9E A;  1M5C A;  3MVY A;  1DPE A;  5KDT A;  1TFA A;  1I6Q A;  2Y84 A;  2G29 A;  4IGT A;  4U4S A;  2DOJ A;  4N6P A;  4OHN A;  5AA2 A;  1P1O A;  4YKI A;  1DSN A;  1S7Y A;  1PBP A;  4OER A;  4LZ7 A;  2W7Y A;  3MZ1 A;  4EF1 A;  3TKD A;  3FVK A;  4H8J A;  3PD9 A;  2Z8D A;  3FJG A;  1LLS A;  4THI A;  4NMY A;  1SDX A;  1NNT A;  1MDP 1;  1NH7 A;  4BDQ A;  3D4C A;  1T0K A;  1P1Q A;  4NWD A;  1B4Z A;  1MS7 A;  1R9Q A;  3EHS A;  4QFP A;  3TTM A;  3SEY A;  1BLF A;  2VOZ A;  1VE4 A;  4ND9 A;  2X26 A;  4P11 A;  1MXW A;  4KHZ E;  1YCJ A;  4IO5 A;  2X7Q A;  2XX9 A;  3G3H A;  3WAF A;  4LUB A;  1ZLQ A;  4QSD A;  1Q1K A;  3EQ1 A;  4LP2 B;  1LFG A;  3DEL B;  5CI5 A;  1A40 A;  3JYR A;  3HST A;  4GD5 A;  3O9P A;  1MM6 A;  5FHO A;  2Z8F A;  4HW8 A;  3DLN A;  1QKA A;  4H5G A;  1UIV A;  1A55 A;  4YAH X;  4O3A A;  3P7I A;  5KZT A;  1FTO A;  3OEK A;  1B5H A;  3U94 A;  4RK9 A;  3PUX E;  1AIV A;  3N26 A;  3T96 B;  3MZ9 A;  4G77 A;  2F7B A;  3G3K A;  3QYT A;  4EQB A;  3SEU A;  3C35 A;  1CB6 A;  4XXU A;  1FQB A;  3DP4 A;  2YJP A;  5I84 A;  1I69 A;  1PB8 A;  4HS7 A;  1Y1Z A;  3M3K A;  4IY6 A;  1N0T A;  4ZEF A;  3CG1 A;  3WAE A;  3K6X A;  5DEX A;  4DCY A;  4Q8R A;  3LSF B;  4NF5 B;  4OMB A;  3E3K A;  3MP1 A;  4DCX A;  3QUJ A;  1UTB B;  3Q27 A;  5I2N A;  1NH8 A;  3C9H A;  4F1Y A;  4R73 A;  3FAS A;  4F3S A;  2Z8E A;  4ZDM A;  1B52 A;  5TU0 A;  1R1N A;  3ZSF A;  1ZMG A;  2PMS A;  3SEX A;  2ALU A;  2E0S A;  4ZEB A;  4I9D A;  3UGW A;  4H6D A;  2Q89 A;  3TOD A;  2NXO A;  1R9L A;  5CM6 A;  3L6H A;  2OBG A;  3KG2 A;  1HSL A;  1KWH A;  1H3D A;  2M8C A;  4RYA A;  2G93 A;  2AYS A;  3TEP A;  1LGB C;  4U22 A;  5BUU A;  1QUI A;  2P1S A;  1N04 A;  1YAE A;  4EXL A;  3FUZ A;  4MLQ A;  3TCF A;  1VFE A;  4QRZ A;  1IZ1 A;  4GVO A;  1BP5 A;  3H6U A;  4LZ5 A;  1AMF A;  4ZZE A;  4PP0 A;  1US5 A;  3EN3 A;  3IO4 A;  3W9V A;  2DE2 A;  3RT8 A;  3B6W A;  4OES A;  2Q2C A;  1DTG A;  1EZO A;  3ILU B;  5TP9 A;  1LST A;  4I8C A;  4G4P A;  4U1Z A;  2B65 A;  4NF4 B;  1FCK A;  4PFW A;  1FQF A;  5LOM A;  2OJT A;  1LFH A;  3K1M A;  1OLA A;  1IUD A;  1B58 A;  4ZZA A;  1VSO A;  2ONS A;  2HCA A;  3GLB A;  4RPN A;  5HM4 B;  4F1U A;  3E4R A;  3KN3 A;  4RY1 A;  3MVW A;  3CFZ A;  3RTF B;  3S4U A;  4QFO A;  3R26 A;  1LAF E;  3OEL A;  2QPQ A;  2ESN A;  2ZNT A;  2I4B A;  3FVO A;  3CSG A;  2F34 A;  3OEM A;  2O68 A;  3C32 A;  4RXL A;  4F3P A;  3MJN A;  5I59 A;  2ONK E;  3CR9 A;  4OXV A;  2HFB A;  4JWY A;  1UTH B;  1XC1 A;  3T9X B;  1O64 A;  4F2Q A;  3PU5 A;  1PBQ A;  4XKQ A;  2HXW A;  1QUJ A;  4XTC Q;  3KOT A;  3MC2 A;  3G3G A;  3SEV A;  5KDT B;  3LBS A;  5AA2 B;  4E0X A;  3RN8 A;  3I6V A;  1IEJ A;  5CMM A;  3BKI B;  1B1H A;  1B4H A;  4YB6 A;  4QF9 A;  4BDM A;  1QKB A;  4FED A;  5CBR A;  2ZNS A;  3K1N A;  3FXR A;  4MBP A;  2THI A;  4OQO A;  3VFJ A;  3H6T A;  3BBR A;  4JWO A;  1XT8 A;  1LAG E;  4N07 A;  1OVB A;  3MQ9 A;  2QMW A;  3HN0 A;  4WKM A;  4ELP A;  2XHD A;  5A5X A;  2DE3 A;  1WOD A;  5H8N B;  2RCB A;  5DVF A;  1D3K A;  4NE4 A;  3PUW E;  1H45 A;  4TOZ A;  3H03 A;  1JNF A;  2NUV A;  3TDJ A;  3HV1 A;  1B7H A;  4LQ5 A;  3N5L A;  5M2V A;  4R9F A;  5EHM A;  4IGR A;  2H4I A;  4ECF A;  1FTM A;  4IO3 A;  4P0G A;  4QSE A;  5ITP A;  4RNS A;  3LR1 A;  3S2V A;  4Q5T A;  3OO8 A;  1FQE A;  4PE5 B;  3O97 A;  3I3V A;  1FTJ A;  3CIJ A;  1MQJ A;  3ODB A;  4H1X A;  3Q26 A;  2UXA A;  2R9J A;  3EHU A;  5FHN A;  1A54 A;  1MXV A;  4KCD A;  3CFX A;  1Y9U A;  4E0W A;  4JSD A;  4H65 A;  2DWA A;  4IB2 A;  4N13 A;  3GBA A;  1JEU A;  4AB6 A;  4HCW A;  4M1V A;  1DOT A;  1LB8 A;  1BIY A;  4GF8 A;  4QFN A;  3K4U A;  2QSX A;  4IO2 A;  3RT6 B;  2DVZ A;  4EQ7 A;  2HEU A;  4Q0C A;  3UA8 A;  3A3U A;  2KLF A;  5AA1 A;  5AA2 D;  2QS4 A;  3ZKL A;  3KJT A;  4ZED A;  2B3B A;  5CMB A;  1POY 1;  1DMB A;  3RTW B;  3ECR A;  1IIW A;  4ELO A;  5JEI A;  1B3L A;  4ZEK A;  2OCU A;  3VDF A;  4R6Y A;  3C36 A;  3RGY A;  3IOV A;  1MPD A;  2FYI A;  1B3E A;  3MAM A;  2ZYO A;  1TT1 A;  3FGS A;  2ZYK A;  2DXY A;  1IIT A;  3PPN A;  4KYD A;  4YMB A;  4WEP A;  1NMU A;  5DEX B;  4X48 A;  2ZYN A;  4PFT A;  1B46 A;  3CSB A;  3D4G A;  1B32 A;  4JDF A;  3UN6 A;  2DQV A;  1A8E A;  4RA1 A;  4GWO A;  3TTK A;  2OK2 A;  5L9O A;  2F7C A;  4QFK A;  1OQH A;  4ESX A;  4YKJ A;  2OWT A;  4DXU A;  1POT A;  4GLI A;  2F5X A;  3C33 A;  4GXA A;  1Z7M E;  1HSE A;  1JVY A;  4KFQ A;  3C4M A;  4G8H A;  1IXH A;  3IX1 A;  1II5 A;  4TLL B;  3TQL A;  5K2X A;  4ZS9 A;  5H8S A;  3U8Q A;  5HBC A;  5H8F A;  1Y3P A;  4DXB A;  3VXC A;  3FVG A;  2RC7 A;  4FE8 A;  2PBW A;  2HZL A;  4QFL A;  1LBB A;  3KFM A;  3S9N C;  2ABH A;  5H8N A;  2DYX A;  4KPT A;  2F6P A;  2PX1 A;  1QJM A;  1IXG A;  1B9J A;  4F3B A;  2I0B A;  1J1N A;  4JB7 A;  2UYF A;  1PDA A;  3OSQ A;  2XX8 A;  1Q35 A;  3OOA A;  4OFL A;  4U2R A;  4H5F A;  1LCT A;  5I58 B;  3F11 A;  3K1P A;  1PB9 A;  3U1O A;  4DXC A;  2XD3 A;  3SKP A;  1GV8 A;  2FA7 A;  4HTG A;  2UVG A;  1SQY A;  4PET A;  5TP9 B;  3IAZ A;  4DE8 A;  2H5Y A;  3LUY A;  3TQW A;  5TPA A;  4FJP A;  2O6A A;  3OSR A;  3B7D A;  3OXN A;  1Y20 A;  4YB5 A;  2F78 A;  2Q8J A;  1P99 A;  4R6H A;  5ICQ A;  3O29 A;  4LA9 A;  4U23 A;  5I57 A;  4ELQ A;  4FAT A;  3UOR A;  3CRB A;  3VLV A;  1B1X A;  1I6A A;  2PVU A;  4O3B A;  2VD3 A;  2QRY A;  1ELJ A;  2XX7 A;  5FTH A;  2XXQ A;  3KEI A;  5JTY B;  3VVE A;  5I59 B;  5DTB A;  3VVF A;  4KYE A;  2ONR A;  3OD7 A;  3VLU A;  1SI1 A;  1JVX A;  2VD2 A;  2XXP A;  3IB2 A;  2P0S A;  3I5O A;  1QVS A;  3IJO B;  3MZB A;  3ZKK A;  4KI0 E;  3A3C A;  2Y7P A;  1MQH A;  3O6H A;  3TAJ A;  4G8M A;  2V3U A;  3FIR A;  4EXK A;  1H43 A;  1XVX A;  5F7V A;  1A8F A;  2AL5 A;  4FIM A;  4F19 A;  4XKP A;  4GOT A;  2DSF A;  3KN7 A;  2Y7K A;  1B0L A;  2QJE A;  1TXF A;  3M3F A;  3PUZ E;  1XVY A;  4OET A;  3K01 A;  4GL8 A;  3IL1 B;  2RF1 A;  3PGF A;  1N76 A;  4GIZ A;  1NNP A;  1OIB A;  5A5X B;  4YIC A;  4OEN A;  2H98 A;  5H8H B;  1DPP A;  3G7W A;  3MP8 A;  4IO4 A;  4WED A;  4MH5 A;  4JXI A;  3MWB A;  3K6V A;  1NFT A;  2YPN A;  1WVJ A;  1VFD A;  1N3X A;  1B3G A;  1EH3 A;  2UVJ A;  4F3G A;  5I58 A;  2REJ A;  3TFL A;  2A5T B;  4G68 C;  1GGG A;  4POW A;  3V89 B;  2I6E A;  5J1D A;  3HHG A;  2I48 A;  2XXV A;  2ANJ A;  2PT1 A;  1QUK A;  3Q28 A;  1Z7N E;  1IXC A;  1URS A;  1P1U A;  2I58 A;  1TWY A;  1MPB A;  5IAI A;  1FQA A;  3TCH A;  1Y4C A;  2XXW A;  1FQD A;  3H7M A;  2RKM A;  2XXX A;  4YZZ A;  2NVU B;  4IO6 A;  1GVC A;  1GTK A;  3K02 A;  2ZYM A;  3IO6 A;  1SYI A;  2B3F A;  3SES A;  3VVD A;  1Y1M A;  4X9T A;  3H6W A;  2ZMB A;  3GXA A;  3TPA A;  4XKN A;  2F35 A;  4FEC A;  2GFE A;  2NWJ A;  1XHY A;  5JTY A;  3S9M C;  3B6T A;  1SD3 A;  1LBC A;  1USY E;  4XIG Q;  4NF6 B;  1I6B A;  3H3G A;  4PQJ A;  3GZG A;  3G3J A;  3VV5 A;  2QS2 A;  1FQC A;  3Q25 A;  1LB9 A;  4R72 A;  5IKB A;  4F18 A;  4Z0I A;  2F6G A;  3ZS6 A;  3SET A;  4YB7 A;  2CMO A;  4MF3 A;  1L5T A;  3BFU A;  4OEV A;  1MRP A;  4HCY A;  4X1B A;  4MFI A;  1Y4T A;  2F7A A;  4R74 A;  4FEB A;  2OLB A;  3PMW A;  5H8F B;  4KR5 A;  4OZ9 A;  2AL4 A;  2O69 A;  1QUL A;  1A7L A;  2HAU A;  4C1T A;  2R6G E;  3K6W A;  1IXI A;  2V93 A;  1SW2 A;  2RC8 A;  4NF8 B;  1MQD A;  4OFO A;  2ZXT A;  3RNN A;  1QW0 A;  2V25 A;  5H8H A;  1B3H A;  3CFL A;  2UYE A;  1TFD A;  1LAH E;  2D21 A;  2DXR A;  5I56 B;  1B2H A;  2GHA A;  2O51 A;  3QK6 A;  3M8U A;  1SI0 A;  1ATG A;  1MXZ A;  4Z7E A;  3LSX A;  5CBS A;  3PV0 E;  2P2A A;  1ZU0 A;  2I3W A;  3PPQ A;  2A5T A;  4I1D A;  4IY5 A;  1US4 A;  2GRV A;  2FNC A;  4F39 A;  5B70 A;  4BDR A;  3FXQ A;  3TTN A;  5CRY A;  3MP6 A;  4OFJ A;  1JW4 A;  2Y7I A;  3L6G A;  4NTL A;  5TPA B;  4GRK A;  4OTE A;  2DE4 A;  5ITO A;  3O2A A;  4EUO A;  3KZG A;  3N6T A;  4GQO A;  4F1V A;  3MVX A;  1Y3N A;  1MXX A;  3IOT A;  3O28 A;  4QHQ A;  5I57 B;  4KQP A;  4LVQ A;  2QS1 A;  3IOW A;  1A99 A;  5AA3 A;  3OO6 A;  1IQ7 A;  2GHB A;  5L9S A;  3TTR A;  4EDP A;  4OYV A;  4U4X A;  4ZE8 A;  3EPE A;  1FTL A;  2DWI A;  4ZEC A;  3TYH A;  2DS9 A;  3R7X A;  3HCQ A;  5AA4 A;  1FW0 A;  3DP6 A;  5H8Q A;  3TZA A;  4NF6 A;  1B7U A;  2BJJ X;  1DTZ A;  1OVT A;  1B51 A;  1B05 A;  3O66 A;  4DZ1 A;  2HZK A;  3KN8 A;  3U92 A;  2DVC A;  2Y7R A;  3EHT A;  1B5J A;  3T9U A;  1MY0 A;  3K00 A;  4I62 A;  3HHF A;  2IA4 A;  2F8D A;  1LAX A;  4BDO A;  1ANF A;  3UIF A;  2DWJ A;  1M5D A;  1GR2 A;  3QSL A;  4DLD A;  3MVZ A;  4M4G A;  3HPI A;  5BWJ A;  1WDN A;  2VP1 A;  5CMK A;  1URD A;  4RJZ A;  3V5A A;  1O63 A;  2O7U A;  4NF8 A;  1MY4 A;  4C1U A;  5EYF A;  1SYH A;  3IJX B;  4DDD A;  1MQI A;  1PEB A;  2I3V A;  3H4Z A;  2XXR A;  1AOV A;  5I56 A;  3CVG A;  2DWH A;  3MPL A;  3OO7 A;  2H9B A;  4YU0 A;  2Q88 A;  2PT2 A;  1B5I A;  1M5B A;  2HQ0 A;  1D9V A;  4L17 A;  5HPQ A;  4BDN A;  3T9H B;  2V84 A;  2R71 A;  3H06 B;  4H67 A;  2RC9 A;  4EQ9 A;  5DVJ A;  1NKX A;  4AQ4 A;  3KJ7 A;  3W15 C;  3U93 A;  5ISU A;  4R2B A;  4XKR A;  5B7D A;  3THI A;  3K2D A;  1YTV A;  4Q30 B;  1B3F A;  3PMV A;  3KSX A;  1SBP A;  3A09 A;  1N84 A;  2NOO A;  3KGC A;  2XXY A;  1JET A;  1P1W A;  1XS5 A;  2Q9T A;  2I0C A;  2LAO A;  4TQU Q;  2Y7W A;  1CE2 A;  1EZP A;  5K2Y A;  3VE1 B;  4R2F A;  3FV1 A;  1NNF A;  3VLW A;  4UAC A;  3V8X B;  4G8N A;  1ZJL A;  2V3T A;  4FOR A;  3RLF E;  3PD8 A;  2XXI A;  5KCJ B;  5DT6 A;  2UVI A;  3TEL A;  3MBP A;  2I49 A;  1XOC A;  3K0V A;  4IO7 A;  4F31 B;  1N7X A;  1MG1 A;  3FXU A;  1D9Y A;  4R9G A;  3OMB A;  2PYY A;  3V83 A;  1USY H;  4WXJ A;  4BDL A;  1M5F A;  1B7Z A;  4ELR A;  1H76 A;  3KBR A;  2QS3 A;  3T66 A;  1H44 A;  3MW0 A;  4ZE9 A;  1B6H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...