3HHFA

Structure of crga regulatory domain, a lysr-type transcriptional regulator from neisseria meningitidis.
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
204
structure length
204
Chain Sequence
PQGVLSVDSAMPMVLHLLAPLAAKFNERYPHIRLSLVSSEGYINLIERKVDIALRAGELDDSGLRARHLFDSRFRVIASPEYLAKHGTPQSTEELAGHQCLGFTEPGSLNTWAVLDAQGNPYKISPHFTASSGEILRSLCLSGCGIVCLSDFLVDNDIAEGKLIPLLAEQTSDKTHPFNAVYYSDKAVNLRLRVFLDFLVEELG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, LysR family
publication title The structure of CrgA from Neisseria meningitidis reveals a new octameric assembly state for LysR transcriptional regulators
pubmed doi rcsb
source organism Neisseria meningitidis serogroup b
molecule tags Transcription regulator
total genus 52
structure length 204
sequence length 204
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3hhfA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3hhfA01
5DVJA 3MQ9A 1Z7NE 1B3FA 3IL1B 4M4GA 3OO9A 2DQVA 3EPEA 5FHMA 3IB1A 3LBSA 3FVNA 1R9QA 3E9XA 3IB2A 3HHFA 3PMWA 1RKMA 2GHBA 4NF6B 1Z7ME 1ZBMA 1SVXB 3A09A 3FD3A 5I58B 1S7YA 3O28A 4OFLA 4YKPA 3AXFA 1YTVA 3U1OA 3EHTA 2V84A 4ELQA 5AE4A 5ITPA 1PB8A 4XIGQ 4GLIA 2QS3A 4QFKA 3B7DA 3FVKA 4QSDA 1UTHA 5HBCA 1YAEA 2RC7A 2PT1A 1R9LA 3TTMA 3UORA 3L6HA 4ESWA 3PGFA 1A8EA 2VD2A 2ONRA 2FYIA 1NH8A 4RNSA 1Y3NA 4JWOA 3B6WA 3PD9A 1MXWA 2UVHA 4JWYA 1MQHA 4DCYA 1EZPA 4EF2A 5TU0A 4TOZA 4H8IA 5HPQA 3S9MC 1URGA 4FEBA 1PB7A 1IXHA 1LAHE 3MVXA 1DOTA 2DWAA 4IY5A 2F6GA 4I62A 2F7AA 4G8HA 4GWOA 3T9VA 4F39A 3GBBA 3K4UA 4OFJA 5L8DA 4NF4A 1SQYA 4PFUA 1XOCA 4BDNA 4U1ZA 4DLDA 3Q25A 2NWJA 2ABHA 1O64A 3SESA 1B0LA 5B7DA 4FIMA 1YPNA 3QAXA 1HSJA 3C36A 3FXQA 4PQJA 3HN0A 5I2KA 1LCFA 3PUVE 2DE2A 4ZZAA 1P1QA 4YKJA 4GL8A 2OWSA 4U2RA 4X1DA 4U22A 1OVTA 4TLMB 1LFGA 3TELA 4R2FA 4QF9A 3U93A 3MJNA 3CIJA 1S50A 4F1YA 2DXRA 3UIFA 2XXTA 4DDDA 5H8HB 1URDA 4KFQA 3C34A 5FHOA 4FECA 4HCYA 2B65A 3DM0A 2I49A 3VFJA 4EQ9A 1QVSA 4LQ2A 3N6UA 3KN8A 3MVZA 1MDQA 4RJZA 2QRYA 1SW4A 2X7QA 4R9GA 2PYYA 4KR5A 4IO5A 4OXVA 3C9HA 3FXUA 5AA2D 1RYXA 3K1MA 1M5EA 4F31B 5IAIA 3CR9A 3IJXB 2BJJX 1IEJA 1MQJA 4DIGA 2OBGA 4QFNA 5ICTA 4H67A 3TQWA 2FA7A 3KSXA 1SW2A 3OEKA 2E0SA 2I3VA 5DYHA 4U23A 2O1LA 1JETA 3TCFA 4NF5A 5LOMA 2ZYNA 3V83A 5AA2B 2A5TA 4ZZEA 1P1NA 3OO6A 1UQWA 4ZEBA 4NF8B 1QKAA 3O6IA 2QMXA 2I4CA 1GGGA 2F6PA 3MP6A 1II5A 4RXLA 1Y3QA 3MZBA 1GVCA 2PBWA 3K6XA 4KCCA 1B1XA 1B4ZA 3GZGA 4U4SA 1NNTA 4YKIA 2VP1A 4LA9A 3SEUA 2XXYA 2DWHA 3SEYA 1B5IA 3H3GA 1N3WA 4LZ8A 1UTBA 1VFEA 2PVUA 3K00A 5DEXA 2I58A 5EHSA 1B6HA 3OEMA 4IB2A 3PUWE 1NL5A 1MH4A 4KPTA 3PUXE 4FE8A 4GF8A 4PFYA 4Z7EA 3IOWA 3IOVA 1NNPA 1MXUA 1FTLA 1SD3A 5TPAA 2XX7A 3ECRA 5CM6A 1FQEA 1D9YA 2XXQA 1A7LA 2H25A 4M1VA 2XX9A 3TPAA 4G68A 3PU5A 2XXVA 3FGSA 3OSRA 1SW5A 1XVYA 2F7BA 4U21A 4FEDA 4JB7A 4OENA 3O6GA 4GFRA 1MXYA 4G8MA 4EF1A 2R71A 1QUKA 3QUJA 3MAMA 3G3HA 1FTKA 2M8CA 3KZGA 3JV9A 3JYRA 5I56A 2Z22A 3OMBA 3OXNA 3VXBA 3K6WA 4PFTA 3T66A 3PPNA 1I6BA 5CMKA 2THIA 2REGA 2F36A 2PX1A 1VSOA 4NTLA 2O7IA 4GD5A 1LBBA 4ZEDA 4F1VA 3C4MA 1JVYA 1IUDA 3BFUA 3RN8A 2DVZA 2H98A 2V3TA 5CC2A 1XT8A 1B3HA 2I0BA 2XXPA 3TEPA 4I9DA 1LBCA 1WODA 2AYSA 1LAGE 4NEDA 5TP9A 2Q2AA 2HXWA 3SKPA 1T0KA 5I2NB 3FUZA 3PPOA 4OTEA 4KQPA 4YB5A 3MP1A 2I0CA 3T96B 2O68A 4E0XA 3IO4A 3LC8A 1BTJA 1JW1A 3SDFA 2P2AA 1ZU0A 4LQ5A 4Q8RA 1MG1A 4DZ1A 1LB9A 1ZMGA 2Z8FA 4RPOA 2ZMBA 3K01A 3EF7A 1AL3A 5I59B 5JTYB 3UK4A 4N6PA 4WEPA 3VVDA 5DTBA 2I4BA 3I5OA 3D4GA 1FCKA 1B40A 2F78A 3SEXA 4DE8A 3TAJA 2O51A 1JW5A 4RK2A 1OQGA 3B6QA 4P11A 2UYEA 3TODA 1XHYA 4G8NA 1AOVA 5I57A 3IAZA 2F97A 4H5GA 2PMSA 2ANJA 1MY1A 4ZE8A 1B9JA 4QHQA 1LFIA 4IO7A 2V3UA 3MP8A 5CRYA 5ITOA 5CMBA 4HCWA 4Q0CA 3KOSA 1Y3PA 3PUZE 1SI1A 2UVGA 3CFXA 4Z0IA 1LGBC 1BIYA 3S9LC 3MW0A 1B32A 4G68C 3PUYE 1FQBA 4QFLA 4N07A 1MXVA 3CVGA 3IX1A 4OEVA 4QSEA 2LAOA 5H8FB 1HSEA 1TFAA 3DP8A 3CG3A 2D21A 3KGCA 3I3VA 2V25A 4OFOA 3KG2A 2UYFA 3DELB 1JW4A 3T9XB 5HM4B 2REJA 4KCDA 1OVBA 5IKBA 4LZ7A 4R73A 1IXGA 1MQIA 1HSLA 2QS2A 5AA3A 2HCAA 2GH9A 5H8NB 4F3BA 5KCJA 1NNFA 3TFLA 4RY1A 3CI8A 2DXYA 2CZLA 3FZVA 4AB5A 5CMCA 4QFPA 4AB6A 1NFTA 1JEUA 1SI0A 4GL0A 3MZ1A 2ZYMA 1B0HA 1JNFA 3A3CA 4NWCA 4EUOA 1QW0A 2DSFA 4ND9A 1DTGA 2W7YA 2V3QA 1DSNA 3N94A 3MBPA 4OVJA 2VOZA 2HAUA 3OD7A 3U8QA 3HCQA 1FQFA 3KJTA 3FXRA 1P1WA 1USYH 4EXLA 1MPBA 3K6UA 2DYXA 4YB6A 2Q88A 4H0WA 1EH3A 3QXMA 1MDP1 4H6DA 3UN6A 3MZ9A 1QUIA 1ZKBA 1B5JA 1B46A 3U72A 4POXA 2XX8A 1P1OA 1B3GA 5KDTB 4POWA 4UA8A 1B3EA 4F18A 2ESNA 4Q30B 1VFDA 1B7HA 2OLBA 4DXBA 4MBPA 3SETA 3KBRA 4KI0E 3RUMA 5ICQA 2HEUA 1TXFA 1VE4A 1TT1A 1ZIUA 2P0SA 3TMGA 2RC8A 1JEVA 5AA4B 2VHAA 1D4NA 3RT8A 4YB7A 2RC9A 5F1QA 3M8UA 3CFZA 4DXCA 1POTA 1B5HA 4NF6A 1A8FA 3CSBA 5K2YA 1MXZA 1SBPA 5M2VA 4HS7A 5I58A 5F7VA 3IK6B 1ANFA 1MQDA 3RGYA 1PBPA 3TDJA 3MPLA 1MM7A 4R2BA 5FHNA 1ELJA 2ONSA 3RQTA 2H9BA 3LSXA 4R6KA 2O6AA 4R72A 3TTLA 2Q9TA 3S9EA 4X1BA 1OQHA 3C35A 2DWJA 3GXAA 5H8QB 4HW8A 1B7ZA 1QKBA 2ZNUA 1SW1A 4KHZE 1TFDA 2D5WA 3K6VA 1USYE 3PMVA 2DE4A 1GR2A 2ALUA 5B70A 1MM6A 2Z8EA 4AQ4A 3OO7A 5JEIA 2ZXTA 2X26A 3GLBA 2UVIA 3KSJA 1I6AA 5CMMA 1DMBA 4R74A 2HAVA 3K2DA 1IQ7A 3B6TA 3MWBA 4JXIA 3BFTA 4PE5B 3O2AA 3ODBA 1P99A 4KYEA 4TQUQ 4FATA 3ZSFA 4XKQA 3ZS6A 1MY0A 4GIZA 4ELRA 4GVOA 2RCAA 3KFMA 4LP2B 3ZKKA 1I6QA 2RF1A 3IO6A 1B05A 4ZS9A 3LUYA 4IO4A 3Q26A 4ISUA 1BKAA 1H43A 4P0IA 5L9MA 1H44A 4C1TA 4ZEFA 3RPWA 2QJEA 1URSA 3QSLA 4C0RA 5A5XA 4PP0A 2XXWA 3IB0A 1D3KA 2F7CA 4RYAA 2AIXA 1UTHB 3KN7A 4G4PA 4O3CA 2O7UA 5ELVA 4ESXA 4PETA 1Y4CA 1R6ZA 2RINA 3GBAA 4THIA 2XHDA 3JZJA 2Z8DA 4F29A 5H8HA 3VLWA 2DS9A 3MC2A 3O6HA 1F9BA 3TKDA 2H99A 3TCGA 4YKKA 3I6VA 4UACA 4RK9A 4GOTA 1N84A 4GQOA 4F2QA 1WDNA 1LAXA 2YJPA 1B51A 3LSWA 4R75A 4YU0A 4YICA 2G93A 1AMFA 2XXIA 3G3IA 2F34A 1DPPA 3Q29A 1NKXA 1N04A 1P1UA 1Y4TA 2UXAA 1FW0A 2H5YA 4NF4B 3MVYA 1AIVA 4KYDA 2XXUA 2DP8A 3EN3A 1N76A 1ZLQA 1B58A 4OETA 1B52A 5AA2A 3FVGA 4BLAA 3OELA 2YLNA 5DVIA 5I2KB 4G2ZA 3MVWA 4XKRA 1H76A 3RTWB 4ZDMA 1CB6A 3W9VA 4NF8A 2I6EA 3H4ZA 5DT6A 4I8CA 3H03A 2VGQA 2F8DA 2Y7WA 1LSTA 4JWXA 2NOOA 3N6TA 1N7WA 1XVXA 3IJOB 4GXSB 1M5FA 4KYSA 4MF3A 2R9JA 1RYOA 2RCBA 2DE3A 5J1DA 2GHAA 2G29A 5EYFA 3IOUA 3H6TA 2NUVA 2O69A 1QJMA 4MLQA 3HSTA 4HTGA 4LONB 4IO2A 3MPKA 3SEVA 3CRBA 3W9WA 2E1SA 2QPQA 3S9NC 2B3BA 4XTCQ 2CMOA 1UIVA 2Q89A 3PPRA 4DXUA 1US4A 1MY3A 5K2XA 3VVEA 1XS5A 5L9SA 3ZKLA 4IO6A 1O7TA 3PV0E 3G3KA 5AA1A 1LLSA 2B3FA 1QUJA 3N26A 4JDFA 1IXIA 1NNKA 1XC1A 3S4UA 1MY2A 4OMBA 4NF5B 1I69A 4LZ5A 3SEWA 1M5CA 3DLNA 4LVQA 2A5TB 3O97A 1MQGA 1DPEA 4F2OA 1PDAA 3TTKA 1LAFE 1J1NA 2ZNSA 4BDQA 2QSXA 4GRKA 4ZEIA 1JQFA 2A5SA 3VV5A 3RT6B 4Q5TA 1BLFA 4OHNA 1FTOA 2HZLA 3QIMA 3QYTA 1GV8A 3T9HB 4ZECA 5FTIA 4OERA 1FQCA 4WXJA 1LCTA 3N5LA 2OJTA 2NXOA 2Q2CA 1M5DA 3P7IA 1N3XA 5EHMA 3RTFB 3C32A 3O66A 1TWYA 4H1XA 4YAHX 4G77A 1UTBB 3E3KA 4ELPA 4YMBA 5DEXB 1PBQA 3L6GA 5BWJA 5KZTA 3E4RA 3O29A 4O3BA 1B7UA 3IOTA 4R6HA 3USDA 4MH5A 4OQOA 3EHUA 2V93A 3T22A 4L17A 1B2HA 3DP4A 2NVUB 5I84A 1CE2A 3Q28A 5FTHA 2O84X 3K02A 3VLVA 1VR5A 5TPAB 4LATA 1POY1 3UGWA 3TZAA 4WEDA 2HQ0A 4EQ7A 3UA8A 1YCJA 3FV2A 3T93B 4ECFA 2QL3A 3TQLA 3G3GA 5A5XB 4F22A 4G68B 1IITA 5BUUA 2XD2A 2I3WA 3EHSA 1Y1MA 2PT2A 5I2NA 1B3LA 1US5A 3HHGA 4YMAA 1FTJA 4OZ9A 4EQBA 1ATGA 3PPQA 2F35A 3D4CA 4DCXA 1N7XA 1BP5A 3KN3A 3CG1A 4OEUA 2AL5A 4IO3A 4BDRA 3IR1A 2GRVA 3FV1A 2QMWA 4QFOA 1GTKA 2YPNA 4H5FA 4TLLB 3U92A 4YZZA 1JVXA 2XD3A 1OIBA 3Q27A 4BDLA 3VVFA 3C33A 3H6WA 4F3PA 1OMPA 1H45A 1Q1KA 5I56B 2OZZA 5CBRA 2ZNTA 3E13X 1QULA 3LR1A 1R1NA 5I59A 5JTYA 2P1SA 3RLFE 2Y7KA 4P0GA 5DVFA 4QRZA 4OESA 4F19A 4O3AA 3M3LA 1H3DA 4NE4A 4XXUA 2OK2A 4IGTA 4WKMA 4E0WA 2IA4A 3R7XA 3THIA 4U4XA 3TYHA 4C1UA 3TTNA 3VXCA 3HV1A 3BBRA 1Y9UA 1A99A 1Q35A 2Y84A 3O9PA 3FJMA 2FNCA 3OSQA 1LFHA 1B4HA 1MRPA 5TP9B 3TCHA 3R26A 3ILUB 3MUQA 3H06B 3WAFA 3HO7A 3OENA 4GXAA 2I48A 3OO8A 4EXKA 2X7PA 3M3KA 1PEBA 2XXXA 3FATA 1OLAA 3KOTA 3EQ1A 5H8SA 5H8FA 3TUSA 3HPIA 3VE1B 4RPNA 1ZTYA 3W15C 1IXCA 1PB9A 2HZKA 1Y20A 2F5XA 3A3UA 1S9TA 3F11A 4IGRA 1A55A 5CBSA 4MFIA 3LSFB 2DOJA 4JSDA 3H7MA 4BDMA 3QK6A 1DTZA 1IZ1A 3ONMA 3ILTB 2UVJA 4IY6A 4BDOA 1MY4A 4RA1A 1MXXA 3TTRA 2IEEA 1UIUA 4KD5A 4N13A 5H8NA 4NMYA 4X48A 1B1HA 1MPCA 1SYIA 3V5AA 2ZYKA 1IIWA 1MPDA 2R6GE 3RY3A 3RNNA 4XKPA 3VDFA 5ISUA 4FORA 4F3GA 5I57B 4F1UA 2KLFA 4ZEKA 3OOAA 4R6YA 4JBZA 2WKYA 3C31A 1MS7A 1WVJA 3K1PA 4MLVA 4NWDA 2H4IA 4ELOA 3PMXA 4EDPA 1EZ9A 3PD8A 3R6UA 1D9VA 1MH3A 4OWDA 1AH5A 1M5BA 2Y7IA 3IORA 1ZJLA 2D3IA 3K1NA 4FJPA 3H6VA 4PFWA 2DVCA 3KJ7A 3FJ7A 4QSCA 5KDTA 3T9UA 1A40A 4OYVA 3FASA 2RKMA 2Y7RA 4LUBA 3M3FA 4ZE9A 3LSLA 1N0TA 1FQDA 3CFLA 2HFBA 3S2VA 1L5TA 3G3FA 4I1DA 4X9TA 5CI5A 4H8JA 2DWIA 4FAJA 5AA4A 3WAEA 1LB8A 1NH7A 1KWHA 1A54A 3SERA 2XXHA 4F3SA 3PPPA 1FTMA 2AL4A 4U1OA 1PC3A 3V8XB 2XXRA 2O1MA 2GFEA 3FVOA 3H6UA 5KCJB 3G7WA 1EZOA 2ZYOA 3UP9A 3FJGA 1Y1ZA 4JSOA 2QS4A 1OLCA 3DP6A 1SDXA 1SYHA 3CSGA 2OCUA 5H8QA 3V89B 4H65A 5JK4A 1NMUA 3FIRA 3BKIB 2Q8JA 4ONYA 3U94A 2ONKE 3KEIA 1EU8A 3K0VA 1FQAA 3QUFA 3VLUA 1O63A 2VD3A 4R9FA 4K3FA 2OWTA 2QS1A 2Z23A 2Y7PA 4XKNA 3G3JA 5L9OA
chains in the Genus database with same CATH superfamily
1INPA 5DVJA 3MQ9A 1Z7NE 1B3FA 3IL1B 4M4GA 3OO9A 2DQVA 3EPEA 5EYGA 5FHMA 3IB1A 4MJOA 3LBSA 3FVNA 1R9QA 3E9XA 3IB2A 3HHFA 3PMWA 1RKMA 2GHBA 4NF6B 1Z7ME 1ZBMA 1SVXB 3A09A 3FD3A 5I58B 1XI6A 1S7YA 3O28A 4OFLA 4YKPA 3AXFA 1YTVA 1FSAA 3U1OA 4XF5A 3EHTA 2V84A 4ELQA 4OVRA 5AE4A 5ITPA 1PB8A 4XIGQ 4GLIA 2QS3A 4QFKA 3B7DA 3FVKA 4QSDA 1UTHA 5HBCA 1YAEA 2RC7A 2PT1A 1R9LA 3TTMA 3UORA 3L6HA 4ESWA 3PGFA 1A8EA 4MNCA 2VD2A 2Q74A 2ONRA 2FYIA 1NH8A 4LN5A 4RNSA 1Y3NA 4JWOA 3B6WA 3PD9A 1MXWA 2UVHA 4JWYA 4PDHA 1MQHA 4DCYA 1EZPA 4EF2A 5TU0A 4TOZA 4H8IA 5HPQA 3S9MC 1URGA 4NAPA 4FEBA 1PB7A 1IXHA 1LAHE 3MVXA 1DOTA 2DWAA 4IY5A 2F6GA 4I62A 2F7AA 4G8HA 4GWOA 3T9VA 1K9ZA 4F39A 3GBBA 3RPLB 3K4UA 4OFJA 5L8DA 4NF4A 1SQYA 1NV1A 4PFUA 1XOCA 4BDNA 4U1ZA 4DLDA 3Q25A 2NWJA 2ABHA 1DK4A 1O64A 3EKIA 3SESA 1B0LA 5B7DA 2XWVA 4FIMA 1YPNA 3QAXA 1HSJA 1D9QA 3C36A 3FXQA 4PQJA 3HN0A 5I2KA 1LCFA 3PUVE 2CEXA 2DE2A 4ZZAA 1LBVA 1P1QA 4YKJA 4GL8A 2XWOA 2OWSA 5I7IA 4U2RA 4X1DA 2B4LA 4U22A 1OVTA 2CZIA 4TLMB 1LFGA 3TELA 2XXKA 4R2FA 4QF9A 3U93A 3MJNA 3CIJA 1S50A 4F1YA 2DXRA 3UIFA 2XXTA 4DDDA 5H8HB 1URDA 5ET6A 4KFQA 3C34A 5FHOA 4FECA 4HCYA 5ET8A 2B65A 3DM0A 2I49A 3VFJA 4EQ9A 1QVSA 4LQ2A 3N6UA 1LBYA 4OVPA 3KN8A 3MVZA 1MDQA 4RJZA 2QRYA 1SW4A 2X7QA 4X8RA 4R9GA 4I3YA 2PYYA 2WBBA 4HE1A 4KR5A 4IO5A 4OXVA 3C9HA 3FXUA 5AA2D 1RYXA 3K1MA 1M5EA 4F31B 4O8MA 2QVRA 5IAIA 4N91A 3CR9A 3IJXB 2BJJX 1IEJA 1MQJA 4N15A 4DIGA 2OBGA 4QFNA 5I3SA 5ICTA 4H67A 3TQWA 2FA7A 3KSXA 1SW2A 3OEKA 2E0SA 1FJ6A 2I3VA 5DYHA 2VPNA 4U23A 2O1LA 1JETA 3TCFA 4NF5A 5LOMA 2ZYNA 3V83A 5AA2B 1NV2A 2A5TA 4JVIA 4ZZEA 1P1NA 3OO6A 1UQWA 4ZEBA 4NF8B 1QKAA 4PGPA 3O6IA 2FBPA 2QMXA 2I4CA 1GGGA 2F6PA 4GWZA 4GWSA 3MP6A 2F3BA 1II5A 4RXLA 2Y5KA 4P56A 1Y3QA 3MZBA 1GVCA 2PBWA 3K6XA 4KCCA 1B1XA 1AWBA 1B4ZA 3GZGA 4U4SA 2P3NA 4NN3A 1NNTA 4YKIA 2VP1A 4LA9A 3SEUA 2XXYA 2DWHA 3SEYA 1B5IA 3H3GA 1N3WA 4LZ8A 4GX4A 4QBAA 1UTBA 1VFEA 5EQ7A 2PVUA 4I40A 3K00A 5DEXA 2I58A 5EHSA 2ZZWA 1B6HA 3OEMA 1LBWA 4H46A 4IB2A 3PUWE 1NL5A 1MH4A 4KPTA 2MKZA 3PUXE 4FE8A 4GF8A 4PFYA 4Z7EA 5EQ9A 3IOWA 3IOVA 1NNPA 1MXUA 4MNIA 1FTLA 1SD3A 4NG7A 5TPAA 2XX7A 3ECRA 1FBHA 5CM6A 1FQEA 1D9YA 2XXQA 1A7LA 2H25A 4M1VA 1YZ0A 2XX9A 3TPAA 3GYYA 4G68A 3PU5A 2XXVA 3FGSA 3OSRA 4N8YA 1SW5A 1FPKA 1XVYA 2F7BA 4U21A 4FEDA 4JB7A 4OENA 3O6GA 4GFRA 1MXYA 4G8MA 4EF1A 1RDZA 2B4MA 2R71A 1QUKA 3QUJA 3KBZA 3MAMA 3G3HA 1FTKA 2M8CA 3KZGA 3JV9A 3JYRA 4O7MA 5I56A 2Z22A 3OMBA 3OXNA 3VXBA 3K6WA 4PFTA 3T66A 3PPNA 1I6BA 4NGUA 5CMKA 2THIA 2REGA 1BK4A 2F36A 2PX1A 1VSOA 4NTLA 2O7IA 4GD5A 1LBBA 2CZKA 1LBZA 4NF0A 4PTKA 4ZEDA 4F1VA 4OVQA 3C4MA 1JVYA 1IUDA 3BFUA 3RN8A 2DVZA 2H98A 2V3TA 2BJIA 2PFYA 5CC2A 1XT8A 1B3HA 2I0BA 2XXPA 3ROJA 3TEPA 4I9DA 1LBCA 1EYJA 4NHBA 1WODA 2AYSA 4GX3A 4HXVA 1LAGE 3PTYA 4NEDA 3HFUA 5TP9A 4AS5A 2Q2AA 2HXWA 3SKPA 4UABA 1T0KA 5I2NB 3FUZA 3PPOA 4OTEA 4KQPA 4YB5A 3MP1A 2I0CA 3T96B 2O68A 4E0XA 3IO4A 1NI9A 1IMEA 3LC8A 1BTJA 1JW1A 3SZPA 3SDFA 2P2AA 4GWWA 5I5PA 1ZU0A 4LQ5A 4Q8RA 1MG1A 4DZ1A 1LB9A 1ZMGA 1FBEA 5EYHA 4MHFA 1DBZA 2Z8FA 4RPOA 2ZMBA 2HXRA 2CZHA 3K01A 3EF7A 4PDDA 1AL3A 5I59B 5JTYB 3UK4A 4N6PA 4WEPA 3VVDA 5DTBA 2I4BA 3I5OA 3D4GA 1FCKA 1B40A 2F78A 3SEXA 4DE8A 3TAJA 2O51A 4OANA 1JW5A 4RK2A 1OQGA 3B6QA 4P11A 2UYEA 3TODA 2V4CA 1XHYA 1NV6A 4G8NA 1AOVA 5I57A 3IAZA 2F97A 4H5GA 2PMSA 2ANJA 1MY1A 4ZE8A 1B9JA 4QHQA 2XWIA 1LFIA 4IO7A 2V3UA 1NV3A 3MP8A 5CRYA 5ITOA 5CMBA 4HCWA 4Q0CA 3KOSA 4MCOA 1JP4A 1Y3PA 3PUZE 4N8GA 1SI1A 2UVGA 3CFXA 4Z0IA 4OVSA 1LGBC 1BIYA 3S9LC 3MW0A 4MEVA 1B32A 4G68C 3PUYE 1FQBA 4QFLA 4N07A 4P8BA 1MXVA 3CVGA 3IX1A 4NQ8A 1EYIA 4OEVA 4QSEA 2LAOA 5H8FB 1HSEA 1TFAA 3DP8A 3CG3A 2D21A 3KGCA 3I3VA 2V25A 4OFOA 3KG2A 4XEQA 2UYFA 3DELB 1JW4A 4N6KA 1FPFA 3T9XB 5HM4B 2REJA 4KCDA 1OVBA 5IKBA 4LZ7A 4R73A 1IXGA 1MQIA 3D1RA 3IFAA 1HSLA 4P47A 2QS2A 5AA3A 2HCAA 4IR8A 2GH9A 5H8NB 4H45A 4F3BA 1VDWA 5KCJA 1NNFA 3TFLA 4RY1A 3CI8A 2DXYA 2CZLA 3FZVA 4AB5A 5CMCA 4QFPA 4AB6A 1IMCA 1NFTA 1JEUA 1SI0A 4GL0A 3MZ1A 2ZYMA 1B0HA 1JNFA 3A3CA 4NWCA 4O94A 1QW0A 4EUOA 2DSFA 2FIEA 4ND9A 1DTGA 2W7YA 2V3QA 1DSNA 3N94A 3MBPA 4OVJA 2VOZA 3BIHA 5IZ3A 2HAUA 3OD7A 3U8QA 4GWXA 3HCQA 1FQFA 3KJTA 3FXRA 1P1WA 1USYH 4EXLA 1MPBA 4MMPA 3K6UA 2DYXA 4YB6A 2JJKA 2Q88A 4H0WA 1EH3A 3QXMA 1MDP1 4H6DA 3UN6A 3MZ9A 1QUIA 1ZKBA 1B5JA 1B46A 3U72A 4POXA 2XX8A 1P1OA 2ZZVA 1B3GA 5KDTB 1KA0A 4POWA 4UA8A 1B3EA 4F18A 2ESNA 4Q30B 1VFDA 1FPLA 5ET5A 1B7HA 2OLBA 4DXBA 4MBPA 4PC9A 3SETA 4PCDA 4GBWA 3KBRA 4KI0E 3RUMA 5ICQA 3MSTA 2HEUA 1TXFA 1VE4A 1TT1A 1ZIUA 2P0SA 3TMGA 2RC8A 1JEVA 5AA4B 2VHAA 1D4NA 3RT8A 4YB7A 2RC9A 5F1QA 3M8UA 2PCRA 4O7IA 3CFZA 4DXCA 3QMFA 1POTA 1B5HA 1FPBA 4NF6A 1A8FA 3CSBA 5K2YA 1MXZA 1SBPA 4I3EA 5M2VA 4QXDA 4HS7A 5I58A 5F7VA 3IK6B 1ANFA 1MQDA 3RGYA 1LBXA 1PBPA 2FHYA 3TDJA 3MPLA 1MM7A 4R2BA 2HPGA 1ELJA 5FHNA 2ONSA 5T3JA 2H9BA 3RQTA 3LSXA 4R6KA 2O6AA 4R72A 1IMFA 3TTLA 2Q9TA 3S9EA 4PAKA 1FPEA 4X1BA 1OQHA 3C35A 1FJ9A 2DWJA 3GXAA 5H8QB 4HW8A 1B7ZA 1QKBA 2CEYA 2ZNUA 1SW1A 4KHZE 1TFDA 2D5WA 3K6VA 1USYE 3PMVA 2DE4A 1GR2A 2ALUA 5B70A 1MM6A 1IMBA 2Z8EA 4N81A 4PAFA 3NOHA 5DW8A 4AQ4A 3OO7A 5JEIA 2ZXTA 2X26A 2XWKA 3GLBA 2UVIA 3KSJA 1I6AA 5CMMA 1DMBA 4R74A 2HAVA 3K2DA 1IQ7A 3B6TA 3MWBA 4JXIA 3BFTA 4PE5B 3O2AA 3ODBA 1P99A 4KYEA 4TQUQ 2FIXA 4FATA 3RPLA 3ZSFA 4XKQA 3ZS6A 1MY0A 4GIZA 4HE2A 1LEVA 4ELRA 4GVOA 5IGAA 2RCAA 3KFMA 4LP2B 3ZKKA 1I6QA 3B50A 2RF1A 3IO6A 1B05A 4ZS9A 3LUYA 4IO4A 4GBVA 3Q26A 4P1LA 4ISUA 4GWYA 1BKAA 1H43A 2L5VA 4P0IA 3E79A 5L9MA 1H44A 3E78A 4C1TA 4ZEFA 3RPWA 2QJEA 1URSA 3QSLA 2PFZA 4C0RA 5A5XA 4PP0A 2XXWA 5EQAA 3IB0A 1D3KA 2F7CA 4RYAA 2AIXA 1NV7A 1DCUA 1UTHB 3KN7A 3RYDA 2XA5A 4G4PA 4O3CA 2O7UA 5ELVA 4ESXA 4PETA 1Y4CA 1YXIA 5LTCA 1R6ZA 2RINA 3GBAA 4THIA 2XHDA 2WYKA 3JZJA 2Z8DA 3LV0A 4F29A 5H8HA 3VLWA 2DS9A 3MC2A 3O6HA 4PGNA 1F9BA 3TKDA 2H99A 3TCGA 1FTAA 4YKKA 3I6VA 4UACA 4RK9A 4GOTA 4N17A 1FPIA 1N84A 4GQOA 4F2QA 4XFEA 1WDNA 1LAXA 2YJPA 1B51A 3LSWA 4R75A 4YU0A 4N4UA 4YICA 2G93A 1AMFA 2XXIA 3G3IA 2F34A 1DPPA 3Q29A 2VPOA 1NKXA 1N04A 1P1UA 1Y4TA 2UXAA 1FW0A 2H5YA 4NF4B 3MVYA 1AIVA 4KYDA 2OX3A 2XXUA 2DP8A 3EN3A 1N76A 1ZLQA 1B58A 4OETA 2R8TA 1B52A 5AA2A 3FVGA 4FBPA 2F3DA 4BLAA 3OELA 2YLNA 5DVIA 5I2KB 2QVUA 4G2ZA 1YYZA 3MVWA 4XKRA 2KR0A 1H76A 4MNPA 3RTWB 4ZDMA 1CB6A 1EYKA 3W9VA 4NF8A 2I6EA 4MIJA 3H4ZA 5DT6A 3CHGA 5IZZA 4I8CA 3H03A 2VGQA 2F8DA 3LUZA 2Y7WA 1LSTA 4JWXA 4P3LA 2NOOA 3N6TA 4PFRA 1N7WA 1XVXA 3IJOB 4GXSB 1M5FA 4KYSA 4MF3A 2R9JA 2WX9A 1RYOA 2RCBA 4N6DA 2DE3A 5J1DA 2GHAA 2G29A 5EYFA 4OVTA 3IOUA 3H6TA 4PBQA 2NUVA 2O69A 1QJMA 4MLQA 4PBHA 3HSTA 4HTGA 4LONB 4IO2A 3MPKA 3SEVA 3CRBA 4PF6A 2E1SA 3W9WA 2QPQA 3S9NC 2B3BA 4XTCQ 2CMOA 1FBCA 1UIVA 2Q89A 2Y5LA 3PPRA 4DXUA 1US4A 1MY3A 2WBDA 5K2XA 3VVEA 1XS5A 5L9SA 3ZKLA 4IO6A 1O7TA 3PV0E 3G3KA 5AA1A 1LLSA 2B3FA 1QUJA 3N26A 4JDFA 1IXIA 1NNKA 1XC1A 3S4UA 1MY2A 4OMBA 5FBPA 4NF5B 1FBPA 1I69A 4LZ5A 3SEWA 1M5CA 2WEFA 3DLNA 4LVQA 2A5TB 3O97A 1MQGA 1DPEA 1IMDA 4F2OA 1PDAA 3TTKA 4NX1A 1LAFE 1J1NA 4PE3A 4JVDA 2ZNSA 4BDQA 5IZ1A 3T1BA 2QSXA 4GRKA 4ZEIA 1JQFA 2A5SA 3VV5A 3RT6B 4Q5TA 1BLFA 4OHNA 1FTOA 2Q8MA 2HZLA 3QIMA 3QYTA 1GV8A 3T9HB 4GX6A 4ZECA 5FTIA 4PF8A 4AS4A 4OERA 1FQCA 1NUZA 4WXJA 3A29A 1LCTA 5ET7A 3N5LA 2OJTA 2NXOA 4KXPA 2Q2CA 1M5DA 3P7IA 1KZ8A 1N3XA 5EHMA 3RTFB 3C32A 3O66A 1TWYA 4H1XA 4YAHX 4G77A 1UTBB 2KQZA 3E3KA 4ELPA 4YMBA 5DEXB 1PBQA 3L6GA 5BWJA 5KZTA 3E4RA 3O29A 4O3BA 1B7UA 3IOTA 4R6HA 3USDA 1Q9DA 3T0JA 4MH5A 3KC0A 4OQOA 3EHUA 2V93A 3BIGA 3T22A 4L17A 1B2HA 4GWUA 1FPGA 1G0HA 3DP4A 2NVUB 5I84A 4PAIA 4DI4B 1CE2A 3Q28A 5FTHA 2O84X 3K02A 3VLVA 1VR5A 5TPAB 4LATA 1POY1 3UGWA 3TZAA 4WEDA 2HQ0A 2GQ1A 4EQ7A 3UA8A 1YCJA 3FV2A 3T93B 4ECFA 1FBDA 2QL3A 3TQLA 3G3GA 1FPDA 5A5XB 4F22A 4G68B 1IITA 5BUUA 2XD2A 2I3WA 3EHSA 1Y1MA 2PT2A 5I2NA 1NUYA 1B3LA 1US5A 3HHGA 4YMAA 1FTJA 2FVZA 4OZ9A 1ATGA 1G0IA 3PPQA 4EQBA 2F35A 3D4CA 4DCXA 4DI3D 1N7XA 1BP5A 3KN3A 1NUXA 3CG1A 4OEUA 2AL5A 4IO3A 1FRPA 4P9KA 4BDRA 3IR1A 2GRVA 5A5LA 3FV1A 2QMWA 4QFOA 1GTKA 2YPNA 4H5FA 2WYPA 4TLLB 1QGXA 3U92A 4YZZA 1JVXA 2XD3A 1OIBA 3Q27A 4BDLA 1RDXA 3VVFA 3C33A 3H6WA 4F3PA 1OMPA 1H45A 1Q1KA 5I56B 2OZZA 5CBRA 2ZNTA 3E13X 1QULA 3LR1A 1R1NA 5I59A 5JTYA 2P1SA 3RLFE 2Y7KA 4P0GA 5DVFA 5J16A 4QRZA 4OESA 4F19A 2P3VA 4O3AA 1FBGA 1FPJA 4MX6A 3M3LA 1H3DA 1IMAA 2QVVA 3MYUA 4NE4A 4XXUA 2OK2A 4IGTA 4WKMA 4E0WA 2IA4A 3R7XA 3THIA 4U4XA 3TYHA 4C1UA 3TTNA 3VXCA 3FBPA 1CNQA 3HV1A 3BBRA 1Y9UA 4JVCA 1A99A 1Q35A 2Y84A 3O9PA 3FJMA 2FNCA 3OSQA 1LFHA 1B4HA 1MRPA 4PFBA 5TP9B 3TCHA 3R26A 2OWZA 3ILUB 1FBFA 3MUQA 3H06B 3WAFA 3HO7A 3OENA 4GXAA 3KC1A 2DDKA 2I48A 3OO8A 4EXKA 1NV0A 2X7PA 3M3KA 1PEBA 2XXXA 3FATA 1OLAA 3KOTA 3EQ1A 5H8SA 5H8FA 5EQ8A 3TUSA 3HPIA 3ISPA 3VE1B 4RPNA 1ZTYA 3W15C 1IXCA 1PB9A 2HZKA 1Y20A 2F5XA 3A3UA 1S9TA 3F11A 4IGRA 1A55A 5CBSA 4MFIA 3LSFB 2DOJA 4PFIA 4JSDA 3H7MA 4BDMA 4HE0A 3QK6A 2ZZXA 1DTZA 1IZ1A 3ONMA 3ILTB 2UVJA 4IY6A 4BDOA 4P1EA 4OA4A 1MY4A 4RA1A 1MXXA 3TTRA 2IEEA 1UIUA 4KD5A 4N13A 5H8NA 4NMYA 4X48A 1B1HA 1MPCA 1SYIA 3V5AA 2ZYKA 1IIWA 1MPDA 2R6GE 3RY3A 3RNNA 4XKPA 2QFLA 3VDFA 5ISUA 4FORA 4G61A 4F3GA 5LDZA 5I57B 4F1UA 2KLFA 4ZEKA 3OOAA 4R6YA 4JBZA 2WKYA 3C31A 1MS7A 1WVJA 3K1PA 4MLVA 4NWDA 2H4IA 4ELOA 3PMXA 4EDPA 1EZ9A 3PD8A 3R6UA 1D9VA 1MH3A 4OWDA 1AH5A 1M5BA 2Y7IA 3IORA 1ZJLA 2D3IA 3K1NA 4FJPA 3H6VA 4PFWA 2DVCA 3KJ7A 3FJ7A 4QSCA 5KDTA 3T9UA 1A40A 4OYVA 3FASA 2RKMA 3B8BA 2Y7RA 4LUBA 3M3FA 4ZE9A 2HHMA 3LSLA 1N0TA 1FQDA 3CFLA 2HFBA 3S2VA 1L5TA 3G3FA 4I1DA 4X9TA 5CI5A 4H8JA 3FXBA 2DWIA 4FAJA 5AA4A 3IFCA 3WAEA 1LB8A 1NH7A 1KWHA 1A54A 3SERA 1K9YA 2XXHA 4F3SA 3PPPA 1FTMA 2AL4A 4U1OA 1PC3A 3V8XB 2XXRA 2O1MA 2GFEA 3FVOA 1SPIA 4X04A 3H6UA 5KCJB 3G7WA 1EZOA 2VT5A 2ZYOA 3UP9A 3FJGA 1Y1ZA 1NV4A 4JSOA 2QS4A 1OLCA 3DP6A 1SDXA 1SYHA 4MAGA 3CSGA 1KA1A 2OCUA 5H8QA 3V89B 5IZ3B 4H65A 5JK4A 1NMUA 5ESYA 3FIRA 3BKIB 3U65A 2Q8JA 4ONYA 3U94A 2ONKE 3KEIA 1EU8A 1NUWA 3K0VA 1FQAA 3QUFA 3VLUA 1O63A 1RDYA 2VD3A 4R9FA 4K3FA 2OWTA 5F24A 2QS1A 5IM2A 2Z23A 2Y7PA 4XKNA 3G3JA 5L9OA 1NV5A
chains in the Genus database with same CATH topology
5DVJA 3MQ9A 1Z7NE 1B3FA 3IL1B 4M4GA 3OO9A 2DQVA 3EPEA 5FHMA 3IB1A 3LBSA 3FVNA 1R9QA 3E9XA 3IB2A 3HHFA 3PMWA 1RKMA 2GHBA 4NF6B 1Z7ME 1ZBMA 1SVXB 3A09A 3FD3A 5I58B 1S7YA 3O28A 4OFLA 4YKPA 3AXFA 1YTVA 3U1OA 3EHTA 2V84A 4ELQA 5AE4A 5ITPA 1PB8A 4XIGQ 4GLIA 2QS3A 4QFKA 3B7DA 3FVKA 4QSDA 1UTHA 5HBCA 1YAEA 2RC7A 2PT1A 1R9LA 3TTMA 3UORA 3L6HA 4ESWA 3PGFA 1A8EA 2VD2A 2ONRA 2FYIA 1NH8A 4RNSA 1Y3NA 4JWOA 3B6WA 3PD9A 1MXWA 2UVHA 4JWYA 1MQHA 4DCYA 1EZPA 4EF2A 5TU0A 4TOZA 4H8IA 5HPQA 3S9MC 1URGA 4FEBA 1PB7A 1IXHA 1LAHE 3MVXA 1DOTA 2DWAA 4IY5A 2F6GA 4I62A 2F7AA 4G8HA 4GWOA 3T9VA 4F39A 3GBBA 3K4UA 4OFJA 5L8DA 4NF4A 1SQYA 4PFUA 1XOCA 4BDNA 4U1ZA 4DLDA 3Q25A 2NWJA 2ABHA 1O64A 3SESA 1B0LA 5B7DA 4FIMA 1YPNA 3QAXA 1HSJA 3C36A 3FXQA 4PQJA 3HN0A 5I2KA 1LCFA 3PUVE 2DE2A 4ZZAA 1P1QA 4YKJA 4GL8A 2OWSA 4U2RA 4X1DA 4U22A 1OVTA 4TLMB 1LFGA 3TELA 4R2FA 4QF9A 3U93A 3MJNA 3CIJA 1S50A 4F1YA 2DXRA 3UIFA 2XXTA 4DDDA 5H8HB 1URDA 4KFQA 3C34A 5FHOA 4FECA 4HCYA 2B65A 3DM0A 2I49A 3VFJA 4EQ9A 1QVSA 4LQ2A 3N6UA 3KN8A 3MVZA 1MDQA 4RJZA 2QRYA 1SW4A 2X7QA 4R9GA 2PYYA 4KR5A 4IO5A 4OXVA 3C9HA 3FXUA 5AA2D 1RYXA 3K1MA 1M5EA 4F31B 5IAIA 3CR9A 3IJXB 2BJJX 1IEJA 1MQJA 4DIGA 2OBGA 4QFNA 5ICTA 4H67A 3TQWA 2FA7A 3KSXA 1SW2A 3OEKA 2E0SA 2I3VA 5DYHA 4U23A 2O1LA 1JETA 3TCFA 4NF5A 5LOMA 2ZYNA 3V83A 5AA2B 2A5TA 4ZZEA 1P1NA 3OO6A 1UQWA 4ZEBA 4NF8B 1QKAA 3O6IA 2QMXA 2I4CA 1GGGA 2F6PA 3MP6A 1II5A 4RXLA 1Y3QA 3MZBA 1GVCA 2PBWA 3K6XA 4KCCA 1B1XA 1B4ZA 3GZGA 4U4SA 1NNTA 4YKIA 2VP1A 4LA9A 3SEUA 2XXYA 2DWHA 3SEYA 1B5IA 3H3GA 1N3WA 4LZ8A 1UTBA 1VFEA 2PVUA 3K00A 5DEXA 2I58A 5EHSA 1B6HA 3OEMA 4IB2A 3PUWE 1NL5A 1MH4A 4KPTA 3PUXE 4FE8A 4GF8A 4PFYA 4Z7EA 3IOWA 3IOVA 1NNPA 1MXUA 1FTLA 1SD3A 5TPAA 2XX7A 3ECRA 5CM6A 1FQEA 1D9YA 2XXQA 1A7LA 2H25A 4M1VA 2XX9A 3TPAA 4G68A 3PU5A 2XXVA 3FGSA 3OSRA 1SW5A 1XVYA 2F7BA 4U21A 4FEDA 4JB7A 4OENA 3O6GA 4GFRA 1MXYA 4G8MA 4EF1A 2R71A 1QUKA 3QUJA 3MAMA 3G3HA 1FTKA 2M8CA 3KZGA 3JV9A 3JYRA 5I56A 2Z22A 3OMBA 3OXNA 3VXBA 3K6WA 4PFTA 3T66A 3PPNA 1I6BA 5CMKA 2THIA 2REGA 2F36A 2PX1A 1VSOA 4NTLA 2O7IA 4GD5A 1LBBA 4ZEDA 4F1VA 3C4MA 1JVYA 1IUDA 3BFUA 3RN8A 2DVZA 2H98A 2V3TA 5CC2A 1XT8A 1B3HA 2I0BA 2XXPA 3TEPA 4I9DA 1LBCA 1WODA 2AYSA 1LAGE 4NEDA 5TP9A 2Q2AA 2HXWA 3SKPA 1T0KA 5I2NB 3FUZA 3PPOA 4OTEA 4KQPA 4YB5A 3MP1A 2I0CA 3T96B 2O68A 4E0XA 3IO4A 3LC8A 1BTJA 1JW1A 3SDFA 2P2AA 1ZU0A 4LQ5A 4Q8RA 1MG1A 4DZ1A 1LB9A 1ZMGA 2Z8FA 4RPOA 2ZMBA 3K01A 3EF7A 1AL3A 5I59B 5JTYB 3UK4A 4N6PA 4WEPA 3VVDA 5DTBA 2I4BA 3I5OA 3D4GA 1FCKA 1B40A 2F78A 3SEXA 4DE8A 3TAJA 2O51A 1JW5A 4RK2A 1OQGA 3B6QA 4P11A 2UYEA 3TODA 1XHYA 4G8NA 1AOVA 5I57A 3IAZA 2F97A 4H5GA 2PMSA 2ANJA 1MY1A 4ZE8A 1B9JA 4QHQA 1LFIA 4IO7A 2V3UA 3MP8A 5CRYA 5ITOA 5CMBA 4HCWA 4Q0CA 3KOSA 1Y3PA 3PUZE 1SI1A 2UVGA 3CFXA 4Z0IA 1LGBC 1BIYA 3S9LC 3MW0A 1B32A 4G68C 3PUYE 1FQBA 4QFLA 4N07A 1MXVA 3CVGA 3IX1A 4OEVA 4QSEA 2LAOA 5H8FB 1HSEA 1TFAA 3DP8A 3CG3A 2D21A 3KGCA 3I3VA 2V25A 4OFOA 3KG2A 2UYFA 3DELB 1JW4A 3T9XB 5HM4B 2REJA 4KCDA 1OVBA 5IKBA 4LZ7A 4R73A 1IXGA 1MQIA 1HSLA 2QS2A 5AA3A 2HCAA 2GH9A 5H8NB 4F3BA 5KCJA 1NNFA 3TFLA 4RY1A 3CI8A 2DXYA 2CZLA 3FZVA 4AB5A 5CMCA 4QFPA 4AB6A 1NFTA 1JEUA 1SI0A 4GL0A 3MZ1A 2ZYMA 1B0HA 1JNFA 3A3CA 4NWCA 4EUOA 1QW0A 2DSFA 4ND9A 1DTGA 2W7YA 2V3QA 1DSNA 3N94A 3MBPA 4OVJA 2VOZA 2HAUA 3OD7A 3U8QA 3HCQA 1FQFA 3KJTA 3FXRA 1P1WA 1USYH 4EXLA 1MPBA 3K6UA 2DYXA 4YB6A 2Q88A 4H0WA 1EH3A 3QXMA 1MDP1 4H6DA 3UN6A 3MZ9A 1QUIA 1ZKBA 1B5JA 1B46A 3U72A 4POXA 2XX8A 1P1OA 1B3GA 5KDTB 4POWA 4UA8A 1B3EA 4F18A 2ESNA 4Q30B 1VFDA 1B7HA 2OLBA 4DXBA 4MBPA 3SETA 3KBRA 4KI0E 3RUMA 5ICQA 2HEUA 1TXFA 1VE4A 1TT1A 1ZIUA 2P0SA 3TMGA 2RC8A 1JEVA 5AA4B 2VHAA 1D4NA 3RT8A 4YB7A 2RC9A 5F1QA 3M8UA 3CFZA 4DXCA 1POTA 1B5HA 4NF6A 1A8FA 3CSBA 5K2YA 1MXZA 1SBPA 5M2VA 4HS7A 5I58A 5F7VA 3IK6B 1ANFA 1MQDA 3RGYA 1PBPA 3TDJA 3MPLA 1MM7A 4R2BA 5FHNA 1ELJA 2ONSA 3RQTA 2H9BA 3LSXA 4R6KA 2O6AA 4R72A 3TTLA 2Q9TA 3S9EA 4X1BA 1OQHA 3C35A 2DWJA 3GXAA 5H8QB 4HW8A 1B7ZA 1QKBA 2ZNUA 1SW1A 4KHZE 1TFDA 2D5WA 3K6VA 1USYE 3PMVA 2DE4A 1GR2A 2ALUA 5B70A 1MM6A 2Z8EA 4AQ4A 3OO7A 5JEIA 2ZXTA 2X26A 3GLBA 2UVIA 3KSJA 1I6AA 5CMMA 1DMBA 4R74A 2HAVA 3K2DA 1IQ7A 3B6TA 3MWBA 4JXIA 3BFTA 4PE5B 3O2AA 3ODBA 1P99A 4KYEA 4TQUQ 4FATA 3ZSFA 4XKQA 3ZS6A 1MY0A 4GIZA 4ELRA 4GVOA 2RCAA 3KFMA 4LP2B 3ZKKA 1I6QA 2RF1A 3IO6A 1B05A 4ZS9A 3LUYA 4IO4A 3Q26A 4ISUA 1BKAA 1H43A 4P0IA 5L9MA 1H44A 4C1TA 4ZEFA 3RPWA 2QJEA 1URSA 3QSLA 4C0RA 5A5XA 4PP0A 2XXWA 3IB0A 1D3KA 2F7CA 4RYAA 2AIXA 1UTHB 3KN7A 4G4PA 4O3CA 2O7UA 5ELVA 4ESXA 4PETA 1Y4CA 1R6ZA 2RINA 3GBAA 4THIA 2XHDA 3JZJA 2Z8DA 4F29A 5H8HA 3VLWA 2DS9A 3MC2A 3O6HA 1F9BA 3TKDA 2H99A 3TCGA 4YKKA 3I6VA 4UACA 4RK9A 4GOTA 1N84A 4GQOA 4F2QA 1WDNA 1LAXA 2YJPA 1B51A 3LSWA 4R75A 4YU0A 4YICA 2G93A 1AMFA 2XXIA 3G3IA 2F34A 1DPPA 3Q29A 1NKXA 1N04A 1P1UA 1Y4TA 2UXAA 1FW0A 2H5YA 4NF4B 3MVYA 1AIVA 4KYDA 2XXUA 2DP8A 3EN3A 1N76A 1ZLQA 1B58A 4OETA 1B52A 5AA2A 3FVGA 4BLAA 3OELA 2YLNA 5DVIA 5I2KB 4G2ZA 3MVWA 4XKRA 1H76A 3RTWB 4ZDMA 1CB6A 3W9VA 4NF8A 2I6EA 3H4ZA 5DT6A 4I8CA 3H03A 2VGQA 2F8DA 2Y7WA 1LSTA 4JWXA 2NOOA 3N6TA 1N7WA 1XVXA 3IJOB 4GXSB 1M5FA 4KYSA 4MF3A 2R9JA 1RYOA 2RCBA 2DE3A 5J1DA 2GHAA 2G29A 5EYFA 3IOUA 3H6TA 2NUVA 2O69A 1QJMA 4MLQA 3HSTA 4HTGA 4LONB 4IO2A 3MPKA 3SEVA 3CRBA 3W9WA 2E1SA 2QPQA 3S9NC 2B3BA 4XTCQ 2CMOA 1UIVA 2Q89A 3PPRA 4DXUA 1US4A 1MY3A 5K2XA 3VVEA 1XS5A 5L9SA 3ZKLA 4IO6A 1O7TA 3PV0E 3G3KA 5AA1A 1LLSA 2B3FA 1QUJA 3N26A 4JDFA 1IXIA 1NNKA 1XC1A 3S4UA 1MY2A 4OMBA 4NF5B 1I69A 4LZ5A 3SEWA 1M5CA 3DLNA 4LVQA 2A5TB 3O97A 1MQGA 1DPEA 4F2OA 1PDAA 3TTKA 1LAFE 1J1NA 2ZNSA 4BDQA 2QSXA 4GRKA 4ZEIA 1JQFA 2A5SA 3VV5A 3RT6B 4Q5TA 1BLFA 4OHNA 1FTOA 2HZLA 3QIMA 3QYTA 1GV8A 3T9HB 4ZECA 5FTIA 4OERA 1FQCA 4WXJA 1LCTA 3N5LA 2OJTA 2NXOA 2Q2CA 1M5DA 3P7IA 1N3XA 5EHMA 3RTFB 3C32A 3O66A 1TWYA 4H1XA 4YAHX 4G77A 1UTBB 3E3KA 4ELPA 4YMBA 5DEXB 1PBQA 3L6GA 5BWJA 5KZTA 3E4RA 3O29A 4O3BA 1B7UA 3IOTA 4R6HA 3USDA 4MH5A 4OQOA 3EHUA 2V93A 3T22A 4L17A 1B2HA 3DP4A 2NVUB 5I84A 1CE2A 3Q28A 5FTHA 2O84X 3K02A 3VLVA 1VR5A 5TPAB 4LATA 1POY1 3UGWA 3TZAA 4WEDA 2HQ0A 4EQ7A 3UA8A 1YCJA 3FV2A 3T93B 4ECFA 2QL3A 3TQLA 3G3GA 5A5XB 4F22A 4G68B 1IITA 5BUUA 2XD2A 2I3WA 3EHSA 1Y1MA 2PT2A 5I2NA 1B3LA 1US5A 3HHGA 4YMAA 1FTJA 4OZ9A 4EQBA 1ATGA 3PPQA 2F35A 3D4CA 4DCXA 1N7XA 1BP5A 3KN3A 3CG1A 4OEUA 2AL5A 4IO3A 4BDRA 3IR1A 2GRVA 3FV1A 2QMWA 4QFOA 1GTKA 2YPNA 4H5FA 4TLLB 3U92A 4YZZA 1JVXA 2XD3A 1OIBA 3Q27A 4BDLA 3VVFA 3C33A 3H6WA 4F3PA 1OMPA 1H45A 1Q1KA 5I56B 2OZZA 5CBRA 2ZNTA 3E13X 1QULA 3LR1A 1R1NA 5I59A 5JTYA 2P1SA 3RLFE 2Y7KA 4P0GA 5DVFA 4QRZA 4OESA 4F19A 4O3AA 3M3LA 1H3DA 4NE4A 4XXUA 2OK2A 4IGTA 4WKMA 4E0WA 2IA4A 3R7XA 3THIA 4U4XA 3TYHA 4C1UA 3TTNA 3VXCA 3HV1A 3BBRA 1Y9UA 1A99A 1Q35A 2Y84A 3O9PA 3FJMA 2FNCA 3OSQA 1LFHA 1B4HA 1MRPA 5TP9B 3TCHA 3R26A 3ILUB 3MUQA 3H06B 3WAFA 3HO7A 3OENA 4GXAA 2I48A 3OO8A 4EXKA 2X7PA 3M3KA 1PEBA 2XXXA 3FATA 1OLAA 3KOTA 3EQ1A 5H8SA 5H8FA 3TUSA 3HPIA 3VE1B 4RPNA 1ZTYA 3W15C 1IXCA 1PB9A 2HZKA 1Y20A 2F5XA 3A3UA 1S9TA 3F11A 4IGRA 1A55A 5CBSA 4MFIA 3LSFB 2DOJA 4JSDA 3H7MA 4BDMA 3QK6A 1DTZA 1IZ1A 3ONMA 3ILTB 2UVJA 4IY6A 4BDOA 1MY4A 4RA1A 1MXXA 3TTRA 2IEEA 1UIUA 4KD5A 4N13A 5H8NA 4NMYA 4X48A 1B1HA 1MPCA 1SYIA 3V5AA 2ZYKA 1IIWA 1MPDA 2R6GE 3RY3A 3RNNA 4XKPA 3VDFA 5ISUA 4FORA 4F3GA 5I57B 4F1UA 2KLFA 4ZEKA 3OOAA 4R6YA 4JBZA 2WKYA 3C31A 1MS7A 1WVJA 3K1PA 4MLVA 4NWDA 2H4IA 4ELOA 3PMXA 4EDPA 1EZ9A 3PD8A 3R6UA 1D9VA 1MH3A 4OWDA 1AH5A 1M5BA 2Y7IA 3IORA 1ZJLA 2D3IA 3K1NA 4FJPA 3H6VA 4PFWA 2DVCA 3KJ7A 3FJ7A 4QSCA 5KDTA 3T9UA 1A40A 4OYVA 3FASA 2RKMA 2Y7RA 4LUBA 3M3FA 4ZE9A 3LSLA 1N0TA 1FQDA 3CFLA 2HFBA 3S2VA 1L5TA 3G3FA 4I1DA 4X9TA 5CI5A 4H8JA 2DWIA 4FAJA 5AA4A 3WAEA 1LB8A 1NH7A 1KWHA 1A54A 3SERA 2XXHA 4F3SA 3PPPA 1FTMA 2AL4A 4U1OA 1PC3A 3V8XB 2XXRA 2O1MA 2GFEA 3FVOA 3H6UA 5KCJB 3G7WA 1EZOA 2ZYOA 3UP9A 3FJGA 1Y1ZA 4JSOA 2QS4A 1OLCA 3DP6A 1SDXA 1SYHA 3CSGA 2OCUA 5H8QA 3V89B 4H65A 5JK4A 1NMUA 3FIRA 3BKIB 2Q8JA 4ONYA 3U94A 2ONKE 3KEIA 1EU8A 3K0VA 1FQAA 3QUFA 3VLUA 1O63A 2VD3A 4R9FA 4K3FA 2OWTA 2QS1A 2Z23A 2Y7PA 4XKNA 3G3JA 5L9OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DVJ A;  3MQ9 A;  1Z7N E;  1B3F A;  3IL1 B;  4M4G A;  3OO9 A;  2DQV A;  3EPE A;  5FHM A;  3IB1 A;  3LBS A;  3FVN A;  1R9Q A;  3E9X A;  3IB2 A;  3HHF A;  3PMW A;  1RKM A;  2GHB A;  4NF6 B;  1Z7M E;  1ZBM A;  1SVX B;  3A09 A;  3FD3 A;  5I58 B;  1S7Y A;  3O28 A;  4OFL A;  4YKP A;  3AXF A;  1YTV A;  3U1O A;  3EHT A;  2V84 A;  4ELQ A;  5AE4 A;  5ITP A;  1PB8 A;  4XIG Q;  4GLI A;  2QS3 A;  4QFK A;  3B7D A;  3FVK A;  4QSD A;  1UTH A;  5HBC A;  1YAE A;  2RC7 A;  2PT1 A;  1R9L A;  3TTM A;  3UOR A;  3L6H A;  4ESW A;  3PGF A;  1A8E A;  2VD2 A;  2ONR A;  2FYI A;  1NH8 A;  4RNS A;  1Y3N A;  4JWO A;  3B6W A;  3PD9 A;  1MXW A;  2UVH A;  4JWY A;  1MQH A;  4DCY A;  1EZP A;  4EF2 A;  5TU0 A;  4TOZ A;  4H8I A;  5HPQ A;  3S9M C;  1URG A;  4FEB A;  1PB7 A;  1IXH A;  1LAH E;  3MVX A;  1DOT A;  2DWA A;  4IY5 A;  2F6G A;  4I62 A;  2F7A A;  4G8H A;  4GWO A;  3T9V A;  4F39 A;  3GBB A;  3K4U A;  4OFJ A;  5L8D A;  4NF4 A;  1SQY A;  4PFU A;  1XOC A;  4BDN A;  4U1Z A;  4DLD A;  3Q25 A;  2NWJ A;  2ABH A;  1O64 A;  3SES A;  1B0L A;  5B7D A;  4FIM A;  1YPN A;  3QAX A;  1HSJ A;  3C36 A;  3FXQ A;  4PQJ A;  3HN0 A;  5I2K A;  1LCF A;  3PUV E;  2DE2 A;  4ZZA A;  1P1Q A;  4YKJ A;  4GL8 A;  2OWS A;  4U2R A;  4X1D A;  4U22 A;  1OVT A;  4TLM B;  1LFG A;  3TEL A;  4R2F A;  4QF9 A;  3U93 A;  3MJN A;  3CIJ A;  1S50 A;  4F1Y A;  2DXR A;  3UIF A;  2XXT A;  4DDD A;  5H8H B;  1URD A;  4KFQ A;  3C34 A;  5FHO A;  4FEC A;  4HCY A;  2B65 A;  3DM0 A;  2I49 A;  3VFJ A;  4EQ9 A;  1QVS A;  4LQ2 A;  3N6U A;  3KN8 A;  3MVZ A;  1MDQ A;  4RJZ A;  2QRY A;  1SW4 A;  2X7Q A;  4R9G A;  2PYY A;  4KR5 A;  4IO5 A;  4OXV A;  3C9H A;  3FXU A;  5AA2 D;  1RYX A;  3K1M A;  1M5E A;  4F31 B;  5IAI A;  3CR9 A;  3IJX B;  2BJJ X;  1IEJ A;  1MQJ A;  4DIG A;  2OBG A;  4QFN A;  5ICT A;  4H67 A;  3TQW A;  2FA7 A;  3KSX A;  1SW2 A;  3OEK A;  2E0S A;  2I3V A;  5DYH A;  4U23 A;  2O1L A;  1JET A;  3TCF A;  4NF5 A;  5LOM A;  2ZYN A;  3V83 A;  5AA2 B;  2A5T A;  4ZZE A;  1P1N A;  3OO6 A;  1UQW A;  4ZEB A;  4NF8 B;  1QKA A;  3O6I A;  2QMX A;  2I4C A;  1GGG A;  2F6P A;  3MP6 A;  1II5 A;  4RXL A;  1Y3Q A;  3MZB A;  1GVC A;  2PBW A;  3K6X A;  4KCC A;  1B1X A;  1B4Z A;  3GZG A;  4U4S A;  1NNT A;  4YKI A;  2VP1 A;  4LA9 A;  3SEU A;  2XXY A;  2DWH A;  3SEY A;  1B5I A;  3H3G A;  1N3W A;  4LZ8 A;  1UTB A;  1VFE A;  2PVU A;  3K00 A;  5DEX A;  2I58 A;  5EHS A;  1B6H A;  3OEM A;  4IB2 A;  3PUW E;  1NL5 A;  1MH4 A;  4KPT A;  3PUX E;  4FE8 A;  4GF8 A;  4PFY A;  4Z7E A;  3IOW A;  3IOV A;  1NNP A;  1MXU A;  1FTL A;  1SD3 A;  5TPA A;  2XX7 A;  3ECR A;  5CM6 A;  1FQE A;  1D9Y A;  2XXQ A;  1A7L A;  2H25 A;  4M1V A;  2XX9 A;  3TPA A;  4G68 A;  3PU5 A;  2XXV A;  3FGS A;  3OSR A;  1SW5 A;  1XVY A;  2F7B A;  4U21 A;  4FED A;  4JB7 A;  4OEN A;  3O6G A;  4GFR A;  1MXY A;  4G8M A;  4EF1 A;  2R71 A;  1QUK A;  3QUJ A;  3MAM A;  3G3H A;  1FTK A;  2M8C A;  3KZG A;  3JV9 A;  3JYR A;  5I56 A;  2Z22 A;  3OMB A;  3OXN A;  3VXB A;  3K6W A;  4PFT A;  3T66 A;  3PPN A;  1I6B A;  5CMK A;  2THI A;  2REG A;  2F36 A;  2PX1 A;  1VSO A;  4NTL A;  2O7I A;  4GD5 A;  1LBB A;  4ZED A;  4F1V A;  3C4M A;  1JVY A;  1IUD A;  3BFU A;  3RN8 A;  2DVZ A;  2H98 A;  2V3T A;  5CC2 A;  1XT8 A;  1B3H A;  2I0B A;  2XXP A;  3TEP A;  4I9D A;  1LBC A;  1WOD A;  2AYS A;  1LAG E;  4NED A;  5TP9 A;  2Q2A A;  2HXW A;  3SKP A;  1T0K A;  5I2N B;  3FUZ A;  3PPO A;  4OTE A;  4KQP A;  4YB5 A;  3MP1 A;  2I0C A;  3T96 B;  2O68 A;  4E0X A;  3IO4 A;  3LC8 A;  1BTJ A;  1JW1 A;  3SDF A;  2P2A A;  1ZU0 A;  4LQ5 A;  4Q8R A;  1MG1 A;  4DZ1 A;  1LB9 A;  1ZMG A;  2Z8F A;  4RPO A;  2ZMB A;  3K01 A;  3EF7 A;  1AL3 A;  5I59 B;  5JTY B;  3UK4 A;  4N6P A;  4WEP A;  3VVD A;  5DTB A;  2I4B A;  3I5O A;  3D4G A;  1FCK A;  1B40 A;  2F78 A;  3SEX A;  4DE8 A;  3TAJ A;  2O51 A;  1JW5 A;  4RK2 A;  1OQG A;  3B6Q A;  4P11 A;  2UYE A;  3TOD A;  1XHY A;  4G8N A;  1AOV A;  5I57 A;  3IAZ A;  2F97 A;  4H5G A;  2PMS A;  2ANJ A;  1MY1 A;  4ZE8 A;  1B9J A;  4QHQ A;  1LFI A;  4IO7 A;  2V3U A;  3MP8 A;  5CRY A;  5ITO A;  5CMB A;  4HCW A;  4Q0C A;  3KOS A;  1Y3P A;  3PUZ E;  1SI1 A;  2UVG A;  3CFX A;  4Z0I A;  1LGB C;  1BIY A;  3S9L C;  3MW0 A;  1B32 A;  4G68 C;  3PUY E;  1FQB A;  4QFL A;  4N07 A;  1MXV A;  3CVG A;  3IX1 A;  4OEV A;  4QSE A;  2LAO A;  5H8F B;  1HSE A;  1TFA A;  3DP8 A;  3CG3 A;  2D21 A;  3KGC A;  3I3V A;  2V25 A;  4OFO A;  3KG2 A;  2UYF A;  3DEL B;  1JW4 A;  3T9X B;  5HM4 B;  2REJ A;  4KCD A;  1OVB A;  5IKB A;  4LZ7 A;  4R73 A;  1IXG A;  1MQI A;  1HSL A;  2QS2 A;  5AA3 A;  2HCA A;  2GH9 A;  5H8N B;  4F3B A;  5KCJ A;  1NNF A;  3TFL A;  4RY1 A;  3CI8 A;  2DXY A;  2CZL A;  3FZV A;  4AB5 A;  5CMC A;  4QFP A;  4AB6 A;  1NFT A;  1JEU A;  1SI0 A;  4GL0 A;  3MZ1 A;  2ZYM A;  1B0H A;  1JNF A;  3A3C A;  4NWC A;  4EUO A;  1QW0 A;  2DSF A;  4ND9 A;  1DTG A;  2W7Y A;  2V3Q A;  1DSN A;  3N94 A;  3MBP A;  4OVJ A;  2VOZ A;  2HAU A;  3OD7 A;  3U8Q A;  3HCQ A;  1FQF A;  3KJT A;  3FXR A;  1P1W A;  1USY H;  4EXL A;  1MPB A;  3K6U A;  2DYX A;  4YB6 A;  2Q88 A;  4H0W A;  1EH3 A;  3QXM A;  1MDP 1;  4H6D A;  3UN6 A;  3MZ9 A;  1QUI A;  1ZKB A;  1B5J A;  1B46 A;  3U72 A;  4POX A;  2XX8 A;  1P1O A;  1B3G A;  5KDT B;  4POW A;  4UA8 A;  1B3E A;  4F18 A;  2ESN A;  4Q30 B;  1VFD A;  1B7H A;  2OLB A;  4DXB A;  4MBP A;  3SET A;  3KBR A;  4KI0 E;  3RUM A;  5ICQ A;  2HEU A;  1TXF A;  1VE4 A;  1TT1 A;  1ZIU A;  2P0S A;  3TMG A;  2RC8 A;  1JEV A;  5AA4 B;  2VHA A;  1D4N A;  3RT8 A;  4YB7 A;  2RC9 A;  5F1Q A;  3M8U A;  3CFZ A;  4DXC A;  1POT A;  1B5H A;  4NF6 A;  1A8F A;  3CSB A;  5K2Y A;  1MXZ A;  1SBP A;  5M2V A;  4HS7 A;  5I58 A;  5F7V A;  3IK6 B;  1ANF A;  1MQD A;  3RGY A;  1PBP A;  3TDJ A;  3MPL A;  1MM7 A;  4R2B A;  5FHN A;  1ELJ A;  2ONS A;  3RQT A;  2H9B A;  3LSX A;  4R6K A;  2O6A A;  4R72 A;  3TTL A;  2Q9T A;  3S9E A;  4X1B A;  1OQH A;  3C35 A;  2DWJ A;  3GXA A;  5H8Q B;  4HW8 A;  1B7Z A;  1QKB A;  2ZNU A;  1SW1 A;  4KHZ E;  1TFD A;  2D5W A;  3K6V A;  1USY E;  3PMV A;  2DE4 A;  1GR2 A;  2ALU A;  5B70 A;  1MM6 A;  2Z8E A;  4AQ4 A;  3OO7 A;  5JEI A;  2ZXT A;  2X26 A;  3GLB A;  2UVI A;  3KSJ A;  1I6A A;  5CMM A;  1DMB A;  4R74 A;  2HAV A;  3K2D A;  1IQ7 A;  3B6T A;  3MWB A;  4JXI A;  3BFT A;  4PE5 B;  3O2A A;  3ODB A;  1P99 A;  4KYE A;  4TQU Q;  4FAT A;  3ZSF A;  4XKQ A;  3ZS6 A;  1MY0 A;  4GIZ A;  4ELR A;  4GVO A;  2RCA A;  3KFM A;  4LP2 B;  3ZKK A;  1I6Q A;  2RF1 A;  3IO6 A;  1B05 A;  4ZS9 A;  3LUY A;  4IO4 A;  3Q26 A;  4ISU A;  1BKA A;  1H43 A;  4P0I A;  5L9M A;  1H44 A;  4C1T A;  4ZEF A;  3RPW A;  2QJE A;  1URS A;  3QSL A;  4C0R A;  5A5X A;  4PP0 A;  2XXW A;  3IB0 A;  1D3K A;  2F7C A;  4RYA A;  2AIX A;  1UTH B;  3KN7 A;  4G4P A;  4O3C A;  2O7U A;  5ELV A;  4ESX A;  4PET A;  1Y4C A;  1R6Z A;  2RIN A;  3GBA A;  4THI A;  2XHD A;  3JZJ A;  2Z8D A;  4F29 A;  5H8H A;  3VLW A;  2DS9 A;  3MC2 A;  3O6H A;  1F9B A;  3TKD A;  2H99 A;  3TCG A;  4YKK A;  3I6V A;  4UAC A;  4RK9 A;  4GOT A;  1N84 A;  4GQO A;  4F2Q A;  1WDN A;  1LAX A;  2YJP A;  1B51 A;  3LSW A;  4R75 A;  4YU0 A;  4YIC A;  2G93 A;  1AMF A;  2XXI A;  3G3I A;  2F34 A;  1DPP A;  3Q29 A;  1NKX A;  1N04 A;  1P1U A;  1Y4T A;  2UXA A;  1FW0 A;  2H5Y A;  4NF4 B;  3MVY A;  1AIV A;  4KYD A;  2XXU A;  2DP8 A;  3EN3 A;  1N76 A;  1ZLQ A;  1B58 A;  4OET A;  1B52 A;  5AA2 A;  3FVG A;  4BLA A;  3OEL A;  2YLN A;  5DVI A;  5I2K B;  4G2Z A;  3MVW A;  4XKR A;  1H76 A;  3RTW B;  4ZDM A;  1CB6 A;  3W9V A;  4NF8 A;  2I6E A;  3H4Z A;  5DT6 A;  4I8C A;  3H03 A;  2VGQ A;  2F8D A;  2Y7W A;  1LST A;  4JWX A;  2NOO A;  3N6T A;  1N7W A;  1XVX A;  3IJO B;  4GXS B;  1M5F A;  4KYS A;  4MF3 A;  2R9J A;  1RYO A;  2RCB A;  2DE3 A;  5J1D A;  2GHA A;  2G29 A;  5EYF A;  3IOU A;  3H6T A;  2NUV A;  2O69 A;  1QJM A;  4MLQ A;  3HST A;  4HTG A;  4LON B;  4IO2 A;  3MPK A;  3SEV A;  3CRB A;  3W9W A;  2E1S A;  2QPQ A;  3S9N C;  2B3B A;  4XTC Q;  2CMO A;  1UIV A;  2Q89 A;  3PPR A;  4DXU A;  1US4 A;  1MY3 A;  5K2X A;  3VVE A;  1XS5 A;  5L9S A;  3ZKL A;  4IO6 A;  1O7T A;  3PV0 E;  3G3K A;  5AA1 A;  1LLS A;  2B3F A;  1QUJ A;  3N26 A;  4JDF A;  1IXI A;  1NNK A;  1XC1 A;  3S4U A;  1MY2 A;  4OMB A;  4NF5 B;  1I69 A;  4LZ5 A;  3SEW A;  1M5C A;  3DLN A;  4LVQ A;  2A5T B;  3O97 A;  1MQG A;  1DPE A;  4F2O A;  1PDA A;  3TTK A;  1LAF E;  1J1N A;  2ZNS A;  4BDQ A;  2QSX A;  4GRK A;  4ZEI A;  1JQF A;  2A5S A;  3VV5 A;  3RT6 B;  4Q5T A;  1BLF A;  4OHN A;  1FTO A;  2HZL A;  3QIM A;  3QYT A;  1GV8 A;  3T9H B;  4ZEC A;  5FTI A;  4OER A;  1FQC A;  4WXJ A;  1LCT A;  3N5L A;  2OJT A;  2NXO A;  2Q2C A;  1M5D A;  3P7I A;  1N3X A;  5EHM A;  3RTF B;  3C32 A;  3O66 A;  1TWY A;  4H1X A;  4YAH X;  4G77 A;  1UTB B;  3E3K A;  4ELP A;  4YMB A;  5DEX B;  1PBQ A;  3L6G A;  5BWJ A;  5KZT A;  3E4R A;  3O29 A;  4O3B A;  1B7U A;  3IOT A;  4R6H A;  3USD A;  4MH5 A;  4OQO A;  3EHU A;  2V93 A;  3T22 A;  4L17 A;  1B2H A;  3DP4 A;  2NVU B;  5I84 A;  1CE2 A;  3Q28 A;  5FTH A;  2O84 X;  3K02 A;  3VLV A;  1VR5 A;  5TPA B;  4LAT A;  1POY 1;  3UGW A;  3TZA A;  4WED A;  2HQ0 A;  4EQ7 A;  3UA8 A;  1YCJ A;  3FV2 A;  3T93 B;  4ECF A;  2QL3 A;  3TQL A;  3G3G A;  5A5X B;  4F22 A;  4G68 B;  1IIT A;  5BUU A;  2XD2 A;  2I3W A;  3EHS A;  1Y1M A;  2PT2 A;  5I2N A;  1B3L A;  1US5 A;  3HHG A;  4YMA A;  1FTJ A;  4OZ9 A;  4EQB A;  1ATG A;  3PPQ A;  2F35 A;  3D4C A;  4DCX A;  1N7X A;  1BP5 A;  3KN3 A;  3CG1 A;  4OEU A;  2AL5 A;  4IO3 A;  4BDR A;  3IR1 A;  2GRV A;  3FV1 A;  2QMW A;  4QFO A;  1GTK A;  2YPN A;  4H5F A;  4TLL B;  3U92 A;  4YZZ A;  1JVX A;  2XD3 A;  1OIB A;  3Q27 A;  4BDL A;  3VVF A;  3C33 A;  3H6W A;  4F3P A;  1OMP A;  1H45 A;  1Q1K A;  5I56 B;  2OZZ A;  5CBR A;  2ZNT A;  3E13 X;  1QUL A;  3LR1 A;  1R1N A;  5I59 A;  5JTY A;  2P1S A;  3RLF E;  2Y7K A;  4P0G A;  5DVF A;  4QRZ A;  4OES A;  4F19 A;  4O3A A;  3M3L A;  1H3D A;  4NE4 A;  4XXU A;  2OK2 A;  4IGT A;  4WKM A;  4E0W A;  2IA4 A;  3R7X A;  3THI A;  4U4X A;  3TYH A;  4C1U A;  3TTN A;  3VXC A;  3HV1 A;  3BBR A;  1Y9U A;  1A99 A;  1Q35 A;  2Y84 A;  3O9P A;  3FJM A;  2FNC A;  3OSQ A;  1LFH A;  1B4H A;  1MRP A;  5TP9 B;  3TCH A;  3R26 A;  3ILU B;  3MUQ A;  3H06 B;  3WAF A;  3HO7 A;  3OEN A;  4GXA A;  2I48 A;  3OO8 A;  4EXK A;  2X7P A;  3M3K A;  1PEB A;  2XXX A;  3FAT A;  1OLA A;  3KOT A;  3EQ1 A;  5H8S A;  5H8F A;  3TUS A;  3HPI A;  3VE1 B;  4RPN A;  1ZTY A;  3W15 C;  1IXC A;  1PB9 A;  2HZK A;  1Y20 A;  2F5X A;  3A3U A;  1S9T A;  3F11 A;  4IGR A;  1A55 A;  5CBS A;  4MFI A;  3LSF B;  2DOJ A;  4JSD A;  3H7M A;  4BDM A;  3QK6 A;  1DTZ A;  1IZ1 A;  3ONM A;  3ILT B;  2UVJ A;  4IY6 A;  4BDO A;  1MY4 A;  4RA1 A;  1MXX A;  3TTR A;  2IEE A;  1UIU A;  4KD5 A;  4N13 A;  5H8N A;  4NMY A;  4X48 A;  1B1H A;  1MPC A;  1SYI A;  3V5A A;  2ZYK A;  1IIW A;  1MPD A;  2R6G E;  3RY3 A;  3RNN A;  4XKP A;  3VDF A;  5ISU A;  4FOR A;  4F3G A;  5I57 B;  4F1U A;  2KLF A;  4ZEK A;  3OOA A;  4R6Y A;  4JBZ A;  2WKY A;  3C31 A;  1MS7 A;  1WVJ A;  3K1P A;  4MLV A;  4NWD A;  2H4I A;  4ELO A;  3PMX A;  4EDP A;  1EZ9 A;  3PD8 A;  3R6U A;  1D9V A;  1MH3 A;  4OWD A;  1AH5 A;  1M5B A;  2Y7I A;  3IOR A;  1ZJL A;  2D3I A;  3K1N A;  4FJP A;  3H6V A;  4PFW A;  2DVC A;  3KJ7 A;  3FJ7 A;  4QSC A;  5KDT A;  3T9U A;  1A40 A;  4OYV A;  3FAS A;  2RKM A;  2Y7R A;  4LUB A;  3M3F A;  4ZE9 A;  3LSL A;  1N0T A;  1FQD A;  3CFL A;  2HFB A;  3S2V A;  1L5T A;  3G3F A;  4I1D A;  4X9T A;  5CI5 A;  4H8J A;  2DWI A;  4FAJ A;  5AA4 A;  3WAE A;  1LB8 A;  1NH7 A;  1KWH A;  1A54 A;  3SER A;  2XXH A;  4F3S A;  3PPP A;  1FTM A;  2AL4 A;  4U1O A;  1PC3 A;  3V8X B;  2XXR A;  2O1M A;  2GFE A;  3FVO A;  3H6U A;  5KCJ B;  3G7W A;  1EZO A;  2ZYO A;  3UP9 A;  3FJG A;  1Y1Z A;  4JSO A;  2QS4 A;  1OLC A;  3DP6 A;  1SDX A;  1SYH A;  3CSG A;  2OCU A;  5H8Q A;  3V89 B;  4H65 A;  5JK4 A;  1NMU A;  3FIR A;  3BKI B;  2Q8J A;  4ONY A;  3U94 A;  2ONK E;  3KEI A;  1EU8 A;  3K0V A;  1FQA A;  3QUF A;  3VLU A;  1O63 A;  2VD3 A;  4R9F A;  4K3F A;  2OWT A;  2QS1 A;  2Z23 A;  2Y7P A;  4XKN A;  3G3J A;  5L9O A; 
#chains in the Genus database with same CATH topology
 1INP A;  5DVJ A;  3MQ9 A;  1Z7N E;  1B3F A;  3IL1 B;  4M4G A;  3OO9 A;  2DQV A;  3EPE A;  5EYG A;  5FHM A;  3IB1 A;  4MJO A;  3LBS A;  3FVN A;  1R9Q A;  3E9X A;  3IB2 A;  3HHF A;  3PMW A;  1RKM A;  2GHB A;  4NF6 B;  1Z7M E;  1ZBM A;  1SVX B;  3A09 A;  3FD3 A;  5I58 B;  1XI6 A;  1S7Y A;  3O28 A;  4OFL A;  4YKP A;  3AXF A;  1YTV A;  1FSA A;  3U1O A;  4XF5 A;  3EHT A;  2V84 A;  4ELQ A;  4OVR A;  5AE4 A;  5ITP A;  1PB8 A;  4XIG Q;  4GLI A;  2QS3 A;  4QFK A;  3B7D A;  3FVK A;  4QSD A;  1UTH A;  5HBC A;  1YAE A;  2RC7 A;  2PT1 A;  1R9L A;  3TTM A;  3UOR A;  3L6H A;  4ESW A;  3PGF A;  1A8E A;  4MNC A;  2VD2 A;  2Q74 A;  2ONR A;  2FYI A;  1NH8 A;  4LN5 A;  4RNS A;  1Y3N A;  4JWO A;  3B6W A;  3PD9 A;  1MXW A;  2UVH A;  4JWY A;  4PDH A;  1MQH A;  4DCY A;  1EZP A;  4EF2 A;  5TU0 A;  4TOZ A;  4H8I A;  5HPQ A;  3S9M C;  1URG A;  4NAP A;  4FEB A;  1PB7 A;  1IXH A;  1LAH E;  3MVX A;  1DOT A;  2DWA A;  4IY5 A;  2F6G A;  4I62 A;  2F7A A;  4G8H A;  4GWO A;  3T9V A;  1K9Z A;  4F39 A;  3GBB A;  3RPL B;  3K4U A;  4OFJ A;  5L8D A;  4NF4 A;  1SQY A;  1NV1 A;  4PFU A;  1XOC A;  4BDN A;  4U1Z A;  4DLD A;  3Q25 A;  2NWJ A;  2ABH A;  1DK4 A;  1O64 A;  3EKI A;  3SES A;  1B0L A;  5B7D A;  2XWV A;  4FIM A;  1YPN A;  3QAX A;  1HSJ A;  1D9Q A;  3C36 A;  3FXQ A;  4PQJ A;  3HN0 A;  5I2K A;  1LCF A;  3PUV E;  2CEX A;  2DE2 A;  4ZZA A;  1LBV A;  1P1Q A;  4YKJ A;  4GL8 A;  2XWO A;  2OWS A;  5I7I A;  4U2R A;  4X1D A;  2B4L A;  4U22 A;  1OVT A;  2CZI A;  4TLM B;  1LFG A;  3TEL A;  2XXK A;  4R2F A;  4QF9 A;  3U93 A;  3MJN A;  3CIJ A;  1S50 A;  4F1Y A;  2DXR A;  3UIF A;  2XXT A;  4DDD A;  5H8H B;  1URD A;  5ET6 A;  4KFQ A;  3C34 A;  5FHO A;  4FEC A;  4HCY A;  5ET8 A;  2B65 A;  3DM0 A;  2I49 A;  3VFJ A;  4EQ9 A;  1QVS A;  4LQ2 A;  3N6U A;  1LBY A;  4OVP A;  3KN8 A;  3MVZ A;  1MDQ A;  4RJZ A;  2QRY A;  1SW4 A;  2X7Q A;  4X8R A;  4R9G A;  4I3Y A;  2PYY A;  2WBB A;  4HE1 A;  4KR5 A;  4IO5 A;  4OXV A;  3C9H A;  3FXU A;  5AA2 D;  1RYX A;  3K1M A;  1M5E A;  4F31 B;  4O8M A;  2QVR A;  5IAI A;  4N91 A;  3CR9 A;  3IJX B;  2BJJ X;  1IEJ A;  1MQJ A;  4N15 A;  4DIG A;  2OBG A;  4QFN A;  5I3S A;  5ICT A;  4H67 A;  3TQW A;  2FA7 A;  3KSX A;  1SW2 A;  3OEK A;  2E0S A;  1FJ6 A;  2I3V A;  5DYH A;  2VPN A;  4U23 A;  2O1L A;  1JET A;  3TCF A;  4NF5 A;  5LOM A;  2ZYN A;  3V83 A;  5AA2 B;  1NV2 A;  2A5T A;  4JVI A;  4ZZE A;  1P1N A;  3OO6 A;  1UQW A;  4ZEB A;  4NF8 B;  1QKA A;  4PGP A;  3O6I A;  2FBP A;  2QMX A;  2I4C A;  1GGG A;  2F6P A;  4GWZ A;  4GWS A;  3MP6 A;  2F3B A;  1II5 A;  4RXL A;  2Y5K A;  4P56 A;  1Y3Q A;  3MZB A;  1GVC A;  2PBW A;  3K6X A;  4KCC A;  1B1X A;  1AWB A;  1B4Z A;  3GZG A;  4U4S A;  2P3N A;  4NN3 A;  1NNT A;  4YKI A;  2VP1 A;  4LA9 A;  3SEU A;  2XXY A;  2DWH A;  3SEY A;  1B5I A;  3H3G A;  1N3W A;  4LZ8 A;  4GX4 A;  4QBA A;  1UTB A;  1VFE A;  5EQ7 A;  2PVU A;  4I40 A;  3K00 A;  5DEX A;  2I58 A;  5EHS A;  2ZZW A;  1B6H A;  3OEM A;  1LBW A;  4H46 A;  4IB2 A;  3PUW E;  1NL5 A;  1MH4 A;  4KPT A;  2MKZ A;  3PUX E;  4FE8 A;  4GF8 A;  4PFY A;  4Z7E A;  5EQ9 A;  3IOW A;  3IOV A;  1NNP A;  1MXU A;  4MNI A;  1FTL A;  1SD3 A;  4NG7 A;  5TPA A;  2XX7 A;  3ECR A;  1FBH A;  5CM6 A;  1FQE A;  1D9Y A;  2XXQ A;  1A7L A;  2H25 A;  4M1V A;  1YZ0 A;  2XX9 A;  3TPA A;  3GYY A;  4G68 A;  3PU5 A;  2XXV A;  3FGS A;  3OSR A;  4N8Y A;  1SW5 A;  1FPK A;  1XVY A;  2F7B A;  4U21 A;  4FED A;  4JB7 A;  4OEN A;  3O6G A;  4GFR A;  1MXY A;  4G8M A;  4EF1 A;  1RDZ A;  2B4M A;  2R71 A;  1QUK A;  3QUJ A;  3KBZ A;  3MAM A;  3G3H A;  1FTK A;  2M8C A;  3KZG A;  3JV9 A;  3JYR A;  4O7M A;  5I56 A;  2Z22 A;  3OMB A;  3OXN A;  3VXB A;  3K6W A;  4PFT A;  3T66 A;  3PPN A;  1I6B A;  4NGU A;  5CMK A;  2THI A;  2REG A;  1BK4 A;  2F36 A;  2PX1 A;  1VSO A;  4NTL A;  2O7I A;  4GD5 A;  1LBB A;  2CZK A;  1LBZ A;  4NF0 A;  4PTK A;  4ZED A;  4F1V A;  4OVQ A;  3C4M A;  1JVY A;  1IUD A;  3BFU A;  3RN8 A;  2DVZ A;  2H98 A;  2V3T A;  2BJI A;  2PFY A;  5CC2 A;  1XT8 A;  1B3H A;  2I0B A;  2XXP A;  3ROJ A;  3TEP A;  4I9D A;  1LBC A;  1EYJ A;  4NHB A;  1WOD A;  2AYS A;  4GX3 A;  4HXV A;  1LAG E;  3PTY A;  4NED A;  3HFU A;  5TP9 A;  4AS5 A;  2Q2A A;  2HXW A;  3SKP A;  4UAB A;  1T0K A;  5I2N B;  3FUZ A;  3PPO A;  4OTE A;  4KQP A;  4YB5 A;  3MP1 A;  2I0C A;  3T96 B;  2O68 A;  4E0X A;  3IO4 A;  1NI9 A;  1IME A;  3LC8 A;  1BTJ A;  1JW1 A;  3SZP A;  3SDF A;  2P2A A;  4GWW A;  5I5P A;  1ZU0 A;  4LQ5 A;  4Q8R A;  1MG1 A;  4DZ1 A;  1LB9 A;  1ZMG A;  1FBE A;  5EYH A;  4MHF A;  1DBZ A;  2Z8F A;  4RPO A;  2ZMB A;  2HXR A;  2CZH A;  3K01 A;  3EF7 A;  4PDD A;  1AL3 A;  5I59 B;  5JTY B;  3UK4 A;  4N6P A;  4WEP A;  3VVD A;  5DTB A;  2I4B A;  3I5O A;  3D4G A;  1FCK A;  1B40 A;  2F78 A;  3SEX A;  4DE8 A;  3TAJ A;  2O51 A;  4OAN A;  1JW5 A;  4RK2 A;  1OQG A;  3B6Q A;  4P11 A;  2UYE A;  3TOD A;  2V4C A;  1XHY A;  1NV6 A;  4G8N A;  1AOV A;  5I57 A;  3IAZ A;  2F97 A;  4H5G A;  2PMS A;  2ANJ A;  1MY1 A;  4ZE8 A;  1B9J A;  4QHQ A;  2XWI A;  1LFI A;  4IO7 A;  2V3U A;  1NV3 A;  3MP8 A;  5CRY A;  5ITO A;  5CMB A;  4HCW A;  4Q0C A;  3KOS A;  4MCO A;  1JP4 A;  1Y3P A;  3PUZ E;  4N8G A;  1SI1 A;  2UVG A;  3CFX A;  4Z0I A;  4OVS A;  1LGB C;  1BIY A;  3S9L C;  3MW0 A;  4MEV A;  1B32 A;  4G68 C;  3PUY E;  1FQB A;  4QFL A;  4N07 A;  4P8B A;  1MXV A;  3CVG A;  3IX1 A;  4NQ8 A;  1EYI A;  4OEV A;  4QSE A;  2LAO A;  5H8F B;  1HSE A;  1TFA A;  3DP8 A;  3CG3 A;  2D21 A;  3KGC A;  3I3V A;  2V25 A;  4OFO A;  3KG2 A;  4XEQ A;  2UYF A;  3DEL B;  1JW4 A;  4N6K A;  1FPF A;  3T9X B;  5HM4 B;  2REJ A;  4KCD A;  1OVB A;  5IKB A;  4LZ7 A;  4R73 A;  1IXG A;  1MQI A;  3D1R A;  3IFA A;  1HSL A;  4P47 A;  2QS2 A;  5AA3 A;  2HCA A;  4IR8 A;  2GH9 A;  5H8N B;  4H45 A;  4F3B A;  1VDW A;  5KCJ A;  1NNF A;  3TFL A;  4RY1 A;  3CI8 A;  2DXY A;  2CZL A;  3FZV A;  4AB5 A;  5CMC A;  4QFP A;  4AB6 A;  1IMC A;  1NFT A;  1JEU A;  1SI0 A;  4GL0 A;  3MZ1 A;  2ZYM A;  1B0H A;  1JNF A;  3A3C A;  4NWC A;  4O94 A;  1QW0 A;  4EUO A;  2DSF A;  2FIE A;  4ND9 A;  1DTG A;  2W7Y A;  2V3Q A;  1DSN A;  3N94 A;  3MBP A;  4OVJ A;  2VOZ A;  3BIH A;  5IZ3 A;  2HAU A;  3OD7 A;  3U8Q A;  4GWX A;  3HCQ A;  1FQF A;  3KJT A;  3FXR A;  1P1W A;  1USY H;  4EXL A;  1MPB A;  4MMP A;  3K6U A;  2DYX A;  4YB6 A;  2JJK A;  2Q88 A;  4H0W A;  1EH3 A;  3QXM A;  1MDP 1;  4H6D A;  3UN6 A;  3MZ9 A;  1QUI A;  1ZKB A;  1B5J A;  1B46 A;  3U72 A;  4POX A;  2XX8 A;  1P1O A;  2ZZV A;  1B3G A;  5KDT B;  1KA0 A;  4POW A;  4UA8 A;  1B3E A;  4F18 A;  2ESN A;  4Q30 B;  1VFD A;  1FPL A;  5ET5 A;  1B7H A;  2OLB A;  4DXB A;  4MBP A;  4PC9 A;  3SET A;  4PCD A;  4GBW A;  3KBR A;  4KI0 E;  3RUM A;  5ICQ A;  3MST A;  2HEU A;  1TXF A;  1VE4 A;  1TT1 A;  1ZIU A;  2P0S A;  3TMG A;  2RC8 A;  1JEV A;  5AA4 B;  2VHA A;  1D4N A;  3RT8 A;  4YB7 A;  2RC9 A;  5F1Q A;  3M8U A;  2PCR A;  4O7I A;  3CFZ A;  4DXC A;  3QMF A;  1POT A;  1B5H A;  1FPB A;  4NF6 A;  1A8F A;  3CSB A;  5K2Y A;  1MXZ A;  1SBP A;  4I3E A;  5M2V A;  4QXD A;  4HS7 A;  5I58 A;  5F7V A;  3IK6 B;  1ANF A;  1MQD A;  3RGY A;  1LBX A;  1PBP A;  2FHY A;  3TDJ A;  3MPL A;  1MM7 A;  4R2B A;  2HPG A;  1ELJ A;  5FHN A;  2ONS A;  5T3J A;  2H9B A;  3RQT A;  3LSX A;  4R6K A;  2O6A A;  4R72 A;  1IMF A;  3TTL A;  2Q9T A;  3S9E A;  4PAK A;  1FPE A;  4X1B A;  1OQH A;  3C35 A;  1FJ9 A;  2DWJ A;  3GXA A;  5H8Q B;  4HW8 A;  1B7Z A;  1QKB A;  2CEY A;  2ZNU A;  1SW1 A;  4KHZ E;  1TFD A;  2D5W A;  3K6V A;  1USY E;  3PMV A;  2DE4 A;  1GR2 A;  2ALU A;  5B70 A;  1MM6 A;  1IMB A;  2Z8E A;  4N81 A;  4PAF A;  3NOH A;  5DW8 A;  4AQ4 A;  3OO7 A;  5JEI A;  2ZXT A;  2X26 A;  2XWK A;  3GLB A;  2UVI A;  3KSJ A;  1I6A A;  5CMM A;  1DMB A;  4R74 A;  2HAV A;  3K2D A;  1IQ7 A;  3B6T A;  3MWB A;  4JXI A;  3BFT A;  4PE5 B;  3O2A A;  3ODB A;  1P99 A;  4KYE A;  4TQU Q;  2FIX A;  4FAT A;  3RPL A;  3ZSF A;  4XKQ A;  3ZS6 A;  1MY0 A;  4GIZ A;  4HE2 A;  1LEV A;  4ELR A;  4GVO A;  5IGA A;  2RCA A;  3KFM A;  4LP2 B;  3ZKK A;  1I6Q A;  3B50 A;  2RF1 A;  3IO6 A;  1B05 A;  4ZS9 A;  3LUY A;  4IO4 A;  4GBV A;  3Q26 A;  4P1L A;  4ISU A;  4GWY A;  1BKA A;  1H43 A;  2L5V A;  4P0I A;  3E79 A;  5L9M A;  1H44 A;  3E78 A;  4C1T A;  4ZEF A;  3RPW A;  2QJE A;  1URS A;  3QSL A;  2PFZ A;  4C0R A;  5A5X A;  4PP0 A;  2XXW A;  5EQA A;  3IB0 A;  1D3K A;  2F7C A;  4RYA A;  2AIX A;  1NV7 A;  1DCU A;  1UTH B;  3KN7 A;  3RYD A;  2XA5 A;  4G4P A;  4O3C A;  2O7U A;  5ELV A;  4ESX A;  4PET A;  1Y4C A;  1YXI A;  5LTC A;  1R6Z A;  2RIN A;  3GBA A;  4THI A;  2XHD A;  2WYK A;  3JZJ A;  2Z8D A;  3LV0 A;  4F29 A;  5H8H A;  3VLW A;  2DS9 A;  3MC2 A;  3O6H A;  4PGN A;  1F9B A;  3TKD A;  2H99 A;  3TCG A;  1FTA A;  4YKK A;  3I6V A;  4UAC A;  4RK9 A;  4GOT A;  4N17 A;  1FPI A;  1N84 A;  4GQO A;  4F2Q A;  4XFE A;  1WDN A;  1LAX A;  2YJP A;  1B51 A;  3LSW A;  4R75 A;  4YU0 A;  4N4U A;  4YIC A;  2G93 A;  1AMF A;  2XXI A;  3G3I A;  2F34 A;  1DPP A;  3Q29 A;  2VPO A;  1NKX A;  1N04 A;  1P1U A;  1Y4T A;  2UXA A;  1FW0 A;  2H5Y A;  4NF4 B;  3MVY A;  1AIV A;  4KYD A;  2OX3 A;  2XXU A;  2DP8 A;  3EN3 A;  1N76 A;  1ZLQ A;  1B58 A;  4OET A;  2R8T A;  1B52 A;  5AA2 A;  3FVG A;  4FBP A;  2F3D A;  4BLA A;  3OEL A;  2YLN A;  5DVI A;  5I2K B;  2QVU A;  4G2Z A;  1YYZ A;  3MVW A;  4XKR A;  2KR0 A;  1H76 A;  4MNP A;  3RTW B;  4ZDM A;  1CB6 A;  1EYK A;  3W9V A;  4NF8 A;  2I6E A;  4MIJ A;  3H4Z A;  5DT6 A;  3CHG A;  5IZZ A;  4I8C A;  3H03 A;  2VGQ A;  2F8D A;  3LUZ A;  2Y7W A;  1LST A;  4JWX A;  4P3L A;  2NOO A;  3N6T A;  4PFR A;  1N7W A;  1XVX A;  3IJO B;  4GXS B;  1M5F A;  4KYS A;  4MF3 A;  2R9J A;  2WX9 A;  1RYO A;  2RCB A;  4N6D A;  2DE3 A;  5J1D A;  2GHA A;  2G29 A;  5EYF A;  4OVT A;  3IOU A;  3H6T A;  4PBQ A;  2NUV A;  2O69 A;  1QJM A;  4MLQ A;  4PBH A;  3HST A;  4HTG A;  4LON B;  4IO2 A;  3MPK A;  3SEV A;  3CRB A;  4PF6 A;  2E1S A;  3W9W A;  2QPQ A;  3S9N C;  2B3B A;  4XTC Q;  2CMO A;  1FBC A;  1UIV A;  2Q89 A;  2Y5L A;  3PPR A;  4DXU A;  1US4 A;  1MY3 A;  2WBD A;  5K2X A;  3VVE A;  1XS5 A;  5L9S A;  3ZKL A;  4IO6 A;  1O7T A;  3PV0 E;  3G3K A;  5AA1 A;  1LLS A;  2B3F A;  1QUJ A;  3N26 A;  4JDF A;  1IXI A;  1NNK A;  1XC1 A;  3S4U A;  1MY2 A;  4OMB A;  5FBP A;  4NF5 B;  1FBP A;  1I69 A;  4LZ5 A;  3SEW A;  1M5C A;  2WEF A;  3DLN A;  4LVQ A;  2A5T B;  3O97 A;  1MQG A;  1DPE A;  1IMD A;  4F2O A;  1PDA A;  3TTK A;  4NX1 A;  1LAF E;  1J1N A;  4PE3 A;  4JVD A;  2ZNS A;  4BDQ A;  5IZ1 A;  3T1B A;  2QSX A;  4GRK A;  4ZEI A;  1JQF A;  2A5S A;  3VV5 A;  3RT6 B;  4Q5T A;  1BLF A;  4OHN A;  1FTO A;  2Q8M A;  2HZL A;  3QIM A;  3QYT A;  1GV8 A;  3T9H B;  4GX6 A;  4ZEC A;  5FTI A;  4PF8 A;  4AS4 A;  4OER A;  1FQC A;  1NUZ A;  4WXJ A;  3A29 A;  1LCT A;  5ET7 A;  3N5L A;  2OJT A;  2NXO A;  4KXP A;  2Q2C A;  1M5D A;  3P7I A;  1KZ8 A;  1N3X A;  5EHM A;  3RTF B;  3C32 A;  3O66 A;  1TWY A;  4H1X A;  4YAH X;  4G77 A;  1UTB B;  2KQZ A;  3E3K A;  4ELP A;  4YMB A;  5DEX B;  1PBQ A;  3L6G A;  5BWJ A;  5KZT A;  3E4R A;  3O29 A;  4O3B A;  1B7U A;  3IOT A;  4R6H A;  3USD A;  1Q9D A;  3T0J A;  4MH5 A;  3KC0 A;  4OQO A;  3EHU A;  2V93 A;  3BIG A;  3T22 A;  4L17 A;  1B2H A;  4GWU A;  1FPG A;  1G0H A;  3DP4 A;  2NVU B;  5I84 A;  4PAI A;  4DI4 B;  1CE2 A;  3Q28 A;  5FTH A;  2O84 X;  3K02 A;  3VLV A;  1VR5 A;  5TPA B;  4LAT A;  1POY 1;  3UGW A;  3TZA A;  4WED A;  2HQ0 A;  2GQ1 A;  4EQ7 A;  3UA8 A;  1YCJ A;  3FV2 A;  3T93 B;  4ECF A;  1FBD A;  2QL3 A;  3TQL A;  3G3G A;  1FPD A;  5A5X B;  4F22 A;  4G68 B;  1IIT A;  5BUU A;  2XD2 A;  2I3W A;  3EHS A;  1Y1M A;  2PT2 A;  5I2N A;  1NUY A;  1B3L A;  1US5 A;  3HHG A;  4YMA A;  1FTJ A;  2FVZ A;  4OZ9 A;  1ATG A;  1G0I A;  3PPQ A;  4EQB A;  2F35 A;  3D4C A;  4DCX A;  4DI3 D;  1N7X A;  1BP5 A;  3KN3 A;  1NUX A;  3CG1 A;  4OEU A;  2AL5 A;  4IO3 A;  1FRP A;  4P9K A;  4BDR A;  3IR1 A;  2GRV A;  5A5L A;  3FV1 A;  2QMW A;  4QFO A;  1GTK A;  2YPN A;  4H5F A;  2WYP A;  4TLL B;  1QGX A;  3U92 A;  4YZZ A;  1JVX A;  2XD3 A;  1OIB A;  3Q27 A;  4BDL A;  1RDX A;  3VVF A;  3C33 A;  3H6W A;  4F3P A;  1OMP A;  1H45 A;  1Q1K A;  5I56 B;  2OZZ A;  5CBR A;  2ZNT A;  3E13 X;  1QUL A;  3LR1 A;  1R1N A;  5I59 A;  5JTY A;  2P1S A;  3RLF E;  2Y7K A;  4P0G A;  5DVF A;  5J16 A;  4QRZ A;  4OES A;  4F19 A;  2P3V A;  4O3A A;  1FBG A;  1FPJ A;  4MX6 A;  3M3L A;  1H3D A;  1IMA A;  2QVV A;  3MYU A;  4NE4 A;  4XXU A;  2OK2 A;  4IGT A;  4WKM A;  4E0W A;  2IA4 A;  3R7X A;  3THI A;  4U4X A;  3TYH A;  4C1U A;  3TTN A;  3VXC A;  3FBP A;  1CNQ A;  3HV1 A;  3BBR A;  1Y9U A;  4JVC A;  1A99 A;  1Q35 A;  2Y84 A;  3O9P A;  3FJM A;  2FNC A;  3OSQ A;  1LFH A;  1B4H A;  1MRP A;  4PFB A;  5TP9 B;  3TCH A;  3R26 A;  2OWZ A;  3ILU B;  1FBF A;  3MUQ A;  3H06 B;  3WAF A;  3HO7 A;  3OEN A;  4GXA A;  3KC1 A;  2DDK A;  2I48 A;  3OO8 A;  4EXK A;  1NV0 A;  2X7P A;  3M3K A;  1PEB A;  2XXX A;  3FAT A;  1OLA A;  3KOT A;  3EQ1 A;  5H8S A;  5H8F A;  5EQ8 A;  3TUS A;  3HPI A;  3ISP A;  3VE1 B;  4RPN A;  1ZTY A;  3W15 C;  1IXC A;  1PB9 A;  2HZK A;  1Y20 A;  2F5X A;  3A3U A;  1S9T A;  3F11 A;  4IGR A;  1A55 A;  5CBS A;  4MFI A;  3LSF B;  2DOJ A;  4PFI A;  4JSD A;  3H7M A;  4BDM A;  4HE0 A;  3QK6 A;  2ZZX A;  1DTZ A;  1IZ1 A;  3ONM A;  3ILT B;  2UVJ A;  4IY6 A;  4BDO A;  4P1E A;  4OA4 A;  1MY4 A;  4RA1 A;  1MXX A;  3TTR A;  2IEE A;  1UIU A;  4KD5 A;  4N13 A;  5H8N A;  4NMY A;  4X48 A;  1B1H A;  1MPC A;  1SYI A;  3V5A A;  2ZYK A;  1IIW A;  1MPD A;  2R6G E;  3RY3 A;  3RNN A;  4XKP A;  2QFL A;  3VDF A;  5ISU A;  4FOR A;  4G61 A;  4F3G A;  5LDZ A;  5I57 B;  4F1U A;  2KLF A;  4ZEK A;  3OOA A;  4R6Y A;  4JBZ A;  2WKY A;  3C31 A;  1MS7 A;  1WVJ A;  3K1P A;  4MLV A;  4NWD A;  2H4I A;  4ELO A;  3PMX A;  4EDP A;  1EZ9 A;  3PD8 A;  3R6U A;  1D9V A;  1MH3 A;  4OWD A;  1AH5 A;  1M5B A;  2Y7I A;  3IOR A;  1ZJL A;  2D3I A;  3K1N A;  4FJP A;  3H6V A;  4PFW A;  2DVC A;  3KJ7 A;  3FJ7 A;  4QSC A;  5KDT A;  3T9U A;  1A40 A;  4OYV A;  3FAS A;  2RKM A;  3B8B A;  2Y7R A;  4LUB A;  3M3F A;  4ZE9 A;  2HHM A;  3LSL A;  1N0T A;  1FQD A;  3CFL A;  2HFB A;  3S2V A;  1L5T A;  3G3F A;  4I1D A;  4X9T A;  5CI5 A;  4H8J A;  3FXB A;  2DWI A;  4FAJ A;  5AA4 A;  3IFC A;  3WAE A;  1LB8 A;  1NH7 A;  1KWH A;  1A54 A;  3SER A;  1K9Y A;  2XXH A;  4F3S A;  3PPP A;  1FTM A;  2AL4 A;  4U1O A;  1PC3 A;  3V8X B;  2XXR A;  2O1M A;  2GFE A;  3FVO A;  1SPI A;  4X04 A;  3H6U A;  5KCJ B;  3G7W A;  1EZO A;  2VT5 A;  2ZYO A;  3UP9 A;  3FJG A;  1Y1Z A;  1NV4 A;  4JSO A;  2QS4 A;  1OLC A;  3DP6 A;  1SDX A;  1SYH A;  4MAG A;  3CSG A;  1KA1 A;  2OCU A;  5H8Q A;  3V89 B;  5IZ3 B;  4H65 A;  5JK4 A;  1NMU A;  5ESY A;  3FIR A;  3BKI B;  3U65 A;  2Q8J A;  4ONY A;  3U94 A;  2ONK E;  3KEI A;  1EU8 A;  1NUW A;  3K0V A;  1FQA A;  3QUF A;  3VLU A;  1O63 A;  1RDY A;  2VD3 A;  4R9F A;  4K3F A;  2OWT A;  5F24 A;  2QS1 A;  5IM2 A;  2Z23 A;  2Y7P A;  4XKN A;  3G3J A;  5L9O A;  1NV5 A; 
#chains in the Genus database with same CATH homology
 5DVJ A;  3MQ9 A;  1Z7N E;  1B3F A;  3IL1 B;  4M4G A;  3OO9 A;  2DQV A;  3EPE A;  5FHM A;  3IB1 A;  3LBS A;  3FVN A;  1R9Q A;  3E9X A;  3IB2 A;  3HHF A;  3PMW A;  1RKM A;  2GHB A;  4NF6 B;  1Z7M E;  1ZBM A;  1SVX B;  3A09 A;  3FD3 A;  5I58 B;  1S7Y A;  3O28 A;  4OFL A;  4YKP A;  3AXF A;  1YTV A;  3U1O A;  3EHT A;  2V84 A;  4ELQ A;  5AE4 A;  5ITP A;  1PB8 A;  4XIG Q;  4GLI A;  2QS3 A;  4QFK A;  3B7D A;  3FVK A;  4QSD A;  1UTH A;  5HBC A;  1YAE A;  2RC7 A;  2PT1 A;  1R9L A;  3TTM A;  3UOR A;  3L6H A;  4ESW A;  3PGF A;  1A8E A;  2VD2 A;  2ONR A;  2FYI A;  1NH8 A;  4RNS A;  1Y3N A;  4JWO A;  3B6W A;  3PD9 A;  1MXW A;  2UVH A;  4JWY A;  1MQH A;  4DCY A;  1EZP A;  4EF2 A;  5TU0 A;  4TOZ A;  4H8I A;  5HPQ A;  3S9M C;  1URG A;  4FEB A;  1PB7 A;  1IXH A;  1LAH E;  3MVX A;  1DOT A;  2DWA A;  4IY5 A;  2F6G A;  4I62 A;  2F7A A;  4G8H A;  4GWO A;  3T9V A;  4F39 A;  3GBB A;  3K4U A;  4OFJ A;  5L8D A;  4NF4 A;  1SQY A;  4PFU A;  1XOC A;  4BDN A;  4U1Z A;  4DLD A;  3Q25 A;  2NWJ A;  2ABH A;  1O64 A;  3SES A;  1B0L A;  5B7D A;  4FIM A;  1YPN A;  3QAX A;  1HSJ A;  3C36 A;  3FXQ A;  4PQJ A;  3HN0 A;  5I2K A;  1LCF A;  3PUV E;  2DE2 A;  4ZZA A;  1P1Q A;  4YKJ A;  4GL8 A;  2OWS A;  4U2R A;  4X1D A;  4U22 A;  1OVT A;  4TLM B;  1LFG A;  3TEL A;  4R2F A;  4QF9 A;  3U93 A;  3MJN A;  3CIJ A;  1S50 A;  4F1Y A;  2DXR A;  3UIF A;  2XXT A;  4DDD A;  5H8H B;  1URD A;  4KFQ A;  3C34 A;  5FHO A;  4FEC A;  4HCY A;  2B65 A;  3DM0 A;  2I49 A;  3VFJ A;  4EQ9 A;  1QVS A;  4LQ2 A;  3N6U A;  3KN8 A;  3MVZ A;  1MDQ A;  4RJZ A;  2QRY A;  1SW4 A;  2X7Q A;  4R9G A;  2PYY A;  4KR5 A;  4IO5 A;  4OXV A;  3C9H A;  3FXU A;  5AA2 D;  1RYX A;  3K1M A;  1M5E A;  4F31 B;  5IAI A;  3CR9 A;  3IJX B;  2BJJ X;  1IEJ A;  1MQJ A;  4DIG A;  2OBG A;  4QFN A;  5ICT A;  4H67 A;  3TQW A;  2FA7 A;  3KSX A;  1SW2 A;  3OEK A;  2E0S A;  2I3V A;  5DYH A;  4U23 A;  2O1L A;  1JET A;  3TCF A;  4NF5 A;  5LOM A;  2ZYN A;  3V83 A;  5AA2 B;  2A5T A;  4ZZE A;  1P1N A;  3OO6 A;  1UQW A;  4ZEB A;  4NF8 B;  1QKA A;  3O6I A;  2QMX A;  2I4C A;  1GGG A;  2F6P A;  3MP6 A;  1II5 A;  4RXL A;  1Y3Q A;  3MZB A;  1GVC A;  2PBW A;  3K6X A;  4KCC A;  1B1X A;  1B4Z A;  3GZG A;  4U4S A;  1NNT A;  4YKI A;  2VP1 A;  4LA9 A;  3SEU A;  2XXY A;  2DWH A;  3SEY A;  1B5I A;  3H3G A;  1N3W A;  4LZ8 A;  1UTB A;  1VFE A;  2PVU A;  3K00 A;  5DEX A;  2I58 A;  5EHS A;  1B6H A;  3OEM A;  4IB2 A;  3PUW E;  1NL5 A;  1MH4 A;  4KPT A;  3PUX E;  4FE8 A;  4GF8 A;  4PFY A;  4Z7E A;  3IOW A;  3IOV A;  1NNP A;  1MXU A;  1FTL A;  1SD3 A;  5TPA A;  2XX7 A;  3ECR A;  5CM6 A;  1FQE A;  1D9Y A;  2XXQ A;  1A7L A;  2H25 A;  4M1V A;  2XX9 A;  3TPA A;  4G68 A;  3PU5 A;  2XXV A;  3FGS A;  3OSR A;  1SW5 A;  1XVY A;  2F7B A;  4U21 A;  4FED A;  4JB7 A;  4OEN A;  3O6G A;  4GFR A;  1MXY A;  4G8M A;  4EF1 A;  2R71 A;  1QUK A;  3QUJ A;  3MAM A;  3G3H A;  1FTK A;  2M8C A;  3KZG A;  3JV9 A;  3JYR A;  5I56 A;  2Z22 A;  3OMB A;  3OXN A;  3VXB A;  3K6W A;  4PFT A;  3T66 A;  3PPN A;  1I6B A;  5CMK A;  2THI A;  2REG A;  2F36 A;  2PX1 A;  1VSO A;  4NTL A;  2O7I A;  4GD5 A;  1LBB A;  4ZED A;  4F1V A;  3C4M A;  1JVY A;  1IUD A;  3BFU A;  3RN8 A;  2DVZ A;  2H98 A;  2V3T A;  5CC2 A;  1XT8 A;  1B3H A;  2I0B A;  2XXP A;  3TEP A;  4I9D A;  1LBC A;  1WOD A;  2AYS A;  1LAG E;  4NED A;  5TP9 A;  2Q2A A;  2HXW A;  3SKP A;  1T0K A;  5I2N B;  3FUZ A;  3PPO A;  4OTE A;  4KQP A;  4YB5 A;  3MP1 A;  2I0C A;  3T96 B;  2O68 A;  4E0X A;  3IO4 A;  3LC8 A;  1BTJ A;  1JW1 A;  3SDF A;  2P2A A;  1ZU0 A;  4LQ5 A;  4Q8R A;  1MG1 A;  4DZ1 A;  1LB9 A;  1ZMG A;  2Z8F A;  4RPO A;  2ZMB A;  3K01 A;  3EF7 A;  1AL3 A;  5I59 B;  5JTY B;  3UK4 A;  4N6P A;  4WEP A;  3VVD A;  5DTB A;  2I4B A;  3I5O A;  3D4G A;  1FCK A;  1B40 A;  2F78 A;  3SEX A;  4DE8 A;  3TAJ A;  2O51 A;  1JW5 A;  4RK2 A;  1OQG A;  3B6Q A;  4P11 A;  2UYE A;  3TOD A;  1XHY A;  4G8N A;  1AOV A;  5I57 A;  3IAZ A;  2F97 A;  4H5G A;  2PMS A;  2ANJ A;  1MY1 A;  4ZE8 A;  1B9J A;  4QHQ A;  1LFI A;  4IO7 A;  2V3U A;  3MP8 A;  5CRY A;  5ITO A;  5CMB A;  4HCW A;  4Q0C A;  3KOS A;  1Y3P A;  3PUZ E;  1SI1 A;  2UVG A;  3CFX A;  4Z0I A;  1LGB C;  1BIY A;  3S9L C;  3MW0 A;  1B32 A;  4G68 C;  3PUY E;  1FQB A;  4QFL A;  4N07 A;  1MXV A;  3CVG A;  3IX1 A;  4OEV A;  4QSE A;  2LAO A;  5H8F B;  1HSE A;  1TFA A;  3DP8 A;  3CG3 A;  2D21 A;  3KGC A;  3I3V A;  2V25 A;  4OFO A;  3KG2 A;  2UYF A;  3DEL B;  1JW4 A;  3T9X B;  5HM4 B;  2REJ A;  4KCD A;  1OVB A;  5IKB A;  4LZ7 A;  4R73 A;  1IXG A;  1MQI A;  1HSL A;  2QS2 A;  5AA3 A;  2HCA A;  2GH9 A;  5H8N B;  4F3B A;  5KCJ A;  1NNF A;  3TFL A;  4RY1 A;  3CI8 A;  2DXY A;  2CZL A;  3FZV A;  4AB5 A;  5CMC A;  4QFP A;  4AB6 A;  1NFT A;  1JEU A;  1SI0 A;  4GL0 A;  3MZ1 A;  2ZYM A;  1B0H A;  1JNF A;  3A3C A;  4NWC A;  4EUO A;  1QW0 A;  2DSF A;  4ND9 A;  1DTG A;  2W7Y A;  2V3Q A;  1DSN A;  3N94 A;  3MBP A;  4OVJ A;  2VOZ A;  2HAU A;  3OD7 A;  3U8Q A;  3HCQ A;  1FQF A;  3KJT A;  3FXR A;  1P1W A;  1USY H;  4EXL A;  1MPB A;  3K6U A;  2DYX A;  4YB6 A;  2Q88 A;  4H0W A;  1EH3 A;  3QXM A;  1MDP 1;  4H6D A;  3UN6 A;  3MZ9 A;  1QUI A;  1ZKB A;  1B5J A;  1B46 A;  3U72 A;  4POX A;  2XX8 A;  1P1O A;  1B3G A;  5KDT B;  4POW A;  4UA8 A;  1B3E A;  4F18 A;  2ESN A;  4Q30 B;  1VFD A;  1B7H A;  2OLB A;  4DXB A;  4MBP A;  3SET A;  3KBR A;  4KI0 E;  3RUM A;  5ICQ A;  2HEU A;  1TXF A;  1VE4 A;  1TT1 A;  1ZIU A;  2P0S A;  3TMG A;  2RC8 A;  1JEV A;  5AA4 B;  2VHA A;  1D4N A;  3RT8 A;  4YB7 A;  2RC9 A;  5F1Q A;  3M8U A;  3CFZ A;  4DXC A;  1POT A;  1B5H A;  4NF6 A;  1A8F A;  3CSB A;  5K2Y A;  1MXZ A;  1SBP A;  5M2V A;  4HS7 A;  5I58 A;  5F7V A;  3IK6 B;  1ANF A;  1MQD A;  3RGY A;  1PBP A;  3TDJ A;  3MPL A;  1MM7 A;  4R2B A;  5FHN A;  1ELJ A;  2ONS A;  3RQT A;  2H9B A;  3LSX A;  4R6K A;  2O6A A;  4R72 A;  3TTL A;  2Q9T A;  3S9E A;  4X1B A;  1OQH A;  3C35 A;  2DWJ A;  3GXA A;  5H8Q B;  4HW8 A;  1B7Z A;  1QKB A;  2ZNU A;  1SW1 A;  4KHZ E;  1TFD A;  2D5W A;  3K6V A;  1USY E;  3PMV A;  2DE4 A;  1GR2 A;  2ALU A;  5B70 A;  1MM6 A;  2Z8E A;  4AQ4 A;  3OO7 A;  5JEI A;  2ZXT A;  2X26 A;  3GLB A;  2UVI A;  3KSJ A;  1I6A A;  5CMM A;  1DMB A;  4R74 A;  2HAV A;  3K2D A;  1IQ7 A;  3B6T A;  3MWB A;  4JXI A;  3BFT A;  4PE5 B;  3O2A A;  3ODB A;  1P99 A;  4KYE A;  4TQU Q;  4FAT A;  3ZSF A;  4XKQ A;  3ZS6 A;  1MY0 A;  4GIZ A;  4ELR A;  4GVO A;  2RCA A;  3KFM A;  4LP2 B;  3ZKK A;  1I6Q A;  2RF1 A;  3IO6 A;  1B05 A;  4ZS9 A;  3LUY A;  4IO4 A;  3Q26 A;  4ISU A;  1BKA A;  1H43 A;  4P0I A;  5L9M A;  1H44 A;  4C1T A;  4ZEF A;  3RPW A;  2QJE A;  1URS A;  3QSL A;  4C0R A;  5A5X A;  4PP0 A;  2XXW A;  3IB0 A;  1D3K A;  2F7C A;  4RYA A;  2AIX A;  1UTH B;  3KN7 A;  4G4P A;  4O3C A;  2O7U A;  5ELV A;  4ESX A;  4PET A;  1Y4C A;  1R6Z A;  2RIN A;  3GBA A;  4THI A;  2XHD A;  3JZJ A;  2Z8D A;  4F29 A;  5H8H A;  3VLW A;  2DS9 A;  3MC2 A;  3O6H A;  1F9B A;  3TKD A;  2H99 A;  3TCG A;  4YKK A;  3I6V A;  4UAC A;  4RK9 A;  4GOT A;  1N84 A;  4GQO A;  4F2Q A;  1WDN A;  1LAX A;  2YJP A;  1B51 A;  3LSW A;  4R75 A;  4YU0 A;  4YIC A;  2G93 A;  1AMF A;  2XXI A;  3G3I A;  2F34 A;  1DPP A;  3Q29 A;  1NKX A;  1N04 A;  1P1U A;  1Y4T A;  2UXA A;  1FW0 A;  2H5Y A;  4NF4 B;  3MVY A;  1AIV A;  4KYD A;  2XXU A;  2DP8 A;  3EN3 A;  1N76 A;  1ZLQ A;  1B58 A;  4OET A;  1B52 A;  5AA2 A;  3FVG A;  4BLA A;  3OEL A;  2YLN A;  5DVI A;  5I2K B;  4G2Z A;  3MVW A;  4XKR A;  1H76 A;  3RTW B;  4ZDM A;  1CB6 A;  3W9V A;  4NF8 A;  2I6E A;  3H4Z A;  5DT6 A;  4I8C A;  3H03 A;  2VGQ A;  2F8D A;  2Y7W A;  1LST A;  4JWX A;  2NOO A;  3N6T A;  1N7W A;  1XVX A;  3IJO B;  4GXS B;  1M5F A;  4KYS A;  4MF3 A;  2R9J A;  1RYO A;  2RCB A;  2DE3 A;  5J1D A;  2GHA A;  2G29 A;  5EYF A;  3IOU A;  3H6T A;  2NUV A;  2O69 A;  1QJM A;  4MLQ A;  3HST A;  4HTG A;  4LON B;  4IO2 A;  3MPK A;  3SEV A;  3CRB A;  3W9W A;  2E1S A;  2QPQ A;  3S9N C;  2B3B A;  4XTC Q;  2CMO A;  1UIV A;  2Q89 A;  3PPR A;  4DXU A;  1US4 A;  1MY3 A;  5K2X A;  3VVE A;  1XS5 A;  5L9S A;  3ZKL A;  4IO6 A;  1O7T A;  3PV0 E;  3G3K A;  5AA1 A;  1LLS A;  2B3F A;  1QUJ A;  3N26 A;  4JDF A;  1IXI A;  1NNK A;  1XC1 A;  3S4U A;  1MY2 A;  4OMB A;  4NF5 B;  1I69 A;  4LZ5 A;  3SEW A;  1M5C A;  3DLN A;  4LVQ A;  2A5T B;  3O97 A;  1MQG A;  1DPE A;  4F2O A;  1PDA A;  3TTK A;  1LAF E;  1J1N A;  2ZNS A;  4BDQ A;  2QSX A;  4GRK A;  4ZEI A;  1JQF A;  2A5S A;  3VV5 A;  3RT6 B;  4Q5T A;  1BLF A;  4OHN A;  1FTO A;  2HZL A;  3QIM A;  3QYT A;  1GV8 A;  3T9H B;  4ZEC A;  5FTI A;  4OER A;  1FQC A;  4WXJ A;  1LCT A;  3N5L A;  2OJT A;  2NXO A;  2Q2C A;  1M5D A;  3P7I A;  1N3X A;  5EHM A;  3RTF B;  3C32 A;  3O66 A;  1TWY A;  4H1X A;  4YAH X;  4G77 A;  1UTB B;  3E3K A;  4ELP A;  4YMB A;  5DEX B;  1PBQ A;  3L6G A;  5BWJ A;  5KZT A;  3E4R A;  3O29 A;  4O3B A;  1B7U A;  3IOT A;  4R6H A;  3USD A;  4MH5 A;  4OQO A;  3EHU A;  2V93 A;  3T22 A;  4L17 A;  1B2H A;  3DP4 A;  2NVU B;  5I84 A;  1CE2 A;  3Q28 A;  5FTH A;  2O84 X;  3K02 A;  3VLV A;  1VR5 A;  5TPA B;  4LAT A;  1POY 1;  3UGW A;  3TZA A;  4WED A;  2HQ0 A;  4EQ7 A;  3UA8 A;  1YCJ A;  3FV2 A;  3T93 B;  4ECF A;  2QL3 A;  3TQL A;  3G3G A;  5A5X B;  4F22 A;  4G68 B;  1IIT A;  5BUU A;  2XD2 A;  2I3W A;  3EHS A;  1Y1M A;  2PT2 A;  5I2N A;  1B3L A;  1US5 A;  3HHG A;  4YMA A;  1FTJ A;  4OZ9 A;  4EQB A;  1ATG A;  3PPQ A;  2F35 A;  3D4C A;  4DCX A;  1N7X A;  1BP5 A;  3KN3 A;  3CG1 A;  4OEU A;  2AL5 A;  4IO3 A;  4BDR A;  3IR1 A;  2GRV A;  3FV1 A;  2QMW A;  4QFO A;  1GTK A;  2YPN A;  4H5F A;  4TLL B;  3U92 A;  4YZZ A;  1JVX A;  2XD3 A;  1OIB A;  3Q27 A;  4BDL A;  3VVF A;  3C33 A;  3H6W A;  4F3P A;  1OMP A;  1H45 A;  1Q1K A;  5I56 B;  2OZZ A;  5CBR A;  2ZNT A;  3E13 X;  1QUL A;  3LR1 A;  1R1N A;  5I59 A;  5JTY A;  2P1S A;  3RLF E;  2Y7K A;  4P0G A;  5DVF A;  4QRZ A;  4OES A;  4F19 A;  4O3A A;  3M3L A;  1H3D A;  4NE4 A;  4XXU A;  2OK2 A;  4IGT A;  4WKM A;  4E0W A;  2IA4 A;  3R7X A;  3THI A;  4U4X A;  3TYH A;  4C1U A;  3TTN A;  3VXC A;  3HV1 A;  3BBR A;  1Y9U A;  1A99 A;  1Q35 A;  2Y84 A;  3O9P A;  3FJM A;  2FNC A;  3OSQ A;  1LFH A;  1B4H A;  1MRP A;  5TP9 B;  3TCH A;  3R26 A;  3ILU B;  3MUQ A;  3H06 B;  3WAF A;  3HO7 A;  3OEN A;  4GXA A;  2I48 A;  3OO8 A;  4EXK A;  2X7P A;  3M3K A;  1PEB A;  2XXX A;  3FAT A;  1OLA A;  3KOT A;  3EQ1 A;  5H8S A;  5H8F A;  3TUS A;  3HPI A;  3VE1 B;  4RPN A;  1ZTY A;  3W15 C;  1IXC A;  1PB9 A;  2HZK A;  1Y20 A;  2F5X A;  3A3U A;  1S9T A;  3F11 A;  4IGR A;  1A55 A;  5CBS A;  4MFI A;  3LSF B;  2DOJ A;  4JSD A;  3H7M A;  4BDM A;  3QK6 A;  1DTZ A;  1IZ1 A;  3ONM A;  3ILT B;  2UVJ A;  4IY6 A;  4BDO A;  1MY4 A;  4RA1 A;  1MXX A;  3TTR A;  2IEE A;  1UIU A;  4KD5 A;  4N13 A;  5H8N A;  4NMY A;  4X48 A;  1B1H A;  1MPC A;  1SYI A;  3V5A A;  2ZYK A;  1IIW A;  1MPD A;  2R6G E;  3RY3 A;  3RNN A;  4XKP A;  3VDF A;  5ISU A;  4FOR A;  4F3G A;  5I57 B;  4F1U A;  2KLF A;  4ZEK A;  3OOA A;  4R6Y A;  4JBZ A;  2WKY A;  3C31 A;  1MS7 A;  1WVJ A;  3K1P A;  4MLV A;  4NWD A;  2H4I A;  4ELO A;  3PMX A;  4EDP A;  1EZ9 A;  3PD8 A;  3R6U A;  1D9V A;  1MH3 A;  4OWD A;  1AH5 A;  1M5B A;  2Y7I A;  3IOR A;  1ZJL A;  2D3I A;  3K1N A;  4FJP A;  3H6V A;  4PFW A;  2DVC A;  3KJ7 A;  3FJ7 A;  4QSC A;  5KDT A;  3T9U A;  1A40 A;  4OYV A;  3FAS A;  2RKM A;  2Y7R A;  4LUB A;  3M3F A;  4ZE9 A;  3LSL A;  1N0T A;  1FQD A;  3CFL A;  2HFB A;  3S2V A;  1L5T A;  3G3F A;  4I1D A;  4X9T A;  5CI5 A;  4H8J A;  2DWI A;  4FAJ A;  5AA4 A;  3WAE A;  1LB8 A;  1NH7 A;  1KWH A;  1A54 A;  3SER A;  2XXH A;  4F3S A;  3PPP A;  1FTM A;  2AL4 A;  4U1O A;  1PC3 A;  3V8X B;  2XXR A;  2O1M A;  2GFE A;  3FVO A;  3H6U A;  5KCJ B;  3G7W A;  1EZO A;  2ZYO A;  3UP9 A;  3FJG A;  1Y1Z A;  4JSO A;  2QS4 A;  1OLC A;  3DP6 A;  1SDX A;  1SYH A;  3CSG A;  2OCU A;  5H8Q A;  3V89 B;  4H65 A;  5JK4 A;  1NMU A;  3FIR A;  3BKI B;  2Q8J A;  4ONY A;  3U94 A;  2ONK E;  3KEI A;  1EU8 A;  3K0V A;  1FQA A;  3QUF A;  3VLU A;  1O63 A;  2VD3 A;  4R9F A;  4K3F A;  2OWT A;  2QS1 A;  2Z23 A;  2Y7P A;  4XKN A;  3G3J A;  5L9O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...