2VP1A

Fe-futa2 from synechocystis pcc6803
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
313
structure length
313
Chain Sequence
RTINLYSSRHYNTDDALYDAFGEVNLIEASAEELIERIQSEGANSPGDILFTVDAGMLWRAEQAGLFQPVRSGKLNERIPENLRHPDGLWYGFTQRARVLYYSRDRVNPADLSTYEALADPQWRGKILVRPSSNVYNLSLTASRIAIHGEPETRRWLQGLVGNFARQPEGNDTAQIRAIAAGIGDVAIANSYYYIRLQKSTDPADQEVVEKVSLFFPNTGSGERGTHVNVSGAGVLKNAPNRDAAIAFLEYLASDDAQRYFAEGNNEYPVIPGVPIDPVLAAHGQLKGDPLNVSNLGRYQPDSARLMNEVGWQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords PERIPLASMIC IRON-BINDING PROTEIN
publication title Futa2 is a Ferric Binding Protein from Synechocystis Pcc 6803.
pubmed doi rcsb
total genus 114
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13343 SBP_bac_6 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2vp1A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2vp1A02
4EQ9A 3EHSA 2F6PA 1TXFA 3ILTB 4IO2A 4X1BA 4KCDA 1P1QA 4IO4A 2O6AA 3L6GA 2ZYNA 4F1VA 4ZEIA 5AA3A 3TTMA 1I6AA 3BBRA 1POY1 3VVEA 3UGWA 2I58A 3G3FA 3PPOA 2I48A 3TODA 2V25A 3T9HB 4HTGA 4BLAA 2F35A 1HSJA 3PPRA 3UN6A 1MY3A 1A55A 3S4UA 5EYFA 4ND9A 3G3KA 3CSGA 2D21A 3G3JA 3FGSA 3LSXA 3K1MA 5I59A 3IK6B 3CI8A 2O51A 4YKJA 4GQOA 1EZPA 3MZBA 1BTJA 1BKAA 4XKNA 2KLFA 3DM0A 3GLBA 1NNPA 2V84A 3H4ZA 4E0XA 1QKBA 3GBAA 1JQFA 2Y7PA 1MXZA 3OSRA 1ANFA 3G3HA 3KG2A 4POXA 4YKIA 4R6KA 1NNKA 3TAJA 4DLDA 3KN3A 5KCJA 2RC7A 1CB6A 5CRYA 1P1OA 2VHAA 5I56A 3O29A 4OFJA 1FTJA 1FTKA 3IB0A 4Q30B 1O64A 3E9XA 1ZIUA 2ZMBA 4EQ7A 4RY1A 1QVSA 4QFKA 3RLFE 3UORA 3TMGA 2BJJX 3MC2A 2G29A 2HQ0A 3K6UA 5IAIA 3TCFA 1YCJA 2Z23A 4M1VA 5TP9A 1XT8A 1Y20A 1M5FA 4TOZA 2AIXA 1B3EA 3O9PA 4KR5A 4NF8A 3FJGA 3FVKA 1UTHB 2PYYA 2H5YA 1P1UA 4OEVA 4GXSB 1LGBC 5HBCA 4Q8RA 3C32A 1A7LA 1B9JA 4NF6A 4ELPA 3FATA 1P99A 4PFYA 1SVXB 3T66A 3QIMA 1MPCA 1MQGA 4XTCQ 3FZVA 4C0RA 3HCQA 1LCFA 5I59B 3EHTA 2XXQA 4F19A 5L9OA 4THIA 3TUSA 3TQLA 3QXMA 1M5DA 5IKBA 2Q2AA 3W9VA 4PFWA 3VV5A 1H76A 3VLWA 1A99A 3C9HA 2ZYKA 3OEMA 4GXAA 3EF7A 2ONSA 3MP1A 1P1WA 3HHFA 4F29A 3K0VA 5I56B 1O63A 3MP6A 1SW5A 4IO3A 4DCXA 1Y3PA 2I3VA 3ECRA 3W9WA 3PUXE 4ZEFA 3N94A 4R72A 2HXWA 1RYOA 1Y1MA 3OOAA 1ZMGA 3W15C 1VFDA 1TFDA 3BFTA 3FUZA 4FEDA 4OMBA 3RY3A 3QK6A 3HV1A 4AB5A 3I5OA 2O7UA 3HPIA 3KSXA 1B40A 1QULA 3IORA 3U93A 4R9GA 4ZE8A 2Y7WA 4EXKA 3KBRA 5DT6A 5CM6A 4MF3A 4ZEBA 3D4CA 2G93A 3KOSA 1SD3A 3P7IA 1N7XA 3K6WA 3QUFA 4BDMA 3N6UA 4NF8B 3IB1A 4IGRA 4FAJA 1LSTA 3EQ1A 3ODBA 4ZEKA 1MXUA 4NF6B 2QS3A 2H4IA 3S9LC 1Y3QA 1NNFA 4IO6A 3KGCA 3N5LA 2AYSA 5LOMA 2CMOA 5I57B 3F11A 5AA2D 1NNTA 3N6TA 4XKRA 2PVUA 4G2ZA 5FTIA 4IY5A 4OZ9A 4MFIA 3HHGA 3RNNA 5B70A 2V3TA 1B0HA 4NWCA 1MQIA 4N6PA 1FTLA 1Q35A 3CR9A 4BDRA 2OWSA 1H3DA 2DSFA 1SYIA 3OO8A 3K6XA 4OYVA 4KI0E 4H0WA 4O3CA 4TLLB 4H8JA 4XKPA 3N26A 1R9LA 1SW2A 4JSDA 1IXHA 3U72A 3PUVE 1DMBA 1B7ZA 4H6DA 4LP2B 3E3KA 4JDFA 4FEBA 3CG1A 4G8HA 3PU5A 2NXOA 5DYHA 1GGGA 4LZ8A 4YB6A 1FCKA 1A54A 4YICA 3TZAA 1R9QA 2OWTA 1D4NA 1B4ZA 2P2AA 1NH8A 1B6HA 3MPKA 2HZKA 1MM7A 1UIVA 2X26A 1ZLQA 1LCTA 3U92A 1HSLA 1AMFA 2B65A 4NWDA 3FV2A 2ZNTA 2I6EA 3IL1B 3B6QA 5H8QB 2XXTA 5AA2A 3LSFB 4R75A 4KYEA 2UVGA 4RPOA 2GHAA 3T96B 4G4PA 1URGA 2FNCA 1PBQA 3CG3A 3ZS6A 1B32A 3TQWA 5FHMA 3TTLA 2F5XA 2B3FA 3JYRA 3FVGA 1LAHE 2ZYOA 4RK2A 1ZKBA 1NH7A 4Z0IA 2QL3A 4BDNA 3MWBA 3S9MC 3VFJA 5CMMA 3H7MA 4NTLA 1KWHA 2WKYA 4H1XA 2DXYA 1LFGA 4OHNA 5ICTA 4NMYA 4GRKA 1UQWA 4PE5B 2HZLA 3E13X 1QKAA 1B7HA 5HM4B 4LQ5A 1AH5A 4AQ4A 1B0LA 3C35A 4JB7A 3MAMA 4HCYA 1B3FA 1RYXA 2XD2A 2UXAA 1B1HA 3WAEA 4PP0A 5I58A 3UP9A 1HSEA 1UIUA 1FQCA 1N76A 1GR2A 3EPEA 4PQJA 3K1NA 3V5AA 3S9EA 4YB7A 3VVFA 1ELJA 2OBGA 1JNFA 4ESXA 3H06B 3IOVA 4K3FA 3H6WA 1LBCA 4HW8A 4R9FA 1AOVA 1SYHA 1B05A 3SEUA 4F22A 3S9NC 2PT1A 2THIA 5AA2B 3C36A 4F3SA 4ZEDA 4F3PA 2YJPA 3KEIA 4I1DA 2DWAA 2REJA 4R6HA 2XX7A 4IY6A 3U94A 4XIGQ 3MUQA 1UTHA 4QFPA 3FD3A 3OO6A 4M4GA 1GTKA 4ZZAA 1DPPA 3CIJA 3IB2A 5ELVA 4G68A 4DXCA 2Z8EA 1S9TA 4JWXA 1A40A 4RJZA 5KDTB 5DVIA 1B5HA 3SERA 1GVCA 1PEBA 3PPNA 3R6UA 1SI0A 4ZECA 1MXWA 1ZU0A 4KCCA 2QMXA 5A5XB 4GL0A 1B58A 2D3IA 1WVJA 3B7DA 3UIFA 1EH3A 3PPQA 3SEYA 4RYAA 3U8QA 1B5IA 3TTNA 1JVXA 4TQUQ 4IO7A 2Z8DA 4QF9A 4MLQA 4MLVA 4H67A 3O6GA 2AL5A 2RCBA 3SETA 5I58B 2XXIA 3SEWA 4ZZEA 3OEKA 5EHSA 4OERA 4KYDA 1LB8A 3MVXA 1L5TA 4G68C 4ZDMA 2UVJA 4PETA 1J1NA 2DVZA 3RQTA 2DXRA 4H65A 4DXUA 4OWDA 1CE2A 3IOWA 1M5BA 2OJTA 4LUBA 3R26A 1WODA 1B51A 2XX9A 4ONYA 1IXCA 3IO4A 3IO6A 2F7CA 2DWJA 3MVZA 2HFBA 4G68B 1LAFE 2DP8A 3PD8A 2P0SA 4QFNA 3FIRA 1D9YA 2D5WA 3Q26A 2RC9A 1MM6A 5I57A 2HEUA 4PFTA 2E0SA 2F36A 5H8HA 1B1XA 2NOOA 2ZNUA 4YMBA 4NE4A 1Y9UA 5FHOA 4WKMA 2I4BA 1QUJA 4GD5A 4DDDA 4QSDA 2H98A 3HSTA 3K4UA 3PD9A 2XXRA 2Y7KA 4IGTA 3G3GA 2VOZA 2HAVA 2O84X 3HO7A 1SW1A 3JV9A 4P0GA 2O7IA 4Q5TA 1N04A 1BIYA 4GIZA 1Z7ME 4F1UA 1JW1A 2XXUA 4F31B 1SDXA 4YB5A 1Y1ZA 1EU8A 5ICQA 1Q1KA 1XC1A 2Q9TA 4LVQA 4JSOA 4WXJA 3VVDA 4F3GA 2FA7A 2GRVA 3TTRA 3H3GA 2UVIA 3I6VA 5I84A 2XHDA 4MH5A 2XXXA 3T93B 5L9MA 1EZOA 2OLBA 3G3IA 4YKKA 4ZS9A 3GBBA 3H6VA 2PT2A 2XXYA 3KOTA 3SDFA 1VSOA 3FASA 3KN8A 3LR1A 5F7VA 1FQBA 4NEDA 1LAXA 5ISUA 2DWIA 4OEUA 2RKMA 3Q27A 1H45A 1Y3NA 3A09A 4ZE9A 3QYTA 4H5GA 5H8HB 5AE4A 3LBSA 4OFOA 3FXRA 1OVTA 5H8QA 3ZKKA 2PMSA 1IITA 3DP4A 4OFLA 3PMXA 1NFTA 1MY1A 3AXFA 4GFRA 3WAFA 4YZZA 3BFUA 3OENA 2DWHA 2XD3A 4U4SA 2VD3A 5L9SA 3A3UA 1OIBA 2Y7IA 3V83A 2QS2A 4TLMB 4AB6A 3UK4A 1OVBA 3V89B 4LZ5A 1M5CA 2PBWA 4ISUA 1SW4A 1TT1A 2W7YA 1YPNA 2DVCA 5DEXA 3TYHA 4F39A 3R7XA 5ITOA 2Z22A 4IB2A 3M3LA 2GHBA 3OO9A 1I6QA 3T9UA 3KN7A 1BLFA 1PBPA 4U4XA 1MQHA 1MY2A 1N84A 4F2QA 3FJMA 3KSJA 4OQOA 1MQJA 3EHUA 1I69A 2DYXA 4X9TA 2E1SA 4BDLA 2F6GA 1QW0A 3SEVA 1MDP1 3VXCA 1JW5A 4GLIA 3H6TA 1IUDA 3CFXA 3DP8A 4RNSA 2A5SA 4Q0CA 4EXLA 2DOJA 5CBRA 4X48A 3MP8A 4C1TA 1XHYA 4ELQA 3RTWB 1FQFA 3ZKLA 1PB9A 1MPDA 1WDNA 3O2AA 3VXBA 2Y7RA 2RINA 1OLCA 5FHNA 2ONRA 2XX8A 1MDQA 3A3CA 4H8IA 1B7UA 1SI1A 1MH4A 1IIWA 3PV0E 4QSEA 1LFHA 4KQPA 4JWOA 2V93A 3DLNA 5KDTA 3QUJA 4H5FA 3CFLA 5EHMA 3M3FA 1ZTYA 3TTKA 3K1PA 4KPTA 4ELOA 1A8EA 2H9BA 5JEIA 5DEXB 4JXIA 4R73A 2A5TA 1R1NA 1UTBA 4LQ2A 4LA9A 5DVJA 4KFQA 4GL8A 5A5XA 2XXHA 2I0BA 1AL3A 3VDFA 5ITPA 3B6TA 4KHZE 4MBPA 1MXVA 4C1UA 1ATGA 5CC2A 1OQHA 3IOUA 4P11A 4DZ1A 4YAHX 2REGA 5TPAB 3IX1A 2F97A 2VP1A 4LONB 3FVOA 3MW0A 1MS7A 3C34A 1D9VA 3CSBA 2R71A 2M8CA 4WEPA 1F9BA 1TFAA 1NL5A 3RUMA 2ANJA 4EF2A 3PMWA 4QFLA 5CMKA 3I3VA 5M2VA 2ZYMA 2X7QA 2UYEA 2VGQA 2XXVA 2QS1A 3K00A 3EN3A 4OETA 4RK9A 3LC8A 5H8SA 5K2XA 1O7TA 2QJEA 4FECA 3SEXA 4U2RA 3MZ1A 1XOCA 3CRBA 2V3UA 4G77A 4OTEA 1FQAA 1H43A 3OMBA 1URDA 4ECFA 1B3HA 1R6ZA 2RCAA 2ONKE 1YTVA 3K01A 1FQDA 5I2NB 4F3BA 4NF5B 3O66A 4QHQA 1RKMA 2A5TB 1UTBB 4KD5A 1N0TA 5JTYA 4FE8A 2VD2A 3MBPA 4DXBA 1N3XA 3PUWE 4YU0A 3TFLA 2RC8A 5CMBA 1FTOA 4GOTA 1FW0A 2ABHA 1LBBA 1SBPA 3B6WA 3IR1A 4G8MA 1M5EA 1NMUA 4ESWA 1US4A 2YLNA 2IA4A 4EDPA 4UA8A 5F1QA 4G8NA 2DE2A 2HAUA 1VR5A 3TPAA 3BKIB 4FIMA 2QPQA 3E4RA 3ZSFA 1VE4A 1JVYA 4DE8A 3M8UA 2V3QA 1FTMA 4OVJA 4YKPA 5KZTA 1T0KA 3O28A 4HCWA 2ZXTA 3K02A 3RT6B 4OXVA 3VLVA 3RN8A 1MRPA 3KZGA 2I3WA 2I49A 1OLAA 2R9JA 3Q28A 1LB9A 2NUVA 3HN0A 2ALUA 2F34A 5AA1A 3RT8A 4JBZA 3L6HA 4FATA 1YAEA 4EQBA 1A8FA 3OELA 1MXXA 2X7PA 4R2BA 2ESNA 1ZJLA 5DVFA 2Q88A 3U1OA 4UACA 3K6VA 2IEEA 3PGFA 1MQDA 2R6GE 4I62A 3IJXB 2XXWA 5JTYB 1IQ7A 3IJOB 2ZNSA 1BP5A 3OSQA 4I8CA 5FTHA 3FXQA 5K2YA 5AA4A 2RF1A 2UVHA 2CZLA 4BDQA 4R2FA 3SESA 4EF1A 1N7WA 1OQGA 2OK2A 4U1OA 1ZBMA 1DTZA 2Q89A 3OXNA 5KCJB 3KJTA 1PC3A 5JK4A 1I6BA 3LUYA 5CBSA 3FVNA 2H99A 3MVYA 3THIA 1S7YA 3QAXA 2DE4A 3KFMA 2DS9A 1JETA 3UA8A 2O1LA 3FJ7A 2P1SA 4OENA 2O1MA 4I9DA 4LATA 2NVUB 3S2VA 3SKPA 5DTBA 5BWJA 3TELA 1DSNA 5BUUA 4FORA 2Q8JA 5I2KA 4FJPA 5TP9B 1B4HA 4WEDA 1P1NA 1XVXA 2OCUA 3QSLA 2F7BA 4XKQA 1USYH 1DPEA 2B3BA 3ONMA 1MH3A 4U23A 1PB7A 1JEUA 3KJ7A 1EZ9A 1VFEA 3T9VA 1SQYA 3GZGA 3V8XB 5H8NA 4PFUA 1MY0A 4KYSA 3H03A 3VE1B 3USDA 1LAGE 1DTGA 3MVWA 5AA4B 4P0IA 1B2HA 1D3KA 1B52A 2XXPA 3O6HA 1DOTA 3T9XB 4X1DA 2QMWA 1B5JA 4U21A 5J1DA 4IO5A 1MY4A 1QUIA 1N3WA 3LSWA 1II5A 4F2OA 1URSA 3C33A 3MZ9A 2H25A 2DE3A 4E0WA 5H8FA 2Q2CA 1B3LA 5L8DA 3O97A 4R74A 5HPQA 3TEPA 4OESA 4RA1A 2O68A 2FYIA 4N07A 1PDAA 2QS4A 4NF4A 1QJMA 3DELB 5TPAA 5I2KB 1IXIA 3JZJA 2LAOA 4POWA 1LFIA 3G7WA 3TCHA 3K2DA 4O3BA 3T22A 1IXGA 3C31A 3RPWA 4RPNA 3MQ9A 4JWYA 2QRYA 4GWOA 1US5A 2I0CA 1JW4A 2F8DA 1FQEA 4ELRA 3VLUA 5H8NB 3OO7A 3CVGA 4QSCA 4BDOA 3MJNA 5CI5A 2UYFA 2PX1A 3H6UA 3FXUA 1TWYA 4GVOA 2Z8FA 2F7AA 3OD7A 1MXYA 1Z7NE 2GFEA 4YMAA 1PB8A 4QRZA 3IOTA 1GV8A 4N13A 3MPLA 1B3GA 4R6YA 3PUYE 3M3KA 4DCYA 1Y4CA 4GF8A 2DQVA 5I2NA 3LSLA 3IAZA 4F1YA 4LZ7A 2O69A 2I4CA 4L17A 4NF5A 1AIVA 1NKXA 4DIGA 3PMVA 5H8FB 1QUKA 2NWJA 1H44A 4F18A 3Q29A 3TCGA 1IZ1A 2F78A 4HS7A 3PPPA 4NF4B 2GH9A 1B46A 4RXLA 2YPNA 1Y4TA 3TKDA 3CFZA 5B7DA 1MPBA 3C4MA 4XXUA 3O6IA 2OZZA 3GXAA 3ILUB 2QSXA 3RTFB 5CMCA 4EUOA 4QFOA 1OMPA 3DP6A 1USYE 4U1ZA 3RGYA 2Y84A 3FV1A 4O3AA 3TDJA 1XVYA 3Q25A 1JEVA 4Z7EA 4U22A 3PUZE 1S50A 1MG1A 1IEJA 5TU0A 1XS5A 2HCAA 2AL4A 3D4GA 1POTA 1LLSA
chains in the Genus database with same CATH superfamily
4EQ9A 3EHSA 2F6PA 1TXFA 3ILTB 4IO2A 4N8GA 4X1BA 4KCDA 5ET7A 1P1QA 4IO4A 2O6AA 3L6GA 4GWSA 2ZYNA 4F1VA 4ZEIA 4NG7A 5AA3A 3TTMA 3HFUA 1I6AA 3BBRA 1POY1 3VVEA 1FPJA 3UGWA 2I58A 3G3FA 1NV5A 3PPOA 2I48A 3TODA 2V25A 3T9HB 4HTGA 4BLAA 2F35A 1HSJA 3PPRA 4PTKA 3UN6A 1MY3A 1A55A 4GBWA 5IM2A 3S4UA 1FBFA 5EYFA 4ND9A 3G3KA 3CSGA 2QVRA 2D21A 3G3JA 3FGSA 3LSXA 3K1MA 5I59A 3IK6B 3CI8A 2O51A 4YKJA 4GQOA 1EZPA 3MZBA 1BTJA 1BKAA 4XKNA 1FBEA 2KLFA 2ZZVA 3DM0A 3GLBA 1NNPA 2V84A 3H4ZA 4E0XA 1QKBA 3GBAA 1JQFA 2Y7PA 1MXZA 3OSRA 1ANFA 3G3HA 3KG2A 4POXA 3MYUA 4YKIA 4R6KA 1NNKA 3TAJA 4DLDA 3KN3A 5KCJA 2RC7A 1FTAA 1CB6A 5CRYA 1P1OA 2VHAA 5I56A 3O29A 4OFJA 1FTJA 1FTKA 1K9YA 3IB0A 4Q30B 1O64A 3E9XA 1ZIUA 2ZMBA 4EQ7A 2Q74A 4RY1A 1QVSA 4QFKA 3RLFE 3UORA 1NV0A 3TMGA 2BJJX 3MC2A 2G29A 2XWIA 2QFLA 2HQ0A 3K6UA 2HPGA 5IAIA 4HE2A 3TCFA 1YCJA 2Z23A 4GX4A 4M1VA 5EYHA 5TP9A 1XT8A 1Y20A 1M5FA 4TOZA 2AIXA 1CNQA 1B3EA 3O9PA 4KR5A 4NF8A 1LBVA 3FJGA 3FVKA 1UTHB 2PYYA 2H5YA 1P1UA 4OEVA 4GXSB 1LGBC 5HBCA 2R8TA 2WYPA 3C32A 4Q8RA 1A7LA 1B9JA 4NF6A 4ELPA 3FATA 1P99A 4PFYA 1SVXB 1DCUA 3T66A 3QIMA 3RYDA 1LBYA 1MPCA 1MQGA 4XTCQ 2ZZXA 3FZVA 4C0RA 3HCQA 1LCFA 5I59B 3EHTA 2XXQA 4F19A 5L9OA 3FBPA 4THIA 3TUSA 3TQLA 3QXMA 1M5DA 5IKBA 2Q2AA 3W9VA 4PFWA 3VV5A 1H76A 3VLWA 1A99A 2FBPA 4NX1A 3C9HA 3EKIA 2ZYKA 4GWYA 3OEMA 3B50A 4GXAA 3EF7A 1NUWA 2ONSA 3MP1A 1P1WA 2MKZA 3HHFA 4F29A 3K0VA 5I56B 1O63A 3MP6A 1IMEA 1SW5A 4IO3A 2VPOA 4DCXA 1Y3PA 4X8RA 2I3VA 3ECRA 3W9WA 3PUXE 4ZEFA 1DK4A 3N94A 4R72A 2HXWA 1IMBA 1RYOA 1Y1MA 1DBZA 1FPKA 3OOAA 1ZMGA 3W15C 1VFDA 1TFDA 4P1EA 5LDZA 3BFTA 3FUZA 4FEDA 4OMBA 3RY3A 3QK6A 3HV1A 4AB5A 3I5OA 2O7UA 3HPIA 3KSXA 1B40A 1QULA 3IORA 3U93A 4R9GA 4ZE8A 2Y7WA 4EXKA 3KBRA 5DT6A 5CM6A 4MF3A 4ZEBA 3D4CA 2G93A 3KOSA 1SD3A 3P7IA 1N7XA 3K6WA 3RPLA 3QUFA 4BDMA 3N6UA 4NF8B 3IB1A 4IGRA 5EQAA 4FAJA 1LSTA 3EQ1A 3ODBA 4ZEKA 1MXUA 1KA1A 3IFAA 4NF6B 2QS3A 2H4IA 3S9LC 1Y3QA 1NNFA 4IO6A 3KGCA 4MNCA 3N5LA 2AYSA 5LOMA 2CMOA 5I57B 1G0IA 3F11A 5AA2D 1NNTA 2WYKA 3N6TA 4XKRA 2PVUA 4G2ZA 5FTIA 4IY5A 4GX3A 4XF5A 4OZ9A 4PFIA 4MFIA 4OA4A 3HHGA 3RNNA 5B70A 2V3TA 1B0HA 4NWCA 1MQIA 4N6PA 4JVIA 1FTLA 4PAKA 4PGNA 1Q35A 3CR9A 4BDRA 4OVRA 2OWSA 1H3DA 2DSFA 1SYIA 3OO8A 3K6XA 4OYVA 4KI0E 4H0WA 4O3CA 4TLLB 4AS4A 4H8JA 4XKPA 4OANA 3N26A 1R9LA 1SW2A 4JSDA 1IXHA 3U72A 3PUVE 1DMBA 2PFZA 1B7ZA 4H6DA 4LP2B 1LBZA 3E3KA 4JDFA 4NN3A 4FEBA 3CG1A 2F3BA 4G8HA 1QGXA 3PU5A 5IZ1A 2NXOA 3BIGA 5DYHA 1NUYA 1GGGA 4GWXA 4LZ8A 4MAGA 4YB6A 3RPLB 1FCKA 1A54A 2CEXA 4YICA 1R9QA 2OWTA 3TZAA 1D4NA 1B4ZA 2P2AA 1NH8A 2VT5A 4UABA 1B6HA 3MPKA 2HZKA 1MM7A 1UIVA 2X26A 1FPGA 1ZLQA 4DI4B 3GYYA 1LCTA 3U92A 4LN5A 1HSLA 1AMFA 1LEVA 2B65A 4NWDA 3FV2A 2B4LA 2ZNTA 2I6EA 3IL1B 3B6QA 4NF0A 5H8QB 2XXTA 5AA2A 3LSFB 4R75A 4KYEA 2UVGA 4RPOA 5EQ8A 2GHAA 3T96B 4G4PA 1URGA 4PFRA 2FNCA 1PBQA 4MJOA 3CG3A 3ZS6A 1B32A 3TQWA 5FHMA 4MEVA 3TTLA 2F5XA 2B3FA 3JYRA 3FVGA 1LAHE 2ZYOA 4RK2A 1ZKBA 1NH7A 4Z0IA 2QL3A 4N81A 4BDNA 3MWBA 5I3SA 3S9MC 3VFJA 5CMMA 3H7MA 4N8YA 2FIEA 4NTLA 1KWHA 2WKYA 4H1XA 2DXYA 1LFGA 4OHNA 5ICTA 4NMYA 4GRKA 1UQWA 4PE5B 3MSTA 2HZLA 3E13X 1QKAA 1B7HA 4AS5A 1EYJA 5HM4B 4LQ5A 1AH5A 4AQ4A 4KXPA 1B0LA 3C35A 4JB7A 4I3EA 3MAMA 4HCYA 1B3FA 1RYXA 2XD2A 2UXAA 1B1HA 3WAEA 4PP0A 5I58A 3UP9A 1HSEA 1XI6A 1UIUA 4MX6A 1FQCA 1N76A 1GR2A 3EPEA 1FPEA 4PQJA 4PDDA 3K1NA 3V5AA 3S9EA 4YB7A 3VVFA 1ELJA 2OBGA 1JNFA 4ESXA 3H06B 3IOVA 4K3FA 3H6WA 1LBCA 4HW8A 1NV1A 4R9FA 4GWWA 1AOVA 4X04A 1SYHA 1B05A 3SEUA 4F22A 3S9NC 2PT1A 2THIA 5AA2B 3C36A 4P8BA 4F3SA 4ZEDA 4F3PA 1NI9A 2YJPA 1NV4A 3KEIA 4I1DA 1FJ9A 2DWAA 2REJA 4R6HA 2XX7A 4IY6A 3U94A 4XIGQ 1FBPA 4MCOA 2HHMA 5FBPA 3MUQA 1UTHA 4QFPA 3FD3A 3OO6A 4NAPA 4M4GA 1GTKA 4ZZAA 1DPPA 3CIJA 3IB2A 5ELVA 4G68A 4DXCA 2Z8EA 1S9TA 3ROJA 1NUZA 4JWXA 1A40A 1RDZA 4RJZA 5KDTB 5DVIA 1B5HA 3SERA 1GVCA 1PEBA 3PPNA 4MNPA 3R6UA 1SI0A 4ZECA 1MXWA 1ZU0A 4KCCA 2QMXA 5A5XB 4GL0A 1B58A 2D3IA 1WVJA 3B7DA 3UIFA 1EH3A 3PPQA 3SEYA 4RYAA 3U8QA 1B5IA 3TTNA 1JVXA 4TQUQ 4IO7A 2Z8DA 2CZKA 4QF9A 4MLQA 4MLVA 4H67A 3O6GA 2AL5A 4PAFA 2RCBA 4PE3A 3SETA 5I58B 2XXIA 4N17A 3SEWA 4ZZEA 3OEKA 5EHSA 4OERA 4KYDA 1LB8A 3MVXA 4OVPA 1L5TA 4G68C 4ZDMA 2UVJA 4PETA 1J1NA 2XWOA 2DVZA 3RQTA 2DXRA 4PF8A 4H65A 4DXUA 4OWDA 1KZ8A 1CE2A 3E78A 3IOWA 2BJIA 1M5BA 2OJTA 4LUBA 3R26A 1FSAA 3ISPA 1YXIA 1WODA 1B51A 2XX9A 4ONYA 1IXCA 2OX3A 3IO4A 4NQ8A 3IO6A 2F7CA 2DWJA 4MHFA 3MVZA 2HFBA 1D9QA 4G68B 4N15A 1LAFE 2DP8A 3PD8A 2P0SA 4QFNA 3FIRA 1D9YA 2D5WA 3Q26A 2RC9A 1MM6A 5I57A 4PGPA 4I3YA 2HEUA 4PFTA 2E0SA 2F36A 5H8HA 1B1XA 1NV2A 3T1BA 1FPBA 2NOOA 2ZNUA 4FBPA 4YMBA 2KQZA 4NE4A 1Y9UA 2F3DA 4PCDA 5FHOA 4WKMA 2I4BA 5DW8A 1QUJA 4GD5A 4DDDA 4QSDA 3KC0A 2H98A 3HSTA 3K4UA 3PD9A 2XXRA 2Y7KA 4IGTA 3G3GA 2VOZA 4OVSA 2HAVA 4P1LA 2O84X 3HO7A 1SW1A 3JV9A 4P0GA 3IFCA 2O7IA 4Q5TA 1N04A 2XA5A 1BIYA 4GIZA 1Z7ME 4F1UA 1JW1A 2XXUA 4F31B 1SDXA 5EQ7A 1FRPA 4YB5A 1Y1ZA 1EU8A 5ICQA 1Q1KA 1XC1A 2Q9TA 4O8MA 4JSOA 4LVQA 4WXJA 3VVDA 4F3GA 2FA7A 1FBCA 2GRVA 3TTRA 3H3GA 2UVIA 3I6VA 5I84A 3KBZA 2XHDA 4MH5A 2XXXA 3T93B 5L9MA 1EZOA 2OLBA 3G3IA 4YKKA 4ZS9A 4O7IA 2WBBA 5A5LA 3GBBA 3H6VA 3NOHA 2PT2A 2XXYA 3KOTA 3SDFA 1VSOA 3FASA 3KN8A 3LR1A 5F7VA 1FQBA 2QVUA 4NEDA 1LAXA 5ISUA 2DWIA 4OEUA 2RKMA 3Q27A 1H45A 4P56A 1Y3NA 3A09A 4ZE9A 1FPLA 3QYTA 4H5GA 5H8HB 5AE4A 3LBSA 4OFOA 3FXRA 2VPNA 3LUZA 1OVTA 5H8QA 3ZKKA 2PMSA 1IITA 3DP4A 2GQ1A 4OFLA 3D1RA 3PMXA 1NFTA 1MY1A 4HE1A 3AXFA 4GFRA 3WAFA 4YZZA 3BFUA 3OENA 1FPFA 2DWHA 2XWKA 2XD3A 1IMAA 4U4SA 2VD3A 4PAIA 3A3UA 5L9SA 1OIBA 2Y7IA 3V83A 5EQ9A 2QS2A 1Q9DA 4TLMB 2JJKA 4AB6A 3UK4A 1OVBA 3V89B 3LV0A 4LZ5A 1M5CA 2PBWA 4ISUA 1SW4A 1TT1A 2W7YA 2FHYA 1YPNA 2DVCA 5DEXA 3TYHA 4F39A 3R7XA 5ITOA 2Z22A 4IB2A 3M3LA 2GHBA 3OO9A 1I6QA 3T9UA 3KN7A 1BLFA 1PBPA 4U4XA 1MQHA 1MY2A 1N84A 4F2QA 2B4MA 3FJMA 3KSJA 5F24A 5IZ3A 4OQOA 1MQJA 1INPA 3PTYA 1K9ZA 4PFBA 3EHUA 1I69A 4QBAA 2DYXA 4X9TA 2E1SA 4BDLA 2F6GA 1QW0A 4HE0A 4N6DA 3SEVA 1MDP1 3VXCA 4H45A 1JW5A 4GLIA 3H6TA 1IUDA 3CFXA 5ET6A 3DP8A 1FPIA 4RNSA 2A5SA 4Q0CA 3U65A 4EXLA 2DOJA 5CBRA 4X48A 3MP8A 4C1TA 1FJ6A 1XHYA 4ELQA 3RTWB 1FQFA 3ZKLA 1PB9A 1BK4A 1MPDA 1WDNA 3O2AA 3VXBA 2Y7RA 2RINA 1OLCA 5FHNA 2ONRA 2XX8A 1MDQA 5ESYA 3A3CA 2Y5KA 4H8IA 1B7UA 1SI1A 1MH4A 1IIWA 3PV0E 4QSEA 1LFHA 4KQPA 4JWOA 2V93A 3DLNA 5KDTA 3QUJA 4H5FA 3CFLA 1G0HA 3M3FA 5EHMA 1ZTYA 3TTKA 3K1PA 4KPTA 4ELOA 1A8EA 2H9BA 5JEIA 4PBHA 5DEXB 4R73A 4JXIA 2A5TA 1R1NA 1UTBA 4LQ2A 4LA9A 5DVJA 4KFQA 4GL8A 5A5XA 2XXHA 2I0BA 1AL3A 3VDFA 5ITPA 3B6TA 4KHZE 4MMPA 4MBPA 1MXVA 4C1UA 1IMCA 1ATGA 5CC2A 1OQHA 1EYIA 3IOUA 4P11A 4DZ1A 4YAHX 2REGA 1RDXA 1NV3A 5IZ3B 5TPAB 3IX1A 2OWZA 2F97A 2VP1A 4LONB 4N6KA 5J16A 3FVOA 3MW0A 1MS7A 3C34A 1D9VA 3CSBA 2R71A 2M8CA 4P47A 4WEPA 1F9BA 1TFAA 2P3NA 1NL5A 3RUMA 2ANJA 4EF2A 3PMWA 4QFLA 5CMKA 3I3VA 4G61A 5M2VA 2ZYMA 2X7QA 2UYEA 2VGQA 2XXVA 2QS1A 3K00A 3EN3A 4OETA 4XFEA 4RK9A 3LC8A 5H8SA 5K2XA 1O7TA 2QJEA 4FECA 3SEXA 4U2RA 3MZ1A 1XOCA 3CRBA 2V3UA 3QMFA 2Q8MA 2WEFA 4OTEA 1IMFA 4G77A 1FQAA 1H43A 3OMBA 1URDA 4ECFA 1B3HA 5ET8A 1R6ZA 1FBGA 2RCAA 2ONKE 1YTVA 3K01A 1FQDA 5I2NB 4F3BA 1JP4A 4NF5B 3O66A 4QHQA 1RKMA 1FPDA 2A5TB 1UTBB 4KD5A 1N0TA 5JTYA 4FE8A 2V4CA 2VD2A 3MBPA 4DXBA 1N3XA 3PUWE 4YU0A 4GWUA 3TFLA 2RC8A 5CMBA 1FTOA 4GOTA 1FW0A 2ABHA 1LBBA 1SBPA 3B6WA 3IR1A 4G8MA 1M5EA 1NMUA 4ESWA 1US4A 2YLNA 2IA4A 4EDPA 2CZHA 4UA8A 5F1QA 4G8NA 2DE2A 4JVCA 2HAUA 1VR5A 3TPAA 3BKIB 4FIMA 2QPQA 2HXRA 3E4RA 3ZSFA 1VE4A 1JVYA 4DE8A 4GX6A 3M8UA 2V3QA 1FTMA 4OVJA 3B8BA 4YKPA 5KZTA 1T0KA 3O28A 4HCWA 2ZXTA 3K02A 3RT6B 5IZZA 4OXVA 3VLVA 3RN8A 1MRPA 3KZGA 2I3WA 2I49A 1OLAA 2R9JA 3Q28A 1LB9A 2NUVA 3HN0A 4GBVA 2ALUA 2F34A 5AA1A 3RT8A 5I7IA 4JBZA 3L6HA 4FATA 1YAEA 4EQBA 2PFYA 1A8FA 3OELA 1MXXA 2X7PA 4R2BA 2ESNA 1ZJLA 1FBDA 5DVFA 2Q88A 3U1OA 4UACA 3K6VA 2IEEA 3PGFA 1MQDA 2R6GE 4I62A 3IJXB 2XXWA 5JTYB 1IQ7A 3IJOB 2WBDA 1BP5A 2ZNSA 3KC1A 4GWZA 3OSQA 4I8CA 5FTHA 3FXQA 2WX9A 2XXKA 5K2YA 1EYKA 5AA4A 2RF1A 2UVHA 2CZLA 1NV7A 4BDQA 1NUXA 4R2FA 3SESA 4EF1A 1N7WA 1OQGA 2OK2A 4U1OA 4PC9A 1ZBMA 1DTZA 2Q89A 3OXNA 5KCJB 3KJTA 1PC3A 5JK4A 1I6BA 2KR0A 3LUYA 5CBSA 3FVNA 2H99A 1VDWA 3MVYA 3THIA 4MNIA 1S7YA 3QAXA 2DE4A 3KFMA 2DS9A 1JETA 4P9KA 1FBHA 3UA8A 1KA0A 2O1LA 2Y5LA 4NHBA 3FJ7A 2P1SA 4OENA 4PBQA 2O1MA 4HXVA 4I9DA 4LATA 2NVUB 3S2VA 3SKPA 5DTBA 5BWJA 3TELA 1DSNA 5BUUA 4FORA 2Q8JA 2L5VA 5I2KA 4FJPA 5TP9B 1B4HA 4WEDA 1P1NA 3BIHA 1XVXA 2OCUA 3QSLA 2F7BA 4XKQA 1USYH 1DPEA 2B3BA 3ONMA 1MH3A 4U23A 1PB7A 1JEUA 3KJ7A 1EZ9A 1VFEA 3T9VA 1SQYA 3GZGA 5EYGA 3V8XB 2FIXA 5H8NA 4PFUA 1MY0A 4KYSA 1NV6A 3H03A 3VE1B 3USDA 1LAGE 1DTGA 3MVWA 4P0IA 5AA4B 1B2HA 1D3KA 1B52A 5T3JA 2XXPA 2PCRA 2FVZA 1YZ0A 3O6HA 1DOTA 3T9XB 4PDHA 2ZZWA 4X1DA 2QMWA 4O94A 1B5JA 4U21A 5J1DA 4O7MA 4IO5A 1MY4A 1QUIA 1N3WA 3LSWA 4I40A 1II5A 4F2OA 1URSA 4XEQA 3C33A 3MZ9A 2H25A 3SZPA 2DE3A 4E0WA 5H8FA 2Q2CA 1B3LA 5L8DA 3O97A 4R74A 4QXDA 5HPQA 4DI3D 3TEPA 4OESA 4RA1A 2O68A 3E79A 2FYIA 4N07A 1PDAA 2QS4A 4NF4A 1QJMA 3DELB 5TPAA 5I2KB 1AWBA 1IXIA 2CEYA 3JZJA 2LAOA 5I5PA 4POWA 5ET5A 1LFIA 3G7WA 3TCHA 3K2DA 4N91A 4O3BA 3T22A 1IXGA 3C31A 3RPWA 4RPNA 3MQ9A 4JWYA 2QRYA 4GWOA 1US5A 2I0CA 1JW4A 2F8DA 1FQEA 4ELRA 3VLUA 5H8NB 3OO7A 3CVGA 3FXBA 4QSCA 4BDOA 3MJNA 5CI5A 2UYFA 3A29A 2PX1A 3H6UA 1LBWA 3FXUA 4OVQA 1TWYA 4GVOA 2Z8FA 2F7AA 3OD7A 1MXYA 1Z7NE 2GFEA 4YMAA 1PB8A 4QRZA 3IOTA 4P3LA 2QVVA 2XWVA 1GV8A 2DDKA 4N13A 3MPLA 1B3GA 4R6YA 3PUYE 3M3KA 4JVDA 4DCYA 1Y4CA 3CHGA 4GF8A 2DQVA 5I2NA 3LSLA 3IAZA 4IR8A 4F1YA 4LZ7A 2O69A 2I4CA 4L17A 4NF5A 1AIVA 1NKXA 4DIGA 3PMVA 5H8FB 1QUKA 2NWJA 1H44A 4H46A 4F18A 2P3VA 3Q29A 3TCGA 1IZ1A 2F78A 4HS7A 3PPPA 4NF4B 2GH9A 1B46A 4RXLA 2YPNA 1IMDA 1Y4TA 3TKDA 3CFZA 5B7DA 1MPBA 3C4MA 4XXUA 3O6IA 2CZIA 2OZZA 3GXAA 3ILUB 2QSXA 4N4UA 5LTCA 3RTFB 5CMCA 4EUOA 1YYZA 4QFOA 1OMPA 3DP6A 1USYE 5IGAA 1RDYA 4OVTA 4PF6A 4U1ZA 2Y84A 3RGYA 3FV1A 3T0JA 4O3AA 1LBXA 3TDJA 1XVYA 3Q25A 1JEVA 4Z7EA 4U22A 3PUZE 1S50A 1MG1A 1IEJA 5TU0A 1XS5A 2HCAA 4NGUA 2AL4A 3D4GA 1POTA 1SPIA 4MIJA 1LLSA
chains in the Genus database with same CATH topology
4EQ9A 3EHSA 2F6PA 1TXFA 3ILTB 4IO2A 4X1BA 4KCDA 1P1QA 4IO4A 2O6AA 3L6GA 2ZYNA 4F1VA 4ZEIA 5AA3A 3TTMA 1I6AA 3BBRA 1POY1 3VVEA 3UGWA 2I58A 3G3FA 3PPOA 2I48A 3TODA 2V25A 3T9HB 4HTGA 4BLAA 2F35A 1HSJA 3PPRA 3UN6A 1MY3A 1A55A 3S4UA 5EYFA 4ND9A 3G3KA 3CSGA 2D21A 3G3JA 3FGSA 3LSXA 3K1MA 5I59A 3IK6B 3CI8A 2O51A 4YKJA 4GQOA 1EZPA 3MZBA 1BTJA 1BKAA 4XKNA 2KLFA 3DM0A 3GLBA 1NNPA 2V84A 3H4ZA 4E0XA 1QKBA 3GBAA 1JQFA 2Y7PA 1MXZA 3OSRA 1ANFA 3G3HA 3KG2A 4POXA 4YKIA 4R6KA 1NNKA 3TAJA 4DLDA 3KN3A 5KCJA 2RC7A 1CB6A 5CRYA 1P1OA 2VHAA 5I56A 3O29A 4OFJA 1FTJA 1FTKA 3IB0A 4Q30B 1O64A 3E9XA 1ZIUA 2ZMBA 4EQ7A 4RY1A 1QVSA 4QFKA 3RLFE 3UORA 3TMGA 2BJJX 3MC2A 2G29A 2HQ0A 3K6UA 5IAIA 3TCFA 1YCJA 2Z23A 4M1VA 5TP9A 1XT8A 1Y20A 1M5FA 4TOZA 2AIXA 1B3EA 3O9PA 4KR5A 4NF8A 3FJGA 3FVKA 1UTHB 2PYYA 2H5YA 1P1UA 4OEVA 4GXSB 1LGBC 5HBCA 4Q8RA 3C32A 1A7LA 1B9JA 4NF6A 4ELPA 3FATA 1P99A 4PFYA 1SVXB 3T66A 3QIMA 1MPCA 1MQGA 4XTCQ 3FZVA 4C0RA 3HCQA 1LCFA 5I59B 3EHTA 2XXQA 4F19A 5L9OA 4THIA 3TUSA 3TQLA 3QXMA 1M5DA 5IKBA 2Q2AA 3W9VA 4PFWA 3VV5A 1H76A 3VLWA 1A99A 3C9HA 2ZYKA 3OEMA 4GXAA 3EF7A 2ONSA 3MP1A 1P1WA 3HHFA 4F29A 3K0VA 5I56B 1O63A 3MP6A 1SW5A 4IO3A 4DCXA 1Y3PA 2I3VA 3ECRA 3W9WA 3PUXE 4ZEFA 3N94A 4R72A 2HXWA 1RYOA 1Y1MA 3OOAA 1ZMGA 3W15C 1VFDA 1TFDA 3BFTA 3FUZA 4FEDA 4OMBA 3RY3A 3QK6A 3HV1A 4AB5A 3I5OA 2O7UA 3HPIA 3KSXA 1B40A 1QULA 3IORA 3U93A 4R9GA 4ZE8A 2Y7WA 4EXKA 3KBRA 5DT6A 5CM6A 4MF3A 4ZEBA 3D4CA 2G93A 3KOSA 1SD3A 3P7IA 1N7XA 3K6WA 3QUFA 4BDMA 3N6UA 4NF8B 3IB1A 4IGRA 4FAJA 1LSTA 3EQ1A 3ODBA 4ZEKA 1MXUA 4NF6B 2QS3A 2H4IA 3S9LC 1Y3QA 1NNFA 4IO6A 3KGCA 3N5LA 2AYSA 5LOMA 2CMOA 5I57B 3F11A 5AA2D 1NNTA 3N6TA 4XKRA 2PVUA 4G2ZA 5FTIA 4IY5A 4OZ9A 4MFIA 3HHGA 3RNNA 5B70A 2V3TA 1B0HA 4NWCA 1MQIA 4N6PA 1FTLA 1Q35A 3CR9A 4BDRA 2OWSA 1H3DA 2DSFA 1SYIA 3OO8A 3K6XA 4OYVA 4KI0E 4H0WA 4O3CA 4TLLB 4H8JA 4XKPA 3N26A 1R9LA 1SW2A 4JSDA 1IXHA 3U72A 3PUVE 1DMBA 1B7ZA 4H6DA 4LP2B 3E3KA 4JDFA 4FEBA 3CG1A 4G8HA 3PU5A 2NXOA 5DYHA 1GGGA 4LZ8A 4YB6A 1FCKA 1A54A 4YICA 3TZAA 1R9QA 2OWTA 1D4NA 1B4ZA 2P2AA 1NH8A 1B6HA 3MPKA 2HZKA 1MM7A 1UIVA 2X26A 1ZLQA 1LCTA 3U92A 1HSLA 1AMFA 2B65A 4NWDA 3FV2A 2ZNTA 2I6EA 3IL1B 3B6QA 5H8QB 2XXTA 5AA2A 3LSFB 4R75A 4KYEA 2UVGA 4RPOA 2GHAA 3T96B 4G4PA 1URGA 2FNCA 1PBQA 3CG3A 3ZS6A 1B32A 3TQWA 5FHMA 3TTLA 2F5XA 2B3FA 3JYRA 3FVGA 1LAHE 2ZYOA 4RK2A 1ZKBA 1NH7A 4Z0IA 2QL3A 4BDNA 3MWBA 3S9MC 3VFJA 5CMMA 3H7MA 4NTLA 1KWHA 2WKYA 4H1XA 2DXYA 1LFGA 4OHNA 5ICTA 4NMYA 4GRKA 1UQWA 4PE5B 2HZLA 3E13X 1QKAA 1B7HA 5HM4B 4LQ5A 1AH5A 4AQ4A 1B0LA 3C35A 4JB7A 3MAMA 4HCYA 1B3FA 1RYXA 2XD2A 2UXAA 1B1HA 3WAEA 4PP0A 5I58A 3UP9A 1HSEA 1UIUA 1FQCA 1N76A 1GR2A 3EPEA 4PQJA 3K1NA 3V5AA 3S9EA 4YB7A 3VVFA 1ELJA 2OBGA 1JNFA 4ESXA 3H06B 3IOVA 4K3FA 3H6WA 1LBCA 4HW8A 4R9FA 1AOVA 1SYHA 1B05A 3SEUA 4F22A 3S9NC 2PT1A 2THIA 5AA2B 3C36A 4F3SA 4ZEDA 4F3PA 2YJPA 3KEIA 4I1DA 2DWAA 2REJA 4R6HA 2XX7A 4IY6A 3U94A 4XIGQ 3MUQA 1UTHA 4QFPA 3FD3A 3OO6A 4M4GA 1GTKA 4ZZAA 1DPPA 3CIJA 3IB2A 5ELVA 4G68A 4DXCA 2Z8EA 1S9TA 4JWXA 1A40A 4RJZA 5KDTB 5DVIA 1B5HA 3SERA 1GVCA 1PEBA 3PPNA 3R6UA 1SI0A 4ZECA 1MXWA 1ZU0A 4KCCA 2QMXA 5A5XB 4GL0A 1B58A 2D3IA 1WVJA 3B7DA 3UIFA 1EH3A 3PPQA 3SEYA 4RYAA 3U8QA 1B5IA 3TTNA 1JVXA 4TQUQ 4IO7A 2Z8DA 4QF9A 4MLQA 4MLVA 4H67A 3O6GA 2AL5A 2RCBA 3SETA 5I58B 2XXIA 3SEWA 4ZZEA 3OEKA 5EHSA 4OERA 4KYDA 1LB8A 3MVXA 1L5TA 4G68C 4ZDMA 2UVJA 4PETA 1J1NA 2DVZA 3RQTA 2DXRA 4H65A 4DXUA 4OWDA 1CE2A 3IOWA 1M5BA 2OJTA 4LUBA 3R26A 1WODA 1B51A 2XX9A 4ONYA 1IXCA 3IO4A 3IO6A 2F7CA 2DWJA 3MVZA 2HFBA 4G68B 1LAFE 2DP8A 3PD8A 2P0SA 4QFNA 3FIRA 1D9YA 2D5WA 3Q26A 2RC9A 1MM6A 5I57A 2HEUA 4PFTA 2E0SA 2F36A 5H8HA 1B1XA 2NOOA 2ZNUA 4YMBA 4NE4A 1Y9UA 5FHOA 4WKMA 2I4BA 1QUJA 4GD5A 4DDDA 4QSDA 2H98A 3HSTA 3K4UA 3PD9A 2XXRA 2Y7KA 4IGTA 3G3GA 2VOZA 2HAVA 2O84X 3HO7A 1SW1A 3JV9A 4P0GA 2O7IA 4Q5TA 1N04A 1BIYA 4GIZA 1Z7ME 4F1UA 1JW1A 2XXUA 4F31B 1SDXA 4YB5A 1Y1ZA 1EU8A 5ICQA 1Q1KA 1XC1A 2Q9TA 4LVQA 4JSOA 4WXJA 3VVDA 4F3GA 2FA7A 2GRVA 3TTRA 3H3GA 2UVIA 3I6VA 5I84A 2XHDA 4MH5A 2XXXA 3T93B 5L9MA 1EZOA 2OLBA 3G3IA 4YKKA 4ZS9A 3GBBA 3H6VA 2PT2A 2XXYA 3KOTA 3SDFA 1VSOA 3FASA 3KN8A 3LR1A 5F7VA 1FQBA 4NEDA 1LAXA 5ISUA 2DWIA 4OEUA 2RKMA 3Q27A 1H45A 1Y3NA 3A09A 4ZE9A 3QYTA 4H5GA 5H8HB 5AE4A 3LBSA 4OFOA 3FXRA 1OVTA 5H8QA 3ZKKA 2PMSA 1IITA 3DP4A 4OFLA 3PMXA 1NFTA 1MY1A 3AXFA 4GFRA 3WAFA 4YZZA 3BFUA 3OENA 2DWHA 2XD3A 4U4SA 2VD3A 5L9SA 3A3UA 1OIBA 2Y7IA 3V83A 2QS2A 4TLMB 4AB6A 3UK4A 1OVBA 3V89B 4LZ5A 1M5CA 2PBWA 4ISUA 1SW4A 1TT1A 2W7YA 1YPNA 2DVCA 5DEXA 3TYHA 4F39A 3R7XA 5ITOA 2Z22A 4IB2A 3M3LA 2GHBA 3OO9A 1I6QA 3T9UA 3KN7A 1BLFA 1PBPA 4U4XA 1MQHA 1MY2A 1N84A 4F2QA 3FJMA 3KSJA 4OQOA 1MQJA 3EHUA 1I69A 2DYXA 4X9TA 2E1SA 4BDLA 2F6GA 1QW0A 3SEVA 1MDP1 3VXCA 1JW5A 4GLIA 3H6TA 1IUDA 3CFXA 3DP8A 4RNSA 2A5SA 4Q0CA 4EXLA 2DOJA 5CBRA 4X48A 3MP8A 4C1TA 1XHYA 4ELQA 3RTWB 1FQFA 3ZKLA 1PB9A 1MPDA 1WDNA 3O2AA 3VXBA 2Y7RA 2RINA 1OLCA 5FHNA 2ONRA 2XX8A 1MDQA 3A3CA 4H8IA 1B7UA 1SI1A 1MH4A 1IIWA 3PV0E 4QSEA 1LFHA 4KQPA 4JWOA 2V93A 3DLNA 5KDTA 3QUJA 4H5FA 3CFLA 5EHMA 3M3FA 1ZTYA 3TTKA 3K1PA 4KPTA 4ELOA 1A8EA 2H9BA 5JEIA 5DEXB 4JXIA 4R73A 2A5TA 1R1NA 1UTBA 4LQ2A 4LA9A 5DVJA 4KFQA 4GL8A 5A5XA 2XXHA 2I0BA 1AL3A 3VDFA 5ITPA 3B6TA 4KHZE 4MBPA 1MXVA 4C1UA 1ATGA 5CC2A 1OQHA 3IOUA 4P11A 4DZ1A 4YAHX 2REGA 5TPAB 3IX1A 2F97A 2VP1A 4LONB 3FVOA 3MW0A 1MS7A 3C34A 1D9VA 3CSBA 2R71A 2M8CA 4WEPA 1F9BA 1TFAA 1NL5A 3RUMA 2ANJA 4EF2A 3PMWA 4QFLA 5CMKA 3I3VA 5M2VA 2ZYMA 2X7QA 2UYEA 2VGQA 2XXVA 2QS1A 3K00A 3EN3A 4OETA 4RK9A 3LC8A 5H8SA 5K2XA 1O7TA 2QJEA 4FECA 3SEXA 4U2RA 3MZ1A 1XOCA 3CRBA 2V3UA 4G77A 4OTEA 1FQAA 1H43A 3OMBA 1URDA 4ECFA 1B3HA 1R6ZA 2RCAA 2ONKE 1YTVA 3K01A 1FQDA 5I2NB 4F3BA 4NF5B 3O66A 4QHQA 1RKMA 2A5TB 1UTBB 4KD5A 1N0TA 5JTYA 4FE8A 2VD2A 3MBPA 4DXBA 1N3XA 3PUWE 4YU0A 3TFLA 2RC8A 5CMBA 1FTOA 4GOTA 1FW0A 2ABHA 1LBBA 1SBPA 3B6WA 3IR1A 4G8MA 1M5EA 1NMUA 4ESWA 1US4A 2YLNA 2IA4A 4EDPA 4UA8A 5F1QA 4G8NA 2DE2A 2HAUA 1VR5A 3TPAA 3BKIB 4FIMA 2QPQA 3E4RA 3ZSFA 1VE4A 1JVYA 4DE8A 3M8UA 2V3QA 1FTMA 4OVJA 4YKPA 5KZTA 1T0KA 3O28A 4HCWA 2ZXTA 3K02A 3RT6B 4OXVA 3VLVA 3RN8A 1MRPA 3KZGA 2I3WA 2I49A 1OLAA 2R9JA 3Q28A 1LB9A 2NUVA 3HN0A 2ALUA 2F34A 5AA1A 3RT8A 4JBZA 3L6HA 4FATA 1YAEA 4EQBA 1A8FA 3OELA 1MXXA 2X7PA 4R2BA 2ESNA 1ZJLA 5DVFA 2Q88A 3U1OA 4UACA 3K6VA 2IEEA 3PGFA 1MQDA 2R6GE 4I62A 3IJXB 2XXWA 5JTYB 1IQ7A 3IJOB 2ZNSA 1BP5A 3OSQA 4I8CA 5FTHA 3FXQA 5K2YA 5AA4A 2RF1A 2UVHA 2CZLA 4BDQA 4R2FA 3SESA 4EF1A 1N7WA 1OQGA 2OK2A 4U1OA 1ZBMA 1DTZA 2Q89A 3OXNA 5KCJB 3KJTA 1PC3A 5JK4A 1I6BA 3LUYA 5CBSA 3FVNA 2H99A 3MVYA 3THIA 1S7YA 3QAXA 2DE4A 3KFMA 2DS9A 1JETA 3UA8A 2O1LA 3FJ7A 2P1SA 4OENA 2O1MA 4I9DA 4LATA 2NVUB 3S2VA 3SKPA 5DTBA 5BWJA 3TELA 1DSNA 5BUUA 4FORA 2Q8JA 5I2KA 4FJPA 5TP9B 1B4HA 4WEDA 1P1NA 1XVXA 2OCUA 3QSLA 2F7BA 4XKQA 1USYH 1DPEA 2B3BA 3ONMA 1MH3A 4U23A 1PB7A 1JEUA 3KJ7A 1EZ9A 1VFEA 3T9VA 1SQYA 3GZGA 3V8XB 5H8NA 4PFUA 1MY0A 4KYSA 3H03A 3VE1B 3USDA 1LAGE 1DTGA 3MVWA 5AA4B 4P0IA 1B2HA 1D3KA 1B52A 2XXPA 3O6HA 1DOTA 3T9XB 4X1DA 2QMWA 1B5JA 4U21A 5J1DA 4IO5A 1MY4A 1QUIA 1N3WA 3LSWA 1II5A 4F2OA 1URSA 3C33A 3MZ9A 2H25A 2DE3A 4E0WA 5H8FA 2Q2CA 1B3LA 5L8DA 3O97A 4R74A 5HPQA 3TEPA 4OESA 4RA1A 2O68A 2FYIA 4N07A 1PDAA 2QS4A 4NF4A 1QJMA 3DELB 5TPAA 5I2KB 1IXIA 3JZJA 2LAOA 4POWA 1LFIA 3G7WA 3TCHA 3K2DA 4O3BA 3T22A 1IXGA 3C31A 3RPWA 4RPNA 3MQ9A 4JWYA 2QRYA 4GWOA 1US5A 2I0CA 1JW4A 2F8DA 1FQEA 4ELRA 3VLUA 5H8NB 3OO7A 3CVGA 4QSCA 4BDOA 3MJNA 5CI5A 2UYFA 2PX1A 3H6UA 3FXUA 1TWYA 4GVOA 2Z8FA 2F7AA 3OD7A 1MXYA 1Z7NE 2GFEA 4YMAA 1PB8A 4QRZA 3IOTA 1GV8A 4N13A 3MPLA 1B3GA 4R6YA 3PUYE 3M3KA 4DCYA 1Y4CA 4GF8A 2DQVA 5I2NA 3LSLA 3IAZA 4F1YA 4LZ7A 2O69A 2I4CA 4L17A 4NF5A 1AIVA 1NKXA 4DIGA 3PMVA 5H8FB 1QUKA 2NWJA 1H44A 4F18A 3Q29A 3TCGA 1IZ1A 2F78A 4HS7A 3PPPA 4NF4B 2GH9A 1B46A 4RXLA 2YPNA 1Y4TA 3TKDA 3CFZA 5B7DA 1MPBA 3C4MA 4XXUA 3O6IA 2OZZA 3GXAA 3ILUB 2QSXA 3RTFB 5CMCA 4EUOA 4QFOA 1OMPA 3DP6A 1USYE 4U1ZA 3RGYA 2Y84A 3FV1A 4O3AA 3TDJA 1XVYA 3Q25A 1JEVA 4Z7EA 4U22A 3PUZE 1S50A 1MG1A 1IEJA 5TU0A 1XS5A 2HCAA 2AL4A 3D4GA 1POTA 1LLSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EQ9 A;  3EHS A;  2F6P A;  1TXF A;  3ILT B;  4IO2 A;  4X1B A;  4KCD A;  1P1Q A;  4IO4 A;  2O6A A;  3L6G A;  2ZYN A;  4F1V A;  4ZEI A;  5AA3 A;  3TTM A;  1I6A A;  3BBR A;  1POY 1;  3VVE A;  3UGW A;  2I58 A;  3G3F A;  3PPO A;  2I48 A;  3TOD A;  2V25 A;  3T9H B;  4HTG A;  4BLA A;  2F35 A;  1HSJ A;  3PPR A;  3UN6 A;  1MY3 A;  1A55 A;  3S4U A;  5EYF A;  4ND9 A;  3G3K A;  3CSG A;  2D21 A;  3G3J A;  3FGS A;  3LSX A;  3K1M A;  5I59 A;  3IK6 B;  3CI8 A;  2O51 A;  4YKJ A;  4GQO A;  1EZP A;  3MZB A;  1BTJ A;  1BKA A;  4XKN A;  2KLF A;  3DM0 A;  3GLB A;  1NNP A;  2V84 A;  3H4Z A;  4E0X A;  1QKB A;  3GBA A;  1JQF A;  2Y7P A;  1MXZ A;  3OSR A;  1ANF A;  3G3H A;  3KG2 A;  4POX A;  4YKI A;  4R6K A;  1NNK A;  3TAJ A;  4DLD A;  3KN3 A;  5KCJ A;  2RC7 A;  1CB6 A;  5CRY A;  1P1O A;  2VHA A;  5I56 A;  3O29 A;  4OFJ A;  1FTJ A;  1FTK A;  3IB0 A;  4Q30 B;  1O64 A;  3E9X A;  1ZIU A;  2ZMB A;  4EQ7 A;  4RY1 A;  1QVS A;  4QFK A;  3RLF E;  3UOR A;  3TMG A;  2BJJ X;  3MC2 A;  2G29 A;  2HQ0 A;  3K6U A;  5IAI A;  3TCF A;  1YCJ A;  2Z23 A;  4M1V A;  5TP9 A;  1XT8 A;  1Y20 A;  1M5F A;  4TOZ A;  2AIX A;  1B3E A;  3O9P A;  4KR5 A;  4NF8 A;  3FJG A;  3FVK A;  1UTH B;  2PYY A;  2H5Y A;  1P1U A;  4OEV A;  4GXS B;  1LGB C;  5HBC A;  4Q8R A;  3C32 A;  1A7L A;  1B9J A;  4NF6 A;  4ELP A;  3FAT A;  1P99 A;  4PFY A;  1SVX B;  3T66 A;  3QIM A;  1MPC A;  1MQG A;  4XTC Q;  3FZV A;  4C0R A;  3HCQ A;  1LCF A;  5I59 B;  3EHT A;  2XXQ A;  4F19 A;  5L9O A;  4THI A;  3TUS A;  3TQL A;  3QXM A;  1M5D A;  5IKB A;  2Q2A A;  3W9V A;  4PFW A;  3VV5 A;  1H76 A;  3VLW A;  1A99 A;  3C9H A;  2ZYK A;  3OEM A;  4GXA A;  3EF7 A;  2ONS A;  3MP1 A;  1P1W A;  3HHF A;  4F29 A;  3K0V A;  5I56 B;  1O63 A;  3MP6 A;  1SW5 A;  4IO3 A;  4DCX A;  1Y3P A;  2I3V A;  3ECR A;  3W9W A;  3PUX E;  4ZEF A;  3N94 A;  4R72 A;  2HXW A;  1RYO A;  1Y1M A;  3OOA A;  1ZMG A;  3W15 C;  1VFD A;  1TFD A;  3BFT A;  3FUZ A;  4FED A;  4OMB A;  3RY3 A;  3QK6 A;  3HV1 A;  4AB5 A;  3I5O A;  2O7U A;  3HPI A;  3KSX A;  1B40 A;  1QUL A;  3IOR A;  3U93 A;  4R9G A;  4ZE8 A;  2Y7W A;  4EXK A;  3KBR A;  5DT6 A;  5CM6 A;  4MF3 A;  4ZEB A;  3D4C A;  2G93 A;  3KOS A;  1SD3 A;  3P7I A;  1N7X A;  3K6W A;  3QUF A;  4BDM A;  3N6U A;  4NF8 B;  3IB1 A;  4IGR A;  4FAJ A;  1LST A;  3EQ1 A;  3ODB A;  4ZEK A;  1MXU A;  4NF6 B;  2QS3 A;  2H4I A;  3S9L C;  1Y3Q A;  1NNF A;  4IO6 A;  3KGC A;  3N5L A;  2AYS A;  5LOM A;  2CMO A;  5I57 B;  3F11 A;  5AA2 D;  1NNT A;  3N6T A;  4XKR A;  2PVU A;  4G2Z A;  5FTI A;  4IY5 A;  4OZ9 A;  4MFI A;  3HHG A;  3RNN A;  5B70 A;  2V3T A;  1B0H A;  4NWC A;  1MQI A;  4N6P A;  1FTL A;  1Q35 A;  3CR9 A;  4BDR A;  2OWS A;  1H3D A;  2DSF A;  1SYI A;  3OO8 A;  3K6X A;  4OYV A;  4KI0 E;  4H0W A;  4O3C A;  4TLL B;  4H8J A;  4XKP A;  3N26 A;  1R9L A;  1SW2 A;  4JSD A;  1IXH A;  3U72 A;  3PUV E;  1DMB A;  1B7Z A;  4H6D A;  4LP2 B;  3E3K A;  4JDF A;  4FEB A;  3CG1 A;  4G8H A;  3PU5 A;  2NXO A;  5DYH A;  1GGG A;  4LZ8 A;  4YB6 A;  1FCK A;  1A54 A;  4YIC A;  3TZA A;  1R9Q A;  2OWT A;  1D4N A;  1B4Z A;  2P2A A;  1NH8 A;  1B6H A;  3MPK A;  2HZK A;  1MM7 A;  1UIV A;  2X26 A;  1ZLQ A;  1LCT A;  3U92 A;  1HSL A;  1AMF A;  2B65 A;  4NWD A;  3FV2 A;  2ZNT A;  2I6E A;  3IL1 B;  3B6Q A;  5H8Q B;  2XXT A;  5AA2 A;  3LSF B;  4R75 A;  4KYE A;  2UVG A;  4RPO A;  2GHA A;  3T96 B;  4G4P A;  1URG A;  2FNC A;  1PBQ A;  3CG3 A;  3ZS6 A;  1B32 A;  3TQW A;  5FHM A;  3TTL A;  2F5X A;  2B3F A;  3JYR A;  3FVG A;  1LAH E;  2ZYO A;  4RK2 A;  1ZKB A;  1NH7 A;  4Z0I A;  2QL3 A;  4BDN A;  3MWB A;  3S9M C;  3VFJ A;  5CMM A;  3H7M A;  4NTL A;  1KWH A;  2WKY A;  4H1X A;  2DXY A;  1LFG A;  4OHN A;  5ICT A;  4NMY A;  4GRK A;  1UQW A;  4PE5 B;  2HZL A;  3E13 X;  1QKA A;  1B7H A;  5HM4 B;  4LQ5 A;  1AH5 A;  4AQ4 A;  1B0L A;  3C35 A;  4JB7 A;  3MAM A;  4HCY A;  1B3F A;  1RYX A;  2XD2 A;  2UXA A;  1B1H A;  3WAE A;  4PP0 A;  5I58 A;  3UP9 A;  1HSE A;  1UIU A;  1FQC A;  1N76 A;  1GR2 A;  3EPE A;  4PQJ A;  3K1N A;  3V5A A;  3S9E A;  4YB7 A;  3VVF A;  1ELJ A;  2OBG A;  1JNF A;  4ESX A;  3H06 B;  3IOV A;  4K3F A;  3H6W A;  1LBC A;  4HW8 A;  4R9F A;  1AOV A;  1SYH A;  1B05 A;  3SEU A;  4F22 A;  3S9N C;  2PT1 A;  2THI A;  5AA2 B;  3C36 A;  4F3S A;  4ZED A;  4F3P A;  2YJP A;  3KEI A;  4I1D A;  2DWA A;  2REJ A;  4R6H A;  2XX7 A;  4IY6 A;  3U94 A;  4XIG Q;  3MUQ A;  1UTH A;  4QFP A;  3FD3 A;  3OO6 A;  4M4G A;  1GTK A;  4ZZA A;  1DPP A;  3CIJ A;  3IB2 A;  5ELV A;  4G68 A;  4DXC A;  2Z8E A;  1S9T A;  4JWX A;  1A40 A;  4RJZ A;  5KDT B;  5DVI A;  1B5H A;  3SER A;  1GVC A;  1PEB A;  3PPN A;  3R6U A;  1SI0 A;  4ZEC A;  1MXW A;  1ZU0 A;  4KCC A;  2QMX A;  5A5X B;  4GL0 A;  1B58 A;  2D3I A;  1WVJ A;  3B7D A;  3UIF A;  1EH3 A;  3PPQ A;  3SEY A;  4RYA A;  3U8Q A;  1B5I A;  3TTN A;  1JVX A;  4TQU Q;  4IO7 A;  2Z8D A;  4QF9 A;  4MLQ A;  4MLV A;  4H67 A;  3O6G A;  2AL5 A;  2RCB A;  3SET A;  5I58 B;  2XXI A;  3SEW A;  4ZZE A;  3OEK A;  5EHS A;  4OER A;  4KYD A;  1LB8 A;  3MVX A;  1L5T A;  4G68 C;  4ZDM A;  2UVJ A;  4PET A;  1J1N A;  2DVZ A;  3RQT A;  2DXR A;  4H65 A;  4DXU A;  4OWD A;  1CE2 A;  3IOW A;  1M5B A;  2OJT A;  4LUB A;  3R26 A;  1WOD A;  1B51 A;  2XX9 A;  4ONY A;  1IXC A;  3IO4 A;  3IO6 A;  2F7C A;  2DWJ A;  3MVZ A;  2HFB A;  4G68 B;  1LAF E;  2DP8 A;  3PD8 A;  2P0S A;  4QFN A;  3FIR A;  1D9Y A;  2D5W A;  3Q26 A;  2RC9 A;  1MM6 A;  5I57 A;  2HEU A;  4PFT A;  2E0S A;  2F36 A;  5H8H A;  1B1X A;  2NOO A;  2ZNU A;  4YMB A;  4NE4 A;  1Y9U A;  5FHO A;  4WKM A;  2I4B A;  1QUJ A;  4GD5 A;  4DDD A;  4QSD A;  2H98 A;  3HST A;  3K4U A;  3PD9 A;  2XXR A;  2Y7K A;  4IGT A;  3G3G A;  2VOZ A;  2HAV A;  2O84 X;  3HO7 A;  1SW1 A;  3JV9 A;  4P0G A;  2O7I A;  4Q5T A;  1N04 A;  1BIY A;  4GIZ A;  1Z7M E;  4F1U A;  1JW1 A;  2XXU A;  4F31 B;  1SDX A;  4YB5 A;  1Y1Z A;  1EU8 A;  5ICQ A;  1Q1K A;  1XC1 A;  2Q9T A;  4LVQ A;  4JSO A;  4WXJ A;  3VVD A;  4F3G A;  2FA7 A;  2GRV A;  3TTR A;  3H3G A;  2UVI A;  3I6V A;  5I84 A;  2XHD A;  4MH5 A;  2XXX A;  3T93 B;  5L9M A;  1EZO A;  2OLB A;  3G3I A;  4YKK A;  4ZS9 A;  3GBB A;  3H6V A;  2PT2 A;  2XXY A;  3KOT A;  3SDF A;  1VSO A;  3FAS A;  3KN8 A;  3LR1 A;  5F7V A;  1FQB A;  4NED A;  1LAX A;  5ISU A;  2DWI A;  4OEU A;  2RKM A;  3Q27 A;  1H45 A;  1Y3N A;  3A09 A;  4ZE9 A;  3QYT A;  4H5G A;  5H8H B;  5AE4 A;  3LBS A;  4OFO A;  3FXR A;  1OVT A;  5H8Q A;  3ZKK A;  2PMS A;  1IIT A;  3DP4 A;  4OFL A;  3PMX A;  1NFT A;  1MY1 A;  3AXF A;  4GFR A;  3WAF A;  4YZZ A;  3BFU A;  3OEN A;  2DWH A;  2XD3 A;  4U4S A;  2VD3 A;  5L9S A;  3A3U A;  1OIB A;  2Y7I A;  3V83 A;  2QS2 A;  4TLM B;  4AB6 A;  3UK4 A;  1OVB A;  3V89 B;  4LZ5 A;  1M5C A;  2PBW A;  4ISU A;  1SW4 A;  1TT1 A;  2W7Y A;  1YPN A;  2DVC A;  5DEX A;  3TYH A;  4F39 A;  3R7X A;  5ITO A;  2Z22 A;  4IB2 A;  3M3L A;  2GHB A;  3OO9 A;  1I6Q A;  3T9U A;  3KN7 A;  1BLF A;  1PBP A;  4U4X A;  1MQH A;  1MY2 A;  1N84 A;  4F2Q A;  3FJM A;  3KSJ A;  4OQO A;  1MQJ A;  3EHU A;  1I69 A;  2DYX A;  4X9T A;  2E1S A;  4BDL A;  2F6G A;  1QW0 A;  3SEV A;  1MDP 1;  3VXC A;  1JW5 A;  4GLI A;  3H6T A;  1IUD A;  3CFX A;  3DP8 A;  4RNS A;  2A5S A;  4Q0C A;  4EXL A;  2DOJ A;  5CBR A;  4X48 A;  3MP8 A;  4C1T A;  1XHY A;  4ELQ A;  3RTW B;  1FQF A;  3ZKL A;  1PB9 A;  1MPD A;  1WDN A;  3O2A A;  3VXB A;  2Y7R A;  2RIN A;  1OLC A;  5FHN A;  2ONR A;  2XX8 A;  1MDQ A;  3A3C A;  4H8I A;  1B7U A;  1SI1 A;  1MH4 A;  1IIW A;  3PV0 E;  4QSE A;  1LFH A;  4KQP A;  4JWO A;  2V93 A;  3DLN A;  5KDT A;  3QUJ A;  4H5F A;  3CFL A;  5EHM A;  3M3F A;  1ZTY A;  3TTK A;  3K1P A;  4KPT A;  4ELO A;  1A8E A;  2H9B A;  5JEI A;  5DEX B;  4JXI A;  4R73 A;  2A5T A;  1R1N A;  1UTB A;  4LQ2 A;  4LA9 A;  5DVJ A;  4KFQ A;  4GL8 A;  5A5X A;  2XXH A;  2I0B A;  1AL3 A;  3VDF A;  5ITP A;  3B6T A;  4KHZ E;  4MBP A;  1MXV A;  4C1U A;  1ATG A;  5CC2 A;  1OQH A;  3IOU A;  4P11 A;  4DZ1 A;  4YAH X;  2REG A;  5TPA B;  3IX1 A;  2F97 A;  2VP1 A;  4LON B;  3FVO A;  3MW0 A;  1MS7 A;  3C34 A;  1D9V A;  3CSB A;  2R71 A;  2M8C A;  4WEP A;  1F9B A;  1TFA A;  1NL5 A;  3RUM A;  2ANJ A;  4EF2 A;  3PMW A;  4QFL A;  5CMK A;  3I3V A;  5M2V A;  2ZYM A;  2X7Q A;  2UYE A;  2VGQ A;  2XXV A;  2QS1 A;  3K00 A;  3EN3 A;  4OET A;  4RK9 A;  3LC8 A;  5H8S A;  5K2X A;  1O7T A;  2QJE A;  4FEC A;  3SEX A;  4U2R A;  3MZ1 A;  1XOC A;  3CRB A;  2V3U A;  4G77 A;  4OTE A;  1FQA A;  1H43 A;  3OMB A;  1URD A;  4ECF A;  1B3H A;  1R6Z A;  2RCA A;  2ONK E;  1YTV A;  3K01 A;  1FQD A;  5I2N B;  4F3B A;  4NF5 B;  3O66 A;  4QHQ A;  1RKM A;  2A5T B;  1UTB B;  4KD5 A;  1N0T A;  5JTY A;  4FE8 A;  2VD2 A;  3MBP A;  4DXB A;  1N3X A;  3PUW E;  4YU0 A;  3TFL A;  2RC8 A;  5CMB A;  1FTO A;  4GOT A;  1FW0 A;  2ABH A;  1LBB A;  1SBP A;  3B6W A;  3IR1 A;  4G8M A;  1M5E A;  1NMU A;  4ESW A;  1US4 A;  2YLN A;  2IA4 A;  4EDP A;  4UA8 A;  5F1Q A;  4G8N A;  2DE2 A;  2HAU A;  1VR5 A;  3TPA A;  3BKI B;  4FIM A;  2QPQ A;  3E4R A;  3ZSF A;  1VE4 A;  1JVY A;  4DE8 A;  3M8U A;  2V3Q A;  1FTM A;  4OVJ A;  4YKP A;  5KZT A;  1T0K A;  3O28 A;  4HCW A;  2ZXT A;  3K02 A;  3RT6 B;  4OXV A;  3VLV A;  3RN8 A;  1MRP A;  3KZG A;  2I3W A;  2I49 A;  1OLA A;  2R9J A;  3Q28 A;  1LB9 A;  2NUV A;  3HN0 A;  2ALU A;  2F34 A;  5AA1 A;  3RT8 A;  4JBZ A;  3L6H A;  4FAT A;  1YAE A;  4EQB A;  1A8F A;  3OEL A;  1MXX A;  2X7P A;  4R2B A;  2ESN A;  1ZJL A;  5DVF A;  2Q88 A;  3U1O A;  4UAC A;  3K6V A;  2IEE A;  3PGF A;  1MQD A;  2R6G E;  4I62 A;  3IJX B;  2XXW A;  5JTY B;  1IQ7 A;  3IJO B;  2ZNS A;  1BP5 A;  3OSQ A;  4I8C A;  5FTH A;  3FXQ A;  5K2Y A;  5AA4 A;  2RF1 A;  2UVH A;  2CZL A;  4BDQ A;  4R2F A;  3SES A;  4EF1 A;  1N7W A;  1OQG A;  2OK2 A;  4U1O A;  1ZBM A;  1DTZ A;  2Q89 A;  3OXN A;  5KCJ B;  3KJT A;  1PC3 A;  5JK4 A;  1I6B A;  3LUY A;  5CBS A;  3FVN A;  2H99 A;  3MVY A;  3THI A;  1S7Y A;  3QAX A;  2DE4 A;  3KFM A;  2DS9 A;  1JET A;  3UA8 A;  2O1L A;  3FJ7 A;  2P1S A;  4OEN A;  2O1M A;  4I9D A;  4LAT A;  2NVU B;  3S2V A;  3SKP A;  5DTB A;  5BWJ A;  3TEL A;  1DSN A;  5BUU A;  4FOR A;  2Q8J A;  5I2K A;  4FJP A;  5TP9 B;  1B4H A;  4WED A;  1P1N A;  1XVX A;  2OCU A;  3QSL A;  2F7B A;  4XKQ A;  1USY H;  1DPE A;  2B3B A;  3ONM A;  1MH3 A;  4U23 A;  1PB7 A;  1JEU A;  3KJ7 A;  1EZ9 A;  1VFE A;  3T9V A;  1SQY A;  3GZG A;  3V8X B;  5H8N A;  4PFU A;  1MY0 A;  4KYS A;  3H03 A;  3VE1 B;  3USD A;  1LAG E;  1DTG A;  3MVW A;  5AA4 B;  4P0I A;  1B2H A;  1D3K A;  1B52 A;  2XXP A;  3O6H A;  1DOT A;  3T9X B;  4X1D A;  2QMW A;  1B5J A;  4U21 A;  5J1D A;  4IO5 A;  1MY4 A;  1QUI A;  1N3W A;  3LSW A;  1II5 A;  4F2O A;  1URS A;  3C33 A;  3MZ9 A;  2H25 A;  2DE3 A;  4E0W A;  5H8F A;  2Q2C A;  1B3L A;  5L8D A;  3O97 A;  4R74 A;  5HPQ A;  3TEP A;  4OES A;  4RA1 A;  2O68 A;  2FYI A;  4N07 A;  1PDA A;  2QS4 A;  4NF4 A;  1QJM A;  3DEL B;  5TPA A;  5I2K B;  1IXI A;  3JZJ A;  2LAO A;  4POW A;  1LFI A;  3G7W A;  3TCH A;  3K2D A;  4O3B A;  3T22 A;  1IXG A;  3C31 A;  3RPW A;  4RPN A;  3MQ9 A;  4JWY A;  2QRY A;  4GWO A;  1US5 A;  2I0C A;  1JW4 A;  2F8D A;  1FQE A;  4ELR A;  3VLU A;  5H8N B;  3OO7 A;  3CVG A;  4QSC A;  4BDO A;  3MJN A;  5CI5 A;  2UYF A;  2PX1 A;  3H6U A;  3FXU A;  1TWY A;  4GVO A;  2Z8F A;  2F7A A;  3OD7 A;  1MXY A;  1Z7N E;  2GFE A;  4YMA A;  1PB8 A;  4QRZ A;  3IOT A;  1GV8 A;  4N13 A;  3MPL A;  1B3G A;  4R6Y A;  3PUY E;  3M3K A;  4DCY A;  1Y4C A;  4GF8 A;  2DQV A;  5I2N A;  3LSL A;  3IAZ A;  4F1Y A;  4LZ7 A;  2O69 A;  2I4C A;  4L17 A;  4NF5 A;  1AIV A;  1NKX A;  4DIG A;  3PMV A;  5H8F B;  1QUK A;  2NWJ A;  1H44 A;  4F18 A;  3Q29 A;  3TCG A;  1IZ1 A;  2F78 A;  4HS7 A;  3PPP A;  4NF4 B;  2GH9 A;  1B46 A;  4RXL A;  2YPN A;  1Y4T A;  3TKD A;  3CFZ A;  5B7D A;  1MPB A;  3C4M A;  4XXU A;  3O6I A;  2OZZ A;  3GXA A;  3ILU B;  2QSX A;  3RTF B;  5CMC A;  4EUO A;  4QFO A;  1OMP A;  3DP6 A;  1USY E;  4U1Z A;  3RGY A;  2Y84 A;  3FV1 A;  4O3A A;  3TDJ A;  1XVY A;  3Q25 A;  1JEV A;  4Z7E A;  4U22 A;  3PUZ E;  1S50 A;  1MG1 A;  1IEJ A;  5TU0 A;  1XS5 A;  2HCA A;  2AL4 A;  3D4G A;  1POT A;  1LLS A; 
#chains in the Genus database with same CATH topology
 4EQ9 A;  3EHS A;  2F6P A;  1TXF A;  3ILT B;  4IO2 A;  4N8G A;  4X1B A;  4KCD A;  5ET7 A;  1P1Q A;  4IO4 A;  2O6A A;  3L6G A;  4GWS A;  2ZYN A;  4F1V A;  4ZEI A;  4NG7 A;  5AA3 A;  3TTM A;  3HFU A;  1I6A A;  3BBR A;  1POY 1;  3VVE A;  1FPJ A;  3UGW A;  2I58 A;  3G3F A;  1NV5 A;  3PPO A;  2I48 A;  3TOD A;  2V25 A;  3T9H B;  4HTG A;  4BLA A;  2F35 A;  1HSJ A;  3PPR A;  4PTK A;  3UN6 A;  1MY3 A;  1A55 A;  4GBW A;  5IM2 A;  3S4U A;  1FBF A;  5EYF A;  4ND9 A;  3G3K A;  3CSG A;  2QVR A;  2D21 A;  3G3J A;  3FGS A;  3LSX A;  3K1M A;  5I59 A;  3IK6 B;  3CI8 A;  2O51 A;  4YKJ A;  4GQO A;  1EZP A;  3MZB A;  1BTJ A;  1BKA A;  4XKN A;  1FBE A;  2KLF A;  2ZZV A;  3DM0 A;  3GLB A;  1NNP A;  2V84 A;  3H4Z A;  4E0X A;  1QKB A;  3GBA A;  1JQF A;  2Y7P A;  1MXZ A;  3OSR A;  1ANF A;  3G3H A;  3KG2 A;  4POX A;  3MYU A;  4YKI A;  4R6K A;  1NNK A;  3TAJ A;  4DLD A;  3KN3 A;  5KCJ A;  2RC7 A;  1FTA A;  1CB6 A;  5CRY A;  1P1O A;  2VHA A;  5I56 A;  3O29 A;  4OFJ A;  1FTJ A;  1FTK A;  1K9Y A;  3IB0 A;  4Q30 B;  1O64 A;  3E9X A;  1ZIU A;  2ZMB A;  4EQ7 A;  2Q74 A;  4RY1 A;  1QVS A;  4QFK A;  3RLF E;  3UOR A;  1NV0 A;  3TMG A;  2BJJ X;  3MC2 A;  2G29 A;  2XWI A;  2QFL A;  2HQ0 A;  3K6U A;  2HPG A;  5IAI A;  4HE2 A;  3TCF A;  1YCJ A;  2Z23 A;  4GX4 A;  4M1V A;  5EYH A;  5TP9 A;  1XT8 A;  1Y20 A;  1M5F A;  4TOZ A;  2AIX A;  1CNQ A;  1B3E A;  3O9P A;  4KR5 A;  4NF8 A;  1LBV A;  3FJG A;  3FVK A;  1UTH B;  2PYY A;  2H5Y A;  1P1U A;  4OEV A;  4GXS B;  1LGB C;  5HBC A;  2R8T A;  2WYP A;  3C32 A;  4Q8R A;  1A7L A;  1B9J A;  4NF6 A;  4ELP A;  3FAT A;  1P99 A;  4PFY A;  1SVX B;  1DCU A;  3T66 A;  3QIM A;  3RYD A;  1LBY A;  1MPC A;  1MQG A;  4XTC Q;  2ZZX A;  3FZV A;  4C0R A;  3HCQ A;  1LCF A;  5I59 B;  3EHT A;  2XXQ A;  4F19 A;  5L9O A;  3FBP A;  4THI A;  3TUS A;  3TQL A;  3QXM A;  1M5D A;  5IKB A;  2Q2A A;  3W9V A;  4PFW A;  3VV5 A;  1H76 A;  3VLW A;  1A99 A;  2FBP A;  4NX1 A;  3C9H A;  3EKI A;  2ZYK A;  4GWY A;  3OEM A;  3B50 A;  4GXA A;  3EF7 A;  1NUW A;  2ONS A;  3MP1 A;  1P1W A;  2MKZ A;  3HHF A;  4F29 A;  3K0V A;  5I56 B;  1O63 A;  3MP6 A;  1IME A;  1SW5 A;  4IO3 A;  2VPO A;  4DCX A;  1Y3P A;  4X8R A;  2I3V A;  3ECR A;  3W9W A;  3PUX E;  4ZEF A;  1DK4 A;  3N94 A;  4R72 A;  2HXW A;  1IMB A;  1RYO A;  1Y1M A;  1DBZ A;  1FPK A;  3OOA A;  1ZMG A;  3W15 C;  1VFD A;  1TFD A;  4P1E A;  5LDZ A;  3BFT A;  3FUZ A;  4FED A;  4OMB A;  3RY3 A;  3QK6 A;  3HV1 A;  4AB5 A;  3I5O A;  2O7U A;  3HPI A;  3KSX A;  1B40 A;  1QUL A;  3IOR A;  3U93 A;  4R9G A;  4ZE8 A;  2Y7W A;  4EXK A;  3KBR A;  5DT6 A;  5CM6 A;  4MF3 A;  4ZEB A;  3D4C A;  2G93 A;  3KOS A;  1SD3 A;  3P7I A;  1N7X A;  3K6W A;  3RPL A;  3QUF A;  4BDM A;  3N6U A;  4NF8 B;  3IB1 A;  4IGR A;  5EQA A;  4FAJ A;  1LST A;  3EQ1 A;  3ODB A;  4ZEK A;  1MXU A;  1KA1 A;  3IFA A;  4NF6 B;  2QS3 A;  2H4I A;  3S9L C;  1Y3Q A;  1NNF A;  4IO6 A;  3KGC A;  4MNC A;  3N5L A;  2AYS A;  5LOM A;  2CMO A;  5I57 B;  1G0I A;  3F11 A;  5AA2 D;  1NNT A;  2WYK A;  3N6T A;  4XKR A;  2PVU A;  4G2Z A;  5FTI A;  4IY5 A;  4GX3 A;  4XF5 A;  4OZ9 A;  4PFI A;  4MFI A;  4OA4 A;  3HHG A;  3RNN A;  5B70 A;  2V3T A;  1B0H A;  4NWC A;  1MQI A;  4N6P A;  4JVI A;  1FTL A;  4PAK A;  4PGN A;  1Q35 A;  3CR9 A;  4BDR A;  4OVR A;  2OWS A;  1H3D A;  2DSF A;  1SYI A;  3OO8 A;  3K6X A;  4OYV A;  4KI0 E;  4H0W A;  4O3C A;  4TLL B;  4AS4 A;  4H8J A;  4XKP A;  4OAN A;  3N26 A;  1R9L A;  1SW2 A;  4JSD A;  1IXH A;  3U72 A;  3PUV E;  1DMB A;  2PFZ A;  1B7Z A;  4H6D A;  4LP2 B;  1LBZ A;  3E3K A;  4JDF A;  4NN3 A;  4FEB A;  3CG1 A;  2F3B A;  4G8H A;  1QGX A;  3PU5 A;  5IZ1 A;  2NXO A;  3BIG A;  5DYH A;  1NUY A;  1GGG A;  4GWX A;  4LZ8 A;  4MAG A;  4YB6 A;  3RPL B;  1FCK A;  1A54 A;  2CEX A;  4YIC A;  1R9Q A;  2OWT A;  3TZA A;  1D4N A;  1B4Z A;  2P2A A;  1NH8 A;  2VT5 A;  4UAB A;  1B6H A;  3MPK A;  2HZK A;  1MM7 A;  1UIV A;  2X26 A;  1FPG A;  1ZLQ A;  4DI4 B;  3GYY A;  1LCT A;  3U92 A;  4LN5 A;  1HSL A;  1AMF A;  1LEV A;  2B65 A;  4NWD A;  3FV2 A;  2B4L A;  2ZNT A;  2I6E A;  3IL1 B;  3B6Q A;  4NF0 A;  5H8Q B;  2XXT A;  5AA2 A;  3LSF B;  4R75 A;  4KYE A;  2UVG A;  4RPO A;  5EQ8 A;  2GHA A;  3T96 B;  4G4P A;  1URG A;  4PFR A;  2FNC A;  1PBQ A;  4MJO A;  3CG3 A;  3ZS6 A;  1B32 A;  3TQW A;  5FHM A;  4MEV A;  3TTL A;  2F5X A;  2B3F A;  3JYR A;  3FVG A;  1LAH E;  2ZYO A;  4RK2 A;  1ZKB A;  1NH7 A;  4Z0I A;  2QL3 A;  4N81 A;  4BDN A;  3MWB A;  5I3S A;  3S9M C;  3VFJ A;  5CMM A;  3H7M A;  4N8Y A;  2FIE A;  4NTL A;  1KWH A;  2WKY A;  4H1X A;  2DXY A;  1LFG A;  4OHN A;  5ICT A;  4NMY A;  4GRK A;  1UQW A;  4PE5 B;  3MST A;  2HZL A;  3E13 X;  1QKA A;  1B7H A;  4AS5 A;  1EYJ A;  5HM4 B;  4LQ5 A;  1AH5 A;  4AQ4 A;  4KXP A;  1B0L A;  3C35 A;  4JB7 A;  4I3E A;  3MAM A;  4HCY A;  1B3F A;  1RYX A;  2XD2 A;  2UXA A;  1B1H A;  3WAE A;  4PP0 A;  5I58 A;  3UP9 A;  1HSE A;  1XI6 A;  1UIU A;  4MX6 A;  1FQC A;  1N76 A;  1GR2 A;  3EPE A;  1FPE A;  4PQJ A;  4PDD A;  3K1N A;  3V5A A;  3S9E A;  4YB7 A;  3VVF A;  1ELJ A;  2OBG A;  1JNF A;  4ESX A;  3H06 B;  3IOV A;  4K3F A;  3H6W A;  1LBC A;  4HW8 A;  1NV1 A;  4R9F A;  4GWW A;  1AOV A;  4X04 A;  1SYH A;  1B05 A;  3SEU A;  4F22 A;  3S9N C;  2PT1 A;  2THI A;  5AA2 B;  3C36 A;  4P8B A;  4F3S A;  4ZED A;  4F3P A;  1NI9 A;  2YJP A;  1NV4 A;  3KEI A;  4I1D A;  1FJ9 A;  2DWA A;  2REJ A;  4R6H A;  2XX7 A;  4IY6 A;  3U94 A;  4XIG Q;  1FBP A;  4MCO A;  2HHM A;  5FBP A;  3MUQ A;  1UTH A;  4QFP A;  3FD3 A;  3OO6 A;  4NAP A;  4M4G A;  1GTK A;  4ZZA A;  1DPP A;  3CIJ A;  3IB2 A;  5ELV A;  4G68 A;  4DXC A;  2Z8E A;  1S9T A;  3ROJ A;  1NUZ A;  4JWX A;  1A40 A;  1RDZ A;  4RJZ A;  5KDT B;  5DVI A;  1B5H A;  3SER A;  1GVC A;  1PEB A;  3PPN A;  4MNP A;  3R6U A;  1SI0 A;  4ZEC A;  1MXW A;  1ZU0 A;  4KCC A;  2QMX A;  5A5X B;  4GL0 A;  1B58 A;  2D3I A;  1WVJ A;  3B7D A;  3UIF A;  1EH3 A;  3PPQ A;  3SEY A;  4RYA A;  3U8Q A;  1B5I A;  3TTN A;  1JVX A;  4TQU Q;  4IO7 A;  2Z8D A;  2CZK A;  4QF9 A;  4MLQ A;  4MLV A;  4H67 A;  3O6G A;  2AL5 A;  4PAF A;  2RCB A;  4PE3 A;  3SET A;  5I58 B;  2XXI A;  4N17 A;  3SEW A;  4ZZE A;  3OEK A;  5EHS A;  4OER A;  4KYD A;  1LB8 A;  3MVX A;  4OVP A;  1L5T A;  4G68 C;  4ZDM A;  2UVJ A;  4PET A;  1J1N A;  2XWO A;  2DVZ A;  3RQT A;  2DXR A;  4PF8 A;  4H65 A;  4DXU A;  4OWD A;  1KZ8 A;  1CE2 A;  3E78 A;  3IOW A;  2BJI A;  1M5B A;  2OJT A;  4LUB A;  3R26 A;  1FSA A;  3ISP A;  1YXI A;  1WOD A;  1B51 A;  2XX9 A;  4ONY A;  1IXC A;  2OX3 A;  3IO4 A;  4NQ8 A;  3IO6 A;  2F7C A;  2DWJ A;  4MHF A;  3MVZ A;  2HFB A;  1D9Q A;  4G68 B;  4N15 A;  1LAF E;  2DP8 A;  3PD8 A;  2P0S A;  4QFN A;  3FIR A;  1D9Y A;  2D5W A;  3Q26 A;  2RC9 A;  1MM6 A;  5I57 A;  4PGP A;  4I3Y A;  2HEU A;  4PFT A;  2E0S A;  2F36 A;  5H8H A;  1B1X A;  1NV2 A;  3T1B A;  1FPB A;  2NOO A;  2ZNU A;  4FBP A;  4YMB A;  2KQZ A;  4NE4 A;  1Y9U A;  2F3D A;  4PCD A;  5FHO A;  4WKM A;  2I4B A;  5DW8 A;  1QUJ A;  4GD5 A;  4DDD A;  4QSD A;  3KC0 A;  2H98 A;  3HST A;  3K4U A;  3PD9 A;  2XXR A;  2Y7K A;  4IGT A;  3G3G A;  2VOZ A;  4OVS A;  2HAV A;  4P1L A;  2O84 X;  3HO7 A;  1SW1 A;  3JV9 A;  4P0G A;  3IFC A;  2O7I A;  4Q5T A;  1N04 A;  2XA5 A;  1BIY A;  4GIZ A;  1Z7M E;  4F1U A;  1JW1 A;  2XXU A;  4F31 B;  1SDX A;  5EQ7 A;  1FRP A;  4YB5 A;  1Y1Z A;  1EU8 A;  5ICQ A;  1Q1K A;  1XC1 A;  2Q9T A;  4O8M A;  4JSO A;  4LVQ A;  4WXJ A;  3VVD A;  4F3G A;  2FA7 A;  1FBC A;  2GRV A;  3TTR A;  3H3G A;  2UVI A;  3I6V A;  5I84 A;  3KBZ A;  2XHD A;  4MH5 A;  2XXX A;  3T93 B;  5L9M A;  1EZO A;  2OLB A;  3G3I A;  4YKK A;  4ZS9 A;  4O7I A;  2WBB A;  5A5L A;  3GBB A;  3H6V A;  3NOH A;  2PT2 A;  2XXY A;  3KOT A;  3SDF A;  1VSO A;  3FAS A;  3KN8 A;  3LR1 A;  5F7V A;  1FQB A;  2QVU A;  4NED A;  1LAX A;  5ISU A;  2DWI A;  4OEU A;  2RKM A;  3Q27 A;  1H45 A;  4P56 A;  1Y3N A;  3A09 A;  4ZE9 A;  1FPL A;  3QYT A;  4H5G A;  5H8H B;  5AE4 A;  3LBS A;  4OFO A;  3FXR A;  2VPN A;  3LUZ A;  1OVT A;  5H8Q A;  3ZKK A;  2PMS A;  1IIT A;  3DP4 A;  2GQ1 A;  4OFL A;  3D1R A;  3PMX A;  1NFT A;  1MY1 A;  4HE1 A;  3AXF A;  4GFR A;  3WAF A;  4YZZ A;  3BFU A;  3OEN A;  1FPF A;  2DWH A;  2XWK A;  2XD3 A;  1IMA A;  4U4S A;  2VD3 A;  4PAI A;  3A3U A;  5L9S A;  1OIB A;  2Y7I A;  3V83 A;  5EQ9 A;  2QS2 A;  1Q9D A;  4TLM B;  2JJK A;  4AB6 A;  3UK4 A;  1OVB A;  3V89 B;  3LV0 A;  4LZ5 A;  1M5C A;  2PBW A;  4ISU A;  1SW4 A;  1TT1 A;  2W7Y A;  2FHY A;  1YPN A;  2DVC A;  5DEX A;  3TYH A;  4F39 A;  3R7X A;  5ITO A;  2Z22 A;  4IB2 A;  3M3L A;  2GHB A;  3OO9 A;  1I6Q A;  3T9U A;  3KN7 A;  1BLF A;  1PBP A;  4U4X A;  1MQH A;  1MY2 A;  1N84 A;  4F2Q A;  2B4M A;  3FJM A;  3KSJ A;  5F24 A;  5IZ3 A;  4OQO A;  1MQJ A;  1INP A;  3PTY A;  1K9Z A;  4PFB A;  3EHU A;  1I69 A;  4QBA A;  2DYX A;  4X9T A;  2E1S A;  4BDL A;  2F6G A;  1QW0 A;  4HE0 A;  4N6D A;  3SEV A;  1MDP 1;  3VXC A;  4H45 A;  1JW5 A;  4GLI A;  3H6T A;  1IUD A;  3CFX A;  5ET6 A;  3DP8 A;  1FPI A;  4RNS A;  2A5S A;  4Q0C A;  3U65 A;  4EXL A;  2DOJ A;  5CBR A;  4X48 A;  3MP8 A;  4C1T A;  1FJ6 A;  1XHY A;  4ELQ A;  3RTW B;  1FQF A;  3ZKL A;  1PB9 A;  1BK4 A;  1MPD A;  1WDN A;  3O2A A;  3VXB A;  2Y7R A;  2RIN A;  1OLC A;  5FHN A;  2ONR A;  2XX8 A;  1MDQ A;  5ESY A;  3A3C A;  2Y5K A;  4H8I A;  1B7U A;  1SI1 A;  1MH4 A;  1IIW A;  3PV0 E;  4QSE A;  1LFH A;  4KQP A;  4JWO A;  2V93 A;  3DLN A;  5KDT A;  3QUJ A;  4H5F A;  3CFL A;  1G0H A;  3M3F A;  5EHM A;  1ZTY A;  3TTK A;  3K1P A;  4KPT A;  4ELO A;  1A8E A;  2H9B A;  5JEI A;  4PBH A;  5DEX B;  4R73 A;  4JXI A;  2A5T A;  1R1N A;  1UTB A;  4LQ2 A;  4LA9 A;  5DVJ A;  4KFQ A;  4GL8 A;  5A5X A;  2XXH A;  2I0B A;  1AL3 A;  3VDF A;  5ITP A;  3B6T A;  4KHZ E;  4MMP A;  4MBP A;  1MXV A;  4C1U A;  1IMC A;  1ATG A;  5CC2 A;  1OQH A;  1EYI A;  3IOU A;  4P11 A;  4DZ1 A;  4YAH X;  2REG A;  1RDX A;  1NV3 A;  5IZ3 B;  5TPA B;  3IX1 A;  2OWZ A;  2F97 A;  2VP1 A;  4LON B;  4N6K A;  5J16 A;  3FVO A;  3MW0 A;  1MS7 A;  3C34 A;  1D9V A;  3CSB A;  2R71 A;  2M8C A;  4P47 A;  4WEP A;  1F9B A;  1TFA A;  2P3N A;  1NL5 A;  3RUM A;  2ANJ A;  4EF2 A;  3PMW A;  4QFL A;  5CMK A;  3I3V A;  4G61 A;  5M2V A;  2ZYM A;  2X7Q A;  2UYE A;  2VGQ A;  2XXV A;  2QS1 A;  3K00 A;  3EN3 A;  4OET A;  4XFE A;  4RK9 A;  3LC8 A;  5H8S A;  5K2X A;  1O7T A;  2QJE A;  4FEC A;  3SEX A;  4U2R A;  3MZ1 A;  1XOC A;  3CRB A;  2V3U A;  3QMF A;  2Q8M A;  2WEF A;  4OTE A;  1IMF A;  4G77 A;  1FQA A;  1H43 A;  3OMB A;  1URD A;  4ECF A;  1B3H A;  5ET8 A;  1R6Z A;  1FBG A;  2RCA A;  2ONK E;  1YTV A;  3K01 A;  1FQD A;  5I2N B;  4F3B A;  1JP4 A;  4NF5 B;  3O66 A;  4QHQ A;  1RKM A;  1FPD A;  2A5T B;  1UTB B;  4KD5 A;  1N0T A;  5JTY A;  4FE8 A;  2V4C A;  2VD2 A;  3MBP A;  4DXB A;  1N3X A;  3PUW E;  4YU0 A;  4GWU A;  3TFL A;  2RC8 A;  5CMB A;  1FTO A;  4GOT A;  1FW0 A;  2ABH A;  1LBB A;  1SBP A;  3B6W A;  3IR1 A;  4G8M A;  1M5E A;  1NMU A;  4ESW A;  1US4 A;  2YLN A;  2IA4 A;  4EDP A;  2CZH A;  4UA8 A;  5F1Q A;  4G8N A;  2DE2 A;  4JVC A;  2HAU A;  1VR5 A;  3TPA A;  3BKI B;  4FIM A;  2QPQ A;  2HXR A;  3E4R A;  3ZSF A;  1VE4 A;  1JVY A;  4DE8 A;  4GX6 A;  3M8U A;  2V3Q A;  1FTM A;  4OVJ A;  3B8B A;  4YKP A;  5KZT A;  1T0K A;  3O28 A;  4HCW A;  2ZXT A;  3K02 A;  3RT6 B;  5IZZ A;  4OXV A;  3VLV A;  3RN8 A;  1MRP A;  3KZG A;  2I3W A;  2I49 A;  1OLA A;  2R9J A;  3Q28 A;  1LB9 A;  2NUV A;  3HN0 A;  4GBV A;  2ALU A;  2F34 A;  5AA1 A;  3RT8 A;  5I7I A;  4JBZ A;  3L6H A;  4FAT A;  1YAE A;  4EQB A;  2PFY A;  1A8F A;  3OEL A;  1MXX A;  2X7P A;  4R2B A;  2ESN A;  1ZJL A;  1FBD A;  5DVF A;  2Q88 A;  3U1O A;  4UAC A;  3K6V A;  2IEE A;  3PGF A;  1MQD A;  2R6G E;  4I62 A;  3IJX B;  2XXW A;  5JTY B;  1IQ7 A;  3IJO B;  2WBD A;  1BP5 A;  2ZNS A;  3KC1 A;  4GWZ A;  3OSQ A;  4I8C A;  5FTH A;  3FXQ A;  2WX9 A;  2XXK A;  5K2Y A;  1EYK A;  5AA4 A;  2RF1 A;  2UVH A;  2CZL A;  1NV7 A;  4BDQ A;  1NUX A;  4R2F A;  3SES A;  4EF1 A;  1N7W A;  1OQG A;  2OK2 A;  4U1O A;  4PC9 A;  1ZBM A;  1DTZ A;  2Q89 A;  3OXN A;  5KCJ B;  3KJT A;  1PC3 A;  5JK4 A;  1I6B A;  2KR0 A;  3LUY A;  5CBS A;  3FVN A;  2H99 A;  1VDW A;  3MVY A;  3THI A;  4MNI A;  1S7Y A;  3QAX A;  2DE4 A;  3KFM A;  2DS9 A;  1JET A;  4P9K A;  1FBH A;  3UA8 A;  1KA0 A;  2O1L A;  2Y5L A;  4NHB A;  3FJ7 A;  2P1S A;  4OEN A;  4PBQ A;  2O1M A;  4HXV A;  4I9D A;  4LAT A;  2NVU B;  3S2V A;  3SKP A;  5DTB A;  5BWJ A;  3TEL A;  1DSN A;  5BUU A;  4FOR A;  2Q8J A;  2L5V A;  5I2K A;  4FJP A;  5TP9 B;  1B4H A;  4WED A;  1P1N A;  3BIH A;  1XVX A;  2OCU A;  3QSL A;  2F7B A;  4XKQ A;  1USY H;  1DPE A;  2B3B A;  3ONM A;  1MH3 A;  4U23 A;  1PB7 A;  1JEU A;  3KJ7 A;  1EZ9 A;  1VFE A;  3T9V A;  1SQY A;  3GZG A;  5EYG A;  3V8X B;  2FIX A;  5H8N A;  4PFU A;  1MY0 A;  4KYS A;  1NV6 A;  3H03 A;  3VE1 B;  3USD A;  1LAG E;  1DTG A;  3MVW A;  4P0I A;  5AA4 B;  1B2H A;  1D3K A;  1B52 A;  5T3J A;  2XXP A;  2PCR A;  2FVZ A;  1YZ0 A;  3O6H A;  1DOT A;  3T9X B;  4PDH A;  2ZZW A;  4X1D A;  2QMW A;  4O94 A;  1B5J A;  4U21 A;  5J1D A;  4O7M A;  4IO5 A;  1MY4 A;  1QUI A;  1N3W A;  3LSW A;  4I40 A;  1II5 A;  4F2O A;  1URS A;  4XEQ A;  3C33 A;  3MZ9 A;  2H25 A;  3SZP A;  2DE3 A;  4E0W A;  5H8F A;  2Q2C A;  1B3L A;  5L8D A;  3O97 A;  4R74 A;  4QXD A;  5HPQ A;  4DI3 D;  3TEP A;  4OES A;  4RA1 A;  2O68 A;  3E79 A;  2FYI A;  4N07 A;  1PDA A;  2QS4 A;  4NF4 A;  1QJM A;  3DEL B;  5TPA A;  5I2K B;  1AWB A;  1IXI A;  2CEY A;  3JZJ A;  2LAO A;  5I5P A;  4POW A;  5ET5 A;  1LFI A;  3G7W A;  3TCH A;  3K2D A;  4N91 A;  4O3B A;  3T22 A;  1IXG A;  3C31 A;  3RPW A;  4RPN A;  3MQ9 A;  4JWY A;  2QRY A;  4GWO A;  1US5 A;  2I0C A;  1JW4 A;  2F8D A;  1FQE A;  4ELR A;  3VLU A;  5H8N B;  3OO7 A;  3CVG A;  3FXB A;  4QSC A;  4BDO A;  3MJN A;  5CI5 A;  2UYF A;  3A29 A;  2PX1 A;  3H6U A;  1LBW A;  3FXU A;  4OVQ A;  1TWY A;  4GVO A;  2Z8F A;  2F7A A;  3OD7 A;  1MXY A;  1Z7N E;  2GFE A;  4YMA A;  1PB8 A;  4QRZ A;  3IOT A;  4P3L A;  2QVV A;  2XWV A;  1GV8 A;  2DDK A;  4N13 A;  3MPL A;  1B3G A;  4R6Y A;  3PUY E;  3M3K A;  4JVD A;  4DCY A;  1Y4C A;  3CHG A;  4GF8 A;  2DQV A;  5I2N A;  3LSL A;  3IAZ A;  4IR8 A;  4F1Y A;  4LZ7 A;  2O69 A;  2I4C A;  4L17 A;  4NF5 A;  1AIV A;  1NKX A;  4DIG A;  3PMV A;  5H8F B;  1QUK A;  2NWJ A;  1H44 A;  4H46 A;  4F18 A;  2P3V A;  3Q29 A;  3TCG A;  1IZ1 A;  2F78 A;  4HS7 A;  3PPP A;  4NF4 B;  2GH9 A;  1B46 A;  4RXL A;  2YPN A;  1IMD A;  1Y4T A;  3TKD A;  3CFZ A;  5B7D A;  1MPB A;  3C4M A;  4XXU A;  3O6I A;  2CZI A;  2OZZ A;  3GXA A;  3ILU B;  2QSX A;  4N4U A;  5LTC A;  3RTF B;  5CMC A;  4EUO A;  1YYZ A;  4QFO A;  1OMP A;  3DP6 A;  1USY E;  5IGA A;  1RDY A;  4OVT A;  4PF6 A;  4U1Z A;  2Y84 A;  3RGY A;  3FV1 A;  3T0J A;  4O3A A;  1LBX A;  3TDJ A;  1XVY A;  3Q25 A;  1JEV A;  4Z7E A;  4U22 A;  3PUZ E;  1S50 A;  1MG1 A;  1IEJ A;  5TU0 A;  1XS5 A;  2HCA A;  4NGU A;  2AL4 A;  3D4G A;  1POT A;  1SPI A;  4MIJ A;  1LLS A; 
#chains in the Genus database with same CATH homology
 4EQ9 A;  3EHS A;  2F6P A;  1TXF A;  3ILT B;  4IO2 A;  4X1B A;  4KCD A;  1P1Q A;  4IO4 A;  2O6A A;  3L6G A;  2ZYN A;  4F1V A;  4ZEI A;  5AA3 A;  3TTM A;  1I6A A;  3BBR A;  1POY 1;  3VVE A;  3UGW A;  2I58 A;  3G3F A;  3PPO A;  2I48 A;  3TOD A;  2V25 A;  3T9H B;  4HTG A;  4BLA A;  2F35 A;  1HSJ A;  3PPR A;  3UN6 A;  1MY3 A;  1A55 A;  3S4U A;  5EYF A;  4ND9 A;  3G3K A;  3CSG A;  2D21 A;  3G3J A;  3FGS A;  3LSX A;  3K1M A;  5I59 A;  3IK6 B;  3CI8 A;  2O51 A;  4YKJ A;  4GQO A;  1EZP A;  3MZB A;  1BTJ A;  1BKA A;  4XKN A;  2KLF A;  3DM0 A;  3GLB A;  1NNP A;  2V84 A;  3H4Z A;  4E0X A;  1QKB A;  3GBA A;  1JQF A;  2Y7P A;  1MXZ A;  3OSR A;  1ANF A;  3G3H A;  3KG2 A;  4POX A;  4YKI A;  4R6K A;  1NNK A;  3TAJ A;  4DLD A;  3KN3 A;  5KCJ A;  2RC7 A;  1CB6 A;  5CRY A;  1P1O A;  2VHA A;  5I56 A;  3O29 A;  4OFJ A;  1FTJ A;  1FTK A;  3IB0 A;  4Q30 B;  1O64 A;  3E9X A;  1ZIU A;  2ZMB A;  4EQ7 A;  4RY1 A;  1QVS A;  4QFK A;  3RLF E;  3UOR A;  3TMG A;  2BJJ X;  3MC2 A;  2G29 A;  2HQ0 A;  3K6U A;  5IAI A;  3TCF A;  1YCJ A;  2Z23 A;  4M1V A;  5TP9 A;  1XT8 A;  1Y20 A;  1M5F A;  4TOZ A;  2AIX A;  1B3E A;  3O9P A;  4KR5 A;  4NF8 A;  3FJG A;  3FVK A;  1UTH B;  2PYY A;  2H5Y A;  1P1U A;  4OEV A;  4GXS B;  1LGB C;  5HBC A;  4Q8R A;  3C32 A;  1A7L A;  1B9J A;  4NF6 A;  4ELP A;  3FAT A;  1P99 A;  4PFY A;  1SVX B;  3T66 A;  3QIM A;  1MPC A;  1MQG A;  4XTC Q;  3FZV A;  4C0R A;  3HCQ A;  1LCF A;  5I59 B;  3EHT A;  2XXQ A;  4F19 A;  5L9O A;  4THI A;  3TUS A;  3TQL A;  3QXM A;  1M5D A;  5IKB A;  2Q2A A;  3W9V A;  4PFW A;  3VV5 A;  1H76 A;  3VLW A;  1A99 A;  3C9H A;  2ZYK A;  3OEM A;  4GXA A;  3EF7 A;  2ONS A;  3MP1 A;  1P1W A;  3HHF A;  4F29 A;  3K0V A;  5I56 B;  1O63 A;  3MP6 A;  1SW5 A;  4IO3 A;  4DCX A;  1Y3P A;  2I3V A;  3ECR A;  3W9W A;  3PUX E;  4ZEF A;  3N94 A;  4R72 A;  2HXW A;  1RYO A;  1Y1M A;  3OOA A;  1ZMG A;  3W15 C;  1VFD A;  1TFD A;  3BFT A;  3FUZ A;  4FED A;  4OMB A;  3RY3 A;  3QK6 A;  3HV1 A;  4AB5 A;  3I5O A;  2O7U A;  3HPI A;  3KSX A;  1B40 A;  1QUL A;  3IOR A;  3U93 A;  4R9G A;  4ZE8 A;  2Y7W A;  4EXK A;  3KBR A;  5DT6 A;  5CM6 A;  4MF3 A;  4ZEB A;  3D4C A;  2G93 A;  3KOS A;  1SD3 A;  3P7I A;  1N7X A;  3K6W A;  3QUF A;  4BDM A;  3N6U A;  4NF8 B;  3IB1 A;  4IGR A;  4FAJ A;  1LST A;  3EQ1 A;  3ODB A;  4ZEK A;  1MXU A;  4NF6 B;  2QS3 A;  2H4I A;  3S9L C;  1Y3Q A;  1NNF A;  4IO6 A;  3KGC A;  3N5L A;  2AYS A;  5LOM A;  2CMO A;  5I57 B;  3F11 A;  5AA2 D;  1NNT A;  3N6T A;  4XKR A;  2PVU A;  4G2Z A;  5FTI A;  4IY5 A;  4OZ9 A;  4MFI A;  3HHG A;  3RNN A;  5B70 A;  2V3T A;  1B0H A;  4NWC A;  1MQI A;  4N6P A;  1FTL A;  1Q35 A;  3CR9 A;  4BDR A;  2OWS A;  1H3D A;  2DSF A;  1SYI A;  3OO8 A;  3K6X A;  4OYV A;  4KI0 E;  4H0W A;  4O3C A;  4TLL B;  4H8J A;  4XKP A;  3N26 A;  1R9L A;  1SW2 A;  4JSD A;  1IXH A;  3U72 A;  3PUV E;  1DMB A;  1B7Z A;  4H6D A;  4LP2 B;  3E3K A;  4JDF A;  4FEB A;  3CG1 A;  4G8H A;  3PU5 A;  2NXO A;  5DYH A;  1GGG A;  4LZ8 A;  4YB6 A;  1FCK A;  1A54 A;  4YIC A;  3TZA A;  1R9Q A;  2OWT A;  1D4N A;  1B4Z A;  2P2A A;  1NH8 A;  1B6H A;  3MPK A;  2HZK A;  1MM7 A;  1UIV A;  2X26 A;  1ZLQ A;  1LCT A;  3U92 A;  1HSL A;  1AMF A;  2B65 A;  4NWD A;  3FV2 A;  2ZNT A;  2I6E A;  3IL1 B;  3B6Q A;  5H8Q B;  2XXT A;  5AA2 A;  3LSF B;  4R75 A;  4KYE A;  2UVG A;  4RPO A;  2GHA A;  3T96 B;  4G4P A;  1URG A;  2FNC A;  1PBQ A;  3CG3 A;  3ZS6 A;  1B32 A;  3TQW A;  5FHM A;  3TTL A;  2F5X A;  2B3F A;  3JYR A;  3FVG A;  1LAH E;  2ZYO A;  4RK2 A;  1ZKB A;  1NH7 A;  4Z0I A;  2QL3 A;  4BDN A;  3MWB A;  3S9M C;  3VFJ A;  5CMM A;  3H7M A;  4NTL A;  1KWH A;  2WKY A;  4H1X A;  2DXY A;  1LFG A;  4OHN A;  5ICT A;  4NMY A;  4GRK A;  1UQW A;  4PE5 B;  2HZL A;  3E13 X;  1QKA A;  1B7H A;  5HM4 B;  4LQ5 A;  1AH5 A;  4AQ4 A;  1B0L A;  3C35 A;  4JB7 A;  3MAM A;  4HCY A;  1B3F A;  1RYX A;  2XD2 A;  2UXA A;  1B1H A;  3WAE A;  4PP0 A;  5I58 A;  3UP9 A;  1HSE A;  1UIU A;  1FQC A;  1N76 A;  1GR2 A;  3EPE A;  4PQJ A;  3K1N A;  3V5A A;  3S9E A;  4YB7 A;  3VVF A;  1ELJ A;  2OBG A;  1JNF A;  4ESX A;  3H06 B;  3IOV A;  4K3F A;  3H6W A;  1LBC A;  4HW8 A;  4R9F A;  1AOV A;  1SYH A;  1B05 A;  3SEU A;  4F22 A;  3S9N C;  2PT1 A;  2THI A;  5AA2 B;  3C36 A;  4F3S A;  4ZED A;  4F3P A;  2YJP A;  3KEI A;  4I1D A;  2DWA A;  2REJ A;  4R6H A;  2XX7 A;  4IY6 A;  3U94 A;  4XIG Q;  3MUQ A;  1UTH A;  4QFP A;  3FD3 A;  3OO6 A;  4M4G A;  1GTK A;  4ZZA A;  1DPP A;  3CIJ A;  3IB2 A;  5ELV A;  4G68 A;  4DXC A;  2Z8E A;  1S9T A;  4JWX A;  1A40 A;  4RJZ A;  5KDT B;  5DVI A;  1B5H A;  3SER A;  1GVC A;  1PEB A;  3PPN A;  3R6U A;  1SI0 A;  4ZEC A;  1MXW A;  1ZU0 A;  4KCC A;  2QMX A;  5A5X B;  4GL0 A;  1B58 A;  2D3I A;  1WVJ A;  3B7D A;  3UIF A;  1EH3 A;  3PPQ A;  3SEY A;  4RYA A;  3U8Q A;  1B5I A;  3TTN A;  1JVX A;  4TQU Q;  4IO7 A;  2Z8D A;  4QF9 A;  4MLQ A;  4MLV A;  4H67 A;  3O6G A;  2AL5 A;  2RCB A;  3SET A;  5I58 B;  2XXI A;  3SEW A;  4ZZE A;  3OEK A;  5EHS A;  4OER A;  4KYD A;  1LB8 A;  3MVX A;  1L5T A;  4G68 C;  4ZDM A;  2UVJ A;  4PET A;  1J1N A;  2DVZ A;  3RQT A;  2DXR A;  4H65 A;  4DXU A;  4OWD A;  1CE2 A;  3IOW A;  1M5B A;  2OJT A;  4LUB A;  3R26 A;  1WOD A;  1B51 A;  2XX9 A;  4ONY A;  1IXC A;  3IO4 A;  3IO6 A;  2F7C A;  2DWJ A;  3MVZ A;  2HFB A;  4G68 B;  1LAF E;  2DP8 A;  3PD8 A;  2P0S A;  4QFN A;  3FIR A;  1D9Y A;  2D5W A;  3Q26 A;  2RC9 A;  1MM6 A;  5I57 A;  2HEU A;  4PFT A;  2E0S A;  2F36 A;  5H8H A;  1B1X A;  2NOO A;  2ZNU A;  4YMB A;  4NE4 A;  1Y9U A;  5FHO A;  4WKM A;  2I4B A;  1QUJ A;  4GD5 A;  4DDD A;  4QSD A;  2H98 A;  3HST A;  3K4U A;  3PD9 A;  2XXR A;  2Y7K A;  4IGT A;  3G3G A;  2VOZ A;  2HAV A;  2O84 X;  3HO7 A;  1SW1 A;  3JV9 A;  4P0G A;  2O7I A;  4Q5T A;  1N04 A;  1BIY A;  4GIZ A;  1Z7M E;  4F1U A;  1JW1 A;  2XXU A;  4F31 B;  1SDX A;  4YB5 A;  1Y1Z A;  1EU8 A;  5ICQ A;  1Q1K A;  1XC1 A;  2Q9T A;  4LVQ A;  4JSO A;  4WXJ A;  3VVD A;  4F3G A;  2FA7 A;  2GRV A;  3TTR A;  3H3G A;  2UVI A;  3I6V A;  5I84 A;  2XHD A;  4MH5 A;  2XXX A;  3T93 B;  5L9M A;  1EZO A;  2OLB A;  3G3I A;  4YKK A;  4ZS9 A;  3GBB A;  3H6V A;  2PT2 A;  2XXY A;  3KOT A;  3SDF A;  1VSO A;  3FAS A;  3KN8 A;  3LR1 A;  5F7V A;  1FQB A;  4NED A;  1LAX A;  5ISU A;  2DWI A;  4OEU A;  2RKM A;  3Q27 A;  1H45 A;  1Y3N A;  3A09 A;  4ZE9 A;  3QYT A;  4H5G A;  5H8H B;  5AE4 A;  3LBS A;  4OFO A;  3FXR A;  1OVT A;  5H8Q A;  3ZKK A;  2PMS A;  1IIT A;  3DP4 A;  4OFL A;  3PMX A;  1NFT A;  1MY1 A;  3AXF A;  4GFR A;  3WAF A;  4YZZ A;  3BFU A;  3OEN A;  2DWH A;  2XD3 A;  4U4S A;  2VD3 A;  5L9S A;  3A3U A;  1OIB A;  2Y7I A;  3V83 A;  2QS2 A;  4TLM B;  4AB6 A;  3UK4 A;  1OVB A;  3V89 B;  4LZ5 A;  1M5C A;  2PBW A;  4ISU A;  1SW4 A;  1TT1 A;  2W7Y A;  1YPN A;  2DVC A;  5DEX A;  3TYH A;  4F39 A;  3R7X A;  5ITO A;  2Z22 A;  4IB2 A;  3M3L A;  2GHB A;  3OO9 A;  1I6Q A;  3T9U A;  3KN7 A;  1BLF A;  1PBP A;  4U4X A;  1MQH A;  1MY2 A;  1N84 A;  4F2Q A;  3FJM A;  3KSJ A;  4OQO A;  1MQJ A;  3EHU A;  1I69 A;  2DYX A;  4X9T A;  2E1S A;  4BDL A;  2F6G A;  1QW0 A;  3SEV A;  1MDP 1;  3VXC A;  1JW5 A;  4GLI A;  3H6T A;  1IUD A;  3CFX A;  3DP8 A;  4RNS A;  2A5S A;  4Q0C A;  4EXL A;  2DOJ A;  5CBR A;  4X48 A;  3MP8 A;  4C1T A;  1XHY A;  4ELQ A;  3RTW B;  1FQF A;  3ZKL A;  1PB9 A;  1MPD A;  1WDN A;  3O2A A;  3VXB A;  2Y7R A;  2RIN A;  1OLC A;  5FHN A;  2ONR A;  2XX8 A;  1MDQ A;  3A3C A;  4H8I A;  1B7U A;  1SI1 A;  1MH4 A;  1IIW A;  3PV0 E;  4QSE A;  1LFH A;  4KQP A;  4JWO A;  2V93 A;  3DLN A;  5KDT A;  3QUJ A;  4H5F A;  3CFL A;  5EHM A;  3M3F A;  1ZTY A;  3TTK A;  3K1P A;  4KPT A;  4ELO A;  1A8E A;  2H9B A;  5JEI A;  5DEX B;  4JXI A;  4R73 A;  2A5T A;  1R1N A;  1UTB A;  4LQ2 A;  4LA9 A;  5DVJ A;  4KFQ A;  4GL8 A;  5A5X A;  2XXH A;  2I0B A;  1AL3 A;  3VDF A;  5ITP A;  3B6T A;  4KHZ E;  4MBP A;  1MXV A;  4C1U A;  1ATG A;  5CC2 A;  1OQH A;  3IOU A;  4P11 A;  4DZ1 A;  4YAH X;  2REG A;  5TPA B;  3IX1 A;  2F97 A;  2VP1 A;  4LON B;  3FVO A;  3MW0 A;  1MS7 A;  3C34 A;  1D9V A;  3CSB A;  2R71 A;  2M8C A;  4WEP A;  1F9B A;  1TFA A;  1NL5 A;  3RUM A;  2ANJ A;  4EF2 A;  3PMW A;  4QFL A;  5CMK A;  3I3V A;  5M2V A;  2ZYM A;  2X7Q A;  2UYE A;  2VGQ A;  2XXV A;  2QS1 A;  3K00 A;  3EN3 A;  4OET A;  4RK9 A;  3LC8 A;  5H8S A;  5K2X A;  1O7T A;  2QJE A;  4FEC A;  3SEX A;  4U2R A;  3MZ1 A;  1XOC A;  3CRB A;  2V3U A;  4G77 A;  4OTE A;  1FQA A;  1H43 A;  3OMB A;  1URD A;  4ECF A;  1B3H A;  1R6Z A;  2RCA A;  2ONK E;  1YTV A;  3K01 A;  1FQD A;  5I2N B;  4F3B A;  4NF5 B;  3O66 A;  4QHQ A;  1RKM A;  2A5T B;  1UTB B;  4KD5 A;  1N0T A;  5JTY A;  4FE8 A;  2VD2 A;  3MBP A;  4DXB A;  1N3X A;  3PUW E;  4YU0 A;  3TFL A;  2RC8 A;  5CMB A;  1FTO A;  4GOT A;  1FW0 A;  2ABH A;  1LBB A;  1SBP A;  3B6W A;  3IR1 A;  4G8M A;  1M5E A;  1NMU A;  4ESW A;  1US4 A;  2YLN A;  2IA4 A;  4EDP A;  4UA8 A;  5F1Q A;  4G8N A;  2DE2 A;  2HAU A;  1VR5 A;  3TPA A;  3BKI B;  4FIM A;  2QPQ A;  3E4R A;  3ZSF A;  1VE4 A;  1JVY A;  4DE8 A;  3M8U A;  2V3Q A;  1FTM A;  4OVJ A;  4YKP A;  5KZT A;  1T0K A;  3O28 A;  4HCW A;  2ZXT A;  3K02 A;  3RT6 B;  4OXV A;  3VLV A;  3RN8 A;  1MRP A;  3KZG A;  2I3W A;  2I49 A;  1OLA A;  2R9J A;  3Q28 A;  1LB9 A;  2NUV A;  3HN0 A;  2ALU A;  2F34 A;  5AA1 A;  3RT8 A;  4JBZ A;  3L6H A;  4FAT A;  1YAE A;  4EQB A;  1A8F A;  3OEL A;  1MXX A;  2X7P A;  4R2B A;  2ESN A;  1ZJL A;  5DVF A;  2Q88 A;  3U1O A;  4UAC A;  3K6V A;  2IEE A;  3PGF A;  1MQD A;  2R6G E;  4I62 A;  3IJX B;  2XXW A;  5JTY B;  1IQ7 A;  3IJO B;  2ZNS A;  1BP5 A;  3OSQ A;  4I8C A;  5FTH A;  3FXQ A;  5K2Y A;  5AA4 A;  2RF1 A;  2UVH A;  2CZL A;  4BDQ A;  4R2F A;  3SES A;  4EF1 A;  1N7W A;  1OQG A;  2OK2 A;  4U1O A;  1ZBM A;  1DTZ A;  2Q89 A;  3OXN A;  5KCJ B;  3KJT A;  1PC3 A;  5JK4 A;  1I6B A;  3LUY A;  5CBS A;  3FVN A;  2H99 A;  3MVY A;  3THI A;  1S7Y A;  3QAX A;  2DE4 A;  3KFM A;  2DS9 A;  1JET A;  3UA8 A;  2O1L A;  3FJ7 A;  2P1S A;  4OEN A;  2O1M A;  4I9D A;  4LAT A;  2NVU B;  3S2V A;  3SKP A;  5DTB A;  5BWJ A;  3TEL A;  1DSN A;  5BUU A;  4FOR A;  2Q8J A;  5I2K A;  4FJP A;  5TP9 B;  1B4H A;  4WED A;  1P1N A;  1XVX A;  2OCU A;  3QSL A;  2F7B A;  4XKQ A;  1USY H;  1DPE A;  2B3B A;  3ONM A;  1MH3 A;  4U23 A;  1PB7 A;  1JEU A;  3KJ7 A;  1EZ9 A;  1VFE A;  3T9V A;  1SQY A;  3GZG A;  3V8X B;  5H8N A;  4PFU A;  1MY0 A;  4KYS A;  3H03 A;  3VE1 B;  3USD A;  1LAG E;  1DTG A;  3MVW A;  5AA4 B;  4P0I A;  1B2H A;  1D3K A;  1B52 A;  2XXP A;  3O6H A;  1DOT A;  3T9X B;  4X1D A;  2QMW A;  1B5J A;  4U21 A;  5J1D A;  4IO5 A;  1MY4 A;  1QUI A;  1N3W A;  3LSW A;  1II5 A;  4F2O A;  1URS A;  3C33 A;  3MZ9 A;  2H25 A;  2DE3 A;  4E0W A;  5H8F A;  2Q2C A;  1B3L A;  5L8D A;  3O97 A;  4R74 A;  5HPQ A;  3TEP A;  4OES A;  4RA1 A;  2O68 A;  2FYI A;  4N07 A;  1PDA A;  2QS4 A;  4NF4 A;  1QJM A;  3DEL B;  5TPA A;  5I2K B;  1IXI A;  3JZJ A;  2LAO A;  4POW A;  1LFI A;  3G7W A;  3TCH A;  3K2D A;  4O3B A;  3T22 A;  1IXG A;  3C31 A;  3RPW A;  4RPN A;  3MQ9 A;  4JWY A;  2QRY A;  4GWO A;  1US5 A;  2I0C A;  1JW4 A;  2F8D A;  1FQE A;  4ELR A;  3VLU A;  5H8N B;  3OO7 A;  3CVG A;  4QSC A;  4BDO A;  3MJN A;  5CI5 A;  2UYF A;  2PX1 A;  3H6U A;  3FXU A;  1TWY A;  4GVO A;  2Z8F A;  2F7A A;  3OD7 A;  1MXY A;  1Z7N E;  2GFE A;  4YMA A;  1PB8 A;  4QRZ A;  3IOT A;  1GV8 A;  4N13 A;  3MPL A;  1B3G A;  4R6Y A;  3PUY E;  3M3K A;  4DCY A;  1Y4C A;  4GF8 A;  2DQV A;  5I2N A;  3LSL A;  3IAZ A;  4F1Y A;  4LZ7 A;  2O69 A;  2I4C A;  4L17 A;  4NF5 A;  1AIV A;  1NKX A;  4DIG A;  3PMV A;  5H8F B;  1QUK A;  2NWJ A;  1H44 A;  4F18 A;  3Q29 A;  3TCG A;  1IZ1 A;  2F78 A;  4HS7 A;  3PPP A;  4NF4 B;  2GH9 A;  1B46 A;  4RXL A;  2YPN A;  1Y4T A;  3TKD A;  3CFZ A;  5B7D A;  1MPB A;  3C4M A;  4XXU A;  3O6I A;  2OZZ A;  3GXA A;  3ILU B;  2QSX A;  3RTF B;  5CMC A;  4EUO A;  4QFO A;  1OMP A;  3DP6 A;  1USY E;  4U1Z A;  3RGY A;  2Y84 A;  3FV1 A;  4O3A A;  3TDJ A;  1XVY A;  3Q25 A;  1JEV A;  4Z7E A;  4U22 A;  3PUZ E;  1S50 A;  1MG1 A;  1IEJ A;  5TU0 A;  1XS5 A;  2HCA A;  2AL4 A;  3D4G A;  1POT A;  1LLS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...