4H8IA

Structure of gluk2-lbd in complex with gluazo
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
256
structure length
256
Chain Sequence
NRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKGTPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Glutamate receptor, ionotropic kainate 2
publication title A photoswitchable neurotransmitter analogue bound to its receptor.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 82
structure length 256
sequence length 256
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-09-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4h8iA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4h8iA02
3C31A 4ZEBA 2D5WA 5JTYA 3OOAA 4C0RA 4LA9A 2Y7PA 5DVIA 3LBSA 2PYYA 4R2BA 4G8NA 1YPNA 1USYE 3FVGA 3I6VA 4OETA 4H5GA 2CZLA 2PMSA 3IO6A 3K02A 3JYRA 1IXHA 3CIJA 2F97A 5H8QA 4DCXA 4KD5A 5DEXA 3SEUA 1MY4A 1R1NA 1B7UA 1UTHB 1FTOA 4WXJA 2XXPA 2A5TB 3IO4A 4NWCA 4F18A 1LCTA 3RN8A 4YB7A 3EHUA 2H25A 1I6BA 3KG2A 3TAJA 4U22A 2XXTA 5M2VA 2QS1A 3KZGA 4ELOA 5I56B 3MP8A 5AA4B 1B7HA 4IB2A 4XKRA 1MM6A 2V84A 4M1VA 2VD2A 1FQDA 3QAXA 2PX1A 4GIZA 4RNSA 3OMBA 4MLVA 1B3HA 3KN3A 2XXRA 1PC3A 3FATA 4R6KA 2Z8DA 2XXHA 4GQOA 3H6TA 2QRYA 1Y9UA 3KEIA 2Y7RA 1GV8A 1P1WA 4QSEA 3K1PA 3GXAA 3TDJA 3MW0A 3KFMA 3MP1A 5IKBA 3T96B 1MQDA 3QUFA 4YMAA 2RC7A 4G68A 2NOOA 3C32A 2XD2A 1B5HA 1H76A 1T0KA 1B51A 4FIMA 3N6TA 4XIGQ 2XXYA 5I59B 2NXOA 4U23A 4YKIA 3MVYA 3TQLA 2FNCA 1H45A 4I8CA 2ONKE 4ZECA 4NF4A 4IO4A 3IX1A 4YU0A 3PU5A 3TTRA 2O7IA 2Q2CA 1ZBMA 1I6QA 3S9LC 1BIYA 1DPPA 4DXBA 2HCAA 4QFLA 2XXQA 1LB8A 4BDLA 1DMBA 2RC9A 2NVUB 3HO7A 1URDA 5DTBA 5CMMA 1XVXA 4AQ4A 1GVCA 1IITA 2HXWA 3VXCA 1IEJA 2HEUA 1JW1A 4JWXA 4QFNA 3VLWA 4ZEIA 1XVYA 4EXKA 5H8HB 2HQ0A 3AXFA 3V89B 2ZYNA 3UGWA 2X7QA 3TKDA 2D3IA 1NKXA 1Z7ME 5KZTA 4XTCQ 3A3UA 4LONB 3MQ9A 4F19A 2ZNUA 2GH9A 1MM7A 3TCGA 3A09A 4MFIA 1JNFA 2RCAA 5ITPA 5L8DA 4YKKA 5BUUA 3FVOA 2VGQA 1IXCA 4DE8A 1SDXA 4OESA 1MQJA 2GFEA 1MQIA 4LUBA 1M5FA 3OO9A 3B6WA 5I58B 1H44A 3IK6B 2R71A 4KI0E 3ZS6A 5FHOA 1JVXA 2HFBA 3VVFA 2H98A 3SEWA 4H8JA 4FORA 3MPKA 4GOTA 3I5OA 4P0GA 3M3FA 3RQTA 3W9VA 3OENA 3BKIB 1QUJA 5LOMA 2QS3A 4R9FA 4IO7A 3MVXA 1FW0A 4MLQA 3CG3A 1B1XA 1LFIA 4F3GA 4O3AA 2DVCA 4IO3A 2I6EA 4MF3A 3TTNA 3IJOB 1MXZA 2V3UA 2DWHA 3TTKA 1QVSA 2R6GE 4KPTA 1SW4A 2F6PA 4GWOA 4GF8A 3IOWA 4KQPA 5CMKA 1VFDA 5ICTA 1JQFA 4JWOA 3S9EA 3Q25A 3MZ9A 4RJZA 1DOTA 1NL5A 3RT8A 1PB8A 1SW1A 3W9WA 3I3VA 3MUQA 3EHSA 1QUKA 2UVHA 2OBGA 3KSJA 4H67A 3MVWA 2R9JA 4ZZEA 1M5DA 1BP5A 2GHBA 2CMOA 4GL0A 4F1VA 3VLVA 5AA2B 1YTVA 5A5XA 4G2ZA 1LFHA 3UN6A 3BBRA 3GZGA 3PUWE 3A3CA 1A40A 3B6TA 4C1TA 3K1MA 3FD3A 1SYHA 3LUYA 4GXSB 5CBRA 3QXMA 1LGBC 2WKYA 3THIA 1RYOA 1MY0A 5TPAA 1MPCA 4DXCA 3E9XA 1LBCA 2QJEA 2OWTA 1FQAA 2UVGA 4YB5A 4IGRA 5I2KA 5I84A 4U4SA 5JTYB 1GR2A 3RUMA 3IR1A 2D21A 1HSJA 1QUIA 2DQVA 2QPQA 2DE2A 1P1QA 1I69A 1FTKA 4RXLA 2LAOA 1AIVA 2XXVA 5H8QB 2O7UA 3Q26A 1Z7NE 1NNKA 4LVQA 5EHMA 5TP9A 1Y4CA 1FQEA 3D4GA 3P7IA 4NWDA 3CFXA 4E0XA 1MG1A 3O29A 3OO6A 4OVJA 4H1XA 1NH7A 3FVKA 1II5A 3B6QA 3ECRA 3DP6A 3D4CA 2W7YA 4EDPA 4F22A 2UXAA 4H8IA 4O3CA 3W15C 1R9QA 3TUSA 1EZ9A 2DXRA 1FQCA 2Z8FA 2RF1A 4LP2B 4OYVA 4ND9A 1WDNA 4QHQA 3TCHA 3LSFB 1AMFA 3ZKLA 3V83A 4HS7A 4U1OA 3K00A 2FA7A 2HZKA 2P0SA 1Y3QA 4RYAA 1B40A 4R72A 4KFQA 4LATA 3MAMA 2AIXA 2XX7A 4EUOA 4KCDA 1XS5A 2DSFA 4POXA 2G93A 3FXQA 3F11A 3TODA 5L9SA 1R6ZA 3MZBA 1VR5A 2IA4A 3CFZA 3T9XB 2OLBA 2P1SA 2OZZA 3LSLA 1LAFE 3FUZA 2DS9A 3FVNA 1S7YA 1EH3A 3R26A 1P1OA 4G68B 1MQGA 1IZ1A 4YICA 3H4ZA 1ZJLA 2OCUA 4XXUA 2F35A 2F6GA 3O6GA 4DIGA 3VXBA 3CG1A 4DCYA 4HCYA 2F34A 3ODBA 1FTJA 3Q28A 4R74A 4TLLB 5H8NB 4OQOA 1N7XA 3KJTA 3RGYA 3HHFA 4F2QA 1A99A 2HAVA 4TQUQ 2Q2AA 3TTMA 2I4BA 2OK2A 5DVFA 3TMGA 3TQWA 2M8CA 4RPNA 3HSTA 4OERA 4NF8A 3G7WA 1L5TA 5H8SA 4DLDA 3K0VA 4IGTA 1D4NA 1DTZA 3H7MA 1DPEA 1JEVA 4NF6B 4ESXA 5I2NA 2DP8A 3IORA 5AA1A 2GRVA 3VDFA 4G8MA 1MY2A 2A5SA 4QFOA 1ZTYA 2F78A 4WEDA 3RY3A 1UIUA 4HW8A 4NF5A 2QMWA 2F8DA 4ZE9A 1B58A 1MXVA 2I3WA 1SW5A 3OSQA 4YKPA 5AA3A 1A8FA 4R6YA 4IO2A 2DYXA 3O9PA 5BWJA 4QSCA 5F1QA 1NH8A 2UYEA 2V3TA 1LB9A 4OEVA 2AYSA 4PFTA 1B3EA 1MH3A 1Y3NA 4F2OA 5FHNA 4X1DA 3RTFB 2ESNA 5KDTB 3CI8A 5H8FB 1UTHA 4OEUA 2A5TA 3DM0A 2DE4A 5B70A 3TCFA 2DWJA 3PPOA 3C4MA 2YJPA 2ABHA 1VE4A 4H5FA 3IL1B 2HZLA 3PUXE 3ZSFA 4F3SA 3RPWA 1QULA 1N3WA 4IO6A 4K3FA 1WODA 5EYFA 4Q5TA 5I56A 1N0TA 1POTA 3HHGA 4LZ8A 4THIA 3DELB 1EZOA 2ONRA 3Q27A 3CVGA 4EF1A 1AH5A 1JEUA 3H03A 4ZEDA 1FTMA 2NWJA 1B52A 3UA8A 1EU8A 4QRZA 2XD3A 1B0HA 1A55A 3C33A 3L6GA 3G3JA 4DZ1A 4AB5A 1Y20A 4ECFA 2UYFA 3MJNA 1FTLA 4ZEFA 1SYIA 1O63A 3B7DA 3IB1A 4OFLA 2Q8JA 3BFUA 3WAEA 3G3FA 4UACA 1JW4A 3K6UA 3N6UA 3TYHA 1OQHA 4N13A 3S2VA 1B32A 1LBBA 4OENA 4RA1A 4GVOA 4ZS9A 4EF2A 1TXFA 1QKAA 2XXXA 2F7AA 3IOUA 1SVXB 5I59A 4Q0CA 1YCJA 2PVUA 1EZPA 1B1HA 3E4RA 4NTLA 2F7BA 1GTKA 3K1NA 3K01A 5TPAB 5FHMA 1D9VA 5FTIA 3USDA 3Q29A 2AL5A 5AA2D 1TWYA 3HV1A 2F36A 2XHDA 2Y7KA 2REGA 3TFLA 2QS4A 5CI5A 3S9NC 3QK6A 2HAUA 4KYDA 1OLCA 3SEYA 3QSLA 4N6PA 1Y3PA 1Y4TA 5CRYA 1URGA 3PPPA 3S4UA 5H8HA 4RK9A 1N76A 5TP9B 1N7WA 2UVJA 4ZE8A 1BLFA 3T9VA 4EXLA 2Z22A 1UIVA 4PE5B 3M3KA 3IOVA 4YZZA 4JB7A 3R6UA 3PMXA 3T22A 4FEBA 3G3IA 1FCKA 3V8XB 2B3BA 4YAHX 2Q89A 4OXVA 2X26A 2V93A 1MXXA 1QJMA 3O28A 3K6WA 1US5A 2V3QA 3OD7A 4R75A 4PFUA 4OWDA 1MXYA 2ANJA 3SERA 4YMBA 5I58A 3PUVE 3HCQA 4PETA 1OQGA 3DP4A 3FJ7A 4OMBA 2RKMA 1POY1 3FIRA 4LZ7A 3EPEA 4KCCA 5K2XA 1R9LA 3HN0A 3MVZA 2VHAA 4GD5A 3DP8A 3KBRA 2QMXA 4JXIA 2Q88A 3CR9A 1UTBA 2H99A 1IXIA 2DE3A 3FV2A 1NFTA 2O69A 3M3LA 4R2FA 4C1UA 3MZ1A 2PT1A 2THIA 4U2RA 2F7CA 5CBSA 1NNPA 4HCWA 4U4XA 4DXUA 5EHSA 3PV0E 1B5IA 5HBCA 3LR1A 5DEXB 5HM4B 3U72A 2B3FA 5ELVA 3TEPA 1ANFA 4Q30B 1HSLA 1TT1A 2B65A 4L17A 4R6HA 1PB9A 2O1LA 4X48A 2RCBA 1XOCA 3T93B 4O3BA 1DTGA 2REJA 4OFOA 1H3DA 2YLNA 4U21A 1Y1MA 3PUYE 1MY3A 4EQ9A 1BKAA 3TPAA 3N5LA 4ELPA 4NF8B 2O6AA 5TU0A 3KN8A 1XC1A 2I48A 1TFDA 2YPNA 4ONYA 4KYSA 1A7LA 1WVJA 4GL8A 4PP0A 5J1DA 1PB7A 3R7XA 3U93A 3VFJA 2G29A 4I9DA 3VLUA 1NNTA 3G3HA 3MBPA 1B2HA 2ZMBA 3U92A 3OO7A 4TLMB 3O2AA 1B05A 1S9TA 2V25A 1SW2A 3FXUA 3U94A 2VOZA 4H65A 2UVIA 1O7TA 1H43A 3FZVA 1OLAA 3LC8A 4GFRA 3IAZA 3TELA 1AOVA 1VSOA 1F9BA 3IB2A 4LZ5A 1M5BA 3C34A 3CSGA 4UA8A 4BDNA 1IQ7A 1MPDA 3LSWA 3EF7A 5I57A 1DSNA 2QS2A 3K6XA 4X9TA 4FECA 1RKMA 1JW5A 1VFEA 2Q9TA 3H6VA 3G3GA 4FEDA 2I0BA 5KCJA 2RC8A 4NF4B 3K4UA 4POWA 4OFJA 1URSA 4FJPA 4PFYA 1LCFA 4ZEKA 4WKMA 3OEMA 4EQBA 4F39A 4BDMA 3KJ7A 5AE4A 4G77A 4IO5A 3EQ1A 4GRKA 3BFTA 1XT8A 2DWAA 3SEVA 4JDFA 4NMYA 3SEXA 5DVJA 4MBPA 4R73A 1USYH 4AB6A 1JETA 2DWIA 1N04A 2ZNTA 4ZZAA 4PQJA 2XX9A 1MXWA 3K2DA 4F1UA 5ISUA 3UP9A 1N3XA 5DYHA 3C9HA 3PMVA 4OHNA 2QL3A 1LLSA 1S50A 1Y1ZA 1MQHA 3OXNA 4M4GA 1M5EA 3MC2A 1P99A 4F1YA 4RK2A 2I49A 4OTEA 3O66A 3VE1B 3RTWB 5ICQA 3O6HA 4FATA 3MPLA 1US4A 4G8HA 4P11A 3VVEA 1IIWA 1OMPA 5JEIA 1CE2A 1SI1A 2BJJX 2XXIA 4BDOA 4QFKA 4XKNA 3OELA 4ESWA 5B7DA 4H0WA 4MH5A 1NMUA 3FGSA 1J1NA 1TFAA 3T9UA 3N94A 3ILUB 2ZYOA 3KOTA 4QF9A 3WAFA 5H8NA 1GGGA 1M5CA 1LAXA 3PPQA 5IAIA 2NUVA 4RPOA 5CMCA 2DVZA 2I3VA 3SKPA 5AA4A 3IB0A 3DLNA 3V5AA 3K6VA 2E1SA 4LQ5A 2QSXA 5ITOA 2ZYKA 3IOTA 1ZMGA 1B5JA 1LFGA 1D3KA 2O1MA 3UIFA 4NF6A 3N26A 4U1ZA 5JK4A 3E13X 1A8EA 1B6HA 1XHYA 3SESA 4Z0IA 4KHZE 4EQ7A 1O64A 1RYXA 3T9HB 1HSEA 4FAJA 4YKJA 4N07A 3O97A 3VVDA 4JWYA 1B3FA 1CB6A 1PDAA 2I4CA 3KN7A 5DT6A 3S9MC 1OVTA 5FTHA 1B3LA 4PFWA 2DOJA 4XKQA 4G68C 5A5XB 1SI0A 2ONSA 2XX8A 4BDQA 1PEBA 4H6DA 2H9BA 2O51A 3RLFE 2Z23A 1QW0A 2AL4A 1MH4A 2VD3A 5KDTA 2Y7IA 5CM6A 2F5XA 2ZXTA 4JSOA 5H8FA 3MP6A 1ZLQA 1B3GA 3QYTA 4I62A 3OSRA 4NEDA 5CC2A 2ALUA 3LSXA 1KWHA 1MRPA 3UORA 4LQ2A 1LSTA 1ZKBA 3FXRA 5F7VA 4IY6A 3PGFA 3ILTB 1UTBB 5I2KB 3FASA 2P2AA 1N84A 3KGCA 4JBZA 4WEPA 3CFLA 1IXGA 2RINA 4F3BA 3PPNA 2IEEA 4R9GA 1SBPA 4FE8A 3TZAA 4GXAA 3PUZE 3PD9A 2OWSA 2ZNSA 3PMWA 1A54A 1Q1KA 4G4PA 1D9YA 5L9MA 2O68A 4KR5A 3FJGA 3OO8A 1PBQA 3JV9A 3JZJA 2E0SA 3SETA 3U1OA 4RY1A 5L9OA 4ELQA 5HPQA 4YB6A 4QFPA 1OIBA 4E0WA 1ELJA 2Y84A 2I0CA 1I6AA 3RT6B 3H6WA 3CRBA 2I58A 2GHAA 1LAGE 3MWBA 3PPRA 3ONMA 1ZU0A 3T66A 1B4ZA 2VP1A 2ZYMA 4F31B 3PD8A 1MDQA 2KLFA 4TOZA 3FJMA 3HPIA 3C36A 4JSDA 2FYIA 1BTJA 1B46A 4IY5A 4BLAA 2O84X 1SQYA 2OJTA 2XXWA 1B4HA 2DXYA 1AL3A 1ATGA 2XXUA 3IJXB 4ISUA 5K2YA 3L6HA 2H5YA 3KOSA 3GBAA 1MXUA 3FV1A 3H06B 4KYEA 4X1BA 3H3GA 4F29A 1ZIUA 4Z7EA 2Z8EA 3VV5A 3H6UA 3E3KA 1QKBA 4BDRA 4I1DA 5CMBA 1Q35A 3EN3A 1B0LA 5I57B 1YAEA 1UQWA 4F3PA 3GBBA 1IUDA 1OVBA 1MS7A 3TTLA 5KCJB 3ZKKA 3G3KA 3OEKA 3EHTA 4QSDA 1FQFA 1MPBA 3UK4A 1SD3A 3RNNA 4Q8RA 1P1NA 5AA2A 3C35A 1B7ZA 3O6IA 1LAHE 1MDP1 1B9JA 4DDDA 1JVYA 4GLIA 1MY1A 2PBWA 4ZDMA 4OZ9A 4P0IA 5I2NB 4HTGA 3QUJA 3U8QA 4ELRA 3KSXA 1NNFA 2H4IA 3SDFA 1PBPA 1P1UA 3M8UA 2Y7WA 4NF5B 3GLBA 4XKPA 2PT2A 2X7PA 3QIMA 4NE4A 3CSBA 1FQBA
chains in the Genus database with same CATH superfamily
3C31A 4ZEBA 2D5WA 5JTYA 3OOAA 4C0RA 4LA9A 3B50A 5ESYA 2Y7PA 5DVIA 5ET7A 3LBSA 2PYYA 4R2BA 4G8NA 4N17A 1YPNA 1USYE 3FVGA 3I6VA 4OETA 4H5GA 2CZLA 2FIEA 2PMSA 3IO6A 3K02A 3JYRA 1IXHA 3CIJA 2F97A 5H8QA 4DCXA 4KD5A 5DEXA 3SEUA 1MY4A 1R1NA 1B7UA 1UTHB 1FPBA 1FTOA 4WXJA 2XXPA 2A5TB 3IO4A 4NWCA 4F18A 2PCRA 1LCTA 3RN8A 4YB7A 3EHUA 2H25A 1I6BA 3KG2A 3TAJA 5EQAA 4U22A 2XXTA 3CHGA 5M2VA 2QS1A 4I3EA 3KZGA 5ET8A 1QGXA 4ELOA 5I56B 3RPLB 3MP8A 5AA4B 1FPIA 2F3BA 1B7HA 1RDYA 4IB2A 4XKRA 4AS4A 1MM6A 2V84A 4M1VA 2VD2A 1FQDA 3QAXA 2PX1A 5LDZA 4GIZA 4RNSA 3OMBA 1IMBA 4MLVA 1B3HA 3KN3A 2XXRA 1PC3A 3FATA 4R6KA 2Z8DA 2XXHA 4GQOA 3H6TA 2QRYA 1Y9UA 3KEIA 2Y7RA 1GV8A 1P1WA 4QSEA 3T1BA 1NV3A 3GYYA 3K1PA 1LBXA 3GXAA 3TDJA 4OANA 1JP4A 3MW0A 4PCDA 3KFMA 3MP1A 3KC0A 5IKBA 3T96B 1MQDA 3QUFA 4YMAA 2RC7A 4G68A 2NOOA 3C32A 2XD2A 1B5HA 4NHBA 1H76A 1T0KA 2B4LA 1B51A 4FIMA 1FRPA 3N6TA 4XIGQ 2XXYA 5I59B 2NXOA 4U23A 4YKIA 3MVYA 3TQLA 2FNCA 1H45A 4I8CA 2ONKE 4ZECA 1INPA 4NF4A 4NX1A 4IO4A 3IX1A 4YU0A 3PU5A 3TTRA 2O7IA 2Q2CA 2B4MA 1XI6A 1ZBMA 3T0JA 1I6QA 1FBCA 3S9LC 1BIYA 1DPPA 4DXBA 2HCAA 4QFLA 2XXQA 1LB8A 4BDLA 3PTYA 1DMBA 2RC9A 2NVUB 3HO7A 1URDA 2WBDA 5DTBA 2MKZA 5CMMA 2HPGA 1XVXA 4AQ4A 1GVCA 1IITA 2HXWA 3VXCA 1IEJA 1FJ6A 2HEUA 1JW1A 4JWXA 4QFNA 3VLWA 4PAIA 4O7MA 4ZEIA 1XVYA 4EXKA 5H8HB 2HQ0A 3AXFA 3V89B 2ZYNA 4MEVA 3UGWA 2X7QA 3TKDA 2D3IA 1NKXA 1Z7ME 5KZTA 4XTCQ 1LBZA 3A3UA 4LONB 3MQ9A 4F19A 2ZNUA 2GH9A 1MM7A 3TCGA 3A09A 4MFIA 2P3NA 1JNFA 1EYIA 2RCAA 5ITPA 5L8DA 4YKKA 5BUUA 3FVOA 2VGQA 4P56A 1IXCA 4DE8A 1FPKA 1SDXA 4OESA 1MQJA 2GFEA 4JVIA 1MQIA 4LUBA 1M5FA 3OO9A 3B6WA 1SPIA 5I58B 3MSTA 1H44A 3IK6B 2R71A 2CEXA 4PGPA 4KI0E 3ZS6A 5FHOA 1JVXA 2HFBA 3VVFA 2H98A 3SEWA 4H8JA 2XWIA 4FORA 3MPKA 4GOTA 3I5OA 4P0GA 3M3FA 4MNPA 3RQTA 3W9VA 3OENA 3SZPA 3BKIB 4MHFA 1QUJA 4HE0A 5LOMA 2QS3A 4R9FA 4IO7A 3MVXA 1FW0A 4MLQA 1CNQA 3CG3A 5I3SA 1LBVA 1B1XA 1LFIA 4GWYA 4F3GA 4O3AA 2DVCA 4IO3A 2I6EA 4MF3A 3TTNA 5ET5A 3IJOB 1MXZA 2V3UA 2DWHA 3TTKA 1QVSA 2R6GE 4XEQA 4KPTA 1SW4A 2F6PA 4GWOA 4GF8A 3IOWA 4KQPA 5CMKA 1VFDA 5ICTA 1IMCA 1JQFA 4JWOA 3S9EA 3Q25A 3MZ9A 4RJZA 1DOTA 1NL5A 3RT8A 1PB8A 3E78A 1SW1A 3I3VA 3W9WA 3MUQA 3EHSA 1QUKA 2UVHA 2OBGA 3KSJA 4H67A 2Y5KA 3MVWA 2R9JA 4ZZEA 3LUZA 1M5DA 1BP5A 1NV7A 2GHBA 2CMOA 4GL0A 4F1VA 3VLVA 5AA2B 1YTVA 5A5XA 5IGAA 4G2ZA 1LFHA 3UN6A 3BBRA 3GZGA 3PUWE 3A3CA 2Y5LA 1A40A 3B6TA 4C1TA 1KA0A 3K1MA 3FD3A 1SYHA 5LTCA 3LUYA 4GXSB 5CBRA 3QXMA 2XWKA 1LGBC 2WKYA 3THIA 1IMFA 1RYOA 1MY0A 5TPAA 1MPCA 4DXCA 3E9XA 1LBCA 2QJEA 2OWTA 1FQAA 2UVGA 4YB5A 4IGRA 5I2KA 5I84A 4U4SA 5JTYB 1AWBA 1GR2A 3RUMA 3IR1A 2D21A 1HSJA 1QUIA 2DQVA 2QPQA 2DE2A 1P1QA 1I69A 4N8YA 1FTKA 4H45A 2LAOA 4RXLA 1AIVA 2XXVA 5H8QB 2O7UA 3Q26A 4XFEA 1Z7NE 1NNKA 3A29A 4LVQA 5EHMA 5TP9A 4MCOA 1Y4CA 1FQEA 3D4GA 3P7IA 4NWDA 3CFXA 4E0XA 1MG1A 3O29A 3OO6A 4OVJA 4H1XA 1FPEA 3FXBA 5J16A 1NH7A 3FVKA 1II5A 3B6QA 3ECRA 3DP6A 3D4CA 2W7YA 4EDPA 4F22A 2UXAA 4H8IA 4O3CA 3W15C 1R9QA 3TUSA 1EZ9A 3D1RA 2DXRA 1FQCA 2Z8FA 2RF1A 4LP2B 4OYVA 4ND9A 1WDNA 4QHQA 3TCHA 3LSFB 1AMFA 3ZKLA 3IFCA 3V83A 4HS7A 5I7IA 4U1OA 3K00A 5EYGA 4XF5A 2FA7A 2HZKA 2P0SA 1Y3QA 4RYAA 1B40A 4R72A 4KFQA 4LATA 3MAMA 2AIXA 4H46A 2XX7A 4EUOA 4KCDA 1XS5A 2DSFA 4POXA 2G93A 3FXQA 3F11A 3TODA 5L9SA 1R6ZA 3MZBA 1VR5A 2IA4A 3CFZA 3T9XB 4NQ8A 1BK4A 2OLBA 2P1SA 2OZZA 3LSLA 1LAFE 3FUZA 2DS9A 3FVNA 1S7YA 1EH3A 2XXKA 3R26A 1P1OA 4G68B 1MQGA 1IZ1A 2WBBA 4YICA 3H4ZA 1ZJLA 2OCUA 1DCUA 4XXUA 2F35A 2F6GA 3O6GA 4DIGA 3VXBA 1NV1A 3CG1A 4DCYA 4HCYA 2F34A 3IFAA 3ODBA 4NGUA 1FTJA 3Q28A 2FHYA 4R74A 4TLLB 5H8NB 4OQOA 1N7XA 3KJTA 3RGYA 1FBDA 3HHFA 4LN5A 4F2QA 1A99A 2HAVA 4TQUQ 2Q2AA 1NUYA 3TTMA 2I4BA 5IM2A 2OK2A 5DVFA 4NF0A 3TMGA 3TQWA 2M8CA 4RPNA 3E79A 3HSTA 4OERA 4NF8A 3G7WA 1L5TA 5H8SA 4DLDA 3K0VA 4IGTA 1D4NA 1DTZA 3H7MA 1DPEA 1FPFA 1JEVA 4NF6B 4ESXA 5I2NA 2DP8A 3IORA 5AA1A 2GRVA 3VDFA 2QVUA 4G8MA 1MY2A 2A5SA 4QFOA 1ZTYA 2F78A 4WEDA 5EQ9A 3RY3A 1UIUA 4HW8A 4NF5A 2QMWA 4PDDA 2F8DA 4ZE9A 1B58A 1MXVA 2I3WA 1SW5A 3OSQA 4YKPA 2R8TA 5AA3A 1A8FA 4NN3A 4R6YA 4IO2A 2DYXA 3O9PA 5BWJA 4QSCA 5F1QA 1NH8A 1NV5A 2UYEA 2V3TA 1LB9A 4OEVA 2AYSA 4PFTA 2Q8MA 1B3EA 1MH3A 1Y3NA 4F2OA 5FHNA 4X1DA 4JVCA 3RTFB 2ESNA 4PFBA 5KDTB 3CI8A 2L5VA 5H8FB 1G0HA 1UTHA 4OEUA 2A5TA 3DM0A 2DE4A 5B70A 4PFRA 3TCFA 2DWJA 3PPOA 3C4MA 2YJPA 1G0IA 2ABHA 2XWVA 1VE4A 3NOHA 4H5FA 1YZ0A 3IL1B 4PBHA 2HZLA 3PUXE 3ZSFA 4N15A 4F3SA 3RPWA 1QULA 1N3WA 4IO6A 4K3FA 1WODA 1LEVA 5EYFA 4O94A 4Q5TA 5I56A 3RPLA 1LBWA 1N0TA 1POTA 3HHGA 4LZ8A 4PC9A 2PFZA 4THIA 3DELB 1EZOA 2ONRA 3Q27A 3CVGA 4EF1A 1AH5A 1LBYA 1JEUA 2CZKA 4PE3A 3H03A 4ZEDA 1FTMA 2NWJA 1B52A 3UA8A 1EU8A 4UABA 4QRZA 2XD3A 1B0HA 1A55A 3C33A 3L6GA 3G3JA 4DZ1A 4AB5A 1Y20A 4N81A 4ECFA 2UYFA 3MJNA 1FTLA 2XWOA 4ZEFA 3B8BA 1SYIA 1O63A 3U65A 3B7DA 3IB1A 4OFLA 2Q8JA 3BFUA 3WAEA 3G3FA 4UACA 1JW4A 3K6UA 3N6UA 3TYHA 1OQHA 4N13A 3ROJA 3S2VA 1B32A 1LBBA 4OENA 4RA1A 4N4UA 4GVOA 4ZS9A 4EF2A 1TXFA 1QKAA 2XXXA 2F7AA 4N8GA 3IOUA 1SVXB 5I59A 4Q0CA 1YCJA 2PVUA 1EZPA 1B1HA 1RDZA 3E4RA 4MJOA 4NTLA 5EQ8A 2F7BA 1GTKA 4GWUA 3K1NA 4PFIA 3K01A 5TPAB 3RYDA 5FHMA 1D9VA 5FTIA 3FBPA 3USDA 3Q29A 2AL5A 4OVRA 5AA2D 1TWYA 3HV1A 4NAPA 2F36A 2XHDA 2Y7KA 2REGA 3TFLA 2QS4A 5CI5A 3S9NC 3QK6A 2HAUA 4KYDA 1OLCA 1FTAA 3SEYA 4GWZA 3QSLA 4X8RA 4MAGA 4N6PA 1Y3PA 1Y4TA 5IZ3A 5CRYA 1URGA 3PPPA 3S4UA 5H8HA 4RK9A 1N76A 5TP9B 1N7WA 3BIHA 1YYZA 2UVJA 4ZE8A 1BLFA 3T9VA 4EXLA 2Z22A 2F3DA 1UIVA 4PE5B 3M3KA 5IZ1A 3IOVA 4YZZA 4JB7A 4DI4B 3R6UA 3PMXA 3T22A 4FEBA 3G3IA 1VDWA 1FCKA 2XA5A 3V8XB 2B3BA 4YAHX 4GWWA 2Q89A 4OXVA 2X26A 2V93A 1MXXA 1QJMA 3O28A 3K6WA 1US5A 4GX3A 2V3QA 3OD7A 4R75A 4PFUA 4OWDA 1MXYA 2ANJA 3SERA 4YMBA 5I58A 3PUVE 3HCQA 4MIJA 4QBAA 4PETA 1OQGA 3DP4A 3FJ7A 4OMBA 2RKMA 2JJKA 1POY1 3FIRA 4LZ7A 3EPEA 4KCCA 5K2XA 1R9LA 3HN0A 3MVZA 2VHAA 4GD5A 3DP8A 3KBRA 2QMXA 4JXIA 2Q88A 3CR9A 1UTBA 2H99A 1IXIA 2DE3A 1NV6A 1NUXA 3FV2A 1NFTA 2O69A 3M3LA 4R2FA 4C1UA 3MZ1A 2PT1A 2THIA 4U2RA 2F7CA 5CBSA 2FIXA 1NNPA 4HCWA 4U4XA 4DXUA 5EHSA 3PV0E 1B5IA 4MX6A 5HBCA 3LR1A 2QVVA 5DEXB 5HM4B 3U72A 4OA4A 2B3FA 5ELVA 4OVTA 4I40A 3TEPA 1ANFA 4Q30B 1IMDA 5EQ7A 1HSLA 1TT1A 2B65A 2BJIA 4L17A 4R6HA 1PB9A 2GQ1A 2O1LA 4X48A 2RCBA 1XOCA 2KR0A 3T93B 4O3BA 1DTGA 5T3JA 2REJA 4OFOA 1H3DA 2YLNA 4U21A 1Y1MA 3PUYE 4MNIA 2ZZXA 4PGNA 2OWZA 1MY3A 4EQ9A 1BKAA 4JVDA 3TPAA 3N5LA 4ELPA 1D9QA 4NF8B 2O6AA 4GBWA 5TU0A 3KN8A 1XC1A 2I48A 1K9YA 1TFDA 4O7IA 2YPNA 4ONYA 4KYSA 2CEYA 1A7LA 1WVJA 4GL8A 4PP0A 5J1DA 1PB7A 3R7XA 4MNCA 3U93A 3VFJA 2G29A 4I9DA 4HE1A 3VLUA 4PF6A 1NNTA 3G3HA 3MBPA 1B2HA 2ZMBA 3U92A 3OO7A 1NV2A 4TLMB 1FPJA 3O2AA 1B05A 1S9TA 2V25A 1SW2A 4OVPA 3FXUA 3U94A 2VOZA 4H65A 2UVIA 1O7TA 1H43A 3FZVA 1OLAA 3LC8A 4GFRA 4MMPA 1FBEA 3IAZA 3TELA 1AOVA 1VSOA 1F9BA 3IB2A 4LZ5A 1M5BA 3C34A 4N6DA 3CSGA 1RDXA 4UA8A 4BDNA 1IQ7A 4KXPA 1MPDA 3LSWA 3EF7A 4I3YA 5I57A 1DSNA 4AS5A 2QS2A 3K6XA 4X9TA 4FECA 1RKMA 1JW5A 1VFEA 2Q9TA 3H6VA 3G3GA 4FEDA 2I0BA 5KCJA 4OVQA 1NUZA 2RC8A 4NF4B 3K4UA 4PDHA 4POWA 4OFJA 1URSA 4GWXA 2CZIA 4FJPA 4PFYA 1FBFA 1LCFA 4ZEKA 4WKMA 4QXDA 3OEMA 4EQBA 4F39A 4BDMA 3KJ7A 5AE4A 4G77A 5IZZA 4G61A 4IO5A 1IMAA 1DK4A 3EQ1A 4GRKA 3BFTA 1XT8A 2DWAA 3SEVA 4JDFA 4NMYA 3SEXA 5DVJA 4MBPA 4R73A 1USYH 4AB6A 1JETA 2DWIA 1N04A 2ZNTA 4ZZAA 4PQJA 2XX9A 1MXWA 3QMFA 3K2DA 4F1UA 5ISUA 3UP9A 1N3XA 5DYHA 3C9HA 3PMVA 4OHNA 2QL3A 1LLSA 1FBGA 1S50A 3EKIA 1Y1ZA 2P3VA 1MQHA 3OXNA 4M4GA 1M5EA 3MC2A 1P99A 4F1YA 4RK2A 2I49A 4OTEA 3O66A 3VE1B 3RTWB 5ICQA 3O6HA 4HE2A 4FATA 2WYKA 2ZZVA 3MPLA 1US4A 4GBVA 4G8HA 4P11A 2HHMA 3VVEA 1IIWA 4PBQA 1OMPA 5JEIA 1CE2A 1SI1A 2BJJX 2XXIA 4BDOA 4QFKA 4XKNA 3OELA 4ESWA 5B7DA 4H0WA 4MH5A 1NMUA 3FGSA 1J1NA 4PTKA 1TFAA 3T9UA 1FPLA 3N94A 3KC1A 3ILUB 2ZYOA 5DW8A 3KOTA 4QF9A 3WAFA 5H8NA 1GGGA 1M5CA 1LAXA 2WYPA 2CZHA 3PPQA 4GWSA 5IAIA 2NUVA 2DDKA 4RPOA 5CMCA 2DVZA 2I3VA 3SKPA 5AA4A 3IB0A 3DLNA 3V5AA 3K6VA 2E1SA 4LQ5A 2QSXA 5ITOA 2ZYKA 3IOTA 1ZMGA 1B5JA 2OX3A 1LFGA 1D3KA 2O1MA 3UIFA 4NF6A 3N26A 2QFLA 4P1LA 4U1ZA 5JK4A 3E13X 1A8EA 1B6HA 1XHYA 1FBHA 4P3LA 3SESA 1DBZA 4Z0IA 1KZ8A 4KHZE 4EQ7A 5IZ3B 1O64A 1RYXA 3T9HB 1HSEA 4FAJA 4YKJA 4N07A 3O97A 3VVDA 1NUWA 1FSAA 4JWYA 1B3FA 1CB6A 1PDAA 2I4CA 3KN7A 5DT6A 3S9MC 1OVTA 5FTHA 1B3LA 4PFWA 2PFYA 2DOJA 4XKQA 4G68C 2ONSA 1SI0A 4BDQA 2XX8A 5A5XB 1PEBA 4H6DA 2H9BA 2O51A 3RLFE 2Z23A 5A5LA 1QW0A 2AL4A 1MH4A 2VD3A 5KDTA 2Y7IA 5CM6A 4N91A 2F5XA 2ZXTA 4JSOA 5H8FA 3MP6A 1ZLQA 4P8BA 1B3GA 3QYTA 4I62A 4P1EA 3OSRA 4FBPA 1EYKA 1YXIA 4NEDA 3BIGA 5CC2A 2ALUA 3LSXA 1KWHA 1MRPA 3UORA 4LQ2A 1LSTA 4OVSA 4X04A 1ZKBA 3FXRA 4P47A 5F7VA 1KA1A 4IY6A 3PGFA 3ILTB 1UTBB 5I2KB 3FASA 4PAKA 1K9ZA 2P2AA 1FPGA 1N84A 3KGCA 4JBZA 4WEPA 3CFLA 1IXGA 2RINA 4F3BA 5FBPA 3PPNA 2IEEA 4R9GA 1SBPA 4FE8A 3TZAA 4GXAA 3PUZE 2HXRA 3PD9A 4DI3D 2OWSA 2ZNSA 3PMWA 4P9KA 1A54A 1Q1KA 4G4PA 1D9YA 5L9MA 2O68A 5ET6A 4KR5A 5EYHA 3FJGA 3OO8A 1PBQA 4PAFA 2WX9A 3JV9A 3JZJA 2E0SA 5F24A 3SETA 3U1OA 4RY1A 5L9OA 4ELQA 5HPQA 4YB6A 4QFPA 1OIBA 4E0WA 3HFUA 1ELJA 2Y84A 2I0CA 4GX6A 1I6AA 2Q74A 3RT6B 3H6WA 3CRBA 2I58A 2GHAA 1LAGE 3MWBA 3PPRA 3ONMA 1ZU0A 3T66A 4PF8A 3MYUA 3KBZA 1B4ZA 2VT5A 2VP1A 2ZYMA 4F31B 3PD8A 1MDQA 5I5PA 2KLFA 3LV0A 4TOZA 3FJMA 3HPIA 3C36A 4JSDA 2FYIA 1BTJA 1B46A 4GX4A 4IY5A 4BLAA 2V4CA 2O84X 1SQYA 2OJTA 2XXWA 1B4HA 2DXYA 1AL3A 1ATGA 2XXUA 1EYJA 3IJXB 4ISUA 5K2YA 1NV4A 2WEFA 3L6HA 4N6KA 2H5YA 3KOSA 3GBAA 1MXUA 2FBPA 3FV1A 3H06B 4KYEA 4X1BA 3H3GA 4F29A 1ZIUA 4Z7EA 2Z8EA 3VV5A 2VPOA 3H6UA 2QVRA 3E3KA 1QKBA 4BDRA 4I1DA 2ZZWA 1Q9DA 5CMBA 1Q35A 3EN3A 1B0LA 1NV0A 5I57B 1YAEA 1FJ9A 1UQWA 4F3PA 4HXVA 3GBBA 1IUDA 1OVBA 1MS7A 3TTLA 5KCJB 1FBPA 3ZKKA 4O8MA 3G3KA 3OEKA 3EHTA 4QSDA 2VPNA 1FQFA 1MPBA 2FVZA 3UK4A 1SD3A 3RNNA 4Q8RA 1P1NA 5AA2A 3C35A 1FPDA 1B7ZA 3O6IA 1LAHE 1MDP1 4NG7A 1B9JA 4DDDA 1JVYA 4GLIA 1MY1A 2KQZA 2PBWA 4ZDMA 4OZ9A 4P0IA 3ISPA 5I2NB 4HTGA 3QUJA 3U8QA 4ELRA 3KSXA 1NNFA 2H4IA 4IR8A 3SDFA 1PBPA 1P1UA 3M8UA 2Y7WA 4NF5B 1IMEA 3GLBA 4XKPA 2PT2A 2X7PA 3QIMA 4NE4A 1NI9A 3CSBA 1FQBA
chains in the Genus database with same CATH topology
3C31A 4ZEBA 2D5WA 5JTYA 3OOAA 4C0RA 4LA9A 2Y7PA 5DVIA 3LBSA 2PYYA 4R2BA 4G8NA 1YPNA 1USYE 3FVGA 3I6VA 4OETA 4H5GA 2CZLA 2PMSA 3IO6A 3K02A 3JYRA 1IXHA 3CIJA 2F97A 5H8QA 4DCXA 4KD5A 5DEXA 3SEUA 1MY4A 1R1NA 1B7UA 1UTHB 1FTOA 4WXJA 2XXPA 2A5TB 3IO4A 4NWCA 4F18A 1LCTA 3RN8A 4YB7A 3EHUA 2H25A 1I6BA 3KG2A 3TAJA 4U22A 2XXTA 5M2VA 2QS1A 3KZGA 4ELOA 5I56B 3MP8A 5AA4B 1B7HA 4IB2A 4XKRA 1MM6A 2V84A 4M1VA 2VD2A 1FQDA 3QAXA 2PX1A 4GIZA 4RNSA 3OMBA 4MLVA 1B3HA 3KN3A 2XXRA 1PC3A 3FATA 4R6KA 2Z8DA 2XXHA 4GQOA 3H6TA 2QRYA 1Y9UA 3KEIA 2Y7RA 1GV8A 1P1WA 4QSEA 3K1PA 3GXAA 3TDJA 3MW0A 3KFMA 3MP1A 5IKBA 3T96B 1MQDA 3QUFA 4YMAA 2RC7A 4G68A 2NOOA 3C32A 2XD2A 1B5HA 1H76A 1T0KA 1B51A 4FIMA 3N6TA 4XIGQ 2XXYA 5I59B 2NXOA 4U23A 4YKIA 3MVYA 3TQLA 2FNCA 1H45A 4I8CA 2ONKE 4ZECA 4NF4A 4IO4A 3IX1A 4YU0A 3PU5A 3TTRA 2O7IA 2Q2CA 1ZBMA 1I6QA 3S9LC 1BIYA 1DPPA 4DXBA 2HCAA 4QFLA 2XXQA 1LB8A 4BDLA 1DMBA 2RC9A 2NVUB 3HO7A 1URDA 5DTBA 5CMMA 1XVXA 4AQ4A 1GVCA 1IITA 2HXWA 3VXCA 1IEJA 2HEUA 1JW1A 4JWXA 4QFNA 3VLWA 4ZEIA 1XVYA 4EXKA 5H8HB 2HQ0A 3AXFA 3V89B 2ZYNA 3UGWA 2X7QA 3TKDA 2D3IA 1NKXA 1Z7ME 5KZTA 4XTCQ 3A3UA 4LONB 3MQ9A 4F19A 2ZNUA 2GH9A 1MM7A 3TCGA 3A09A 4MFIA 1JNFA 2RCAA 5ITPA 5L8DA 4YKKA 5BUUA 3FVOA 2VGQA 1IXCA 4DE8A 1SDXA 4OESA 1MQJA 2GFEA 1MQIA 4LUBA 1M5FA 3OO9A 3B6WA 5I58B 1H44A 3IK6B 2R71A 4KI0E 3ZS6A 5FHOA 1JVXA 2HFBA 3VVFA 2H98A 3SEWA 4H8JA 4FORA 3MPKA 4GOTA 3I5OA 4P0GA 3M3FA 3RQTA 3W9VA 3OENA 3BKIB 1QUJA 5LOMA 2QS3A 4R9FA 4IO7A 3MVXA 1FW0A 4MLQA 3CG3A 1B1XA 1LFIA 4F3GA 4O3AA 2DVCA 4IO3A 2I6EA 4MF3A 3TTNA 3IJOB 1MXZA 2V3UA 2DWHA 3TTKA 1QVSA 2R6GE 4KPTA 1SW4A 2F6PA 4GWOA 4GF8A 3IOWA 4KQPA 5CMKA 1VFDA 5ICTA 1JQFA 4JWOA 3S9EA 3Q25A 3MZ9A 4RJZA 1DOTA 1NL5A 3RT8A 1PB8A 1SW1A 3W9WA 3I3VA 3MUQA 3EHSA 1QUKA 2UVHA 2OBGA 3KSJA 4H67A 3MVWA 2R9JA 4ZZEA 1M5DA 1BP5A 2GHBA 2CMOA 4GL0A 4F1VA 3VLVA 5AA2B 1YTVA 5A5XA 4G2ZA 1LFHA 3UN6A 3BBRA 3GZGA 3PUWE 3A3CA 1A40A 3B6TA 4C1TA 3K1MA 3FD3A 1SYHA 3LUYA 4GXSB 5CBRA 3QXMA 1LGBC 2WKYA 3THIA 1RYOA 1MY0A 5TPAA 1MPCA 4DXCA 3E9XA 1LBCA 2QJEA 2OWTA 1FQAA 2UVGA 4YB5A 4IGRA 5I2KA 5I84A 4U4SA 5JTYB 1GR2A 3RUMA 3IR1A 2D21A 1HSJA 1QUIA 2DQVA 2QPQA 2DE2A 1P1QA 1I69A 1FTKA 4RXLA 2LAOA 1AIVA 2XXVA 5H8QB 2O7UA 3Q26A 1Z7NE 1NNKA 4LVQA 5EHMA 5TP9A 1Y4CA 1FQEA 3D4GA 3P7IA 4NWDA 3CFXA 4E0XA 1MG1A 3O29A 3OO6A 4OVJA 4H1XA 1NH7A 3FVKA 1II5A 3B6QA 3ECRA 3DP6A 3D4CA 2W7YA 4EDPA 4F22A 2UXAA 4H8IA 4O3CA 3W15C 1R9QA 3TUSA 1EZ9A 2DXRA 1FQCA 2Z8FA 2RF1A 4LP2B 4OYVA 4ND9A 1WDNA 4QHQA 3TCHA 3LSFB 1AMFA 3ZKLA 3V83A 4HS7A 4U1OA 3K00A 2FA7A 2HZKA 2P0SA 1Y3QA 4RYAA 1B40A 4R72A 4KFQA 4LATA 3MAMA 2AIXA 2XX7A 4EUOA 4KCDA 1XS5A 2DSFA 4POXA 2G93A 3FXQA 3F11A 3TODA 5L9SA 1R6ZA 3MZBA 1VR5A 2IA4A 3CFZA 3T9XB 2OLBA 2P1SA 2OZZA 3LSLA 1LAFE 3FUZA 2DS9A 3FVNA 1S7YA 1EH3A 3R26A 1P1OA 4G68B 1MQGA 1IZ1A 4YICA 3H4ZA 1ZJLA 2OCUA 4XXUA 2F35A 2F6GA 3O6GA 4DIGA 3VXBA 3CG1A 4DCYA 4HCYA 2F34A 3ODBA 1FTJA 3Q28A 4R74A 4TLLB 5H8NB 4OQOA 1N7XA 3KJTA 3RGYA 3HHFA 4F2QA 1A99A 2HAVA 4TQUQ 2Q2AA 3TTMA 2I4BA 2OK2A 5DVFA 3TMGA 3TQWA 2M8CA 4RPNA 3HSTA 4OERA 4NF8A 3G7WA 1L5TA 5H8SA 4DLDA 3K0VA 4IGTA 1D4NA 1DTZA 3H7MA 1DPEA 1JEVA 4NF6B 4ESXA 5I2NA 2DP8A 3IORA 5AA1A 2GRVA 3VDFA 4G8MA 1MY2A 2A5SA 4QFOA 1ZTYA 2F78A 4WEDA 3RY3A 1UIUA 4HW8A 4NF5A 2QMWA 2F8DA 4ZE9A 1B58A 1MXVA 2I3WA 1SW5A 3OSQA 4YKPA 5AA3A 1A8FA 4R6YA 4IO2A 2DYXA 3O9PA 5BWJA 4QSCA 5F1QA 1NH8A 2UYEA 2V3TA 1LB9A 4OEVA 2AYSA 4PFTA 1B3EA 1MH3A 1Y3NA 4F2OA 5FHNA 4X1DA 3RTFB 2ESNA 5KDTB 3CI8A 5H8FB 1UTHA 4OEUA 2A5TA 3DM0A 2DE4A 5B70A 3TCFA 2DWJA 3PPOA 3C4MA 2YJPA 2ABHA 1VE4A 4H5FA 3IL1B 2HZLA 3PUXE 3ZSFA 4F3SA 3RPWA 1QULA 1N3WA 4IO6A 4K3FA 1WODA 5EYFA 4Q5TA 5I56A 1N0TA 1POTA 3HHGA 4LZ8A 4THIA 3DELB 1EZOA 2ONRA 3Q27A 3CVGA 4EF1A 1AH5A 1JEUA 3H03A 4ZEDA 1FTMA 2NWJA 1B52A 3UA8A 1EU8A 4QRZA 2XD3A 1B0HA 1A55A 3C33A 3L6GA 3G3JA 4DZ1A 4AB5A 1Y20A 4ECFA 2UYFA 3MJNA 1FTLA 4ZEFA 1SYIA 1O63A 3B7DA 3IB1A 4OFLA 2Q8JA 3BFUA 3WAEA 3G3FA 4UACA 1JW4A 3K6UA 3N6UA 3TYHA 1OQHA 4N13A 3S2VA 1B32A 1LBBA 4OENA 4RA1A 4GVOA 4ZS9A 4EF2A 1TXFA 1QKAA 2XXXA 2F7AA 3IOUA 1SVXB 5I59A 4Q0CA 1YCJA 2PVUA 1EZPA 1B1HA 3E4RA 4NTLA 2F7BA 1GTKA 3K1NA 3K01A 5TPAB 5FHMA 1D9VA 5FTIA 3USDA 3Q29A 2AL5A 5AA2D 1TWYA 3HV1A 2F36A 2XHDA 2Y7KA 2REGA 3TFLA 2QS4A 5CI5A 3S9NC 3QK6A 2HAUA 4KYDA 1OLCA 3SEYA 3QSLA 4N6PA 1Y3PA 1Y4TA 5CRYA 1URGA 3PPPA 3S4UA 5H8HA 4RK9A 1N76A 5TP9B 1N7WA 2UVJA 4ZE8A 1BLFA 3T9VA 4EXLA 2Z22A 1UIVA 4PE5B 3M3KA 3IOVA 4YZZA 4JB7A 3R6UA 3PMXA 3T22A 4FEBA 3G3IA 1FCKA 3V8XB 2B3BA 4YAHX 2Q89A 4OXVA 2X26A 2V93A 1MXXA 1QJMA 3O28A 3K6WA 1US5A 2V3QA 3OD7A 4R75A 4PFUA 4OWDA 1MXYA 2ANJA 3SERA 4YMBA 5I58A 3PUVE 3HCQA 4PETA 1OQGA 3DP4A 3FJ7A 4OMBA 2RKMA 1POY1 3FIRA 4LZ7A 3EPEA 4KCCA 5K2XA 1R9LA 3HN0A 3MVZA 2VHAA 4GD5A 3DP8A 3KBRA 2QMXA 4JXIA 2Q88A 3CR9A 1UTBA 2H99A 1IXIA 2DE3A 3FV2A 1NFTA 2O69A 3M3LA 4R2FA 4C1UA 3MZ1A 2PT1A 2THIA 4U2RA 2F7CA 5CBSA 1NNPA 4HCWA 4U4XA 4DXUA 5EHSA 3PV0E 1B5IA 5HBCA 3LR1A 5DEXB 5HM4B 3U72A 2B3FA 5ELVA 3TEPA 1ANFA 4Q30B 1HSLA 1TT1A 2B65A 4L17A 4R6HA 1PB9A 2O1LA 4X48A 2RCBA 1XOCA 3T93B 4O3BA 1DTGA 2REJA 4OFOA 1H3DA 2YLNA 4U21A 1Y1MA 3PUYE 1MY3A 4EQ9A 1BKAA 3TPAA 3N5LA 4ELPA 4NF8B 2O6AA 5TU0A 3KN8A 1XC1A 2I48A 1TFDA 2YPNA 4ONYA 4KYSA 1A7LA 1WVJA 4GL8A 4PP0A 5J1DA 1PB7A 3R7XA 3U93A 3VFJA 2G29A 4I9DA 3VLUA 1NNTA 3G3HA 3MBPA 1B2HA 2ZMBA 3U92A 3OO7A 4TLMB 3O2AA 1B05A 1S9TA 2V25A 1SW2A 3FXUA 3U94A 2VOZA 4H65A 2UVIA 1O7TA 1H43A 3FZVA 1OLAA 3LC8A 4GFRA 3IAZA 3TELA 1AOVA 1VSOA 1F9BA 3IB2A 4LZ5A 1M5BA 3C34A 3CSGA 4UA8A 4BDNA 1IQ7A 1MPDA 3LSWA 3EF7A 5I57A 1DSNA 2QS2A 3K6XA 4X9TA 4FECA 1RKMA 1JW5A 1VFEA 2Q9TA 3H6VA 3G3GA 4FEDA 2I0BA 5KCJA 2RC8A 4NF4B 3K4UA 4POWA 4OFJA 1URSA 4FJPA 4PFYA 1LCFA 4ZEKA 4WKMA 3OEMA 4EQBA 4F39A 4BDMA 3KJ7A 5AE4A 4G77A 4IO5A 3EQ1A 4GRKA 3BFTA 1XT8A 2DWAA 3SEVA 4JDFA 4NMYA 3SEXA 5DVJA 4MBPA 4R73A 1USYH 4AB6A 1JETA 2DWIA 1N04A 2ZNTA 4ZZAA 4PQJA 2XX9A 1MXWA 3K2DA 4F1UA 5ISUA 3UP9A 1N3XA 5DYHA 3C9HA 3PMVA 4OHNA 2QL3A 1LLSA 1S50A 1Y1ZA 1MQHA 3OXNA 4M4GA 1M5EA 3MC2A 1P99A 4F1YA 4RK2A 2I49A 4OTEA 3O66A 3VE1B 3RTWB 5ICQA 3O6HA 4FATA 3MPLA 1US4A 4G8HA 4P11A 3VVEA 1IIWA 1OMPA 5JEIA 1CE2A 1SI1A 2BJJX 2XXIA 4BDOA 4QFKA 4XKNA 3OELA 4ESWA 5B7DA 4H0WA 4MH5A 1NMUA 3FGSA 1J1NA 1TFAA 3T9UA 3N94A 3ILUB 2ZYOA 3KOTA 4QF9A 3WAFA 5H8NA 1GGGA 1M5CA 1LAXA 3PPQA 5IAIA 2NUVA 4RPOA 5CMCA 2DVZA 2I3VA 3SKPA 5AA4A 3IB0A 3DLNA 3V5AA 3K6VA 2E1SA 4LQ5A 2QSXA 5ITOA 2ZYKA 3IOTA 1ZMGA 1B5JA 1LFGA 1D3KA 2O1MA 3UIFA 4NF6A 3N26A 4U1ZA 5JK4A 3E13X 1A8EA 1B6HA 1XHYA 3SESA 4Z0IA 4KHZE 4EQ7A 1O64A 1RYXA 3T9HB 1HSEA 4FAJA 4YKJA 4N07A 3O97A 3VVDA 4JWYA 1B3FA 1CB6A 1PDAA 2I4CA 3KN7A 5DT6A 3S9MC 1OVTA 5FTHA 1B3LA 4PFWA 2DOJA 4XKQA 4G68C 5A5XB 1SI0A 2ONSA 2XX8A 4BDQA 1PEBA 4H6DA 2H9BA 2O51A 3RLFE 2Z23A 1QW0A 2AL4A 1MH4A 2VD3A 5KDTA 2Y7IA 5CM6A 2F5XA 2ZXTA 4JSOA 5H8FA 3MP6A 1ZLQA 1B3GA 3QYTA 4I62A 3OSRA 4NEDA 5CC2A 2ALUA 3LSXA 1KWHA 1MRPA 3UORA 4LQ2A 1LSTA 1ZKBA 3FXRA 5F7VA 4IY6A 3PGFA 3ILTB 1UTBB 5I2KB 3FASA 2P2AA 1N84A 3KGCA 4JBZA 4WEPA 3CFLA 1IXGA 2RINA 4F3BA 3PPNA 2IEEA 4R9GA 1SBPA 4FE8A 3TZAA 4GXAA 3PUZE 3PD9A 2OWSA 2ZNSA 3PMWA 1A54A 1Q1KA 4G4PA 1D9YA 5L9MA 2O68A 4KR5A 3FJGA 3OO8A 1PBQA 3JV9A 3JZJA 2E0SA 3SETA 3U1OA 4RY1A 5L9OA 4ELQA 5HPQA 4YB6A 4QFPA 1OIBA 4E0WA 1ELJA 2Y84A 2I0CA 1I6AA 3RT6B 3H6WA 3CRBA 2I58A 2GHAA 1LAGE 3MWBA 3PPRA 3ONMA 1ZU0A 3T66A 1B4ZA 2VP1A 2ZYMA 4F31B 3PD8A 1MDQA 2KLFA 4TOZA 3FJMA 3HPIA 3C36A 4JSDA 2FYIA 1BTJA 1B46A 4IY5A 4BLAA 2O84X 1SQYA 2OJTA 2XXWA 1B4HA 2DXYA 1AL3A 1ATGA 2XXUA 3IJXB 4ISUA 5K2YA 3L6HA 2H5YA 3KOSA 3GBAA 1MXUA 3FV1A 3H06B 4KYEA 4X1BA 3H3GA 4F29A 1ZIUA 4Z7EA 2Z8EA 3VV5A 3H6UA 3E3KA 1QKBA 4BDRA 4I1DA 5CMBA 1Q35A 3EN3A 1B0LA 5I57B 1YAEA 1UQWA 4F3PA 3GBBA 1IUDA 1OVBA 1MS7A 3TTLA 5KCJB 3ZKKA 3G3KA 3OEKA 3EHTA 4QSDA 1FQFA 1MPBA 3UK4A 1SD3A 3RNNA 4Q8RA 1P1NA 5AA2A 3C35A 1B7ZA 3O6IA 1LAHE 1MDP1 1B9JA 4DDDA 1JVYA 4GLIA 1MY1A 2PBWA 4ZDMA 4OZ9A 4P0IA 5I2NB 4HTGA 3QUJA 3U8QA 4ELRA 3KSXA 1NNFA 2H4IA 3SDFA 1PBPA 1P1UA 3M8UA 2Y7WA 4NF5B 3GLBA 4XKPA 2PT2A 2X7PA 3QIMA 4NE4A 3CSBA 1FQBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C31 A;  4ZEB A;  2D5W A;  5JTY A;  3OOA A;  4C0R A;  4LA9 A;  2Y7P A;  5DVI A;  3LBS A;  2PYY A;  4R2B A;  4G8N A;  1YPN A;  1USY E;  3FVG A;  3I6V A;  4OET A;  4H5G A;  2CZL A;  2PMS A;  3IO6 A;  3K02 A;  3JYR A;  1IXH A;  3CIJ A;  2F97 A;  5H8Q A;  4DCX A;  4KD5 A;  5DEX A;  3SEU A;  1MY4 A;  1R1N A;  1B7U A;  1UTH B;  1FTO A;  4WXJ A;  2XXP A;  2A5T B;  3IO4 A;  4NWC A;  4F18 A;  1LCT A;  3RN8 A;  4YB7 A;  3EHU A;  2H25 A;  1I6B A;  3KG2 A;  3TAJ A;  4U22 A;  2XXT A;  5M2V A;  2QS1 A;  3KZG A;  4ELO A;  5I56 B;  3MP8 A;  5AA4 B;  1B7H A;  4IB2 A;  4XKR A;  1MM6 A;  2V84 A;  4M1V A;  2VD2 A;  1FQD A;  3QAX A;  2PX1 A;  4GIZ A;  4RNS A;  3OMB A;  4MLV A;  1B3H A;  3KN3 A;  2XXR A;  1PC3 A;  3FAT A;  4R6K A;  2Z8D A;  2XXH A;  4GQO A;  3H6T A;  2QRY A;  1Y9U A;  3KEI A;  2Y7R A;  1GV8 A;  1P1W A;  4QSE A;  3K1P A;  3GXA A;  3TDJ A;  3MW0 A;  3KFM A;  3MP1 A;  5IKB A;  3T96 B;  1MQD A;  3QUF A;  4YMA A;  2RC7 A;  4G68 A;  2NOO A;  3C32 A;  2XD2 A;  1B5H A;  1H76 A;  1T0K A;  1B51 A;  4FIM A;  3N6T A;  4XIG Q;  2XXY A;  5I59 B;  2NXO A;  4U23 A;  4YKI A;  3MVY A;  3TQL A;  2FNC A;  1H45 A;  4I8C A;  2ONK E;  4ZEC A;  4NF4 A;  4IO4 A;  3IX1 A;  4YU0 A;  3PU5 A;  3TTR A;  2O7I A;  2Q2C A;  1ZBM A;  1I6Q A;  3S9L C;  1BIY A;  1DPP A;  4DXB A;  2HCA A;  4QFL A;  2XXQ A;  1LB8 A;  4BDL A;  1DMB A;  2RC9 A;  2NVU B;  3HO7 A;  1URD A;  5DTB A;  5CMM A;  1XVX A;  4AQ4 A;  1GVC A;  1IIT A;  2HXW A;  3VXC A;  1IEJ A;  2HEU A;  1JW1 A;  4JWX A;  4QFN A;  3VLW A;  4ZEI A;  1XVY A;  4EXK A;  5H8H B;  2HQ0 A;  3AXF A;  3V89 B;  2ZYN A;  3UGW A;  2X7Q A;  3TKD A;  2D3I A;  1NKX A;  1Z7M E;  5KZT A;  4XTC Q;  3A3U A;  4LON B;  3MQ9 A;  4F19 A;  2ZNU A;  2GH9 A;  1MM7 A;  3TCG A;  3A09 A;  4MFI A;  1JNF A;  2RCA A;  5ITP A;  5L8D A;  4YKK A;  5BUU A;  3FVO A;  2VGQ A;  1IXC A;  4DE8 A;  1SDX A;  4OES A;  1MQJ A;  2GFE A;  1MQI A;  4LUB A;  1M5F A;  3OO9 A;  3B6W A;  5I58 B;  1H44 A;  3IK6 B;  2R71 A;  4KI0 E;  3ZS6 A;  5FHO A;  1JVX A;  2HFB A;  3VVF A;  2H98 A;  3SEW A;  4H8J A;  4FOR A;  3MPK A;  4GOT A;  3I5O A;  4P0G A;  3M3F A;  3RQT A;  3W9V A;  3OEN A;  3BKI B;  1QUJ A;  5LOM A;  2QS3 A;  4R9F A;  4IO7 A;  3MVX A;  1FW0 A;  4MLQ A;  3CG3 A;  1B1X A;  1LFI A;  4F3G A;  4O3A A;  2DVC A;  4IO3 A;  2I6E A;  4MF3 A;  3TTN A;  3IJO B;  1MXZ A;  2V3U A;  2DWH A;  3TTK A;  1QVS A;  2R6G E;  4KPT A;  1SW4 A;  2F6P A;  4GWO A;  4GF8 A;  3IOW A;  4KQP A;  5CMK A;  1VFD A;  5ICT A;  1JQF A;  4JWO A;  3S9E A;  3Q25 A;  3MZ9 A;  4RJZ A;  1DOT A;  1NL5 A;  3RT8 A;  1PB8 A;  1SW1 A;  3W9W A;  3I3V A;  3MUQ A;  3EHS A;  1QUK A;  2UVH A;  2OBG A;  3KSJ A;  4H67 A;  3MVW A;  2R9J A;  4ZZE A;  1M5D A;  1BP5 A;  2GHB A;  2CMO A;  4GL0 A;  4F1V A;  3VLV A;  5AA2 B;  1YTV A;  5A5X A;  4G2Z A;  1LFH A;  3UN6 A;  3BBR A;  3GZG A;  3PUW E;  3A3C A;  1A40 A;  3B6T A;  4C1T A;  3K1M A;  3FD3 A;  1SYH A;  3LUY A;  4GXS B;  5CBR A;  3QXM A;  1LGB C;  2WKY A;  3THI A;  1RYO A;  1MY0 A;  5TPA A;  1MPC A;  4DXC A;  3E9X A;  1LBC A;  2QJE A;  2OWT A;  1FQA A;  2UVG A;  4YB5 A;  4IGR A;  5I2K A;  5I84 A;  4U4S A;  5JTY B;  1GR2 A;  3RUM A;  3IR1 A;  2D21 A;  1HSJ A;  1QUI A;  2DQV A;  2QPQ A;  2DE2 A;  1P1Q A;  1I69 A;  1FTK A;  4RXL A;  2LAO A;  1AIV A;  2XXV A;  5H8Q B;  2O7U A;  3Q26 A;  1Z7N E;  1NNK A;  4LVQ A;  5EHM A;  5TP9 A;  1Y4C A;  1FQE A;  3D4G A;  3P7I A;  4NWD A;  3CFX A;  4E0X A;  1MG1 A;  3O29 A;  3OO6 A;  4OVJ A;  4H1X A;  1NH7 A;  3FVK A;  1II5 A;  3B6Q A;  3ECR A;  3DP6 A;  3D4C A;  2W7Y A;  4EDP A;  4F22 A;  2UXA A;  4H8I A;  4O3C A;  3W15 C;  1R9Q A;  3TUS A;  1EZ9 A;  2DXR A;  1FQC A;  2Z8F A;  2RF1 A;  4LP2 B;  4OYV A;  4ND9 A;  1WDN A;  4QHQ A;  3TCH A;  3LSF B;  1AMF A;  3ZKL A;  3V83 A;  4HS7 A;  4U1O A;  3K00 A;  2FA7 A;  2HZK A;  2P0S A;  1Y3Q A;  4RYA A;  1B40 A;  4R72 A;  4KFQ A;  4LAT A;  3MAM A;  2AIX A;  2XX7 A;  4EUO A;  4KCD A;  1XS5 A;  2DSF A;  4POX A;  2G93 A;  3FXQ A;  3F11 A;  3TOD A;  5L9S A;  1R6Z A;  3MZB A;  1VR5 A;  2IA4 A;  3CFZ A;  3T9X B;  2OLB A;  2P1S A;  2OZZ A;  3LSL A;  1LAF E;  3FUZ A;  2DS9 A;  3FVN A;  1S7Y A;  1EH3 A;  3R26 A;  1P1O A;  4G68 B;  1MQG A;  1IZ1 A;  4YIC A;  3H4Z A;  1ZJL A;  2OCU A;  4XXU A;  2F35 A;  2F6G A;  3O6G A;  4DIG A;  3VXB A;  3CG1 A;  4DCY A;  4HCY A;  2F34 A;  3ODB A;  1FTJ A;  3Q28 A;  4R74 A;  4TLL B;  5H8N B;  4OQO A;  1N7X A;  3KJT A;  3RGY A;  3HHF A;  4F2Q A;  1A99 A;  2HAV A;  4TQU Q;  2Q2A A;  3TTM A;  2I4B A;  2OK2 A;  5DVF A;  3TMG A;  3TQW A;  2M8C A;  4RPN A;  3HST A;  4OER A;  4NF8 A;  3G7W A;  1L5T A;  5H8S A;  4DLD A;  3K0V A;  4IGT A;  1D4N A;  1DTZ A;  3H7M A;  1DPE A;  1JEV A;  4NF6 B;  4ESX A;  5I2N A;  2DP8 A;  3IOR A;  5AA1 A;  2GRV A;  3VDF A;  4G8M A;  1MY2 A;  2A5S A;  4QFO A;  1ZTY A;  2F78 A;  4WED A;  3RY3 A;  1UIU A;  4HW8 A;  4NF5 A;  2QMW A;  2F8D A;  4ZE9 A;  1B58 A;  1MXV A;  2I3W A;  1SW5 A;  3OSQ A;  4YKP A;  5AA3 A;  1A8F A;  4R6Y A;  4IO2 A;  2DYX A;  3O9P A;  5BWJ A;  4QSC A;  5F1Q A;  1NH8 A;  2UYE A;  2V3T A;  1LB9 A;  4OEV A;  2AYS A;  4PFT A;  1B3E A;  1MH3 A;  1Y3N A;  4F2O A;  5FHN A;  4X1D A;  3RTF B;  2ESN A;  5KDT B;  3CI8 A;  5H8F B;  1UTH A;  4OEU A;  2A5T A;  3DM0 A;  2DE4 A;  5B70 A;  3TCF A;  2DWJ A;  3PPO A;  3C4M A;  2YJP A;  2ABH A;  1VE4 A;  4H5F A;  3IL1 B;  2HZL A;  3PUX E;  3ZSF A;  4F3S A;  3RPW A;  1QUL A;  1N3W A;  4IO6 A;  4K3F A;  1WOD A;  5EYF A;  4Q5T A;  5I56 A;  1N0T A;  1POT A;  3HHG A;  4LZ8 A;  4THI A;  3DEL B;  1EZO A;  2ONR A;  3Q27 A;  3CVG A;  4EF1 A;  1AH5 A;  1JEU A;  3H03 A;  4ZED A;  1FTM A;  2NWJ A;  1B52 A;  3UA8 A;  1EU8 A;  4QRZ A;  2XD3 A;  1B0H A;  1A55 A;  3C33 A;  3L6G A;  3G3J A;  4DZ1 A;  4AB5 A;  1Y20 A;  4ECF A;  2UYF A;  3MJN A;  1FTL A;  4ZEF A;  1SYI A;  1O63 A;  3B7D A;  3IB1 A;  4OFL A;  2Q8J A;  3BFU A;  3WAE A;  3G3F A;  4UAC A;  1JW4 A;  3K6U A;  3N6U A;  3TYH A;  1OQH A;  4N13 A;  3S2V A;  1B32 A;  1LBB A;  4OEN A;  4RA1 A;  4GVO A;  4ZS9 A;  4EF2 A;  1TXF A;  1QKA A;  2XXX A;  2F7A A;  3IOU A;  1SVX B;  5I59 A;  4Q0C A;  1YCJ A;  2PVU A;  1EZP A;  1B1H A;  3E4R A;  4NTL A;  2F7B A;  1GTK A;  3K1N A;  3K01 A;  5TPA B;  5FHM A;  1D9V A;  5FTI A;  3USD A;  3Q29 A;  2AL5 A;  5AA2 D;  1TWY A;  3HV1 A;  2F36 A;  2XHD A;  2Y7K A;  2REG A;  3TFL A;  2QS4 A;  5CI5 A;  3S9N C;  3QK6 A;  2HAU A;  4KYD A;  1OLC A;  3SEY A;  3QSL A;  4N6P A;  1Y3P A;  1Y4T A;  5CRY A;  1URG A;  3PPP A;  3S4U A;  5H8H A;  4RK9 A;  1N76 A;  5TP9 B;  1N7W A;  2UVJ A;  4ZE8 A;  1BLF A;  3T9V A;  4EXL A;  2Z22 A;  1UIV A;  4PE5 B;  3M3K A;  3IOV A;  4YZZ A;  4JB7 A;  3R6U A;  3PMX A;  3T22 A;  4FEB A;  3G3I A;  1FCK A;  3V8X B;  2B3B A;  4YAH X;  2Q89 A;  4OXV A;  2X26 A;  2V93 A;  1MXX A;  1QJM A;  3O28 A;  3K6W A;  1US5 A;  2V3Q A;  3OD7 A;  4R75 A;  4PFU A;  4OWD A;  1MXY A;  2ANJ A;  3SER A;  4YMB A;  5I58 A;  3PUV E;  3HCQ A;  4PET A;  1OQG A;  3DP4 A;  3FJ7 A;  4OMB A;  2RKM A;  1POY 1;  3FIR A;  4LZ7 A;  3EPE A;  4KCC A;  5K2X A;  1R9L A;  3HN0 A;  3MVZ A;  2VHA A;  4GD5 A;  3DP8 A;  3KBR A;  2QMX A;  4JXI A;  2Q88 A;  3CR9 A;  1UTB A;  2H99 A;  1IXI A;  2DE3 A;  3FV2 A;  1NFT A;  2O69 A;  3M3L A;  4R2F A;  4C1U A;  3MZ1 A;  2PT1 A;  2THI A;  4U2R A;  2F7C A;  5CBS A;  1NNP A;  4HCW A;  4U4X A;  4DXU A;  5EHS A;  3PV0 E;  1B5I A;  5HBC A;  3LR1 A;  5DEX B;  5HM4 B;  3U72 A;  2B3F A;  5ELV A;  3TEP A;  1ANF A;  4Q30 B;  1HSL A;  1TT1 A;  2B65 A;  4L17 A;  4R6H A;  1PB9 A;  2O1L A;  4X48 A;  2RCB A;  1XOC A;  3T93 B;  4O3B A;  1DTG A;  2REJ A;  4OFO A;  1H3D A;  2YLN A;  4U21 A;  1Y1M A;  3PUY E;  1MY3 A;  4EQ9 A;  1BKA A;  3TPA A;  3N5L A;  4ELP A;  4NF8 B;  2O6A A;  5TU0 A;  3KN8 A;  1XC1 A;  2I48 A;  1TFD A;  2YPN A;  4ONY A;  4KYS A;  1A7L A;  1WVJ A;  4GL8 A;  4PP0 A;  5J1D A;  1PB7 A;  3R7X A;  3U93 A;  3VFJ A;  2G29 A;  4I9D A;  3VLU A;  1NNT A;  3G3H A;  3MBP A;  1B2H A;  2ZMB A;  3U92 A;  3OO7 A;  4TLM B;  3O2A A;  1B05 A;  1S9T A;  2V25 A;  1SW2 A;  3FXU A;  3U94 A;  2VOZ A;  4H65 A;  2UVI A;  1O7T A;  1H43 A;  3FZV A;  1OLA A;  3LC8 A;  4GFR A;  3IAZ A;  3TEL A;  1AOV A;  1VSO A;  1F9B A;  3IB2 A;  4LZ5 A;  1M5B A;  3C34 A;  3CSG A;  4UA8 A;  4BDN A;  1IQ7 A;  1MPD A;  3LSW A;  3EF7 A;  5I57 A;  1DSN A;  2QS2 A;  3K6X A;  4X9T A;  4FEC A;  1RKM A;  1JW5 A;  1VFE A;  2Q9T A;  3H6V A;  3G3G A;  4FED A;  2I0B A;  5KCJ A;  2RC8 A;  4NF4 B;  3K4U A;  4POW A;  4OFJ A;  1URS A;  4FJP A;  4PFY A;  1LCF A;  4ZEK A;  4WKM A;  3OEM A;  4EQB A;  4F39 A;  4BDM A;  3KJ7 A;  5AE4 A;  4G77 A;  4IO5 A;  3EQ1 A;  4GRK A;  3BFT A;  1XT8 A;  2DWA A;  3SEV A;  4JDF A;  4NMY A;  3SEX A;  5DVJ A;  4MBP A;  4R73 A;  1USY H;  4AB6 A;  1JET A;  2DWI A;  1N04 A;  2ZNT A;  4ZZA A;  4PQJ A;  2XX9 A;  1MXW A;  3K2D A;  4F1U A;  5ISU A;  3UP9 A;  1N3X A;  5DYH A;  3C9H A;  3PMV A;  4OHN A;  2QL3 A;  1LLS A;  1S50 A;  1Y1Z A;  1MQH A;  3OXN A;  4M4G A;  1M5E A;  3MC2 A;  1P99 A;  4F1Y A;  4RK2 A;  2I49 A;  4OTE A;  3O66 A;  3VE1 B;  3RTW B;  5ICQ A;  3O6H A;  4FAT A;  3MPL A;  1US4 A;  4G8H A;  4P11 A;  3VVE A;  1IIW A;  1OMP A;  5JEI A;  1CE2 A;  1SI1 A;  2BJJ X;  2XXI A;  4BDO A;  4QFK A;  4XKN A;  3OEL A;  4ESW A;  5B7D A;  4H0W A;  4MH5 A;  1NMU A;  3FGS A;  1J1N A;  1TFA A;  3T9U A;  3N94 A;  3ILU B;  2ZYO A;  3KOT A;  4QF9 A;  3WAF A;  5H8N A;  1GGG A;  1M5C A;  1LAX A;  3PPQ A;  5IAI A;  2NUV A;  4RPO A;  5CMC A;  2DVZ A;  2I3V A;  3SKP A;  5AA4 A;  3IB0 A;  3DLN A;  3V5A A;  3K6V A;  2E1S A;  4LQ5 A;  2QSX A;  5ITO A;  2ZYK A;  3IOT A;  1ZMG A;  1B5J A;  1LFG A;  1D3K A;  2O1M A;  3UIF A;  4NF6 A;  3N26 A;  4U1Z A;  5JK4 A;  3E13 X;  1A8E A;  1B6H A;  1XHY A;  3SES A;  4Z0I A;  4KHZ E;  4EQ7 A;  1O64 A;  1RYX A;  3T9H B;  1HSE A;  4FAJ A;  4YKJ A;  4N07 A;  3O97 A;  3VVD A;  4JWY A;  1B3F A;  1CB6 A;  1PDA A;  2I4C A;  3KN7 A;  5DT6 A;  3S9M C;  1OVT A;  5FTH A;  1B3L A;  4PFW A;  2DOJ A;  4XKQ A;  4G68 C;  5A5X B;  1SI0 A;  2ONS A;  2XX8 A;  4BDQ A;  1PEB A;  4H6D A;  2H9B A;  2O51 A;  3RLF E;  2Z23 A;  1QW0 A;  2AL4 A;  1MH4 A;  2VD3 A;  5KDT A;  2Y7I A;  5CM6 A;  2F5X A;  2ZXT A;  4JSO A;  5H8F A;  3MP6 A;  1ZLQ A;  1B3G A;  3QYT A;  4I62 A;  3OSR A;  4NED A;  5CC2 A;  2ALU A;  3LSX A;  1KWH A;  1MRP A;  3UOR A;  4LQ2 A;  1LST A;  1ZKB A;  3FXR A;  5F7V A;  4IY6 A;  3PGF A;  3ILT B;  1UTB B;  5I2K B;  3FAS A;  2P2A A;  1N84 A;  3KGC A;  4JBZ A;  4WEP A;  3CFL A;  1IXG A;  2RIN A;  4F3B A;  3PPN A;  2IEE A;  4R9G A;  1SBP A;  4FE8 A;  3TZA A;  4GXA A;  3PUZ E;  3PD9 A;  2OWS A;  2ZNS A;  3PMW A;  1A54 A;  1Q1K A;  4G4P A;  1D9Y A;  5L9M A;  2O68 A;  4KR5 A;  3FJG A;  3OO8 A;  1PBQ A;  3JV9 A;  3JZJ A;  2E0S A;  3SET A;  3U1O A;  4RY1 A;  5L9O A;  4ELQ A;  5HPQ A;  4YB6 A;  4QFP A;  1OIB A;  4E0W A;  1ELJ A;  2Y84 A;  2I0C A;  1I6A A;  3RT6 B;  3H6W A;  3CRB A;  2I58 A;  2GHA A;  1LAG E;  3MWB A;  3PPR A;  3ONM A;  1ZU0 A;  3T66 A;  1B4Z A;  2VP1 A;  2ZYM A;  4F31 B;  3PD8 A;  1MDQ A;  2KLF A;  4TOZ A;  3FJM A;  3HPI A;  3C36 A;  4JSD A;  2FYI A;  1BTJ A;  1B46 A;  4IY5 A;  4BLA A;  2O84 X;  1SQY A;  2OJT A;  2XXW A;  1B4H A;  2DXY A;  1AL3 A;  1ATG A;  2XXU A;  3IJX B;  4ISU A;  5K2Y A;  3L6H A;  2H5Y A;  3KOS A;  3GBA A;  1MXU A;  3FV1 A;  3H06 B;  4KYE A;  4X1B A;  3H3G A;  4F29 A;  1ZIU A;  4Z7E A;  2Z8E A;  3VV5 A;  3H6U A;  3E3K A;  1QKB A;  4BDR A;  4I1D A;  5CMB A;  1Q35 A;  3EN3 A;  1B0L A;  5I57 B;  1YAE A;  1UQW A;  4F3P A;  3GBB A;  1IUD A;  1OVB A;  1MS7 A;  3TTL A;  5KCJ B;  3ZKK A;  3G3K A;  3OEK A;  3EHT A;  4QSD A;  1FQF A;  1MPB A;  3UK4 A;  1SD3 A;  3RNN A;  4Q8R A;  1P1N A;  5AA2 A;  3C35 A;  1B7Z A;  3O6I A;  1LAH E;  1MDP 1;  1B9J A;  4DDD A;  1JVY A;  4GLI A;  1MY1 A;  2PBW A;  4ZDM A;  4OZ9 A;  4P0I A;  5I2N B;  4HTG A;  3QUJ A;  3U8Q A;  4ELR A;  3KSX A;  1NNF A;  2H4I A;  3SDF A;  1PBP A;  1P1U A;  3M8U A;  2Y7W A;  4NF5 B;  3GLB A;  4XKP A;  2PT2 A;  2X7P A;  3QIM A;  4NE4 A;  3CSB A;  1FQB A; 
#chains in the Genus database with same CATH topology
 3C31 A;  4ZEB A;  2D5W A;  5JTY A;  3OOA A;  4C0R A;  4LA9 A;  3B50 A;  5ESY A;  2Y7P A;  5DVI A;  5ET7 A;  3LBS A;  2PYY A;  4R2B A;  4G8N A;  4N17 A;  1YPN A;  1USY E;  3FVG A;  3I6V A;  4OET A;  4H5G A;  2CZL A;  2FIE A;  2PMS A;  3IO6 A;  3K02 A;  3JYR A;  1IXH A;  3CIJ A;  2F97 A;  5H8Q A;  4DCX A;  4KD5 A;  5DEX A;  3SEU A;  1MY4 A;  1R1N A;  1B7U A;  1UTH B;  1FPB A;  1FTO A;  4WXJ A;  2XXP A;  2A5T B;  3IO4 A;  4NWC A;  4F18 A;  2PCR A;  1LCT A;  3RN8 A;  4YB7 A;  3EHU A;  2H25 A;  1I6B A;  3KG2 A;  3TAJ A;  5EQA A;  4U22 A;  2XXT A;  3CHG A;  5M2V A;  2QS1 A;  4I3E A;  3KZG A;  5ET8 A;  1QGX A;  4ELO A;  5I56 B;  3RPL B;  3MP8 A;  5AA4 B;  1FPI A;  2F3B A;  1B7H A;  1RDY A;  4IB2 A;  4XKR A;  4AS4 A;  1MM6 A;  2V84 A;  4M1V A;  2VD2 A;  1FQD A;  3QAX A;  2PX1 A;  5LDZ A;  4GIZ A;  4RNS A;  3OMB A;  1IMB A;  4MLV A;  1B3H A;  3KN3 A;  2XXR A;  1PC3 A;  3FAT A;  4R6K A;  2Z8D A;  2XXH A;  4GQO A;  3H6T A;  2QRY A;  1Y9U A;  3KEI A;  2Y7R A;  1GV8 A;  1P1W A;  4QSE A;  3T1B A;  1NV3 A;  3GYY A;  3K1P A;  1LBX A;  3GXA A;  3TDJ A;  4OAN A;  1JP4 A;  3MW0 A;  4PCD A;  3KFM A;  3MP1 A;  3KC0 A;  5IKB A;  3T96 B;  1MQD A;  3QUF A;  4YMA A;  2RC7 A;  4G68 A;  2NOO A;  3C32 A;  2XD2 A;  1B5H A;  4NHB A;  1H76 A;  1T0K A;  2B4L A;  1B51 A;  4FIM A;  1FRP A;  3N6T A;  4XIG Q;  2XXY A;  5I59 B;  2NXO A;  4U23 A;  4YKI A;  3MVY A;  3TQL A;  2FNC A;  1H45 A;  4I8C A;  2ONK E;  4ZEC A;  1INP A;  4NF4 A;  4NX1 A;  4IO4 A;  3IX1 A;  4YU0 A;  3PU5 A;  3TTR A;  2O7I A;  2Q2C A;  2B4M A;  1XI6 A;  1ZBM A;  3T0J A;  1I6Q A;  1FBC A;  3S9L C;  1BIY A;  1DPP A;  4DXB A;  2HCA A;  4QFL A;  2XXQ A;  1LB8 A;  4BDL A;  3PTY A;  1DMB A;  2RC9 A;  2NVU B;  3HO7 A;  1URD A;  2WBD A;  5DTB A;  2MKZ A;  5CMM A;  2HPG A;  1XVX A;  4AQ4 A;  1GVC A;  1IIT A;  2HXW A;  3VXC A;  1IEJ A;  1FJ6 A;  2HEU A;  1JW1 A;  4JWX A;  4QFN A;  3VLW A;  4PAI A;  4O7M A;  4ZEI A;  1XVY A;  4EXK A;  5H8H B;  2HQ0 A;  3AXF A;  3V89 B;  2ZYN A;  4MEV A;  3UGW A;  2X7Q A;  3TKD A;  2D3I A;  1NKX A;  1Z7M E;  5KZT A;  4XTC Q;  1LBZ A;  3A3U A;  4LON B;  3MQ9 A;  4F19 A;  2ZNU A;  2GH9 A;  1MM7 A;  3TCG A;  3A09 A;  4MFI A;  2P3N A;  1JNF A;  1EYI A;  2RCA A;  5ITP A;  5L8D A;  4YKK A;  5BUU A;  3FVO A;  2VGQ A;  4P56 A;  1IXC A;  4DE8 A;  1FPK A;  1SDX A;  4OES A;  1MQJ A;  2GFE A;  4JVI A;  1MQI A;  4LUB A;  1M5F A;  3OO9 A;  3B6W A;  1SPI A;  5I58 B;  3MST A;  1H44 A;  3IK6 B;  2R71 A;  2CEX A;  4PGP A;  4KI0 E;  3ZS6 A;  5FHO A;  1JVX A;  2HFB A;  3VVF A;  2H98 A;  3SEW A;  4H8J A;  2XWI A;  4FOR A;  3MPK A;  4GOT A;  3I5O A;  4P0G A;  3M3F A;  4MNP A;  3RQT A;  3W9V A;  3OEN A;  3SZP A;  3BKI B;  4MHF A;  1QUJ A;  4HE0 A;  5LOM A;  2QS3 A;  4R9F A;  4IO7 A;  3MVX A;  1FW0 A;  4MLQ A;  1CNQ A;  3CG3 A;  5I3S A;  1LBV A;  1B1X A;  1LFI A;  4GWY A;  4F3G A;  4O3A A;  2DVC A;  4IO3 A;  2I6E A;  4MF3 A;  3TTN A;  5ET5 A;  3IJO B;  1MXZ A;  2V3U A;  2DWH A;  3TTK A;  1QVS A;  2R6G E;  4XEQ A;  4KPT A;  1SW4 A;  2F6P A;  4GWO A;  4GF8 A;  3IOW A;  4KQP A;  5CMK A;  1VFD A;  5ICT A;  1IMC A;  1JQF A;  4JWO A;  3S9E A;  3Q25 A;  3MZ9 A;  4RJZ A;  1DOT A;  1NL5 A;  3RT8 A;  1PB8 A;  3E78 A;  1SW1 A;  3I3V A;  3W9W A;  3MUQ A;  3EHS A;  1QUK A;  2UVH A;  2OBG A;  3KSJ A;  4H67 A;  2Y5K A;  3MVW A;  2R9J A;  4ZZE A;  3LUZ A;  1M5D A;  1BP5 A;  1NV7 A;  2GHB A;  2CMO A;  4GL0 A;  4F1V A;  3VLV A;  5AA2 B;  1YTV A;  5A5X A;  5IGA A;  4G2Z A;  1LFH A;  3UN6 A;  3BBR A;  3GZG A;  3PUW E;  3A3C A;  2Y5L A;  1A40 A;  3B6T A;  4C1T A;  1KA0 A;  3K1M A;  3FD3 A;  1SYH A;  5LTC A;  3LUY A;  4GXS B;  5CBR A;  3QXM A;  2XWK A;  1LGB C;  2WKY A;  3THI A;  1IMF A;  1RYO A;  1MY0 A;  5TPA A;  1MPC A;  4DXC A;  3E9X A;  1LBC A;  2QJE A;  2OWT A;  1FQA A;  2UVG A;  4YB5 A;  4IGR A;  5I2K A;  5I84 A;  4U4S A;  5JTY B;  1AWB A;  1GR2 A;  3RUM A;  3IR1 A;  2D21 A;  1HSJ A;  1QUI A;  2DQV A;  2QPQ A;  2DE2 A;  1P1Q A;  1I69 A;  4N8Y A;  1FTK A;  4H45 A;  2LAO A;  4RXL A;  1AIV A;  2XXV A;  5H8Q B;  2O7U A;  3Q26 A;  4XFE A;  1Z7N E;  1NNK A;  3A29 A;  4LVQ A;  5EHM A;  5TP9 A;  4MCO A;  1Y4C A;  1FQE A;  3D4G A;  3P7I A;  4NWD A;  3CFX A;  4E0X A;  1MG1 A;  3O29 A;  3OO6 A;  4OVJ A;  4H1X A;  1FPE A;  3FXB A;  5J16 A;  1NH7 A;  3FVK A;  1II5 A;  3B6Q A;  3ECR A;  3DP6 A;  3D4C A;  2W7Y A;  4EDP A;  4F22 A;  2UXA A;  4H8I A;  4O3C A;  3W15 C;  1R9Q A;  3TUS A;  1EZ9 A;  3D1R A;  2DXR A;  1FQC A;  2Z8F A;  2RF1 A;  4LP2 B;  4OYV A;  4ND9 A;  1WDN A;  4QHQ A;  3TCH A;  3LSF B;  1AMF A;  3ZKL A;  3IFC A;  3V83 A;  4HS7 A;  5I7I A;  4U1O A;  3K00 A;  5EYG A;  4XF5 A;  2FA7 A;  2HZK A;  2P0S A;  1Y3Q A;  4RYA A;  1B40 A;  4R72 A;  4KFQ A;  4LAT A;  3MAM A;  2AIX A;  4H46 A;  2XX7 A;  4EUO A;  4KCD A;  1XS5 A;  2DSF A;  4POX A;  2G93 A;  3FXQ A;  3F11 A;  3TOD A;  5L9S A;  1R6Z A;  3MZB A;  1VR5 A;  2IA4 A;  3CFZ A;  3T9X B;  4NQ8 A;  1BK4 A;  2OLB A;  2P1S A;  2OZZ A;  3LSL A;  1LAF E;  3FUZ A;  2DS9 A;  3FVN A;  1S7Y A;  1EH3 A;  2XXK A;  3R26 A;  1P1O A;  4G68 B;  1MQG A;  1IZ1 A;  2WBB A;  4YIC A;  3H4Z A;  1ZJL A;  2OCU A;  1DCU A;  4XXU A;  2F35 A;  2F6G A;  3O6G A;  4DIG A;  3VXB A;  1NV1 A;  3CG1 A;  4DCY A;  4HCY A;  2F34 A;  3IFA A;  3ODB A;  4NGU A;  1FTJ A;  3Q28 A;  2FHY A;  4R74 A;  4TLL B;  5H8N B;  4OQO A;  1N7X A;  3KJT A;  3RGY A;  1FBD A;  3HHF A;  4LN5 A;  4F2Q A;  1A99 A;  2HAV A;  4TQU Q;  2Q2A A;  1NUY A;  3TTM A;  2I4B A;  5IM2 A;  2OK2 A;  5DVF A;  4NF0 A;  3TMG A;  3TQW A;  2M8C A;  4RPN A;  3E79 A;  3HST A;  4OER A;  4NF8 A;  3G7W A;  1L5T A;  5H8S A;  4DLD A;  3K0V A;  4IGT A;  1D4N A;  1DTZ A;  3H7M A;  1DPE A;  1FPF A;  1JEV A;  4NF6 B;  4ESX A;  5I2N A;  2DP8 A;  3IOR A;  5AA1 A;  2GRV A;  3VDF A;  2QVU A;  4G8M A;  1MY2 A;  2A5S A;  4QFO A;  1ZTY A;  2F78 A;  4WED A;  5EQ9 A;  3RY3 A;  1UIU A;  4HW8 A;  4NF5 A;  2QMW A;  4PDD A;  2F8D A;  4ZE9 A;  1B58 A;  1MXV A;  2I3W A;  1SW5 A;  3OSQ A;  4YKP A;  2R8T A;  5AA3 A;  1A8F A;  4NN3 A;  4R6Y A;  4IO2 A;  2DYX A;  3O9P A;  5BWJ A;  4QSC A;  5F1Q A;  1NH8 A;  1NV5 A;  2UYE A;  2V3T A;  1LB9 A;  4OEV A;  2AYS A;  4PFT A;  2Q8M A;  1B3E A;  1MH3 A;  1Y3N A;  4F2O A;  5FHN A;  4X1D A;  4JVC A;  3RTF B;  2ESN A;  4PFB A;  5KDT B;  3CI8 A;  2L5V A;  5H8F B;  1G0H A;  1UTH A;  4OEU A;  2A5T A;  3DM0 A;  2DE4 A;  5B70 A;  4PFR A;  3TCF A;  2DWJ A;  3PPO A;  3C4M A;  2YJP A;  1G0I A;  2ABH A;  2XWV A;  1VE4 A;  3NOH A;  4H5F A;  1YZ0 A;  3IL1 B;  4PBH A;  2HZL A;  3PUX E;  3ZSF A;  4N15 A;  4F3S A;  3RPW A;  1QUL A;  1N3W A;  4IO6 A;  4K3F A;  1WOD A;  1LEV A;  5EYF A;  4O94 A;  4Q5T A;  5I56 A;  3RPL A;  1LBW A;  1N0T A;  1POT A;  3HHG A;  4LZ8 A;  4PC9 A;  2PFZ A;  4THI A;  3DEL B;  1EZO A;  2ONR A;  3Q27 A;  3CVG A;  4EF1 A;  1AH5 A;  1LBY A;  1JEU A;  2CZK A;  4PE3 A;  3H03 A;  4ZED A;  1FTM A;  2NWJ A;  1B52 A;  3UA8 A;  1EU8 A;  4UAB A;  4QRZ A;  2XD3 A;  1B0H A;  1A55 A;  3C33 A;  3L6G A;  3G3J A;  4DZ1 A;  4AB5 A;  1Y20 A;  4N81 A;  4ECF A;  2UYF A;  3MJN A;  1FTL A;  2XWO A;  4ZEF A;  3B8B A;  1SYI A;  1O63 A;  3U65 A;  3B7D A;  3IB1 A;  4OFL A;  2Q8J A;  3BFU A;  3WAE A;  3G3F A;  4UAC A;  1JW4 A;  3K6U A;  3N6U A;  3TYH A;  1OQH A;  4N13 A;  3ROJ A;  3S2V A;  1B32 A;  1LBB A;  4OEN A;  4RA1 A;  4N4U A;  4GVO A;  4ZS9 A;  4EF2 A;  1TXF A;  1QKA A;  2XXX A;  2F7A A;  4N8G A;  3IOU A;  1SVX B;  5I59 A;  4Q0C A;  1YCJ A;  2PVU A;  1EZP A;  1B1H A;  1RDZ A;  3E4R A;  4MJO A;  4NTL A;  5EQ8 A;  2F7B A;  1GTK A;  4GWU A;  3K1N A;  4PFI A;  3K01 A;  5TPA B;  3RYD A;  5FHM A;  1D9V A;  5FTI A;  3FBP A;  3USD A;  3Q29 A;  2AL5 A;  4OVR A;  5AA2 D;  1TWY A;  3HV1 A;  4NAP A;  2F36 A;  2XHD A;  2Y7K A;  2REG A;  3TFL A;  2QS4 A;  5CI5 A;  3S9N C;  3QK6 A;  2HAU A;  4KYD A;  1OLC A;  1FTA A;  3SEY A;  4GWZ A;  3QSL A;  4X8R A;  4MAG A;  4N6P A;  1Y3P A;  1Y4T A;  5IZ3 A;  5CRY A;  1URG A;  3PPP A;  3S4U A;  5H8H A;  4RK9 A;  1N76 A;  5TP9 B;  1N7W A;  3BIH A;  1YYZ A;  2UVJ A;  4ZE8 A;  1BLF A;  3T9V A;  4EXL A;  2Z22 A;  2F3D A;  1UIV A;  4PE5 B;  3M3K A;  5IZ1 A;  3IOV A;  4YZZ A;  4JB7 A;  4DI4 B;  3R6U A;  3PMX A;  3T22 A;  4FEB A;  3G3I A;  1VDW A;  1FCK A;  2XA5 A;  3V8X B;  2B3B A;  4YAH X;  4GWW A;  2Q89 A;  4OXV A;  2X26 A;  2V93 A;  1MXX A;  1QJM A;  3O28 A;  3K6W A;  1US5 A;  4GX3 A;  2V3Q A;  3OD7 A;  4R75 A;  4PFU A;  4OWD A;  1MXY A;  2ANJ A;  3SER A;  4YMB A;  5I58 A;  3PUV E;  3HCQ A;  4MIJ A;  4QBA A;  4PET A;  1OQG A;  3DP4 A;  3FJ7 A;  4OMB A;  2RKM A;  2JJK A;  1POY 1;  3FIR A;  4LZ7 A;  3EPE A;  4KCC A;  5K2X A;  1R9L A;  3HN0 A;  3MVZ A;  2VHA A;  4GD5 A;  3DP8 A;  3KBR A;  2QMX A;  4JXI A;  2Q88 A;  3CR9 A;  1UTB A;  2H99 A;  1IXI A;  2DE3 A;  1NV6 A;  1NUX A;  3FV2 A;  1NFT A;  2O69 A;  3M3L A;  4R2F A;  4C1U A;  3MZ1 A;  2PT1 A;  2THI A;  4U2R A;  2F7C A;  5CBS A;  2FIX A;  1NNP A;  4HCW A;  4U4X A;  4DXU A;  5EHS A;  3PV0 E;  1B5I A;  4MX6 A;  5HBC A;  3LR1 A;  2QVV A;  5DEX B;  5HM4 B;  3U72 A;  4OA4 A;  2B3F A;  5ELV A;  4OVT A;  4I40 A;  3TEP A;  1ANF A;  4Q30 B;  1IMD A;  5EQ7 A;  1HSL A;  1TT1 A;  2B65 A;  2BJI A;  4L17 A;  4R6H A;  1PB9 A;  2GQ1 A;  2O1L A;  4X48 A;  2RCB A;  1XOC A;  2KR0 A;  3T93 B;  4O3B A;  1DTG A;  5T3J A;  2REJ A;  4OFO A;  1H3D A;  2YLN A;  4U21 A;  1Y1M A;  3PUY E;  4MNI A;  2ZZX A;  4PGN A;  2OWZ A;  1MY3 A;  4EQ9 A;  1BKA A;  4JVD A;  3TPA A;  3N5L A;  4ELP A;  1D9Q A;  4NF8 B;  2O6A A;  4GBW A;  5TU0 A;  3KN8 A;  1XC1 A;  2I48 A;  1K9Y A;  1TFD A;  4O7I A;  2YPN A;  4ONY A;  4KYS A;  2CEY A;  1A7L A;  1WVJ A;  4GL8 A;  4PP0 A;  5J1D A;  1PB7 A;  3R7X A;  4MNC A;  3U93 A;  3VFJ A;  2G29 A;  4I9D A;  4HE1 A;  3VLU A;  4PF6 A;  1NNT A;  3G3H A;  3MBP A;  1B2H A;  2ZMB A;  3U92 A;  3OO7 A;  1NV2 A;  4TLM B;  1FPJ A;  3O2A A;  1B05 A;  1S9T A;  2V25 A;  1SW2 A;  4OVP A;  3FXU A;  3U94 A;  2VOZ A;  4H65 A;  2UVI A;  1O7T A;  1H43 A;  3FZV A;  1OLA A;  3LC8 A;  4GFR A;  4MMP A;  1FBE A;  3IAZ A;  3TEL A;  1AOV A;  1VSO A;  1F9B A;  3IB2 A;  4LZ5 A;  1M5B A;  3C34 A;  4N6D A;  3CSG A;  1RDX A;  4UA8 A;  4BDN A;  1IQ7 A;  4KXP A;  1MPD A;  3LSW A;  3EF7 A;  4I3Y A;  5I57 A;  1DSN A;  4AS5 A;  2QS2 A;  3K6X A;  4X9T A;  4FEC A;  1RKM A;  1JW5 A;  1VFE A;  2Q9T A;  3H6V A;  3G3G A;  4FED A;  2I0B A;  5KCJ A;  4OVQ A;  1NUZ A;  2RC8 A;  4NF4 B;  3K4U A;  4PDH A;  4POW A;  4OFJ A;  1URS A;  4GWX A;  2CZI A;  4FJP A;  4PFY A;  1FBF A;  1LCF A;  4ZEK A;  4WKM A;  4QXD A;  3OEM A;  4EQB A;  4F39 A;  4BDM A;  3KJ7 A;  5AE4 A;  4G77 A;  5IZZ A;  4G61 A;  4IO5 A;  1IMA A;  1DK4 A;  3EQ1 A;  4GRK A;  3BFT A;  1XT8 A;  2DWA A;  3SEV A;  4JDF A;  4NMY A;  3SEX A;  5DVJ A;  4MBP A;  4R73 A;  1USY H;  4AB6 A;  1JET A;  2DWI A;  1N04 A;  2ZNT A;  4ZZA A;  4PQJ A;  2XX9 A;  1MXW A;  3QMF A;  3K2D A;  4F1U A;  5ISU A;  3UP9 A;  1N3X A;  5DYH A;  3C9H A;  3PMV A;  4OHN A;  2QL3 A;  1LLS A;  1FBG A;  1S50 A;  3EKI A;  1Y1Z A;  2P3V A;  1MQH A;  3OXN A;  4M4G A;  1M5E A;  3MC2 A;  1P99 A;  4F1Y A;  4RK2 A;  2I49 A;  4OTE A;  3O66 A;  3VE1 B;  3RTW B;  5ICQ A;  3O6H A;  4HE2 A;  4FAT A;  2WYK A;  2ZZV A;  3MPL A;  1US4 A;  4GBV A;  4G8H A;  4P11 A;  2HHM A;  3VVE A;  1IIW A;  4PBQ A;  1OMP A;  5JEI A;  1CE2 A;  1SI1 A;  2BJJ X;  2XXI A;  4BDO A;  4QFK A;  4XKN A;  3OEL A;  4ESW A;  5B7D A;  4H0W A;  4MH5 A;  1NMU A;  3FGS A;  1J1N A;  4PTK A;  1TFA A;  3T9U A;  1FPL A;  3N94 A;  3KC1 A;  3ILU B;  2ZYO A;  5DW8 A;  3KOT A;  4QF9 A;  3WAF A;  5H8N A;  1GGG A;  1M5C A;  1LAX A;  2WYP A;  2CZH A;  3PPQ A;  4GWS A;  5IAI A;  2NUV A;  2DDK A;  4RPO A;  5CMC A;  2DVZ A;  2I3V A;  3SKP A;  5AA4 A;  3IB0 A;  3DLN A;  3V5A A;  3K6V A;  2E1S A;  4LQ5 A;  2QSX A;  5ITO A;  2ZYK A;  3IOT A;  1ZMG A;  1B5J A;  2OX3 A;  1LFG A;  1D3K A;  2O1M A;  3UIF A;  4NF6 A;  3N26 A;  2QFL A;  4P1L A;  4U1Z A;  5JK4 A;  3E13 X;  1A8E A;  1B6H A;  1XHY A;  1FBH A;  4P3L A;  3SES A;  1DBZ A;  4Z0I A;  1KZ8 A;  4KHZ E;  4EQ7 A;  5IZ3 B;  1O64 A;  1RYX A;  3T9H B;  1HSE A;  4FAJ A;  4YKJ A;  4N07 A;  3O97 A;  3VVD A;  1NUW A;  1FSA A;  4JWY A;  1B3F A;  1CB6 A;  1PDA A;  2I4C A;  3KN7 A;  5DT6 A;  3S9M C;  1OVT A;  5FTH A;  1B3L A;  4PFW A;  2PFY A;  2DOJ A;  4XKQ A;  4G68 C;  2ONS A;  1SI0 A;  4BDQ A;  2XX8 A;  5A5X B;  1PEB A;  4H6D A;  2H9B A;  2O51 A;  3RLF E;  2Z23 A;  5A5L A;  1QW0 A;  2AL4 A;  1MH4 A;  2VD3 A;  5KDT A;  2Y7I A;  5CM6 A;  4N91 A;  2F5X A;  2ZXT A;  4JSO A;  5H8F A;  3MP6 A;  1ZLQ A;  4P8B A;  1B3G A;  3QYT A;  4I62 A;  4P1E A;  3OSR A;  4FBP A;  1EYK A;  1YXI A;  4NED A;  3BIG A;  5CC2 A;  2ALU A;  3LSX A;  1KWH A;  1MRP A;  3UOR A;  4LQ2 A;  1LST A;  4OVS A;  4X04 A;  1ZKB A;  3FXR A;  4P47 A;  5F7V A;  1KA1 A;  4IY6 A;  3PGF A;  3ILT B;  1UTB B;  5I2K B;  3FAS A;  4PAK A;  1K9Z A;  2P2A A;  1FPG A;  1N84 A;  3KGC A;  4JBZ A;  4WEP A;  3CFL A;  1IXG A;  2RIN A;  4F3B A;  5FBP A;  3PPN A;  2IEE A;  4R9G A;  1SBP A;  4FE8 A;  3TZA A;  4GXA A;  3PUZ E;  2HXR A;  3PD9 A;  4DI3 D;  2OWS A;  2ZNS A;  3PMW A;  4P9K A;  1A54 A;  1Q1K A;  4G4P A;  1D9Y A;  5L9M A;  2O68 A;  5ET6 A;  4KR5 A;  5EYH A;  3FJG A;  3OO8 A;  1PBQ A;  4PAF A;  2WX9 A;  3JV9 A;  3JZJ A;  2E0S A;  5F24 A;  3SET A;  3U1O A;  4RY1 A;  5L9O A;  4ELQ A;  5HPQ A;  4YB6 A;  4QFP A;  1OIB A;  4E0W A;  3HFU A;  1ELJ A;  2Y84 A;  2I0C A;  4GX6 A;  1I6A A;  2Q74 A;  3RT6 B;  3H6W A;  3CRB A;  2I58 A;  2GHA A;  1LAG E;  3MWB A;  3PPR A;  3ONM A;  1ZU0 A;  3T66 A;  4PF8 A;  3MYU A;  3KBZ A;  1B4Z A;  2VT5 A;  2VP1 A;  2ZYM A;  4F31 B;  3PD8 A;  1MDQ A;  5I5P A;  2KLF A;  3LV0 A;  4TOZ A;  3FJM A;  3HPI A;  3C36 A;  4JSD A;  2FYI A;  1BTJ A;  1B46 A;  4GX4 A;  4IY5 A;  4BLA A;  2V4C A;  2O84 X;  1SQY A;  2OJT A;  2XXW A;  1B4H A;  2DXY A;  1AL3 A;  1ATG A;  2XXU A;  1EYJ A;  3IJX B;  4ISU A;  5K2Y A;  1NV4 A;  2WEF A;  3L6H A;  4N6K A;  2H5Y A;  3KOS A;  3GBA A;  1MXU A;  2FBP A;  3FV1 A;  3H06 B;  4KYE A;  4X1B A;  3H3G A;  4F29 A;  1ZIU A;  4Z7E A;  2Z8E A;  3VV5 A;  2VPO A;  3H6U A;  2QVR A;  3E3K A;  1QKB A;  4BDR A;  4I1D A;  2ZZW A;  1Q9D A;  5CMB A;  1Q35 A;  3EN3 A;  1B0L A;  1NV0 A;  5I57 B;  1YAE A;  1FJ9 A;  1UQW A;  4F3P A;  4HXV A;  3GBB A;  1IUD A;  1OVB A;  1MS7 A;  3TTL A;  5KCJ B;  1FBP A;  3ZKK A;  4O8M A;  3G3K A;  3OEK A;  3EHT A;  4QSD A;  2VPN A;  1FQF A;  1MPB A;  2FVZ A;  3UK4 A;  1SD3 A;  3RNN A;  4Q8R A;  1P1N A;  5AA2 A;  3C35 A;  1FPD A;  1B7Z A;  3O6I A;  1LAH E;  1MDP 1;  4NG7 A;  1B9J A;  4DDD A;  1JVY A;  4GLI A;  1MY1 A;  2KQZ A;  2PBW A;  4ZDM A;  4OZ9 A;  4P0I A;  3ISP A;  5I2N B;  4HTG A;  3QUJ A;  3U8Q A;  4ELR A;  3KSX A;  1NNF A;  2H4I A;  4IR8 A;  3SDF A;  1PBP A;  1P1U A;  3M8U A;  2Y7W A;  4NF5 B;  1IME A;  3GLB A;  4XKP A;  2PT2 A;  2X7P A;  3QIM A;  4NE4 A;  1NI9 A;  3CSB A;  1FQB A; 
#chains in the Genus database with same CATH homology
 3C31 A;  4ZEB A;  2D5W A;  5JTY A;  3OOA A;  4C0R A;  4LA9 A;  2Y7P A;  5DVI A;  3LBS A;  2PYY A;  4R2B A;  4G8N A;  1YPN A;  1USY E;  3FVG A;  3I6V A;  4OET A;  4H5G A;  2CZL A;  2PMS A;  3IO6 A;  3K02 A;  3JYR A;  1IXH A;  3CIJ A;  2F97 A;  5H8Q A;  4DCX A;  4KD5 A;  5DEX A;  3SEU A;  1MY4 A;  1R1N A;  1B7U A;  1UTH B;  1FTO A;  4WXJ A;  2XXP A;  2A5T B;  3IO4 A;  4NWC A;  4F18 A;  1LCT A;  3RN8 A;  4YB7 A;  3EHU A;  2H25 A;  1I6B A;  3KG2 A;  3TAJ A;  4U22 A;  2XXT A;  5M2V A;  2QS1 A;  3KZG A;  4ELO A;  5I56 B;  3MP8 A;  5AA4 B;  1B7H A;  4IB2 A;  4XKR A;  1MM6 A;  2V84 A;  4M1V A;  2VD2 A;  1FQD A;  3QAX A;  2PX1 A;  4GIZ A;  4RNS A;  3OMB A;  4MLV A;  1B3H A;  3KN3 A;  2XXR A;  1PC3 A;  3FAT A;  4R6K A;  2Z8D A;  2XXH A;  4GQO A;  3H6T A;  2QRY A;  1Y9U A;  3KEI A;  2Y7R A;  1GV8 A;  1P1W A;  4QSE A;  3K1P A;  3GXA A;  3TDJ A;  3MW0 A;  3KFM A;  3MP1 A;  5IKB A;  3T96 B;  1MQD A;  3QUF A;  4YMA A;  2RC7 A;  4G68 A;  2NOO A;  3C32 A;  2XD2 A;  1B5H A;  1H76 A;  1T0K A;  1B51 A;  4FIM A;  3N6T A;  4XIG Q;  2XXY A;  5I59 B;  2NXO A;  4U23 A;  4YKI A;  3MVY A;  3TQL A;  2FNC A;  1H45 A;  4I8C A;  2ONK E;  4ZEC A;  4NF4 A;  4IO4 A;  3IX1 A;  4YU0 A;  3PU5 A;  3TTR A;  2O7I A;  2Q2C A;  1ZBM A;  1I6Q A;  3S9L C;  1BIY A;  1DPP A;  4DXB A;  2HCA A;  4QFL A;  2XXQ A;  1LB8 A;  4BDL A;  1DMB A;  2RC9 A;  2NVU B;  3HO7 A;  1URD A;  5DTB A;  5CMM A;  1XVX A;  4AQ4 A;  1GVC A;  1IIT A;  2HXW A;  3VXC A;  1IEJ A;  2HEU A;  1JW1 A;  4JWX A;  4QFN A;  3VLW A;  4ZEI A;  1XVY A;  4EXK A;  5H8H B;  2HQ0 A;  3AXF A;  3V89 B;  2ZYN A;  3UGW A;  2X7Q A;  3TKD A;  2D3I A;  1NKX A;  1Z7M E;  5KZT A;  4XTC Q;  3A3U A;  4LON B;  3MQ9 A;  4F19 A;  2ZNU A;  2GH9 A;  1MM7 A;  3TCG A;  3A09 A;  4MFI A;  1JNF A;  2RCA A;  5ITP A;  5L8D A;  4YKK A;  5BUU A;  3FVO A;  2VGQ A;  1IXC A;  4DE8 A;  1SDX A;  4OES A;  1MQJ A;  2GFE A;  1MQI A;  4LUB A;  1M5F A;  3OO9 A;  3B6W A;  5I58 B;  1H44 A;  3IK6 B;  2R71 A;  4KI0 E;  3ZS6 A;  5FHO A;  1JVX A;  2HFB A;  3VVF A;  2H98 A;  3SEW A;  4H8J A;  4FOR A;  3MPK A;  4GOT A;  3I5O A;  4P0G A;  3M3F A;  3RQT A;  3W9V A;  3OEN A;  3BKI B;  1QUJ A;  5LOM A;  2QS3 A;  4R9F A;  4IO7 A;  3MVX A;  1FW0 A;  4MLQ A;  3CG3 A;  1B1X A;  1LFI A;  4F3G A;  4O3A A;  2DVC A;  4IO3 A;  2I6E A;  4MF3 A;  3TTN A;  3IJO B;  1MXZ A;  2V3U A;  2DWH A;  3TTK A;  1QVS A;  2R6G E;  4KPT A;  1SW4 A;  2F6P A;  4GWO A;  4GF8 A;  3IOW A;  4KQP A;  5CMK A;  1VFD A;  5ICT A;  1JQF A;  4JWO A;  3S9E A;  3Q25 A;  3MZ9 A;  4RJZ A;  1DOT A;  1NL5 A;  3RT8 A;  1PB8 A;  1SW1 A;  3W9W A;  3I3V A;  3MUQ A;  3EHS A;  1QUK A;  2UVH A;  2OBG A;  3KSJ A;  4H67 A;  3MVW A;  2R9J A;  4ZZE A;  1M5D A;  1BP5 A;  2GHB A;  2CMO A;  4GL0 A;  4F1V A;  3VLV A;  5AA2 B;  1YTV A;  5A5X A;  4G2Z A;  1LFH A;  3UN6 A;  3BBR A;  3GZG A;  3PUW E;  3A3C A;  1A40 A;  3B6T A;  4C1T A;  3K1M A;  3FD3 A;  1SYH A;  3LUY A;  4GXS B;  5CBR A;  3QXM A;  1LGB C;  2WKY A;  3THI A;  1RYO A;  1MY0 A;  5TPA A;  1MPC A;  4DXC A;  3E9X A;  1LBC A;  2QJE A;  2OWT A;  1FQA A;  2UVG A;  4YB5 A;  4IGR A;  5I2K A;  5I84 A;  4U4S A;  5JTY B;  1GR2 A;  3RUM A;  3IR1 A;  2D21 A;  1HSJ A;  1QUI A;  2DQV A;  2QPQ A;  2DE2 A;  1P1Q A;  1I69 A;  1FTK A;  4RXL A;  2LAO A;  1AIV A;  2XXV A;  5H8Q B;  2O7U A;  3Q26 A;  1Z7N E;  1NNK A;  4LVQ A;  5EHM A;  5TP9 A;  1Y4C A;  1FQE A;  3D4G A;  3P7I A;  4NWD A;  3CFX A;  4E0X A;  1MG1 A;  3O29 A;  3OO6 A;  4OVJ A;  4H1X A;  1NH7 A;  3FVK A;  1II5 A;  3B6Q A;  3ECR A;  3DP6 A;  3D4C A;  2W7Y A;  4EDP A;  4F22 A;  2UXA A;  4H8I A;  4O3C A;  3W15 C;  1R9Q A;  3TUS A;  1EZ9 A;  2DXR A;  1FQC A;  2Z8F A;  2RF1 A;  4LP2 B;  4OYV A;  4ND9 A;  1WDN A;  4QHQ A;  3TCH A;  3LSF B;  1AMF A;  3ZKL A;  3V83 A;  4HS7 A;  4U1O A;  3K00 A;  2FA7 A;  2HZK A;  2P0S A;  1Y3Q A;  4RYA A;  1B40 A;  4R72 A;  4KFQ A;  4LAT A;  3MAM A;  2AIX A;  2XX7 A;  4EUO A;  4KCD A;  1XS5 A;  2DSF A;  4POX A;  2G93 A;  3FXQ A;  3F11 A;  3TOD A;  5L9S A;  1R6Z A;  3MZB A;  1VR5 A;  2IA4 A;  3CFZ A;  3T9X B;  2OLB A;  2P1S A;  2OZZ A;  3LSL A;  1LAF E;  3FUZ A;  2DS9 A;  3FVN A;  1S7Y A;  1EH3 A;  3R26 A;  1P1O A;  4G68 B;  1MQG A;  1IZ1 A;  4YIC A;  3H4Z A;  1ZJL A;  2OCU A;  4XXU A;  2F35 A;  2F6G A;  3O6G A;  4DIG A;  3VXB A;  3CG1 A;  4DCY A;  4HCY A;  2F34 A;  3ODB A;  1FTJ A;  3Q28 A;  4R74 A;  4TLL B;  5H8N B;  4OQO A;  1N7X A;  3KJT A;  3RGY A;  3HHF A;  4F2Q A;  1A99 A;  2HAV A;  4TQU Q;  2Q2A A;  3TTM A;  2I4B A;  2OK2 A;  5DVF A;  3TMG A;  3TQW A;  2M8C A;  4RPN A;  3HST A;  4OER A;  4NF8 A;  3G7W A;  1L5T A;  5H8S A;  4DLD A;  3K0V A;  4IGT A;  1D4N A;  1DTZ A;  3H7M A;  1DPE A;  1JEV A;  4NF6 B;  4ESX A;  5I2N A;  2DP8 A;  3IOR A;  5AA1 A;  2GRV A;  3VDF A;  4G8M A;  1MY2 A;  2A5S A;  4QFO A;  1ZTY A;  2F78 A;  4WED A;  3RY3 A;  1UIU A;  4HW8 A;  4NF5 A;  2QMW A;  2F8D A;  4ZE9 A;  1B58 A;  1MXV A;  2I3W A;  1SW5 A;  3OSQ A;  4YKP A;  5AA3 A;  1A8F A;  4R6Y A;  4IO2 A;  2DYX A;  3O9P A;  5BWJ A;  4QSC A;  5F1Q A;  1NH8 A;  2UYE A;  2V3T A;  1LB9 A;  4OEV A;  2AYS A;  4PFT A;  1B3E A;  1MH3 A;  1Y3N A;  4F2O A;  5FHN A;  4X1D A;  3RTF B;  2ESN A;  5KDT B;  3CI8 A;  5H8F B;  1UTH A;  4OEU A;  2A5T A;  3DM0 A;  2DE4 A;  5B70 A;  3TCF A;  2DWJ A;  3PPO A;  3C4M A;  2YJP A;  2ABH A;  1VE4 A;  4H5F A;  3IL1 B;  2HZL A;  3PUX E;  3ZSF A;  4F3S A;  3RPW A;  1QUL A;  1N3W A;  4IO6 A;  4K3F A;  1WOD A;  5EYF A;  4Q5T A;  5I56 A;  1N0T A;  1POT A;  3HHG A;  4LZ8 A;  4THI A;  3DEL B;  1EZO A;  2ONR A;  3Q27 A;  3CVG A;  4EF1 A;  1AH5 A;  1JEU A;  3H03 A;  4ZED A;  1FTM A;  2NWJ A;  1B52 A;  3UA8 A;  1EU8 A;  4QRZ A;  2XD3 A;  1B0H A;  1A55 A;  3C33 A;  3L6G A;  3G3J A;  4DZ1 A;  4AB5 A;  1Y20 A;  4ECF A;  2UYF A;  3MJN A;  1FTL A;  4ZEF A;  1SYI A;  1O63 A;  3B7D A;  3IB1 A;  4OFL A;  2Q8J A;  3BFU A;  3WAE A;  3G3F A;  4UAC A;  1JW4 A;  3K6U A;  3N6U A;  3TYH A;  1OQH A;  4N13 A;  3S2V A;  1B32 A;  1LBB A;  4OEN A;  4RA1 A;  4GVO A;  4ZS9 A;  4EF2 A;  1TXF A;  1QKA A;  2XXX A;  2F7A A;  3IOU A;  1SVX B;  5I59 A;  4Q0C A;  1YCJ A;  2PVU A;  1EZP A;  1B1H A;  3E4R A;  4NTL A;  2F7B A;  1GTK A;  3K1N A;  3K01 A;  5TPA B;  5FHM A;  1D9V A;  5FTI A;  3USD A;  3Q29 A;  2AL5 A;  5AA2 D;  1TWY A;  3HV1 A;  2F36 A;  2XHD A;  2Y7K A;  2REG A;  3TFL A;  2QS4 A;  5CI5 A;  3S9N C;  3QK6 A;  2HAU A;  4KYD A;  1OLC A;  3SEY A;  3QSL A;  4N6P A;  1Y3P A;  1Y4T A;  5CRY A;  1URG A;  3PPP A;  3S4U A;  5H8H A;  4RK9 A;  1N76 A;  5TP9 B;  1N7W A;  2UVJ A;  4ZE8 A;  1BLF A;  3T9V A;  4EXL A;  2Z22 A;  1UIV A;  4PE5 B;  3M3K A;  3IOV A;  4YZZ A;  4JB7 A;  3R6U A;  3PMX A;  3T22 A;  4FEB A;  3G3I A;  1FCK A;  3V8X B;  2B3B A;  4YAH X;  2Q89 A;  4OXV A;  2X26 A;  2V93 A;  1MXX A;  1QJM A;  3O28 A;  3K6W A;  1US5 A;  2V3Q A;  3OD7 A;  4R75 A;  4PFU A;  4OWD A;  1MXY A;  2ANJ A;  3SER A;  4YMB A;  5I58 A;  3PUV E;  3HCQ A;  4PET A;  1OQG A;  3DP4 A;  3FJ7 A;  4OMB A;  2RKM A;  1POY 1;  3FIR A;  4LZ7 A;  3EPE A;  4KCC A;  5K2X A;  1R9L A;  3HN0 A;  3MVZ A;  2VHA A;  4GD5 A;  3DP8 A;  3KBR A;  2QMX A;  4JXI A;  2Q88 A;  3CR9 A;  1UTB A;  2H99 A;  1IXI A;  2DE3 A;  3FV2 A;  1NFT A;  2O69 A;  3M3L A;  4R2F A;  4C1U A;  3MZ1 A;  2PT1 A;  2THI A;  4U2R A;  2F7C A;  5CBS A;  1NNP A;  4HCW A;  4U4X A;  4DXU A;  5EHS A;  3PV0 E;  1B5I A;  5HBC A;  3LR1 A;  5DEX B;  5HM4 B;  3U72 A;  2B3F A;  5ELV A;  3TEP A;  1ANF A;  4Q30 B;  1HSL A;  1TT1 A;  2B65 A;  4L17 A;  4R6H A;  1PB9 A;  2O1L A;  4X48 A;  2RCB A;  1XOC A;  3T93 B;  4O3B A;  1DTG A;  2REJ A;  4OFO A;  1H3D A;  2YLN A;  4U21 A;  1Y1M A;  3PUY E;  1MY3 A;  4EQ9 A;  1BKA A;  3TPA A;  3N5L A;  4ELP A;  4NF8 B;  2O6A A;  5TU0 A;  3KN8 A;  1XC1 A;  2I48 A;  1TFD A;  2YPN A;  4ONY A;  4KYS A;  1A7L A;  1WVJ A;  4GL8 A;  4PP0 A;  5J1D A;  1PB7 A;  3R7X A;  3U93 A;  3VFJ A;  2G29 A;  4I9D A;  3VLU A;  1NNT A;  3G3H A;  3MBP A;  1B2H A;  2ZMB A;  3U92 A;  3OO7 A;  4TLM B;  3O2A A;  1B05 A;  1S9T A;  2V25 A;  1SW2 A;  3FXU A;  3U94 A;  2VOZ A;  4H65 A;  2UVI A;  1O7T A;  1H43 A;  3FZV A;  1OLA A;  3LC8 A;  4GFR A;  3IAZ A;  3TEL A;  1AOV A;  1VSO A;  1F9B A;  3IB2 A;  4LZ5 A;  1M5B A;  3C34 A;  3CSG A;  4UA8 A;  4BDN A;  1IQ7 A;  1MPD A;  3LSW A;  3EF7 A;  5I57 A;  1DSN A;  2QS2 A;  3K6X A;  4X9T A;  4FEC A;  1RKM A;  1JW5 A;  1VFE A;  2Q9T A;  3H6V A;  3G3G A;  4FED A;  2I0B A;  5KCJ A;  2RC8 A;  4NF4 B;  3K4U A;  4POW A;  4OFJ A;  1URS A;  4FJP A;  4PFY A;  1LCF A;  4ZEK A;  4WKM A;  3OEM A;  4EQB A;  4F39 A;  4BDM A;  3KJ7 A;  5AE4 A;  4G77 A;  4IO5 A;  3EQ1 A;  4GRK A;  3BFT A;  1XT8 A;  2DWA A;  3SEV A;  4JDF A;  4NMY A;  3SEX A;  5DVJ A;  4MBP A;  4R73 A;  1USY H;  4AB6 A;  1JET A;  2DWI A;  1N04 A;  2ZNT A;  4ZZA A;  4PQJ A;  2XX9 A;  1MXW A;  3K2D A;  4F1U A;  5ISU A;  3UP9 A;  1N3X A;  5DYH A;  3C9H A;  3PMV A;  4OHN A;  2QL3 A;  1LLS A;  1S50 A;  1Y1Z A;  1MQH A;  3OXN A;  4M4G A;  1M5E A;  3MC2 A;  1P99 A;  4F1Y A;  4RK2 A;  2I49 A;  4OTE A;  3O66 A;  3VE1 B;  3RTW B;  5ICQ A;  3O6H A;  4FAT A;  3MPL A;  1US4 A;  4G8H A;  4P11 A;  3VVE A;  1IIW A;  1OMP A;  5JEI A;  1CE2 A;  1SI1 A;  2BJJ X;  2XXI A;  4BDO A;  4QFK A;  4XKN A;  3OEL A;  4ESW A;  5B7D A;  4H0W A;  4MH5 A;  1NMU A;  3FGS A;  1J1N A;  1TFA A;  3T9U A;  3N94 A;  3ILU B;  2ZYO A;  3KOT A;  4QF9 A;  3WAF A;  5H8N A;  1GGG A;  1M5C A;  1LAX A;  3PPQ A;  5IAI A;  2NUV A;  4RPO A;  5CMC A;  2DVZ A;  2I3V A;  3SKP A;  5AA4 A;  3IB0 A;  3DLN A;  3V5A A;  3K6V A;  2E1S A;  4LQ5 A;  2QSX A;  5ITO A;  2ZYK A;  3IOT A;  1ZMG A;  1B5J A;  1LFG A;  1D3K A;  2O1M A;  3UIF A;  4NF6 A;  3N26 A;  4U1Z A;  5JK4 A;  3E13 X;  1A8E A;  1B6H A;  1XHY A;  3SES A;  4Z0I A;  4KHZ E;  4EQ7 A;  1O64 A;  1RYX A;  3T9H B;  1HSE A;  4FAJ A;  4YKJ A;  4N07 A;  3O97 A;  3VVD A;  4JWY A;  1B3F A;  1CB6 A;  1PDA A;  2I4C A;  3KN7 A;  5DT6 A;  3S9M C;  1OVT A;  5FTH A;  1B3L A;  4PFW A;  2DOJ A;  4XKQ A;  4G68 C;  5A5X B;  1SI0 A;  2ONS A;  2XX8 A;  4BDQ A;  1PEB A;  4H6D A;  2H9B A;  2O51 A;  3RLF E;  2Z23 A;  1QW0 A;  2AL4 A;  1MH4 A;  2VD3 A;  5KDT A;  2Y7I A;  5CM6 A;  2F5X A;  2ZXT A;  4JSO A;  5H8F A;  3MP6 A;  1ZLQ A;  1B3G A;  3QYT A;  4I62 A;  3OSR A;  4NED A;  5CC2 A;  2ALU A;  3LSX A;  1KWH A;  1MRP A;  3UOR A;  4LQ2 A;  1LST A;  1ZKB A;  3FXR A;  5F7V A;  4IY6 A;  3PGF A;  3ILT B;  1UTB B;  5I2K B;  3FAS A;  2P2A A;  1N84 A;  3KGC A;  4JBZ A;  4WEP A;  3CFL A;  1IXG A;  2RIN A;  4F3B A;  3PPN A;  2IEE A;  4R9G A;  1SBP A;  4FE8 A;  3TZA A;  4GXA A;  3PUZ E;  3PD9 A;  2OWS A;  2ZNS A;  3PMW A;  1A54 A;  1Q1K A;  4G4P A;  1D9Y A;  5L9M A;  2O68 A;  4KR5 A;  3FJG A;  3OO8 A;  1PBQ A;  3JV9 A;  3JZJ A;  2E0S A;  3SET A;  3U1O A;  4RY1 A;  5L9O A;  4ELQ A;  5HPQ A;  4YB6 A;  4QFP A;  1OIB A;  4E0W A;  1ELJ A;  2Y84 A;  2I0C A;  1I6A A;  3RT6 B;  3H6W A;  3CRB A;  2I58 A;  2GHA A;  1LAG E;  3MWB A;  3PPR A;  3ONM A;  1ZU0 A;  3T66 A;  1B4Z A;  2VP1 A;  2ZYM A;  4F31 B;  3PD8 A;  1MDQ A;  2KLF A;  4TOZ A;  3FJM A;  3HPI A;  3C36 A;  4JSD A;  2FYI A;  1BTJ A;  1B46 A;  4IY5 A;  4BLA A;  2O84 X;  1SQY A;  2OJT A;  2XXW A;  1B4H A;  2DXY A;  1AL3 A;  1ATG A;  2XXU A;  3IJX B;  4ISU A;  5K2Y A;  3L6H A;  2H5Y A;  3KOS A;  3GBA A;  1MXU A;  3FV1 A;  3H06 B;  4KYE A;  4X1B A;  3H3G A;  4F29 A;  1ZIU A;  4Z7E A;  2Z8E A;  3VV5 A;  3H6U A;  3E3K A;  1QKB A;  4BDR A;  4I1D A;  5CMB A;  1Q35 A;  3EN3 A;  1B0L A;  5I57 B;  1YAE A;  1UQW A;  4F3P A;  3GBB A;  1IUD A;  1OVB A;  1MS7 A;  3TTL A;  5KCJ B;  3ZKK A;  3G3K A;  3OEK A;  3EHT A;  4QSD A;  1FQF A;  1MPB A;  3UK4 A;  1SD3 A;  3RNN A;  4Q8R A;  1P1N A;  5AA2 A;  3C35 A;  1B7Z A;  3O6I A;  1LAH E;  1MDP 1;  1B9J A;  4DDD A;  1JVY A;  4GLI A;  1MY1 A;  2PBW A;  4ZDM A;  4OZ9 A;  4P0I A;  5I2N B;  4HTG A;  3QUJ A;  3U8Q A;  4ELR A;  3KSX A;  1NNF A;  2H4I A;  3SDF A;  1PBP A;  1P1U A;  3M8U A;  2Y7W A;  4NF5 B;  3GLB A;  4XKP A;  2PT2 A;  2X7P A;  3QIM A;  4NE4 A;  3CSB A;  1FQB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...