3HHFA

Structure of crga regulatory domain, a lysr-type transcriptional regulator from neisseria meningitidis.
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
204
structure length
204
Chain Sequence
PQGVLSVDSAMPMVLHLLAPLAAKFNERYPHIRLSLVSSEGYINLIERKVDIALRAGELDDSGLRARHLFDSRFRVIASPEYLAKHGTPQSTEELAGHQCLGFTEPGSLNTWAVLDAQGNPYKISPHFTASSGEILRSLCLSGCGIVCLSDFLVDNDIAEGKLIPLLAEQTSDKTHPFNAVYYSDKAVNLRLRVFLDFLVEELG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of CrgA from Neisseria meningitidis reveals a new octameric assembly state for LysR transcriptional regulators
pubmed doi rcsb
source organism Neisseria meningitidis serogroup b
molecule tags Transcription regulator
molecule keywords Transcriptional regulator, LysR family
total genus 52
structure length 204
sequence length 204
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3hhfA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3hhfA01
4F19A 2I58A 1LAHE 1D4NA 1M5DA 2HAUA 3EPEA 3O66A 2UVJA 2Y7KA 3Q27A 1I6BA 1P1WA 1POY1 1NH7A 2UYFA 1BP5A 4RNSA 2Z8DA 2XXIA 3FV1A 3QIMA 5FTIA 4F1VA 2HFBA 1NKXA 1NL5A 4F3PA 3LBSA 3RTWB 1PB8A 4RY1A 4H5FA 3O97A 3SEWA 4BDOA 3FJGA 2RCAA 3KN3A 1SW4A 3CR9A 4NWDA 4BDNA 4POWA 3SKPA 5EYFA 2DVZA 2ZNSA 3T22A 1H43A 2Y84A 1FQEA 3PUVE 1URDA 5I57A 4G68C 4KD5A 2D3IA 2I3WA 1ANFA 4E0XA 2NOOA 3QUFA 4FECA 4GVOA 1MY4A 2QMWA 3Q29A 4OHNA 4OYVA 4QFLA 3M3LA 3SERA 4BDRA 1D9YA 1IXGA 3MAMA 1LCTA 3WAEA 1RKMA 3PUZE 1DSNA 3KN7A 3QSLA 5I56A 5TU0A 1Y1MA 2F6GA 3PPNA 4G8HA 2ZXTA 3VXCA 1FTMA 1DOTA 2F78A 4JSOA 4F39A 1EZ9A 4ND9A 4OETA 4OMBA 1FQFA 4XTCQ 4DIGA 4KCCA 1PDAA 4GXSB 4F2QA 1MXZA 4KYEA 4EQ7A 3A3CA 4PQJA 5ELVA 1PC3A 1LB8A 4NMYA 4YKJA 1D3KA 1MQHA 3N6TA 1WDNA 1S7YA 2X7QA 2DS9A 3VXBA 4ZECA 3EF7A 3JYRA 1FQDA 2PVUA 3K00A 3E9XA 4PP0A 4ESWA 2OZZA 3CFZA 1NNFA 5F1QA 1S50A 4M4GA 1FQBA 3SEUA 1ELJA 1TXFA 2DSFA 3PPRA 3B6QA 2A5SA 4KYDA 4N13A 3TELA 3EN3A 3K1MA 5L8DA 4ECFA 1I6AA 3USDA 4AB6A 4F22A 1MQIA 2QMXA 4KI0E 4R72A 5K2YA 3RN8A 2QJEA 3C33A 4PE5B 4TQUQ 3H03A 3G3FA 4I1DA 4IO7A 4I62A 3K2DA 1B9JA 1HSJA 3PD9A 4U4XA 4ISUA 3K6XA 2VOZA 5HBCA 5B70A 5I59A 2NWJA 2ZYOA 4BDQA 4X1DA 3MUQA 2VD3A 3FUZA 4R75A 3O6HA 4ELOA 1Z7NE 4ZE9A 3S9LC 2FYIA 2XD2A 1GVCA 4U4SA 3IAZA 1MG1A 5TP9B 2GH9A 4DZ1A 2HZLA 4EQ9A 3FZVA 1URSA 3LSLA 4XKNA 4H65A 1B3EA 1SBPA 4QFNA 4BDLA 5JEIA 4WKMA 2RF1A 5ISUA 2O68A 3A3UA 1XS5A 4JXIA 5I57B 3L6HA 5FHNA 1IXIA 3MVYA 3VLWA 3V8XB 5AA4B 3FXUA 5I2NA 3TUSA 2F8DA 3LUYA 2FA7A 4POXA 4EXLA 4FATA 5A5XB 3RY3A 1IITA 1SD3A 3FVNA 4Q5TA 5CM6A 4FEDA 2DXYA 4OWDA 3U1OA 1B52A 2CMOA 5LOMA 1JVYA 2P1SA 2NXOA 4NF6A 1MPDA 3MP1A 5H8SA 4ZEFA 1PBPA 1Q35A 4F18A 4XIGQ 1IZ1A 1M5FA 1NH8A 1XVXA 1XT8A 1TFAA 4JDFA 3TCFA 3C34A 3PPPA 1JETA 2XX8A 3I5OA 4G8MA 1L5TA 2ONKE 3THIA 2UXAA 4U23A 3UA8A 5DEXB 3D4GA 3HPIA 3N26A 3IJXB 1MPBA 3LSWA 4RXLA 3VVDA 3SDFA 4E0WA 2RKMA 2ALUA 2F7AA 5A5XA 3PGFA 3UK4A 2THIA 3H06B 1VFDA 1B4HA 3IK6B 3KZGA 4NWCA 2XXTA 3P7IA 1N3XA 3W9WA 1B5JA 1Y3QA 2O51A 1Y4CA 2H4IA 2OWSA 3BBRA 1FTOA 3G3IA 4OXVA 1R1NA 3MC2A 4LZ8A 3RLFE 3VV5A 2H25A 1IXCA 4U21A 1SVXB 1MDP1 1OQGA 1SYHA 2PMSA 3CSGA 1MXYA 3H6UA 1GTKA 3MQ9A 3K0VA 4HCYA 4OESA 3V89B 2I4BA 2ANJA 4JWYA 1IUDA 1GR2A 1B5IA 5AA3A 2QPQA 4OERA 5HM4B 1J1NA 2PBWA 5JTYA 5L9SA 4YZZA 1B6HA 4ZEDA 1B40A 4C1TA 1SDXA 2G93A 4PFUA 5AA1A 5I59B 3CG3A 1A7LA 1LSTA 3K6VA 2E1SA 3KBRA 1P1NA 3K4UA 3LSXA 2Q9TA 4G68B 1XOCA 4NF8B 4P0IA 3VE1B 4R2FA 1B58A 1R9LA 1OVTA 1Z7ME 2UVIA 3MVZA 2ESNA 1YCJA 4KFQA 3TEPA 2FNCA 3LSFB 4THIA 3OOAA 3RPWA 1B0LA 1SW2A 1MRPA 3OSRA 3FIRA 1MXUA 1O64A 3QUJA 3TAJA 3E4RA 1IIWA 1QULA 3G3GA 3DELB 1OIBA 2AL5A 4P11A 4LUBA 1OMPA 1VR5A 1H3DA 2Z23A 3CRBA 3VDFA 2LAOA 1B51A 1QKAA 2X7PA 4JWXA 5JTYB 1VFEA 3TTLA 4U22A 2DYXA 3UGWA 1A8FA 4GL0A 3W9VA 4DXBA 3QK6A 2PYYA 3MBPA 4IO3A 4GOTA 3IX1A 5DEXA 3PMWA 1URGA 3UIFA 1RYOA 2DWHA 5CI5A 2DQVA 3SEXA 2NUVA 3PMVA 4LATA 4P0GA 3D4CA 3C31A 3IB2A 4NTLA 3IOTA 3TODA 3TDJA 3MVWA 4ZDMA 5I58A 3EHTA 3UP9A 1MY1A 3S2VA 3CFLA 5AA2D 2OLBA 5KDTB 3PPQA 5AA2B 1LFHA 2REJA 3LR1A 3RT8A 4G2ZA 3S9EA 1B5HA 1B3GA 3CI8A 4GXAA 4XKPA 1ZJLA 3U94A 4AB5A 5CC2A 3Q26A 5I2KA 3MZBA 3OELA 1Y3NA 2QS3A 1WODA 2YLNA 4DCYA 1SYIA 4WEPA 3G3HA 1SW5A 1XHYA 3KOTA 4NEDA 3TTNA 1NNPA 1MY3A 2XX7A 3HCQA 3G3JA 3IJOB 4YKKA 3RUMA 3QXMA 1M5EA 3IL1B 3T9XB 3ZKKA 2F36A 3HHFA 3U92A 1DPPA 3RGYA 3RNNA 2H5YA 1FQCA 3B7DA 4NF8A 1SI0A 2G29A 2Q89A 4OQOA 3RT6B 4H8IA 1RYXA 3N6UA 2YPNA 4DCXA 1IXHA 4G4PA 2Z8EA 4LQ2A 2DVCA 2REGA 3MPKA 2ONRA 4PETA 3RQTA 2F34A 2BJJX 3H6TA 1PB7A 5H8FB 1B7ZA 3H6WA 1R6ZA 4ZEIA 2P2AA 1ZLQA 2I49A 1SI1A 4DLDA 4XKRA 3TKDA 1A99A 1MPCA 4IO4A 3HV1A 4G68A 1B1XA 2UVGA 3FJ7A 4JB7A 4WEDA 4RPOA 2YJPA 1B2HA 3R6UA 3KN8A 3MZ1A 1SQYA 1MXWA 1B7HA 1LB9A 1N84A 1UIUA 4GWOA 3SEYA 2OK2A 4EDPA 4HW8A 4F3SA 2V3QA 5AE4A 2PT1A 4OEVA 2RC7A 2XXWA 3W15C 1FW0A 3PPOA 1B05A 3Q25A 3UN6A 2UYEA 1PBQA 3PV0E 4LZ5A 1QW0A 5F7VA 1S9TA 3C32A 4L17A 3K01A 3T9VA 3IOWA 3TTKA 4G8NA 1H44A 4DXUA 1WVJA 2OCUA 5I58B 5KCJB 1AIVA 3C9HA 3I6VA 3VLUA 4GLIA 4F2OA 3CFXA 5KDTA 3IOUA 3TTRA 2W7YA 5I2NB 1AL3A 2KLFA 3KSJA 3TCHA 1P99A 2I6EA 3PUYE 4U2RA 4I8CA 2XXQA 2B3BA 2XHDA 1HSLA 5ITPA 1MXXA 4OFJA 4H67A 3LC8A 2D21A 1ZMGA 2ONSA 1EU8A 1LBCA 2O7UA 3V83A 3FVOA 5ICQA 4EXKA 1GGGA 3ONMA 2ZNUA 1XVYA 4NF6B 1MQGA 1H45A 1VSOA 3E3KA 4YU0A 4ELRA 2I3VA 3MVXA 3S4UA 1MM6A 1HSEA 1LAXA 5AA2A 5BUUA 5L9OA 3R26A 3K02A 2HEUA 1PEBA 2PX1A 3C35A 4IB2A 4MLVA 1N04A 2XXYA 3OMBA 4AQ4A 1US5A 3BFTA 4I9DA 5AA4A 4MH5A 1ZU0A 1LFIA 4Q0CA 2H99A 5JK4A 2GHBA 4LP2B 5H8FA 4FAJA 3IR1A 2AIXA 3KSXA 4QFOA 2RCBA 4R2BA 2P0SA 3O9PA 4IO5A 5EHMA 5FHOA 3DLNA 5DVJA 4YMBA 2Q8JA 2QS2A 2O1MA 4K3FA 1DTZA 4EUOA 4MBPA 1FTJA 3ECRA 3TTMA 4F3GA 1ZKBA 2DE3A 2NVUB 1B3HA 2V84A 4GF8A 1Y20A 1AOVA 1PB9A 1UIVA 1BTJA 2VHAA 2B65A 2OBGA 3FATA 4GFRA 4GQOA 4IY5A 3KJ7A 2WKYA 2XXRA 2HCAA 1JVXA 1OVBA 4IO6A 3MP6A 2IA4A 2QRYA 3KGCA 3CIJA 1MXVA 3OO6A 4GD5A 4BLAA 3EQ1A 1MH3A 4KCDA 4ELPA 4F31B 2OJTA 3GBAA 1USYH 3FVGA 2UVHA 4FEBA 1YPNA 5CMMA 5CMCA 1N7XA 3FV2A 5HPQA 3T9HB 1P1OA 1F9BA 2I48A 2Q2AA 2VGQA 1MS7A 1LCFA 3Q28A 1JW1A 3H3GA 5CRYA 3IB0A 2DWJA 2O6AA 2RC9A 3T9UA 1YTVA 2R71A 2QSXA 2ZYMA 4Q30B 3TQWA 2OWTA 1Y1ZA 3KEIA 1TFDA 1M5CA 2F6PA 2XD3A 3MPLA 3PUXE 4H5GA 4OFLA 4WXJA 1USYE 4KHZE 4RYAA 3ILUB 1MQDA 2V25A 4YB7A 1DTGA 1JEUA 3E13X 1FTLA 3ZSFA 3S9MC 4FORA 4QSCA 1FCKA 1JW5A 4YKIA 4KR5A 3ODBA 1II5A 4LQ5A 3HN0A 2F35A 2ZYKA 4H6DA 3CVGA 4NF4A 1ATGA 4KYSA 4GIZA 3OXNA 1MY2A 1SW1A 1B0HA 4H8JA 4X9TA 3T96B 3UORA 5J1DA 3A09A 4G77A 2GRVA 2ZNTA 5I84A 3IORA 4ZZAA 1UQWA 3JV9A 4C0RA 1EZPA 1VE4A 2DE2A 5CBSA 4IGTA 3EHUA 4R6HA 3PUWE 2AYSA 4MLQA 5I2KB 1BIYA 1LAGE 3M3KA 4EF2A 4Z7EA 2RINA 1UTHA 4OFOA 4NE4A 4FJPA 3U93A 2XXPA 1DPEA 1QKBA 4HTGA 3BFUA 4JWOA 3CG1A 4YICA 4ZE8A 1R9QA 3OD7A 3TZAA 2O1LA 4PFYA 3V5AA 3RTFB 3VVFA 5H8HB 1CE2A 4RPNA 3MWBA 3OEMA 1H76A 3O29A 2A5TA 2ZYNA 4NF4B 2Y7PA 4NF5B 5CMBA 3SESA 3VVEA 5ICTA 4PFTA 4IY6A 1P1QA 3DP8A 3MZ9A 4ESXA 5CMKA 2XXUA 2QS4A 1NNKA 2D5WA 2Q2CA 2Z8FA 4U1OA 3KFMA 3OO8A 3F11A 3DM0A 4C1UA 3U8QA 1A8EA 2Z22A 1B3LA 1Y3PA 1QUJA 1ZBMA 3HHGA 4JSDA 1LAFE 1JNFA 4YKPA 4DE8A 1O7TA 4ZEKA 3SETA 2XXHA 1I69A 2HZKA 3O6GA 1O63A 3FXRA 1FTKA 1NMUA 3L6GA 4MF3A 3VLVA 3KG2A 3FD3A 4N07A 3TQLA 4QFPA 2A5TB 4NF5A 2V3TA 2I4CA 3OO9A 3R7XA 4QSEA 4LVQA 5DT6A 5IKBA 3K6UA 2B3FA 2DXRA 3AXFA 4OTEA 5EHSA 1JW4A 3FASA 3OSQA 2F7CA 1EZOA 4R9FA 2V3UA 2I0CA 3C36A 2AL4A 5M2VA 4O3BA 5KCJA 4H0WA 2GFEA 2I0BA 3M8UA 4KPTA 1QJMA 4PFWA 3K1PA 2QL3A 5DTBA 2H9BA 3G3KA 2F97A 1DMBA 3FXQA 3M3FA 3GLBA 4X1BA 1CB6A 3GBBA 4YB5A 3KJTA 4R9GA 1FQAA 3BKIB 4ZEBA 4TOZA 1EH3A 3TYHA 3C4MA 4EQBA 5FHMA 4QFKA 4R6KA 4IO2A 2IEEA 1QUKA 2RC8A 3O6IA 4GRKA 3N5LA 1KWHA 1AMFA 2O69A 4X48A 5ITOA 4OZ9A 5B7DA 4RA1A 2VD2A 5H8HA 1ZTYA 1B4ZA 4QRZA 3WAFA 4UA8A 4EF1A 4H1XA 4LA9A 4ZS9A 1MH4A 3FGSA 3K6WA 1LGBC 4XXUA 4RJZA 4FIMA 3IB1A 3H6VA 3B6TA 4UACA 4DDDA 3IO6A 4R74A 1ZIUA 4ELQA 3OENA 1MY0A 1XC1A 4YB6A 4QSDA 1US4A 3VFJA 4IGRA 4F1YA 3HO7A 4O3CA 1T0KA 1I6QA 1UTBB 4O3AA 1N0TA 4YMAA 3U72A 2GHAA 3MP8A 1LLSA 1B7UA 3OO7A 4MFIA 5IAIA 4Z0IA 2V93A 4RK2A 1YAEA 3HSTA 1OQHA 4OENA 4OEUA 5L9MA 1IEJA 3CSBA 3OEKA 2QS1A 2O84X 3EHSA 5TP9A 1OLCA 1MQJA 2XX9A 2PT2A 2VP1A 3QAXA 2DOJA 4BDMA 2Q88A 3PMXA 1M5BA 2XXXA 1JQFA 2X26A 4F29A 1UTBA 1N76A 3PU5A 5DVFA 3IO4A 2XXVA 2ABHA 2R6GE 2ZMBA 4RK9A 4DXCA 4LZ7A 1A40A 1OLAA 3T66A 4LONB 4F3BA 2DWAA 1BKAA 4KQPA 1LBBA 3TMGA 1IQ7A 2HAVA 3FJMA 4OVJA 1A54A 1BLFA 4QHQA 2F5XA 5H8QB 2Y7IA 3SEVA 3ZKLA 4QF9A 3JZJA 3TFLA 1QVSA 1QUIA 3TCGA 1N7WA 3KOSA 4TLLB 1A55A 1P1UA 2Y7WA 1TT1A 4JBZA 1GV8A 3N94A 5DVIA 1NFTA 5CBRA 3FVKA 4HCWA 4N6PA 5K2XA 5BWJA 3GXAA 5H8NA 3T93B 4GL8A 3ILTB 4R6YA 5TPAB 3ZS6A 1LFGA 4Q8RA 1Q1KA 3MW0A 3K1NA 1Y9UA 4ONYA 3DP6A 2CZLA 1POTA 3IOVA 4R73A 5DYHA 3GZGA 1B32A 4ZZEA 1B46A 2O7IA 4F1UA 3MJNA 2F7BA 3B6WA 5H8QA 2M8CA 2Y7RA 2DWIA 2E0SA 4U1ZA 2DP8A 4XKQA 1AH5A 5I56B 3S9NC 3G7WA 3O28A 2R9JA 2DE4A 3QYTA 4FE8A 1TWYA 2HQ0A 1B1HA 1MM7A 3DP4A 3O2AA 1N3WA 4TLMB 5H8NB 4M1VA 2HXWA 5TPAA 5KZTA 1JEVA 3I3VA 4YAHX 1UTHB 2H98A 3PD8A 1MDQA 1NNTA 5FTHA 3TPAA 3H7MA 1Y4TA 1B3FA 3H4ZA 4HS7A 1D9VA
chains in the Genus database with same CATH superfamily
4F19A 2FHYA 4YKKA 4RNSA 1FPBA 1I6BA 1P1WA 3Q27A 1BP5A 2Z8DA 1NL5A 4P56A 4RY1A 5EQ8A 3CR9A 4NWDA 4POWA 3PUVE 4E0XA 5AA4A 1MY4A 3M3LA 3QSLA 5I56A 2F6GA 3PPNA 4G8HA 1FTMA 4JSOA 4N6DA 1FJ6A 1MXZA 4PQJA 1LB8A 2HPGA 3N6TA 2PCRA 4ZECA 2VPNA 4AS5A 2PVUA 3E9XA 2R8TA 1ELJA 1TXFA 2DSFA 3EN3A 4AB6A 1RDZA 1B9JA 1HSJA 1LBZA 3K6XA 2NWJA 3CHGA 3MUQA 3FUZA 4R75A 3S9LC 3O6HA 1Z7NE 2FYIA 2XD2A 3IAZA 5TP9B 4EQ9A 2GH9A 1B3EA 4WKMA 1XS5A 2QFLA 5FHNA 1IXIA 3MVYA 4P47A 3LUYA 4FATA 3FVNA 4FEDA 2DXYA 4OWDA 2P1SA 2NXOA 1MPDA 3MP1A 4ZEFA 4F18A 1XVXA 2WBBA 2XX8A 2UXAA 3HPIA 3VVDA 3IJXB 4E0WA 2RKMA 2F7AA 2THIA 3H06B 1VFDA 4MNPA 3P7IA 4FBPA 2XXKA 1Y4CA 1BK4A 4LZ8A 4U21A 1CNQA 1OQGA 2PMSA 3CSGA 3MQ9A 3V89B 4HCYA 1IUDA 3IFCA 2QPQA 5HM4B 1J1NA 4YZZA 1B6HA 1SDXA 4PFUA 1LSTA 3VVEA 2UVIA 3HFUA 3LSFB 1B0LA 3OSRA 1MXUA 3TAJA 3G3GA 2AL5A 5IM2A 1FBHA 1H3DA 1DBZA 3VDFA 1VFEA 5EYGA 3MBPA 4X8RA 3IX1A 1RYOA 3LV0A 4P0GA 3C31A 3TDJA 5AA2D 5KDTB 3RT8A 4P1EA 3MZBA 1Y3NA 2QS3A 1WODA 1SYIA 4NEDA 1NNPA 3HCQA 3RUMA 3T9XB 3ZKKA 3RGYA 3RT6B 4H8IA 1FJ9A 2YPNA 4G4PA 2REGA 3MPKA 2ONRA 3RQTA 2BJJX 1ZLQA 4DLDA 4XKRA 3TKDA 1A99A 4G68A 4RPOA 4GWOA 1SQYA 5DW8A 1N84A 3SEYA 4EDPA 4HW8A 5AE4A 2V3QA 4H45A 2PT1A 2XXWA 4N8GA 2UYEA 3BIHA 5F7VA 3C32A 1AIVA 1JP4A 3I6VA 3IOUA 5EQAA 2JJKA 2XXQA 4N15A 2XHDA 1HSLA 4OFJA 1NUXA 3V83A 2Y5LA 2FIXA 1MQGA 1H45A 3S4UA 1MM6A 5BUUA 5L9OA 3K02A 2HEUA 2PX1A 3C35A 4IB2A 1N04A 3OMBA 4AQ4A 3BFTA 2GHBA 3IR1A 3KSXA 4R2BA 2P0SA 5FHOA 3BIGA 3DLNA 5DVJA 2O1MA 4MBPA 1FTJA 3ECRA 1ZKBA 2DE3A 2NVUB 4G61A 2V84A 1AOVA 1Y20A 1IMAA 1UIVA 2B65A 4GFRA 4IY5A 4P1LA 3KJ7A 1JVXA 4GD5A 4ELPA 4NN3A 5CMMA 2Q2AA 3Q28A 1NV0A 2O6AA 2FIEA 2ZYMA 3KEIA 2XD3A 1RDYA 1JEUA 1FTLA 1NI9A 3S9MC 4QSCA 1JW5A 4N4UA 4H6DA 4NF4A 4KYSA 4GWSA 4X9TA 3UORA 5J1DA 3A09A 1UQWA 4MLQA 1LAGE 1IMCA 2FBPA 2XWKA 1QKBA 4HTGA 4JWOA 4PTKA 4YICA 1R9QA 4PFYA 5I5PA 3VVFA 4JVDA 4NF4B 1H76A 5CMBA 4NF5B 3SESA 1P1QA 3DP8A 4ESXA 2XXUA 2Z8FA 4U1OA 3OO8A 3DM0A 4C1UA 1QUJA 1Y3PA 3HHGA 4DI4B 1LAFE 3SETA 2XXHA 1O63A 3KG2A 4NF5A 3R7XA 3K6UA 4OTEA 3C36A 3M8UA 4KPTA 4PFWA 3K1PA 2H9BA 3G3KA 1DMBA 2CEXA 4X1BA 3GBBA 4R9GA 4TOZA 3C4MA 4QFKA 4R6KA 2RC8A 5ITOA 5H8HA 4LA9A 1MH4A 2F3BA 3H6VA 3IO6A 4ELQA 1XC1A 1Q9DA 4IGRA 4YMAA 2GHAA 3MP8A 1LLSA 4Z0IA 2PFYA 2B4MA 3CSBA 3OEKA 2WYPA 2DDKA 3EHSA 5TP9A 2DOJA 4BDMA 1EYKA 3PMXA 2XXVA 2ABHA 4RK9A 3T66A 4LONB 2DWAA 1BKAA 2QVVA 2HAVA 5H8QB 3ZKLA 3TFLA 1QVSA 3GYYA 5DVIA 2Q8MA 1NFTA 5K2XA 4GL8A 3ILTB 5TPAB 4R73A 5EQ7A 5H8QA 2M8CA 2E0SA 2R9JA 4FE8A 3KC1A 1MM7A 4TLMB 5KZTA 5TPAA 1JEVA 5T3JA 1MDQA 1NNTA 1B3FA 1D9VA 2OX3A 2V4CA 1LAHE 2HAUA 3EPEA 4F1VA 3FV1A 3RTWB 4BDOA 2RCAA 3KN3A 3T22A 1FQEA 5I57A 1FBGA 2NOOA 3B8BA 4OA4A 2QMWA 4OHNA 4QFLA 3SERA 1RKMA 1DSNA 1DOTA 4OMBA 1FQFA 2L5VA 4XTCQ 4GWWA 2HHMA 4KCCA 4GXSB 4F2QA 4YKJA 1FPEA 1MQHA 1S7YA 2X7QA 3VXBA 2ZZXA 4LN5A 2OZZA 4M4GA 1FQBA 3B6QA 4P9KA 5L8DA 4F22A 1MQIA 5K2YA 3C33A 3H03A 1RDXA 4IO7A 4I1DA 3PD9A 3A29A 5HBCA 4MIJA 4X1DA 2VD3A 4GX6A 4ZE9A 4DZ1A 4JXIA 3VLWA 2F8DA 1K9ZA 4EXLA 1IITA 1SD3A 5CM6A 1NV6A 1TFAA 1JETA 3THIA 5DEXB 3D4GA 3N26A 3SDFA 2Q74A 2XXTA 1Y3QA 3MC2A 3VV5A 2H25A 1IXCA 1LBWA 1MXYA 2ANJA 4OERA 5L9SA 4ZEDA 4C1TA 5I59B 5AA1A 3K6VA 4H1XA 3LSXA 3KBRA 4NF8B 5IZ3B 2Q9TA 4GBVA 4OVSA 3VE1B 1B58A 1R9LA 1Z7ME 1EYJA 4KFQA 3RPWA 3DELB 2Z23A 4JWXA 4U22A 3UGWA 4DXBA 1DCUA 4GOTA 1URGA 4OVTA 3UIFA 3SEXA 5CI5A 1EYIA 3MVWA 5I58A 1MY1A 5AA2B 4PFIA 1B5HA 1B3GA 3S9EA 1ZJLA 3Q26A 2YLNA 4DCYA 3TTNA 5LTCA 1SW5A 3QXMA 2F3DA 2MKZA 1FQCA 3B7DA 1NV4A 3H6TA 1PB7A 5H8FB 3H6WA 4ZEIA 2I49A 1SI1A 1MPCA 4IO4A 2UVGA 2YJPA 3KN8A 1MXWA 1B7HA 1LB9A 1UIUA 4F3SA 4OEVA 3W15C 1FW0A 1B05A 3Q25A 3UN6A 1PBQA 1S9TA 2CZKA 3K01A 4G8NA 2OCUA 5LDZA 4GLIA 5KDTA 3CFXA 4UABA 5I2NB 3KSJA 3PUYE 5F24A 5ET6A 3LC8A 1ZMGA 1EU8A 5ICQA 2ZNUA 4ELRA 4YU0A 2I3VA 4MLVA 1PEBA 5A5LA 4I9DA 4MH5A 2H99A 4FAJA 3MSTA 4PDHA 5ESYA 1B3HA 1FBDA 1PB9A 1BTJA 3FATA 5I7IA 1OVBA 2HXRA 4BLAA 4FEBA 2UVHA 1N7XA 1P1OA 1SPIA 2VGQA 4I3EA 4NX1A 1JW1A 5CRYA 3IB0A 2DWJA 1YTVA 2QSXA 4Q30B 3TQWA 1Y1ZA 1M5CA 2F6PA 4MAGA 1FPKA 3ILUB 2V25A 4OANA 1FCKA 4YKIA 1II5A 2XWOA 4LQ5A 2F35A 2ZYKA 4XFEA 4GIZA 3OXNA 1MY2A 4G77A 4O8MA 4ZZAA 2BJIA 5I2KB 1BIYA 2QVUA 3U93A 2XXPA 1DPEA 1FBEA 2XWVA 5EQ9A 3OD7A 3V5AA 3MWBA 3OEMA 2ZYNA 5ICTA 4PFTA 3MZ9A 2D5WA 3KFMA 1A8EA 1NV3A 4YKPA 4ZEKA 1DK4A 3FXRA 5IZZA 1NMUA 4MJOA 5IKBA 4NAPA 2AL4A 4O3BA 5KCJA 4H0WA 5TU0A 2I0BA 5DTBA 3GLBA 3BKIB 3TYHA 4IO2A 1AMFA 2O69A 4RA1A 1B4ZA 3K6WA 1LGBC 4XXUA 4RJZA 4DDDA 3IB1A 3B6TA 4R74A 3OENA 1US4A 1KA0A 4O3CA 4PBQA 4MFIA 4NGUA 5IAIA 2Y5KA 1IEJA 4MCOA 1JQFA 1N76A 3IO4A 2ZMBA 2R6GE 4KQPA 1IQ7A 3TPAA 4OVJA 2Y7IA 3SEVA 4XEQA 2KQZA 1QUIA 4P3LA 4TLLB 4JBZA 5BWJA 3DP6A 5DYHA 3KC0A 1NUZA 2DWIA 4XF5A 3MYUA 3DP4A 3I3VA 4YAHX 1UTHB 2H98A 2QVRA 2VT5A 3H4ZA 4HS7A 1AWBA 3O66A 2Y7KA 1POY1 1NH7A 2UYFA 2XXIA 3QIMA 2HFBA 4F3PA 3LBSA 4H5FA 4GX3A 1IMDA 1URDA 3FXBA 4G68C 2CZHA 2WBDA 4FECA 4OYVA 3Q29A 4BDRA 3MAMA 1LCTA 4O7IA 3WAEA 4F39A 1EZ9A 4OETA 4KYEA 3A3CA 4PFBA 4NMYA 1D3KA 1WDNA 4DI3D 3EF7A 1FQDA 4PP0A 3K00A 3CFZA 2KR0A 5F1QA 1S50A 3PPRA 3TELA 4ECFA 1I6AA 2QMXA 4KXPA 2QJEA 4PE5B 3G3FA 4I62A 1FPDA 3K2DA 4U4XA 4ISUA 2VOZA 5B70A 4U4SA 1LBXA 2HZLA 1KA1A 4XKNA 1SBPA 5JEIA 5ISUA 1FBCA 2O68A 3L6HA 5I2NA 5AA4B 3V8XB 4PBHA 4POXA 2FA7A 5A5XB 4H46A 5LOMA 1B52A 2CMOA 1JVYA 1Q35A 4XIGQ 4X04A 1IZ1A 1M5FA 1NH8A 1XT8A 3TCFA 3PPPA 4G8MA 1L5TA 3LSWA 4RXLA 2ALUA 5A5XA 3UK4A 1B4HA 3IK6B 4NWCA 3W9WA 1B5JA 3BBRA 2H4IA 3G3IA 1R1NA 1SVXB 1MDP1 1SYHA 2WYKA 4OESA 1GTKA 2I4BA 1B5IA 5AA3A 5JTYA 1B40A 2G93A 1A7LA 4G68B 3K4UA 1XOCA 3MVZA 3TEPA 3E79A 2ESNA 1YCJA 3OOAA 1SW2A 1O64A 3E4RA 1IIWA 1VR5A 5JTYB 1B51A 1NUYA 1A8FA 4IO3A 5DEXA 3PMWA 2DWHA 2NUVA 3IB2A 3IOTA 1D9QA 3S2VA 2OLBA 3PPQA 1LFHA 2REJA 4GXAA 3CI8A 4AB5A 5I2KA 3OELA 1XI6A 4WEPA 3G3HA 1XHYA 3KOTA 1MY3A 2XX7A 3IJOB 3G3JA 1M5EA 3IL1B 2F36A 3ISPA 1DPPA 1G0IA 4NF8A 5IZ3A 1RYXA 1IXHA 5ET8A 4LQ2A 2Z8EA 4PETA 1B7ZA 3HV1A 4JB7A 1B1XA 4WEDA 3R6UA 4L17A 1FBPA 2OK2A 4N91A 2VPOA 3PV0E 1QW0A 4DXUA 5KCJB 1WVJA 5I58B 3C9HA 2ZZVA 4PAIA 4F2OA 3TTRA 2W7YA 1LEVA 4PF6A 1AL3A 2I6EA 4U2RA 1MXXA 2ONSA 2O7UA 4P8BA 1GGGA 3ONMA 4NF6B 4O94A 5B7DA 3MVXA 5JK4A 1LFIA 4Q0CA 5H8FA 2AIXA 4QFOA 2RCBA 5EHMA 4IO5A 4YMBA 4PC9A 5EYHA 4K3FA 4GWYA 2Q8JA 1DTZA 3QMFA 4F3GA 5ET7A 1YYZA 4GF8A 2VHAA 2OBGA 2XXRA 3MP6A 2QRYA 3KGCA 3CIJA 3OO6A 1MH3A 5CMCA 3FVGA 4I40A 4NHBA 2I48A 4OFLA 1TFDA 3MPLA 2WX9A 4WXJA 3PUXE 4H5GA 4PE3A 4KHZE 3E13X 4KR5A 3ODBA 1ATGA 2P3VA 1SW1A 3T96B 4H8JA 5I84A 3FBPA 1EZPA 1VE4A 4IGTA 4R6HA 2ZZWA 3PUWE 2WEFA 2RINA 1UTHA 4Z7EA 4OFOA 4ZE8A 4GX4A 3RTFB 1CE2A 3O29A 2Y7PA 2Q2CA 3U8QA 3LUZA 2Z22A 5CC2A 1ZBMA 4JSDA 3L6GA 4N07A 2V3TA 4NF0A 5DT6A 3AXFA 1JW4A 3OSQA 2F7CA 2I0CA 2GFEA 5FTHA 5L9MA 1QJMA 2QL3A 2F97A 3FXQA 1CB6A 4ZEBA 5FHMA 2IEEA 1QUKA 2GQ1A 4GRKA 1KWHA 2VD2A 3IFAA 1ZTYA 3WAFA 4UA8A 4EF1A 4ZS9A 1VDWA 4UACA 4PCDA 3VFJA 3HO7A 3U72A 1B7UA 4N6KA 5IZ1A 2V93A 4RK2A 1YAEA 1NV5A 3HSTA 4OENA 2QS1A 1MQJA 3QAXA 3T0JA 4F29A 2X26A 4JVCA 4QBAA 4DXCA 1A40A 4F3BA 3FJMA 1A54A 4QHQA 2B4LA 1A55A 1P1UA 1NUWA 3N94A 4HCWA 4N6PA 4GWXA 5H8NA 4Q8RA 1Q1KA 3MW0A 1Y9UA 4ONYA 3IOVA 3GZGA 4F1UA 2F7BA 3B6WA 2Y7RA 4XKQA 5I56B 3S9NC 2DE4A 4GWZA 3QYTA 3O2AA 1N3WA 5H8NB 4M1VA 2HXWA 4PAKA 3H7MA 1INPA 2I58A 1D4NA 1M5DA 2UVJA 3SEUA 5FTIA 4GBWA 1NKXA 2OWZA 1PB8A 3O97A 3SEWA 3FJGA 1SW4A 4BDNA 4IR8A 3SKPA 5EYFA 2DVZA 2ZNSA 1H43A 2Y84A 4KD5A 2D3IA 2I3WA 1ANFA 5ITPA 3QUFA 4GVOA 1D9YA 1IXGA 3PUZE 3KN7A 1Y1MA 2ZXTA 3VXCA 2F78A 4ND9A 4DIGA 1PDAA 4EQ7A 5ELVA 1PC3A 2DS9A 3JYRA 3NOHA 4ESWA 1NNFA 4NG7A 4N13A 2A5SA 4KYDA 3K1MA 3USDA 4KI0E 2P3NA 4R72A 3RN8A 4TQUQ 1FPFA 5FBPA 4HXVA 5I59A 3PTYA 2ZYOA 4BDQA 3U65A 4ELOA 1GVCA 1MG1A 3FZVA 1URSA 3LSLA 4H65A 4QFNA 4BDLA 2RF1A 3A3UA 5I57B 3FXUA 3TUSA 4N81A 3RY3A 4Q5TA 3U1OA 4MHFA 4NF6A 5H8SA 1PBPA 4JDFA 3C34A 3I5OA 2ONKE 4U23A 3UA8A 3KBZA 1MPBA 3PGFA 3KZGA 1N3XA 2O51A 2OWSA 3RLFE 1FTOA 4OXVA 1LBVA 1NV1A 3H6UA 3K0VA 4JWYA 1GR2A 4MEVA 2PBWA 3CG3A 3RYDA 2E1SA 4PDDA 1P1NA 4P0IA 4R2FA 1OVTA 2FNCA 4THIA 1MRPA 3FIRA 3QUJA 1QULA 1OIBA 4P11A 4LUBA 1OMPA 2XWIA 3CRBA 5I3SA 1FPJA 4AS4A 2LAOA 3TTLA 1QKAA 1G0HA 2X7PA 2DYXA 4GL0A 3W9VA 3QK6A 2PYYA 4PGNA 1IMFA 2DQVA 3PMVA 4HE0A 4LATA 3D4CA 4NTLA 3TODA 4N8YA 4ZDMA 3EHTA 3UP9A 3CFLA 3LR1A 4G2ZA 4I3YA 4XKPA 3U94A 4JVIA 5ET5A 4EXKA 4HE2A 3HHFA 3U92A 3RNNA 2H5YA 1SI0A 2G29A 2Q89A 4OQOA 3N6UA 4N17A 4DCXA 2DVCA 2F34A 1R6ZA 2P2AA 3FJ7A 4QXDA 1B2HA 1FSAA 3MZ1A 3B50A 2RC7A 3PPOA 4LZ5A 3T9VA 3IOWA 3TTKA 1H44A 3EKIA 1NV7A 3VLUA 2KLFA 3TCHA 1P99A 4I8CA 2B3BA 4H67A 2D21A 1LBCA 3FVOA 1XVYA 3E3KA 1VSOA 5AA2A 1HSEA 1LAXA 3R26A 2XXYA 1FPIA 1US5A 1YZ0A 1ZU0A 3E78A 4LP2B 1FTAA 3O9PA 4OVPA 4EUOA 2QS2A 4PGPA 3TTMA 1K9YA 4GQOA 1IMEA 2WKYA 2HCAA 4IO6A 2IA4A 1MXVA 3EQ1A 4KCDA 4F31B 2OJTA 3GBAA 1USYH 5HPQA 1YPNA 3FV2A 3T9HB 2PFZA 1F9BA 1MS7A 4MNCA 1LCFA 3H3GA 2RC9A 3T9UA 2R71A 2OWTA 3T1BA 1USYE 4RYAA 1MQDA 1LBYA 4YB7A 1DTGA 3ZSFA 3D1RA 4FORA 1FPLA 3HN0A 3CVGA 1B0HA 2GRVA 2ZNTA 3IORA 3JV9A 4C0RA 2DE2A 5CBSA 3EHUA 5IGAA 2AYSA 4EF2A 3M3KA 4NE4A 4FJPA 3BFUA 3CG1A 3TZAA 2O1LA 5H8HB 4RPNA 2A5TA 4IY6A 5CMKA 2QS4A 1NNKA 4NQ8A 3F11A 4PFRA 1B3LA 4DE8A 1JNFA 1O7TA 4GWUA 1I69A 2HZKA 3O6GA 4MF3A 1FTKA 3VLVA 3FD3A 1FBFA 3TQLA 4QFPA 2A5TB 2I4CA 3OO9A 4QSEA 4LVQA 1QGXA 2B3FA 2DXRA 5EHSA 3FASA 1EZOA 4R9FA 2V3UA 5M2VA 3M3FA 2FVZA 5J16A 4YB5A 3KJTA 1FQAA 3SZPA 1EH3A 4EQBA 4PAFA 3O6IA 3N5LA 4X48A 4OZ9A 1IMBA 4QRZA 3FGSA 4FIMA 1KZ8A 1ZIUA 1MY0A 4YB6A 4QSDA 4F1YA 1T0KA 1I6QA 1FPGA 1UTBB 1N0TA 4O3AA 4OVQA 3OO7A 1NV2A 4MMPA 4O7MA 4OEUA 1OQHA 2CEYA 2O84X 3RPLA 1OLCA 2XX9A 2PT2A 2VP1A 2Q88A 1M5BA 2XXXA 1UTBA 3PU5A 5DVFA 1YXIA 4HE1A 4LZ7A 1OLAA 1LBBA 3TMGA 1BLFA 2F5XA 4QF9A 3JZJA 3RPLB 3TCGA 4PF8A 1N7WA 3KOSA 4MX6A 2Y7WA 1TT1A 1GV8A 5CBRA 3FVKA 2CZIA 3GXAA 3ZS6A 3T93B 4R6YA 1LFGA 3K1NA 2CZLA 1POTA 4OVRA 4ZZEA 1B32A 1B46A 2O7IA 3ROJA 3MJNA 4U1ZA 2DP8A 1AH5A 3G7WA 3O28A 2XA5A 1TWYA 2HQ0A 1B1HA 4MNIA 3PD8A 1Y4TA 1FRPA
chains in the Genus database with same CATH topology
4F19A 2I58A 1LAHE 1D4NA 1M5DA 2HAUA 3EPEA 3O66A 2UVJA 2Y7KA 3Q27A 1I6BA 1P1WA 1POY1 1NH7A 2UYFA 1BP5A 4RNSA 2Z8DA 2XXIA 3FV1A 3QIMA 5FTIA 4F1VA 2HFBA 1NKXA 1NL5A 4F3PA 3LBSA 3RTWB 1PB8A 4RY1A 4H5FA 3O97A 3SEWA 4BDOA 3FJGA 2RCAA 3KN3A 1SW4A 3CR9A 4NWDA 4BDNA 4POWA 3SKPA 5EYFA 2DVZA 2ZNSA 3T22A 1H43A 2Y84A 1FQEA 3PUVE 1URDA 5I57A 4G68C 4KD5A 2D3IA 2I3WA 1ANFA 4E0XA 2NOOA 3QUFA 4FECA 4GVOA 1MY4A 2QMWA 3Q29A 4OHNA 4OYVA 4QFLA 3M3LA 3SERA 4BDRA 1D9YA 1IXGA 3MAMA 1LCTA 3WAEA 1RKMA 3PUZE 1DSNA 3KN7A 3QSLA 5I56A 5TU0A 1Y1MA 2F6GA 3PPNA 4G8HA 2ZXTA 3VXCA 1FTMA 1DOTA 2F78A 4JSOA 4F39A 1EZ9A 4ND9A 4OETA 4OMBA 1FQFA 4XTCQ 4DIGA 4KCCA 1PDAA 4GXSB 4F2QA 1MXZA 4KYEA 4EQ7A 3A3CA 4PQJA 5ELVA 1PC3A 1LB8A 4NMYA 4YKJA 1D3KA 1MQHA 3N6TA 1WDNA 1S7YA 2X7QA 2DS9A 3VXBA 4ZECA 3EF7A 3JYRA 1FQDA 2PVUA 3K00A 3E9XA 4PP0A 4ESWA 2OZZA 3CFZA 1NNFA 5F1QA 1S50A 4M4GA 1FQBA 3SEUA 1ELJA 1TXFA 2DSFA 3PPRA 3B6QA 2A5SA 4KYDA 4N13A 3TELA 3EN3A 3K1MA 5L8DA 4ECFA 1I6AA 3USDA 4AB6A 4F22A 1MQIA 2QMXA 4KI0E 4R72A 5K2YA 3RN8A 2QJEA 3C33A 4PE5B 4TQUQ 3H03A 3G3FA 4I1DA 4IO7A 4I62A 3K2DA 1B9JA 1HSJA 3PD9A 4U4XA 4ISUA 3K6XA 2VOZA 5HBCA 5B70A 5I59A 2NWJA 2ZYOA 4BDQA 4X1DA 3MUQA 2VD3A 3FUZA 4R75A 3O6HA 4ELOA 1Z7NE 4ZE9A 3S9LC 2FYIA 2XD2A 1GVCA 4U4SA 3IAZA 1MG1A 5TP9B 2GH9A 4DZ1A 2HZLA 4EQ9A 3FZVA 1URSA 3LSLA 4XKNA 4H65A 1B3EA 1SBPA 4QFNA 4BDLA 5JEIA 4WKMA 2RF1A 5ISUA 2O68A 3A3UA 1XS5A 4JXIA 5I57B 3L6HA 5FHNA 1IXIA 3MVYA 3VLWA 3V8XB 5AA4B 3FXUA 5I2NA 3TUSA 2F8DA 3LUYA 2FA7A 4POXA 4EXLA 4FATA 5A5XB 3RY3A 1IITA 1SD3A 3FVNA 4Q5TA 5CM6A 4FEDA 2DXYA 4OWDA 3U1OA 1B52A 2CMOA 5LOMA 1JVYA 2P1SA 2NXOA 4NF6A 1MPDA 3MP1A 5H8SA 4ZEFA 1PBPA 1Q35A 4F18A 4XIGQ 1IZ1A 1M5FA 1NH8A 1XVXA 1XT8A 1TFAA 4JDFA 3TCFA 3C34A 3PPPA 1JETA 2XX8A 3I5OA 4G8MA 1L5TA 2ONKE 3THIA 2UXAA 4U23A 3UA8A 5DEXB 3D4GA 3HPIA 3N26A 3IJXB 1MPBA 3LSWA 4RXLA 3VVDA 3SDFA 4E0WA 2RKMA 2ALUA 2F7AA 5A5XA 3PGFA 3UK4A 2THIA 3H06B 1VFDA 1B4HA 3IK6B 3KZGA 4NWCA 2XXTA 3P7IA 1N3XA 3W9WA 1B5JA 1Y3QA 2O51A 1Y4CA 2H4IA 2OWSA 3BBRA 1FTOA 3G3IA 4OXVA 1R1NA 3MC2A 4LZ8A 3RLFE 3VV5A 2H25A 1IXCA 4U21A 1SVXB 1MDP1 1OQGA 1SYHA 2PMSA 3CSGA 1MXYA 3H6UA 1GTKA 3MQ9A 3K0VA 4HCYA 4OESA 3V89B 2I4BA 2ANJA 4JWYA 1IUDA 1GR2A 1B5IA 5AA3A 2QPQA 4OERA 5HM4B 1J1NA 2PBWA 5JTYA 5L9SA 4YZZA 1B6HA 4ZEDA 1B40A 4C1TA 1SDXA 2G93A 4PFUA 5AA1A 5I59B 3CG3A 1A7LA 1LSTA 3K6VA 2E1SA 3KBRA 1P1NA 3K4UA 3LSXA 2Q9TA 4G68B 1XOCA 4NF8B 4P0IA 3VE1B 4R2FA 1B58A 1R9LA 1OVTA 1Z7ME 2UVIA 3MVZA 2ESNA 1YCJA 4KFQA 3TEPA 2FNCA 3LSFB 4THIA 3OOAA 3RPWA 1B0LA 1SW2A 1MRPA 3OSRA 3FIRA 1MXUA 1O64A 3QUJA 3TAJA 3E4RA 1IIWA 1QULA 3G3GA 3DELB 1OIBA 2AL5A 4P11A 4LUBA 1OMPA 1VR5A 1H3DA 2Z23A 3CRBA 3VDFA 2LAOA 1B51A 1QKAA 2X7PA 4JWXA 5JTYB 1VFEA 3TTLA 4U22A 2DYXA 3UGWA 1A8FA 4GL0A 3W9VA 4DXBA 3QK6A 2PYYA 3MBPA 4IO3A 4GOTA 3IX1A 5DEXA 3PMWA 1URGA 3UIFA 1RYOA 2DWHA 5CI5A 2DQVA 3SEXA 2NUVA 3PMVA 4LATA 4P0GA 3D4CA 3C31A 3IB2A 4NTLA 3IOTA 3TODA 3TDJA 3MVWA 4ZDMA 5I58A 3EHTA 3UP9A 1MY1A 3S2VA 3CFLA 5AA2D 2OLBA 5KDTB 3PPQA 5AA2B 1LFHA 2REJA 3LR1A 3RT8A 4G2ZA 3S9EA 1B5HA 1B3GA 3CI8A 4GXAA 4XKPA 1ZJLA 3U94A 4AB5A 5CC2A 3Q26A 5I2KA 3MZBA 3OELA 1Y3NA 2QS3A 1WODA 2YLNA 4DCYA 1SYIA 4WEPA 3G3HA 1SW5A 1XHYA 3KOTA 4NEDA 3TTNA 1NNPA 1MY3A 2XX7A 3HCQA 3G3JA 3IJOB 4YKKA 3RUMA 3QXMA 1M5EA 3IL1B 3T9XB 3ZKKA 2F36A 3HHFA 3U92A 1DPPA 3RGYA 3RNNA 2H5YA 1FQCA 3B7DA 4NF8A 1SI0A 2G29A 2Q89A 4OQOA 3RT6B 4H8IA 1RYXA 3N6UA 2YPNA 4DCXA 1IXHA 4G4PA 2Z8EA 4LQ2A 2DVCA 2REGA 3MPKA 2ONRA 4PETA 3RQTA 2F34A 2BJJX 3H6TA 1PB7A 5H8FB 1B7ZA 3H6WA 1R6ZA 4ZEIA 2P2AA 1ZLQA 2I49A 1SI1A 4DLDA 4XKRA 3TKDA 1A99A 1MPCA 4IO4A 3HV1A 4G68A 1B1XA 2UVGA 3FJ7A 4JB7A 4WEDA 4RPOA 2YJPA 1B2HA 3R6UA 3KN8A 3MZ1A 1SQYA 1MXWA 1B7HA 1LB9A 1N84A 1UIUA 4GWOA 3SEYA 2OK2A 4EDPA 4HW8A 4F3SA 2V3QA 5AE4A 2PT1A 4OEVA 2RC7A 2XXWA 3W15C 1FW0A 3PPOA 1B05A 3Q25A 3UN6A 2UYEA 1PBQA 3PV0E 4LZ5A 1QW0A 5F7VA 1S9TA 3C32A 4L17A 3K01A 3T9VA 3IOWA 3TTKA 4G8NA 1H44A 4DXUA 1WVJA 2OCUA 5I58B 5KCJB 1AIVA 3C9HA 3I6VA 3VLUA 4GLIA 4F2OA 3CFXA 5KDTA 3IOUA 3TTRA 2W7YA 5I2NB 1AL3A 2KLFA 3KSJA 3TCHA 1P99A 2I6EA 3PUYE 4U2RA 4I8CA 2XXQA 2B3BA 2XHDA 1HSLA 5ITPA 1MXXA 4OFJA 4H67A 3LC8A 2D21A 1ZMGA 2ONSA 1EU8A 1LBCA 2O7UA 3V83A 3FVOA 5ICQA 4EXKA 1GGGA 3ONMA 2ZNUA 1XVYA 4NF6B 1MQGA 1H45A 1VSOA 3E3KA 4YU0A 4ELRA 2I3VA 3MVXA 3S4UA 1MM6A 1HSEA 1LAXA 5AA2A 5BUUA 5L9OA 3R26A 3K02A 2HEUA 1PEBA 2PX1A 3C35A 4IB2A 4MLVA 1N04A 2XXYA 3OMBA 4AQ4A 1US5A 3BFTA 4I9DA 5AA4A 4MH5A 1ZU0A 1LFIA 4Q0CA 2H99A 5JK4A 2GHBA 4LP2B 5H8FA 4FAJA 3IR1A 2AIXA 3KSXA 4QFOA 2RCBA 4R2BA 2P0SA 3O9PA 4IO5A 5EHMA 5FHOA 3DLNA 5DVJA 4YMBA 2Q8JA 2QS2A 2O1MA 4K3FA 1DTZA 4EUOA 4MBPA 1FTJA 3ECRA 3TTMA 4F3GA 1ZKBA 2DE3A 2NVUB 1B3HA 2V84A 4GF8A 1Y20A 1AOVA 1PB9A 1UIVA 1BTJA 2VHAA 2B65A 2OBGA 3FATA 4GFRA 4GQOA 4IY5A 3KJ7A 2WKYA 2XXRA 2HCAA 1JVXA 1OVBA 4IO6A 3MP6A 2IA4A 2QRYA 3KGCA 3CIJA 1MXVA 3OO6A 4GD5A 4BLAA 3EQ1A 1MH3A 4KCDA 4ELPA 4F31B 2OJTA 3GBAA 1USYH 3FVGA 2UVHA 4FEBA 1YPNA 5CMMA 5CMCA 1N7XA 3FV2A 5HPQA 3T9HB 1P1OA 1F9BA 2I48A 2Q2AA 2VGQA 1MS7A 1LCFA 3Q28A 1JW1A 3H3GA 5CRYA 3IB0A 2DWJA 2O6AA 2RC9A 3T9UA 1YTVA 2R71A 2QSXA 2ZYMA 4Q30B 3TQWA 2OWTA 1Y1ZA 3KEIA 1TFDA 1M5CA 2F6PA 2XD3A 3MPLA 3PUXE 4H5GA 4OFLA 4WXJA 1USYE 4KHZE 4RYAA 3ILUB 1MQDA 2V25A 4YB7A 1DTGA 1JEUA 3E13X 1FTLA 3ZSFA 3S9MC 4FORA 4QSCA 1FCKA 1JW5A 4YKIA 4KR5A 3ODBA 1II5A 4LQ5A 3HN0A 2F35A 2ZYKA 4H6DA 3CVGA 4NF4A 1ATGA 4KYSA 4GIZA 3OXNA 1MY2A 1SW1A 1B0HA 4H8JA 4X9TA 3T96B 3UORA 5J1DA 3A09A 4G77A 2GRVA 2ZNTA 5I84A 3IORA 4ZZAA 1UQWA 3JV9A 4C0RA 1EZPA 1VE4A 2DE2A 5CBSA 4IGTA 3EHUA 4R6HA 3PUWE 2AYSA 4MLQA 5I2KB 1BIYA 1LAGE 3M3KA 4EF2A 4Z7EA 2RINA 1UTHA 4OFOA 4NE4A 4FJPA 3U93A 2XXPA 1DPEA 1QKBA 4HTGA 3BFUA 4JWOA 3CG1A 4YICA 4ZE8A 1R9QA 3OD7A 3TZAA 2O1LA 4PFYA 3V5AA 3RTFB 3VVFA 5H8HB 1CE2A 4RPNA 3MWBA 3OEMA 1H76A 3O29A 2A5TA 2ZYNA 4NF4B 2Y7PA 4NF5B 5CMBA 3SESA 3VVEA 5ICTA 4PFTA 4IY6A 1P1QA 3DP8A 3MZ9A 4ESXA 5CMKA 2XXUA 2QS4A 1NNKA 2D5WA 2Q2CA 2Z8FA 4U1OA 3KFMA 3OO8A 3F11A 3DM0A 4C1UA 3U8QA 1A8EA 2Z22A 1B3LA 1Y3PA 1QUJA 1ZBMA 3HHGA 4JSDA 1LAFE 1JNFA 4YKPA 4DE8A 1O7TA 4ZEKA 3SETA 2XXHA 1I69A 2HZKA 3O6GA 1O63A 3FXRA 1FTKA 1NMUA 3L6GA 4MF3A 3VLVA 3KG2A 3FD3A 4N07A 3TQLA 4QFPA 2A5TB 4NF5A 2V3TA 2I4CA 3OO9A 3R7XA 4QSEA 4LVQA 5DT6A 5IKBA 3K6UA 2B3FA 2DXRA 3AXFA 4OTEA 5EHSA 1JW4A 3FASA 3OSQA 2F7CA 1EZOA 4R9FA 2V3UA 2I0CA 3C36A 2AL4A 5M2VA 4O3BA 5KCJA 4H0WA 2GFEA 2I0BA 3M8UA 4KPTA 1QJMA 4PFWA 3K1PA 2QL3A 5DTBA 2H9BA 3G3KA 2F97A 1DMBA 3FXQA 3M3FA 3GLBA 4X1BA 1CB6A 3GBBA 4YB5A 3KJTA 4R9GA 1FQAA 3BKIB 4ZEBA 4TOZA 1EH3A 3TYHA 3C4MA 4EQBA 5FHMA 4QFKA 4R6KA 4IO2A 2IEEA 1QUKA 2RC8A 3O6IA 4GRKA 3N5LA 1KWHA 1AMFA 2O69A 4X48A 5ITOA 4OZ9A 5B7DA 4RA1A 2VD2A 5H8HA 1ZTYA 1B4ZA 4QRZA 3WAFA 4UA8A 4EF1A 4H1XA 4LA9A 4ZS9A 1MH4A 3FGSA 3K6WA 1LGBC 4XXUA 4RJZA 4FIMA 3IB1A 3H6VA 3B6TA 4UACA 4DDDA 3IO6A 4R74A 1ZIUA 4ELQA 3OENA 1MY0A 1XC1A 4YB6A 4QSDA 1US4A 3VFJA 4IGRA 4F1YA 3HO7A 4O3CA 1T0KA 1I6QA 1UTBB 4O3AA 1N0TA 4YMAA 3U72A 2GHAA 3MP8A 1LLSA 1B7UA 3OO7A 4MFIA 5IAIA 4Z0IA 2V93A 4RK2A 1YAEA 3HSTA 1OQHA 4OENA 4OEUA 5L9MA 1IEJA 3CSBA 3OEKA 2QS1A 2O84X 3EHSA 5TP9A 1OLCA 1MQJA 2XX9A 2PT2A 2VP1A 3QAXA 2DOJA 4BDMA 2Q88A 3PMXA 1M5BA 2XXXA 1JQFA 2X26A 4F29A 1UTBA 1N76A 3PU5A 5DVFA 3IO4A 2XXVA 2ABHA 2R6GE 2ZMBA 4RK9A 4DXCA 4LZ7A 1A40A 1OLAA 3T66A 4LONB 4F3BA 2DWAA 1BKAA 4KQPA 1LBBA 3TMGA 1IQ7A 2HAVA 3FJMA 4OVJA 1A54A 1BLFA 4QHQA 2F5XA 5H8QB 2Y7IA 3SEVA 3ZKLA 4QF9A 3JZJA 3TFLA 1QVSA 1QUIA 3TCGA 1N7WA 3KOSA 4TLLB 1A55A 1P1UA 2Y7WA 1TT1A 4JBZA 1GV8A 3N94A 5DVIA 1NFTA 5CBRA 3FVKA 4HCWA 4N6PA 5K2XA 5BWJA 3GXAA 5H8NA 3T93B 4GL8A 3ILTB 4R6YA 5TPAB 3ZS6A 1LFGA 4Q8RA 1Q1KA 3MW0A 3K1NA 1Y9UA 4ONYA 3DP6A 2CZLA 1POTA 3IOVA 4R73A 5DYHA 3GZGA 1B32A 4ZZEA 1B46A 2O7IA 4F1UA 3MJNA 2F7BA 3B6WA 5H8QA 2M8CA 2Y7RA 2DWIA 2E0SA 4U1ZA 2DP8A 4XKQA 1AH5A 5I56B 3S9NC 3G7WA 3O28A 2R9JA 2DE4A 3QYTA 4FE8A 1TWYA 2HQ0A 1B1HA 1MM7A 3DP4A 3O2AA 1N3WA 4TLMB 5H8NB 4M1VA 2HXWA 5TPAA 5KZTA 1JEVA 3I3VA 4YAHX 1UTHB 2H98A 3PD8A 1MDQA 1NNTA 5FTHA 3TPAA 3H7MA 1Y4TA 1B3FA 3H4ZA 4HS7A 1D9VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F19 A;  2I58 A;  1LAH E;  1D4N A;  1M5D A;  2HAU A;  3EPE A;  3O66 A;  2UVJ A;  2Y7K A;  3Q27 A;  1I6B A;  1P1W A;  1POY 1;  1NH7 A;  2UYF A;  1BP5 A;  4RNS A;  2Z8D A;  2XXI A;  3FV1 A;  3QIM A;  5FTI A;  4F1V A;  2HFB A;  1NKX A;  1NL5 A;  4F3P A;  3LBS A;  3RTW B;  1PB8 A;  4RY1 A;  4H5F A;  3O97 A;  3SEW A;  4BDO A;  3FJG A;  2RCA A;  3KN3 A;  1SW4 A;  3CR9 A;  4NWD A;  4BDN A;  4POW A;  3SKP A;  5EYF A;  2DVZ A;  2ZNS A;  3T22 A;  1H43 A;  2Y84 A;  1FQE A;  3PUV E;  1URD A;  5I57 A;  4G68 C;  4KD5 A;  2D3I A;  2I3W A;  1ANF A;  4E0X A;  2NOO A;  3QUF A;  4FEC A;  4GVO A;  1MY4 A;  2QMW A;  3Q29 A;  4OHN A;  4OYV A;  4QFL A;  3M3L A;  3SER A;  4BDR A;  1D9Y A;  1IXG A;  3MAM A;  1LCT A;  3WAE A;  1RKM A;  3PUZ E;  1DSN A;  3KN7 A;  3QSL A;  5I56 A;  5TU0 A;  1Y1M A;  2F6G A;  3PPN A;  4G8H A;  2ZXT A;  3VXC A;  1FTM A;  1DOT A;  2F78 A;  4JSO A;  4F39 A;  1EZ9 A;  4ND9 A;  4OET A;  4OMB A;  1FQF A;  4XTC Q;  4DIG A;  4KCC A;  1PDA A;  4GXS B;  4F2Q A;  1MXZ A;  4KYE A;  4EQ7 A;  3A3C A;  4PQJ A;  5ELV A;  1PC3 A;  1LB8 A;  4NMY A;  4YKJ A;  1D3K A;  1MQH A;  3N6T A;  1WDN A;  1S7Y A;  2X7Q A;  2DS9 A;  3VXB A;  4ZEC A;  3EF7 A;  3JYR A;  1FQD A;  2PVU A;  3K00 A;  3E9X A;  4PP0 A;  4ESW A;  2OZZ A;  3CFZ A;  1NNF A;  5F1Q A;  1S50 A;  4M4G A;  1FQB A;  3SEU A;  1ELJ A;  1TXF A;  2DSF A;  3PPR A;  3B6Q A;  2A5S A;  4KYD A;  4N13 A;  3TEL A;  3EN3 A;  3K1M A;  5L8D A;  4ECF A;  1I6A A;  3USD A;  4AB6 A;  4F22 A;  1MQI A;  2QMX A;  4KI0 E;  4R72 A;  5K2Y A;  3RN8 A;  2QJE A;  3C33 A;  4PE5 B;  4TQU Q;  3H03 A;  3G3F A;  4I1D A;  4IO7 A;  4I62 A;  3K2D A;  1B9J A;  1HSJ A;  3PD9 A;  4U4X A;  4ISU A;  3K6X A;  2VOZ A;  5HBC A;  5B70 A;  5I59 A;  2NWJ A;  2ZYO A;  4BDQ A;  4X1D A;  3MUQ A;  2VD3 A;  3FUZ A;  4R75 A;  3O6H A;  4ELO A;  1Z7N E;  4ZE9 A;  3S9L C;  2FYI A;  2XD2 A;  1GVC A;  4U4S A;  3IAZ A;  1MG1 A;  5TP9 B;  2GH9 A;  4DZ1 A;  2HZL A;  4EQ9 A;  3FZV A;  1URS A;  3LSL A;  4XKN A;  4H65 A;  1B3E A;  1SBP A;  4QFN A;  4BDL A;  5JEI A;  4WKM A;  2RF1 A;  5ISU A;  2O68 A;  3A3U A;  1XS5 A;  4JXI A;  5I57 B;  3L6H A;  5FHN A;  1IXI A;  3MVY A;  3VLW A;  3V8X B;  5AA4 B;  3FXU A;  5I2N A;  3TUS A;  2F8D A;  3LUY A;  2FA7 A;  4POX A;  4EXL A;  4FAT A;  5A5X B;  3RY3 A;  1IIT A;  1SD3 A;  3FVN A;  4Q5T A;  5CM6 A;  4FED A;  2DXY A;  4OWD A;  3U1O A;  1B52 A;  2CMO A;  5LOM A;  1JVY A;  2P1S A;  2NXO A;  4NF6 A;  1MPD A;  3MP1 A;  5H8S A;  4ZEF A;  1PBP A;  1Q35 A;  4F18 A;  4XIG Q;  1IZ1 A;  1M5F A;  1NH8 A;  1XVX A;  1XT8 A;  1TFA A;  4JDF A;  3TCF A;  3C34 A;  3PPP A;  1JET A;  2XX8 A;  3I5O A;  4G8M A;  1L5T A;  2ONK E;  3THI A;  2UXA A;  4U23 A;  3UA8 A;  5DEX B;  3D4G A;  3HPI A;  3N26 A;  3IJX B;  1MPB A;  3LSW A;  4RXL A;  3VVD A;  3SDF A;  4E0W A;  2RKM A;  2ALU A;  2F7A A;  5A5X A;  3PGF A;  3UK4 A;  2THI A;  3H06 B;  1VFD A;  1B4H A;  3IK6 B;  3KZG A;  4NWC A;  2XXT A;  3P7I A;  1N3X A;  3W9W A;  1B5J A;  1Y3Q A;  2O51 A;  1Y4C A;  2H4I A;  2OWS A;  3BBR A;  1FTO A;  3G3I A;  4OXV A;  1R1N A;  3MC2 A;  4LZ8 A;  3RLF E;  3VV5 A;  2H25 A;  1IXC A;  4U21 A;  1SVX B;  1MDP 1;  1OQG A;  1SYH A;  2PMS A;  3CSG A;  1MXY A;  3H6U A;  1GTK A;  3MQ9 A;  3K0V A;  4HCY A;  4OES A;  3V89 B;  2I4B A;  2ANJ A;  4JWY A;  1IUD A;  1GR2 A;  1B5I A;  5AA3 A;  2QPQ A;  4OER A;  5HM4 B;  1J1N A;  2PBW A;  5JTY A;  5L9S A;  4YZZ A;  1B6H A;  4ZED A;  1B40 A;  4C1T A;  1SDX A;  2G93 A;  4PFU A;  5AA1 A;  5I59 B;  3CG3 A;  1A7L A;  1LST A;  3K6V A;  2E1S A;  3KBR A;  1P1N A;  3K4U A;  3LSX A;  2Q9T A;  4G68 B;  1XOC A;  4NF8 B;  4P0I A;  3VE1 B;  4R2F A;  1B58 A;  1R9L A;  1OVT A;  1Z7M E;  2UVI A;  3MVZ A;  2ESN A;  1YCJ A;  4KFQ A;  3TEP A;  2FNC A;  3LSF B;  4THI A;  3OOA A;  3RPW A;  1B0L A;  1SW2 A;  1MRP A;  3OSR A;  3FIR A;  1MXU A;  1O64 A;  3QUJ A;  3TAJ A;  3E4R A;  1IIW A;  1QUL A;  3G3G A;  3DEL B;  1OIB A;  2AL5 A;  4P11 A;  4LUB A;  1OMP A;  1VR5 A;  1H3D A;  2Z23 A;  3CRB A;  3VDF A;  2LAO A;  1B51 A;  1QKA A;  2X7P A;  4JWX A;  5JTY B;  1VFE A;  3TTL A;  4U22 A;  2DYX A;  3UGW A;  1A8F A;  4GL0 A;  3W9V A;  4DXB A;  3QK6 A;  2PYY A;  3MBP A;  4IO3 A;  4GOT A;  3IX1 A;  5DEX A;  3PMW A;  1URG A;  3UIF A;  1RYO A;  2DWH A;  5CI5 A;  2DQV A;  3SEX A;  2NUV A;  3PMV A;  4LAT A;  4P0G A;  3D4C A;  3C31 A;  3IB2 A;  4NTL A;  3IOT A;  3TOD A;  3TDJ A;  3MVW A;  4ZDM A;  5I58 A;  3EHT A;  3UP9 A;  1MY1 A;  3S2V A;  3CFL A;  5AA2 D;  2OLB A;  5KDT B;  3PPQ A;  5AA2 B;  1LFH A;  2REJ A;  3LR1 A;  3RT8 A;  4G2Z A;  3S9E A;  1B5H A;  1B3G A;  3CI8 A;  4GXA A;  4XKP A;  1ZJL A;  3U94 A;  4AB5 A;  5CC2 A;  3Q26 A;  5I2K A;  3MZB A;  3OEL A;  1Y3N A;  2QS3 A;  1WOD A;  2YLN A;  4DCY A;  1SYI A;  4WEP A;  3G3H A;  1SW5 A;  1XHY A;  3KOT A;  4NED A;  3TTN A;  1NNP A;  1MY3 A;  2XX7 A;  3HCQ A;  3G3J A;  3IJO B;  4YKK A;  3RUM A;  3QXM A;  1M5E A;  3IL1 B;  3T9X B;  3ZKK A;  2F36 A;  3HHF A;  3U92 A;  1DPP A;  3RGY A;  3RNN A;  2H5Y A;  1FQC A;  3B7D A;  4NF8 A;  1SI0 A;  2G29 A;  2Q89 A;  4OQO A;  3RT6 B;  4H8I A;  1RYX A;  3N6U A;  2YPN A;  4DCX A;  1IXH A;  4G4P A;  2Z8E A;  4LQ2 A;  2DVC A;  2REG A;  3MPK A;  2ONR A;  4PET A;  3RQT A;  2F34 A;  2BJJ X;  3H6T A;  1PB7 A;  5H8F B;  1B7Z A;  3H6W A;  1R6Z A;  4ZEI A;  2P2A A;  1ZLQ A;  2I49 A;  1SI1 A;  4DLD A;  4XKR A;  3TKD A;  1A99 A;  1MPC A;  4IO4 A;  3HV1 A;  4G68 A;  1B1X A;  2UVG A;  3FJ7 A;  4JB7 A;  4WED A;  4RPO A;  2YJP A;  1B2H A;  3R6U A;  3KN8 A;  3MZ1 A;  1SQY A;  1MXW A;  1B7H A;  1LB9 A;  1N84 A;  1UIU A;  4GWO A;  3SEY A;  2OK2 A;  4EDP A;  4HW8 A;  4F3S A;  2V3Q A;  5AE4 A;  2PT1 A;  4OEV A;  2RC7 A;  2XXW A;  3W15 C;  1FW0 A;  3PPO A;  1B05 A;  3Q25 A;  3UN6 A;  2UYE A;  1PBQ A;  3PV0 E;  4LZ5 A;  1QW0 A;  5F7V A;  1S9T A;  3C32 A;  4L17 A;  3K01 A;  3T9V A;  3IOW A;  3TTK A;  4G8N A;  1H44 A;  4DXU A;  1WVJ A;  2OCU A;  5I58 B;  5KCJ B;  1AIV A;  3C9H A;  3I6V A;  3VLU A;  4GLI A;  4F2O A;  3CFX A;  5KDT A;  3IOU A;  3TTR A;  2W7Y A;  5I2N B;  1AL3 A;  2KLF A;  3KSJ A;  3TCH A;  1P99 A;  2I6E A;  3PUY E;  4U2R A;  4I8C A;  2XXQ A;  2B3B A;  2XHD A;  1HSL A;  5ITP A;  1MXX A;  4OFJ A;  4H67 A;  3LC8 A;  2D21 A;  1ZMG A;  2ONS A;  1EU8 A;  1LBC A;  2O7U A;  3V83 A;  3FVO A;  5ICQ A;  4EXK A;  1GGG A;  3ONM A;  2ZNU A;  1XVY A;  4NF6 B;  1MQG A;  1H45 A;  1VSO A;  3E3K A;  4YU0 A;  4ELR A;  2I3V A;  3MVX A;  3S4U A;  1MM6 A;  1HSE A;  1LAX A;  5AA2 A;  5BUU A;  5L9O A;  3R26 A;  3K02 A;  2HEU A;  1PEB A;  2PX1 A;  3C35 A;  4IB2 A;  4MLV A;  1N04 A;  2XXY A;  3OMB A;  4AQ4 A;  1US5 A;  3BFT A;  4I9D A;  5AA4 A;  4MH5 A;  1ZU0 A;  1LFI A;  4Q0C A;  2H99 A;  5JK4 A;  2GHB A;  4LP2 B;  5H8F A;  4FAJ A;  3IR1 A;  2AIX A;  3KSX A;  4QFO A;  2RCB A;  4R2B A;  2P0S A;  3O9P A;  4IO5 A;  5EHM A;  5FHO A;  3DLN A;  5DVJ A;  4YMB A;  2Q8J A;  2QS2 A;  2O1M A;  4K3F A;  1DTZ A;  4EUO A;  4MBP A;  1FTJ A;  3ECR A;  3TTM A;  4F3G A;  1ZKB A;  2DE3 A;  2NVU B;  1B3H A;  2V84 A;  4GF8 A;  1Y20 A;  1AOV A;  1PB9 A;  1UIV A;  1BTJ A;  2VHA A;  2B65 A;  2OBG A;  3FAT A;  4GFR A;  4GQO A;  4IY5 A;  3KJ7 A;  2WKY A;  2XXR A;  2HCA A;  1JVX A;  1OVB A;  4IO6 A;  3MP6 A;  2IA4 A;  2QRY A;  3KGC A;  3CIJ A;  1MXV A;  3OO6 A;  4GD5 A;  4BLA A;  3EQ1 A;  1MH3 A;  4KCD A;  4ELP A;  4F31 B;  2OJT A;  3GBA A;  1USY H;  3FVG A;  2UVH A;  4FEB A;  1YPN A;  5CMM A;  5CMC A;  1N7X A;  3FV2 A;  5HPQ A;  3T9H B;  1P1O A;  1F9B A;  2I48 A;  2Q2A A;  2VGQ A;  1MS7 A;  1LCF A;  3Q28 A;  1JW1 A;  3H3G A;  5CRY A;  3IB0 A;  2DWJ A;  2O6A A;  2RC9 A;  3T9U A;  1YTV A;  2R71 A;  2QSX A;  2ZYM A;  4Q30 B;  3TQW A;  2OWT A;  1Y1Z A;  3KEI A;  1TFD A;  1M5C A;  2F6P A;  2XD3 A;  3MPL A;  3PUX E;  4H5G A;  4OFL A;  4WXJ A;  1USY E;  4KHZ E;  4RYA A;  3ILU B;  1MQD A;  2V25 A;  4YB7 A;  1DTG A;  1JEU A;  3E13 X;  1FTL A;  3ZSF A;  3S9M C;  4FOR A;  4QSC A;  1FCK A;  1JW5 A;  4YKI A;  4KR5 A;  3ODB A;  1II5 A;  4LQ5 A;  3HN0 A;  2F35 A;  2ZYK A;  4H6D A;  3CVG A;  4NF4 A;  1ATG A;  4KYS A;  4GIZ A;  3OXN A;  1MY2 A;  1SW1 A;  1B0H A;  4H8J A;  4X9T A;  3T96 B;  3UOR A;  5J1D A;  3A09 A;  4G77 A;  2GRV A;  2ZNT A;  5I84 A;  3IOR A;  4ZZA A;  1UQW A;  3JV9 A;  4C0R A;  1EZP A;  1VE4 A;  2DE2 A;  5CBS A;  4IGT A;  3EHU A;  4R6H A;  3PUW E;  2AYS A;  4MLQ A;  5I2K B;  1BIY A;  1LAG E;  3M3K A;  4EF2 A;  4Z7E A;  2RIN A;  1UTH A;  4OFO A;  4NE4 A;  4FJP A;  3U93 A;  2XXP A;  1DPE A;  1QKB A;  4HTG A;  3BFU A;  4JWO A;  3CG1 A;  4YIC A;  4ZE8 A;  1R9Q A;  3OD7 A;  3TZA A;  2O1L A;  4PFY A;  3V5A A;  3RTF B;  3VVF A;  5H8H B;  1CE2 A;  4RPN A;  3MWB A;  3OEM A;  1H76 A;  3O29 A;  2A5T A;  2ZYN A;  4NF4 B;  2Y7P A;  4NF5 B;  5CMB A;  3SES A;  3VVE A;  5ICT A;  4PFT A;  4IY6 A;  1P1Q A;  3DP8 A;  3MZ9 A;  4ESX A;  5CMK A;  2XXU A;  2QS4 A;  1NNK A;  2D5W A;  2Q2C A;  2Z8F A;  4U1O A;  3KFM A;  3OO8 A;  3F11 A;  3DM0 A;  4C1U A;  3U8Q A;  1A8E A;  2Z22 A;  1B3L A;  1Y3P A;  1QUJ A;  1ZBM A;  3HHG A;  4JSD A;  1LAF E;  1JNF A;  4YKP A;  4DE8 A;  1O7T A;  4ZEK A;  3SET A;  2XXH A;  1I69 A;  2HZK A;  3O6G A;  1O63 A;  3FXR A;  1FTK A;  1NMU A;  3L6G A;  4MF3 A;  3VLV A;  3KG2 A;  3FD3 A;  4N07 A;  3TQL A;  4QFP A;  2A5T B;  4NF5 A;  2V3T A;  2I4C A;  3OO9 A;  3R7X A;  4QSE A;  4LVQ A;  5DT6 A;  5IKB A;  3K6U A;  2B3F A;  2DXR A;  3AXF A;  4OTE A;  5EHS A;  1JW4 A;  3FAS A;  3OSQ A;  2F7C A;  1EZO A;  4R9F A;  2V3U A;  2I0C A;  3C36 A;  2AL4 A;  5M2V A;  4O3B A;  5KCJ A;  4H0W A;  2GFE A;  2I0B A;  3M8U A;  4KPT A;  1QJM A;  4PFW A;  3K1P A;  2QL3 A;  5DTB A;  2H9B A;  3G3K A;  2F97 A;  1DMB A;  3FXQ A;  3M3F A;  3GLB A;  4X1B A;  1CB6 A;  3GBB A;  4YB5 A;  3KJT A;  4R9G A;  1FQA A;  3BKI B;  4ZEB A;  4TOZ A;  1EH3 A;  3TYH A;  3C4M A;  4EQB A;  5FHM A;  4QFK A;  4R6K A;  4IO2 A;  2IEE A;  1QUK A;  2RC8 A;  3O6I A;  4GRK A;  3N5L A;  1KWH A;  1AMF A;  2O69 A;  4X48 A;  5ITO A;  4OZ9 A;  5B7D A;  4RA1 A;  2VD2 A;  5H8H A;  1ZTY A;  1B4Z A;  4QRZ A;  3WAF A;  4UA8 A;  4EF1 A;  4H1X A;  4LA9 A;  4ZS9 A;  1MH4 A;  3FGS A;  3K6W A;  1LGB C;  4XXU A;  4RJZ A;  4FIM A;  3IB1 A;  3H6V A;  3B6T A;  4UAC A;  4DDD A;  3IO6 A;  4R74 A;  1ZIU A;  4ELQ A;  3OEN A;  1MY0 A;  1XC1 A;  4YB6 A;  4QSD A;  1US4 A;  3VFJ A;  4IGR A;  4F1Y A;  3HO7 A;  4O3C A;  1T0K A;  1I6Q A;  1UTB B;  4O3A A;  1N0T A;  4YMA A;  3U72 A;  2GHA A;  3MP8 A;  1LLS A;  1B7U A;  3OO7 A;  4MFI A;  5IAI A;  4Z0I A;  2V93 A;  4RK2 A;  1YAE A;  3HST A;  1OQH A;  4OEN A;  4OEU A;  5L9M A;  1IEJ A;  3CSB A;  3OEK A;  2QS1 A;  2O84 X;  3EHS A;  5TP9 A;  1OLC A;  1MQJ A;  2XX9 A;  2PT2 A;  2VP1 A;  3QAX A;  2DOJ A;  4BDM A;  2Q88 A;  3PMX A;  1M5B A;  2XXX A;  1JQF A;  2X26 A;  4F29 A;  1UTB A;  1N76 A;  3PU5 A;  5DVF A;  3IO4 A;  2XXV A;  2ABH A;  2R6G E;  2ZMB A;  4RK9 A;  4DXC A;  4LZ7 A;  1A40 A;  1OLA A;  3T66 A;  4LON B;  4F3B A;  2DWA A;  1BKA A;  4KQP A;  1LBB A;  3TMG A;  1IQ7 A;  2HAV A;  3FJM A;  4OVJ A;  1A54 A;  1BLF A;  4QHQ A;  2F5X A;  5H8Q B;  2Y7I A;  3SEV A;  3ZKL A;  4QF9 A;  3JZJ A;  3TFL A;  1QVS A;  1QUI A;  3TCG A;  1N7W A;  3KOS A;  4TLL B;  1A55 A;  1P1U A;  2Y7W A;  1TT1 A;  4JBZ A;  1GV8 A;  3N94 A;  5DVI A;  1NFT A;  5CBR A;  3FVK A;  4HCW A;  4N6P A;  5K2X A;  5BWJ A;  3GXA A;  5H8N A;  3T93 B;  4GL8 A;  3ILT B;  4R6Y A;  5TPA B;  3ZS6 A;  1LFG A;  4Q8R A;  1Q1K A;  3MW0 A;  3K1N A;  1Y9U A;  4ONY A;  3DP6 A;  2CZL A;  1POT A;  3IOV A;  4R73 A;  5DYH A;  3GZG A;  1B32 A;  4ZZE A;  1B46 A;  2O7I A;  4F1U A;  3MJN A;  2F7B A;  3B6W A;  5H8Q A;  2M8C A;  2Y7R A;  2DWI A;  2E0S A;  4U1Z A;  2DP8 A;  4XKQ A;  1AH5 A;  5I56 B;  3S9N C;  3G7W A;  3O28 A;  2R9J A;  2DE4 A;  3QYT A;  4FE8 A;  1TWY A;  2HQ0 A;  1B1H A;  1MM7 A;  3DP4 A;  3O2A A;  1N3W A;  4TLM B;  5H8N B;  4M1V A;  2HXW A;  5TPA A;  5KZT A;  1JEV A;  3I3V A;  4YAH X;  1UTH B;  2H98 A;  3PD8 A;  1MDQ A;  1NNT A;  5FTH A;  3TPA A;  3H7M A;  1Y4T A;  1B3F A;  3H4Z A;  4HS7 A;  1D9V A; 
#chains in the Genus database with same CATH topology
 4F19 A;  2FHY A;  4YKK A;  4RNS A;  1FPB A;  1I6B A;  1P1W A;  3Q27 A;  1BP5 A;  2Z8D A;  1NL5 A;  4P56 A;  4RY1 A;  5EQ8 A;  3CR9 A;  4NWD A;  4POW A;  3PUV E;  4E0X A;  5AA4 A;  1MY4 A;  3M3L A;  3QSL A;  5I56 A;  2F6G A;  3PPN A;  4G8H A;  1FTM A;  4JSO A;  4N6D A;  1FJ6 A;  1MXZ A;  4PQJ A;  1LB8 A;  2HPG A;  3N6T A;  2PCR A;  4ZEC A;  2VPN A;  4AS5 A;  2PVU A;  3E9X A;  2R8T A;  1ELJ A;  1TXF A;  2DSF A;  3EN3 A;  4AB6 A;  1RDZ A;  1B9J A;  1HSJ A;  1LBZ A;  3K6X A;  2NWJ A;  3CHG A;  3MUQ A;  3FUZ A;  4R75 A;  3S9L C;  3O6H A;  1Z7N E;  2FYI A;  2XD2 A;  3IAZ A;  5TP9 B;  4EQ9 A;  2GH9 A;  1B3E A;  4WKM A;  1XS5 A;  2QFL A;  5FHN A;  1IXI A;  3MVY A;  4P47 A;  3LUY A;  4FAT A;  3FVN A;  4FED A;  2DXY A;  4OWD A;  2P1S A;  2NXO A;  1MPD A;  3MP1 A;  4ZEF A;  4F18 A;  1XVX A;  2WBB A;  2XX8 A;  2UXA A;  3HPI A;  3VVD A;  3IJX B;  4E0W A;  2RKM A;  2F7A A;  2THI A;  3H06 B;  1VFD A;  4MNP A;  3P7I A;  4FBP A;  2XXK A;  1Y4C A;  1BK4 A;  4LZ8 A;  4U21 A;  1CNQ A;  1OQG A;  2PMS A;  3CSG A;  3MQ9 A;  3V89 B;  4HCY A;  1IUD A;  3IFC A;  2QPQ A;  5HM4 B;  1J1N A;  4YZZ A;  1B6H A;  1SDX A;  4PFU A;  1LST A;  3VVE A;  2UVI A;  3HFU A;  3LSF B;  1B0L A;  3OSR A;  1MXU A;  3TAJ A;  3G3G A;  2AL5 A;  5IM2 A;  1FBH A;  1H3D A;  1DBZ A;  3VDF A;  1VFE A;  5EYG A;  3MBP A;  4X8R A;  3IX1 A;  1RYO A;  3LV0 A;  4P0G A;  3C31 A;  3TDJ A;  5AA2 D;  5KDT B;  3RT8 A;  4P1E A;  3MZB A;  1Y3N A;  2QS3 A;  1WOD A;  1SYI A;  4NED A;  1NNP A;  3HCQ A;  3RUM A;  3T9X B;  3ZKK A;  3RGY A;  3RT6 B;  4H8I A;  1FJ9 A;  2YPN A;  4G4P A;  2REG A;  3MPK A;  2ONR A;  3RQT A;  2BJJ X;  1ZLQ A;  4DLD A;  4XKR A;  3TKD A;  1A99 A;  4G68 A;  4RPO A;  4GWO A;  1SQY A;  5DW8 A;  1N84 A;  3SEY A;  4EDP A;  4HW8 A;  5AE4 A;  2V3Q A;  4H45 A;  2PT1 A;  2XXW A;  4N8G A;  2UYE A;  3BIH A;  5F7V A;  3C32 A;  1AIV A;  1JP4 A;  3I6V A;  3IOU A;  5EQA A;  2JJK A;  2XXQ A;  4N15 A;  2XHD A;  1HSL A;  4OFJ A;  1NUX A;  3V83 A;  2Y5L A;  2FIX A;  1MQG A;  1H45 A;  3S4U A;  1MM6 A;  5BUU A;  5L9O A;  3K02 A;  2HEU A;  2PX1 A;  3C35 A;  4IB2 A;  1N04 A;  3OMB A;  4AQ4 A;  3BFT A;  2GHB A;  3IR1 A;  3KSX A;  4R2B A;  2P0S A;  5FHO A;  3BIG A;  3DLN A;  5DVJ A;  2O1M A;  4MBP A;  1FTJ A;  3ECR A;  1ZKB A;  2DE3 A;  2NVU B;  4G61 A;  2V84 A;  1AOV A;  1Y20 A;  1IMA A;  1UIV A;  2B65 A;  4GFR A;  4IY5 A;  4P1L A;  3KJ7 A;  1JVX A;  4GD5 A;  4ELP A;  4NN3 A;  5CMM A;  2Q2A A;  3Q28 A;  1NV0 A;  2O6A A;  2FIE A;  2ZYM A;  3KEI A;  2XD3 A;  1RDY A;  1JEU A;  1FTL A;  1NI9 A;  3S9M C;  4QSC A;  1JW5 A;  4N4U A;  4H6D A;  4NF4 A;  4KYS A;  4GWS A;  4X9T A;  3UOR A;  5J1D A;  3A09 A;  1UQW A;  4MLQ A;  1LAG E;  1IMC A;  2FBP A;  2XWK A;  1QKB A;  4HTG A;  4JWO A;  4PTK A;  4YIC A;  1R9Q A;  4PFY A;  5I5P A;  3VVF A;  4JVD A;  4NF4 B;  1H76 A;  5CMB A;  4NF5 B;  3SES A;  1P1Q A;  3DP8 A;  4ESX A;  2XXU A;  2Z8F A;  4U1O A;  3OO8 A;  3DM0 A;  4C1U A;  1QUJ A;  1Y3P A;  3HHG A;  4DI4 B;  1LAF E;  3SET A;  2XXH A;  1O63 A;  3KG2 A;  4NF5 A;  3R7X A;  3K6U A;  4OTE A;  3C36 A;  3M8U A;  4KPT A;  4PFW A;  3K1P A;  2H9B A;  3G3K A;  1DMB A;  2CEX A;  4X1B A;  3GBB A;  4R9G A;  4TOZ A;  3C4M A;  4QFK A;  4R6K A;  2RC8 A;  5ITO A;  5H8H A;  4LA9 A;  1MH4 A;  2F3B A;  3H6V A;  3IO6 A;  4ELQ A;  1XC1 A;  1Q9D A;  4IGR A;  4YMA A;  2GHA A;  3MP8 A;  1LLS A;  4Z0I A;  2PFY A;  2B4M A;  3CSB A;  3OEK A;  2WYP A;  2DDK A;  3EHS A;  5TP9 A;  2DOJ A;  4BDM A;  1EYK A;  3PMX A;  2XXV A;  2ABH A;  4RK9 A;  3T66 A;  4LON B;  2DWA A;  1BKA A;  2QVV A;  2HAV A;  5H8Q B;  3ZKL A;  3TFL A;  1QVS A;  3GYY A;  5DVI A;  2Q8M A;  1NFT A;  5K2X A;  4GL8 A;  3ILT B;  5TPA B;  4R73 A;  5EQ7 A;  5H8Q A;  2M8C A;  2E0S A;  2R9J A;  4FE8 A;  3KC1 A;  1MM7 A;  4TLM B;  5KZT A;  5TPA A;  1JEV A;  5T3J A;  1MDQ A;  1NNT A;  1B3F A;  1D9V A;  2OX3 A;  2V4C A;  1LAH E;  2HAU A;  3EPE A;  4F1V A;  3FV1 A;  3RTW B;  4BDO A;  2RCA A;  3KN3 A;  3T22 A;  1FQE A;  5I57 A;  1FBG A;  2NOO A;  3B8B A;  4OA4 A;  2QMW A;  4OHN A;  4QFL A;  3SER A;  1RKM A;  1DSN A;  1DOT A;  4OMB A;  1FQF A;  2L5V A;  4XTC Q;  4GWW A;  2HHM A;  4KCC A;  4GXS B;  4F2Q A;  4YKJ A;  1FPE A;  1MQH A;  1S7Y A;  2X7Q A;  3VXB A;  2ZZX A;  4LN5 A;  2OZZ A;  4M4G A;  1FQB A;  3B6Q A;  4P9K A;  5L8D A;  4F22 A;  1MQI A;  5K2Y A;  3C33 A;  3H03 A;  1RDX A;  4IO7 A;  4I1D A;  3PD9 A;  3A29 A;  5HBC A;  4MIJ A;  4X1D A;  2VD3 A;  4GX6 A;  4ZE9 A;  4DZ1 A;  4JXI A;  3VLW A;  2F8D A;  1K9Z A;  4EXL A;  1IIT A;  1SD3 A;  5CM6 A;  1NV6 A;  1TFA A;  1JET A;  3THI A;  5DEX B;  3D4G A;  3N26 A;  3SDF A;  2Q74 A;  2XXT A;  1Y3Q A;  3MC2 A;  3VV5 A;  2H25 A;  1IXC A;  1LBW A;  1MXY A;  2ANJ A;  4OER A;  5L9S A;  4ZED A;  4C1T A;  5I59 B;  5AA1 A;  3K6V A;  4H1X A;  3LSX A;  3KBR A;  4NF8 B;  5IZ3 B;  2Q9T A;  4GBV A;  4OVS A;  3VE1 B;  1B58 A;  1R9L A;  1Z7M E;  1EYJ A;  4KFQ A;  3RPW A;  3DEL B;  2Z23 A;  4JWX A;  4U22 A;  3UGW A;  4DXB A;  1DCU A;  4GOT A;  1URG A;  4OVT A;  3UIF A;  3SEX A;  5CI5 A;  1EYI A;  3MVW A;  5I58 A;  1MY1 A;  5AA2 B;  4PFI A;  1B5H A;  1B3G A;  3S9E A;  1ZJL A;  3Q26 A;  2YLN A;  4DCY A;  3TTN A;  5LTC A;  1SW5 A;  3QXM A;  2F3D A;  2MKZ A;  1FQC A;  3B7D A;  1NV4 A;  3H6T A;  1PB7 A;  5H8F B;  3H6W A;  4ZEI A;  2I49 A;  1SI1 A;  1MPC A;  4IO4 A;  2UVG A;  2YJP A;  3KN8 A;  1MXW A;  1B7H A;  1LB9 A;  1UIU A;  4F3S A;  4OEV A;  3W15 C;  1FW0 A;  1B05 A;  3Q25 A;  3UN6 A;  1PBQ A;  1S9T A;  2CZK A;  3K01 A;  4G8N A;  2OCU A;  5LDZ A;  4GLI A;  5KDT A;  3CFX A;  4UAB A;  5I2N B;  3KSJ A;  3PUY E;  5F24 A;  5ET6 A;  3LC8 A;  1ZMG A;  1EU8 A;  5ICQ A;  2ZNU A;  4ELR A;  4YU0 A;  2I3V A;  4MLV A;  1PEB A;  5A5L A;  4I9D A;  4MH5 A;  2H99 A;  4FAJ A;  3MST A;  4PDH A;  5ESY A;  1B3H A;  1FBD A;  1PB9 A;  1BTJ A;  3FAT A;  5I7I A;  1OVB A;  2HXR A;  4BLA A;  4FEB A;  2UVH A;  1N7X A;  1P1O A;  1SPI A;  2VGQ A;  4I3E A;  4NX1 A;  1JW1 A;  5CRY A;  3IB0 A;  2DWJ A;  1YTV A;  2QSX A;  4Q30 B;  3TQW A;  1Y1Z A;  1M5C A;  2F6P A;  4MAG A;  1FPK A;  3ILU B;  2V25 A;  4OAN A;  1FCK A;  4YKI A;  1II5 A;  2XWO A;  4LQ5 A;  2F35 A;  2ZYK A;  4XFE A;  4GIZ A;  3OXN A;  1MY2 A;  4G77 A;  4O8M A;  4ZZA A;  2BJI A;  5I2K B;  1BIY A;  2QVU A;  3U93 A;  2XXP A;  1DPE A;  1FBE A;  2XWV A;  5EQ9 A;  3OD7 A;  3V5A A;  3MWB A;  3OEM A;  2ZYN A;  5ICT A;  4PFT A;  3MZ9 A;  2D5W A;  3KFM A;  1A8E A;  1NV3 A;  4YKP A;  4ZEK A;  1DK4 A;  3FXR A;  5IZZ A;  1NMU A;  4MJO A;  5IKB A;  4NAP A;  2AL4 A;  4O3B A;  5KCJ A;  4H0W A;  5TU0 A;  2I0B A;  5DTB A;  3GLB A;  3BKI B;  3TYH A;  4IO2 A;  1AMF A;  2O69 A;  4RA1 A;  1B4Z A;  3K6W A;  1LGB C;  4XXU A;  4RJZ A;  4DDD A;  3IB1 A;  3B6T A;  4R74 A;  3OEN A;  1US4 A;  1KA0 A;  4O3C A;  4PBQ A;  4MFI A;  4NGU A;  5IAI A;  2Y5K A;  1IEJ A;  4MCO A;  1JQF A;  1N76 A;  3IO4 A;  2ZMB A;  2R6G E;  4KQP A;  1IQ7 A;  3TPA A;  4OVJ A;  2Y7I A;  3SEV A;  4XEQ A;  2KQZ A;  1QUI A;  4P3L A;  4TLL B;  4JBZ A;  5BWJ A;  3DP6 A;  5DYH A;  3KC0 A;  1NUZ A;  2DWI A;  4XF5 A;  3MYU A;  3DP4 A;  3I3V A;  4YAH X;  1UTH B;  2H98 A;  2QVR A;  2VT5 A;  3H4Z A;  4HS7 A;  1AWB A;  3O66 A;  2Y7K A;  1POY 1;  1NH7 A;  2UYF A;  2XXI A;  3QIM A;  2HFB A;  4F3P A;  3LBS A;  4H5F A;  4GX3 A;  1IMD A;  1URD A;  3FXB A;  4G68 C;  2CZH A;  2WBD A;  4FEC A;  4OYV A;  3Q29 A;  4BDR A;  3MAM A;  1LCT A;  4O7I A;  3WAE A;  4F39 A;  1EZ9 A;  4OET A;  4KYE A;  3A3C A;  4PFB A;  4NMY A;  1D3K A;  1WDN A;  4DI3 D;  3EF7 A;  1FQD A;  4PP0 A;  3K00 A;  3CFZ A;  2KR0 A;  5F1Q A;  1S50 A;  3PPR A;  3TEL A;  4ECF A;  1I6A A;  2QMX A;  4KXP A;  2QJE A;  4PE5 B;  3G3F A;  4I62 A;  1FPD A;  3K2D A;  4U4X A;  4ISU A;  2VOZ A;  5B70 A;  4U4S A;  1LBX A;  2HZL A;  1KA1 A;  4XKN A;  1SBP A;  5JEI A;  5ISU A;  1FBC A;  2O68 A;  3L6H A;  5I2N A;  5AA4 B;  3V8X B;  4PBH A;  4POX A;  2FA7 A;  5A5X B;  4H46 A;  5LOM A;  1B52 A;  2CMO A;  1JVY A;  1Q35 A;  4XIG Q;  4X04 A;  1IZ1 A;  1M5F A;  1NH8 A;  1XT8 A;  3TCF A;  3PPP A;  4G8M A;  1L5T A;  3LSW A;  4RXL A;  2ALU A;  5A5X A;  3UK4 A;  1B4H A;  3IK6 B;  4NWC A;  3W9W A;  1B5J A;  3BBR A;  2H4I A;  3G3I A;  1R1N A;  1SVX B;  1MDP 1;  1SYH A;  2WYK A;  4OES A;  1GTK A;  2I4B A;  1B5I A;  5AA3 A;  5JTY A;  1B40 A;  2G93 A;  1A7L A;  4G68 B;  3K4U A;  1XOC A;  3MVZ A;  3TEP A;  3E79 A;  2ESN A;  1YCJ A;  3OOA A;  1SW2 A;  1O64 A;  3E4R A;  1IIW A;  1VR5 A;  5JTY B;  1B51 A;  1NUY A;  1A8F A;  4IO3 A;  5DEX A;  3PMW A;  2DWH A;  2NUV A;  3IB2 A;  3IOT A;  1D9Q A;  3S2V A;  2OLB A;  3PPQ A;  1LFH A;  2REJ A;  4GXA A;  3CI8 A;  4AB5 A;  5I2K A;  3OEL A;  1XI6 A;  4WEP A;  3G3H A;  1XHY A;  3KOT A;  1MY3 A;  2XX7 A;  3IJO B;  3G3J A;  1M5E A;  3IL1 B;  2F36 A;  3ISP A;  1DPP A;  1G0I A;  4NF8 A;  5IZ3 A;  1RYX A;  1IXH A;  5ET8 A;  4LQ2 A;  2Z8E A;  4PET A;  1B7Z A;  3HV1 A;  4JB7 A;  1B1X A;  4WED A;  3R6U A;  4L17 A;  1FBP A;  2OK2 A;  4N91 A;  2VPO A;  3PV0 E;  1QW0 A;  4DXU A;  5KCJ B;  1WVJ A;  5I58 B;  3C9H A;  2ZZV A;  4PAI A;  4F2O A;  3TTR A;  2W7Y A;  1LEV A;  4PF6 A;  1AL3 A;  2I6E A;  4U2R A;  1MXX A;  2ONS A;  2O7U A;  4P8B A;  1GGG A;  3ONM A;  4NF6 B;  4O94 A;  5B7D A;  3MVX A;  5JK4 A;  1LFI A;  4Q0C A;  5H8F A;  2AIX A;  4QFO A;  2RCB A;  5EHM A;  4IO5 A;  4YMB A;  4PC9 A;  5EYH A;  4K3F A;  4GWY A;  2Q8J A;  1DTZ A;  3QMF A;  4F3G A;  5ET7 A;  1YYZ A;  4GF8 A;  2VHA A;  2OBG A;  2XXR A;  3MP6 A;  2QRY A;  3KGC A;  3CIJ A;  3OO6 A;  1MH3 A;  5CMC A;  3FVG A;  4I40 A;  4NHB A;  2I48 A;  4OFL A;  1TFD A;  3MPL A;  2WX9 A;  4WXJ A;  3PUX E;  4H5G A;  4PE3 A;  4KHZ E;  3E13 X;  4KR5 A;  3ODB A;  1ATG A;  2P3V A;  1SW1 A;  3T96 B;  4H8J A;  5I84 A;  3FBP A;  1EZP A;  1VE4 A;  4IGT A;  4R6H A;  2ZZW A;  3PUW E;  2WEF A;  2RIN A;  1UTH A;  4Z7E A;  4OFO A;  4ZE8 A;  4GX4 A;  3RTF B;  1CE2 A;  3O29 A;  2Y7P A;  2Q2C A;  3U8Q A;  3LUZ A;  2Z22 A;  5CC2 A;  1ZBM A;  4JSD A;  3L6G A;  4N07 A;  2V3T A;  4NF0 A;  5DT6 A;  3AXF A;  1JW4 A;  3OSQ A;  2F7C A;  2I0C A;  2GFE A;  5FTH A;  5L9M A;  1QJM A;  2QL3 A;  2F97 A;  3FXQ A;  1CB6 A;  4ZEB A;  5FHM A;  2IEE A;  1QUK A;  2GQ1 A;  4GRK A;  1KWH A;  2VD2 A;  3IFA A;  1ZTY A;  3WAF A;  4UA8 A;  4EF1 A;  4ZS9 A;  1VDW A;  4UAC A;  4PCD A;  3VFJ A;  3HO7 A;  3U72 A;  1B7U A;  4N6K A;  5IZ1 A;  2V93 A;  4RK2 A;  1YAE A;  1NV5 A;  3HST A;  4OEN A;  2QS1 A;  1MQJ A;  3QAX A;  3T0J A;  4F29 A;  2X26 A;  4JVC A;  4QBA A;  4DXC A;  1A40 A;  4F3B A;  3FJM A;  1A54 A;  4QHQ A;  2B4L A;  1A55 A;  1P1U A;  1NUW A;  3N94 A;  4HCW A;  4N6P A;  4GWX A;  5H8N A;  4Q8R A;  1Q1K A;  3MW0 A;  1Y9U A;  4ONY A;  3IOV A;  3GZG A;  4F1U A;  2F7B A;  3B6W A;  2Y7R A;  4XKQ A;  5I56 B;  3S9N C;  2DE4 A;  4GWZ A;  3QYT A;  3O2A A;  1N3W A;  5H8N B;  4M1V A;  2HXW A;  4PAK A;  3H7M A;  1INP A;  2I58 A;  1D4N A;  1M5D A;  2UVJ A;  3SEU A;  5FTI A;  4GBW A;  1NKX A;  2OWZ A;  1PB8 A;  3O97 A;  3SEW A;  3FJG A;  1SW4 A;  4BDN A;  4IR8 A;  3SKP A;  5EYF A;  2DVZ A;  2ZNS A;  1H43 A;  2Y84 A;  4KD5 A;  2D3I A;  2I3W A;  1ANF A;  5ITP A;  3QUF A;  4GVO A;  1D9Y A;  1IXG A;  3PUZ E;  3KN7 A;  1Y1M A;  2ZXT A;  3VXC A;  2F78 A;  4ND9 A;  4DIG A;  1PDA A;  4EQ7 A;  5ELV A;  1PC3 A;  2DS9 A;  3JYR A;  3NOH A;  4ESW A;  1NNF A;  4NG7 A;  4N13 A;  2A5S A;  4KYD A;  3K1M A;  3USD A;  4KI0 E;  2P3N A;  4R72 A;  3RN8 A;  4TQU Q;  1FPF A;  5FBP A;  4HXV A;  5I59 A;  3PTY A;  2ZYO A;  4BDQ A;  3U65 A;  4ELO A;  1GVC A;  1MG1 A;  3FZV A;  1URS A;  3LSL A;  4H65 A;  4QFN A;  4BDL A;  2RF1 A;  3A3U A;  5I57 B;  3FXU A;  3TUS A;  4N81 A;  3RY3 A;  4Q5T A;  3U1O A;  4MHF A;  4NF6 A;  5H8S A;  1PBP A;  4JDF A;  3C34 A;  3I5O A;  2ONK E;  4U23 A;  3UA8 A;  3KBZ A;  1MPB A;  3PGF A;  3KZG A;  1N3X A;  2O51 A;  2OWS A;  3RLF E;  1FTO A;  4OXV A;  1LBV A;  1NV1 A;  3H6U A;  3K0V A;  4JWY A;  1GR2 A;  4MEV A;  2PBW A;  3CG3 A;  3RYD A;  2E1S A;  4PDD A;  1P1N A;  4P0I A;  4R2F A;  1OVT A;  2FNC A;  4THI A;  1MRP A;  3FIR A;  3QUJ A;  1QUL A;  1OIB A;  4P11 A;  4LUB A;  1OMP A;  2XWI A;  3CRB A;  5I3S A;  1FPJ A;  4AS4 A;  2LAO A;  3TTL A;  1QKA A;  1G0H A;  2X7P A;  2DYX A;  4GL0 A;  3W9V A;  3QK6 A;  2PYY A;  4PGN A;  1IMF A;  2DQV A;  3PMV A;  4HE0 A;  4LAT A;  3D4C A;  4NTL A;  3TOD A;  4N8Y A;  4ZDM A;  3EHT A;  3UP9 A;  3CFL A;  3LR1 A;  4G2Z A;  4I3Y A;  4XKP A;  3U94 A;  4JVI A;  5ET5 A;  4EXK A;  4HE2 A;  3HHF A;  3U92 A;  3RNN A;  2H5Y A;  1SI0 A;  2G29 A;  2Q89 A;  4OQO A;  3N6U A;  4N17 A;  4DCX A;  2DVC A;  2F34 A;  1R6Z A;  2P2A A;  3FJ7 A;  4QXD A;  1B2H A;  1FSA A;  3MZ1 A;  3B50 A;  2RC7 A;  3PPO A;  4LZ5 A;  3T9V A;  3IOW A;  3TTK A;  1H44 A;  3EKI A;  1NV7 A;  3VLU A;  2KLF A;  3TCH A;  1P99 A;  4I8C A;  2B3B A;  4H67 A;  2D21 A;  1LBC A;  3FVO A;  1XVY A;  3E3K A;  1VSO A;  5AA2 A;  1HSE A;  1LAX A;  3R26 A;  2XXY A;  1FPI A;  1US5 A;  1YZ0 A;  1ZU0 A;  3E78 A;  4LP2 B;  1FTA A;  3O9P A;  4OVP A;  4EUO A;  2QS2 A;  4PGP A;  3TTM A;  1K9Y A;  4GQO A;  1IME A;  2WKY A;  2HCA A;  4IO6 A;  2IA4 A;  1MXV A;  3EQ1 A;  4KCD A;  4F31 B;  2OJT A;  3GBA A;  1USY H;  5HPQ A;  1YPN A;  3FV2 A;  3T9H B;  2PFZ A;  1F9B A;  1MS7 A;  4MNC A;  1LCF A;  3H3G A;  2RC9 A;  3T9U A;  2R71 A;  2OWT A;  3T1B A;  1USY E;  4RYA A;  1MQD A;  1LBY A;  4YB7 A;  1DTG A;  3ZSF A;  3D1R A;  4FOR A;  1FPL A;  3HN0 A;  3CVG A;  1B0H A;  2GRV A;  2ZNT A;  3IOR A;  3JV9 A;  4C0R A;  2DE2 A;  5CBS A;  3EHU A;  5IGA A;  2AYS A;  4EF2 A;  3M3K A;  4NE4 A;  4FJP A;  3BFU A;  3CG1 A;  3TZA A;  2O1L A;  5H8H B;  4RPN A;  2A5T A;  4IY6 A;  5CMK A;  2QS4 A;  1NNK A;  4NQ8 A;  3F11 A;  4PFR A;  1B3L A;  4DE8 A;  1JNF A;  1O7T A;  4GWU A;  1I69 A;  2HZK A;  3O6G A;  4MF3 A;  1FTK A;  3VLV A;  3FD3 A;  1FBF A;  3TQL A;  4QFP A;  2A5T B;  2I4C A;  3OO9 A;  4QSE A;  4LVQ A;  1QGX A;  2B3F A;  2DXR A;  5EHS A;  3FAS A;  1EZO A;  4R9F A;  2V3U A;  5M2V A;  3M3F A;  2FVZ A;  5J16 A;  4YB5 A;  3KJT A;  1FQA A;  3SZP A;  1EH3 A;  4EQB A;  4PAF A;  3O6I A;  3N5L A;  4X48 A;  4OZ9 A;  1IMB A;  4QRZ A;  3FGS A;  4FIM A;  1KZ8 A;  1ZIU A;  1MY0 A;  4YB6 A;  4QSD A;  4F1Y A;  1T0K A;  1I6Q A;  1FPG A;  1UTB B;  1N0T A;  4O3A A;  4OVQ A;  3OO7 A;  1NV2 A;  4MMP A;  4O7M A;  4OEU A;  1OQH A;  2CEY A;  2O84 X;  3RPL A;  1OLC A;  2XX9 A;  2PT2 A;  2VP1 A;  2Q88 A;  1M5B A;  2XXX A;  1UTB A;  3PU5 A;  5DVF A;  1YXI A;  4HE1 A;  4LZ7 A;  1OLA A;  1LBB A;  3TMG A;  1BLF A;  2F5X A;  4QF9 A;  3JZJ A;  3RPL B;  3TCG A;  4PF8 A;  1N7W A;  3KOS A;  4MX6 A;  2Y7W A;  1TT1 A;  1GV8 A;  5CBR A;  3FVK A;  2CZI A;  3GXA A;  3ZS6 A;  3T93 B;  4R6Y A;  1LFG A;  3K1N A;  2CZL A;  1POT A;  4OVR A;  4ZZE A;  1B32 A;  1B46 A;  2O7I A;  3ROJ A;  3MJN A;  4U1Z A;  2DP8 A;  1AH5 A;  3G7W A;  3O28 A;  2XA5 A;  1TWY A;  2HQ0 A;  1B1H A;  4MNI A;  3PD8 A;  1Y4T A;  1FRP A; 
#chains in the Genus database with same CATH homology
 4F19 A;  2I58 A;  1LAH E;  1D4N A;  1M5D A;  2HAU A;  3EPE A;  3O66 A;  2UVJ A;  2Y7K A;  3Q27 A;  1I6B A;  1P1W A;  1POY 1;  1NH7 A;  2UYF A;  1BP5 A;  4RNS A;  2Z8D A;  2XXI A;  3FV1 A;  3QIM A;  5FTI A;  4F1V A;  2HFB A;  1NKX A;  1NL5 A;  4F3P A;  3LBS A;  3RTW B;  1PB8 A;  4RY1 A;  4H5F A;  3O97 A;  3SEW A;  4BDO A;  3FJG A;  2RCA A;  3KN3 A;  1SW4 A;  3CR9 A;  4NWD A;  4BDN A;  4POW A;  3SKP A;  5EYF A;  2DVZ A;  2ZNS A;  3T22 A;  1H43 A;  2Y84 A;  1FQE A;  3PUV E;  1URD A;  5I57 A;  4G68 C;  4KD5 A;  2D3I A;  2I3W A;  1ANF A;  4E0X A;  2NOO A;  3QUF A;  4FEC A;  4GVO A;  1MY4 A;  2QMW A;  3Q29 A;  4OHN A;  4OYV A;  4QFL A;  3M3L A;  3SER A;  4BDR A;  1D9Y A;  1IXG A;  3MAM A;  1LCT A;  3WAE A;  1RKM A;  3PUZ E;  1DSN A;  3KN7 A;  3QSL A;  5I56 A;  5TU0 A;  1Y1M A;  2F6G A;  3PPN A;  4G8H A;  2ZXT A;  3VXC A;  1FTM A;  1DOT A;  2F78 A;  4JSO A;  4F39 A;  1EZ9 A;  4ND9 A;  4OET A;  4OMB A;  1FQF A;  4XTC Q;  4DIG A;  4KCC A;  1PDA A;  4GXS B;  4F2Q A;  1MXZ A;  4KYE A;  4EQ7 A;  3A3C A;  4PQJ A;  5ELV A;  1PC3 A;  1LB8 A;  4NMY A;  4YKJ A;  1D3K A;  1MQH A;  3N6T A;  1WDN A;  1S7Y A;  2X7Q A;  2DS9 A;  3VXB A;  4ZEC A;  3EF7 A;  3JYR A;  1FQD A;  2PVU A;  3K00 A;  3E9X A;  4PP0 A;  4ESW A;  2OZZ A;  3CFZ A;  1NNF A;  5F1Q A;  1S50 A;  4M4G A;  1FQB A;  3SEU A;  1ELJ A;  1TXF A;  2DSF A;  3PPR A;  3B6Q A;  2A5S A;  4KYD A;  4N13 A;  3TEL A;  3EN3 A;  3K1M A;  5L8D A;  4ECF A;  1I6A A;  3USD A;  4AB6 A;  4F22 A;  1MQI A;  2QMX A;  4KI0 E;  4R72 A;  5K2Y A;  3RN8 A;  2QJE A;  3C33 A;  4PE5 B;  4TQU Q;  3H03 A;  3G3F A;  4I1D A;  4IO7 A;  4I62 A;  3K2D A;  1B9J A;  1HSJ A;  3PD9 A;  4U4X A;  4ISU A;  3K6X A;  2VOZ A;  5HBC A;  5B70 A;  5I59 A;  2NWJ A;  2ZYO A;  4BDQ A;  4X1D A;  3MUQ A;  2VD3 A;  3FUZ A;  4R75 A;  3O6H A;  4ELO A;  1Z7N E;  4ZE9 A;  3S9L C;  2FYI A;  2XD2 A;  1GVC A;  4U4S A;  3IAZ A;  1MG1 A;  5TP9 B;  2GH9 A;  4DZ1 A;  2HZL A;  4EQ9 A;  3FZV A;  1URS A;  3LSL A;  4XKN A;  4H65 A;  1B3E A;  1SBP A;  4QFN A;  4BDL A;  5JEI A;  4WKM A;  2RF1 A;  5ISU A;  2O68 A;  3A3U A;  1XS5 A;  4JXI A;  5I57 B;  3L6H A;  5FHN A;  1IXI A;  3MVY A;  3VLW A;  3V8X B;  5AA4 B;  3FXU A;  5I2N A;  3TUS A;  2F8D A;  3LUY A;  2FA7 A;  4POX A;  4EXL A;  4FAT A;  5A5X B;  3RY3 A;  1IIT A;  1SD3 A;  3FVN A;  4Q5T A;  5CM6 A;  4FED A;  2DXY A;  4OWD A;  3U1O A;  1B52 A;  2CMO A;  5LOM A;  1JVY A;  2P1S A;  2NXO A;  4NF6 A;  1MPD A;  3MP1 A;  5H8S A;  4ZEF A;  1PBP A;  1Q35 A;  4F18 A;  4XIG Q;  1IZ1 A;  1M5F A;  1NH8 A;  1XVX A;  1XT8 A;  1TFA A;  4JDF A;  3TCF A;  3C34 A;  3PPP A;  1JET A;  2XX8 A;  3I5O A;  4G8M A;  1L5T A;  2ONK E;  3THI A;  2UXA A;  4U23 A;  3UA8 A;  5DEX B;  3D4G A;  3HPI A;  3N26 A;  3IJX B;  1MPB A;  3LSW A;  4RXL A;  3VVD A;  3SDF A;  4E0W A;  2RKM A;  2ALU A;  2F7A A;  5A5X A;  3PGF A;  3UK4 A;  2THI A;  3H06 B;  1VFD A;  1B4H A;  3IK6 B;  3KZG A;  4NWC A;  2XXT A;  3P7I A;  1N3X A;  3W9W A;  1B5J A;  1Y3Q A;  2O51 A;  1Y4C A;  2H4I A;  2OWS A;  3BBR A;  1FTO A;  3G3I A;  4OXV A;  1R1N A;  3MC2 A;  4LZ8 A;  3RLF E;  3VV5 A;  2H25 A;  1IXC A;  4U21 A;  1SVX B;  1MDP 1;  1OQG A;  1SYH A;  2PMS A;  3CSG A;  1MXY A;  3H6U A;  1GTK A;  3MQ9 A;  3K0V A;  4HCY A;  4OES A;  3V89 B;  2I4B A;  2ANJ A;  4JWY A;  1IUD A;  1GR2 A;  1B5I A;  5AA3 A;  2QPQ A;  4OER A;  5HM4 B;  1J1N A;  2PBW A;  5JTY A;  5L9S A;  4YZZ A;  1B6H A;  4ZED A;  1B40 A;  4C1T A;  1SDX A;  2G93 A;  4PFU A;  5AA1 A;  5I59 B;  3CG3 A;  1A7L A;  1LST A;  3K6V A;  2E1S A;  3KBR A;  1P1N A;  3K4U A;  3LSX A;  2Q9T A;  4G68 B;  1XOC A;  4NF8 B;  4P0I A;  3VE1 B;  4R2F A;  1B58 A;  1R9L A;  1OVT A;  1Z7M E;  2UVI A;  3MVZ A;  2ESN A;  1YCJ A;  4KFQ A;  3TEP A;  2FNC A;  3LSF B;  4THI A;  3OOA A;  3RPW A;  1B0L A;  1SW2 A;  1MRP A;  3OSR A;  3FIR A;  1MXU A;  1O64 A;  3QUJ A;  3TAJ A;  3E4R A;  1IIW A;  1QUL A;  3G3G A;  3DEL B;  1OIB A;  2AL5 A;  4P11 A;  4LUB A;  1OMP A;  1VR5 A;  1H3D A;  2Z23 A;  3CRB A;  3VDF A;  2LAO A;  1B51 A;  1QKA A;  2X7P A;  4JWX A;  5JTY B;  1VFE A;  3TTL A;  4U22 A;  2DYX A;  3UGW A;  1A8F A;  4GL0 A;  3W9V A;  4DXB A;  3QK6 A;  2PYY A;  3MBP A;  4IO3 A;  4GOT A;  3IX1 A;  5DEX A;  3PMW A;  1URG A;  3UIF A;  1RYO A;  2DWH A;  5CI5 A;  2DQV A;  3SEX A;  2NUV A;  3PMV A;  4LAT A;  4P0G A;  3D4C A;  3C31 A;  3IB2 A;  4NTL A;  3IOT A;  3TOD A;  3TDJ A;  3MVW A;  4ZDM A;  5I58 A;  3EHT A;  3UP9 A;  1MY1 A;  3S2V A;  3CFL A;  5AA2 D;  2OLB A;  5KDT B;  3PPQ A;  5AA2 B;  1LFH A;  2REJ A;  3LR1 A;  3RT8 A;  4G2Z A;  3S9E A;  1B5H A;  1B3G A;  3CI8 A;  4GXA A;  4XKP A;  1ZJL A;  3U94 A;  4AB5 A;  5CC2 A;  3Q26 A;  5I2K A;  3MZB A;  3OEL A;  1Y3N A;  2QS3 A;  1WOD A;  2YLN A;  4DCY A;  1SYI A;  4WEP A;  3G3H A;  1SW5 A;  1XHY A;  3KOT A;  4NED A;  3TTN A;  1NNP A;  1MY3 A;  2XX7 A;  3HCQ A;  3G3J A;  3IJO B;  4YKK A;  3RUM A;  3QXM A;  1M5E A;  3IL1 B;  3T9X B;  3ZKK A;  2F36 A;  3HHF A;  3U92 A;  1DPP A;  3RGY A;  3RNN A;  2H5Y A;  1FQC A;  3B7D A;  4NF8 A;  1SI0 A;  2G29 A;  2Q89 A;  4OQO A;  3RT6 B;  4H8I A;  1RYX A;  3N6U A;  2YPN A;  4DCX A;  1IXH A;  4G4P A;  2Z8E A;  4LQ2 A;  2DVC A;  2REG A;  3MPK A;  2ONR A;  4PET A;  3RQT A;  2F34 A;  2BJJ X;  3H6T A;  1PB7 A;  5H8F B;  1B7Z A;  3H6W A;  1R6Z A;  4ZEI A;  2P2A A;  1ZLQ A;  2I49 A;  1SI1 A;  4DLD A;  4XKR A;  3TKD A;  1A99 A;  1MPC A;  4IO4 A;  3HV1 A;  4G68 A;  1B1X A;  2UVG A;  3FJ7 A;  4JB7 A;  4WED A;  4RPO A;  2YJP A;  1B2H A;  3R6U A;  3KN8 A;  3MZ1 A;  1SQY A;  1MXW A;  1B7H A;  1LB9 A;  1N84 A;  1UIU A;  4GWO A;  3SEY A;  2OK2 A;  4EDP A;  4HW8 A;  4F3S A;  2V3Q A;  5AE4 A;  2PT1 A;  4OEV A;  2RC7 A;  2XXW A;  3W15 C;  1FW0 A;  3PPO A;  1B05 A;  3Q25 A;  3UN6 A;  2UYE A;  1PBQ A;  3PV0 E;  4LZ5 A;  1QW0 A;  5F7V A;  1S9T A;  3C32 A;  4L17 A;  3K01 A;  3T9V A;  3IOW A;  3TTK A;  4G8N A;  1H44 A;  4DXU A;  1WVJ A;  2OCU A;  5I58 B;  5KCJ B;  1AIV A;  3C9H A;  3I6V A;  3VLU A;  4GLI A;  4F2O A;  3CFX A;  5KDT A;  3IOU A;  3TTR A;  2W7Y A;  5I2N B;  1AL3 A;  2KLF A;  3KSJ A;  3TCH A;  1P99 A;  2I6E A;  3PUY E;  4U2R A;  4I8C A;  2XXQ A;  2B3B A;  2XHD A;  1HSL A;  5ITP A;  1MXX A;  4OFJ A;  4H67 A;  3LC8 A;  2D21 A;  1ZMG A;  2ONS A;  1EU8 A;  1LBC A;  2O7U A;  3V83 A;  3FVO A;  5ICQ A;  4EXK A;  1GGG A;  3ONM A;  2ZNU A;  1XVY A;  4NF6 B;  1MQG A;  1H45 A;  1VSO A;  3E3K A;  4YU0 A;  4ELR A;  2I3V A;  3MVX A;  3S4U A;  1MM6 A;  1HSE A;  1LAX A;  5AA2 A;  5BUU A;  5L9O A;  3R26 A;  3K02 A;  2HEU A;  1PEB A;  2PX1 A;  3C35 A;  4IB2 A;  4MLV A;  1N04 A;  2XXY A;  3OMB A;  4AQ4 A;  1US5 A;  3BFT A;  4I9D A;  5AA4 A;  4MH5 A;  1ZU0 A;  1LFI A;  4Q0C A;  2H99 A;  5JK4 A;  2GHB A;  4LP2 B;  5H8F A;  4FAJ A;  3IR1 A;  2AIX A;  3KSX A;  4QFO A;  2RCB A;  4R2B A;  2P0S A;  3O9P A;  4IO5 A;  5EHM A;  5FHO A;  3DLN A;  5DVJ A;  4YMB A;  2Q8J A;  2QS2 A;  2O1M A;  4K3F A;  1DTZ A;  4EUO A;  4MBP A;  1FTJ A;  3ECR A;  3TTM A;  4F3G A;  1ZKB A;  2DE3 A;  2NVU B;  1B3H A;  2V84 A;  4GF8 A;  1Y20 A;  1AOV A;  1PB9 A;  1UIV A;  1BTJ A;  2VHA A;  2B65 A;  2OBG A;  3FAT A;  4GFR A;  4GQO A;  4IY5 A;  3KJ7 A;  2WKY A;  2XXR A;  2HCA A;  1JVX A;  1OVB A;  4IO6 A;  3MP6 A;  2IA4 A;  2QRY A;  3KGC A;  3CIJ A;  1MXV A;  3OO6 A;  4GD5 A;  4BLA A;  3EQ1 A;  1MH3 A;  4KCD A;  4ELP A;  4F31 B;  2OJT A;  3GBA A;  1USY H;  3FVG A;  2UVH A;  4FEB A;  1YPN A;  5CMM A;  5CMC A;  1N7X A;  3FV2 A;  5HPQ A;  3T9H B;  1P1O A;  1F9B A;  2I48 A;  2Q2A A;  2VGQ A;  1MS7 A;  1LCF A;  3Q28 A;  1JW1 A;  3H3G A;  5CRY A;  3IB0 A;  2DWJ A;  2O6A A;  2RC9 A;  3T9U A;  1YTV A;  2R71 A;  2QSX A;  2ZYM A;  4Q30 B;  3TQW A;  2OWT A;  1Y1Z A;  3KEI A;  1TFD A;  1M5C A;  2F6P A;  2XD3 A;  3MPL A;  3PUX E;  4H5G A;  4OFL A;  4WXJ A;  1USY E;  4KHZ E;  4RYA A;  3ILU B;  1MQD A;  2V25 A;  4YB7 A;  1DTG A;  1JEU A;  3E13 X;  1FTL A;  3ZSF A;  3S9M C;  4FOR A;  4QSC A;  1FCK A;  1JW5 A;  4YKI A;  4KR5 A;  3ODB A;  1II5 A;  4LQ5 A;  3HN0 A;  2F35 A;  2ZYK A;  4H6D A;  3CVG A;  4NF4 A;  1ATG A;  4KYS A;  4GIZ A;  3OXN A;  1MY2 A;  1SW1 A;  1B0H A;  4H8J A;  4X9T A;  3T96 B;  3UOR A;  5J1D A;  3A09 A;  4G77 A;  2GRV A;  2ZNT A;  5I84 A;  3IOR A;  4ZZA A;  1UQW A;  3JV9 A;  4C0R A;  1EZP A;  1VE4 A;  2DE2 A;  5CBS A;  4IGT A;  3EHU A;  4R6H A;  3PUW E;  2AYS A;  4MLQ A;  5I2K B;  1BIY A;  1LAG E;  3M3K A;  4EF2 A;  4Z7E A;  2RIN A;  1UTH A;  4OFO A;  4NE4 A;  4FJP A;  3U93 A;  2XXP A;  1DPE A;  1QKB A;  4HTG A;  3BFU A;  4JWO A;  3CG1 A;  4YIC A;  4ZE8 A;  1R9Q A;  3OD7 A;  3TZA A;  2O1L A;  4PFY A;  3V5A A;  3RTF B;  3VVF A;  5H8H B;  1CE2 A;  4RPN A;  3MWB A;  3OEM A;  1H76 A;  3O29 A;  2A5T A;  2ZYN A;  4NF4 B;  2Y7P A;  4NF5 B;  5CMB A;  3SES A;  3VVE A;  5ICT A;  4PFT A;  4IY6 A;  1P1Q A;  3DP8 A;  3MZ9 A;  4ESX A;  5CMK A;  2XXU A;  2QS4 A;  1NNK A;  2D5W A;  2Q2C A;  2Z8F A;  4U1O A;  3KFM A;  3OO8 A;  3F11 A;  3DM0 A;  4C1U A;  3U8Q A;  1A8E A;  2Z22 A;  1B3L A;  1Y3P A;  1QUJ A;  1ZBM A;  3HHG A;  4JSD A;  1LAF E;  1JNF A;  4YKP A;  4DE8 A;  1O7T A;  4ZEK A;  3SET A;  2XXH A;  1I69 A;  2HZK A;  3O6G A;  1O63 A;  3FXR A;  1FTK A;  1NMU A;  3L6G A;  4MF3 A;  3VLV A;  3KG2 A;  3FD3 A;  4N07 A;  3TQL A;  4QFP A;  2A5T B;  4NF5 A;  2V3T A;  2I4C A;  3OO9 A;  3R7X A;  4QSE A;  4LVQ A;  5DT6 A;  5IKB A;  3K6U A;  2B3F A;  2DXR A;  3AXF A;  4OTE A;  5EHS A;  1JW4 A;  3FAS A;  3OSQ A;  2F7C A;  1EZO A;  4R9F A;  2V3U A;  2I0C A;  3C36 A;  2AL4 A;  5M2V A;  4O3B A;  5KCJ A;  4H0W A;  2GFE A;  2I0B A;  3M8U A;  4KPT A;  1QJM A;  4PFW A;  3K1P A;  2QL3 A;  5DTB A;  2H9B A;  3G3K A;  2F97 A;  1DMB A;  3FXQ A;  3M3F A;  3GLB A;  4X1B A;  1CB6 A;  3GBB A;  4YB5 A;  3KJT A;  4R9G A;  1FQA A;  3BKI B;  4ZEB A;  4TOZ A;  1EH3 A;  3TYH A;  3C4M A;  4EQB A;  5FHM A;  4QFK A;  4R6K A;  4IO2 A;  2IEE A;  1QUK A;  2RC8 A;  3O6I A;  4GRK A;  3N5L A;  1KWH A;  1AMF A;  2O69 A;  4X48 A;  5ITO A;  4OZ9 A;  5B7D A;  4RA1 A;  2VD2 A;  5H8H A;  1ZTY A;  1B4Z A;  4QRZ A;  3WAF A;  4UA8 A;  4EF1 A;  4H1X A;  4LA9 A;  4ZS9 A;  1MH4 A;  3FGS A;  3K6W A;  1LGB C;  4XXU A;  4RJZ A;  4FIM A;  3IB1 A;  3H6V A;  3B6T A;  4UAC A;  4DDD A;  3IO6 A;  4R74 A;  1ZIU A;  4ELQ A;  3OEN A;  1MY0 A;  1XC1 A;  4YB6 A;  4QSD A;  1US4 A;  3VFJ A;  4IGR A;  4F1Y A;  3HO7 A;  4O3C A;  1T0K A;  1I6Q A;  1UTB B;  4O3A A;  1N0T A;  4YMA A;  3U72 A;  2GHA A;  3MP8 A;  1LLS A;  1B7U A;  3OO7 A;  4MFI A;  5IAI A;  4Z0I A;  2V93 A;  4RK2 A;  1YAE A;  3HST A;  1OQH A;  4OEN A;  4OEU A;  5L9M A;  1IEJ A;  3CSB A;  3OEK A;  2QS1 A;  2O84 X;  3EHS A;  5TP9 A;  1OLC A;  1MQJ A;  2XX9 A;  2PT2 A;  2VP1 A;  3QAX A;  2DOJ A;  4BDM A;  2Q88 A;  3PMX A;  1M5B A;  2XXX A;  1JQF A;  2X26 A;  4F29 A;  1UTB A;  1N76 A;  3PU5 A;  5DVF A;  3IO4 A;  2XXV A;  2ABH A;  2R6G E;  2ZMB A;  4RK9 A;  4DXC A;  4LZ7 A;  1A40 A;  1OLA A;  3T66 A;  4LON B;  4F3B A;  2DWA A;  1BKA A;  4KQP A;  1LBB A;  3TMG A;  1IQ7 A;  2HAV A;  3FJM A;  4OVJ A;  1A54 A;  1BLF A;  4QHQ A;  2F5X A;  5H8Q B;  2Y7I A;  3SEV A;  3ZKL A;  4QF9 A;  3JZJ A;  3TFL A;  1QVS A;  1QUI A;  3TCG A;  1N7W A;  3KOS A;  4TLL B;  1A55 A;  1P1U A;  2Y7W A;  1TT1 A;  4JBZ A;  1GV8 A;  3N94 A;  5DVI A;  1NFT A;  5CBR A;  3FVK A;  4HCW A;  4N6P A;  5K2X A;  5BWJ A;  3GXA A;  5H8N A;  3T93 B;  4GL8 A;  3ILT B;  4R6Y A;  5TPA B;  3ZS6 A;  1LFG A;  4Q8R A;  1Q1K A;  3MW0 A;  3K1N A;  1Y9U A;  4ONY A;  3DP6 A;  2CZL A;  1POT A;  3IOV A;  4R73 A;  5DYH A;  3GZG A;  1B32 A;  4ZZE A;  1B46 A;  2O7I A;  4F1U A;  3MJN A;  2F7B A;  3B6W A;  5H8Q A;  2M8C A;  2Y7R A;  2DWI A;  2E0S A;  4U1Z A;  2DP8 A;  4XKQ A;  1AH5 A;  5I56 B;  3S9N C;  3G7W A;  3O28 A;  2R9J A;  2DE4 A;  3QYT A;  4FE8 A;  1TWY A;  2HQ0 A;  1B1H A;  1MM7 A;  3DP4 A;  3O2A A;  1N3W A;  4TLM B;  5H8N B;  4M1V A;  2HXW A;  5TPA A;  5KZT A;  1JEV A;  3I3V A;  4YAH X;  1UTH B;  2H98 A;  3PD8 A;  1MDQ A;  1NNT A;  5FTH A;  3TPA A;  3H7M A;  1Y4T A;  1B3F A;  3H4Z A;  4HS7 A;  1D9V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...