2VP1A

Fe-futa2 from synechocystis pcc6803
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
313
structure length
313
Chain Sequence
RTINLYSSRHYNTDDALYDAFGEVNLIEASAEELIERIQSEGANSPGDILFTVDAGMLWRAEQAGLFQPVRSGKLNERIPENLRHPDGLWYGFTQRARVLYYSRDRVNPADLSTYEALADPQWRGKILVRPSSNVYNLSLTASRIAIHGEPETRRWLQGLVGNFARQPEGNDTAQIRAIAAGIGDVAIANSYYYIRLQKSTDPADQEVVEKVSLFFPNTGSGERGTHVNVSGAGVLKNAPNRDAAIAFLEYLASDDAQRYFAEGNNEYPVIPGVPIDPVLAAHGQLKGDPLNVSNLGRYQPDSARLMNEVGWQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PERIPLASMIC IRON-BINDING PROTEIN
publication title Futa2 is a Ferric Binding Protein from Synechocystis Pcc 6803.
pubmed doi rcsb
molecule tags Metal binding protein
total genus 114
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13343 SBP_bac_6 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2vp1A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2vp1A02
3O28A 3TTKA 2Q88A 1B0LA 1LAFE 2D5WA 3IR1A 1JETA 2O7IA 2I6EA 2R6GE 2DE2A 4OFLA 4FJPA 3C32A 5J1DA 5DYHA 1B51A 4H67A 1GR2A 3H3GA 5AA4A 3VVFA 4F22A 4YB5A 2ANJA 4R2FA 1IITA 1LCTA 4R9GA 4RY1A 1BKAA 3S9LC 4P11A 4I62A 1UTBB 2O6AA 1VE4A 2ZNUA 1JW5A 5ITOA 2X7QA 3CG3A 3S9EA 1USYH 3EHSA 1UIVA 2V25A 4LUBA 4OMBA 5EHSA 1B05A 2A5SA 4KHZE 4DDDA 3RY3A 2Y7WA 2NOOA 4JDFA 5H8FB 1MQJA 4NWDA 2HEUA 1A8EA 4PFTA 1DMBA 4MF3A 1H45A 4U21A 3EN3A 3G3FA 1MRPA 3H7MA 3VXBA 1MM7A 1MXXA 4GXSB 4HCYA 3MZ1A 4OXVA 3TTMA 4MLQA 3A3UA 4JSDA 4YMBA 3UIFA 2Z8EA 3K0VA 2O51A 3BFUA 1DPEA 3M8UA 1B2HA 3G3GA 3JZJA 3FXRA 3RQTA 5H8FA 1A40A 1B3FA 1LFGA 1ZLQA 3SEXA 3R6UA 2I4CA 1OMPA 3O6HA 1FQAA 4QFKA 4DLDA 2GFEA 3KFMA 1Q1KA 3QAXA 3TCFA 3MZBA 1LAXA 1UIUA 5IAIA 2XXQA 4PFWA 4QF9A 5I2KB 3OXNA 1O7TA 1GGGA 1FTLA 3V89B 2XD2A 4R75A 4U1OA 4C1TA 1SW5A 3PUWE 1MY4A 2B3BA 3FGSA 2H5YA 3KJTA 1B1XA 5CI5A 3IO4A 3CSBA 5DT6A 4IO6A 3PUVE 2XXHA 2XX7A 4EUOA 3PMXA 4ELRA 5F7VA 4BDNA 1AL3A 5EYFA 5TP9B 3L6HA 4U2RA 3W9VA 1PB8A 1SI1A 4L17A 1OQGA 3S4UA 3U8QA 4LVQA 3U1OA 1IXCA 4KYSA 5I84A 4HCWA 2DWJA 2AL4A 1YPNA 1MG1A 2P1SA 4QSDA 3TKDA 4OWDA 5EHMA 5CM6A 3VLVA 3M3FA 3OO6A 4M4GA 2ZYKA 1B3EA 1VFDA 1FW0A 4PETA 5B7DA 3T93B 4LZ7A 1S9TA 3N94A 3TPAA 1ZIUA 2QRYA 4WEPA 5TP9A 1LFHA 4HTGA 2NWJA 4F31B 4POWA 4XKQA 3K4UA 1IXGA 3H03A 1A8FA 1QVSA 4BLAA 5CMCA 3IOUA 3VDFA 4ZZEA 4YB6A 1ELJA 1BTJA 3DELB 1SYHA 3QUJA 2RCBA 5H8NA 1UQWA 1IXIA 3FVNA 2HAUA 1R9QA 3PPQA 3TYHA 3QSLA 3KOTA 4IY6A 1IZ1A 2X26A 2F34A 3RGYA 3B7DA 1P1OA 4HW8A 3BFTA 4AB6A 4I1DA 2ZMBA 3RPWA 1FCKA 1NNKA 3MAMA 2I48A 2F36A 4OESA 5HM4B 3ZKLA 5AA3A 2B3FA 4ZE8A 2XD3A 1UTHA 2GHBA 3HSTA 4R9FA 3LUYA 3I3VA 5K2XA 5ICQA 2ONKE 4ELQA 1B32A 4KFQA 1MDQA 2OWTA 1Z7NE 1P99A 3FASA 1SQYA 5CMMA 2ALUA 4WXJA 3HHFA 2FA7A 1LLSA 4EF1A 2GH9A 2DS9A 1II5A 4PFYA 1MXYA 2RC7A 4H0WA 4OQOA 1LB9A 5TPAA 4F3BA 4JWOA 1JW1A 1WDNA 4FATA 4WKMA 3KEIA 1DTGA 1D3KA 3D4GA 1O63A 3GBBA 1H76A 1MM6A 2Y7PA 3N6TA 3KOSA 1URSA 4NF8B 3FZVA 3CSGA 4FORA 2XXIA 3GBAA 2IEEA 1MDP1 1FQBA 5DTBA 4X1DA 3RLFE 4LP2B 4JSOA 3VE1B 4JBZA 5FHMA 2F7CA 3CR9A 3N6UA 3B6TA 4ZECA 4K3FA 2Z23A 3PUZE 2F97A 4KI0E 1QUJA 3DM0A 3IOWA 4Z7EA 3KSXA 3LSXA 4JWYA 4G8HA 3M3LA 2OJTA 5I56A 1QJMA 2G29A 4NF8A 3TCHA 1WVJA 4YB7A 3LSFB 4ZDMA 3A09A 3RTFB 3EHTA 3FV1A 2UYEA 1N76A 3C34A 4NMYA 2Z8FA 5I59B 1NH7A 1SBPA 4OTEA 4F3PA 2YLNA 3LC8A 1LSTA 5AA2A 2UVGA 2O1LA 2O84X 4O3BA 3PMWA 2ZNTA 4EF2A 2H4IA 2QMXA 2RKMA 1H44A 4BDMA 2F6PA 4IY5A 2ZYOA 3ECRA 5DVIA 1S7YA 1S50A 1B1HA 5DEXA 3C36A 2XX9A 3HCQA 4RPOA 1Y3QA 4FIMA 2RCAA 2XXVA 1M5FA 4R6HA 1FQEA 3B6WA 3I6VA 3KN7A 3B6QA 3ILTB 3O97A 5ICTA 1AIVA 3TZAA 1NH8A 1L5TA 3S2VA 2OWSA 4UA8A 2ZNSA 3OELA 3MVWA 4U4XA 1P1QA 4XKPA 2F5XA 5B70A 4F2OA 4N6PA 4OVJA 4YZZA 5HBCA 1RYXA 2Y7RA 1MXWA 1I69A 5A5XB 5H8QB 3SKPA 1PBQA 3THIA 2NVUB 2DVCA 2UVHA 4ZEKA 2DWAA 2Y7KA 3T66A 3U72A 3E9XA 3DP6A 3G7WA 4LZ8A 3K6WA 2F7BA 3MP8A 5JEIA 3Q25A 1QULA 2QL3A 3OEMA 4PQJA 4F1VA 3LR1A 3IK6B 3K2DA 1XS5A 2XXTA 2KLFA 2XX8A 2DP8A 4Q0CA 2H99A 2HZLA 3EHUA 1SW1A 3H6TA 2A5TB 3TQLA 1UTBA 3KSJA 3C33A 3E13X 4IO3A 4BDQA 1PDAA 4PP0A 3N5LA 3OENA 1R1NA 5ELVA 1IXHA 4G68B 3OOAA 4DZ1A 4GRKA 1MPBA 3CG1A 1IQ7A 1QUKA 4IO7A 3K1PA 2ZYNA 1EZPA 4F29A 2IA4A 5F1QA 4Z0IA 1MPCA 2BJJX 3IOTA 3UK4A 3MVYA 2ZXTA 2QMWA 1MY3A 5L8DA 1F9BA 1TXFA 1PBPA 3PPOA 4N07A 2R9JA 1IUDA 2I0BA 4F2QA 4I8CA 4GVOA 2R71A 5I57B 1CE2A 2F7AA 3F11A 1SVXB 4R74A 5FTHA 2OZZA 1FTMA 4R73A 1EH3A 5CMKA 4OZ9A 2QS3A 1YCJA 2DE4A 3V5AA 1HSJA 4F1YA 1HSEA 1N7XA 1QKAA 2AIXA 2DE3A 3MPLA 1MH4A 4KQPA 1LGBC 2Q2AA 3RT8A 1KWHA 3H6WA 5I2KA 3R7XA 1I6BA 2FYIA 4OEUA 5M2VA 1LCFA 5I57A 4H1XA 1N04A 2NUVA 1MXZA 4R2BA 4DCYA 3Q28A 1PB9A 4GLIA 3PV0E 1US4A 2G93A 4PFUA 3VFJA 1XT8A 4NF4B 1B3LA 1N3WA 4QSEA 4IO5A 4F3GA 1JQFA 5AE4A 2CMOA 2E0SA 5JK4A 1B46A 1P1UA 5BWJA 3QUFA 1AMFA 3W9WA 1H43A 5KCJB 1Y1ZA 3FJ7A 4FE8A 1ZU0A 3CI8A 3EQ1A 2Z8DA 3ODBA 2GRVA 1LBBA 5CBSA 4DXBA 4GF8A 2W7YA 4H65A 3IL1B 1QUIA 1SW4A 3MC2A 1XVYA 3FD3A 1B3GA 1DOTA 2F35A 3LSWA 2F6GA 2DWIA 3TTNA 4N13A 2Y7IA 2DVZA 1OIBA 2HZKA 2O68A 3SEYA 3V83A 4TOZA 3VLWA 1ZBMA 3G3IA 5KCJA 1NNFA 1Y4TA 3MWBA 4P0GA 3H4ZA 4FEBA 3UP9A 3OSRA 3MVXA 3PUXE 4QSCA 4ZEFA 2QS2A 2PT1A 3IX1A 3CIJA 3TELA 3MP1A 1ZJLA 3HV1A 4RK2A 4FECA 1FQDA 4R72A 4E0XA 2ZYMA 1B58A 1OVTA 4H8IA 2I58A 3HHGA 4ZEDA 3MQ9A 4DXCA 1PC3A 3MZ9A 1I6AA 3OSQA 3TCGA 3IORA 3R26A 3IO6A 4M1VA 3JYRA 4XKRA 3DP8A 1B5JA 1USYE 1JEVA 1GVCA 4ESWA 2ONRA 3I5OA 3OO8A 3L6GA 3RNNA 2THIA 3SESA 2Y84A 3ONMA 3SEWA 1MXUA 4OFJA 4IO2A 4YKKA 4H5FA 4ISUA 5FHNA 1DPPA 1D9YA 1Y20A 4F39A 1B7UA 4OEVA 1B40A 2DXYA 4GQOA 5L9SA 1SW2A 1PB7A 2Q8JA 2D21A 3AXFA 2V84A 3TTRA 2HFBA 2HQ0A 1BLFA 3QIMA 4OYVA 3PD9A 5AA1A 1PEBA 4ESXA 2REGA 4DCXA 2PYYA 3FVKA 3KBRA 4XKNA 4ECFA 2VHAA 3LSLA 3FVGA 3SETA 4X48A 3K6XA 2RC8A 3FJMA 3WAFA 4F1UA 1ANFA 3T9HB 4RXLA 3KG2A 3K6UA 3OO7A 4OHNA 2X7PA 1VSOA 3CVGA 4XIGQ 2XXRA 4F19A 3IOVA 1N84A 1TT1A 4YKPA 2HAVA 1DSNA 4ND9A 1H3DA 2DOJA 3E3KA 2RINA 1R6ZA 1B5IA 4IGRA 1LB8A 5I2NB 4F3SA 2DYXA 2XXPA 1R9LA 3C35A 4OETA 1B0HA 2M8CA 1EU8A 2I3VA 3A3CA 5I59A 4F18A 2QPQA 4G68C 2RC9A 4AQ4A 5LOMA 2P0SA 3OO9A 1JEUA 1SD3A 4LZ5A 4ELOA 3BBRA 1XHYA 2QS1A 4MLVA 1OLAA 1Y4CA 4BDOA 3EF7A 3M3KA 5DVFA 4LQ5A 1ZKBA 1A55A 3HPIA 1A99A 4POXA 3TQWA 4TLLB 2DQVA 1IEJA 1M5DA 3U94A 1Y1MA 2D3IA 4FEDA 4C0RA 3CFZA 2I0CA 4GD5A 4PE5B 4U22A 5BUUA 3PPNA 4LONB 3FVOA 3KN3A 4MH5A 3O6GA 1ZTYA 4LATA 1B3HA 2Z22A 1AH5A 3KGCA 2DSFA 3ZSFA 2OLBA 2OCUA 3KN8A 1Q35A 3TMGA 3DLNA 5KDTB 3GLBA 4GFRA 1B52A 1B5HA 1AOVA 1POTA 1SI0A 1JW4A 4G4PA 1VR5A 3T22A 2DWHA 4WEDA 2Q9TA 4EXKA 1OLCA 1LAGE 3CRBA 4G8NA 5KZTA 5A5XA 5H8QA 4NF6B 1B7ZA 4H8JA 4ZS9A 3RT6B 3H6VA 5AA2D 4AB5A 3MBPA 4IGTA 3FUZA 3DP4A 4EXLA 2CZLA 5KDTA 4O3AA 5ITPA 2V3QA 5CRYA 4JB7A 4RJZA 3LBSA 3U92A 1FTJA 3QK6A 4QFLA 1GV8A 4BDRA 3OEKA 1TFAA 4YKJA 2VGQA 3SERA 4UACA 1Z7ME 3UORA 1YAEA 2A5TA 1N3XA 4NF6A 4P0IA 2ONSA 4KD5A 3MPKA 1NNPA 1JVXA 3TODA 4KCDA 4HS7A 3TFLA 3ILUB 3JV9A 1QKBA 3MUQA 4G68A 2HCAA 4YICA 1FTOA 2VP1A 3OMBA 2DXRA 4QFOA 4ZEIA 4H6DA 4QHQA 3UGWA 3ZKKA 2XXWA 3IJOB 4TQUQ 3O2AA 4ELPA 2PX1A 3GXAA 2UVIA 4MFIA 3E4RA 5ISUA 5K2YA 3KJ7A 3IJXB 1NKXA 3IB0A 1MXVA 2O69A 3MW0A 1EZ9A 1LAHE 3G3KA 2OK2A 1NFTA 4GL0A 4FAJA 2XXYA 3T9VA 2XHDA 2UVJA 3Q26A 2YJPA 4EQ9A 3VV5A 4XXUA 1MH3A 2O1MA 4U4SA 4EDPA 5IKBA 4O3CA 3TDJA 3C4MA 3KZGA 3TTLA 1MQDA 4NTLA 1GTKA 1P1WA 4GWOA 4DE8A 1IIWA 3QXMA 2XXXA 3BKIB 3FATA 1URDA 2VD3A 5FHOA 3K6VA 3PU5A 4E0WA 2B65A 1B4HA 1T0KA 1VFEA 3O9PA 5H8NB 1URGA 3SEUA 2AYSA 4IO4A 3D4CA 1FTKA 1LBCA 4U23A 3T96B 2UXAA 1J1NA 3Q27A 4YAHX 3K1MA 4XTCQ 5I58B 3WAEA 2ABHA 1A54A 4G77A 3FJGA 4NE4A 2HXWA 1NMUA 4YMAA 5CBRA 4RNSA 2FNCA 3FXQA 4NF4A 3T9UA 4NWCA 3UA8A 3G3HA 4DIGA 1A7LA 1UTHB 3PUYE 4TLMB 2F78A 3TAJA 3PPPA 2O7UA 1FQFA 3CFXA 2E1SA 3MVZA 4G2ZA 2I49A 3O6IA 1WODA 4JXIA 3U93A 4LA9A 4Q5TA 4OERA 3FV2A 4NEDA 4GL8A 3N26A 5I58A 1MQIA 4X1BA 2ESNA 2H9BA 3PMVA 2VD2A 5CMBA 2UYFA 4R6KA 3K00A 1POY1 4RA1A 4ZEBA 3S9NC 3O66A 1QW0A 4Q8RA 3PPRA 5H8HB 5JTYB 4KR5A 4YU0A 5TPAB 5TU0A 1ATGA 4I9DA 1B4ZA 1B6HA 4EQBA 1OVBA 3PGFA 1EZOA 4QFPA 2LAOA 5CC2A 4QRZA 2XXUA 4BDLA 3CFLA 4JWXA 3VVDA 2QJEA 4YKIA 3VVEA 1Y3NA 5L9OA 3IB2A 3H6UA 4OFOA 4R6YA 1NL5A 1I6QA 1MY0A 1M5BA 3QYTA 4KYDA 4LQ2A 2Q2CA 5H8HA 4G8MA 5JTYA 3Q29A 2QSXA 1MPDA 1HSLA 4X9TA 1TFDA 1JVYA 2REJA 3RUMA 3T9XB 3C9HA 4THIA 4H5GA 2VOZA 5FTIA 2OBGA 2H98A 1D4NA 3K01A 2F8DA 3VXCA 5I56B 1BIYA 1Y9UA 1LFIA 3RTWB 3HO7A 1N7WA 3GZGA 3SEVA 2I3WA 1OQHA 3W15C 1RKMA 4U1ZA 4RYAA 4NF5B 3EPEA 1YTVA 5AA2B 2I4BA 2H25A 2V93A 2V3UA 3K1NA 1MQGA 3MP6A 2RF1A 3IAZA 4KPTA 4KCCA 4DXUA 1MY2A 1O64A 4RPNA 4ZZAA 1FQCA 3USDA 4Q30B 5HPQA 1NNTA 1CB6A 4GIZA 3S9MC 1MS7A 2YPNA 2V3TA 3MJNA 1P1NA 3G3JA 5DEXB 3PD8A 1DTZA 1SDXA 1US5A 3IB1A 3TUSA 3C31A 1XOCA 1RYOA 4QFNA 3FIRA 1D9VA 2PT2A 3VLUA 3RN8A 2Q89A 1ZMGA 5L9MA 1MQHA 3V8XB 4NF5A 1Y3PA 5H8SA 1TWYA 2PBWA 1XVXA 1M5CA 1N0TA 4IB2A 3UN6A 4ZE9A 4KYEA 3FXUA 4ONYA 1SYIA 3K02A 2PMSA 2AL5A 1XC1A 3SDFA 5DVJA 3ZS6A 4C1UA 3HN0A 3OD7A 1B9JA 3P7IA 2GHAA 1BP5A 3H06B 4GOTA 4EQ7A 2WKYA 1MY1A 4RK9A 5AA4B 4GXAA 1M5EA 3O29A 5I2NA 2P2AA 2QS4A 1JNFA 3TEPA 4MBPA 2PVUA 2NXOA 1B7HA 4OENA
chains in the Genus database with same CATH superfamily
3O28A 3TTKA 2Q88A 1B0LA 1LAFE 2D5WA 3IR1A 1JETA 1FBGA 2O7IA 2I6EA 2R6GE 2DE2A 4OFLA 4FJPA 3C32A 3RPLB 5J1DA 1RDZA 5DYHA 1B51A 4H67A 1GR2A 3H3GA 5AA4A 3VVFA 3FXBA 1FPBA 4F22A 4YB5A 2ANJA 4R2FA 1IITA 1LCTA 4R9GA 3KBZA 4RY1A 1BKAA 3S9LC 4P11A 4I62A 1UTBB 4PAFA 2O6AA 1VE4A 4N6DA 2ZNUA 1JW5A 4OANA 5ITOA 2X7QA 3CG3A 3S9EA 1USYH 3EHSA 1UIVA 2V25A 4LUBA 4OMBA 5EHSA 1B05A 2A5SA 4KHZE 4DDDA 3RY3A 2Y7WA 1D9QA 2NOOA 4JDFA 5H8FB 1MQJA 4NWDA 2HEUA 1A8EA 4PFTA 1DMBA 4MF3A 1H45A 4U21A 3EN3A 4N91A 3G3FA 1MRPA 3H7MA 3VXBA 1MM7A 1MXXA 4GXSB 4HCYA 3MZ1A 2OWZA 4GX3A 4OXVA 3TTMA 4MLQA 3U65A 3A3UA 4JSDA 4N17A 4YMBA 3UIFA 2Z8EA 5IZ3B 3K0VA 2O51A 3BFUA 2OX3A 1DPEA 1XI6A 3M8UA 1B2HA 4GBWA 3G3GA 3JZJA 4OVQA 3FXRA 3RQTA 5H8FA 1A40A 1B3FA 1LFGA 1ZLQA 2Q74A 4N6KA 3SEXA 3R6UA 4OVSA 2I4CA 1OMPA 3O6HA 1FQAA 4QFKA 4DLDA 4MNPA 4HE1A 2GFEA 3KFMA 1Q1KA 3B8BA 3QAXA 2ZZVA 3TCFA 2CZKA 3MZBA 1LAXA 2VPOA 1UIUA 5IAIA 2XXQA 1YYZA 4PFWA 4QF9A 5IZ3A 5I2KB 3OXNA 1O7TA 1GGGA 1FTLA 3V89B 2XD2A 4R75A 4U1OA 4C1TA 1SW5A 3PUWE 1MY4A 2B3BA 3FGSA 2H5YA 3KJTA 1B1XA 4NQ8A 5CI5A 3IO4A 3CSBA 5DT6A 4IO6A 3PUVE 2XXHA 2XX7A 4EUOA 3PMXA 4ELRA 5F7VA 3E79A 4BDNA 1AL3A 5EYFA 5TP9B 3L6HA 4U2RA 3W9VA 1PB8A 1SI1A 4L17A 1OQGA 3S4UA 3U8QA 4LVQA 3U1OA 1G0IA 1IXCA 4KYSA 5I84A 3IFAA 4HCWA 2DWJA 2AL4A 1YPNA 1MG1A 2P1SA 4QSDA 3TKDA 4OWDA 5EHMA 5CM6A 3VLVA 2CEXA 3M3FA 3OO6A 4M4GA 2ZYKA 1B3EA 1VFDA 1FW0A 4PETA 5B7DA 3T93B 4LZ7A 1S9TA 3N94A 3TPAA 1LBXA 1ZIUA 2QRYA 4WEPA 5TP9A 1LFHA 4PTKA 4HTGA 2NWJA 4F31B 4POWA 4XKQA 1KA0A 3K4UA 1IXGA 3H03A 1A8FA 1QVSA 4BLAA 1NV2A 5CMCA 1G0HA 2FHYA 4AS5A 3IOUA 3VDFA 4PGNA 4ZZEA 4P3LA 4YB6A 1ELJA 1BTJA 3DELB 1SYHA 3QUJA 2RCBA 5H8NA 1UQWA 4DI3D 1IXIA 4NX1A 3FVNA 4G61A 2HAUA 1R9QA 3PPQA 3TYHA 4N15A 4PF8A 3QSLA 4N8YA 3EKIA 3KOTA 4IY6A 1IZ1A 2X26A 1YXIA 2F34A 3RGYA 2F3BA 3B7DA 1P1OA 4HW8A 3BFTA 4AB6A 4I1DA 2ZMBA 3RPWA 1FCKA 1NNKA 3MAMA 2I48A 2F36A 4OESA 4PE3A 5HM4B 3ZKLA 5AA3A 2B3FA 4PFIA 4ZE8A 2XD3A 1UTHA 2GHBA 3HSTA 3GYYA 4R9FA 3LUYA 3I3VA 5K2XA 5ICQA 2ONKE 4ELQA 1B32A 4KFQA 1MDQA 1FPGA 2OWTA 1Z7NE 1P99A 3FASA 1SQYA 4XEQA 3BIHA 5CMMA 2ALUA 3SZPA 4WXJA 3HHFA 2FA7A 1LLSA 4EF1A 5IZZA 4MIJA 4OVPA 4I3EA 2GH9A 2DS9A 1II5A 4PFYA 1MXYA 2RC7A 4H0WA 4OQOA 1LB9A 5TPAA 4F3BA 4JWOA 1JW1A 1WDNA 4FATA 4WKMA 4HE0A 3KEIA 1DTGA 1D3KA 3D4GA 1BK4A 4KXPA 1NV4A 1O63A 3GBBA 1H76A 1MM6A 2Y7PA 3N6TA 3KOSA 1URSA 4NF8B 3FZVA 3CSGA 4JVCA 4FORA 2XXIA 3GBAA 2IEEA 1MDP1 1FQBA 5DTBA 4X1DA 3RLFE 4LP2B 1FBPA 4JSOA 3VE1B 2PCRA 4JBZA 5FHMA 2F7CA 3CR9A 3N6UA 3B6TA 4MCOA 4ZECA 1NV0A 5I7IA 4K3FA 2Z23A 3PUZE 2F97A 4KI0E 2L5VA 1QUJA 3DM0A 5ET7A 3IOWA 2F3DA 4Z7EA 3KSXA 3LSXA 4JWYA 4G8HA 3M3LA 2OJTA 5T3JA 5I56A 1QJMA 2P3VA 2G29A 4NF8A 3TCHA 1WVJA 4YB7A 3LSFB 4ZDMA 3A09A 3RTFB 3EHTA 3FV1A 2UYEA 1N76A 3C34A 4NMYA 2Z8FA 5I59B 1NUWA 1NH7A 1SBPA 4OTEA 4F3PA 2YLNA 3LC8A 1LSTA 5AA2A 2B4MA 2UVGA 5DW8A 2O1LA 2O84X 4FBPA 4O3BA 3PMWA 2ZNTA 4EF2A 2H4IA 2QMXA 2RKMA 1H44A 4BDMA 5EYGA 2F6PA 4OA4A 4IY5A 2ZYOA 3ECRA 5DVIA 1S7YA 1S50A 1B1HA 5DEXA 3C36A 2XX9A 3HCQA 4P56A 4RPOA 1Y3QA 4FIMA 2RCAA 2XXVA 5ET8A 1FBDA 1M5FA 4R6HA 1FQEA 4NHBA 3B6WA 3I6VA 3KN7A 3B6QA 3ILTB 3O97A 2Q8MA 5ICTA 1AIVA 5IGAA 3TZAA 1NH8A 1L5TA 3S2VA 2OWSA 4UA8A 2HHMA 2ZNSA 1NV1A 3OELA 3MVWA 3KC0A 4U4XA 2WYKA 1P1QA 4XKPA 1CNQA 2F5XA 4NF0A 5B70A 4GWZA 4GBVA 4F2OA 4N6PA 4OVJA 4YZZA 5HBCA 4PBQA 1RYXA 2Y7RA 1K9ZA 1MXWA 1I69A 5A5XB 5H8QB 3SKPA 1PBQA 3THIA 2NVUB 2DVCA 2UVHA 4ZEKA 2DWAA 2Y7KA 3T66A 3U72A 3E9XA 2XWKA 3DP6A 3G7WA 4LZ8A 3K6WA 2F7BA 3MP8A 5JEIA 3MYUA 3Q25A 4HE2A 5LTCA 1QULA 1FPKA 2QL3A 4OVRA 3OEMA 1NV6A 4PQJA 4F1VA 3RPLA 3LR1A 3IK6B 5EQ9A 3K2DA 1XS5A 2XXTA 2KLFA 2XX8A 2DP8A 4Q0CA 2H99A 2HZLA 3EHUA 5I3SA 1SW1A 3H6TA 2A5TB 3TQLA 1UTBA 3KSJA 5A5LA 3C33A 4P9KA 3E13X 4IO3A 4BDQA 4MNCA 1PDAA 4PP0A 3N5LA 3OENA 1R1NA 1LBVA 5ELVA 1IXHA 4G68B 3OOAA 4DZ1A 5I5PA 4GRKA 1MPBA 3CG1A 1IQ7A 5ET6A 1QUKA 4IO7A 3K1PA 2ZYNA 1EZPA 1LBWA 4F29A 1FPEA 2IA4A 5ESYA 4GWSA 3LUZA 5F1QA 4Z0IA 1MPCA 2BJJX 3IOTA 3UK4A 1K9YA 4IR8A 3MVYA 2ZXTA 2QMWA 1MY3A 4H46A 5L8DA 3FBPA 1F9BA 1TXFA 1PBPA 3PPOA 4N07A 2R9JA 1IUDA 2I0BA 4F2QA 4I8CA 4GVOA 2R71A 5I57B 1CE2A 2F7AA 3F11A 1SVXB 4R74A 5FTHA 2OZZA 1FTMA 3LV0A 4R73A 1EH3A 4X8RA 5CMKA 3PTYA 4OZ9A 2QS3A 1YCJA 5IZ1A 2DE4A 3V5AA 2CZHA 4NGUA 1HSJA 4F1YA 1HSEA 1N7XA 1QKAA 4MAGA 2AIXA 2DE3A 3MPLA 1MH4A 4P1LA 4KQPA 1LGBC 2Q2AA 3RT8A 2MKZA 1KWHA 3H6WA 4OVTA 5I2KA 3R7XA 1I6BA 2FYIA 4OEUA 5M2VA 1LCFA 5I57A 2FIEA 4O8MA 4H1XA 1N04A 5LDZA 4PDHA 2NUVA 4MHFA 1FPDA 1MXZA 4R2BA 4DCYA 3Q28A 1PB9A 4GLIA 3PV0E 1US4A 2G93A 4PFUA 3VFJA 1XT8A 4NF4B 1B3LA 1N3WA 4QSEA 3CHGA 4IO5A 4F3GA 1JQFA 4LN5A 5AE4A 2CMOA 2E0SA 5JK4A 1B46A 1P1UA 5BWJA 3QUFA 1AMFA 3W9WA 1H43A 5KCJB 1Y1ZA 2FVZA 3FJ7A 4FE8A 1ZU0A 3CI8A 3T0JA 3EQ1A 2Z8DA 3ODBA 4GWYA 1RDYA 2GRVA 1LBBA 5CBSA 4DXBA 4GF8A 2W7YA 4H65A 3IL1B 1NUXA 1QUIA 1SW4A 3MC2A 1XVYA 3FD3A 4HXVA 1B3GA 1DOTA 2F35A 3LSWA 2VPNA 2F6GA 2DWIA 3TTNA 4N13A 2Y7IA 2DVZA 1OIBA 1NUYA 2HZKA 2O68A 3SEYA 3V83A 4TOZA 2VT5A 3VLWA 1ZBMA 3G3IA 5KCJA 1NNFA 1Y4TA 4H45A 3MWBA 4P0GA 3H4ZA 4FEBA 3UP9A 3OSRA 3MVXA 3PUXE 4QSCA 4ZEFA 2QS2A 2PT1A 3IX1A 4PF6A 3CIJA 3TELA 3MP1A 1ZJLA 3HV1A 4I3YA 4RK2A 2WX9A 4FECA 1FQDA 4R72A 4E0XA 2ZYMA 1B58A 1FTAA 1OVTA 4H8IA 2I58A 2P3NA 2ZZWA 3HHGA 4ZEDA 3MQ9A 4DXCA 1PC3A 3MZ9A 1I6AA 3OSQA 1IMAA 3TCGA 3IORA 1FBEA 3R26A 3IO6A 4M1VA 3JYRA 4XKRA 3DP8A 1B5JA 1USYE 1JEVA 1GVCA 4ESWA 2ONRA 3I5OA 3OO8A 3L6GA 3RNNA 2THIA 3SESA 2Y84A 3ONMA 1LBYA 3SEWA 1MXUA 4OFJA 4IO2A 4YKKA 4H5FA 4ISUA 1NV7A 3IFCA 5FHNA 1DPPA 1D9YA 1Y20A 4F39A 1B7UA 4OEVA 1B40A 2DXYA 4GQOA 5L9SA 1SW2A 1PB7A 5IM2A 2PFZA 2Q8JA 2D21A 3AXFA 2V84A 1INPA 3TTRA 2HFBA 2HQ0A 1BLFA 3QIMA 1FPIA 1NV3A 4OYVA 3PD9A 5AA1A 1PEBA 4O94A 4ESXA 2REGA 4DCXA 2KQZA 2PYYA 3FVKA 1IMBA 3KBRA 4XKNA 4ECFA 2VHAA 3LSLA 3FVGA 3SETA 4X48A 2Y5KA 3K6XA 2RC8A 5J16A 3FJMA 3WAFA 4F1UA 1ANFA 2WYPA 1FBCA 3T9HB 4RXLA 3KG2A 3K6UA 3OO7A 4OHNA 2KR0A 1IMFA 2X7PA 1VSOA 3CVGA 4UABA 4XIGQ 2XXRA 5F24A 4F19A 3IOVA 1N84A 1TT1A 4YKPA 2HAVA 1DSNA 4ND9A 4P1EA 4PDDA 1H3DA 2DOJA 3E3KA 4PC9A 2RINA 1R6ZA 1B5IA 4IGRA 1LB8A 5I2NB 4F3SA 2DYXA 5EQ8A 2XXPA 1R9LA 3C35A 4OETA 1B0HA 2M8CA 2XWOA 4PCDA 1EU8A 2I3VA 5EYHA 3A3CA 2XWIA 5I59A 4F18A 2QPQA 4QBAA 4G68C 2RC9A 4AQ4A 5LOMA 2P0SA 3OO9A 1JEUA 1SD3A 4LZ5A 4ELOA 3BBRA 1XHYA 4PAIA 2QS1A 4MLVA 5FBPA 1OLAA 1Y4CA 4BDOA 3EF7A 3B50A 3M3KA 5DVFA 4LQ5A 5EQ7A 1ZKBA 1A55A 3HPIA 1A99A 4POXA 2V4CA 3MSTA 4P8BA 3TQWA 4TLLB 2DQVA 1IEJA 1DBZA 1M5DA 3U94A 1Y1MA 2D3IA 4FEDA 4C0RA 3CFZA 2I0CA 4GD5A 3A29A 2Y5LA 4PE5B 4U22A 5BUUA 3PPNA 4LONB 3FVOA 3KN3A 4MH5A 3O6GA 1ZTYA 4LATA 1B3HA 2Z22A 1AH5A 3KGCA 2DSFA 3ZSFA 2OLBA 4GWUA 3KC1A 2OCUA 3KN8A 1Q35A 1QGXA 3TMGA 3DLNA 5KDTB 3GLBA 4GFRA 1B52A 1LEVA 1B5HA 1AOVA 1POTA 3ISPA 1SI0A 1JW4A 2B4LA 4G4PA 4JVDA 1VR5A 3T22A 2DWHA 4WEDA 2Q9TA 4EXKA 1OLCA 1LAGE 3CRBA 1FBHA 2QVUA 4PBHA 4O7IA 4G8NA 1NI9A 5KZTA 2FIXA 5A5XA 5H8QA 4MJOA 4NF6B 2JJKA 1B7ZA 3BIGA 4H8JA 4ZS9A 1FRPA 3RT6B 3H6VA 5AA2D 4AB5A 2QFLA 1EYIA 3MBPA 4IGTA 3FUZA 3DP4A 4EXLA 2CZLA 5KDTA 4O3AA 5ITPA 2V3QA 4PFBA 2WBDA 5CRYA 4JB7A 4RJZA 3LBSA 3U92A 2CEYA 1FTJA 3QK6A 4QFLA 1GV8A 2HPGA 4BDRA 3OEKA 1TFAA 4YKJA 4O7MA 2VGQA 3RYDA 5ET5A 1FJ6A 3SERA 1SPIA 4UACA 1Z7ME 3UORA 1YAEA 2A5TA 1N3XA 4NF6A 4QXDA 4P0IA 2ONSA 4KD5A 3MPKA 1NNPA 1JVXA 4HS7A 4KCDA 3TODA 3TFLA 3ILUB 3JV9A 1QKBA 4XFEA 1FPJA 3MUQA 4G68A 2HCAA 4YICA 1FTOA 1EYKA 2VP1A 3OMBA 1JP4A 2DXRA 1IMEA 4QFOA 4ZEIA 4H6DA 4QHQA 3UGWA 3ZKKA 2XXWA 3IJOB 4TQUQ 3O2AA 1YZ0A 4ELPA 1FPLA 2PX1A 3GXAA 2UVIA 4MFIA 3E4RA 5ISUA 5K2YA 3KJ7A 3IJXB 1NKXA 3IB0A 1MXVA 2O69A 3MW0A 1EZ9A 1LAHE 3G3KA 2OK2A 1NFTA 4GL0A 4FAJA 2XXYA 3T9VA 2XHDA 2UVJA 3Q26A 2YJPA 4EQ9A 3VV5A 4XXUA 1FSAA 1MH3A 2O1MA 4U4SA 4EDPA 5IKBA 4O3CA 3TDJA 2WEFA 3C4MA 3KZGA 3TTLA 1MQDA 4NTLA 1GTKA 1P1WA 4GWOA 4DE8A 1IIWA 3QXMA 2XXXA 3BKIB 3FATA 1URDA 2VD3A 5FHOA 3K6VA 3PU5A 3QMFA 4E0WA 2B65A 1EYJA 4XF5A 1B4HA 1T0KA 1VFEA 3O9PA 1KZ8A 5H8NB 1URGA 3SEUA 2AYSA 4IO4A 3D4CA 3NOHA 4MMPA 1FTKA 1LBCA 4U23A 3T96B 2UXAA 1J1NA 4GWWA 1DK4A 3Q27A 4YAHX 5EQAA 3K1MA 2HXRA 4XTCQ 4JVIA 5I58B 3WAEA 2ABHA 1A54A 4G77A 3FJGA 4NE4A 2HXWA 2DDKA 4MEVA 1NMUA 4YMAA 5CBRA 4RNSA 2BJIA 2FNCA 3FXQA 4NF4A 3T9UA 4NWCA 3UA8A 3G3HA 4DIGA 1A7LA 1UTHB 3PUYE 4TLMB 2F78A 3TAJA 3PPPA 2O7UA 1FQFA 3CFXA 4NAPA 2E1SA 3MVZA 4G2ZA 2I49A 3O6IA 1WODA 4JXIA 3U93A 4LA9A 4Q5TA 4OERA 3FV2A 4NEDA 4GL8A 3N26A 5I58A 2R8TA 1MQIA 4X1BA 2ESNA 2H9BA 3PMVA 2VD2A 5CMBA 2UYFA 4R6KA 4I40A 3K00A 3HFUA 1POY1 4RA1A 4ZEBA 3S9NC 3O66A 1QW0A 4Q8RA 3PPRA 5H8HB 5JTYB 4KR5A 3ROJA 4YU0A 5TPAB 5TU0A 1ATGA 4I9DA 1B4ZA 1B6HA 2ZZXA 2PFYA 4EQBA 1OVBA 3PGFA 1EZOA 4NN3A 4QFPA 2LAOA 5CC2A 4QRZA 2XXUA 4BDLA 3CFLA 4N4UA 4JWXA 3VVDA 2QJEA 4YKIA 3VVEA 1Y3NA 5L9OA 3IB2A 3H6UA 4OFOA 4R6YA 4PFRA 4PAKA 1DCUA 1NL5A 4N8GA 1KA1A 1I6QA 1MY0A 1M5BA 3QYTA 4KYDA 4LQ2A 2Q2CA 5H8HA 4G8MA 1Q9DA 5JTYA 3Q29A 2QSXA 1MPDA 1HSLA 4X9TA 1TFDA 1JVYA 2REJA 3RUMA 3T9XB 3C9HA 4THIA 4H5GA 2VOZA 5FTIA 2OBGA 2H98A 1D4NA 3K01A 2F8DA 2QVRA 3VXCA 1NUZA 5I56B 1BIYA 1RDXA 1Y9UA 1LFIA 3RTWB 3HO7A 1N7WA 3GZGA 3SEVA 2I3WA 1OQHA 2WBBA 2XA5A 3W15C 1RKMA 1AWBA 2XWVA 4U1ZA 4RYAA 4X04A 4NF5B 3D1RA 1YTVA 3EPEA 3T1BA 5AA2B 2I4BA 2H25A 2V93A 2V3UA 3K1NA 1MQGA 3MP6A 2RF1A 4P47A 2CZIA 3IAZA 2FBPA 4KPTA 4KCCA 4DXUA 1MY2A 1O64A 4RPNA 4ZZAA 1FQCA 3USDA 4Q30B 5HPQA 1NNTA 1CB6A 4GIZA 3S9MC 1MS7A 2YPNA 2V3TA 3MJNA 1P1NA 3G3JA 5DEXB 3PD8A 1DTZA 1SDXA 1US5A 3IB1A 3TUSA 3C31A 1XOCA 1RYOA 4GX6A 4QFNA 3FIRA 1D9VA 2XXKA 2PT2A 3VLUA 3RN8A 2Q89A 1ZMGA 5L9MA 1MQHA 3V8XB 4NF5A 3E78A 1Y3PA 5H8SA 1TWYA 2PBWA 1XVXA 1M5CA 1N0TA 1NV5A 4IB2A 3UN6A 2GQ1A 4ZE9A 4KYEA 3FXUA 1IMCA 4ONYA 1FJ9A 4N81A 1SYIA 3K02A 2PMSA 2AL5A 1XC1A 1FBFA 3SDFA 5DVJA 3ZS6A 4C1UA 4PGPA 3HN0A 3OD7A 4MX6A 4GX4A 1B9JA 3P7IA 2GHAA 1BP5A 4GWXA 3H06B 4GOTA 4EQ7A 2WKYA 1MY1A 4RK9A 4NG7A 5AA4B 4GXAA 4MNIA 1FPFA 1M5EA 1VDWA 3O29A 4DI4B 1LBZA 5I2NA 1IMDA 2P2AA 2QS4A 2QVVA 1JNFA 3TEPA 4MBPA 2PVUA 2NXOA 4AS4A 1B7HA 4OENA
chains in the Genus database with same CATH topology
3O28A 3TTKA 2Q88A 1B0LA 1LAFE 2D5WA 3IR1A 1JETA 2O7IA 2I6EA 2R6GE 2DE2A 4OFLA 4FJPA 3C32A 5J1DA 5DYHA 1B51A 4H67A 1GR2A 3H3GA 5AA4A 3VVFA 4F22A 4YB5A 2ANJA 4R2FA 1IITA 1LCTA 4R9GA 4RY1A 1BKAA 3S9LC 4P11A 4I62A 1UTBB 2O6AA 1VE4A 2ZNUA 1JW5A 5ITOA 2X7QA 3CG3A 3S9EA 1USYH 3EHSA 1UIVA 2V25A 4LUBA 4OMBA 5EHSA 1B05A 2A5SA 4KHZE 4DDDA 3RY3A 2Y7WA 2NOOA 4JDFA 5H8FB 1MQJA 4NWDA 2HEUA 1A8EA 4PFTA 1DMBA 4MF3A 1H45A 4U21A 3EN3A 3G3FA 1MRPA 3H7MA 3VXBA 1MM7A 1MXXA 4GXSB 4HCYA 3MZ1A 4OXVA 3TTMA 4MLQA 3A3UA 4JSDA 4YMBA 3UIFA 2Z8EA 3K0VA 2O51A 3BFUA 1DPEA 3M8UA 1B2HA 3G3GA 3JZJA 3FXRA 3RQTA 5H8FA 1A40A 1B3FA 1LFGA 1ZLQA 3SEXA 3R6UA 2I4CA 1OMPA 3O6HA 1FQAA 4QFKA 4DLDA 2GFEA 3KFMA 1Q1KA 3QAXA 3TCFA 3MZBA 1LAXA 1UIUA 5IAIA 2XXQA 4PFWA 4QF9A 5I2KB 3OXNA 1O7TA 1GGGA 1FTLA 3V89B 2XD2A 4R75A 4U1OA 4C1TA 1SW5A 3PUWE 1MY4A 2B3BA 3FGSA 2H5YA 3KJTA 1B1XA 5CI5A 3IO4A 3CSBA 5DT6A 4IO6A 3PUVE 2XXHA 2XX7A 4EUOA 3PMXA 4ELRA 5F7VA 4BDNA 1AL3A 5EYFA 5TP9B 3L6HA 4U2RA 3W9VA 1PB8A 1SI1A 4L17A 1OQGA 3S4UA 3U8QA 4LVQA 3U1OA 1IXCA 4KYSA 5I84A 4HCWA 2DWJA 2AL4A 1YPNA 1MG1A 2P1SA 4QSDA 3TKDA 4OWDA 5EHMA 5CM6A 3VLVA 3M3FA 3OO6A 4M4GA 2ZYKA 1B3EA 1VFDA 1FW0A 4PETA 5B7DA 3T93B 4LZ7A 1S9TA 3N94A 3TPAA 1ZIUA 2QRYA 4WEPA 5TP9A 1LFHA 4HTGA 2NWJA 4F31B 4POWA 4XKQA 3K4UA 1IXGA 3H03A 1A8FA 1QVSA 4BLAA 5CMCA 3IOUA 3VDFA 4ZZEA 4YB6A 1ELJA 1BTJA 3DELB 1SYHA 3QUJA 2RCBA 5H8NA 1UQWA 1IXIA 3FVNA 2HAUA 1R9QA 3PPQA 3TYHA 3QSLA 3KOTA 4IY6A 1IZ1A 2X26A 2F34A 3RGYA 3B7DA 1P1OA 4HW8A 3BFTA 4AB6A 4I1DA 2ZMBA 3RPWA 1FCKA 1NNKA 3MAMA 2I48A 2F36A 4OESA 5HM4B 3ZKLA 5AA3A 2B3FA 4ZE8A 2XD3A 1UTHA 2GHBA 3HSTA 4R9FA 3LUYA 3I3VA 5K2XA 5ICQA 2ONKE 4ELQA 1B32A 4KFQA 1MDQA 2OWTA 1Z7NE 1P99A 3FASA 1SQYA 5CMMA 2ALUA 4WXJA 3HHFA 2FA7A 1LLSA 4EF1A 2GH9A 2DS9A 1II5A 4PFYA 1MXYA 2RC7A 4H0WA 4OQOA 1LB9A 5TPAA 4F3BA 4JWOA 1JW1A 1WDNA 4FATA 4WKMA 3KEIA 1DTGA 1D3KA 3D4GA 1O63A 3GBBA 1H76A 1MM6A 2Y7PA 3N6TA 3KOSA 1URSA 4NF8B 3FZVA 3CSGA 4FORA 2XXIA 3GBAA 2IEEA 1MDP1 1FQBA 5DTBA 4X1DA 3RLFE 4LP2B 4JSOA 3VE1B 4JBZA 5FHMA 2F7CA 3CR9A 3N6UA 3B6TA 4ZECA 4K3FA 2Z23A 3PUZE 2F97A 4KI0E 1QUJA 3DM0A 3IOWA 4Z7EA 3KSXA 3LSXA 4JWYA 4G8HA 3M3LA 2OJTA 5I56A 1QJMA 2G29A 4NF8A 3TCHA 1WVJA 4YB7A 3LSFB 4ZDMA 3A09A 3RTFB 3EHTA 3FV1A 2UYEA 1N76A 3C34A 4NMYA 2Z8FA 5I59B 1NH7A 1SBPA 4OTEA 4F3PA 2YLNA 3LC8A 1LSTA 5AA2A 2UVGA 2O1LA 2O84X 4O3BA 3PMWA 2ZNTA 4EF2A 2H4IA 2QMXA 2RKMA 1H44A 4BDMA 2F6PA 4IY5A 2ZYOA 3ECRA 5DVIA 1S7YA 1S50A 1B1HA 5DEXA 3C36A 2XX9A 3HCQA 4RPOA 1Y3QA 4FIMA 2RCAA 2XXVA 1M5FA 4R6HA 1FQEA 3B6WA 3I6VA 3KN7A 3B6QA 3ILTB 3O97A 5ICTA 1AIVA 3TZAA 1NH8A 1L5TA 3S2VA 2OWSA 4UA8A 2ZNSA 3OELA 3MVWA 4U4XA 1P1QA 4XKPA 2F5XA 5B70A 4F2OA 4N6PA 4OVJA 4YZZA 5HBCA 1RYXA 2Y7RA 1MXWA 1I69A 5A5XB 5H8QB 3SKPA 1PBQA 3THIA 2NVUB 2DVCA 2UVHA 4ZEKA 2DWAA 2Y7KA 3T66A 3U72A 3E9XA 3DP6A 3G7WA 4LZ8A 3K6WA 2F7BA 3MP8A 5JEIA 3Q25A 1QULA 2QL3A 3OEMA 4PQJA 4F1VA 3LR1A 3IK6B 3K2DA 1XS5A 2XXTA 2KLFA 2XX8A 2DP8A 4Q0CA 2H99A 2HZLA 3EHUA 1SW1A 3H6TA 2A5TB 3TQLA 1UTBA 3KSJA 3C33A 3E13X 4IO3A 4BDQA 1PDAA 4PP0A 3N5LA 3OENA 1R1NA 5ELVA 1IXHA 4G68B 3OOAA 4DZ1A 4GRKA 1MPBA 3CG1A 1IQ7A 1QUKA 4IO7A 3K1PA 2ZYNA 1EZPA 4F29A 2IA4A 5F1QA 4Z0IA 1MPCA 2BJJX 3IOTA 3UK4A 3MVYA 2ZXTA 2QMWA 1MY3A 5L8DA 1F9BA 1TXFA 1PBPA 3PPOA 4N07A 2R9JA 1IUDA 2I0BA 4F2QA 4I8CA 4GVOA 2R71A 5I57B 1CE2A 2F7AA 3F11A 1SVXB 4R74A 5FTHA 2OZZA 1FTMA 4R73A 1EH3A 5CMKA 4OZ9A 2QS3A 1YCJA 2DE4A 3V5AA 1HSJA 4F1YA 1HSEA 1N7XA 1QKAA 2AIXA 2DE3A 3MPLA 1MH4A 4KQPA 1LGBC 2Q2AA 3RT8A 1KWHA 3H6WA 5I2KA 3R7XA 1I6BA 2FYIA 4OEUA 5M2VA 1LCFA 5I57A 4H1XA 1N04A 2NUVA 1MXZA 4R2BA 4DCYA 3Q28A 1PB9A 4GLIA 3PV0E 1US4A 2G93A 4PFUA 3VFJA 1XT8A 4NF4B 1B3LA 1N3WA 4QSEA 4IO5A 4F3GA 1JQFA 5AE4A 2CMOA 2E0SA 5JK4A 1B46A 1P1UA 5BWJA 3QUFA 1AMFA 3W9WA 1H43A 5KCJB 1Y1ZA 3FJ7A 4FE8A 1ZU0A 3CI8A 3EQ1A 2Z8DA 3ODBA 2GRVA 1LBBA 5CBSA 4DXBA 4GF8A 2W7YA 4H65A 3IL1B 1QUIA 1SW4A 3MC2A 1XVYA 3FD3A 1B3GA 1DOTA 2F35A 3LSWA 2F6GA 2DWIA 3TTNA 4N13A 2Y7IA 2DVZA 1OIBA 2HZKA 2O68A 3SEYA 3V83A 4TOZA 3VLWA 1ZBMA 3G3IA 5KCJA 1NNFA 1Y4TA 3MWBA 4P0GA 3H4ZA 4FEBA 3UP9A 3OSRA 3MVXA 3PUXE 4QSCA 4ZEFA 2QS2A 2PT1A 3IX1A 3CIJA 3TELA 3MP1A 1ZJLA 3HV1A 4RK2A 4FECA 1FQDA 4R72A 4E0XA 2ZYMA 1B58A 1OVTA 4H8IA 2I58A 3HHGA 4ZEDA 3MQ9A 4DXCA 1PC3A 3MZ9A 1I6AA 3OSQA 3TCGA 3IORA 3R26A 3IO6A 4M1VA 3JYRA 4XKRA 3DP8A 1B5JA 1USYE 1JEVA 1GVCA 4ESWA 2ONRA 3I5OA 3OO8A 3L6GA 3RNNA 2THIA 3SESA 2Y84A 3ONMA 3SEWA 1MXUA 4OFJA 4IO2A 4YKKA 4H5FA 4ISUA 5FHNA 1DPPA 1D9YA 1Y20A 4F39A 1B7UA 4OEVA 1B40A 2DXYA 4GQOA 5L9SA 1SW2A 1PB7A 2Q8JA 2D21A 3AXFA 2V84A 3TTRA 2HFBA 2HQ0A 1BLFA 3QIMA 4OYVA 3PD9A 5AA1A 1PEBA 4ESXA 2REGA 4DCXA 2PYYA 3FVKA 3KBRA 4XKNA 4ECFA 2VHAA 3LSLA 3FVGA 3SETA 4X48A 3K6XA 2RC8A 3FJMA 3WAFA 4F1UA 1ANFA 3T9HB 4RXLA 3KG2A 3K6UA 3OO7A 4OHNA 2X7PA 1VSOA 3CVGA 4XIGQ 2XXRA 4F19A 3IOVA 1N84A 1TT1A 4YKPA 2HAVA 1DSNA 4ND9A 1H3DA 2DOJA 3E3KA 2RINA 1R6ZA 1B5IA 4IGRA 1LB8A 5I2NB 4F3SA 2DYXA 2XXPA 1R9LA 3C35A 4OETA 1B0HA 2M8CA 1EU8A 2I3VA 3A3CA 5I59A 4F18A 2QPQA 4G68C 2RC9A 4AQ4A 5LOMA 2P0SA 3OO9A 1JEUA 1SD3A 4LZ5A 4ELOA 3BBRA 1XHYA 2QS1A 4MLVA 1OLAA 1Y4CA 4BDOA 3EF7A 3M3KA 5DVFA 4LQ5A 1ZKBA 1A55A 3HPIA 1A99A 4POXA 3TQWA 4TLLB 2DQVA 1IEJA 1M5DA 3U94A 1Y1MA 2D3IA 4FEDA 4C0RA 3CFZA 2I0CA 4GD5A 4PE5B 4U22A 5BUUA 3PPNA 4LONB 3FVOA 3KN3A 4MH5A 3O6GA 1ZTYA 4LATA 1B3HA 2Z22A 1AH5A 3KGCA 2DSFA 3ZSFA 2OLBA 2OCUA 3KN8A 1Q35A 3TMGA 3DLNA 5KDTB 3GLBA 4GFRA 1B52A 1B5HA 1AOVA 1POTA 1SI0A 1JW4A 4G4PA 1VR5A 3T22A 2DWHA 4WEDA 2Q9TA 4EXKA 1OLCA 1LAGE 3CRBA 4G8NA 5KZTA 5A5XA 5H8QA 4NF6B 1B7ZA 4H8JA 4ZS9A 3RT6B 3H6VA 5AA2D 4AB5A 3MBPA 4IGTA 3FUZA 3DP4A 4EXLA 2CZLA 5KDTA 4O3AA 5ITPA 2V3QA 5CRYA 4JB7A 4RJZA 3LBSA 3U92A 1FTJA 3QK6A 4QFLA 1GV8A 4BDRA 3OEKA 1TFAA 4YKJA 2VGQA 3SERA 4UACA 1Z7ME 3UORA 1YAEA 2A5TA 1N3XA 4NF6A 4P0IA 2ONSA 4KD5A 3MPKA 1NNPA 1JVXA 3TODA 4KCDA 4HS7A 3TFLA 3ILUB 3JV9A 1QKBA 3MUQA 4G68A 2HCAA 4YICA 1FTOA 2VP1A 3OMBA 2DXRA 4QFOA 4ZEIA 4H6DA 4QHQA 3UGWA 3ZKKA 2XXWA 3IJOB 4TQUQ 3O2AA 4ELPA 2PX1A 3GXAA 2UVIA 4MFIA 3E4RA 5ISUA 5K2YA 3KJ7A 3IJXB 1NKXA 3IB0A 1MXVA 2O69A 3MW0A 1EZ9A 1LAHE 3G3KA 2OK2A 1NFTA 4GL0A 4FAJA 2XXYA 3T9VA 2XHDA 2UVJA 3Q26A 2YJPA 4EQ9A 3VV5A 4XXUA 1MH3A 2O1MA 4U4SA 4EDPA 5IKBA 4O3CA 3TDJA 3C4MA 3KZGA 3TTLA 1MQDA 4NTLA 1GTKA 1P1WA 4GWOA 4DE8A 1IIWA 3QXMA 2XXXA 3BKIB 3FATA 1URDA 2VD3A 5FHOA 3K6VA 3PU5A 4E0WA 2B65A 1B4HA 1T0KA 1VFEA 3O9PA 5H8NB 1URGA 3SEUA 2AYSA 4IO4A 3D4CA 1FTKA 1LBCA 4U23A 3T96B 2UXAA 1J1NA 3Q27A 4YAHX 3K1MA 4XTCQ 5I58B 3WAEA 2ABHA 1A54A 4G77A 3FJGA 4NE4A 2HXWA 1NMUA 4YMAA 5CBRA 4RNSA 2FNCA 3FXQA 4NF4A 3T9UA 4NWCA 3UA8A 3G3HA 4DIGA 1A7LA 1UTHB 3PUYE 4TLMB 2F78A 3TAJA 3PPPA 2O7UA 1FQFA 3CFXA 2E1SA 3MVZA 4G2ZA 2I49A 3O6IA 1WODA 4JXIA 3U93A 4LA9A 4Q5TA 4OERA 3FV2A 4NEDA 4GL8A 3N26A 5I58A 1MQIA 4X1BA 2ESNA 2H9BA 3PMVA 2VD2A 5CMBA 2UYFA 4R6KA 3K00A 1POY1 4RA1A 4ZEBA 3S9NC 3O66A 1QW0A 4Q8RA 3PPRA 5H8HB 5JTYB 4KR5A 4YU0A 5TPAB 5TU0A 1ATGA 4I9DA 1B4ZA 1B6HA 4EQBA 1OVBA 3PGFA 1EZOA 4QFPA 2LAOA 5CC2A 4QRZA 2XXUA 4BDLA 3CFLA 4JWXA 3VVDA 2QJEA 4YKIA 3VVEA 1Y3NA 5L9OA 3IB2A 3H6UA 4OFOA 4R6YA 1NL5A 1I6QA 1MY0A 1M5BA 3QYTA 4KYDA 4LQ2A 2Q2CA 5H8HA 4G8MA 5JTYA 3Q29A 2QSXA 1MPDA 1HSLA 4X9TA 1TFDA 1JVYA 2REJA 3RUMA 3T9XB 3C9HA 4THIA 4H5GA 2VOZA 5FTIA 2OBGA 2H98A 1D4NA 3K01A 2F8DA 3VXCA 5I56B 1BIYA 1Y9UA 1LFIA 3RTWB 3HO7A 1N7WA 3GZGA 3SEVA 2I3WA 1OQHA 3W15C 1RKMA 4U1ZA 4RYAA 4NF5B 3EPEA 1YTVA 5AA2B 2I4BA 2H25A 2V93A 2V3UA 3K1NA 1MQGA 3MP6A 2RF1A 3IAZA 4KPTA 4KCCA 4DXUA 1MY2A 1O64A 4RPNA 4ZZAA 1FQCA 3USDA 4Q30B 5HPQA 1NNTA 1CB6A 4GIZA 3S9MC 1MS7A 2YPNA 2V3TA 3MJNA 1P1NA 3G3JA 5DEXB 3PD8A 1DTZA 1SDXA 1US5A 3IB1A 3TUSA 3C31A 1XOCA 1RYOA 4QFNA 3FIRA 1D9VA 2PT2A 3VLUA 3RN8A 2Q89A 1ZMGA 5L9MA 1MQHA 3V8XB 4NF5A 1Y3PA 5H8SA 1TWYA 2PBWA 1XVXA 1M5CA 1N0TA 4IB2A 3UN6A 4ZE9A 4KYEA 3FXUA 4ONYA 1SYIA 3K02A 2PMSA 2AL5A 1XC1A 3SDFA 5DVJA 3ZS6A 4C1UA 3HN0A 3OD7A 1B9JA 3P7IA 2GHAA 1BP5A 3H06B 4GOTA 4EQ7A 2WKYA 1MY1A 4RK9A 5AA4B 4GXAA 1M5EA 3O29A 5I2NA 2P2AA 2QS4A 1JNFA 3TEPA 4MBPA 2PVUA 2NXOA 1B7HA 4OENA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O28 A;  3TTK A;  2Q88 A;  1B0L A;  1LAF E;  2D5W A;  3IR1 A;  1JET A;  2O7I A;  2I6E A;  2R6G E;  2DE2 A;  4OFL A;  4FJP A;  3C32 A;  5J1D A;  5DYH A;  1B51 A;  4H67 A;  1GR2 A;  3H3G A;  5AA4 A;  3VVF A;  4F22 A;  4YB5 A;  2ANJ A;  4R2F A;  1IIT A;  1LCT A;  4R9G A;  4RY1 A;  1BKA A;  3S9L C;  4P11 A;  4I62 A;  1UTB B;  2O6A A;  1VE4 A;  2ZNU A;  1JW5 A;  5ITO A;  2X7Q A;  3CG3 A;  3S9E A;  1USY H;  3EHS A;  1UIV A;  2V25 A;  4LUB A;  4OMB A;  5EHS A;  1B05 A;  2A5S A;  4KHZ E;  4DDD A;  3RY3 A;  2Y7W A;  2NOO A;  4JDF A;  5H8F B;  1MQJ A;  4NWD A;  2HEU A;  1A8E A;  4PFT A;  1DMB A;  4MF3 A;  1H45 A;  4U21 A;  3EN3 A;  3G3F A;  1MRP A;  3H7M A;  3VXB A;  1MM7 A;  1MXX A;  4GXS B;  4HCY A;  3MZ1 A;  4OXV A;  3TTM A;  4MLQ A;  3A3U A;  4JSD A;  4YMB A;  3UIF A;  2Z8E A;  3K0V A;  2O51 A;  3BFU A;  1DPE A;  3M8U A;  1B2H A;  3G3G A;  3JZJ A;  3FXR A;  3RQT A;  5H8F A;  1A40 A;  1B3F A;  1LFG A;  1ZLQ A;  3SEX A;  3R6U A;  2I4C A;  1OMP A;  3O6H A;  1FQA A;  4QFK A;  4DLD A;  2GFE A;  3KFM A;  1Q1K A;  3QAX A;  3TCF A;  3MZB A;  1LAX A;  1UIU A;  5IAI A;  2XXQ A;  4PFW A;  4QF9 A;  5I2K B;  3OXN A;  1O7T A;  1GGG A;  1FTL A;  3V89 B;  2XD2 A;  4R75 A;  4U1O A;  4C1T A;  1SW5 A;  3PUW E;  1MY4 A;  2B3B A;  3FGS A;  2H5Y A;  3KJT A;  1B1X A;  5CI5 A;  3IO4 A;  3CSB A;  5DT6 A;  4IO6 A;  3PUV E;  2XXH A;  2XX7 A;  4EUO A;  3PMX A;  4ELR A;  5F7V A;  4BDN A;  1AL3 A;  5EYF A;  5TP9 B;  3L6H A;  4U2R A;  3W9V A;  1PB8 A;  1SI1 A;  4L17 A;  1OQG A;  3S4U A;  3U8Q A;  4LVQ A;  3U1O A;  1IXC A;  4KYS A;  5I84 A;  4HCW A;  2DWJ A;  2AL4 A;  1YPN A;  1MG1 A;  2P1S A;  4QSD A;  3TKD A;  4OWD A;  5EHM A;  5CM6 A;  3VLV A;  3M3F A;  3OO6 A;  4M4G A;  2ZYK A;  1B3E A;  1VFD A;  1FW0 A;  4PET A;  5B7D A;  3T93 B;  4LZ7 A;  1S9T A;  3N94 A;  3TPA A;  1ZIU A;  2QRY A;  4WEP A;  5TP9 A;  1LFH A;  4HTG A;  2NWJ A;  4F31 B;  4POW A;  4XKQ A;  3K4U A;  1IXG A;  3H03 A;  1A8F A;  1QVS A;  4BLA A;  5CMC A;  3IOU A;  3VDF A;  4ZZE A;  4YB6 A;  1ELJ A;  1BTJ A;  3DEL B;  1SYH A;  3QUJ A;  2RCB A;  5H8N A;  1UQW A;  1IXI A;  3FVN A;  2HAU A;  1R9Q A;  3PPQ A;  3TYH A;  3QSL A;  3KOT A;  4IY6 A;  1IZ1 A;  2X26 A;  2F34 A;  3RGY A;  3B7D A;  1P1O A;  4HW8 A;  3BFT A;  4AB6 A;  4I1D A;  2ZMB A;  3RPW A;  1FCK A;  1NNK A;  3MAM A;  2I48 A;  2F36 A;  4OES A;  5HM4 B;  3ZKL A;  5AA3 A;  2B3F A;  4ZE8 A;  2XD3 A;  1UTH A;  2GHB A;  3HST A;  4R9F A;  3LUY A;  3I3V A;  5K2X A;  5ICQ A;  2ONK E;  4ELQ A;  1B32 A;  4KFQ A;  1MDQ A;  2OWT A;  1Z7N E;  1P99 A;  3FAS A;  1SQY A;  5CMM A;  2ALU A;  4WXJ A;  3HHF A;  2FA7 A;  1LLS A;  4EF1 A;  2GH9 A;  2DS9 A;  1II5 A;  4PFY A;  1MXY A;  2RC7 A;  4H0W A;  4OQO A;  1LB9 A;  5TPA A;  4F3B A;  4JWO A;  1JW1 A;  1WDN A;  4FAT A;  4WKM A;  3KEI A;  1DTG A;  1D3K A;  3D4G A;  1O63 A;  3GBB A;  1H76 A;  1MM6 A;  2Y7P A;  3N6T A;  3KOS A;  1URS A;  4NF8 B;  3FZV A;  3CSG A;  4FOR A;  2XXI A;  3GBA A;  2IEE A;  1MDP 1;  1FQB A;  5DTB A;  4X1D A;  3RLF E;  4LP2 B;  4JSO A;  3VE1 B;  4JBZ A;  5FHM A;  2F7C A;  3CR9 A;  3N6U A;  3B6T A;  4ZEC A;  4K3F A;  2Z23 A;  3PUZ E;  2F97 A;  4KI0 E;  1QUJ A;  3DM0 A;  3IOW A;  4Z7E A;  3KSX A;  3LSX A;  4JWY A;  4G8H A;  3M3L A;  2OJT A;  5I56 A;  1QJM A;  2G29 A;  4NF8 A;  3TCH A;  1WVJ A;  4YB7 A;  3LSF B;  4ZDM A;  3A09 A;  3RTF B;  3EHT A;  3FV1 A;  2UYE A;  1N76 A;  3C34 A;  4NMY A;  2Z8F A;  5I59 B;  1NH7 A;  1SBP A;  4OTE A;  4F3P A;  2YLN A;  3LC8 A;  1LST A;  5AA2 A;  2UVG A;  2O1L A;  2O84 X;  4O3B A;  3PMW A;  2ZNT A;  4EF2 A;  2H4I A;  2QMX A;  2RKM A;  1H44 A;  4BDM A;  2F6P A;  4IY5 A;  2ZYO A;  3ECR A;  5DVI A;  1S7Y A;  1S50 A;  1B1H A;  5DEX A;  3C36 A;  2XX9 A;  3HCQ A;  4RPO A;  1Y3Q A;  4FIM A;  2RCA A;  2XXV A;  1M5F A;  4R6H A;  1FQE A;  3B6W A;  3I6V A;  3KN7 A;  3B6Q A;  3ILT B;  3O97 A;  5ICT A;  1AIV A;  3TZA A;  1NH8 A;  1L5T A;  3S2V A;  2OWS A;  4UA8 A;  2ZNS A;  3OEL A;  3MVW A;  4U4X A;  1P1Q A;  4XKP A;  2F5X A;  5B70 A;  4F2O A;  4N6P A;  4OVJ A;  4YZZ A;  5HBC A;  1RYX A;  2Y7R A;  1MXW A;  1I69 A;  5A5X B;  5H8Q B;  3SKP A;  1PBQ A;  3THI A;  2NVU B;  2DVC A;  2UVH A;  4ZEK A;  2DWA A;  2Y7K A;  3T66 A;  3U72 A;  3E9X A;  3DP6 A;  3G7W A;  4LZ8 A;  3K6W A;  2F7B A;  3MP8 A;  5JEI A;  3Q25 A;  1QUL A;  2QL3 A;  3OEM A;  4PQJ A;  4F1V A;  3LR1 A;  3IK6 B;  3K2D A;  1XS5 A;  2XXT A;  2KLF A;  2XX8 A;  2DP8 A;  4Q0C A;  2H99 A;  2HZL A;  3EHU A;  1SW1 A;  3H6T A;  2A5T B;  3TQL A;  1UTB A;  3KSJ A;  3C33 A;  3E13 X;  4IO3 A;  4BDQ A;  1PDA A;  4PP0 A;  3N5L A;  3OEN A;  1R1N A;  5ELV A;  1IXH A;  4G68 B;  3OOA A;  4DZ1 A;  4GRK A;  1MPB A;  3CG1 A;  1IQ7 A;  1QUK A;  4IO7 A;  3K1P A;  2ZYN A;  1EZP A;  4F29 A;  2IA4 A;  5F1Q A;  4Z0I A;  1MPC A;  2BJJ X;  3IOT A;  3UK4 A;  3MVY A;  2ZXT A;  2QMW A;  1MY3 A;  5L8D A;  1F9B A;  1TXF A;  1PBP A;  3PPO A;  4N07 A;  2R9J A;  1IUD A;  2I0B A;  4F2Q A;  4I8C A;  4GVO A;  2R71 A;  5I57 B;  1CE2 A;  2F7A A;  3F11 A;  1SVX B;  4R74 A;  5FTH A;  2OZZ A;  1FTM A;  4R73 A;  1EH3 A;  5CMK A;  4OZ9 A;  2QS3 A;  1YCJ A;  2DE4 A;  3V5A A;  1HSJ A;  4F1Y A;  1HSE A;  1N7X A;  1QKA A;  2AIX A;  2DE3 A;  3MPL A;  1MH4 A;  4KQP A;  1LGB C;  2Q2A A;  3RT8 A;  1KWH A;  3H6W A;  5I2K A;  3R7X A;  1I6B A;  2FYI A;  4OEU A;  5M2V A;  1LCF A;  5I57 A;  4H1X A;  1N04 A;  2NUV A;  1MXZ A;  4R2B A;  4DCY A;  3Q28 A;  1PB9 A;  4GLI A;  3PV0 E;  1US4 A;  2G93 A;  4PFU A;  3VFJ A;  1XT8 A;  4NF4 B;  1B3L A;  1N3W A;  4QSE A;  4IO5 A;  4F3G A;  1JQF A;  5AE4 A;  2CMO A;  2E0S A;  5JK4 A;  1B46 A;  1P1U A;  5BWJ A;  3QUF A;  1AMF A;  3W9W A;  1H43 A;  5KCJ B;  1Y1Z A;  3FJ7 A;  4FE8 A;  1ZU0 A;  3CI8 A;  3EQ1 A;  2Z8D A;  3ODB A;  2GRV A;  1LBB A;  5CBS A;  4DXB A;  4GF8 A;  2W7Y A;  4H65 A;  3IL1 B;  1QUI A;  1SW4 A;  3MC2 A;  1XVY A;  3FD3 A;  1B3G A;  1DOT A;  2F35 A;  3LSW A;  2F6G A;  2DWI A;  3TTN A;  4N13 A;  2Y7I A;  2DVZ A;  1OIB A;  2HZK A;  2O68 A;  3SEY A;  3V83 A;  4TOZ A;  3VLW A;  1ZBM A;  3G3I A;  5KCJ A;  1NNF A;  1Y4T A;  3MWB A;  4P0G A;  3H4Z A;  4FEB A;  3UP9 A;  3OSR A;  3MVX A;  3PUX E;  4QSC A;  4ZEF A;  2QS2 A;  2PT1 A;  3IX1 A;  3CIJ A;  3TEL A;  3MP1 A;  1ZJL A;  3HV1 A;  4RK2 A;  4FEC A;  1FQD A;  4R72 A;  4E0X A;  2ZYM A;  1B58 A;  1OVT A;  4H8I A;  2I58 A;  3HHG A;  4ZED A;  3MQ9 A;  4DXC A;  1PC3 A;  3MZ9 A;  1I6A A;  3OSQ A;  3TCG A;  3IOR A;  3R26 A;  3IO6 A;  4M1V A;  3JYR A;  4XKR A;  3DP8 A;  1B5J A;  1USY E;  1JEV A;  1GVC A;  4ESW A;  2ONR A;  3I5O A;  3OO8 A;  3L6G A;  3RNN A;  2THI A;  3SES A;  2Y84 A;  3ONM A;  3SEW A;  1MXU A;  4OFJ A;  4IO2 A;  4YKK A;  4H5F A;  4ISU A;  5FHN A;  1DPP A;  1D9Y A;  1Y20 A;  4F39 A;  1B7U A;  4OEV A;  1B40 A;  2DXY A;  4GQO A;  5L9S A;  1SW2 A;  1PB7 A;  2Q8J A;  2D21 A;  3AXF A;  2V84 A;  3TTR A;  2HFB A;  2HQ0 A;  1BLF A;  3QIM A;  4OYV A;  3PD9 A;  5AA1 A;  1PEB A;  4ESX A;  2REG A;  4DCX A;  2PYY A;  3FVK A;  3KBR A;  4XKN A;  4ECF A;  2VHA A;  3LSL A;  3FVG A;  3SET A;  4X48 A;  3K6X A;  2RC8 A;  3FJM A;  3WAF A;  4F1U A;  1ANF A;  3T9H B;  4RXL A;  3KG2 A;  3K6U A;  3OO7 A;  4OHN A;  2X7P A;  1VSO A;  3CVG A;  4XIG Q;  2XXR A;  4F19 A;  3IOV A;  1N84 A;  1TT1 A;  4YKP A;  2HAV A;  1DSN A;  4ND9 A;  1H3D A;  2DOJ A;  3E3K A;  2RIN A;  1R6Z A;  1B5I A;  4IGR A;  1LB8 A;  5I2N B;  4F3S A;  2DYX A;  2XXP A;  1R9L A;  3C35 A;  4OET A;  1B0H A;  2M8C A;  1EU8 A;  2I3V A;  3A3C A;  5I59 A;  4F18 A;  2QPQ A;  4G68 C;  2RC9 A;  4AQ4 A;  5LOM A;  2P0S A;  3OO9 A;  1JEU A;  1SD3 A;  4LZ5 A;  4ELO A;  3BBR A;  1XHY A;  2QS1 A;  4MLV A;  1OLA A;  1Y4C A;  4BDO A;  3EF7 A;  3M3K A;  5DVF A;  4LQ5 A;  1ZKB A;  1A55 A;  3HPI A;  1A99 A;  4POX A;  3TQW A;  4TLL B;  2DQV A;  1IEJ A;  1M5D A;  3U94 A;  1Y1M A;  2D3I A;  4FED A;  4C0R A;  3CFZ A;  2I0C A;  4GD5 A;  4PE5 B;  4U22 A;  5BUU A;  3PPN A;  4LON B;  3FVO A;  3KN3 A;  4MH5 A;  3O6G A;  1ZTY A;  4LAT A;  1B3H A;  2Z22 A;  1AH5 A;  3KGC A;  2DSF A;  3ZSF A;  2OLB A;  2OCU A;  3KN8 A;  1Q35 A;  3TMG A;  3DLN A;  5KDT B;  3GLB A;  4GFR A;  1B52 A;  1B5H A;  1AOV A;  1POT A;  1SI0 A;  1JW4 A;  4G4P A;  1VR5 A;  3T22 A;  2DWH A;  4WED A;  2Q9T A;  4EXK A;  1OLC A;  1LAG E;  3CRB A;  4G8N A;  5KZT A;  5A5X A;  5H8Q A;  4NF6 B;  1B7Z A;  4H8J A;  4ZS9 A;  3RT6 B;  3H6V A;  5AA2 D;  4AB5 A;  3MBP A;  4IGT A;  3FUZ A;  3DP4 A;  4EXL A;  2CZL A;  5KDT A;  4O3A A;  5ITP A;  2V3Q A;  5CRY A;  4JB7 A;  4RJZ A;  3LBS A;  3U92 A;  1FTJ A;  3QK6 A;  4QFL A;  1GV8 A;  4BDR A;  3OEK A;  1TFA A;  4YKJ A;  2VGQ A;  3SER A;  4UAC A;  1Z7M E;  3UOR A;  1YAE A;  2A5T A;  1N3X A;  4NF6 A;  4P0I A;  2ONS A;  4KD5 A;  3MPK A;  1NNP A;  1JVX A;  3TOD A;  4KCD A;  4HS7 A;  3TFL A;  3ILU B;  3JV9 A;  1QKB A;  3MUQ A;  4G68 A;  2HCA A;  4YIC A;  1FTO A;  2VP1 A;  3OMB A;  2DXR A;  4QFO A;  4ZEI A;  4H6D A;  4QHQ A;  3UGW A;  3ZKK A;  2XXW A;  3IJO B;  4TQU Q;  3O2A A;  4ELP A;  2PX1 A;  3GXA A;  2UVI A;  4MFI A;  3E4R A;  5ISU A;  5K2Y A;  3KJ7 A;  3IJX B;  1NKX A;  3IB0 A;  1MXV A;  2O69 A;  3MW0 A;  1EZ9 A;  1LAH E;  3G3K A;  2OK2 A;  1NFT A;  4GL0 A;  4FAJ A;  2XXY A;  3T9V A;  2XHD A;  2UVJ A;  3Q26 A;  2YJP A;  4EQ9 A;  3VV5 A;  4XXU A;  1MH3 A;  2O1M A;  4U4S A;  4EDP A;  5IKB A;  4O3C A;  3TDJ A;  3C4M A;  3KZG A;  3TTL A;  1MQD A;  4NTL A;  1GTK A;  1P1W A;  4GWO A;  4DE8 A;  1IIW A;  3QXM A;  2XXX A;  3BKI B;  3FAT A;  1URD A;  2VD3 A;  5FHO A;  3K6V A;  3PU5 A;  4E0W A;  2B65 A;  1B4H A;  1T0K A;  1VFE A;  3O9P A;  5H8N B;  1URG A;  3SEU A;  2AYS A;  4IO4 A;  3D4C A;  1FTK A;  1LBC A;  4U23 A;  3T96 B;  2UXA A;  1J1N A;  3Q27 A;  4YAH X;  3K1M A;  4XTC Q;  5I58 B;  3WAE A;  2ABH A;  1A54 A;  4G77 A;  3FJG A;  4NE4 A;  2HXW A;  1NMU A;  4YMA A;  5CBR A;  4RNS A;  2FNC A;  3FXQ A;  4NF4 A;  3T9U A;  4NWC A;  3UA8 A;  3G3H A;  4DIG A;  1A7L A;  1UTH B;  3PUY E;  4TLM B;  2F78 A;  3TAJ A;  3PPP A;  2O7U A;  1FQF A;  3CFX A;  2E1S A;  3MVZ A;  4G2Z A;  2I49 A;  3O6I A;  1WOD A;  4JXI A;  3U93 A;  4LA9 A;  4Q5T A;  4OER A;  3FV2 A;  4NED A;  4GL8 A;  3N26 A;  5I58 A;  1MQI A;  4X1B A;  2ESN A;  2H9B A;  3PMV A;  2VD2 A;  5CMB A;  2UYF A;  4R6K A;  3K00 A;  1POY 1;  4RA1 A;  4ZEB A;  3S9N C;  3O66 A;  1QW0 A;  4Q8R A;  3PPR A;  5H8H B;  5JTY B;  4KR5 A;  4YU0 A;  5TPA B;  5TU0 A;  1ATG A;  4I9D A;  1B4Z A;  1B6H A;  4EQB A;  1OVB A;  3PGF A;  1EZO A;  4QFP A;  2LAO A;  5CC2 A;  4QRZ A;  2XXU A;  4BDL A;  3CFL A;  4JWX A;  3VVD A;  2QJE A;  4YKI A;  3VVE A;  1Y3N A;  5L9O A;  3IB2 A;  3H6U A;  4OFO A;  4R6Y A;  1NL5 A;  1I6Q A;  1MY0 A;  1M5B A;  3QYT A;  4KYD A;  4LQ2 A;  2Q2C A;  5H8H A;  4G8M A;  5JTY A;  3Q29 A;  2QSX A;  1MPD A;  1HSL A;  4X9T A;  1TFD A;  1JVY A;  2REJ A;  3RUM A;  3T9X B;  3C9H A;  4THI A;  4H5G A;  2VOZ A;  5FTI A;  2OBG A;  2H98 A;  1D4N A;  3K01 A;  2F8D A;  3VXC A;  5I56 B;  1BIY A;  1Y9U A;  1LFI A;  3RTW B;  3HO7 A;  1N7W A;  3GZG A;  3SEV A;  2I3W A;  1OQH A;  3W15 C;  1RKM A;  4U1Z A;  4RYA A;  4NF5 B;  3EPE A;  1YTV A;  5AA2 B;  2I4B A;  2H25 A;  2V93 A;  2V3U A;  3K1N A;  1MQG A;  3MP6 A;  2RF1 A;  3IAZ A;  4KPT A;  4KCC A;  4DXU A;  1MY2 A;  1O64 A;  4RPN A;  4ZZA A;  1FQC A;  3USD A;  4Q30 B;  5HPQ A;  1NNT A;  1CB6 A;  4GIZ A;  3S9M C;  1MS7 A;  2YPN A;  2V3T A;  3MJN A;  1P1N A;  3G3J A;  5DEX B;  3PD8 A;  1DTZ A;  1SDX A;  1US5 A;  3IB1 A;  3TUS A;  3C31 A;  1XOC A;  1RYO A;  4QFN A;  3FIR A;  1D9V A;  2PT2 A;  3VLU A;  3RN8 A;  2Q89 A;  1ZMG A;  5L9M A;  1MQH A;  3V8X B;  4NF5 A;  1Y3P A;  5H8S A;  1TWY A;  2PBW A;  1XVX A;  1M5C A;  1N0T A;  4IB2 A;  3UN6 A;  4ZE9 A;  4KYE A;  3FXU A;  4ONY A;  1SYI A;  3K02 A;  2PMS A;  2AL5 A;  1XC1 A;  3SDF A;  5DVJ A;  3ZS6 A;  4C1U A;  3HN0 A;  3OD7 A;  1B9J A;  3P7I A;  2GHA A;  1BP5 A;  3H06 B;  4GOT A;  4EQ7 A;  2WKY A;  1MY1 A;  4RK9 A;  5AA4 B;  4GXA A;  1M5E A;  3O29 A;  5I2N A;  2P2A A;  2QS4 A;  1JNF A;  3TEP A;  4MBP A;  2PVU A;  2NXO A;  1B7H A;  4OEN A; 
#chains in the Genus database with same CATH topology
 3O28 A;  3TTK A;  2Q88 A;  1B0L A;  1LAF E;  2D5W A;  3IR1 A;  1JET A;  1FBG A;  2O7I A;  2I6E A;  2R6G E;  2DE2 A;  4OFL A;  4FJP A;  3C32 A;  3RPL B;  5J1D A;  1RDZ A;  5DYH A;  1B51 A;  4H67 A;  1GR2 A;  3H3G A;  5AA4 A;  3VVF A;  3FXB A;  1FPB A;  4F22 A;  4YB5 A;  2ANJ A;  4R2F A;  1IIT A;  1LCT A;  4R9G A;  3KBZ A;  4RY1 A;  1BKA A;  3S9L C;  4P11 A;  4I62 A;  1UTB B;  4PAF A;  2O6A A;  1VE4 A;  4N6D A;  2ZNU A;  1JW5 A;  4OAN A;  5ITO A;  2X7Q A;  3CG3 A;  3S9E A;  1USY H;  3EHS A;  1UIV A;  2V25 A;  4LUB A;  4OMB A;  5EHS A;  1B05 A;  2A5S A;  4KHZ E;  4DDD A;  3RY3 A;  2Y7W A;  1D9Q A;  2NOO A;  4JDF A;  5H8F B;  1MQJ A;  4NWD A;  2HEU A;  1A8E A;  4PFT A;  1DMB A;  4MF3 A;  1H45 A;  4U21 A;  3EN3 A;  4N91 A;  3G3F A;  1MRP A;  3H7M A;  3VXB A;  1MM7 A;  1MXX A;  4GXS B;  4HCY A;  3MZ1 A;  2OWZ A;  4GX3 A;  4OXV A;  3TTM A;  4MLQ A;  3U65 A;  3A3U A;  4JSD A;  4N17 A;  4YMB A;  3UIF A;  2Z8E A;  5IZ3 B;  3K0V A;  2O51 A;  3BFU A;  2OX3 A;  1DPE A;  1XI6 A;  3M8U A;  1B2H A;  4GBW A;  3G3G A;  3JZJ A;  4OVQ A;  3FXR A;  3RQT A;  5H8F A;  1A40 A;  1B3F A;  1LFG A;  1ZLQ A;  2Q74 A;  4N6K A;  3SEX A;  3R6U A;  4OVS A;  2I4C A;  1OMP A;  3O6H A;  1FQA A;  4QFK A;  4DLD A;  4MNP A;  4HE1 A;  2GFE A;  3KFM A;  1Q1K A;  3B8B A;  3QAX A;  2ZZV A;  3TCF A;  2CZK A;  3MZB A;  1LAX A;  2VPO A;  1UIU A;  5IAI A;  2XXQ A;  1YYZ A;  4PFW A;  4QF9 A;  5IZ3 A;  5I2K B;  3OXN A;  1O7T A;  1GGG A;  1FTL A;  3V89 B;  2XD2 A;  4R75 A;  4U1O A;  4C1T A;  1SW5 A;  3PUW E;  1MY4 A;  2B3B A;  3FGS A;  2H5Y A;  3KJT A;  1B1X A;  4NQ8 A;  5CI5 A;  3IO4 A;  3CSB A;  5DT6 A;  4IO6 A;  3PUV E;  2XXH A;  2XX7 A;  4EUO A;  3PMX A;  4ELR A;  5F7V A;  3E79 A;  4BDN A;  1AL3 A;  5EYF A;  5TP9 B;  3L6H A;  4U2R A;  3W9V A;  1PB8 A;  1SI1 A;  4L17 A;  1OQG A;  3S4U A;  3U8Q A;  4LVQ A;  3U1O A;  1G0I A;  1IXC A;  4KYS A;  5I84 A;  3IFA A;  4HCW A;  2DWJ A;  2AL4 A;  1YPN A;  1MG1 A;  2P1S A;  4QSD A;  3TKD A;  4OWD A;  5EHM A;  5CM6 A;  3VLV A;  2CEX A;  3M3F A;  3OO6 A;  4M4G A;  2ZYK A;  1B3E A;  1VFD A;  1FW0 A;  4PET A;  5B7D A;  3T93 B;  4LZ7 A;  1S9T A;  3N94 A;  3TPA A;  1LBX A;  1ZIU A;  2QRY A;  4WEP A;  5TP9 A;  1LFH A;  4PTK A;  4HTG A;  2NWJ A;  4F31 B;  4POW A;  4XKQ A;  1KA0 A;  3K4U A;  1IXG A;  3H03 A;  1A8F A;  1QVS A;  4BLA A;  1NV2 A;  5CMC A;  1G0H A;  2FHY A;  4AS5 A;  3IOU A;  3VDF A;  4PGN A;  4ZZE A;  4P3L A;  4YB6 A;  1ELJ A;  1BTJ A;  3DEL B;  1SYH A;  3QUJ A;  2RCB A;  5H8N A;  1UQW A;  4DI3 D;  1IXI A;  4NX1 A;  3FVN A;  4G61 A;  2HAU A;  1R9Q A;  3PPQ A;  3TYH A;  4N15 A;  4PF8 A;  3QSL A;  4N8Y A;  3EKI A;  3KOT A;  4IY6 A;  1IZ1 A;  2X26 A;  1YXI A;  2F34 A;  3RGY A;  2F3B A;  3B7D A;  1P1O A;  4HW8 A;  3BFT A;  4AB6 A;  4I1D A;  2ZMB A;  3RPW A;  1FCK A;  1NNK A;  3MAM A;  2I48 A;  2F36 A;  4OES A;  4PE3 A;  5HM4 B;  3ZKL A;  5AA3 A;  2B3F A;  4PFI A;  4ZE8 A;  2XD3 A;  1UTH A;  2GHB A;  3HST A;  3GYY A;  4R9F A;  3LUY A;  3I3V A;  5K2X A;  5ICQ A;  2ONK E;  4ELQ A;  1B32 A;  4KFQ A;  1MDQ A;  1FPG A;  2OWT A;  1Z7N E;  1P99 A;  3FAS A;  1SQY A;  4XEQ A;  3BIH A;  5CMM A;  2ALU A;  3SZP A;  4WXJ A;  3HHF A;  2FA7 A;  1LLS A;  4EF1 A;  5IZZ A;  4MIJ A;  4OVP A;  4I3E A;  2GH9 A;  2DS9 A;  1II5 A;  4PFY A;  1MXY A;  2RC7 A;  4H0W A;  4OQO A;  1LB9 A;  5TPA A;  4F3B A;  4JWO A;  1JW1 A;  1WDN A;  4FAT A;  4WKM A;  4HE0 A;  3KEI A;  1DTG A;  1D3K A;  3D4G A;  1BK4 A;  4KXP A;  1NV4 A;  1O63 A;  3GBB A;  1H76 A;  1MM6 A;  2Y7P A;  3N6T A;  3KOS A;  1URS A;  4NF8 B;  3FZV A;  3CSG A;  4JVC A;  4FOR A;  2XXI A;  3GBA A;  2IEE A;  1MDP 1;  1FQB A;  5DTB A;  4X1D A;  3RLF E;  4LP2 B;  1FBP A;  4JSO A;  3VE1 B;  2PCR A;  4JBZ A;  5FHM A;  2F7C A;  3CR9 A;  3N6U A;  3B6T A;  4MCO A;  4ZEC A;  1NV0 A;  5I7I A;  4K3F A;  2Z23 A;  3PUZ E;  2F97 A;  4KI0 E;  2L5V A;  1QUJ A;  3DM0 A;  5ET7 A;  3IOW A;  2F3D A;  4Z7E A;  3KSX A;  3LSX A;  4JWY A;  4G8H A;  3M3L A;  2OJT A;  5T3J A;  5I56 A;  1QJM A;  2P3V A;  2G29 A;  4NF8 A;  3TCH A;  1WVJ A;  4YB7 A;  3LSF B;  4ZDM A;  3A09 A;  3RTF B;  3EHT A;  3FV1 A;  2UYE A;  1N76 A;  3C34 A;  4NMY A;  2Z8F A;  5I59 B;  1NUW A;  1NH7 A;  1SBP A;  4OTE A;  4F3P A;  2YLN A;  3LC8 A;  1LST A;  5AA2 A;  2B4M A;  2UVG A;  5DW8 A;  2O1L A;  2O84 X;  4FBP A;  4O3B A;  3PMW A;  2ZNT A;  4EF2 A;  2H4I A;  2QMX A;  2RKM A;  1H44 A;  4BDM A;  5EYG A;  2F6P A;  4OA4 A;  4IY5 A;  2ZYO A;  3ECR A;  5DVI A;  1S7Y A;  1S50 A;  1B1H A;  5DEX A;  3C36 A;  2XX9 A;  3HCQ A;  4P56 A;  4RPO A;  1Y3Q A;  4FIM A;  2RCA A;  2XXV A;  5ET8 A;  1FBD A;  1M5F A;  4R6H A;  1FQE A;  4NHB A;  3B6W A;  3I6V A;  3KN7 A;  3B6Q A;  3ILT B;  3O97 A;  2Q8M A;  5ICT A;  1AIV A;  5IGA A;  3TZA A;  1NH8 A;  1L5T A;  3S2V A;  2OWS A;  4UA8 A;  2HHM A;  2ZNS A;  1NV1 A;  3OEL A;  3MVW A;  3KC0 A;  4U4X A;  2WYK A;  1P1Q A;  4XKP A;  1CNQ A;  2F5X A;  4NF0 A;  5B70 A;  4GWZ A;  4GBV A;  4F2O A;  4N6P A;  4OVJ A;  4YZZ A;  5HBC A;  4PBQ A;  1RYX A;  2Y7R A;  1K9Z A;  1MXW A;  1I69 A;  5A5X B;  5H8Q B;  3SKP A;  1PBQ A;  3THI A;  2NVU B;  2DVC A;  2UVH A;  4ZEK A;  2DWA A;  2Y7K A;  3T66 A;  3U72 A;  3E9X A;  2XWK A;  3DP6 A;  3G7W A;  4LZ8 A;  3K6W A;  2F7B A;  3MP8 A;  5JEI A;  3MYU A;  3Q25 A;  4HE2 A;  5LTC A;  1QUL A;  1FPK A;  2QL3 A;  4OVR A;  3OEM A;  1NV6 A;  4PQJ A;  4F1V A;  3RPL A;  3LR1 A;  3IK6 B;  5EQ9 A;  3K2D A;  1XS5 A;  2XXT A;  2KLF A;  2XX8 A;  2DP8 A;  4Q0C A;  2H99 A;  2HZL A;  3EHU A;  5I3S A;  1SW1 A;  3H6T A;  2A5T B;  3TQL A;  1UTB A;  3KSJ A;  5A5L A;  3C33 A;  4P9K A;  3E13 X;  4IO3 A;  4BDQ A;  4MNC A;  1PDA A;  4PP0 A;  3N5L A;  3OEN A;  1R1N A;  1LBV A;  5ELV A;  1IXH A;  4G68 B;  3OOA A;  4DZ1 A;  5I5P A;  4GRK A;  1MPB A;  3CG1 A;  1IQ7 A;  5ET6 A;  1QUK A;  4IO7 A;  3K1P A;  2ZYN A;  1EZP A;  1LBW A;  4F29 A;  1FPE A;  2IA4 A;  5ESY A;  4GWS A;  3LUZ A;  5F1Q A;  4Z0I A;  1MPC A;  2BJJ X;  3IOT A;  3UK4 A;  1K9Y A;  4IR8 A;  3MVY A;  2ZXT A;  2QMW A;  1MY3 A;  4H46 A;  5L8D A;  3FBP A;  1F9B A;  1TXF A;  1PBP A;  3PPO A;  4N07 A;  2R9J A;  1IUD A;  2I0B A;  4F2Q A;  4I8C A;  4GVO A;  2R71 A;  5I57 B;  1CE2 A;  2F7A A;  3F11 A;  1SVX B;  4R74 A;  5FTH A;  2OZZ A;  1FTM A;  3LV0 A;  4R73 A;  1EH3 A;  4X8R A;  5CMK A;  3PTY A;  4OZ9 A;  2QS3 A;  1YCJ A;  5IZ1 A;  2DE4 A;  3V5A A;  2CZH A;  4NGU A;  1HSJ A;  4F1Y A;  1HSE A;  1N7X A;  1QKA A;  4MAG A;  2AIX A;  2DE3 A;  3MPL A;  1MH4 A;  4P1L A;  4KQP A;  1LGB C;  2Q2A A;  3RT8 A;  2MKZ A;  1KWH A;  3H6W A;  4OVT A;  5I2K A;  3R7X A;  1I6B A;  2FYI A;  4OEU A;  5M2V A;  1LCF A;  5I57 A;  2FIE A;  4O8M A;  4H1X A;  1N04 A;  5LDZ A;  4PDH A;  2NUV A;  4MHF A;  1FPD A;  1MXZ A;  4R2B A;  4DCY A;  3Q28 A;  1PB9 A;  4GLI A;  3PV0 E;  1US4 A;  2G93 A;  4PFU A;  3VFJ A;  1XT8 A;  4NF4 B;  1B3L A;  1N3W A;  4QSE A;  3CHG A;  4IO5 A;  4F3G A;  1JQF A;  4LN5 A;  5AE4 A;  2CMO A;  2E0S A;  5JK4 A;  1B46 A;  1P1U A;  5BWJ A;  3QUF A;  1AMF A;  3W9W A;  1H43 A;  5KCJ B;  1Y1Z A;  2FVZ A;  3FJ7 A;  4FE8 A;  1ZU0 A;  3CI8 A;  3T0J A;  3EQ1 A;  2Z8D A;  3ODB A;  4GWY A;  1RDY A;  2GRV A;  1LBB A;  5CBS A;  4DXB A;  4GF8 A;  2W7Y A;  4H65 A;  3IL1 B;  1NUX A;  1QUI A;  1SW4 A;  3MC2 A;  1XVY A;  3FD3 A;  4HXV A;  1B3G A;  1DOT A;  2F35 A;  3LSW A;  2VPN A;  2F6G A;  2DWI A;  3TTN A;  4N13 A;  2Y7I A;  2DVZ A;  1OIB A;  1NUY A;  2HZK A;  2O68 A;  3SEY A;  3V83 A;  4TOZ A;  2VT5 A;  3VLW A;  1ZBM A;  3G3I A;  5KCJ A;  1NNF A;  1Y4T A;  4H45 A;  3MWB A;  4P0G A;  3H4Z A;  4FEB A;  3UP9 A;  3OSR A;  3MVX A;  3PUX E;  4QSC A;  4ZEF A;  2QS2 A;  2PT1 A;  3IX1 A;  4PF6 A;  3CIJ A;  3TEL A;  3MP1 A;  1ZJL A;  3HV1 A;  4I3Y A;  4RK2 A;  2WX9 A;  4FEC A;  1FQD A;  4R72 A;  4E0X A;  2ZYM A;  1B58 A;  1FTA A;  1OVT A;  4H8I A;  2I58 A;  2P3N A;  2ZZW A;  3HHG A;  4ZED A;  3MQ9 A;  4DXC A;  1PC3 A;  3MZ9 A;  1I6A A;  3OSQ A;  1IMA A;  3TCG A;  3IOR A;  1FBE A;  3R26 A;  3IO6 A;  4M1V A;  3JYR A;  4XKR A;  3DP8 A;  1B5J A;  1USY E;  1JEV A;  1GVC A;  4ESW A;  2ONR A;  3I5O A;  3OO8 A;  3L6G A;  3RNN A;  2THI A;  3SES A;  2Y84 A;  3ONM A;  1LBY A;  3SEW A;  1MXU A;  4OFJ A;  4IO2 A;  4YKK A;  4H5F A;  4ISU A;  1NV7 A;  3IFC A;  5FHN A;  1DPP A;  1D9Y A;  1Y20 A;  4F39 A;  1B7U A;  4OEV A;  1B40 A;  2DXY A;  4GQO A;  5L9S A;  1SW2 A;  1PB7 A;  5IM2 A;  2PFZ A;  2Q8J A;  2D21 A;  3AXF A;  2V84 A;  1INP A;  3TTR A;  2HFB A;  2HQ0 A;  1BLF A;  3QIM A;  1FPI A;  1NV3 A;  4OYV A;  3PD9 A;  5AA1 A;  1PEB A;  4O94 A;  4ESX A;  2REG A;  4DCX A;  2KQZ A;  2PYY A;  3FVK A;  1IMB A;  3KBR A;  4XKN A;  4ECF A;  2VHA A;  3LSL A;  3FVG A;  3SET A;  4X48 A;  2Y5K A;  3K6X A;  2RC8 A;  5J16 A;  3FJM A;  3WAF A;  4F1U A;  1ANF A;  2WYP A;  1FBC A;  3T9H B;  4RXL A;  3KG2 A;  3K6U A;  3OO7 A;  4OHN A;  2KR0 A;  1IMF A;  2X7P A;  1VSO A;  3CVG A;  4UAB A;  4XIG Q;  2XXR A;  5F24 A;  4F19 A;  3IOV A;  1N84 A;  1TT1 A;  4YKP A;  2HAV A;  1DSN A;  4ND9 A;  4P1E A;  4PDD A;  1H3D A;  2DOJ A;  3E3K A;  4PC9 A;  2RIN A;  1R6Z A;  1B5I A;  4IGR A;  1LB8 A;  5I2N B;  4F3S A;  2DYX A;  5EQ8 A;  2XXP A;  1R9L A;  3C35 A;  4OET A;  1B0H A;  2M8C A;  2XWO A;  4PCD A;  1EU8 A;  2I3V A;  5EYH A;  3A3C A;  2XWI A;  5I59 A;  4F18 A;  2QPQ A;  4QBA A;  4G68 C;  2RC9 A;  4AQ4 A;  5LOM A;  2P0S A;  3OO9 A;  1JEU A;  1SD3 A;  4LZ5 A;  4ELO A;  3BBR A;  1XHY A;  4PAI A;  2QS1 A;  4MLV A;  5FBP A;  1OLA A;  1Y4C A;  4BDO A;  3EF7 A;  3B50 A;  3M3K A;  5DVF A;  4LQ5 A;  5EQ7 A;  1ZKB A;  1A55 A;  3HPI A;  1A99 A;  4POX A;  2V4C A;  3MST A;  4P8B A;  3TQW A;  4TLL B;  2DQV A;  1IEJ A;  1DBZ A;  1M5D A;  3U94 A;  1Y1M A;  2D3I A;  4FED A;  4C0R A;  3CFZ A;  2I0C A;  4GD5 A;  3A29 A;  2Y5L A;  4PE5 B;  4U22 A;  5BUU A;  3PPN A;  4LON B;  3FVO A;  3KN3 A;  4MH5 A;  3O6G A;  1ZTY A;  4LAT A;  1B3H A;  2Z22 A;  1AH5 A;  3KGC A;  2DSF A;  3ZSF A;  2OLB A;  4GWU A;  3KC1 A;  2OCU A;  3KN8 A;  1Q35 A;  1QGX A;  3TMG A;  3DLN A;  5KDT B;  3GLB A;  4GFR A;  1B52 A;  1LEV A;  1B5H A;  1AOV A;  1POT A;  3ISP A;  1SI0 A;  1JW4 A;  2B4L A;  4G4P A;  4JVD A;  1VR5 A;  3T22 A;  2DWH A;  4WED A;  2Q9T A;  4EXK A;  1OLC A;  1LAG E;  3CRB A;  1FBH A;  2QVU A;  4PBH A;  4O7I A;  4G8N A;  1NI9 A;  5KZT A;  2FIX A;  5A5X A;  5H8Q A;  4MJO A;  4NF6 B;  2JJK A;  1B7Z A;  3BIG A;  4H8J A;  4ZS9 A;  1FRP A;  3RT6 B;  3H6V A;  5AA2 D;  4AB5 A;  2QFL A;  1EYI A;  3MBP A;  4IGT A;  3FUZ A;  3DP4 A;  4EXL A;  2CZL A;  5KDT A;  4O3A A;  5ITP A;  2V3Q A;  4PFB A;  2WBD A;  5CRY A;  4JB7 A;  4RJZ A;  3LBS A;  3U92 A;  2CEY A;  1FTJ A;  3QK6 A;  4QFL A;  1GV8 A;  2HPG A;  4BDR A;  3OEK A;  1TFA A;  4YKJ A;  4O7M A;  2VGQ A;  3RYD A;  5ET5 A;  1FJ6 A;  3SER A;  1SPI A;  4UAC A;  1Z7M E;  3UOR A;  1YAE A;  2A5T A;  1N3X A;  4NF6 A;  4QXD A;  4P0I A;  2ONS A;  4KD5 A;  3MPK A;  1NNP A;  1JVX A;  4HS7 A;  4KCD A;  3TOD A;  3TFL A;  3ILU B;  3JV9 A;  1QKB A;  4XFE A;  1FPJ A;  3MUQ A;  4G68 A;  2HCA A;  4YIC A;  1FTO A;  1EYK A;  2VP1 A;  3OMB A;  1JP4 A;  2DXR A;  1IME A;  4QFO A;  4ZEI A;  4H6D A;  4QHQ A;  3UGW A;  3ZKK A;  2XXW A;  3IJO B;  4TQU Q;  3O2A A;  1YZ0 A;  4ELP A;  1FPL A;  2PX1 A;  3GXA A;  2UVI A;  4MFI A;  3E4R A;  5ISU A;  5K2Y A;  3KJ7 A;  3IJX B;  1NKX A;  3IB0 A;  1MXV A;  2O69 A;  3MW0 A;  1EZ9 A;  1LAH E;  3G3K A;  2OK2 A;  1NFT A;  4GL0 A;  4FAJ A;  2XXY A;  3T9V A;  2XHD A;  2UVJ A;  3Q26 A;  2YJP A;  4EQ9 A;  3VV5 A;  4XXU A;  1FSA A;  1MH3 A;  2O1M A;  4U4S A;  4EDP A;  5IKB A;  4O3C A;  3TDJ A;  2WEF A;  3C4M A;  3KZG A;  3TTL A;  1MQD A;  4NTL A;  1GTK A;  1P1W A;  4GWO A;  4DE8 A;  1IIW A;  3QXM A;  2XXX A;  3BKI B;  3FAT A;  1URD A;  2VD3 A;  5FHO A;  3K6V A;  3PU5 A;  3QMF A;  4E0W A;  2B65 A;  1EYJ A;  4XF5 A;  1B4H A;  1T0K A;  1VFE A;  3O9P A;  1KZ8 A;  5H8N B;  1URG A;  3SEU A;  2AYS A;  4IO4 A;  3D4C A;  3NOH A;  4MMP A;  1FTK A;  1LBC A;  4U23 A;  3T96 B;  2UXA A;  1J1N A;  4GWW A;  1DK4 A;  3Q27 A;  4YAH X;  5EQA A;  3K1M A;  2HXR A;  4XTC Q;  4JVI A;  5I58 B;  3WAE A;  2ABH A;  1A54 A;  4G77 A;  3FJG A;  4NE4 A;  2HXW A;  2DDK A;  4MEV A;  1NMU A;  4YMA A;  5CBR A;  4RNS A;  2BJI A;  2FNC A;  3FXQ A;  4NF4 A;  3T9U A;  4NWC A;  3UA8 A;  3G3H A;  4DIG A;  1A7L A;  1UTH B;  3PUY E;  4TLM B;  2F78 A;  3TAJ A;  3PPP A;  2O7U A;  1FQF A;  3CFX A;  4NAP A;  2E1S A;  3MVZ A;  4G2Z A;  2I49 A;  3O6I A;  1WOD A;  4JXI A;  3U93 A;  4LA9 A;  4Q5T A;  4OER A;  3FV2 A;  4NED A;  4GL8 A;  3N26 A;  5I58 A;  2R8T A;  1MQI A;  4X1B A;  2ESN A;  2H9B A;  3PMV A;  2VD2 A;  5CMB A;  2UYF A;  4R6K A;  4I40 A;  3K00 A;  3HFU A;  1POY 1;  4RA1 A;  4ZEB A;  3S9N C;  3O66 A;  1QW0 A;  4Q8R A;  3PPR A;  5H8H B;  5JTY B;  4KR5 A;  3ROJ A;  4YU0 A;  5TPA B;  5TU0 A;  1ATG A;  4I9D A;  1B4Z A;  1B6H A;  2ZZX A;  2PFY A;  4EQB A;  1OVB A;  3PGF A;  1EZO A;  4NN3 A;  4QFP A;  2LAO A;  5CC2 A;  4QRZ A;  2XXU A;  4BDL A;  3CFL A;  4N4U A;  4JWX A;  3VVD A;  2QJE A;  4YKI A;  3VVE A;  1Y3N A;  5L9O A;  3IB2 A;  3H6U A;  4OFO A;  4R6Y A;  4PFR A;  4PAK A;  1DCU A;  1NL5 A;  4N8G A;  1KA1 A;  1I6Q A;  1MY0 A;  1M5B A;  3QYT A;  4KYD A;  4LQ2 A;  2Q2C A;  5H8H A;  4G8M A;  1Q9D A;  5JTY A;  3Q29 A;  2QSX A;  1MPD A;  1HSL A;  4X9T A;  1TFD A;  1JVY A;  2REJ A;  3RUM A;  3T9X B;  3C9H A;  4THI A;  4H5G A;  2VOZ A;  5FTI A;  2OBG A;  2H98 A;  1D4N A;  3K01 A;  2F8D A;  2QVR A;  3VXC A;  1NUZ A;  5I56 B;  1BIY A;  1RDX A;  1Y9U A;  1LFI A;  3RTW B;  3HO7 A;  1N7W A;  3GZG A;  3SEV A;  2I3W A;  1OQH A;  2WBB A;  2XA5 A;  3W15 C;  1RKM A;  1AWB A;  2XWV A;  4U1Z A;  4RYA A;  4X04 A;  4NF5 B;  3D1R A;  1YTV A;  3EPE A;  3T1B A;  5AA2 B;  2I4B A;  2H25 A;  2V93 A;  2V3U A;  3K1N A;  1MQG A;  3MP6 A;  2RF1 A;  4P47 A;  2CZI A;  3IAZ A;  2FBP A;  4KPT A;  4KCC A;  4DXU A;  1MY2 A;  1O64 A;  4RPN A;  4ZZA A;  1FQC A;  3USD A;  4Q30 B;  5HPQ A;  1NNT A;  1CB6 A;  4GIZ A;  3S9M C;  1MS7 A;  2YPN A;  2V3T A;  3MJN A;  1P1N A;  3G3J A;  5DEX B;  3PD8 A;  1DTZ A;  1SDX A;  1US5 A;  3IB1 A;  3TUS A;  3C31 A;  1XOC A;  1RYO A;  4GX6 A;  4QFN A;  3FIR A;  1D9V A;  2XXK A;  2PT2 A;  3VLU A;  3RN8 A;  2Q89 A;  1ZMG A;  5L9M A;  1MQH A;  3V8X B;  4NF5 A;  3E78 A;  1Y3P A;  5H8S A;  1TWY A;  2PBW A;  1XVX A;  1M5C A;  1N0T A;  1NV5 A;  4IB2 A;  3UN6 A;  2GQ1 A;  4ZE9 A;  4KYE A;  3FXU A;  1IMC A;  4ONY A;  1FJ9 A;  4N81 A;  1SYI A;  3K02 A;  2PMS A;  2AL5 A;  1XC1 A;  1FBF A;  3SDF A;  5DVJ A;  3ZS6 A;  4C1U A;  4PGP A;  3HN0 A;  3OD7 A;  4MX6 A;  4GX4 A;  1B9J A;  3P7I A;  2GHA A;  1BP5 A;  4GWX A;  3H06 B;  4GOT A;  4EQ7 A;  2WKY A;  1MY1 A;  4RK9 A;  4NG7 A;  5AA4 B;  4GXA A;  4MNI A;  1FPF A;  1M5E A;  1VDW A;  3O29 A;  4DI4 B;  1LBZ A;  5I2N A;  1IMD A;  2P2A A;  2QS4 A;  2QVV A;  1JNF A;  3TEP A;  4MBP A;  2PVU A;  2NXO A;  4AS4 A;  1B7H A;  4OEN A; 
#chains in the Genus database with same CATH homology
 3O28 A;  3TTK A;  2Q88 A;  1B0L A;  1LAF E;  2D5W A;  3IR1 A;  1JET A;  2O7I A;  2I6E A;  2R6G E;  2DE2 A;  4OFL A;  4FJP A;  3C32 A;  5J1D A;  5DYH A;  1B51 A;  4H67 A;  1GR2 A;  3H3G A;  5AA4 A;  3VVF A;  4F22 A;  4YB5 A;  2ANJ A;  4R2F A;  1IIT A;  1LCT A;  4R9G A;  4RY1 A;  1BKA A;  3S9L C;  4P11 A;  4I62 A;  1UTB B;  2O6A A;  1VE4 A;  2ZNU A;  1JW5 A;  5ITO A;  2X7Q A;  3CG3 A;  3S9E A;  1USY H;  3EHS A;  1UIV A;  2V25 A;  4LUB A;  4OMB A;  5EHS A;  1B05 A;  2A5S A;  4KHZ E;  4DDD A;  3RY3 A;  2Y7W A;  2NOO A;  4JDF A;  5H8F B;  1MQJ A;  4NWD A;  2HEU A;  1A8E A;  4PFT A;  1DMB A;  4MF3 A;  1H45 A;  4U21 A;  3EN3 A;  3G3F A;  1MRP A;  3H7M A;  3VXB A;  1MM7 A;  1MXX A;  4GXS B;  4HCY A;  3MZ1 A;  4OXV A;  3TTM A;  4MLQ A;  3A3U A;  4JSD A;  4YMB A;  3UIF A;  2Z8E A;  3K0V A;  2O51 A;  3BFU A;  1DPE A;  3M8U A;  1B2H A;  3G3G A;  3JZJ A;  3FXR A;  3RQT A;  5H8F A;  1A40 A;  1B3F A;  1LFG A;  1ZLQ A;  3SEX A;  3R6U A;  2I4C A;  1OMP A;  3O6H A;  1FQA A;  4QFK A;  4DLD A;  2GFE A;  3KFM A;  1Q1K A;  3QAX A;  3TCF A;  3MZB A;  1LAX A;  1UIU A;  5IAI A;  2XXQ A;  4PFW A;  4QF9 A;  5I2K B;  3OXN A;  1O7T A;  1GGG A;  1FTL A;  3V89 B;  2XD2 A;  4R75 A;  4U1O A;  4C1T A;  1SW5 A;  3PUW E;  1MY4 A;  2B3B A;  3FGS A;  2H5Y A;  3KJT A;  1B1X A;  5CI5 A;  3IO4 A;  3CSB A;  5DT6 A;  4IO6 A;  3PUV E;  2XXH A;  2XX7 A;  4EUO A;  3PMX A;  4ELR A;  5F7V A;  4BDN A;  1AL3 A;  5EYF A;  5TP9 B;  3L6H A;  4U2R A;  3W9V A;  1PB8 A;  1SI1 A;  4L17 A;  1OQG A;  3S4U A;  3U8Q A;  4LVQ A;  3U1O A;  1IXC A;  4KYS A;  5I84 A;  4HCW A;  2DWJ A;  2AL4 A;  1YPN A;  1MG1 A;  2P1S A;  4QSD A;  3TKD A;  4OWD A;  5EHM A;  5CM6 A;  3VLV A;  3M3F A;  3OO6 A;  4M4G A;  2ZYK A;  1B3E A;  1VFD A;  1FW0 A;  4PET A;  5B7D A;  3T93 B;  4LZ7 A;  1S9T A;  3N94 A;  3TPA A;  1ZIU A;  2QRY A;  4WEP A;  5TP9 A;  1LFH A;  4HTG A;  2NWJ A;  4F31 B;  4POW A;  4XKQ A;  3K4U A;  1IXG A;  3H03 A;  1A8F A;  1QVS A;  4BLA A;  5CMC A;  3IOU A;  3VDF A;  4ZZE A;  4YB6 A;  1ELJ A;  1BTJ A;  3DEL B;  1SYH A;  3QUJ A;  2RCB A;  5H8N A;  1UQW A;  1IXI A;  3FVN A;  2HAU A;  1R9Q A;  3PPQ A;  3TYH A;  3QSL A;  3KOT A;  4IY6 A;  1IZ1 A;  2X26 A;  2F34 A;  3RGY A;  3B7D A;  1P1O A;  4HW8 A;  3BFT A;  4AB6 A;  4I1D A;  2ZMB A;  3RPW A;  1FCK A;  1NNK A;  3MAM A;  2I48 A;  2F36 A;  4OES A;  5HM4 B;  3ZKL A;  5AA3 A;  2B3F A;  4ZE8 A;  2XD3 A;  1UTH A;  2GHB A;  3HST A;  4R9F A;  3LUY A;  3I3V A;  5K2X A;  5ICQ A;  2ONK E;  4ELQ A;  1B32 A;  4KFQ A;  1MDQ A;  2OWT A;  1Z7N E;  1P99 A;  3FAS A;  1SQY A;  5CMM A;  2ALU A;  4WXJ A;  3HHF A;  2FA7 A;  1LLS A;  4EF1 A;  2GH9 A;  2DS9 A;  1II5 A;  4PFY A;  1MXY A;  2RC7 A;  4H0W A;  4OQO A;  1LB9 A;  5TPA A;  4F3B A;  4JWO A;  1JW1 A;  1WDN A;  4FAT A;  4WKM A;  3KEI A;  1DTG A;  1D3K A;  3D4G A;  1O63 A;  3GBB A;  1H76 A;  1MM6 A;  2Y7P A;  3N6T A;  3KOS A;  1URS A;  4NF8 B;  3FZV A;  3CSG A;  4FOR A;  2XXI A;  3GBA A;  2IEE A;  1MDP 1;  1FQB A;  5DTB A;  4X1D A;  3RLF E;  4LP2 B;  4JSO A;  3VE1 B;  4JBZ A;  5FHM A;  2F7C A;  3CR9 A;  3N6U A;  3B6T A;  4ZEC A;  4K3F A;  2Z23 A;  3PUZ E;  2F97 A;  4KI0 E;  1QUJ A;  3DM0 A;  3IOW A;  4Z7E A;  3KSX A;  3LSX A;  4JWY A;  4G8H A;  3M3L A;  2OJT A;  5I56 A;  1QJM A;  2G29 A;  4NF8 A;  3TCH A;  1WVJ A;  4YB7 A;  3LSF B;  4ZDM A;  3A09 A;  3RTF B;  3EHT A;  3FV1 A;  2UYE A;  1N76 A;  3C34 A;  4NMY A;  2Z8F A;  5I59 B;  1NH7 A;  1SBP A;  4OTE A;  4F3P A;  2YLN A;  3LC8 A;  1LST A;  5AA2 A;  2UVG A;  2O1L A;  2O84 X;  4O3B A;  3PMW A;  2ZNT A;  4EF2 A;  2H4I A;  2QMX A;  2RKM A;  1H44 A;  4BDM A;  2F6P A;  4IY5 A;  2ZYO A;  3ECR A;  5DVI A;  1S7Y A;  1S50 A;  1B1H A;  5DEX A;  3C36 A;  2XX9 A;  3HCQ A;  4RPO A;  1Y3Q A;  4FIM A;  2RCA A;  2XXV A;  1M5F A;  4R6H A;  1FQE A;  3B6W A;  3I6V A;  3KN7 A;  3B6Q A;  3ILT B;  3O97 A;  5ICT A;  1AIV A;  3TZA A;  1NH8 A;  1L5T A;  3S2V A;  2OWS A;  4UA8 A;  2ZNS A;  3OEL A;  3MVW A;  4U4X A;  1P1Q A;  4XKP A;  2F5X A;  5B70 A;  4F2O A;  4N6P A;  4OVJ A;  4YZZ A;  5HBC A;  1RYX A;  2Y7R A;  1MXW A;  1I69 A;  5A5X B;  5H8Q B;  3SKP A;  1PBQ A;  3THI A;  2NVU B;  2DVC A;  2UVH A;  4ZEK A;  2DWA A;  2Y7K A;  3T66 A;  3U72 A;  3E9X A;  3DP6 A;  3G7W A;  4LZ8 A;  3K6W A;  2F7B A;  3MP8 A;  5JEI A;  3Q25 A;  1QUL A;  2QL3 A;  3OEM A;  4PQJ A;  4F1V A;  3LR1 A;  3IK6 B;  3K2D A;  1XS5 A;  2XXT A;  2KLF A;  2XX8 A;  2DP8 A;  4Q0C A;  2H99 A;  2HZL A;  3EHU A;  1SW1 A;  3H6T A;  2A5T B;  3TQL A;  1UTB A;  3KSJ A;  3C33 A;  3E13 X;  4IO3 A;  4BDQ A;  1PDA A;  4PP0 A;  3N5L A;  3OEN A;  1R1N A;  5ELV A;  1IXH A;  4G68 B;  3OOA A;  4DZ1 A;  4GRK A;  1MPB A;  3CG1 A;  1IQ7 A;  1QUK A;  4IO7 A;  3K1P A;  2ZYN A;  1EZP A;  4F29 A;  2IA4 A;  5F1Q A;  4Z0I A;  1MPC A;  2BJJ X;  3IOT A;  3UK4 A;  3MVY A;  2ZXT A;  2QMW A;  1MY3 A;  5L8D A;  1F9B A;  1TXF A;  1PBP A;  3PPO A;  4N07 A;  2R9J A;  1IUD A;  2I0B A;  4F2Q A;  4I8C A;  4GVO A;  2R71 A;  5I57 B;  1CE2 A;  2F7A A;  3F11 A;  1SVX B;  4R74 A;  5FTH A;  2OZZ A;  1FTM A;  4R73 A;  1EH3 A;  5CMK A;  4OZ9 A;  2QS3 A;  1YCJ A;  2DE4 A;  3V5A A;  1HSJ A;  4F1Y A;  1HSE A;  1N7X A;  1QKA A;  2AIX A;  2DE3 A;  3MPL A;  1MH4 A;  4KQP A;  1LGB C;  2Q2A A;  3RT8 A;  1KWH A;  3H6W A;  5I2K A;  3R7X A;  1I6B A;  2FYI A;  4OEU A;  5M2V A;  1LCF A;  5I57 A;  4H1X A;  1N04 A;  2NUV A;  1MXZ A;  4R2B A;  4DCY A;  3Q28 A;  1PB9 A;  4GLI A;  3PV0 E;  1US4 A;  2G93 A;  4PFU A;  3VFJ A;  1XT8 A;  4NF4 B;  1B3L A;  1N3W A;  4QSE A;  4IO5 A;  4F3G A;  1JQF A;  5AE4 A;  2CMO A;  2E0S A;  5JK4 A;  1B46 A;  1P1U A;  5BWJ A;  3QUF A;  1AMF A;  3W9W A;  1H43 A;  5KCJ B;  1Y1Z A;  3FJ7 A;  4FE8 A;  1ZU0 A;  3CI8 A;  3EQ1 A;  2Z8D A;  3ODB A;  2GRV A;  1LBB A;  5CBS A;  4DXB A;  4GF8 A;  2W7Y A;  4H65 A;  3IL1 B;  1QUI A;  1SW4 A;  3MC2 A;  1XVY A;  3FD3 A;  1B3G A;  1DOT A;  2F35 A;  3LSW A;  2F6G A;  2DWI A;  3TTN A;  4N13 A;  2Y7I A;  2DVZ A;  1OIB A;  2HZK A;  2O68 A;  3SEY A;  3V83 A;  4TOZ A;  3VLW A;  1ZBM A;  3G3I A;  5KCJ A;  1NNF A;  1Y4T A;  3MWB A;  4P0G A;  3H4Z A;  4FEB A;  3UP9 A;  3OSR A;  3MVX A;  3PUX E;  4QSC A;  4ZEF A;  2QS2 A;  2PT1 A;  3IX1 A;  3CIJ A;  3TEL A;  3MP1 A;  1ZJL A;  3HV1 A;  4RK2 A;  4FEC A;  1FQD A;  4R72 A;  4E0X A;  2ZYM A;  1B58 A;  1OVT A;  4H8I A;  2I58 A;  3HHG A;  4ZED A;  3MQ9 A;  4DXC A;  1PC3 A;  3MZ9 A;  1I6A A;  3OSQ A;  3TCG A;  3IOR A;  3R26 A;  3IO6 A;  4M1V A;  3JYR A;  4XKR A;  3DP8 A;  1B5J A;  1USY E;  1JEV A;  1GVC A;  4ESW A;  2ONR A;  3I5O A;  3OO8 A;  3L6G A;  3RNN A;  2THI A;  3SES A;  2Y84 A;  3ONM A;  3SEW A;  1MXU A;  4OFJ A;  4IO2 A;  4YKK A;  4H5F A;  4ISU A;  5FHN A;  1DPP A;  1D9Y A;  1Y20 A;  4F39 A;  1B7U A;  4OEV A;  1B40 A;  2DXY A;  4GQO A;  5L9S A;  1SW2 A;  1PB7 A;  2Q8J A;  2D21 A;  3AXF A;  2V84 A;  3TTR A;  2HFB A;  2HQ0 A;  1BLF A;  3QIM A;  4OYV A;  3PD9 A;  5AA1 A;  1PEB A;  4ESX A;  2REG A;  4DCX A;  2PYY A;  3FVK A;  3KBR A;  4XKN A;  4ECF A;  2VHA A;  3LSL A;  3FVG A;  3SET A;  4X48 A;  3K6X A;  2RC8 A;  3FJM A;  3WAF A;  4F1U A;  1ANF A;  3T9H B;  4RXL A;  3KG2 A;  3K6U A;  3OO7 A;  4OHN A;  2X7P A;  1VSO A;  3CVG A;  4XIG Q;  2XXR A;  4F19 A;  3IOV A;  1N84 A;  1TT1 A;  4YKP A;  2HAV A;  1DSN A;  4ND9 A;  1H3D A;  2DOJ A;  3E3K A;  2RIN A;  1R6Z A;  1B5I A;  4IGR A;  1LB8 A;  5I2N B;  4F3S A;  2DYX A;  2XXP A;  1R9L A;  3C35 A;  4OET A;  1B0H A;  2M8C A;  1EU8 A;  2I3V A;  3A3C A;  5I59 A;  4F18 A;  2QPQ A;  4G68 C;  2RC9 A;  4AQ4 A;  5LOM A;  2P0S A;  3OO9 A;  1JEU A;  1SD3 A;  4LZ5 A;  4ELO A;  3BBR A;  1XHY A;  2QS1 A;  4MLV A;  1OLA A;  1Y4C A;  4BDO A;  3EF7 A;  3M3K A;  5DVF A;  4LQ5 A;  1ZKB A;  1A55 A;  3HPI A;  1A99 A;  4POX A;  3TQW A;  4TLL B;  2DQV A;  1IEJ A;  1M5D A;  3U94 A;  1Y1M A;  2D3I A;  4FED A;  4C0R A;  3CFZ A;  2I0C A;  4GD5 A;  4PE5 B;  4U22 A;  5BUU A;  3PPN A;  4LON B;  3FVO A;  3KN3 A;  4MH5 A;  3O6G A;  1ZTY A;  4LAT A;  1B3H A;  2Z22 A;  1AH5 A;  3KGC A;  2DSF A;  3ZSF A;  2OLB A;  2OCU A;  3KN8 A;  1Q35 A;  3TMG A;  3DLN A;  5KDT B;  3GLB A;  4GFR A;  1B52 A;  1B5H A;  1AOV A;  1POT A;  1SI0 A;  1JW4 A;  4G4P A;  1VR5 A;  3T22 A;  2DWH A;  4WED A;  2Q9T A;  4EXK A;  1OLC A;  1LAG E;  3CRB A;  4G8N A;  5KZT A;  5A5X A;  5H8Q A;  4NF6 B;  1B7Z A;  4H8J A;  4ZS9 A;  3RT6 B;  3H6V A;  5AA2 D;  4AB5 A;  3MBP A;  4IGT A;  3FUZ A;  3DP4 A;  4EXL A;  2CZL A;  5KDT A;  4O3A A;  5ITP A;  2V3Q A;  5CRY A;  4JB7 A;  4RJZ A;  3LBS A;  3U92 A;  1FTJ A;  3QK6 A;  4QFL A;  1GV8 A;  4BDR A;  3OEK A;  1TFA A;  4YKJ A;  2VGQ A;  3SER A;  4UAC A;  1Z7M E;  3UOR A;  1YAE A;  2A5T A;  1N3X A;  4NF6 A;  4P0I A;  2ONS A;  4KD5 A;  3MPK A;  1NNP A;  1JVX A;  3TOD A;  4KCD A;  4HS7 A;  3TFL A;  3ILU B;  3JV9 A;  1QKB A;  3MUQ A;  4G68 A;  2HCA A;  4YIC A;  1FTO A;  2VP1 A;  3OMB A;  2DXR A;  4QFO A;  4ZEI A;  4H6D A;  4QHQ A;  3UGW A;  3ZKK A;  2XXW A;  3IJO B;  4TQU Q;  3O2A A;  4ELP A;  2PX1 A;  3GXA A;  2UVI A;  4MFI A;  3E4R A;  5ISU A;  5K2Y A;  3KJ7 A;  3IJX B;  1NKX A;  3IB0 A;  1MXV A;  2O69 A;  3MW0 A;  1EZ9 A;  1LAH E;  3G3K A;  2OK2 A;  1NFT A;  4GL0 A;  4FAJ A;  2XXY A;  3T9V A;  2XHD A;  2UVJ A;  3Q26 A;  2YJP A;  4EQ9 A;  3VV5 A;  4XXU A;  1MH3 A;  2O1M A;  4U4S A;  4EDP A;  5IKB A;  4O3C A;  3TDJ A;  3C4M A;  3KZG A;  3TTL A;  1MQD A;  4NTL A;  1GTK A;  1P1W A;  4GWO A;  4DE8 A;  1IIW A;  3QXM A;  2XXX A;  3BKI B;  3FAT A;  1URD A;  2VD3 A;  5FHO A;  3K6V A;  3PU5 A;  4E0W A;  2B65 A;  1B4H A;  1T0K A;  1VFE A;  3O9P A;  5H8N B;  1URG A;  3SEU A;  2AYS A;  4IO4 A;  3D4C A;  1FTK A;  1LBC A;  4U23 A;  3T96 B;  2UXA A;  1J1N A;  3Q27 A;  4YAH X;  3K1M A;  4XTC Q;  5I58 B;  3WAE A;  2ABH A;  1A54 A;  4G77 A;  3FJG A;  4NE4 A;  2HXW A;  1NMU A;  4YMA A;  5CBR A;  4RNS A;  2FNC A;  3FXQ A;  4NF4 A;  3T9U A;  4NWC A;  3UA8 A;  3G3H A;  4DIG A;  1A7L A;  1UTH B;  3PUY E;  4TLM B;  2F78 A;  3TAJ A;  3PPP A;  2O7U A;  1FQF A;  3CFX A;  2E1S A;  3MVZ A;  4G2Z A;  2I49 A;  3O6I A;  1WOD A;  4JXI A;  3U93 A;  4LA9 A;  4Q5T A;  4OER A;  3FV2 A;  4NED A;  4GL8 A;  3N26 A;  5I58 A;  1MQI A;  4X1B A;  2ESN A;  2H9B A;  3PMV A;  2VD2 A;  5CMB A;  2UYF A;  4R6K A;  3K00 A;  1POY 1;  4RA1 A;  4ZEB A;  3S9N C;  3O66 A;  1QW0 A;  4Q8R A;  3PPR A;  5H8H B;  5JTY B;  4KR5 A;  4YU0 A;  5TPA B;  5TU0 A;  1ATG A;  4I9D A;  1B4Z A;  1B6H A;  4EQB A;  1OVB A;  3PGF A;  1EZO A;  4QFP A;  2LAO A;  5CC2 A;  4QRZ A;  2XXU A;  4BDL A;  3CFL A;  4JWX A;  3VVD A;  2QJE A;  4YKI A;  3VVE A;  1Y3N A;  5L9O A;  3IB2 A;  3H6U A;  4OFO A;  4R6Y A;  1NL5 A;  1I6Q A;  1MY0 A;  1M5B A;  3QYT A;  4KYD A;  4LQ2 A;  2Q2C A;  5H8H A;  4G8M A;  5JTY A;  3Q29 A;  2QSX A;  1MPD A;  1HSL A;  4X9T A;  1TFD A;  1JVY A;  2REJ A;  3RUM A;  3T9X B;  3C9H A;  4THI A;  4H5G A;  2VOZ A;  5FTI A;  2OBG A;  2H98 A;  1D4N A;  3K01 A;  2F8D A;  3VXC A;  5I56 B;  1BIY A;  1Y9U A;  1LFI A;  3RTW B;  3HO7 A;  1N7W A;  3GZG A;  3SEV A;  2I3W A;  1OQH A;  3W15 C;  1RKM A;  4U1Z A;  4RYA A;  4NF5 B;  3EPE A;  1YTV A;  5AA2 B;  2I4B A;  2H25 A;  2V93 A;  2V3U A;  3K1N A;  1MQG A;  3MP6 A;  2RF1 A;  3IAZ A;  4KPT A;  4KCC A;  4DXU A;  1MY2 A;  1O64 A;  4RPN A;  4ZZA A;  1FQC A;  3USD A;  4Q30 B;  5HPQ A;  1NNT A;  1CB6 A;  4GIZ A;  3S9M C;  1MS7 A;  2YPN A;  2V3T A;  3MJN A;  1P1N A;  3G3J A;  5DEX B;  3PD8 A;  1DTZ A;  1SDX A;  1US5 A;  3IB1 A;  3TUS A;  3C31 A;  1XOC A;  1RYO A;  4QFN A;  3FIR A;  1D9V A;  2PT2 A;  3VLU A;  3RN8 A;  2Q89 A;  1ZMG A;  5L9M A;  1MQH A;  3V8X B;  4NF5 A;  1Y3P A;  5H8S A;  1TWY A;  2PBW A;  1XVX A;  1M5C A;  1N0T A;  4IB2 A;  3UN6 A;  4ZE9 A;  4KYE A;  3FXU A;  4ONY A;  1SYI A;  3K02 A;  2PMS A;  2AL5 A;  1XC1 A;  3SDF A;  5DVJ A;  3ZS6 A;  4C1U A;  3HN0 A;  3OD7 A;  1B9J A;  3P7I A;  2GHA A;  1BP5 A;  3H06 B;  4GOT A;  4EQ7 A;  2WKY A;  1MY1 A;  4RK9 A;  5AA4 B;  4GXA A;  1M5E A;  3O29 A;  5I2N A;  2P2A A;  2QS4 A;  1JNF A;  3TEP A;  4MBP A;  2PVU A;  2NXO A;  1B7H A;  4OEN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...