4H8IA

Structure of gluk2-lbd in complex with gluazo
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
256
structure length
256
Chain Sequence
NRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKGTPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamate receptor, ionotropic kainate 2
publication title A photoswitchable neurotransmitter analogue bound to its receptor.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 82
structure length 256
sequence length 256
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-09-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4h8iA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4h8iA02
1FQEA 1NFTA 3THIA 2DSFA 4Q8RA 2H4IA 3EHSA 3VE1B 3HPIA 3FVKA 3H4ZA 2RKMA 4FJPA 3U93A 1FQFA 2DWAA 3C34A 5DT6A 1SW2A 4F3BA 1Q1KA 1JEVA 4XKQA 3C32A 4QSDA 3TODA 4P11A 2WKYA 4KR5A 3H3GA 4QF9A 3HSTA 4ZDMA 3QUFA 1S9TA 2DWHA 3FIRA 3IJOB 1NMUA 2OWTA 1B3FA 5ITOA 1IEJA 2XXIA 5AA2A 3SEYA 4RNSA 5EHMA 4XKNA 3CSGA 3O2AA 1B3HA 2NVUB 3TKDA 4QHQA 5H8SA 1SI1A 4KFQA 3PGFA 4QFNA 4ND9A 2DXRA 4NF4B 1A40A 1VFEA 4P0GA 1MXWA 2PBWA 2V84A 1UTBB 3FATA 3QYTA 1AH5A 1MXVA 1B5JA 2XX8A 1FTMA 5TP9A 3IOTA 4TQUQ 1NH7A 4H0WA 2V93A 1P1OA 1B9JA 1AIVA 4QFOA 1Y20A 2ANJA 2D3IA 1B51A 4QFLA 1XT8A 2RCBA 1R6ZA 4LVQA 5FTIA 4OHNA 3S9LC 1P99A 3KZGA 3VV5A 1NH8A 2H98A 4UA8A 4ZEBA 1ELJA 4MFIA 5I59A 2DXYA 1MPCA 4QFPA 4DCYA 1UTHA 3OO7A 1XOCA 4KPTA 1DPEA 4FAJA 3EHTA 4RK2A 3E9XA 3T93B 2HEUA 2P2AA 4DCXA 1II5A 1MQIA 2I48A 3PPOA 2RF1A 2F6GA 3N26A 4O3AA 3S2VA 3HV1A 3IB1A 3IB0A 2QSXA 3LBSA 1MDQA 5H8QB 4PP0A 1R1NA 3OO6A 1QW0A 4E0WA 3TDJA 1Y3NA 3FV2A 4XKRA 4YB5A 2F36A 4IO2A 3PPQA 4HW8A 3IB2A 2DWIA 4YKPA 1ZTYA 3CRBA 4ELRA 1OVBA 1N76A 2HAVA 1FTKA 1MPBA 4OFOA 3FVNA 1WODA 1LCFA 3S9NC 5KDTA 2ZNTA 3MP8A 4GVOA 4PE5B 1ZLQA 3IO6A 4JWXA 3S9EA 1IZ1A 1R9QA 1PB7A 5A5XA 4RA1A 3ILUB 4N13A 4YMBA 5I2NB 3HO7A 3SDFA 1FW0A 3PU5A 1URSA 1RYXA 4MF3A 3FGSA 4OESA 3O6HA 4C1TA 4OFLA 2UVHA 1N04A 3FUZA 4LA9A 2XXQA 1MS7A 1B1HA 2PX1A 3TCHA 2OCUA 2V3UA 4RPNA 2VD3A 1EU8A 3A3UA 2W7YA 3OSQA 3CSBA 1GTKA 1QUKA 4YKKA 3TTRA 4R6KA 1XC1A 4LZ5A 2O1LA 2OK2A 1NNPA 3G3KA 1USYE 1OQGA 4H6DA 2B3FA 3UN6A 4NWCA 1JVYA 1HSLA 1SD3A 3C36A 4JDFA 2RC9A 3K6UA 1A8FA 2Y84A 1RKMA 5AE4A 2QJEA 1Y9UA 4RPOA 2XHDA 3MBPA 2D5WA 3IORA 3U72A 4GD5A 3L6HA 4RJZA 3C35A 1M5FA 3CFZA 4ZEFA 2HQ0A 3K01A 5CBRA 3QIMA 2QS2A 4H5GA 3V8XB 4HTGA 3FZVA 4ECFA 3ODBA 2A5SA 4YKJA 3QAXA 3MWBA 3K6XA 3JZJA 1MM6A 4Z7EA 2NXOA 4G8NA 2Y7KA 4OVJA 1B5HA 3K6WA 3TUSA 1B0HA 4FORA 1OLAA 3KN3A 4L17A 1VR5A 1FQCA 4Q30B 3O6IA 3MUQA 1OQHA 5BUUA 3LSXA 4UACA 3PMXA 1D9VA 4G68B 3IAZA 4JSDA 1EH3A 4RK9A 4EXLA 3RQTA 4AB6A 1IITA 1DTZA 2E1SA 4IO6A 4XTCQ 5L9OA 1MY2A 5AA4B 2HZKA 4Z0IA 4FATA 2F97A 4EF2A 5H8NB 2O69A 1CB6A 1Y3PA 5F1QA 3OELA 1Y4CA 2H9BA 5JEIA 3VVEA 2AYSA 3SESA 2ZNUA 2Z22A 3VLWA 3FV1A 2XXTA 3I5OA 2BJJX 5I56B 3KOTA 3E4RA 3K6VA 1Z7ME 1JEUA 4WEPA 1LB8A 1DTGA 5H8HB 1OIBA 1PEBA 2Y7RA 5CMBA 4BDMA 5CRYA 1UTBA 1VSOA 1T0KA 3EF7A 2A5TB 3F11A 3VXBA 4KYSA 1B4ZA 4P0IA 3PPNA 4ZEDA 3KSXA 4FIMA 4LZ8A 3U8QA 1S50A 2HAUA 4NTLA 2NUVA 2X7PA 1URGA 2I49A 2REGA 2ZNSA 1Y1ZA 2V3QA 4QSCA 1P1UA 3W9VA 2AL4A 1IXCA 5FTHA 1HSJA 1JW1A 3MVZA 4GQOA 3C33A 5IAIA 2R71A 1IXGA 3UP9A 3O9PA 1US5A 1USYH 2PT2A 3H6WA 3ONMA 4H8JA 4R6YA 1GGGA 3TMGA 3H6VA 5CMMA 4ZEKA 1POTA 1JW5A 1N84A 2DVCA 4R73A 1TT1A 1P1QA 3FXQA 2IA4A 4ELPA 4Q0CA 2DQVA 1H3DA 2PYYA 2UVJA 2QS3A 3IOVA 1PBQA 2D21A 1GR2A 1LFIA 4QRZA 4OENA 5H8QA 5DVJA 1MY0A 1XVYA 1ZJLA 3T9UA 4EQ9A 5DEXA 4F2OA 2XXRA 1UIVA 3FD3A 1BIYA 3C4MA 3MAMA 4GXSB 3T96B 4H67A 4KI0E 4GL8A 2H5YA 3MZBA 4RXLA 1H43A 3IK6B 1H45A 4BLAA 4F1YA 5AA2D 2V3TA 3SKPA 4U2RA 3T66A 1B3LA 3IOWA 4I1DA 4NF6A 4IO5A 1WVJA 2OJTA 3O28A 4FECA 1DPPA 4JWOA 2PMSA 1ZBMA 2ESNA 4F22A 3VFJA 1A54A 3DELB 4TOZA 1QUIA 4X48A 4LATA 3QXMA 4U21A 2QS1A 4YB7A 2F5XA 2FYIA 3Q26A 5CM6A 3TEPA 4F39A 2Q2AA 4KHZE 4X9TA 5I2KA 1LBBA 5K2YA 5F7VA 3RY3A 1AOVA 4U22A 2ZMBA 1UQWA 5DTBA 4THIA 1IIWA 3OEKA 3D4GA 2P1SA 3B6TA 2ZYNA 2XXWA 1FQDA 3FJGA 3RN8A 3U94A 4MH5A 3LUYA 3H03A 1UIUA 1OVTA 3Q25A 4XXUA 1US4A 2UYEA 1MY3A 3DM0A 1B0LA 3KFMA 4QFKA 3B6QA 1QVSA 4POXA 4XIGQ 1MXUA 5L9SA 1J1NA 3JV9A 3N6UA 1KWHA 3VLUA 2XXHA 3M3KA 3WAFA 5BWJA 4OERA 4GWOA 5L9MA 3N5LA 3MP6A 3H06B 1DMBA 5FHMA 1OMPA 1B4HA 3R6UA 1MPDA 3PUWE 4R72A 3LSLA 2DOJA 2ALUA 3KN7A 1P1NA 3IJXB 5K2XA 3RT6B 2LAOA 5KCJB 2UXAA 1MXZA 4YU0A 1TFDA 2QRYA 2B3BA 2QS4A 1MDP1 4GRKA 1B7HA 1Q35A 4I8CA 3OXNA 1SI0A 3E13X 4EQBA 5I57A 5B70A 4LP2B 1MQGA 1JW4A 2GFEA 1MRPA 1N7WA 5TP9B 3PPPA 4LQ2A 3DLNA 2ONRA 2Z23A 1N7XA 1B6HA 3RUMA 4TLLB 3PD8A 1DSNA 2O84X 4DXUA 4OEVA 2F34A 1LBCA 5LOMA 1P1WA 1LCTA 4NF8A 5ISUA 2YJPA 3HN0A 3GBBA 5ICTA 2ZXTA 4WKMA 3G3JA 2XXVA 1LLSA 2XXUA 4MLVA 3MPLA 5I59B 1SW1A 1VFDA 2Y7PA 3O29A 2DE2A 2H99A 3PMWA 3HHGA 1M5BA 2QL3A 3DP6A 3Q27A 1M5CA 5EYFA 1IUDA 3M3LA 4NF5B 3SERA 2CMOA 1NNKA 2E0SA 2I6EA 1MM7A 5H8FA 1GV8A 4MBPA 4JBZA 5I56A 1PC3A 2FA7A 4LQ5A 3TAJA 4MLQA 1ATGA 4ZZAA 3PPRA 3LSFB 3SEWA 1XS5A 3G3GA 4M1VA 5ITPA 5AA3A 5H8HA 4G4PA 3L6GA 5CI5A 1ZU0A 2YPNA 1LAFE 4R9GA 5TPAA 1FCKA 4R75A 3PMVA 2I0CA 4IGRA 4IO3A 1IXIA 1FQAA 4GLIA 3ZKLA 3ZSFA 1IXHA 1BP5A 5JTYA 4OTEA 3EHUA 2NOOA 4OWDA 4X1BA 2X26A 2VD2A 3VXCA 3MJNA 4I62A 5KDTB 2I0BA 1B2HA 4YICA 3PD9A 3PUZE 4K3FA 4YAHX 2XXXA 3KBRA 4YB6A 1QULA 4IY6A 2I4CA 5J1DA 2ZYKA 1AMFA 3KG2A 3I3VA 1XVXA 1EZOA 4F18A 1MH3A 1LAGE 5FHOA 4YZZA 1FQBA 3G7WA 4U23A 4XKPA 4Q5TA 3K1PA 4U1ZA 1YCJA 3GZGA 3CIJA 3DP4A 2XXYA 2OBGA 3BFUA 1OLCA 2Z8DA 3MZ9A 2I4BA 3W9WA 5KZTA 3EQ1A 2VGQA 1SVXB 2G29A 2XXPA 1MY4A 1B46A 3FVGA 4OFJA 2VHAA 4NE4A 4PFTA 2X7QA 1JETA 4BDNA 2ZYOA 3TQLA 2THIA 5CC2A 3CR9A 4NF4A 1PB9A 3RGYA 2F7CA 3T9HB 1ANFA 1FTJA 1FTLA 3R7XA 3UIFA 4ELOA 3Q28A 3G3HA 3BKIB 3TZAA 5L8DA 3FASA 1SW5A 1O64A 2ONSA 2M8CA 4JSOA 3TCFA 2DYXA 3IX1A 4I9DA 3UGWA 1TWYA 3O6GA 1TXFA 3FXRA 3D4CA 3R26A 1B7ZA 1LAXA 2B65A 2O7IA 3N94A 1QUJA 4C1UA 5DVFA 1SQYA 3SEXA 2H25A 2ABHA 4GFRA 2HZLA 1O63A 3TPAA 1JQFA 4KCCA 4PFYA 1A99A 2RCAA 4QSEA 3WAEA 2O7UA 1MY1A 4F29A 4KYEA 3A3CA 1I6QA 4KYDA 3PUYE 2RINA 1D3KA 1MXXA 4AB5A 3OEMA 3CFXA 2FNCA 3E3KA 1MQDA 3FJMA 4OXVA 1N3XA 4ESWA 4LZ7A 2QMWA 3MVWA 1XHYA 1L5TA 1MQHA 3VVFA 3BBRA 3OMBA 4G8HA 1Z7NE 3CFLA 1LAHE 2I58A 1ZIUA 4ELQA 2IEEA 4WEDA 2QPQA 1I69A 4DLDA 4ZE8A 4YKIA 5AA1A 4X1DA 4M4GA 2DVZA 3V89B 3IR1A 1SBPA 2F6PA 3ZKKA 3K00A 3V5AA 5HBCA 4R6HA 4YMAA 1LFHA 3OO9A 2ZYMA 3O66A 2F35A 5KCJA 3QSLA 2Q8JA 3OOAA 4OQOA 5I58B 2F78A 4G8MA 3T9VA 4HS7A 3KOSA 3SETA 4OETA 4AQ4A 1SYIA 3PUVE 5FHNA 1RYOA 4PFWA 4R2FA 3M8UA 3TELA 1POY1 2O51A 3U92A 4FE8A 2O6AA 1VE4A 3LSWA 5DYHA 1B5IA 1H76A 4F1UA 1B1XA 4HCYA 4DXBA 3K1NA 4C0RA 4ESXA 5I2NA 4DIGA 4NEDA 4ZEIA 1A7LA 1MXYA 1LFGA 4H1XA 3K0VA 3KJ7A 2REJA 1QKBA 2OWSA 1Y4TA 3LC8A 2RC8A 3TQWA 4NMYA 3GBAA 2NWJA 1H44A 4IY5A 2OZZA 3RTWB 4GOTA 4F31B 1B05A 3RLFE 4ONYA 3H6UA 1YTVA 2G93A 1B40A 3FVOA 3N6TA 4U4XA 4F3GA 4NF5A 3EN3A 3RT8A 4PETA 3ECRA 2HXWA 4NWDA 4IO4A 5AA2B 4JB7A 1IQ7A 5CBSA 1FTOA 3U1OA 2RC7A 5M2VA 4EQ7A 4EXKA 4U1OA 5JK4A 4FEBA 5CMCA 4FEDA 4EUOA 5DEXB 3KSJA 5DVIA 4O3BA 4F19A 1M5EA 4GIZA 2KLFA 3TFLA 3K2DA 2XX7A 4DDDA 2XD2A 2ONKE 3OD7A 3G3FA 3MP1A 3MZ1A 4GXAA 3OO8A 3USDA 3W15C 5IKBA 3G3IA 4NF6B 2Z8EA 2Z8FA 3KJTA 3TCGA 4N07A 3T22A 1LGBC 1YPNA 4R74A 4G68A 2Q2CA 5B7DA 4BDLA 2O1MA 3C9HA 2I3WA 1Y1MA 1PB8A 1D4NA 1AL3A 1M5DA 3CI8A 1B3GA 4F3SA 3MQ9A 4OEUA 5AA4A 3IL1B 1QKAA 3KEIA 2DE3A 1EZPA 5EHSA 1YAEA 5H8NA 5I2KB 2DP8A 1UTHB 1LB9A 3P7IA 3RNNA 3OENA 3KGCA 1TFAA 4IO7A 4PQJA 1BTJA 3H7MA 3SEUA 1N3WA 3K1MA 1WDNA 4F2QA 2AL5A 4DZ1A 3RPWA 2AIXA 2QMXA 4G68C 4IB2A 1URDA 2GRVA 3CG3A 3M3FA 3FXUA 2PVUA 4DE8A 1O7TA 3IOUA 1F9BA 4LONB 3VDFA 4G2ZA 2F7AA 4H65A 4WXJA 1MG1A 4KCDA 3DP8A 3GLBA 3JYRA 3K02A 3Q29A 3TTKA 1SDXA 2Y7IA 3AXFA 1MQJA 1Y3QA 4OYVA 2GHBA 4HCWA 4ZS9A 2F7BA 4G77A 2A5TA 2HCAA 4ZZEA 1I6BA 4IGTA 3HCQA 4GF8A 2DS9A 1NL5A 2XX9A 2Q9TA 1B32A 1DOTA 2P0SA 1R9LA 2Q89A 3SEVA 1HSEA 3PUXE 3ILTB 3CVGA 3TTMA 3V83A 4O3CA 2GH9A 4KQPA 3TYHA 3MC2A 5I57B 3HHFA 4BDQA 2DWJA 3EPEA 5A5XB 3B6WA 4BDRA 1ZMGA 3QK6A 2GHAA 3OSRA 2DE4A 4E0XA 1B52A 1EZ9A 4ISUA 2UVIA 3FJ7A 1SW4A 3UK4A 5CMKA 3UORA 4F1VA 1JNFA 4NF8B 1BKAA 4R2BA 1NNFA 1LSTA 4H8IA 3MVYA 5ELVA 2CZLA 2OLBA 3T9XB 5I84A 1MH4A 3RTFB 3VLVA 5HM4B 2V25A 4PFUA 2R6GE 4OZ9A 3VVDA 4BDOA 4ZECA 1NNTA 1PBPA 2UVGA 4JXIA 3UA8A 2Y7WA 1D9YA 3H6TA 4GL0A 4DXCA 1B7UA 1QJMA 4KD5A 1B3EA 3GXAA 3O97A 1JVXA 2VOZA 2F8DA 1PDAA 5H8FB 1B58A 2R9JA 3LR1A 2I3VA 3I6VA 4EF1A 3TTNA 3IO4A 4F3PA 2O68A 3S9MC 1GVCA 1CE2A 3MVXA 4RYAA 4JWYA 2VP1A 5I58A 1SYHA 2YLNA 3QUJA 4H5FA 3A09A 1I6AA 4POWA 1N0TA 2HFBA 3PV0E 3C31A 5HPQA 2XD3A 1ZKBA 3ZS6A 4R9FA 5TPAB 1S7YA 1A55A 4RY1A 2Q88A 3KN8A 4OMBA 3K4UA 2UYFA 4EDPA 5JTYB 3B7DA 4LUBA 3S4UA 3TTLA 1BLFA 2PT1A 4ZE9A 3CG1A 1NKXA 4TLMB 3MW0A 5ICQA 3MPKA 4U4SA 1A8EA 4N6PA 3BFTA 5TU0A
chains in the Genus database with same CATH superfamily
1FQEA 1NFTA 3THIA 2V4CA 2DSFA 4Q8RA 2H4IA 3EHSA 3VE1B 3HPIA 2CEYA 3FVKA 3H4ZA 2RKMA 4FJPA 3U93A 1FQFA 2DWAA 3C34A 5DT6A 1SW2A 4F3BA 1Q1KA 2OX3A 1JEVA 4XKQA 3C32A 1QGXA 4QSDA 3TODA 4P11A 2XWKA 2WKYA 1FJ9A 4KR5A 3H3GA 4QF9A 3HSTA 4ZDMA 3QUFA 1S9TA 4AS5A 2DWHA 3FIRA 3IJOB 1NMUA 2OWTA 1B3FA 5ITOA 1IEJA 2XXIA 5AA2A 3SEYA 4RNSA 5EHMA 4XKNA 1FPDA 3CSGA 4GWXA 3O2AA 4XEQA 1B3HA 4AS4A 5ESYA 2NVUB 3TKDA 4HE2A 4QXDA 4QHQA 5H8SA 1SI1A 4KFQA 3PGFA 2HXRA 4QFNA 4ND9A 2PFYA 4GX4A 4PAKA 2DXRA 4NF4B 1A40A 1VFEA 4P0GA 4PFBA 1MXWA 2PBWA 2V84A 3GYYA 2XWIA 1UTBB 3FATA 4GWSA 3QYTA 1AH5A 1MXVA 2FIXA 5A5LA 4MNPA 1B5JA 2XX8A 1FTMA 5TP9A 4TQUQ 2VT5A 3IOTA 1NH7A 2JJKA 2V93A 1P1OA 4H0WA 1B9JA 1AIVA 4QFOA 1Y20A 2ANJA 2D3IA 1B51A 4QFLA 1XT8A 2RCBA 1R6ZA 4LVQA 5FTIA 4PDHA 4OHNA 3S9LC 1P99A 5I7IA 3KZGA 3VV5A 1NH8A 2H98A 4UA8A 4ZEBA 1ELJA 4MFIA 5I59A 2DXYA 1MPCA 4QFPA 4DCYA 1UTHA 3OO7A 3HFUA 1XOCA 4KPTA 1DPEA 4GWWA 2WBDA 4FAJA 3A29A 3EHTA 4RK2A 3E9XA 3T93B 2HEUA 2P2AA 4DCXA 1II5A 1MQIA 2I48A 3PPOA 1INPA 2BJIA 2RF1A 2F6GA 3BIGA 3N26A 4O3AA 3S2VA 3HV1A 3IB1A 1EYJA 3IB0A 2QSXA 4OVRA 3LBSA 1MDQA 5H8QB 4PP0A 1R1NA 3OO6A 4MJOA 1QW0A 4E0WA 1Y3NA 3TDJA 3FV2A 4XKRA 4YB5A 2F36A 2PFZA 4IO2A 1NV7A 3PPQA 4HW8A 1NUZA 2B4LA 3IB2A 1IMCA 2DWIA 4YKPA 1ZTYA 3CRBA 4ELRA 1NV3A 1OVBA 1N76A 2HAVA 1FTKA 1MPBA 4NGUA 4OFOA 4MNIA 3FVNA 1WODA 1LCFA 3S9NC 5KDTA 4O7IA 2ZNTA 3MP8A 4GVOA 3FXBA 4PE5B 2OWZA 1ZLQA 3IO6A 4JWXA 3S9EA 1CNQA 1IZ1A 1R9QA 1PB7A 5A5XA 4RA1A 3ILUB 4N13A 4YMBA 5I2NB 5IZZA 3HO7A 3SDFA 1FW0A 3PU5A 1URSA 1RYXA 4MF3A 3FGSA 4OESA 3O6HA 4C1TA 4OFLA 2UVHA 1N04A 3FUZA 4LA9A 2XXQA 1MS7A 1B1HA 2PX1A 3TCHA 2OCUA 3ROJA 2V3UA 4RPNA 2VD3A 1EU8A 3A3UA 2W7YA 3OSQA 3CSBA 1RDYA 1GTKA 1QUKA 4YKKA 3TTRA 4R6KA 5IZ3B 1XC1A 4LZ5A 2O1LA 2OK2A 1NNPA 3G3KA 1USYE 1BK4A 4N17A 3ISPA 1OQGA 4H6DA 2B3FA 3UN6A 4NWCA 1JVYA 1HSLA 1NV0A 1FBCA 1SD3A 3C36A 4JDFA 2RC9A 3K6UA 5I5PA 1A8FA 2Y84A 1RKMA 5AE4A 2QJEA 1Y9UA 4RPOA 2XHDA 1K9YA 3MBPA 2D5WA 2Y5KA 3IORA 3U72A 4GD5A 3L6HA 4RJZA 3C35A 1M5FA 3CFZA 4ZEFA 4PF8A 4N6DA 2HQ0A 3K01A 2ZZWA 5CBRA 1G0IA 3QIMA 2QS2A 4H5GA 3V8XB 4HTGA 3FZVA 4OVPA 4ECFA 3ODBA 4IR8A 2A5SA 4YKJA 3QAXA 4N4UA 3MWBA 3K6XA 3JZJA 1MM6A 3D1RA 4PCDA 4Z7EA 2NXOA 4G8NA 2QVRA 2Y7KA 4OVJA 1B5HA 3K6WA 3TUSA 1B0HA 4FORA 1OLAA 3KN3A 4L17A 1VR5A 1FQCA 4Q30B 3O6IA 3MUQA 1OQHA 5BUUA 3LSXA 2CZHA 4UACA 3PMXA 1D9VA 4MX6A 4G68B 3IAZA 4JSDA 1EH3A 4RK9A 4EXLA 3RQTA 4AB6A 1IITA 1DTZA 2E1SA 4IO6A 4XFEA 4XTCQ 5L9OA 1MY2A 5AA4B 2HZKA 2FHYA 4Z0IA 4FATA 2F97A 4EF2A 5H8NB 2ZZVA 2O69A 1CB6A 1Y3PA 2HHMA 4X8RA 5F1QA 3OELA 1Y4CA 4PFIA 2H9BA 4DI4B 4GBWA 5EYGA 5JEIA 3VVEA 2AYSA 3SESA 2ZNUA 2Z22A 3VLWA 3FV1A 2XXTA 3I5OA 2BJJX 3RPLB 5I56B 3KOTA 5IM2A 3E4RA 3K6VA 1Z7ME 1JEUA 4WEPA 4MNCA 1LB8A 1DTGA 5H8HB 1OIBA 1PEBA 2Y7RA 5CMBA 4OANA 4BDMA 3BIHA 5CRYA 1UTBA 1VSOA 1T0KA 3EF7A 4PGNA 2A5TB 2KR0A 3F11A 3VXBA 4KYSA 1B4ZA 4P0IA 3PPNA 4N8YA 4ZEDA 3KSXA 4FIMA 4LZ8A 1NUWA 3U8QA 1S50A 2HAUA 4NTLA 2NUVA 2X7PA 1URGA 2I49A 2REGA 2ZNSA 4MAGA 1Y1ZA 2V3QA 4QSCA 1P1UA 4UABA 3W9VA 2AL4A 1IXCA 5FTHA 1HSJA 1JW1A 5IGAA 3MVZA 4GQOA 3C33A 5IAIA 2R71A 1IXGA 3UP9A 3O9PA 1US5A 1USYH 2PT2A 3H6WA 3ONMA 4H8JA 4R6YA 4HXVA 1GGGA 3TMGA 3H6VA 5CMMA 4ZEKA 1POTA 1JW5A 1N84A 2DVCA 4R73A 1TT1A 1P1QA 1FPJA 3FXQA 2IA4A 4ELPA 1Q9DA 4Q0CA 2DQVA 1LBYA 1H3DA 2PYYA 5EYHA 2UVJA 2QS3A 5EQ8A 2WYPA 1G0HA 3IOVA 1PBQA 2D21A 1GR2A 1LFIA 4NHBA 4QRZA 4OENA 5H8QA 5DVJA 1MY0A 1XVYA 1ZJLA 3T9UA 4EQ9A 4I3EA 5DEXA 4PE3A 4F2OA 2XXRA 2F3BA 1UIVA 4PAIA 3FD3A 1BIYA 3C4MA 3MAMA 4GXSB 3T96B 4H67A 4KI0E 4GL8A 2H5YA 3MZBA 4RXLA 1H43A 3IK6B 1H45A 4BLAA 4F1YA 5AA2D 2V3TA 3SKPA 4U2RA 3T66A 1B3LA 3IOWA 4PAFA 4I1DA 4NF6A 4IO5A 1WVJA 2OJTA 3O28A 4FECA 2Q8MA 4N6KA 1DPPA 4JWOA 4PTKA 2PMSA 1ZBMA 2ESNA 4GWZA 3VFJA 4F22A 1A54A 3DELB 4TOZA 1QUIA 4X48A 4LATA 3QXMA 4U21A 4NF0A 3KC0A 5LTCA 2QS1A 4MIJA 4YB7A 2F5XA 2HPGA 2PCRA 2FYIA 3Q26A 5CM6A 3TEPA 4F39A 2Q2AA 1NV1A 4KHZE 4X9TA 5I2KA 1FPEA 1LBBA 5K2YA 5F7VA 3RY3A 4LN5A 1AOVA 4U22A 2ZMBA 1UQWA 5DTBA 4THIA 1IIWA 3OEKA 3D4GA 2P1SA 4OVQA 3B6TA 2ZYNA 1NV5A 1YZ0A 2QFLA 2XXWA 1FQDA 3EKIA 3FJGA 4N91A 3RN8A 2CEXA 3U94A 4MH5A 3LUYA 5IZ3A 3H03A 1UIUA 1OVTA 3Q25A 4XXUA 1US4A 2UYEA 1MY3A 3DM0A 1B0LA 3KFMA 4QFKA 3B6QA 1QVSA 4POXA 4XIGQ 1MXUA 5L9SA 1J1NA 3JV9A 3N6UA 1KWHA 3VLUA 2XXHA 3CHGA 3M3KA 3WAFA 5BWJA 4OERA 4GWOA 5L9MA 3N5LA 3MP6A 3H06B 1DMBA 5FHMA 1OMPA 1B4HA 3R6UA 4G61A 1MPDA 3PUWE 4R72A 3LSLA 2DOJA 2ALUA 3KN7A 1P1NA 3IJXB 5K2XA 4MCOA 3RT6B 2LAOA 5KCJB 2UXAA 1MXZA 4YU0A 1TFDA 2QRYA 2B3BA 2QS4A 1MDP1 4GRKA 3RYDA 1B7HA 1Q35A 3T1BA 4I8CA 1VDWA 1FPGA 3OXNA 3U65A 1SI0A 3E13X 1DBZA 1YYZA 4EQBA 5IZ1A 5I57A 5B70A 3T0JA 4LP2B 1MQGA 1JW4A 2GFEA 1MRPA 1N7WA 5TP9B 3PPPA 4LQ2A 3B8BA 3DLNA 2ONRA 2Z23A 1N7XA 1B6HA 3RUMA 4TLLB 3PD8A 4N81A 1DSNA 2O84X 4DXUA 4OEVA 2F34A 1LBCA 4OA4A 5LOMA 1P1WA 1LCTA 1IMFA 4NF8A 5ISUA 2YJPA 3HN0A 3GBBA 5ICTA 2ZXTA 4WKMA 3G3JA 2XXVA 1LLSA 2XXUA 4MLVA 1NUYA 3MPLA 5I59B 1SW1A 1VFDA 1XI6A 2Y7PA 3O29A 2DE2A 4JVCA 2H99A 3PMWA 3HHGA 1M5BA 4MMPA 2QL3A 3DP6A 3Q27A 1M5CA 5EYFA 1LBXA 1IUDA 3M3LA 4NF5B 3SERA 2CMOA 1NNKA 2E0SA 2I6EA 1MM7A 5H8FA 3RPLA 1GV8A 4MBPA 4JBZA 5I56A 2XA5A 1PC3A 2FA7A 3E79A 4LQ5A 3TAJA 4MLQA 1ATGA 4ZZAA 3PPRA 3LSFB 3SEWA 1XS5A 3G3GA 4M1VA 5ITPA 5AA3A 5H8HA 3KBZA 3IFCA 4G4PA 3L6GA 5CI5A 1ZU0A 2YPNA 1LAFE 4R9GA 5TPAA 1LEVA 1FCKA 4R75A 3PMVA 2I0CA 5F24A 4IGRA 4IO3A 1IXIA 1FQAA 4GLIA 3ZKLA 3ZSFA 1IXHA 1BP5A 5JTYA 4OTEA 3EHUA 2NOOA 4OWDA 4X1BA 2X26A 2VD2A 3VXCA 3MJNA 4I62A 5KDTB 2I0BA 1B2HA 4YICA 3PD9A 3PUZE 3MYUA 4K3FA 4YAHX 2XXXA 4P56A 3KBRA 4YB6A 1QULA 4IY6A 2I4CA 2Q74A 5J1DA 4O8MA 2GQ1A 2ZYKA 1AMFA 1DK4A 2XWOA 3KG2A 3I3VA 1XVXA 1EZOA 4PBQA 4F18A 1MH3A 3KC1A 4DI3D 1LAGE 5FHOA 4YZZA 1FQBA 3G7WA 4GBVA 4U23A 4XKPA 4Q5TA 3K1PA 2VPOA 4PF6A 4U1ZA 1YCJA 3GZGA 3CIJA 1LBWA 3DP4A 2XXYA 1EYIA 2OBGA 3BFUA 5ET7A 1OLCA 2Z8DA 3MZ9A 2I4BA 3W9WA 1FRPA 5KZTA 3EQ1A 2VGQA 4PDDA 1SVXB 2G29A 2XXPA 2MKZA 1MY4A 1B46A 3FVGA 1FBPA 4OFJA 2VHAA 4NE4A 4PFTA 2X7QA 1JETA 4BDNA 2ZYOA 3TQLA 2THIA 5CC2A 3CR9A 5I3SA 4NF4A 1PB9A 3RGYA 2F7CA 3T9HB 2F3DA 1ANFA 1FTJA 1FTLA 3R7XA 3UIFA 4ELOA 3Q28A 3G3HA 3BKIB 3TZAA 5L8DA 5J16A 1IMBA 3FASA 4JVDA 1SW5A 1O64A 2ONSA 2M8CA 4JSOA 3TCFA 2B4MA 2DYXA 3IX1A 1FPBA 1NI9A 4I9DA 3UGWA 1TWYA 3O6GA 1TXFA 3FXRA 1FPLA 3D4CA 3R26A 1B7ZA 3SZPA 1LAXA 2B65A 2O7IA 5LDZA 3N94A 1QUJA 4C1UA 5DVFA 1SQYA 3SEXA 2H25A 2ABHA 4GFRA 2HZLA 1O63A 3TPAA 1JQFA 4KCCA 4PFYA 4NQ8A 1A99A 2RCAA 4QSEA 3WAEA 2O7UA 1MY1A 5EQ9A 4F29A 4KYEA 3A3CA 5ET6A 4P1LA 1I6QA 4KYDA 1JP4A 3PUYE 2RINA 1D3KA 1MXXA 4AB5A 4P47A 1FPKA 3OEMA 4PC9A 3CFXA 2FNCA 3E3KA 1MQDA 3FJMA 4OXVA 1N3XA 4ESWA 4LZ7A 2QMWA 3MVWA 1XHYA 1L5TA 1MQHA 3VVFA 3BBRA 3OMBA 4G8HA 1Z7NE 4PBHA 3CFLA 2Y5LA 1LAHE 2I58A 4O7MA 1ZIUA 1IMDA 4ELQA 2IEEA 4WEDA 2QPQA 1I69A 4XF5A 4DLDA 4ZE8A 4YKIA 5AA1A 4X1DA 4M4GA 2DVZA 3MSTA 1IMAA 3V89B 1LBZA 3IR1A 1SBPA 2F6PA 3ZKKA 3K00A 2WYKA 3V5AA 5HBCA 1RDXA 4R6HA 4YMAA 1LFHA 3OO9A 2ZYMA 3O66A 2F35A 5KCJA 3QSLA 2Q8JA 3OOAA 4OQOA 4P9KA 5I58B 3IFAA 2F78A 4G8MA 3T9VA 4HS7A 3KOSA 3SETA 4OETA 4AQ4A 1SYIA 3PUVE 5FHNA 1RYOA 4PFWA 4H45A 4R2FA 3M8UA 3TELA 1FBEA 1POY1 2O51A 3U92A 4FE8A 4OVSA 2O6AA 1VE4A 3LSWA 5DYHA 1B5IA 1H76A 4F1UA 1B1XA 4HCYA 4DXBA 4P3LA 3K1NA 4C0RA 4ESXA 5I2NA 2CZIA 4MHFA 4DIGA 4NEDA 4ZEIA 1A7LA 1MXYA 2FBPA 1LFGA 4OVTA 4H1XA 3K0VA 3KJ7A 2REJA 1QKBA 2OWSA 1Y4TA 3LC8A 2RC8A 3TQWA 4NMYA 3GBAA 2NWJA 1H44A 4GWUA 4GX6A 4IY5A 2WX9A 2OZZA 2P3VA 3RTWB 4GOTA 4F31B 1B05A 4NG7A 3RLFE 4ONYA 3H6UA 1YTVA 4O94A 2G93A 1B40A 3FVOA 3N6TA 4U4XA 4F3GA 4NF5A 3EN3A 3RT8A 4PETA 1AWBA 3ECRA 2HXWA 2XXKA 4NWDA 4IO4A 5AA2B 4JB7A 1IQ7A 5CBSA 1FTOA 3U1OA 2RC7A 5M2VA 4EQ7A 4HE0A 4EXKA 4P1EA 2R8TA 4U1OA 5JK4A 4FEBA 1NV4A 5CMCA 4FEDA 4EUOA 5DEXB 1EYKA 3KSJA 5DVIA 4O3BA 4F19A 2KQZA 4I3YA 1M5EA 4GIZA 5T3JA 2KLFA 3TFLA 3K2DA 2XX7A 1FBGA 4DDDA 2XD2A 1IMEA 2ONKE 3OD7A 3G3FA 3MP1A 3MZ1A 2QVUA 4GXAA 3OO8A 3USDA 3W15C 5IKBA 3G3IA 1NV2A 4NF6B 4H46A 2Z8EA 2Z8FA 4HE1A 1K9ZA 3KJTA 2FIEA 3TCGA 4N07A 1KA0A 3T22A 1DCUA 1LGBC 1YPNA 4R74A 4G68A 2Q2CA 5B7DA 4BDLA 2O1MA 3C9HA 2I3WA 1Y1MA 1PB8A 1D4NA 1AL3A 1M5DA 3CI8A 4N8GA 1B3GA 4GWYA 1FBFA 2QVVA 4F3SA 3MQ9A 4OEUA 5AA4A 3IL1B 1QKAA 1FJ6A 3KEIA 2DE3A 3PTYA 5ET5A 1KZ8A 1EZPA 5EHSA 1YAEA 1SPIA 5H8NA 5I2KB 2DP8A 3FBPA 1UTHB 1FBDA 1LB9A 3P7IA 3RNNA 3OENA 3KGCA 1FPFA 1TFAA 4IO7A 4PQJA 1BTJA 3H7MA 3LV0A 3B50A 1YXIA 3SEUA 5FBPA 1LBVA 1N3WA 3K1MA 3LUZA 1WDNA 4F2QA 2AL5A 4DZ1A 3RPWA 2AIXA 2QMXA 4G68C 4IB2A 1URDA 4NX1A 4NN3A 2GRVA 3CG3A 3M3FA 3FXUA 1FBHA 2PVUA 4DE8A 1O7TA 3IOUA 5ET8A 1F9BA 4LONB 3VDFA 4G2ZA 2F7AA 4H65A 2FVZA 4WXJA 3QMFA 1MG1A 4KCDA 3DP8A 3GLBA 3JYRA 3K02A 3Q29A 3TTKA 1SDXA 2Y7IA 3AXFA 1MQJA 1Y3QA 4OYVA 2L5VA 2GHBA 4HCWA 1D9QA 1FPIA 4ZS9A 4MEVA 2F7BA 4G77A 2A5TA 4JVIA 2HCAA 4ZZEA 1I6BA 4IGTA 3HCQA 4GF8A 2DS9A 1NL5A 2XX9A 2Q9TA 1B32A 1RDZA 1DOTA 2P0SA 1R9LA 2Q89A 3SEVA 1HSEA 3PUXE 4X04A 3ILTB 3CVGA 5EQ7A 3TTMA 3V83A 4O3CA 2GH9A 4KQPA 3TYHA 3MC2A 5I57B 3HHFA 4BDQA 2DWJA 3EPEA 3B6WA 4BDRA 5A5XB 1ZMGA 3QK6A 2CZKA 2GHAA 3OSRA 2DE4A 4E0XA 5DW8A 1B52A 1EZ9A 4ISUA 2UVIA 3FJ7A 1SW4A 1NV6A 3UK4A 5CMKA 4FBPA 3UORA 4F1VA 2XWVA 1JNFA 4NF8B 1BKAA 4R2BA 1NNFA 1LSTA 4H8IA 3MVYA 5ELVA 4I40A 2CZLA 4N15A 2OLBA 3T9XB 5I84A 4GX3A 1MH4A 3RTFB 3VLVA 2P3NA 5HM4B 2V25A 4PFUA 2R6GE 4OZ9A 3VVDA 4BDOA 4ZECA 1NNTA 1PBPA 2UVGA 2DDKA 4JXIA 3UA8A 4P8BA 2Y7WA 1D9YA 3H6TA 4GL0A 2WBBA 4DXCA 1B7UA 2WEFA 1QJMA 4KD5A 1B3EA 3GXAA 3O97A 4QBAA 1JVXA 2VOZA 2F8DA 1PDAA 5H8FB 1B58A 1FSAA 2R9JA 3LR1A 2I3VA 3I6VA 4EF1A 3TTNA 3IO4A 4F3PA 5EQAA 2O68A 3S9MC 1GVCA 1CE2A 3MVXA 4NAPA 4JWYA 4RYAA 2VP1A 5I58A 1SYHA 2YLNA 4PGPA 2VPNA 4KXPA 1FTAA 3QUJA 4H5FA 3A09A 1I6AA 4POWA 1N0TA 2HFBA 3PV0E 3C31A 5HPQA 2XD3A 1ZKBA 3ZS6A 3NOHA 1NUXA 4R9FA 5TPAB 1S7YA 2ZZXA 1A55A 3E78A 4RY1A 2Q88A 3KN8A 4OMBA 3K4UA 2UYFA 4EDPA 5JTYB 3B7DA 4LUBA 3S4UA 3TTLA 1BLFA 2PT1A 4PFRA 4ZE9A 3CG1A 1NKXA 4TLMB 3MW0A 5ICQA 1KA1A 3MPKA 4U4SA 1A8EA 4N6PA 3BFTA 5TU0A
chains in the Genus database with same CATH topology
1FQEA 1NFTA 3THIA 2DSFA 4Q8RA 2H4IA 3EHSA 3VE1B 3HPIA 3FVKA 3H4ZA 2RKMA 4FJPA 3U93A 1FQFA 2DWAA 3C34A 5DT6A 1SW2A 4F3BA 1Q1KA 1JEVA 4XKQA 3C32A 4QSDA 3TODA 4P11A 2WKYA 4KR5A 3H3GA 4QF9A 3HSTA 4ZDMA 3QUFA 1S9TA 2DWHA 3FIRA 3IJOB 1NMUA 2OWTA 1B3FA 5ITOA 1IEJA 2XXIA 5AA2A 3SEYA 4RNSA 5EHMA 4XKNA 3CSGA 3O2AA 1B3HA 2NVUB 3TKDA 4QHQA 5H8SA 1SI1A 4KFQA 3PGFA 4QFNA 4ND9A 2DXRA 4NF4B 1A40A 1VFEA 4P0GA 1MXWA 2PBWA 2V84A 1UTBB 3FATA 3QYTA 1AH5A 1MXVA 1B5JA 2XX8A 1FTMA 5TP9A 3IOTA 4TQUQ 1NH7A 4H0WA 2V93A 1P1OA 1B9JA 1AIVA 4QFOA 1Y20A 2ANJA 2D3IA 1B51A 4QFLA 1XT8A 2RCBA 1R6ZA 4LVQA 5FTIA 4OHNA 3S9LC 1P99A 3KZGA 3VV5A 1NH8A 2H98A 4UA8A 4ZEBA 1ELJA 4MFIA 5I59A 2DXYA 1MPCA 4QFPA 4DCYA 1UTHA 3OO7A 1XOCA 4KPTA 1DPEA 4FAJA 3EHTA 4RK2A 3E9XA 3T93B 2HEUA 2P2AA 4DCXA 1II5A 1MQIA 2I48A 3PPOA 2RF1A 2F6GA 3N26A 4O3AA 3S2VA 3HV1A 3IB1A 3IB0A 2QSXA 3LBSA 1MDQA 5H8QB 4PP0A 1R1NA 3OO6A 1QW0A 4E0WA 3TDJA 1Y3NA 3FV2A 4XKRA 4YB5A 2F36A 4IO2A 3PPQA 4HW8A 3IB2A 2DWIA 4YKPA 1ZTYA 3CRBA 4ELRA 1OVBA 1N76A 2HAVA 1FTKA 1MPBA 4OFOA 3FVNA 1WODA 1LCFA 3S9NC 5KDTA 2ZNTA 3MP8A 4GVOA 4PE5B 1ZLQA 3IO6A 4JWXA 3S9EA 1IZ1A 1R9QA 1PB7A 5A5XA 4RA1A 3ILUB 4N13A 4YMBA 5I2NB 3HO7A 3SDFA 1FW0A 3PU5A 1URSA 1RYXA 4MF3A 3FGSA 4OESA 3O6HA 4C1TA 4OFLA 2UVHA 1N04A 3FUZA 4LA9A 2XXQA 1MS7A 1B1HA 2PX1A 3TCHA 2OCUA 2V3UA 4RPNA 2VD3A 1EU8A 3A3UA 2W7YA 3OSQA 3CSBA 1GTKA 1QUKA 4YKKA 3TTRA 4R6KA 1XC1A 4LZ5A 2O1LA 2OK2A 1NNPA 3G3KA 1USYE 1OQGA 4H6DA 2B3FA 3UN6A 4NWCA 1JVYA 1HSLA 1SD3A 3C36A 4JDFA 2RC9A 3K6UA 1A8FA 2Y84A 1RKMA 5AE4A 2QJEA 1Y9UA 4RPOA 2XHDA 3MBPA 2D5WA 3IORA 3U72A 4GD5A 3L6HA 4RJZA 3C35A 1M5FA 3CFZA 4ZEFA 2HQ0A 3K01A 5CBRA 3QIMA 2QS2A 4H5GA 3V8XB 4HTGA 3FZVA 4ECFA 3ODBA 2A5SA 4YKJA 3QAXA 3MWBA 3K6XA 3JZJA 1MM6A 4Z7EA 2NXOA 4G8NA 2Y7KA 4OVJA 1B5HA 3K6WA 3TUSA 1B0HA 4FORA 1OLAA 3KN3A 4L17A 1VR5A 1FQCA 4Q30B 3O6IA 3MUQA 1OQHA 5BUUA 3LSXA 4UACA 3PMXA 1D9VA 4G68B 3IAZA 4JSDA 1EH3A 4RK9A 4EXLA 3RQTA 4AB6A 1IITA 1DTZA 2E1SA 4IO6A 4XTCQ 5L9OA 1MY2A 5AA4B 2HZKA 4Z0IA 4FATA 2F97A 4EF2A 5H8NB 2O69A 1CB6A 1Y3PA 5F1QA 3OELA 1Y4CA 2H9BA 5JEIA 3VVEA 2AYSA 3SESA 2ZNUA 2Z22A 3VLWA 3FV1A 2XXTA 3I5OA 2BJJX 5I56B 3KOTA 3E4RA 3K6VA 1Z7ME 1JEUA 4WEPA 1LB8A 1DTGA 5H8HB 1OIBA 1PEBA 2Y7RA 5CMBA 4BDMA 5CRYA 1UTBA 1VSOA 1T0KA 3EF7A 2A5TB 3F11A 3VXBA 4KYSA 1B4ZA 4P0IA 3PPNA 4ZEDA 3KSXA 4FIMA 4LZ8A 3U8QA 1S50A 2HAUA 4NTLA 2NUVA 2X7PA 1URGA 2I49A 2REGA 2ZNSA 1Y1ZA 2V3QA 4QSCA 1P1UA 3W9VA 2AL4A 1IXCA 5FTHA 1HSJA 1JW1A 3MVZA 4GQOA 3C33A 5IAIA 2R71A 1IXGA 3UP9A 3O9PA 1US5A 1USYH 2PT2A 3H6WA 3ONMA 4H8JA 4R6YA 1GGGA 3TMGA 3H6VA 5CMMA 4ZEKA 1POTA 1JW5A 1N84A 2DVCA 4R73A 1TT1A 1P1QA 3FXQA 2IA4A 4ELPA 4Q0CA 2DQVA 1H3DA 2PYYA 2UVJA 2QS3A 3IOVA 1PBQA 2D21A 1GR2A 1LFIA 4QRZA 4OENA 5H8QA 5DVJA 1MY0A 1XVYA 1ZJLA 3T9UA 4EQ9A 5DEXA 4F2OA 2XXRA 1UIVA 3FD3A 1BIYA 3C4MA 3MAMA 4GXSB 3T96B 4H67A 4KI0E 4GL8A 2H5YA 3MZBA 4RXLA 1H43A 3IK6B 1H45A 4BLAA 4F1YA 5AA2D 2V3TA 3SKPA 4U2RA 3T66A 1B3LA 3IOWA 4I1DA 4NF6A 4IO5A 1WVJA 2OJTA 3O28A 4FECA 1DPPA 4JWOA 2PMSA 1ZBMA 2ESNA 4F22A 3VFJA 1A54A 3DELB 4TOZA 1QUIA 4X48A 4LATA 3QXMA 4U21A 2QS1A 4YB7A 2F5XA 2FYIA 3Q26A 5CM6A 3TEPA 4F39A 2Q2AA 4KHZE 4X9TA 5I2KA 1LBBA 5K2YA 5F7VA 3RY3A 1AOVA 4U22A 2ZMBA 1UQWA 5DTBA 4THIA 1IIWA 3OEKA 3D4GA 2P1SA 3B6TA 2ZYNA 2XXWA 1FQDA 3FJGA 3RN8A 3U94A 4MH5A 3LUYA 3H03A 1UIUA 1OVTA 3Q25A 4XXUA 1US4A 2UYEA 1MY3A 3DM0A 1B0LA 3KFMA 4QFKA 3B6QA 1QVSA 4POXA 4XIGQ 1MXUA 5L9SA 1J1NA 3JV9A 3N6UA 1KWHA 3VLUA 2XXHA 3M3KA 3WAFA 5BWJA 4OERA 4GWOA 5L9MA 3N5LA 3MP6A 3H06B 1DMBA 5FHMA 1OMPA 1B4HA 3R6UA 1MPDA 3PUWE 4R72A 3LSLA 2DOJA 2ALUA 3KN7A 1P1NA 3IJXB 5K2XA 3RT6B 2LAOA 5KCJB 2UXAA 1MXZA 4YU0A 1TFDA 2QRYA 2B3BA 2QS4A 1MDP1 4GRKA 1B7HA 1Q35A 4I8CA 3OXNA 1SI0A 3E13X 4EQBA 5I57A 5B70A 4LP2B 1MQGA 1JW4A 2GFEA 1MRPA 1N7WA 5TP9B 3PPPA 4LQ2A 3DLNA 2ONRA 2Z23A 1N7XA 1B6HA 3RUMA 4TLLB 3PD8A 1DSNA 2O84X 4DXUA 4OEVA 2F34A 1LBCA 5LOMA 1P1WA 1LCTA 4NF8A 5ISUA 2YJPA 3HN0A 3GBBA 5ICTA 2ZXTA 4WKMA 3G3JA 2XXVA 1LLSA 2XXUA 4MLVA 3MPLA 5I59B 1SW1A 1VFDA 2Y7PA 3O29A 2DE2A 2H99A 3PMWA 3HHGA 1M5BA 2QL3A 3DP6A 3Q27A 1M5CA 5EYFA 1IUDA 3M3LA 4NF5B 3SERA 2CMOA 1NNKA 2E0SA 2I6EA 1MM7A 5H8FA 1GV8A 4MBPA 4JBZA 5I56A 1PC3A 2FA7A 4LQ5A 3TAJA 4MLQA 1ATGA 4ZZAA 3PPRA 3LSFB 3SEWA 1XS5A 3G3GA 4M1VA 5ITPA 5AA3A 5H8HA 4G4PA 3L6GA 5CI5A 1ZU0A 2YPNA 1LAFE 4R9GA 5TPAA 1FCKA 4R75A 3PMVA 2I0CA 4IGRA 4IO3A 1IXIA 1FQAA 4GLIA 3ZKLA 3ZSFA 1IXHA 1BP5A 5JTYA 4OTEA 3EHUA 2NOOA 4OWDA 4X1BA 2X26A 2VD2A 3VXCA 3MJNA 4I62A 5KDTB 2I0BA 1B2HA 4YICA 3PD9A 3PUZE 4K3FA 4YAHX 2XXXA 3KBRA 4YB6A 1QULA 4IY6A 2I4CA 5J1DA 2ZYKA 1AMFA 3KG2A 3I3VA 1XVXA 1EZOA 4F18A 1MH3A 1LAGE 5FHOA 4YZZA 1FQBA 3G7WA 4U23A 4XKPA 4Q5TA 3K1PA 4U1ZA 1YCJA 3GZGA 3CIJA 3DP4A 2XXYA 2OBGA 3BFUA 1OLCA 2Z8DA 3MZ9A 2I4BA 3W9WA 5KZTA 3EQ1A 2VGQA 1SVXB 2G29A 2XXPA 1MY4A 1B46A 3FVGA 4OFJA 2VHAA 4NE4A 4PFTA 2X7QA 1JETA 4BDNA 2ZYOA 3TQLA 2THIA 5CC2A 3CR9A 4NF4A 1PB9A 3RGYA 2F7CA 3T9HB 1ANFA 1FTJA 1FTLA 3R7XA 3UIFA 4ELOA 3Q28A 3G3HA 3BKIB 3TZAA 5L8DA 3FASA 1SW5A 1O64A 2ONSA 2M8CA 4JSOA 3TCFA 2DYXA 3IX1A 4I9DA 3UGWA 1TWYA 3O6GA 1TXFA 3FXRA 3D4CA 3R26A 1B7ZA 1LAXA 2B65A 2O7IA 3N94A 1QUJA 4C1UA 5DVFA 1SQYA 3SEXA 2H25A 2ABHA 4GFRA 2HZLA 1O63A 3TPAA 1JQFA 4KCCA 4PFYA 1A99A 2RCAA 4QSEA 3WAEA 2O7UA 1MY1A 4F29A 4KYEA 3A3CA 1I6QA 4KYDA 3PUYE 2RINA 1D3KA 1MXXA 4AB5A 3OEMA 3CFXA 2FNCA 3E3KA 1MQDA 3FJMA 4OXVA 1N3XA 4ESWA 4LZ7A 2QMWA 3MVWA 1XHYA 1L5TA 1MQHA 3VVFA 3BBRA 3OMBA 4G8HA 1Z7NE 3CFLA 1LAHE 2I58A 1ZIUA 4ELQA 2IEEA 4WEDA 2QPQA 1I69A 4DLDA 4ZE8A 4YKIA 5AA1A 4X1DA 4M4GA 2DVZA 3V89B 3IR1A 1SBPA 2F6PA 3ZKKA 3K00A 3V5AA 5HBCA 4R6HA 4YMAA 1LFHA 3OO9A 2ZYMA 3O66A 2F35A 5KCJA 3QSLA 2Q8JA 3OOAA 4OQOA 5I58B 2F78A 4G8MA 3T9VA 4HS7A 3KOSA 3SETA 4OETA 4AQ4A 1SYIA 3PUVE 5FHNA 1RYOA 4PFWA 4R2FA 3M8UA 3TELA 1POY1 2O51A 3U92A 4FE8A 2O6AA 1VE4A 3LSWA 5DYHA 1B5IA 1H76A 4F1UA 1B1XA 4HCYA 4DXBA 3K1NA 4C0RA 4ESXA 5I2NA 4DIGA 4NEDA 4ZEIA 1A7LA 1MXYA 1LFGA 4H1XA 3K0VA 3KJ7A 2REJA 1QKBA 2OWSA 1Y4TA 3LC8A 2RC8A 3TQWA 4NMYA 3GBAA 2NWJA 1H44A 4IY5A 2OZZA 3RTWB 4GOTA 4F31B 1B05A 3RLFE 4ONYA 3H6UA 1YTVA 2G93A 1B40A 3FVOA 3N6TA 4U4XA 4F3GA 4NF5A 3EN3A 3RT8A 4PETA 3ECRA 2HXWA 4NWDA 4IO4A 5AA2B 4JB7A 1IQ7A 5CBSA 1FTOA 3U1OA 2RC7A 5M2VA 4EQ7A 4EXKA 4U1OA 5JK4A 4FEBA 5CMCA 4FEDA 4EUOA 5DEXB 3KSJA 5DVIA 4O3BA 4F19A 1M5EA 4GIZA 2KLFA 3TFLA 3K2DA 2XX7A 4DDDA 2XD2A 2ONKE 3OD7A 3G3FA 3MP1A 3MZ1A 4GXAA 3OO8A 3USDA 3W15C 5IKBA 3G3IA 4NF6B 2Z8EA 2Z8FA 3KJTA 3TCGA 4N07A 3T22A 1LGBC 1YPNA 4R74A 4G68A 2Q2CA 5B7DA 4BDLA 2O1MA 3C9HA 2I3WA 1Y1MA 1PB8A 1D4NA 1AL3A 1M5DA 3CI8A 1B3GA 4F3SA 3MQ9A 4OEUA 5AA4A 3IL1B 1QKAA 3KEIA 2DE3A 1EZPA 5EHSA 1YAEA 5H8NA 5I2KB 2DP8A 1UTHB 1LB9A 3P7IA 3RNNA 3OENA 3KGCA 1TFAA 4IO7A 4PQJA 1BTJA 3H7MA 3SEUA 1N3WA 3K1MA 1WDNA 4F2QA 2AL5A 4DZ1A 3RPWA 2AIXA 2QMXA 4G68C 4IB2A 1URDA 2GRVA 3CG3A 3M3FA 3FXUA 2PVUA 4DE8A 1O7TA 3IOUA 1F9BA 4LONB 3VDFA 4G2ZA 2F7AA 4H65A 4WXJA 1MG1A 4KCDA 3DP8A 3GLBA 3JYRA 3K02A 3Q29A 3TTKA 1SDXA 2Y7IA 3AXFA 1MQJA 1Y3QA 4OYVA 2GHBA 4HCWA 4ZS9A 2F7BA 4G77A 2A5TA 2HCAA 4ZZEA 1I6BA 4IGTA 3HCQA 4GF8A 2DS9A 1NL5A 2XX9A 2Q9TA 1B32A 1DOTA 2P0SA 1R9LA 2Q89A 3SEVA 1HSEA 3PUXE 3ILTB 3CVGA 3TTMA 3V83A 4O3CA 2GH9A 4KQPA 3TYHA 3MC2A 5I57B 3HHFA 4BDQA 2DWJA 3EPEA 5A5XB 3B6WA 4BDRA 1ZMGA 3QK6A 2GHAA 3OSRA 2DE4A 4E0XA 1B52A 1EZ9A 4ISUA 2UVIA 3FJ7A 1SW4A 3UK4A 5CMKA 3UORA 4F1VA 1JNFA 4NF8B 1BKAA 4R2BA 1NNFA 1LSTA 4H8IA 3MVYA 5ELVA 2CZLA 2OLBA 3T9XB 5I84A 1MH4A 3RTFB 3VLVA 5HM4B 2V25A 4PFUA 2R6GE 4OZ9A 3VVDA 4BDOA 4ZECA 1NNTA 1PBPA 2UVGA 4JXIA 3UA8A 2Y7WA 1D9YA 3H6TA 4GL0A 4DXCA 1B7UA 1QJMA 4KD5A 1B3EA 3GXAA 3O97A 1JVXA 2VOZA 2F8DA 1PDAA 5H8FB 1B58A 2R9JA 3LR1A 2I3VA 3I6VA 4EF1A 3TTNA 3IO4A 4F3PA 2O68A 3S9MC 1GVCA 1CE2A 3MVXA 4RYAA 4JWYA 2VP1A 5I58A 1SYHA 2YLNA 3QUJA 4H5FA 3A09A 1I6AA 4POWA 1N0TA 2HFBA 3PV0E 3C31A 5HPQA 2XD3A 1ZKBA 3ZS6A 4R9FA 5TPAB 1S7YA 1A55A 4RY1A 2Q88A 3KN8A 4OMBA 3K4UA 2UYFA 4EDPA 5JTYB 3B7DA 4LUBA 3S4UA 3TTLA 1BLFA 2PT1A 4ZE9A 3CG1A 1NKXA 4TLMB 3MW0A 5ICQA 3MPKA 4U4SA 1A8EA 4N6PA 3BFTA 5TU0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FQE A;  1NFT A;  3THI A;  2DSF A;  4Q8R A;  2H4I A;  3EHS A;  3VE1 B;  3HPI A;  3FVK A;  3H4Z A;  2RKM A;  4FJP A;  3U93 A;  1FQF A;  2DWA A;  3C34 A;  5DT6 A;  1SW2 A;  4F3B A;  1Q1K A;  1JEV A;  4XKQ A;  3C32 A;  4QSD A;  3TOD A;  4P11 A;  2WKY A;  4KR5 A;  3H3G A;  4QF9 A;  3HST A;  4ZDM A;  3QUF A;  1S9T A;  2DWH A;  3FIR A;  3IJO B;  1NMU A;  2OWT A;  1B3F A;  5ITO A;  1IEJ A;  2XXI A;  5AA2 A;  3SEY A;  4RNS A;  5EHM A;  4XKN A;  3CSG A;  3O2A A;  1B3H A;  2NVU B;  3TKD A;  4QHQ A;  5H8S A;  1SI1 A;  4KFQ A;  3PGF A;  4QFN A;  4ND9 A;  2DXR A;  4NF4 B;  1A40 A;  1VFE A;  4P0G A;  1MXW A;  2PBW A;  2V84 A;  1UTB B;  3FAT A;  3QYT A;  1AH5 A;  1MXV A;  1B5J A;  2XX8 A;  1FTM A;  5TP9 A;  3IOT A;  4TQU Q;  1NH7 A;  4H0W A;  2V93 A;  1P1O A;  1B9J A;  1AIV A;  4QFO A;  1Y20 A;  2ANJ A;  2D3I A;  1B51 A;  4QFL A;  1XT8 A;  2RCB A;  1R6Z A;  4LVQ A;  5FTI A;  4OHN A;  3S9L C;  1P99 A;  3KZG A;  3VV5 A;  1NH8 A;  2H98 A;  4UA8 A;  4ZEB A;  1ELJ A;  4MFI A;  5I59 A;  2DXY A;  1MPC A;  4QFP A;  4DCY A;  1UTH A;  3OO7 A;  1XOC A;  4KPT A;  1DPE A;  4FAJ A;  3EHT A;  4RK2 A;  3E9X A;  3T93 B;  2HEU A;  2P2A A;  4DCX A;  1II5 A;  1MQI A;  2I48 A;  3PPO A;  2RF1 A;  2F6G A;  3N26 A;  4O3A A;  3S2V A;  3HV1 A;  3IB1 A;  3IB0 A;  2QSX A;  3LBS A;  1MDQ A;  5H8Q B;  4PP0 A;  1R1N A;  3OO6 A;  1QW0 A;  4E0W A;  3TDJ A;  1Y3N A;  3FV2 A;  4XKR A;  4YB5 A;  2F36 A;  4IO2 A;  3PPQ A;  4HW8 A;  3IB2 A;  2DWI A;  4YKP A;  1ZTY A;  3CRB A;  4ELR A;  1OVB A;  1N76 A;  2HAV A;  1FTK A;  1MPB A;  4OFO A;  3FVN A;  1WOD A;  1LCF A;  3S9N C;  5KDT A;  2ZNT A;  3MP8 A;  4GVO A;  4PE5 B;  1ZLQ A;  3IO6 A;  4JWX A;  3S9E A;  1IZ1 A;  1R9Q A;  1PB7 A;  5A5X A;  4RA1 A;  3ILU B;  4N13 A;  4YMB A;  5I2N B;  3HO7 A;  3SDF A;  1FW0 A;  3PU5 A;  1URS A;  1RYX A;  4MF3 A;  3FGS A;  4OES A;  3O6H A;  4C1T A;  4OFL A;  2UVH A;  1N04 A;  3FUZ A;  4LA9 A;  2XXQ A;  1MS7 A;  1B1H A;  2PX1 A;  3TCH A;  2OCU A;  2V3U A;  4RPN A;  2VD3 A;  1EU8 A;  3A3U A;  2W7Y A;  3OSQ A;  3CSB A;  1GTK A;  1QUK A;  4YKK A;  3TTR A;  4R6K A;  1XC1 A;  4LZ5 A;  2O1L A;  2OK2 A;  1NNP A;  3G3K A;  1USY E;  1OQG A;  4H6D A;  2B3F A;  3UN6 A;  4NWC A;  1JVY A;  1HSL A;  1SD3 A;  3C36 A;  4JDF A;  2RC9 A;  3K6U A;  1A8F A;  2Y84 A;  1RKM A;  5AE4 A;  2QJE A;  1Y9U A;  4RPO A;  2XHD A;  3MBP A;  2D5W A;  3IOR A;  3U72 A;  4GD5 A;  3L6H A;  4RJZ A;  3C35 A;  1M5F A;  3CFZ A;  4ZEF A;  2HQ0 A;  3K01 A;  5CBR A;  3QIM A;  2QS2 A;  4H5G A;  3V8X B;  4HTG A;  3FZV A;  4ECF A;  3ODB A;  2A5S A;  4YKJ A;  3QAX A;  3MWB A;  3K6X A;  3JZJ A;  1MM6 A;  4Z7E A;  2NXO A;  4G8N A;  2Y7K A;  4OVJ A;  1B5H A;  3K6W A;  3TUS A;  1B0H A;  4FOR A;  1OLA A;  3KN3 A;  4L17 A;  1VR5 A;  1FQC A;  4Q30 B;  3O6I A;  3MUQ A;  1OQH A;  5BUU A;  3LSX A;  4UAC A;  3PMX A;  1D9V A;  4G68 B;  3IAZ A;  4JSD A;  1EH3 A;  4RK9 A;  4EXL A;  3RQT A;  4AB6 A;  1IIT A;  1DTZ A;  2E1S A;  4IO6 A;  4XTC Q;  5L9O A;  1MY2 A;  5AA4 B;  2HZK A;  4Z0I A;  4FAT A;  2F97 A;  4EF2 A;  5H8N B;  2O69 A;  1CB6 A;  1Y3P A;  5F1Q A;  3OEL A;  1Y4C A;  2H9B A;  5JEI A;  3VVE A;  2AYS A;  3SES A;  2ZNU A;  2Z22 A;  3VLW A;  3FV1 A;  2XXT A;  3I5O A;  2BJJ X;  5I56 B;  3KOT A;  3E4R A;  3K6V A;  1Z7M E;  1JEU A;  4WEP A;  1LB8 A;  1DTG A;  5H8H B;  1OIB A;  1PEB A;  2Y7R A;  5CMB A;  4BDM A;  5CRY A;  1UTB A;  1VSO A;  1T0K A;  3EF7 A;  2A5T B;  3F11 A;  3VXB A;  4KYS A;  1B4Z A;  4P0I A;  3PPN A;  4ZED A;  3KSX A;  4FIM A;  4LZ8 A;  3U8Q A;  1S50 A;  2HAU A;  4NTL A;  2NUV A;  2X7P A;  1URG A;  2I49 A;  2REG A;  2ZNS A;  1Y1Z A;  2V3Q A;  4QSC A;  1P1U A;  3W9V A;  2AL4 A;  1IXC A;  5FTH A;  1HSJ A;  1JW1 A;  3MVZ A;  4GQO A;  3C33 A;  5IAI A;  2R71 A;  1IXG A;  3UP9 A;  3O9P A;  1US5 A;  1USY H;  2PT2 A;  3H6W A;  3ONM A;  4H8J A;  4R6Y A;  1GGG A;  3TMG A;  3H6V A;  5CMM A;  4ZEK A;  1POT A;  1JW5 A;  1N84 A;  2DVC A;  4R73 A;  1TT1 A;  1P1Q A;  3FXQ A;  2IA4 A;  4ELP A;  4Q0C A;  2DQV A;  1H3D A;  2PYY A;  2UVJ A;  2QS3 A;  3IOV A;  1PBQ A;  2D21 A;  1GR2 A;  1LFI A;  4QRZ A;  4OEN A;  5H8Q A;  5DVJ A;  1MY0 A;  1XVY A;  1ZJL A;  3T9U A;  4EQ9 A;  5DEX A;  4F2O A;  2XXR A;  1UIV A;  3FD3 A;  1BIY A;  3C4M A;  3MAM A;  4GXS B;  3T96 B;  4H67 A;  4KI0 E;  4GL8 A;  2H5Y A;  3MZB A;  4RXL A;  1H43 A;  3IK6 B;  1H45 A;  4BLA A;  4F1Y A;  5AA2 D;  2V3T A;  3SKP A;  4U2R A;  3T66 A;  1B3L A;  3IOW A;  4I1D A;  4NF6 A;  4IO5 A;  1WVJ A;  2OJT A;  3O28 A;  4FEC A;  1DPP A;  4JWO A;  2PMS A;  1ZBM A;  2ESN A;  4F22 A;  3VFJ A;  1A54 A;  3DEL B;  4TOZ A;  1QUI A;  4X48 A;  4LAT A;  3QXM A;  4U21 A;  2QS1 A;  4YB7 A;  2F5X A;  2FYI A;  3Q26 A;  5CM6 A;  3TEP A;  4F39 A;  2Q2A A;  4KHZ E;  4X9T A;  5I2K A;  1LBB A;  5K2Y A;  5F7V A;  3RY3 A;  1AOV A;  4U22 A;  2ZMB A;  1UQW A;  5DTB A;  4THI A;  1IIW A;  3OEK A;  3D4G A;  2P1S A;  3B6T A;  2ZYN A;  2XXW A;  1FQD A;  3FJG A;  3RN8 A;  3U94 A;  4MH5 A;  3LUY A;  3H03 A;  1UIU A;  1OVT A;  3Q25 A;  4XXU A;  1US4 A;  2UYE A;  1MY3 A;  3DM0 A;  1B0L A;  3KFM A;  4QFK A;  3B6Q A;  1QVS A;  4POX A;  4XIG Q;  1MXU A;  5L9S A;  1J1N A;  3JV9 A;  3N6U A;  1KWH A;  3VLU A;  2XXH A;  3M3K A;  3WAF A;  5BWJ A;  4OER A;  4GWO A;  5L9M A;  3N5L A;  3MP6 A;  3H06 B;  1DMB A;  5FHM A;  1OMP A;  1B4H A;  3R6U A;  1MPD A;  3PUW E;  4R72 A;  3LSL A;  2DOJ A;  2ALU A;  3KN7 A;  1P1N A;  3IJX B;  5K2X A;  3RT6 B;  2LAO A;  5KCJ B;  2UXA A;  1MXZ A;  4YU0 A;  1TFD A;  2QRY A;  2B3B A;  2QS4 A;  1MDP 1;  4GRK A;  1B7H A;  1Q35 A;  4I8C A;  3OXN A;  1SI0 A;  3E13 X;  4EQB A;  5I57 A;  5B70 A;  4LP2 B;  1MQG A;  1JW4 A;  2GFE A;  1MRP A;  1N7W A;  5TP9 B;  3PPP A;  4LQ2 A;  3DLN A;  2ONR A;  2Z23 A;  1N7X A;  1B6H A;  3RUM A;  4TLL B;  3PD8 A;  1DSN A;  2O84 X;  4DXU A;  4OEV A;  2F34 A;  1LBC A;  5LOM A;  1P1W A;  1LCT A;  4NF8 A;  5ISU A;  2YJP A;  3HN0 A;  3GBB A;  5ICT A;  2ZXT A;  4WKM A;  3G3J A;  2XXV A;  1LLS A;  2XXU A;  4MLV A;  3MPL A;  5I59 B;  1SW1 A;  1VFD A;  2Y7P A;  3O29 A;  2DE2 A;  2H99 A;  3PMW A;  3HHG A;  1M5B A;  2QL3 A;  3DP6 A;  3Q27 A;  1M5C A;  5EYF A;  1IUD A;  3M3L A;  4NF5 B;  3SER A;  2CMO A;  1NNK A;  2E0S A;  2I6E A;  1MM7 A;  5H8F A;  1GV8 A;  4MBP A;  4JBZ A;  5I56 A;  1PC3 A;  2FA7 A;  4LQ5 A;  3TAJ A;  4MLQ A;  1ATG A;  4ZZA A;  3PPR A;  3LSF B;  3SEW A;  1XS5 A;  3G3G A;  4M1V A;  5ITP A;  5AA3 A;  5H8H A;  4G4P A;  3L6G A;  5CI5 A;  1ZU0 A;  2YPN A;  1LAF E;  4R9G A;  5TPA A;  1FCK A;  4R75 A;  3PMV A;  2I0C A;  4IGR A;  4IO3 A;  1IXI A;  1FQA A;  4GLI A;  3ZKL A;  3ZSF A;  1IXH A;  1BP5 A;  5JTY A;  4OTE A;  3EHU A;  2NOO A;  4OWD A;  4X1B A;  2X26 A;  2VD2 A;  3VXC A;  3MJN A;  4I62 A;  5KDT B;  2I0B A;  1B2H A;  4YIC A;  3PD9 A;  3PUZ E;  4K3F A;  4YAH X;  2XXX A;  3KBR A;  4YB6 A;  1QUL A;  4IY6 A;  2I4C A;  5J1D A;  2ZYK A;  1AMF A;  3KG2 A;  3I3V A;  1XVX A;  1EZO A;  4F18 A;  1MH3 A;  1LAG E;  5FHO A;  4YZZ A;  1FQB A;  3G7W A;  4U23 A;  4XKP A;  4Q5T A;  3K1P A;  4U1Z A;  1YCJ A;  3GZG A;  3CIJ A;  3DP4 A;  2XXY A;  2OBG A;  3BFU A;  1OLC A;  2Z8D A;  3MZ9 A;  2I4B A;  3W9W A;  5KZT A;  3EQ1 A;  2VGQ A;  1SVX B;  2G29 A;  2XXP A;  1MY4 A;  1B46 A;  3FVG A;  4OFJ A;  2VHA A;  4NE4 A;  4PFT A;  2X7Q A;  1JET A;  4BDN A;  2ZYO A;  3TQL A;  2THI A;  5CC2 A;  3CR9 A;  4NF4 A;  1PB9 A;  3RGY A;  2F7C A;  3T9H B;  1ANF A;  1FTJ A;  1FTL A;  3R7X A;  3UIF A;  4ELO A;  3Q28 A;  3G3H A;  3BKI B;  3TZA A;  5L8D A;  3FAS A;  1SW5 A;  1O64 A;  2ONS A;  2M8C A;  4JSO A;  3TCF A;  2DYX A;  3IX1 A;  4I9D A;  3UGW A;  1TWY A;  3O6G A;  1TXF A;  3FXR A;  3D4C A;  3R26 A;  1B7Z A;  1LAX A;  2B65 A;  2O7I A;  3N94 A;  1QUJ A;  4C1U A;  5DVF A;  1SQY A;  3SEX A;  2H25 A;  2ABH A;  4GFR A;  2HZL A;  1O63 A;  3TPA A;  1JQF A;  4KCC A;  4PFY A;  1A99 A;  2RCA A;  4QSE A;  3WAE A;  2O7U A;  1MY1 A;  4F29 A;  4KYE A;  3A3C A;  1I6Q A;  4KYD A;  3PUY E;  2RIN A;  1D3K A;  1MXX A;  4AB5 A;  3OEM A;  3CFX A;  2FNC A;  3E3K A;  1MQD A;  3FJM A;  4OXV A;  1N3X A;  4ESW A;  4LZ7 A;  2QMW A;  3MVW A;  1XHY A;  1L5T A;  1MQH A;  3VVF A;  3BBR A;  3OMB A;  4G8H A;  1Z7N E;  3CFL A;  1LAH E;  2I58 A;  1ZIU A;  4ELQ A;  2IEE A;  4WED A;  2QPQ A;  1I69 A;  4DLD A;  4ZE8 A;  4YKI A;  5AA1 A;  4X1D A;  4M4G A;  2DVZ A;  3V89 B;  3IR1 A;  1SBP A;  2F6P A;  3ZKK A;  3K00 A;  3V5A A;  5HBC A;  4R6H A;  4YMA A;  1LFH A;  3OO9 A;  2ZYM A;  3O66 A;  2F35 A;  5KCJ A;  3QSL A;  2Q8J A;  3OOA A;  4OQO A;  5I58 B;  2F78 A;  4G8M A;  3T9V A;  4HS7 A;  3KOS A;  3SET A;  4OET A;  4AQ4 A;  1SYI A;  3PUV E;  5FHN A;  1RYO A;  4PFW A;  4R2F A;  3M8U A;  3TEL A;  1POY 1;  2O51 A;  3U92 A;  4FE8 A;  2O6A A;  1VE4 A;  3LSW A;  5DYH A;  1B5I A;  1H76 A;  4F1U A;  1B1X A;  4HCY A;  4DXB A;  3K1N A;  4C0R A;  4ESX A;  5I2N A;  4DIG A;  4NED A;  4ZEI A;  1A7L A;  1MXY A;  1LFG A;  4H1X A;  3K0V A;  3KJ7 A;  2REJ A;  1QKB A;  2OWS A;  1Y4T A;  3LC8 A;  2RC8 A;  3TQW A;  4NMY A;  3GBA A;  2NWJ A;  1H44 A;  4IY5 A;  2OZZ A;  3RTW B;  4GOT A;  4F31 B;  1B05 A;  3RLF E;  4ONY A;  3H6U A;  1YTV A;  2G93 A;  1B40 A;  3FVO A;  3N6T A;  4U4X A;  4F3G A;  4NF5 A;  3EN3 A;  3RT8 A;  4PET A;  3ECR A;  2HXW A;  4NWD A;  4IO4 A;  5AA2 B;  4JB7 A;  1IQ7 A;  5CBS A;  1FTO A;  3U1O A;  2RC7 A;  5M2V A;  4EQ7 A;  4EXK A;  4U1O A;  5JK4 A;  4FEB A;  5CMC A;  4FED A;  4EUO A;  5DEX B;  3KSJ A;  5DVI A;  4O3B A;  4F19 A;  1M5E A;  4GIZ A;  2KLF A;  3TFL A;  3K2D A;  2XX7 A;  4DDD A;  2XD2 A;  2ONK E;  3OD7 A;  3G3F A;  3MP1 A;  3MZ1 A;  4GXA A;  3OO8 A;  3USD A;  3W15 C;  5IKB A;  3G3I A;  4NF6 B;  2Z8E A;  2Z8F A;  3KJT A;  3TCG A;  4N07 A;  3T22 A;  1LGB C;  1YPN A;  4R74 A;  4G68 A;  2Q2C A;  5B7D A;  4BDL A;  2O1M A;  3C9H A;  2I3W A;  1Y1M A;  1PB8 A;  1D4N A;  1AL3 A;  1M5D A;  3CI8 A;  1B3G A;  4F3S A;  3MQ9 A;  4OEU A;  5AA4 A;  3IL1 B;  1QKA A;  3KEI A;  2DE3 A;  1EZP A;  5EHS A;  1YAE A;  5H8N A;  5I2K B;  2DP8 A;  1UTH B;  1LB9 A;  3P7I A;  3RNN A;  3OEN A;  3KGC A;  1TFA A;  4IO7 A;  4PQJ A;  1BTJ A;  3H7M A;  3SEU A;  1N3W A;  3K1M A;  1WDN A;  4F2Q A;  2AL5 A;  4DZ1 A;  3RPW A;  2AIX A;  2QMX A;  4G68 C;  4IB2 A;  1URD A;  2GRV A;  3CG3 A;  3M3F A;  3FXU A;  2PVU A;  4DE8 A;  1O7T A;  3IOU A;  1F9B A;  4LON B;  3VDF A;  4G2Z A;  2F7A A;  4H65 A;  4WXJ A;  1MG1 A;  4KCD A;  3DP8 A;  3GLB A;  3JYR A;  3K02 A;  3Q29 A;  3TTK A;  1SDX A;  2Y7I A;  3AXF A;  1MQJ A;  1Y3Q A;  4OYV A;  2GHB A;  4HCW A;  4ZS9 A;  2F7B A;  4G77 A;  2A5T A;  2HCA A;  4ZZE A;  1I6B A;  4IGT A;  3HCQ A;  4GF8 A;  2DS9 A;  1NL5 A;  2XX9 A;  2Q9T A;  1B32 A;  1DOT A;  2P0S A;  1R9L A;  2Q89 A;  3SEV A;  1HSE A;  3PUX E;  3ILT B;  3CVG A;  3TTM A;  3V83 A;  4O3C A;  2GH9 A;  4KQP A;  3TYH A;  3MC2 A;  5I57 B;  3HHF A;  4BDQ A;  2DWJ A;  3EPE A;  5A5X B;  3B6W A;  4BDR A;  1ZMG A;  3QK6 A;  2GHA A;  3OSR A;  2DE4 A;  4E0X A;  1B52 A;  1EZ9 A;  4ISU A;  2UVI A;  3FJ7 A;  1SW4 A;  3UK4 A;  5CMK A;  3UOR A;  4F1V A;  1JNF A;  4NF8 B;  1BKA A;  4R2B A;  1NNF A;  1LST A;  4H8I A;  3MVY A;  5ELV A;  2CZL A;  2OLB A;  3T9X B;  5I84 A;  1MH4 A;  3RTF B;  3VLV A;  5HM4 B;  2V25 A;  4PFU A;  2R6G E;  4OZ9 A;  3VVD A;  4BDO A;  4ZEC A;  1NNT A;  1PBP A;  2UVG A;  4JXI A;  3UA8 A;  2Y7W A;  1D9Y A;  3H6T A;  4GL0 A;  4DXC A;  1B7U A;  1QJM A;  4KD5 A;  1B3E A;  3GXA A;  3O97 A;  1JVX A;  2VOZ A;  2F8D A;  1PDA A;  5H8F B;  1B58 A;  2R9J A;  3LR1 A;  2I3V A;  3I6V A;  4EF1 A;  3TTN A;  3IO4 A;  4F3P A;  2O68 A;  3S9M C;  1GVC A;  1CE2 A;  3MVX A;  4RYA A;  4JWY A;  2VP1 A;  5I58 A;  1SYH A;  2YLN A;  3QUJ A;  4H5F A;  3A09 A;  1I6A A;  4POW A;  1N0T A;  2HFB A;  3PV0 E;  3C31 A;  5HPQ A;  2XD3 A;  1ZKB A;  3ZS6 A;  4R9F A;  5TPA B;  1S7Y A;  1A55 A;  4RY1 A;  2Q88 A;  3KN8 A;  4OMB A;  3K4U A;  2UYF A;  4EDP A;  5JTY B;  3B7D A;  4LUB A;  3S4U A;  3TTL A;  1BLF A;  2PT1 A;  4ZE9 A;  3CG1 A;  1NKX A;  4TLM B;  3MW0 A;  5ICQ A;  3MPK A;  4U4S A;  1A8E A;  4N6P A;  3BFT A;  5TU0 A; 
#chains in the Genus database with same CATH topology
 1FQE A;  1NFT A;  3THI A;  2V4C A;  2DSF A;  4Q8R A;  2H4I A;  3EHS A;  3VE1 B;  3HPI A;  2CEY A;  3FVK A;  3H4Z A;  2RKM A;  4FJP A;  3U93 A;  1FQF A;  2DWA A;  3C34 A;  5DT6 A;  1SW2 A;  4F3B A;  1Q1K A;  2OX3 A;  1JEV A;  4XKQ A;  3C32 A;  1QGX A;  4QSD A;  3TOD A;  4P11 A;  2XWK A;  2WKY A;  1FJ9 A;  4KR5 A;  3H3G A;  4QF9 A;  3HST A;  4ZDM A;  3QUF A;  1S9T A;  4AS5 A;  2DWH A;  3FIR A;  3IJO B;  1NMU A;  2OWT A;  1B3F A;  5ITO A;  1IEJ A;  2XXI A;  5AA2 A;  3SEY A;  4RNS A;  5EHM A;  4XKN A;  1FPD A;  3CSG A;  4GWX A;  3O2A A;  4XEQ A;  1B3H A;  4AS4 A;  5ESY A;  2NVU B;  3TKD A;  4HE2 A;  4QXD A;  4QHQ A;  5H8S A;  1SI1 A;  4KFQ A;  3PGF A;  2HXR A;  4QFN A;  4ND9 A;  2PFY A;  4GX4 A;  4PAK A;  2DXR A;  4NF4 B;  1A40 A;  1VFE A;  4P0G A;  4PFB A;  1MXW A;  2PBW A;  2V84 A;  3GYY A;  2XWI A;  1UTB B;  3FAT A;  4GWS A;  3QYT A;  1AH5 A;  1MXV A;  2FIX A;  5A5L A;  4MNP A;  1B5J A;  2XX8 A;  1FTM A;  5TP9 A;  4TQU Q;  2VT5 A;  3IOT A;  1NH7 A;  2JJK A;  2V93 A;  1P1O A;  4H0W A;  1B9J A;  1AIV A;  4QFO A;  1Y20 A;  2ANJ A;  2D3I A;  1B51 A;  4QFL A;  1XT8 A;  2RCB A;  1R6Z A;  4LVQ A;  5FTI A;  4PDH A;  4OHN A;  3S9L C;  1P99 A;  5I7I A;  3KZG A;  3VV5 A;  1NH8 A;  2H98 A;  4UA8 A;  4ZEB A;  1ELJ A;  4MFI A;  5I59 A;  2DXY A;  1MPC A;  4QFP A;  4DCY A;  1UTH A;  3OO7 A;  3HFU A;  1XOC A;  4KPT A;  1DPE A;  4GWW A;  2WBD A;  4FAJ A;  3A29 A;  3EHT A;  4RK2 A;  3E9X A;  3T93 B;  2HEU A;  2P2A A;  4DCX A;  1II5 A;  1MQI A;  2I48 A;  3PPO A;  1INP A;  2BJI A;  2RF1 A;  2F6G A;  3BIG A;  3N26 A;  4O3A A;  3S2V A;  3HV1 A;  3IB1 A;  1EYJ A;  3IB0 A;  2QSX A;  4OVR A;  3LBS A;  1MDQ A;  5H8Q B;  4PP0 A;  1R1N A;  3OO6 A;  4MJO A;  1QW0 A;  4E0W A;  1Y3N A;  3TDJ A;  3FV2 A;  4XKR A;  4YB5 A;  2F36 A;  2PFZ A;  4IO2 A;  1NV7 A;  3PPQ A;  4HW8 A;  1NUZ A;  2B4L A;  3IB2 A;  1IMC A;  2DWI A;  4YKP A;  1ZTY A;  3CRB A;  4ELR A;  1NV3 A;  1OVB A;  1N76 A;  2HAV A;  1FTK A;  1MPB A;  4NGU A;  4OFO A;  4MNI A;  3FVN A;  1WOD A;  1LCF A;  3S9N C;  5KDT A;  4O7I A;  2ZNT A;  3MP8 A;  4GVO A;  3FXB A;  4PE5 B;  2OWZ A;  1ZLQ A;  3IO6 A;  4JWX A;  3S9E A;  1CNQ A;  1IZ1 A;  1R9Q A;  1PB7 A;  5A5X A;  4RA1 A;  3ILU B;  4N13 A;  4YMB A;  5I2N B;  5IZZ A;  3HO7 A;  3SDF A;  1FW0 A;  3PU5 A;  1URS A;  1RYX A;  4MF3 A;  3FGS A;  4OES A;  3O6H A;  4C1T A;  4OFL A;  2UVH A;  1N04 A;  3FUZ A;  4LA9 A;  2XXQ A;  1MS7 A;  1B1H A;  2PX1 A;  3TCH A;  2OCU A;  3ROJ A;  2V3U A;  4RPN A;  2VD3 A;  1EU8 A;  3A3U A;  2W7Y A;  3OSQ A;  3CSB A;  1RDY A;  1GTK A;  1QUK A;  4YKK A;  3TTR A;  4R6K A;  5IZ3 B;  1XC1 A;  4LZ5 A;  2O1L A;  2OK2 A;  1NNP A;  3G3K A;  1USY E;  1BK4 A;  4N17 A;  3ISP A;  1OQG A;  4H6D A;  2B3F A;  3UN6 A;  4NWC A;  1JVY A;  1HSL A;  1NV0 A;  1FBC A;  1SD3 A;  3C36 A;  4JDF A;  2RC9 A;  3K6U A;  5I5P A;  1A8F A;  2Y84 A;  1RKM A;  5AE4 A;  2QJE A;  1Y9U A;  4RPO A;  2XHD A;  1K9Y A;  3MBP A;  2D5W A;  2Y5K A;  3IOR A;  3U72 A;  4GD5 A;  3L6H A;  4RJZ A;  3C35 A;  1M5F A;  3CFZ A;  4ZEF A;  4PF8 A;  4N6D A;  2HQ0 A;  3K01 A;  2ZZW A;  5CBR A;  1G0I A;  3QIM A;  2QS2 A;  4H5G A;  3V8X B;  4HTG A;  3FZV A;  4OVP A;  4ECF A;  3ODB A;  4IR8 A;  2A5S A;  4YKJ A;  3QAX A;  4N4U A;  3MWB A;  3K6X A;  3JZJ A;  1MM6 A;  3D1R A;  4PCD A;  4Z7E A;  2NXO A;  4G8N A;  2QVR A;  2Y7K A;  4OVJ A;  1B5H A;  3K6W A;  3TUS A;  1B0H A;  4FOR A;  1OLA A;  3KN3 A;  4L17 A;  1VR5 A;  1FQC A;  4Q30 B;  3O6I A;  3MUQ A;  1OQH A;  5BUU A;  3LSX A;  2CZH A;  4UAC A;  3PMX A;  1D9V A;  4MX6 A;  4G68 B;  3IAZ A;  4JSD A;  1EH3 A;  4RK9 A;  4EXL A;  3RQT A;  4AB6 A;  1IIT A;  1DTZ A;  2E1S A;  4IO6 A;  4XFE A;  4XTC Q;  5L9O A;  1MY2 A;  5AA4 B;  2HZK A;  2FHY A;  4Z0I A;  4FAT A;  2F97 A;  4EF2 A;  5H8N B;  2ZZV A;  2O69 A;  1CB6 A;  1Y3P A;  2HHM A;  4X8R A;  5F1Q A;  3OEL A;  1Y4C A;  4PFI A;  2H9B A;  4DI4 B;  4GBW A;  5EYG A;  5JEI A;  3VVE A;  2AYS A;  3SES A;  2ZNU A;  2Z22 A;  3VLW A;  3FV1 A;  2XXT A;  3I5O A;  2BJJ X;  3RPL B;  5I56 B;  3KOT A;  5IM2 A;  3E4R A;  3K6V A;  1Z7M E;  1JEU A;  4WEP A;  4MNC A;  1LB8 A;  1DTG A;  5H8H B;  1OIB A;  1PEB A;  2Y7R A;  5CMB A;  4OAN A;  4BDM A;  3BIH A;  5CRY A;  1UTB A;  1VSO A;  1T0K A;  3EF7 A;  4PGN A;  2A5T B;  2KR0 A;  3F11 A;  3VXB A;  4KYS A;  1B4Z A;  4P0I A;  3PPN A;  4N8Y A;  4ZED A;  3KSX A;  4FIM A;  4LZ8 A;  1NUW A;  3U8Q A;  1S50 A;  2HAU A;  4NTL A;  2NUV A;  2X7P A;  1URG A;  2I49 A;  2REG A;  2ZNS A;  4MAG A;  1Y1Z A;  2V3Q A;  4QSC A;  1P1U A;  4UAB A;  3W9V A;  2AL4 A;  1IXC A;  5FTH A;  1HSJ A;  1JW1 A;  5IGA A;  3MVZ A;  4GQO A;  3C33 A;  5IAI A;  2R71 A;  1IXG A;  3UP9 A;  3O9P A;  1US5 A;  1USY H;  2PT2 A;  3H6W A;  3ONM A;  4H8J A;  4R6Y A;  4HXV A;  1GGG A;  3TMG A;  3H6V A;  5CMM A;  4ZEK A;  1POT A;  1JW5 A;  1N84 A;  2DVC A;  4R73 A;  1TT1 A;  1P1Q A;  1FPJ A;  3FXQ A;  2IA4 A;  4ELP A;  1Q9D A;  4Q0C A;  2DQV A;  1LBY A;  1H3D A;  2PYY A;  5EYH A;  2UVJ A;  2QS3 A;  5EQ8 A;  2WYP A;  1G0H A;  3IOV A;  1PBQ A;  2D21 A;  1GR2 A;  1LFI A;  4NHB A;  4QRZ A;  4OEN A;  5H8Q A;  5DVJ A;  1MY0 A;  1XVY A;  1ZJL A;  3T9U A;  4EQ9 A;  4I3E A;  5DEX A;  4PE3 A;  4F2O A;  2XXR A;  2F3B A;  1UIV A;  4PAI A;  3FD3 A;  1BIY A;  3C4M A;  3MAM A;  4GXS B;  3T96 B;  4H67 A;  4KI0 E;  4GL8 A;  2H5Y A;  3MZB A;  4RXL A;  1H43 A;  3IK6 B;  1H45 A;  4BLA A;  4F1Y A;  5AA2 D;  2V3T A;  3SKP A;  4U2R A;  3T66 A;  1B3L A;  3IOW A;  4PAF A;  4I1D A;  4NF6 A;  4IO5 A;  1WVJ A;  2OJT A;  3O28 A;  4FEC A;  2Q8M A;  4N6K A;  1DPP A;  4JWO A;  4PTK A;  2PMS A;  1ZBM A;  2ESN A;  4GWZ A;  3VFJ A;  4F22 A;  1A54 A;  3DEL B;  4TOZ A;  1QUI A;  4X48 A;  4LAT A;  3QXM A;  4U21 A;  4NF0 A;  3KC0 A;  5LTC A;  2QS1 A;  4MIJ A;  4YB7 A;  2F5X A;  2HPG A;  2PCR A;  2FYI A;  3Q26 A;  5CM6 A;  3TEP A;  4F39 A;  2Q2A A;  1NV1 A;  4KHZ E;  4X9T A;  5I2K A;  1FPE A;  1LBB A;  5K2Y A;  5F7V A;  3RY3 A;  4LN5 A;  1AOV A;  4U22 A;  2ZMB A;  1UQW A;  5DTB A;  4THI A;  1IIW A;  3OEK A;  3D4G A;  2P1S A;  4OVQ A;  3B6T A;  2ZYN A;  1NV5 A;  1YZ0 A;  2QFL A;  2XXW A;  1FQD A;  3EKI A;  3FJG A;  4N91 A;  3RN8 A;  2CEX A;  3U94 A;  4MH5 A;  3LUY A;  5IZ3 A;  3H03 A;  1UIU A;  1OVT A;  3Q25 A;  4XXU A;  1US4 A;  2UYE A;  1MY3 A;  3DM0 A;  1B0L A;  3KFM A;  4QFK A;  3B6Q A;  1QVS A;  4POX A;  4XIG Q;  1MXU A;  5L9S A;  1J1N A;  3JV9 A;  3N6U A;  1KWH A;  3VLU A;  2XXH A;  3CHG A;  3M3K A;  3WAF A;  5BWJ A;  4OER A;  4GWO A;  5L9M A;  3N5L A;  3MP6 A;  3H06 B;  1DMB A;  5FHM A;  1OMP A;  1B4H A;  3R6U A;  4G61 A;  1MPD A;  3PUW E;  4R72 A;  3LSL A;  2DOJ A;  2ALU A;  3KN7 A;  1P1N A;  3IJX B;  5K2X A;  4MCO A;  3RT6 B;  2LAO A;  5KCJ B;  2UXA A;  1MXZ A;  4YU0 A;  1TFD A;  2QRY A;  2B3B A;  2QS4 A;  1MDP 1;  4GRK A;  3RYD A;  1B7H A;  1Q35 A;  3T1B A;  4I8C A;  1VDW A;  1FPG A;  3OXN A;  3U65 A;  1SI0 A;  3E13 X;  1DBZ A;  1YYZ A;  4EQB A;  5IZ1 A;  5I57 A;  5B70 A;  3T0J A;  4LP2 B;  1MQG A;  1JW4 A;  2GFE A;  1MRP A;  1N7W A;  5TP9 B;  3PPP A;  4LQ2 A;  3B8B A;  3DLN A;  2ONR A;  2Z23 A;  1N7X A;  1B6H A;  3RUM A;  4TLL B;  3PD8 A;  4N81 A;  1DSN A;  2O84 X;  4DXU A;  4OEV A;  2F34 A;  1LBC A;  4OA4 A;  5LOM A;  1P1W A;  1LCT A;  1IMF A;  4NF8 A;  5ISU A;  2YJP A;  3HN0 A;  3GBB A;  5ICT A;  2ZXT A;  4WKM A;  3G3J A;  2XXV A;  1LLS A;  2XXU A;  4MLV A;  1NUY A;  3MPL A;  5I59 B;  1SW1 A;  1VFD A;  1XI6 A;  2Y7P A;  3O29 A;  2DE2 A;  4JVC A;  2H99 A;  3PMW A;  3HHG A;  1M5B A;  4MMP A;  2QL3 A;  3DP6 A;  3Q27 A;  1M5C A;  5EYF A;  1LBX A;  1IUD A;  3M3L A;  4NF5 B;  3SER A;  2CMO A;  1NNK A;  2E0S A;  2I6E A;  1MM7 A;  5H8F A;  3RPL A;  1GV8 A;  4MBP A;  4JBZ A;  5I56 A;  2XA5 A;  1PC3 A;  2FA7 A;  3E79 A;  4LQ5 A;  3TAJ A;  4MLQ A;  1ATG A;  4ZZA A;  3PPR A;  3LSF B;  3SEW A;  1XS5 A;  3G3G A;  4M1V A;  5ITP A;  5AA3 A;  5H8H A;  3KBZ A;  3IFC A;  4G4P A;  3L6G A;  5CI5 A;  1ZU0 A;  2YPN A;  1LAF E;  4R9G A;  5TPA A;  1LEV A;  1FCK A;  4R75 A;  3PMV A;  2I0C A;  5F24 A;  4IGR A;  4IO3 A;  1IXI A;  1FQA A;  4GLI A;  3ZKL A;  3ZSF A;  1IXH A;  1BP5 A;  5JTY A;  4OTE A;  3EHU A;  2NOO A;  4OWD A;  4X1B A;  2X26 A;  2VD2 A;  3VXC A;  3MJN A;  4I62 A;  5KDT B;  2I0B A;  1B2H A;  4YIC A;  3PD9 A;  3PUZ E;  3MYU A;  4K3F A;  4YAH X;  2XXX A;  4P56 A;  3KBR A;  4YB6 A;  1QUL A;  4IY6 A;  2I4C A;  2Q74 A;  5J1D A;  4O8M A;  2GQ1 A;  2ZYK A;  1AMF A;  1DK4 A;  2XWO A;  3KG2 A;  3I3V A;  1XVX A;  1EZO A;  4PBQ A;  4F18 A;  1MH3 A;  3KC1 A;  4DI3 D;  1LAG E;  5FHO A;  4YZZ A;  1FQB A;  3G7W A;  4GBV A;  4U23 A;  4XKP A;  4Q5T A;  3K1P A;  2VPO A;  4PF6 A;  4U1Z A;  1YCJ A;  3GZG A;  3CIJ A;  1LBW A;  3DP4 A;  2XXY A;  1EYI A;  2OBG A;  3BFU A;  5ET7 A;  1OLC A;  2Z8D A;  3MZ9 A;  2I4B A;  3W9W A;  1FRP A;  5KZT A;  3EQ1 A;  2VGQ A;  4PDD A;  1SVX B;  2G29 A;  2XXP A;  2MKZ A;  1MY4 A;  1B46 A;  3FVG A;  1FBP A;  4OFJ A;  2VHA A;  4NE4 A;  4PFT A;  2X7Q A;  1JET A;  4BDN A;  2ZYO A;  3TQL A;  2THI A;  5CC2 A;  3CR9 A;  5I3S A;  4NF4 A;  1PB9 A;  3RGY A;  2F7C A;  3T9H B;  2F3D A;  1ANF A;  1FTJ A;  1FTL A;  3R7X A;  3UIF A;  4ELO A;  3Q28 A;  3G3H A;  3BKI B;  3TZA A;  5L8D A;  5J16 A;  1IMB A;  3FAS A;  4JVD A;  1SW5 A;  1O64 A;  2ONS A;  2M8C A;  4JSO A;  3TCF A;  2B4M A;  2DYX A;  3IX1 A;  1FPB A;  1NI9 A;  4I9D A;  3UGW A;  1TWY A;  3O6G A;  1TXF A;  3FXR A;  1FPL A;  3D4C A;  3R26 A;  1B7Z A;  3SZP A;  1LAX A;  2B65 A;  2O7I A;  5LDZ A;  3N94 A;  1QUJ A;  4C1U A;  5DVF A;  1SQY A;  3SEX A;  2H25 A;  2ABH A;  4GFR A;  2HZL A;  1O63 A;  3TPA A;  1JQF A;  4KCC A;  4PFY A;  4NQ8 A;  1A99 A;  2RCA A;  4QSE A;  3WAE A;  2O7U A;  1MY1 A;  5EQ9 A;  4F29 A;  4KYE A;  3A3C A;  5ET6 A;  4P1L A;  1I6Q A;  4KYD A;  1JP4 A;  3PUY E;  2RIN A;  1D3K A;  1MXX A;  4AB5 A;  4P47 A;  1FPK A;  3OEM A;  4PC9 A;  3CFX A;  2FNC A;  3E3K A;  1MQD A;  3FJM A;  4OXV A;  1N3X A;  4ESW A;  4LZ7 A;  2QMW A;  3MVW A;  1XHY A;  1L5T A;  1MQH A;  3VVF A;  3BBR A;  3OMB A;  4G8H A;  1Z7N E;  4PBH A;  3CFL A;  2Y5L A;  1LAH E;  2I58 A;  4O7M A;  1ZIU A;  1IMD A;  4ELQ A;  2IEE A;  4WED A;  2QPQ A;  1I69 A;  4XF5 A;  4DLD A;  4ZE8 A;  4YKI A;  5AA1 A;  4X1D A;  4M4G A;  2DVZ A;  3MST A;  1IMA A;  3V89 B;  1LBZ A;  3IR1 A;  1SBP A;  2F6P A;  3ZKK A;  3K00 A;  2WYK A;  3V5A A;  5HBC A;  1RDX A;  4R6H A;  4YMA A;  1LFH A;  3OO9 A;  2ZYM A;  3O66 A;  2F35 A;  5KCJ A;  3QSL A;  2Q8J A;  3OOA A;  4OQO A;  4P9K A;  5I58 B;  3IFA A;  2F78 A;  4G8M A;  3T9V A;  4HS7 A;  3KOS A;  3SET A;  4OET A;  4AQ4 A;  1SYI A;  3PUV E;  5FHN A;  1RYO A;  4PFW A;  4H45 A;  4R2F A;  3M8U A;  3TEL A;  1FBE A;  1POY 1;  2O51 A;  3U92 A;  4FE8 A;  4OVS A;  2O6A A;  1VE4 A;  3LSW A;  5DYH A;  1B5I A;  1H76 A;  4F1U A;  1B1X A;  4HCY A;  4DXB A;  4P3L A;  3K1N A;  4C0R A;  4ESX A;  5I2N A;  2CZI A;  4MHF A;  4DIG A;  4NED A;  4ZEI A;  1A7L A;  1MXY A;  2FBP A;  1LFG A;  4OVT A;  4H1X A;  3K0V A;  3KJ7 A;  2REJ A;  1QKB A;  2OWS A;  1Y4T A;  3LC8 A;  2RC8 A;  3TQW A;  4NMY A;  3GBA A;  2NWJ A;  1H44 A;  4GWU A;  4GX6 A;  4IY5 A;  2WX9 A;  2OZZ A;  2P3V A;  3RTW B;  4GOT A;  4F31 B;  1B05 A;  4NG7 A;  3RLF E;  4ONY A;  3H6U A;  1YTV A;  4O94 A;  2G93 A;  1B40 A;  3FVO A;  3N6T A;  4U4X A;  4F3G A;  4NF5 A;  3EN3 A;  3RT8 A;  4PET A;  1AWB A;  3ECR A;  2HXW A;  2XXK A;  4NWD A;  4IO4 A;  5AA2 B;  4JB7 A;  1IQ7 A;  5CBS A;  1FTO A;  3U1O A;  2RC7 A;  5M2V A;  4EQ7 A;  4HE0 A;  4EXK A;  4P1E A;  2R8T A;  4U1O A;  5JK4 A;  4FEB A;  1NV4 A;  5CMC A;  4FED A;  4EUO A;  5DEX B;  1EYK A;  3KSJ A;  5DVI A;  4O3B A;  4F19 A;  2KQZ A;  4I3Y A;  1M5E A;  4GIZ A;  5T3J A;  2KLF A;  3TFL A;  3K2D A;  2XX7 A;  1FBG A;  4DDD A;  2XD2 A;  1IME A;  2ONK E;  3OD7 A;  3G3F A;  3MP1 A;  3MZ1 A;  2QVU A;  4GXA A;  3OO8 A;  3USD A;  3W15 C;  5IKB A;  3G3I A;  1NV2 A;  4NF6 B;  4H46 A;  2Z8E A;  2Z8F A;  4HE1 A;  1K9Z A;  3KJT A;  2FIE A;  3TCG A;  4N07 A;  1KA0 A;  3T22 A;  1DCU A;  1LGB C;  1YPN A;  4R74 A;  4G68 A;  2Q2C A;  5B7D A;  4BDL A;  2O1M A;  3C9H A;  2I3W A;  1Y1M A;  1PB8 A;  1D4N A;  1AL3 A;  1M5D A;  3CI8 A;  4N8G A;  1B3G A;  4GWY A;  1FBF A;  2QVV A;  4F3S A;  3MQ9 A;  4OEU A;  5AA4 A;  3IL1 B;  1QKA A;  1FJ6 A;  3KEI A;  2DE3 A;  3PTY A;  5ET5 A;  1KZ8 A;  1EZP A;  5EHS A;  1YAE A;  1SPI A;  5H8N A;  5I2K B;  2DP8 A;  3FBP A;  1UTH B;  1FBD A;  1LB9 A;  3P7I A;  3RNN A;  3OEN A;  3KGC A;  1FPF A;  1TFA A;  4IO7 A;  4PQJ A;  1BTJ A;  3H7M A;  3LV0 A;  3B50 A;  1YXI A;  3SEU A;  5FBP A;  1LBV A;  1N3W A;  3K1M A;  3LUZ A;  1WDN A;  4F2Q A;  2AL5 A;  4DZ1 A;  3RPW A;  2AIX A;  2QMX A;  4G68 C;  4IB2 A;  1URD A;  4NX1 A;  4NN3 A;  2GRV A;  3CG3 A;  3M3F A;  3FXU A;  1FBH A;  2PVU A;  4DE8 A;  1O7T A;  3IOU A;  5ET8 A;  1F9B A;  4LON B;  3VDF A;  4G2Z A;  2F7A A;  4H65 A;  2FVZ A;  4WXJ A;  3QMF A;  1MG1 A;  4KCD A;  3DP8 A;  3GLB A;  3JYR A;  3K02 A;  3Q29 A;  3TTK A;  1SDX A;  2Y7I A;  3AXF A;  1MQJ A;  1Y3Q A;  4OYV A;  2L5V A;  2GHB A;  4HCW A;  1D9Q A;  1FPI A;  4ZS9 A;  4MEV A;  2F7B A;  4G77 A;  2A5T A;  4JVI A;  2HCA A;  4ZZE A;  1I6B A;  4IGT A;  3HCQ A;  4GF8 A;  2DS9 A;  1NL5 A;  2XX9 A;  2Q9T A;  1B32 A;  1RDZ A;  1DOT A;  2P0S A;  1R9L A;  2Q89 A;  3SEV A;  1HSE A;  3PUX E;  4X04 A;  3ILT B;  3CVG A;  5EQ7 A;  3TTM A;  3V83 A;  4O3C A;  2GH9 A;  4KQP A;  3TYH A;  3MC2 A;  5I57 B;  3HHF A;  4BDQ A;  2DWJ A;  3EPE A;  3B6W A;  4BDR A;  5A5X B;  1ZMG A;  3QK6 A;  2CZK A;  2GHA A;  3OSR A;  2DE4 A;  4E0X A;  5DW8 A;  1B52 A;  1EZ9 A;  4ISU A;  2UVI A;  3FJ7 A;  1SW4 A;  1NV6 A;  3UK4 A;  5CMK A;  4FBP A;  3UOR A;  4F1V A;  2XWV A;  1JNF A;  4NF8 B;  1BKA A;  4R2B A;  1NNF A;  1LST A;  4H8I A;  3MVY A;  5ELV A;  4I40 A;  2CZL A;  4N15 A;  2OLB A;  3T9X B;  5I84 A;  4GX3 A;  1MH4 A;  3RTF B;  3VLV A;  2P3N A;  5HM4 B;  2V25 A;  4PFU A;  2R6G E;  4OZ9 A;  3VVD A;  4BDO A;  4ZEC A;  1NNT A;  1PBP A;  2UVG A;  2DDK A;  4JXI A;  3UA8 A;  4P8B A;  2Y7W A;  1D9Y A;  3H6T A;  4GL0 A;  2WBB A;  4DXC A;  1B7U A;  2WEF A;  1QJM A;  4KD5 A;  1B3E A;  3GXA A;  3O97 A;  4QBA A;  1JVX A;  2VOZ A;  2F8D A;  1PDA A;  5H8F B;  1B58 A;  1FSA A;  2R9J A;  3LR1 A;  2I3V A;  3I6V A;  4EF1 A;  3TTN A;  3IO4 A;  4F3P A;  5EQA A;  2O68 A;  3S9M C;  1GVC A;  1CE2 A;  3MVX A;  4NAP A;  4JWY A;  4RYA A;  2VP1 A;  5I58 A;  1SYH A;  2YLN A;  4PGP A;  2VPN A;  4KXP A;  1FTA A;  3QUJ A;  4H5F A;  3A09 A;  1I6A A;  4POW A;  1N0T A;  2HFB A;  3PV0 E;  3C31 A;  5HPQ A;  2XD3 A;  1ZKB A;  3ZS6 A;  3NOH A;  1NUX A;  4R9F A;  5TPA B;  1S7Y A;  2ZZX A;  1A55 A;  3E78 A;  4RY1 A;  2Q88 A;  3KN8 A;  4OMB A;  3K4U A;  2UYF A;  4EDP A;  5JTY B;  3B7D A;  4LUB A;  3S4U A;  3TTL A;  1BLF A;  2PT1 A;  4PFR A;  4ZE9 A;  3CG1 A;  1NKX A;  4TLM B;  3MW0 A;  5ICQ A;  1KA1 A;  3MPK A;  4U4S A;  1A8E A;  4N6P A;  3BFT A;  5TU0 A; 
#chains in the Genus database with same CATH homology
 1FQE A;  1NFT A;  3THI A;  2DSF A;  4Q8R A;  2H4I A;  3EHS A;  3VE1 B;  3HPI A;  3FVK A;  3H4Z A;  2RKM A;  4FJP A;  3U93 A;  1FQF A;  2DWA A;  3C34 A;  5DT6 A;  1SW2 A;  4F3B A;  1Q1K A;  1JEV A;  4XKQ A;  3C32 A;  4QSD A;  3TOD A;  4P11 A;  2WKY A;  4KR5 A;  3H3G A;  4QF9 A;  3HST A;  4ZDM A;  3QUF A;  1S9T A;  2DWH A;  3FIR A;  3IJO B;  1NMU A;  2OWT A;  1B3F A;  5ITO A;  1IEJ A;  2XXI A;  5AA2 A;  3SEY A;  4RNS A;  5EHM A;  4XKN A;  3CSG A;  3O2A A;  1B3H A;  2NVU B;  3TKD A;  4QHQ A;  5H8S A;  1SI1 A;  4KFQ A;  3PGF A;  4QFN A;  4ND9 A;  2DXR A;  4NF4 B;  1A40 A;  1VFE A;  4P0G A;  1MXW A;  2PBW A;  2V84 A;  1UTB B;  3FAT A;  3QYT A;  1AH5 A;  1MXV A;  1B5J A;  2XX8 A;  1FTM A;  5TP9 A;  3IOT A;  4TQU Q;  1NH7 A;  4H0W A;  2V93 A;  1P1O A;  1B9J A;  1AIV A;  4QFO A;  1Y20 A;  2ANJ A;  2D3I A;  1B51 A;  4QFL A;  1XT8 A;  2RCB A;  1R6Z A;  4LVQ A;  5FTI A;  4OHN A;  3S9L C;  1P99 A;  3KZG A;  3VV5 A;  1NH8 A;  2H98 A;  4UA8 A;  4ZEB A;  1ELJ A;  4MFI A;  5I59 A;  2DXY A;  1MPC A;  4QFP A;  4DCY A;  1UTH A;  3OO7 A;  1XOC A;  4KPT A;  1DPE A;  4FAJ A;  3EHT A;  4RK2 A;  3E9X A;  3T93 B;  2HEU A;  2P2A A;  4DCX A;  1II5 A;  1MQI A;  2I48 A;  3PPO A;  2RF1 A;  2F6G A;  3N26 A;  4O3A A;  3S2V A;  3HV1 A;  3IB1 A;  3IB0 A;  2QSX A;  3LBS A;  1MDQ A;  5H8Q B;  4PP0 A;  1R1N A;  3OO6 A;  1QW0 A;  4E0W A;  3TDJ A;  1Y3N A;  3FV2 A;  4XKR A;  4YB5 A;  2F36 A;  4IO2 A;  3PPQ A;  4HW8 A;  3IB2 A;  2DWI A;  4YKP A;  1ZTY A;  3CRB A;  4ELR A;  1OVB A;  1N76 A;  2HAV A;  1FTK A;  1MPB A;  4OFO A;  3FVN A;  1WOD A;  1LCF A;  3S9N C;  5KDT A;  2ZNT A;  3MP8 A;  4GVO A;  4PE5 B;  1ZLQ A;  3IO6 A;  4JWX A;  3S9E A;  1IZ1 A;  1R9Q A;  1PB7 A;  5A5X A;  4RA1 A;  3ILU B;  4N13 A;  4YMB A;  5I2N B;  3HO7 A;  3SDF A;  1FW0 A;  3PU5 A;  1URS A;  1RYX A;  4MF3 A;  3FGS A;  4OES A;  3O6H A;  4C1T A;  4OFL A;  2UVH A;  1N04 A;  3FUZ A;  4LA9 A;  2XXQ A;  1MS7 A;  1B1H A;  2PX1 A;  3TCH A;  2OCU A;  2V3U A;  4RPN A;  2VD3 A;  1EU8 A;  3A3U A;  2W7Y A;  3OSQ A;  3CSB A;  1GTK A;  1QUK A;  4YKK A;  3TTR A;  4R6K A;  1XC1 A;  4LZ5 A;  2O1L A;  2OK2 A;  1NNP A;  3G3K A;  1USY E;  1OQG A;  4H6D A;  2B3F A;  3UN6 A;  4NWC A;  1JVY A;  1HSL A;  1SD3 A;  3C36 A;  4JDF A;  2RC9 A;  3K6U A;  1A8F A;  2Y84 A;  1RKM A;  5AE4 A;  2QJE A;  1Y9U A;  4RPO A;  2XHD A;  3MBP A;  2D5W A;  3IOR A;  3U72 A;  4GD5 A;  3L6H A;  4RJZ A;  3C35 A;  1M5F A;  3CFZ A;  4ZEF A;  2HQ0 A;  3K01 A;  5CBR A;  3QIM A;  2QS2 A;  4H5G A;  3V8X B;  4HTG A;  3FZV A;  4ECF A;  3ODB A;  2A5S A;  4YKJ A;  3QAX A;  3MWB A;  3K6X A;  3JZJ A;  1MM6 A;  4Z7E A;  2NXO A;  4G8N A;  2Y7K A;  4OVJ A;  1B5H A;  3K6W A;  3TUS A;  1B0H A;  4FOR A;  1OLA A;  3KN3 A;  4L17 A;  1VR5 A;  1FQC A;  4Q30 B;  3O6I A;  3MUQ A;  1OQH A;  5BUU A;  3LSX A;  4UAC A;  3PMX A;  1D9V A;  4G68 B;  3IAZ A;  4JSD A;  1EH3 A;  4RK9 A;  4EXL A;  3RQT A;  4AB6 A;  1IIT A;  1DTZ A;  2E1S A;  4IO6 A;  4XTC Q;  5L9O A;  1MY2 A;  5AA4 B;  2HZK A;  4Z0I A;  4FAT A;  2F97 A;  4EF2 A;  5H8N B;  2O69 A;  1CB6 A;  1Y3P A;  5F1Q A;  3OEL A;  1Y4C A;  2H9B A;  5JEI A;  3VVE A;  2AYS A;  3SES A;  2ZNU A;  2Z22 A;  3VLW A;  3FV1 A;  2XXT A;  3I5O A;  2BJJ X;  5I56 B;  3KOT A;  3E4R A;  3K6V A;  1Z7M E;  1JEU A;  4WEP A;  1LB8 A;  1DTG A;  5H8H B;  1OIB A;  1PEB A;  2Y7R A;  5CMB A;  4BDM A;  5CRY A;  1UTB A;  1VSO A;  1T0K A;  3EF7 A;  2A5T B;  3F11 A;  3VXB A;  4KYS A;  1B4Z A;  4P0I A;  3PPN A;  4ZED A;  3KSX A;  4FIM A;  4LZ8 A;  3U8Q A;  1S50 A;  2HAU A;  4NTL A;  2NUV A;  2X7P A;  1URG A;  2I49 A;  2REG A;  2ZNS A;  1Y1Z A;  2V3Q A;  4QSC A;  1P1U A;  3W9V A;  2AL4 A;  1IXC A;  5FTH A;  1HSJ A;  1JW1 A;  3MVZ A;  4GQO A;  3C33 A;  5IAI A;  2R71 A;  1IXG A;  3UP9 A;  3O9P A;  1US5 A;  1USY H;  2PT2 A;  3H6W A;  3ONM A;  4H8J A;  4R6Y A;  1GGG A;  3TMG A;  3H6V A;  5CMM A;  4ZEK A;  1POT A;  1JW5 A;  1N84 A;  2DVC A;  4R73 A;  1TT1 A;  1P1Q A;  3FXQ A;  2IA4 A;  4ELP A;  4Q0C A;  2DQV A;  1H3D A;  2PYY A;  2UVJ A;  2QS3 A;  3IOV A;  1PBQ A;  2D21 A;  1GR2 A;  1LFI A;  4QRZ A;  4OEN A;  5H8Q A;  5DVJ A;  1MY0 A;  1XVY A;  1ZJL A;  3T9U A;  4EQ9 A;  5DEX A;  4F2O A;  2XXR A;  1UIV A;  3FD3 A;  1BIY A;  3C4M A;  3MAM A;  4GXS B;  3T96 B;  4H67 A;  4KI0 E;  4GL8 A;  2H5Y A;  3MZB A;  4RXL A;  1H43 A;  3IK6 B;  1H45 A;  4BLA A;  4F1Y A;  5AA2 D;  2V3T A;  3SKP A;  4U2R A;  3T66 A;  1B3L A;  3IOW A;  4I1D A;  4NF6 A;  4IO5 A;  1WVJ A;  2OJT A;  3O28 A;  4FEC A;  1DPP A;  4JWO A;  2PMS A;  1ZBM A;  2ESN A;  4F22 A;  3VFJ A;  1A54 A;  3DEL B;  4TOZ A;  1QUI A;  4X48 A;  4LAT A;  3QXM A;  4U21 A;  2QS1 A;  4YB7 A;  2F5X A;  2FYI A;  3Q26 A;  5CM6 A;  3TEP A;  4F39 A;  2Q2A A;  4KHZ E;  4X9T A;  5I2K A;  1LBB A;  5K2Y A;  5F7V A;  3RY3 A;  1AOV A;  4U22 A;  2ZMB A;  1UQW A;  5DTB A;  4THI A;  1IIW A;  3OEK A;  3D4G A;  2P1S A;  3B6T A;  2ZYN A;  2XXW A;  1FQD A;  3FJG A;  3RN8 A;  3U94 A;  4MH5 A;  3LUY A;  3H03 A;  1UIU A;  1OVT A;  3Q25 A;  4XXU A;  1US4 A;  2UYE A;  1MY3 A;  3DM0 A;  1B0L A;  3KFM A;  4QFK A;  3B6Q A;  1QVS A;  4POX A;  4XIG Q;  1MXU A;  5L9S A;  1J1N A;  3JV9 A;  3N6U A;  1KWH A;  3VLU A;  2XXH A;  3M3K A;  3WAF A;  5BWJ A;  4OER A;  4GWO A;  5L9M A;  3N5L A;  3MP6 A;  3H06 B;  1DMB A;  5FHM A;  1OMP A;  1B4H A;  3R6U A;  1MPD A;  3PUW E;  4R72 A;  3LSL A;  2DOJ A;  2ALU A;  3KN7 A;  1P1N A;  3IJX B;  5K2X A;  3RT6 B;  2LAO A;  5KCJ B;  2UXA A;  1MXZ A;  4YU0 A;  1TFD A;  2QRY A;  2B3B A;  2QS4 A;  1MDP 1;  4GRK A;  1B7H A;  1Q35 A;  4I8C A;  3OXN A;  1SI0 A;  3E13 X;  4EQB A;  5I57 A;  5B70 A;  4LP2 B;  1MQG A;  1JW4 A;  2GFE A;  1MRP A;  1N7W A;  5TP9 B;  3PPP A;  4LQ2 A;  3DLN A;  2ONR A;  2Z23 A;  1N7X A;  1B6H A;  3RUM A;  4TLL B;  3PD8 A;  1DSN A;  2O84 X;  4DXU A;  4OEV A;  2F34 A;  1LBC A;  5LOM A;  1P1W A;  1LCT A;  4NF8 A;  5ISU A;  2YJP A;  3HN0 A;  3GBB A;  5ICT A;  2ZXT A;  4WKM A;  3G3J A;  2XXV A;  1LLS A;  2XXU A;  4MLV A;  3MPL A;  5I59 B;  1SW1 A;  1VFD A;  2Y7P A;  3O29 A;  2DE2 A;  2H99 A;  3PMW A;  3HHG A;  1M5B A;  2QL3 A;  3DP6 A;  3Q27 A;  1M5C A;  5EYF A;  1IUD A;  3M3L A;  4NF5 B;  3SER A;  2CMO A;  1NNK A;  2E0S A;  2I6E A;  1MM7 A;  5H8F A;  1GV8 A;  4MBP A;  4JBZ A;  5I56 A;  1PC3 A;  2FA7 A;  4LQ5 A;  3TAJ A;  4MLQ A;  1ATG A;  4ZZA A;  3PPR A;  3LSF B;  3SEW A;  1XS5 A;  3G3G A;  4M1V A;  5ITP A;  5AA3 A;  5H8H A;  4G4P A;  3L6G A;  5CI5 A;  1ZU0 A;  2YPN A;  1LAF E;  4R9G A;  5TPA A;  1FCK A;  4R75 A;  3PMV A;  2I0C A;  4IGR A;  4IO3 A;  1IXI A;  1FQA A;  4GLI A;  3ZKL A;  3ZSF A;  1IXH A;  1BP5 A;  5JTY A;  4OTE A;  3EHU A;  2NOO A;  4OWD A;  4X1B A;  2X26 A;  2VD2 A;  3VXC A;  3MJN A;  4I62 A;  5KDT B;  2I0B A;  1B2H A;  4YIC A;  3PD9 A;  3PUZ E;  4K3F A;  4YAH X;  2XXX A;  3KBR A;  4YB6 A;  1QUL A;  4IY6 A;  2I4C A;  5J1D A;  2ZYK A;  1AMF A;  3KG2 A;  3I3V A;  1XVX A;  1EZO A;  4F18 A;  1MH3 A;  1LAG E;  5FHO A;  4YZZ A;  1FQB A;  3G7W A;  4U23 A;  4XKP A;  4Q5T A;  3K1P A;  4U1Z A;  1YCJ A;  3GZG A;  3CIJ A;  3DP4 A;  2XXY A;  2OBG A;  3BFU A;  1OLC A;  2Z8D A;  3MZ9 A;  2I4B A;  3W9W A;  5KZT A;  3EQ1 A;  2VGQ A;  1SVX B;  2G29 A;  2XXP A;  1MY4 A;  1B46 A;  3FVG A;  4OFJ A;  2VHA A;  4NE4 A;  4PFT A;  2X7Q A;  1JET A;  4BDN A;  2ZYO A;  3TQL A;  2THI A;  5CC2 A;  3CR9 A;  4NF4 A;  1PB9 A;  3RGY A;  2F7C A;  3T9H B;  1ANF A;  1FTJ A;  1FTL A;  3R7X A;  3UIF A;  4ELO A;  3Q28 A;  3G3H A;  3BKI B;  3TZA A;  5L8D A;  3FAS A;  1SW5 A;  1O64 A;  2ONS A;  2M8C A;  4JSO A;  3TCF A;  2DYX A;  3IX1 A;  4I9D A;  3UGW A;  1TWY A;  3O6G A;  1TXF A;  3FXR A;  3D4C A;  3R26 A;  1B7Z A;  1LAX A;  2B65 A;  2O7I A;  3N94 A;  1QUJ A;  4C1U A;  5DVF A;  1SQY A;  3SEX A;  2H25 A;  2ABH A;  4GFR A;  2HZL A;  1O63 A;  3TPA A;  1JQF A;  4KCC A;  4PFY A;  1A99 A;  2RCA A;  4QSE A;  3WAE A;  2O7U A;  1MY1 A;  4F29 A;  4KYE A;  3A3C A;  1I6Q A;  4KYD A;  3PUY E;  2RIN A;  1D3K A;  1MXX A;  4AB5 A;  3OEM A;  3CFX A;  2FNC A;  3E3K A;  1MQD A;  3FJM A;  4OXV A;  1N3X A;  4ESW A;  4LZ7 A;  2QMW A;  3MVW A;  1XHY A;  1L5T A;  1MQH A;  3VVF A;  3BBR A;  3OMB A;  4G8H A;  1Z7N E;  3CFL A;  1LAH E;  2I58 A;  1ZIU A;  4ELQ A;  2IEE A;  4WED A;  2QPQ A;  1I69 A;  4DLD A;  4ZE8 A;  4YKI A;  5AA1 A;  4X1D A;  4M4G A;  2DVZ A;  3V89 B;  3IR1 A;  1SBP A;  2F6P A;  3ZKK A;  3K00 A;  3V5A A;  5HBC A;  4R6H A;  4YMA A;  1LFH A;  3OO9 A;  2ZYM A;  3O66 A;  2F35 A;  5KCJ A;  3QSL A;  2Q8J A;  3OOA A;  4OQO A;  5I58 B;  2F78 A;  4G8M A;  3T9V A;  4HS7 A;  3KOS A;  3SET A;  4OET A;  4AQ4 A;  1SYI A;  3PUV E;  5FHN A;  1RYO A;  4PFW A;  4R2F A;  3M8U A;  3TEL A;  1POY 1;  2O51 A;  3U92 A;  4FE8 A;  2O6A A;  1VE4 A;  3LSW A;  5DYH A;  1B5I A;  1H76 A;  4F1U A;  1B1X A;  4HCY A;  4DXB A;  3K1N A;  4C0R A;  4ESX A;  5I2N A;  4DIG A;  4NED A;  4ZEI A;  1A7L A;  1MXY A;  1LFG A;  4H1X A;  3K0V A;  3KJ7 A;  2REJ A;  1QKB A;  2OWS A;  1Y4T A;  3LC8 A;  2RC8 A;  3TQW A;  4NMY A;  3GBA A;  2NWJ A;  1H44 A;  4IY5 A;  2OZZ A;  3RTW B;  4GOT A;  4F31 B;  1B05 A;  3RLF E;  4ONY A;  3H6U A;  1YTV A;  2G93 A;  1B40 A;  3FVO A;  3N6T A;  4U4X A;  4F3G A;  4NF5 A;  3EN3 A;  3RT8 A;  4PET A;  3ECR A;  2HXW A;  4NWD A;  4IO4 A;  5AA2 B;  4JB7 A;  1IQ7 A;  5CBS A;  1FTO A;  3U1O A;  2RC7 A;  5M2V A;  4EQ7 A;  4EXK A;  4U1O A;  5JK4 A;  4FEB A;  5CMC A;  4FED A;  4EUO A;  5DEX B;  3KSJ A;  5DVI A;  4O3B A;  4F19 A;  1M5E A;  4GIZ A;  2KLF A;  3TFL A;  3K2D A;  2XX7 A;  4DDD A;  2XD2 A;  2ONK E;  3OD7 A;  3G3F A;  3MP1 A;  3MZ1 A;  4GXA A;  3OO8 A;  3USD A;  3W15 C;  5IKB A;  3G3I A;  4NF6 B;  2Z8E A;  2Z8F A;  3KJT A;  3TCG A;  4N07 A;  3T22 A;  1LGB C;  1YPN A;  4R74 A;  4G68 A;  2Q2C A;  5B7D A;  4BDL A;  2O1M A;  3C9H A;  2I3W A;  1Y1M A;  1PB8 A;  1D4N A;  1AL3 A;  1M5D A;  3CI8 A;  1B3G A;  4F3S A;  3MQ9 A;  4OEU A;  5AA4 A;  3IL1 B;  1QKA A;  3KEI A;  2DE3 A;  1EZP A;  5EHS A;  1YAE A;  5H8N A;  5I2K B;  2DP8 A;  1UTH B;  1LB9 A;  3P7I A;  3RNN A;  3OEN A;  3KGC A;  1TFA A;  4IO7 A;  4PQJ A;  1BTJ A;  3H7M A;  3SEU A;  1N3W A;  3K1M A;  1WDN A;  4F2Q A;  2AL5 A;  4DZ1 A;  3RPW A;  2AIX A;  2QMX A;  4G68 C;  4IB2 A;  1URD A;  2GRV A;  3CG3 A;  3M3F A;  3FXU A;  2PVU A;  4DE8 A;  1O7T A;  3IOU A;  1F9B A;  4LON B;  3VDF A;  4G2Z A;  2F7A A;  4H65 A;  4WXJ A;  1MG1 A;  4KCD A;  3DP8 A;  3GLB A;  3JYR A;  3K02 A;  3Q29 A;  3TTK A;  1SDX A;  2Y7I A;  3AXF A;  1MQJ A;  1Y3Q A;  4OYV A;  2GHB A;  4HCW A;  4ZS9 A;  2F7B A;  4G77 A;  2A5T A;  2HCA A;  4ZZE A;  1I6B A;  4IGT A;  3HCQ A;  4GF8 A;  2DS9 A;  1NL5 A;  2XX9 A;  2Q9T A;  1B32 A;  1DOT A;  2P0S A;  1R9L A;  2Q89 A;  3SEV A;  1HSE A;  3PUX E;  3ILT B;  3CVG A;  3TTM A;  3V83 A;  4O3C A;  2GH9 A;  4KQP A;  3TYH A;  3MC2 A;  5I57 B;  3HHF A;  4BDQ A;  2DWJ A;  3EPE A;  5A5X B;  3B6W A;  4BDR A;  1ZMG A;  3QK6 A;  2GHA A;  3OSR A;  2DE4 A;  4E0X A;  1B52 A;  1EZ9 A;  4ISU A;  2UVI A;  3FJ7 A;  1SW4 A;  3UK4 A;  5CMK A;  3UOR A;  4F1V A;  1JNF A;  4NF8 B;  1BKA A;  4R2B A;  1NNF A;  1LST A;  4H8I A;  3MVY A;  5ELV A;  2CZL A;  2OLB A;  3T9X B;  5I84 A;  1MH4 A;  3RTF B;  3VLV A;  5HM4 B;  2V25 A;  4PFU A;  2R6G E;  4OZ9 A;  3VVD A;  4BDO A;  4ZEC A;  1NNT A;  1PBP A;  2UVG A;  4JXI A;  3UA8 A;  2Y7W A;  1D9Y A;  3H6T A;  4GL0 A;  4DXC A;  1B7U A;  1QJM A;  4KD5 A;  1B3E A;  3GXA A;  3O97 A;  1JVX A;  2VOZ A;  2F8D A;  1PDA A;  5H8F B;  1B58 A;  2R9J A;  3LR1 A;  2I3V A;  3I6V A;  4EF1 A;  3TTN A;  3IO4 A;  4F3P A;  2O68 A;  3S9M C;  1GVC A;  1CE2 A;  3MVX A;  4RYA A;  4JWY A;  2VP1 A;  5I58 A;  1SYH A;  2YLN A;  3QUJ A;  4H5F A;  3A09 A;  1I6A A;  4POW A;  1N0T A;  2HFB A;  3PV0 E;  3C31 A;  5HPQ A;  2XD3 A;  1ZKB A;  3ZS6 A;  4R9F A;  5TPA B;  1S7Y A;  1A55 A;  4RY1 A;  2Q88 A;  3KN8 A;  4OMB A;  3K4U A;  2UYF A;  4EDP A;  5JTY B;  3B7D A;  4LUB A;  3S4U A;  3TTL A;  1BLF A;  2PT1 A;  4ZE9 A;  3CG1 A;  1NKX A;  4TLM B;  3MW0 A;  5ICQ A;  3MPK A;  4U4S A;  1A8E A;  4N6P A;  3BFT A;  5TU0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...