3WAFA

X-ray structure of apo-ttfbpa, a ferric ion-binding protein from thermus thermophilus hb8
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
309
structure length
309
Chain Sequence
PTLTIYSGRGQSLVEPLVKQFEAETGIRVQVRYSTDAQILAALQEEGSRSPADLFWANTAGALGQASAKGLLRPLGETLLEKPIAFVPASRTWVPVTVRLRVLAYNPDRIKAEELPESLLDLPRFAREKGLVGRVGWTPTYSSFQDMVAGMIALYGEEKTREWLLAMKALAPKAYPSNPAMLDAIRAGEVDLGSTNHYYVVRFRRAGYRLGMHHFRDGDAGNLALVTGAGLLKTSKNLAAATRFLTYLLSPQAQQYFVGNIGEYPLVKGVALDPNLLPLEEALAKSPKLDLEKLPLDRALRLLRETGVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A novel mode of ferric ion coordination by the periplasmic ferric ion-binding subunit FbpA of an ABC-type iron transporter from Thermus thermophilus HB8.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Metal binding protein
molecule keywords Iron ABC transporter, periplasmic iron-binding protein
total genus 107
structure length 309
sequence length 309
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13416 SBP_bac_8 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3wafA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3wafA02
4YMBA 2ALUA 3O28A 4Q30B 5KDTB 3O66A 1N0TA 3W15C 1OMPA 4EQBA 1UTBA 3FD3A 3HHFA 4DLDA 3K6WA 2ZYOA 3U92A 5ELVA 3H6TA 3K1NA 3LSLA 1PBQA 4DE8A 4ZEBA 3KZGA 1HSEA 5AA1A 3D4CA 4TOZA 1B46A 3CSBA 1AH5A 2ABHA 3OO6A 1XHYA 2XX8A 3PUWE 4I1DA 4N6PA 4QFPA 5H8HB 4YKPA 4ZEIA 3UP9A 3ZSFA 2M8CA 2V25A 1DTGA 1MXYA 4GOTA 1JETA 3AXFA 5JEIA 5KCJB 2NOOA 1PB8A 3Q27A 5K2YA 4H1XA 2AL4A 3GZGA 4P0IA 3UIFA 4C1UA 1B3GA 2UVGA 4RPOA 4H8JA 2O7IA 3HHGA 3RLFE 3MZ1A 4KCDA 1MY4A 3IO6A 4YKKA 1QUKA 4XXUA 4HW8A 1LBCA 2ZYMA 2XXTA 4R74A 3TTNA 1UTHA 2ZNSA 3OSQA 3Q29A 2AL5A 4QFKA 1IZ1A 4PP0A 4WXJA 1MM7A 3RTFB 4FAJA 3H03A 2F8DA 2V3UA 1MPDA 4EXKA 2UVJA 1FTMA 1Y1ZA 4GLIA 1OLCA 5L9OA 1MXVA 4ELPA 3CRBA 1LB8A 2ONRA 3K6UA 1H76A 1B5HA 3PUZE 5KZTA 1II5A 3HV1A 3KFMA 5H8NA 3TODA 4LQ2A 4YB6A 4YICA 2DE3A 3IOVA 5I2KB 4BDLA 1IXGA 3MVXA 3RQTA 1RYOA 1S9TA 1GVCA 2XXVA 3SERA 1FCKA 1MQHA 2B65A 3C34A 4NMYA 5B7DA 2O1MA 4O3BA 2PT2A 2OJTA 1H43A 2RCAA 3IB1A 4F22A 1R6ZA 4ECFA 1POTA 2D3IA 4QRZA 1FTLA 3TYHA 5BWJA 1OVBA 4WEDA 2V84A 3F11A 3GBBA 5H8FB 3RPWA 3T22A 4U1ZA 4MH5A 2UVIA 4H67A 4EDPA 4EQ7A 2Y7PA 5AA3A 1Y4TA 3G3HA 3IR1A 4ZZAA 5TP9A 4ISUA 1AIVA 5H8QB 4OETA 1SW4A 3VXBA 3QUFA 4X9TA 5BUUA 1WDNA 3E9XA 2A5TB 4H5GA 2RC7A 2QS1A 1VFDA 1LAFE 3SEVA 3V5AA 3RT8A 3S9NC 3MVYA 2VP1A 4IB2A 2HZKA 2ZYKA 3G3IA 4ESWA 3OO9A 2B3FA 2H9BA 3ZKKA 5FTIA 3TTKA 4DZ1A 4LZ7A 4GL8A 1LAHE 3CSGA 4XIGQ 4XKRA 1FQCA 1A8EA 4F1YA 3T9VA 3B6WA 4LVQA 1MQIA 4KD5A 2REJA 3PUXE 2A5SA 4TQUQ 4FATA 2O68A 2PVUA 3EPEA 4PFTA 2H99A 2OWTA 2AIXA 1NNKA 1YCJA 4OWDA 3IJXB 4POXA 4C0RA 4OXVA 3EF7A 1O64A 2IA4A 2LAOA 3FXRA 3CFXA 4NF8A 3M3FA 4E0XA 3DELB 3EHTA 4X1BA 2QRYA 3FIRA 2QPQA 5AA4A 1TXFA 2HEUA 2DE2A 2OBGA 2XX9A 5DVFA 1LSTA 1MPBA 1B4ZA 3IL1B 3O6HA 5H8QA 1JNFA 4DXBA 2RC8A 4MLVA 2XXXA 5ICTA 1Q35A 1FQBA 4MFIA 4OVJA 4R2FA 2XXQA 2RC9A 4F3SA 3MP1A 3UGWA 1IQ7A 2UVHA 2UXAA 1VFEA 1MPCA 4EQ9A 1Y9UA 4IO5A 4KR5A 1LCFA 4U22A 4R73A 4KHZE 4ZE8A 2DP8A 3FVKA 2F6PA 1XVXA 2DQVA 1LFHA 2F5XA 3S9LC 3TUSA 4R6KA 3LR1A 4KYSA 4EXLA 1SQYA 2DS9A 1YAEA 2F7BA 3O6GA 4H8IA 2X7PA 4I8CA 2O51A 3MUQA 4ONYA 3K2DA 2I58A 2NXOA 1ZU0A 3B6TA 3VXCA 4NF5A 1QVSA 2ONSA 3OELA 4NF8B 4O3CA 5CBSA 1P1QA 2VHAA 5A5XB 1M5DA 1B5IA 3OMBA 4L17A 1PEBA 3VVEA 4IO6A 4NEDA 2OCUA 3WAEA 5I2NA 4QSCA 2ZNTA 5IAIA 1IXCA 2OLBA 4OFJA 3KSJA 3K00A 1MG1A 3BFUA 4RXLA 4RY1A 2Q8JA 4QSEA 4GF8A 3HSTA 3DP4A 5CBRA 1H3DA 3E13X 1DOTA 4ND9A 1AOVA 3I6VA 3LUYA 1SDXA 3L6GA 4RYAA 4U4XA 1BP5A 4EF2A 3CR9A 3FJMA 3K02A 4JSDA 1QKBA 1MQGA 1PBPA 3VLWA 3KBRA 1B40A 1UIVA 4MF3A 4ESXA 3H6UA 2R71A 4IO4A 1N7WA 5I59B 1JW5A 4F3BA 1B7ZA 3FGSA 4OFOA 4F29A 5I59A 2OK2A 2F35A 3WAFA 1DMBA 3TPAA 3UA8A 2ANJA 4ZS9A 1M5EA 1N3XA 1QUIA 2GRVA 2Z8EA 3FJGA 4KPTA 3T66A 4DDDA 1MXWA 3PGFA 2P1SA 1IIWA 1US4A 4NF6A 4X48A 3S4UA 1O7TA 1SBPA 1XT8A 4IY5A 4KQPA 2REGA 4KCCA 1JQFA 4QF9A 4DCXA 3JZJA 3PMXA 2THIA 3PUYE 2AYSA 5ITPA 3OENA 3EN3A 4KFQA 4QFNA 3V83A 2Z8FA 1B0LA 2I0CA 3PPPA 3KSXA 5JK4A 1AL3A 1DPEA 2DE4A 2G93A 2F34A 2HAVA 4MBPA 4PETA 5H8SA 5I57B 1MQDA 4LZ5A 1FTJA 2HXWA 4DXUA 3MPLA 2UYFA 3H06B 1FQFA 5DTBA 4OZ9A 3QAXA 3G7WA 1NNFA 2QS3A 1SI0A 5H8NB 2WKYA 5FHOA 2ONKE 3S9EA 3PPOA 3R26A 3M3LA 5LOMA 1MM6A 5ITOA 3M8UA 3IK6B 3QK6A 4QSDA 3TAJA 1R1NA 5EYFA 3QIMA 3TELA 3TCGA 2XXIA 3FZVA 1ZIUA 1NFTA 3C31A 2QJEA 1GTKA 2FA7A 3N6TA 4P0GA 3SDFA 4JDFA 1B0HA 3H3GA 4KYDA 4FJPA 4LQ5A 3VDFA 3QXMA 4LATA 4ELOA 3IOUA 1XS5A 3G3GA 3KN3A 1YTVA 4KYEA 3LC8A 1LFIA 5JTYB 1B7HA 1OQGA 4Q5TA 3PD9A 2RINA 1I6QA 5H8HA 1TFAA 4UACA 1GV8A 1NKXA 3RN8A 1FQEA 1WODA 4IO7A 2ZNUA 3IB2A 5TPAB 1N04A 2Z8DA 2X7QA 5I2NB 1LAGE 4GWOA 1LAXA 1D3KA 1MRPA 2F97A 1TT1A 3OXNA 1MQJA 4ZEKA 3U93A 4G4PA 3N94A 4LA9A 5DEXB 4DIGA 5I57A 4YKIA 4ZEFA 2I3WA 3KN8A 4FE8A 1EU8A 1JEVA 1R9LA 2VD2A 2DVCA 4FEDA 3PD8A 3SETA 3KG2A 1RYXA 4OTEA 5L8DA 1NNPA 2GH9A 3LSWA 4Q8RA 4F3GA 5CC2A 1H44A 1MH4A 2XXYA 1MDQA 5L9MA 3TTLA 2GFEA 5HM4B 2H98A 3U72A 1EZOA 1LLSA 4QHQA 1M5CA 4GFRA 3OOAA 1XOCA 3KN7A 4GIZA 5CRYA 4BDOA 5AA2D 1B5JA 5JTYA 3S9MC 1P1NA 3K6XA 1Q1KA 1IEJA 3N5LA 3I3VA 4FIMA 1M5FA 1FTOA 1OIBA 2O69A 2QMWA 2XXUA 1IITA 2V3QA 4RK9A 3RNNA 3QUJA 3V89B 3FV1A 3CFZA 1LCTA 1PB9A 3MAMA 4G8MA 5TU0A 3DM0A 2VOZA 4XKQA 2XXPA 2IEEA 3EQ1A 3TCFA 2HZLA 3MP8A 3TDJA 3LSFB 3OSRA 1CE2A 3Q25A 5ICQA 1LGBC 3IO4A 4KI0E 3TMGA 1JW1A 3GXAA 2I3VA 2QSXA 3IX1A 2H4IA 1QW0A 3MBPA 4OFLA 5TPAA 5H8FA 4BDMA 1B58A 4I9DA 3A09A 2YJPA 3T96B 1SW2A 2P2AA 3C32A 3G3KA 4R2BA 3UK4A 3O6IA 4F2OA 3H6VA 2QS2A 3T93B 3CFLA 3KJTA 3FXUA 3MPKA 4WEPA 1MS7A 3MP6A 4NF4A 1I6BA 1SW5A 3O2AA 2PT1A 3FXQA 1F9BA 3P7IA 4H65A 5DVIA 1FQDA 3CI8A 1PB7A 5I58B 1ZKBA 3OO7A 3S2VA 4OQOA 1ANFA 2DWHA 2V3TA 4Q0CA 4NWCA 2PBWA 5HBCA 4NWDA 3SEWA 3DP6A 2HQ0A 4IY6A 3SKPA 2NVUB 4GQOA 1LBBA 4JB7A 4RA1A 3G3FA 3O97A 5FTHA 1VSOA 2H25A 3GBAA 4AB5A 1SYHA 2KLFA 1ZJLA 4R9FA 1B4HA 1OVTA 1Z7NE 3TQLA 2E1SA 3IORA 3OEMA 2NUVA 1FTKA 1A54A 3RTWB 2ZXTA 2QMXA 4I62A 2HFBA 1B52A 3KOSA 4OERA 4U1OA 4IO2A 3H4ZA 3ILTB 1J1NA 1XVYA 1Y3PA 3VFJA 2I48A 2XHDA 1WVJA 4G8NA 2DXYA 4WKMA 1LFGA 3MVZA 2O6AA 1I69A 3OO8A 4UA8A 3ILUB 3FVOA 4G68C 1MY0A 1MH3A 1Y1MA 2UYEA 1FQAA 4XKPA 3USDA 2Z22A 1B1XA 3ONMA 4F1UA 3SESA 5CMKA 1B3HA 1MXXA 4RNSA 4ELQA 1USYH 4OYVA 1B51A 3DLNA 4K3FA 4TLLB 4LP2B 4AB6A 3QYTA 3VVDA 4OMBA 4NF5B 3FVGA 1MXZA 2Y7RA 5J1DA 1MXUA 5I58A 4LZ8A 3FV2A 3A3UA 2Y7KA 4M1VA 1FW0A 4F31B 1BLFA 5DYHA 1A8FA 2DWIA 5AE4A 2PX1A 5A5XA 5DT6A 4ELRA 3G3JA 4PFWA 3K0VA 2RF1A 2RKMA 4YB7A 1ZBMA 2I4BA 2H5YA 3CVGA 1N7XA 1DTZA 2Q9TA 3BFTA 5EHSA 1B2HA 1IXIA 2DYXA 1N84A 5EHMA 2G29A 3UORA 1P1OA 4JWYA 1IUDA 4HTGA 2W7YA 4OHNA 2Q88A 3VLUA 3H6WA 1B3FA 4ZE9A 1URGA 3VVFA 4NTLA 1MY1A 2PMSA 1GGGA 1MDP1 2RCBA 3R6UA 4X1DA 1S50A 3RY3A 4Z7EA 3IOWA 2NWJA 1RKMA 1URDA 3HO7A 2DXRA 1ELJA 1JVYA 2F6GA 2GHBA 4TLMB 2O84X 1YPNA 3MWBA 1B3LA 3E3KA 5I84A 2O1LA 2HCAA 3RGYA 5HPQA 1MY2A 4YB5A 4NF4B 4FORA 1P99A 3VE1B 3TEPA 3H7MA 1ZMGA 4RPNA 2DWJA 3B6QA 3FJ7A 3SEUA 3D4GA 3W9VA 1B32A 3KEIA 5F7VA 4HS7A 3B7DA 4MLQA 4G2ZA 5KDTA 1A55A 3N26A 3TCHA 5CMCA 3MW0A 2DSFA 4HCYA 4HCWA 5IKBA 4YAHX 1S7YA 4F2QA 5I56A 1NNTA 1P1WA 3R7XA 1URSA 2QS4A 2XXWA 3SEYA 3PPNA 2Q89A 4H0WA 3K1MA 5ISUA 1USYE 2OZZA 3K01A 1I6AA 1Z7ME 2F36A 3THIA 3UN6A 4H6DA 3ECRA 1B7UA 3CIJA 1O63A 2YLNA 3K4UA 3MC2A 3CG1A 3MZ9A 1LB9A 4FEBA 3U1OA 1NMUA 3RT6B 3MJNA 2A5TA 1XC1A 1A99A 1SVXB 1VE4A 4G68A 4G8HA 5DVJA 4JSOA 2D5WA 4NF6B 3BBRA 3C33A 3LBSA 3JV9A 2I0BA 3ODBA 4R6YA 1TWYA 2VGQA 3EHSA 3IOTA 4YU0A 2Q2CA 4BDRA 2PYYA 4RK2A 4F3PA 3IJOB 3JYRA 1D4NA 1ATGA 3KGCA 1B3EA 1BKAA 1SD3A 3HCQA 3C35A 2F78A 3FUZA 3MQ9A 4OENA 3A3CA 3PPRA 3I5OA 2I4CA 1QKAA 3MVWA 5FHMA 1D9VA 3V8XB 4F19A 1MY3A 1B9JA 4GXSB 4IGRA 4BDNA 3O29A 2BJJX 4C1TA 5AA4B 1SW1A 4M4GA 3O9PA 4JBZA 5B70A 1B05A 2XXRA 3ZS6A 4RJZA 2XX7A 2Y84A 5DEXA 4THIA 4AQ4A 4DXCA 3C4MA 1POY1 1L5TA 4OESA 1JEUA 1IXHA 1M5BA 4G68B 5M2VA 2QL3A 4FECA 1A7LA 3L6HA 3BKIB 3VV5A 1KWHA 4F1VA 4YMAA 1T0KA 3FVNA 3TTMA 4GXAA 3FATA 5CMBA 3QSLA 3W9WA 3U94A 4O3AA 4ZZEA 4XKNA 4XTCQ 1OLAA 3K6VA 1B6HA 1N3WA 3Q26A 4R9GA 4U21A 1PDAA 4YKJA 4LUBA 1HSJA 2V93A 1ZLQA 4PFUA 4F18A 4N13A 2I49A 4EF1A 1H45A 2GHAA 3CG3A 4POWA 3C9HA 5K2XA 1PC3A 2DVZA 2XD2A 3C36A 3HPIA 3KJ7A 4OEVA 1SYIA 2HAUA 4LONB 3OEKA 1Y4CA 4ZECA 4ZDMA 5KCJA 3PV0E 2F7AA 2YPNA 3IAZA 3PMWA 5F1QA 2DOJA 3T9UA 2CMOA 1BTJA 3ZKLA 5CM6A 4JWOA 1TFDA 2Y7WA 3Q28A 3TZAA 1QUJA 4YZZA 3DP8A 3E4RA 4IGTA 2XXHA 4IO3A 3LSXA 1Y3NA 3PU5A 1DPPA 4OEUA 3T9XB 1QJMA 1AMFA 1Y3QA 2ZMBA 3SEXA 5I56B 4N07A 4R72A 3TTRA 3FASA 2E0SA 2Z23A 4E0WA 3OD7A 4G77A 1A40A 1B1HA 1VR5A 3TKDA 1NH8A 1QULA 4U23A 2O7UA 1Y20A 4ZEDA 1US5A 2DWAA 2Q2AA 2VD3A 3MZBA 3KOTA 5AA2B 5L9SA 1JW4A 1NL5A 2Y7IA 4BDQA 2FYIA 4GRKA 1BIYA 2B3BA 1R9QA 4NE4A 2R6GE 3T9HB 1OQHA 3M3KA 1DSNA 1JVXA 4EUOA 4GD5A 1UTBB 2ZYNA 3HN0A 4U2RA 3GLBA 4BLAA 4F39A 2R9JA 4JXIA 4R6HA 2P0SA 5I2KA 2XD3A 1EZ9A 2OWSA 3VLVA 4QFOA 2FNCA 3PPQA 1GR2A 1CB6A 1D9YA 3PUVE 1ZTYA 2F7CA 3K1PA 4PFYA 4DCYA 3TQWA 1HSLA 3IB0A 2I6EA 2CZLA 3TFLA 4GVOA 3RUMA 5TP9B 4JWXA 4Z0IA 4GL0A 1NH7A 1P1UA 3N6UA 4P11A 4R75A 4H5FA 1EZPA 3EHUA 2D21A 1UTHB 1UIUA 4PQJA 4QFLA 5CI5A 1SI1A 2ESNA 5FHNA 1EH3A 2X26A 4PE5B 3U8QA 5AA2A 1UQWA 5CMMA 4U4SA 1N76A 3PMVA
chains in the Genus database with same CATH superfamily
4Q30B 1N0TA 1OMPA 3KZGA 3D4CA 1IMEA 1DBZA 3OO6A 4I1DA 2XX8A 4QFPA 3ZSFA 5H8HB 3UP9A 4PAFA 4C1UA 4H8JA 1MY4A 1Q9DA 4YKKA 4XXUA 2MKZA 1IMFA 1UTHA 2ZNSA 3TUSA 3Q29A 4PP0A 1MM7A 4FAJA 1Y1ZA 4GLIA 4ELPA 3CRBA 1K9ZA 3K6UA 5KZTA 1II5A 3BIHA 3HV1A 4LQ2A 4YICA 2DE3A 5I2KB 3RQTA 2B65A 4O3BA 2OJTA 2GQ1A 1H43A 3IB1A 1R6ZA 5BWJA 4I40A 4QRZA 1FTLA 2XWOA 1QGXA 3RPWA 4N91A 4NG7A 1EYIA 2RC7A 4N8YA 2HZKA 4ESWA 2B3FA 4LZ7A 4GL8A 1A8EA 2O68A 1IMCA 3EPEA 3NOHA 4PFTA 2OWTA 4OWDA 4C0RA 1O64A 3FIRA 4MX6A 2OBGA 1LSTA 1MPBA 4HE1A 5ICTA 1Q35A 4EQ9A 1MPCA 4XF5A 4KR5A 1LCFA 2DP8A 3S9LC 2F5XA 1FBCA 4EXLA 2O51A 3MUQA 2I58A 1ZU0A 1QVSA 4NF8B 5A5XB 3OMBA 1B5IA 3WAEA 1PEBA 5IZ1A 4NEDA 1AWBA 4QSCA 4PE3A 4OFJA 4RXLA 4RY1A 2JJKA 3HSTA 3DP4A 1H3DA 1DOTA 3I6VA 3L6GA 4U4XA 3CR9A 1PBPA 3KBRA 1UIVA 3H6UA 4IO4A 5I59B 1JW5A 3FGSA 4OFOA 2F35A 1M5EA 4OVRA 4KPTA 1K9YA 4P8BA 4PBQA 3E78A 2THIA 3PUYE 5ITPA 3OENA 3V83A 2Z8FA 1DPEA 5H8SA 4PETA 3IFCA 2HXWA 3QAXA 1EYKA 3R26A 3M8UA 4QSDA 3TAJA 3TCGA 3N6TA 1ZIUA 1NFTA 3C31A 2QJEA 4P0GA 4LATA 4PC9A 3G3GA 3LC8A 1LFIA 2Q8MA 3PD9A 2RINA 1I6QA 1TFAA 1GV8A 2OX3A 3RN8A 1WODA 5TPAB 2X7QA 3OXNA 4G4PA 4ZEFA 1R9LA 2DVCA 3SETA 2GH9A 4F3GA 4PDDA 3CHGA 5CRYA 5JTYA 1P1NA 3K6XA 1IEJA 3N5LA 3I3VA 3RNNA 4RK9A 3QUJA 1NV3A 3FV1A 1PB9A 3MAMA 4G8MA 3DM0A 4O8MA 3EQ1A 3TCFA 2HZLA 1LGBC 4KI0E 4GX6A 4PF6A 2I3VA 2QSXA 5H8FA 1QW0A 4OFLA 4I9DA 4PGNA 3G3KA 3UK4A 2B4LA 3T93B 3CFLA 1RDZA 4NWDA 1NV2A 4H45A 3SKPA 4RA1A 5FTHA 3G3FA 3O97A 1VSOA 3GBAA 1SYHA 2KLFA 3B8BA 4R9FA 1Z7NE 3TQLA 1FTKA 1A54A 4IO2A 1J1NA 1XVYA 1WVJA 3MVZA 2O6AA 3OO8A 1LBWA 4G68C 2FIXA 1MH3A 1FPEA 2CZKA 4AB6A 3QYTA 1MXZA 2Y7RA 2PFZA 4GWYA 3A3UA 2Y7KA 4F31B 5A5XA 4ELRA 4PFWA 3K0VA 2VPOA 1ZBMA 2I4BA 5EHSA 1IXIA 3UORA 1IUDA 4HTGA 2W7YA 4OHNA 3VLUA 1B3FA 1URGA 2PMSA 1GGGA 1MDP1 3R6UA 4TLMB 3RGYA 3VE1B 1ZMGA 1B32A 5F7VA 4HS7A 3B7DA 1A55A 4GX3A 2DSFA 3HFUA 4HCWA 4YAHX 1P1WA 3R7XA 2QS4A 5ISUA 2OZZA 3ECRA 1B7UA 1O63A 3K4UA 3MZ9A 1LB9A 1NMUA 3RT6B 1SVXB 1NV4A 3C33A 3LBSA 2I0BA 2VGQA 4YU0A 2Q2CA 4BDRA 4F3PA 3IJOB 3FUZA 1IMDA 3MVWA 1QKAA 3V8XB 1B9JA 4BDNA 3U65A 1B05A 2XXRA 5IM2A 4P3LA 4DXCA 1JEUA 4G68B 4N4UA 4FECA 2HXRA 3VV5A 4F1VA 1T0KA 3W9WA 3FATA 3QSLA 3U94A 4U21A 3Q26A 1PDAA 4NQ8A 2I49A 4EF1A 2GHAA 3CG3A 4POWA 2QVVA 1PC3A 2XD2A 3HPIA 4ZECA 3PV0E 2F7AA 2YPNA 2CMOA 2Y7WA 3TZAA 3E4RA 2XXHA 3PU5A 1DPPA 2ZMBA 5I56B 4N07A 3TTRA 2Z23A 4GWSA 1LEVA 3TKDA 2Q2AA 3KOTA 4PAKA 2Y7IA 1R9QA 2B3BA 1OQHA 3M3KA 1JVXA 3HN0A 1EZ9A 4QFOA 3PPQA 2HHMA 4PFYA 2XA5A 1P1UA 4H5FA 3EHUA 1SI1A 1NI9A 2ALUA 3W15C 3FD3A 3HHFA 3U92A 4DE8A 5AA1A 4TOZA 1AH5A 3PUWE 1XHYA 4YKPA 1FPKA 2M8CA 4GOTA 3AXFA 1PB8A 4P1EA 4H1XA 2AL4A 3GZGA 4OVQA 3UIFA 2UVGA 4RPOA 3MZ1A 1QUKA 4HW8A 4PF8A 1LBCA 3OSQA 4QFKA 2AL5A 1IZ1A 3H03A 2F8DA 2V3UA 1MPDA 3PUZE 3TODA 4BDLA 1GVCA 3SERA 3C34A 4NMYA 4F22A 4ECFA 3TYHA 4IR8A 1OVBA 4EDPA 3SZPA 1YXIA 3IR1A 3G3HA 1AIVA 5H8QB 3VXBA 4H5GA 3V5AA 3RT8A 2VP1A 3G3IA 2H9BA 1LAHE 4XKRA 1FQCA 3B6WA 4KD5A 2REJA 2A5SA 3D1RA 2PVUA 1CNQA 4POXA 4OXVA 3EF7A 2LAOA 3FXRA 3CFXA 4NF8A 3M3FA 4E0XA 3EHTA 4G61A 2XX9A 5DVFA 3IL1B 5H8QA 4MLVA 1NV6A 4MFIA 4OVJA 2XXQA 3MP1A 3UGWA 1IQ7A 2UVHA 2UXAA 1VFEA 4ZE8A 1LFHA 4R6KA 4X04A 4KYSA 4OANA 1SQYA 2DS9A 2X7PA 5A5LA 2NXOA 3B6TA 3VXCA 2ONSA 3OELA 4O3CA 2VHAA 5H8NB 2FBPA 2ZNTA 5IAIA 3KSJA 3K00A 1MG1A 4ND9A 3LUYA 1SDXA 3RPLA 1BP5A 5EYGA 1MQGA 3QMFA 4MF3A 2R71A 1N7WA 1NUWA 4UABA 3WAFA 4ZS9A 2Z8EA 3PGFA 1IIWA 4X48A 4NF6A 1SBPA 1KZ8A 1NV1A 2REGA 4KCCA 2L5VA 3EN3A 2I0CA 2XWIA 2DE4A 1MQDA 2OWZA 4LZ5A 3MPLA 2UYFA 4OZ9A 1NNFA 2QS3A 2WKYA 1RDXA 2WEFA 3PPOA 4GWXA 3S9EA 4NHBA 3IK6B 3QK6A 3VLWA 5EYFA 1FPJA 4NGUA 3VDFA 3IOUA 4KYEA 1B7HA 4PCDA 4UACA 5LTCA 1LAXA 2F97A 3U93A 3N94A 4LA9A 5I57A 2I3WA 1EU8A 1JEVA 3KG2A 1RYXA 3LSWA 2XXYA 1MDQA 3TTLA 3FXBA 5ET7A 1EZOA 1M5CA 1D9QA 4GFRA 1XOCA 4GIZA 1B5JA 4FIMA 1OIBA 2XXUA 2V3QA 3V89B 3CFZA 3BIGA 3LSFB 3OSRA 5ICQA 3GXAA 3IX1A 5TPAA 4GWUA 4BDMA 1SW2A 2PFYA 3C32A 4R2BA 1G0IA 2XXKA 4PBHA 3KJTA 3FXUA 3MPKA 4NF4A 3O2AA 2PT1A 4H65A 5DVIA 1FQDA 3CI8A 3S2VA 3SEWA 3DP6A 4GQOA 4JVIA 1ZJLA 1OVTA 3RTWB 2ZXTA 2QMXA 2HFBA 4OERA 3ILTB 2XWKA 3T0JA 1FQAA 3ONMA 3DLNA 3VVDA 5I58A 4LZ8A 4M1VA 2P3VA 1DTZA 2XWVA 1FRPA 3H6WA 3VVFA 1MY1A 2NWJA 1RKMA 1ELJA 3MWBA 2O1LA 2HCAA 5HPQA 1MY2A 3TEPA 3H7MA 4RPNA 1FJ6A 3SEUA 3FJ7A 3ROJA 3EKIA 5CMCA 4HCYA 4F2QA 3T1BA 4MHFA 4PFIA 5F24A 4XFEA 4H0WA 3K1MA 3UN6A 1Z7ME 4H6DA 3CIJA 2YLNA 2FVZA 3U1OA 2A5TA 1XC1A 4JSOA 4NF6B 3JV9A 1FPFA 4MCOA 1TWYA 3ZKLA 1ATGA 1B3EA 3MQ9A 4OENA 5ET6A 2F78A 3A3CA 2I4CA 3O29A 4C1TA 1SW1A 5B70A 4GWZA 2Y84A 5DEXA 3C4MA 4GBVA 3L6HA 2F3BA 3BKIB 4YMAA 4GXAA 4OVSA 3LV0A 2V4CA 1B6HA 4DXUA 4R9GA 4DI4B 4N15A 1RDYA 4NX1A 5K2XA 2HAUA 3OEKA 1Y4CA 5F1QA 3IAZA 1YZ0A 5CM6A 3Q28A 4YZZA 3DP8A 4NAPA 4OEUA 4R72A 4G77A 1FPGA 4U23A 1Y20A 4LN5A 1YYZA 2DWAA 2VD3A 5EQ9A 1NL5A 2FYIA 2R6GE 4HE0A 4EUOA 2XD3A 2OWSA 2CZHA 2FNCA 5ESYA 3PUVE 1ZTYA 3K1PA 3IFAA 5ET5A 1HSLA 3IB0A 2CZLA 5TP9B 4GL0A 3N6UA 2QFLA 4F18A 4QFLA 4PE5B 5AA2A 5CMMA 4U4SA 3PMVA 4DLDA 2ZYOA 3LSLA 1PBQA 2R8TA 1FBEA 1JP4A 4ZEBA 1HSEA 4ZEIA 5I5PA 2V25A 1DTGA 1MXYA 5JEIA 1JETA 5KCJB 2NOOA 3Q27A 4P0IA 5EQ8A 1B3GA 2O7IA 3HHGA 2ZYMA 2UVJA 1LB8A 1H76A 1B5HA 5H8NA 3KFMA 3MVXA 1RYOA 2D3IA 2CZIA 3F11A 2VPNA 2Y5LA 3T22A 4U1ZA 4MH5A 2UVIA 5AA3A 1Y4TA 5TP9A 1NUZA 4ISUA 4X9TA 1WDNA 5J16A 2QS1A 3SEVA 3OO9A 1FSAA 3CSGA 4F1YA 3T9VA 5I7IA 3PUXE 4FATA 2H99A 2AIXA 4P56A 2IA4A 1TXFA 2HEUA 3MSTA 4PAIA 3O6HA 1B4ZA 3E79A 4PGPA 1JNFA 2XXXA 1FQBA 4R2FA 2RC9A 1LBVA 3KC1A 2F6PA 1XVXA 3LR1A 4I8CA 1YAEA 2F7BA 4H8IA 3K2DA 5CBSA 1M5DA 4L17A 1IXCA 2OLBA 3BFUA 2Q8JA 1AOVA 5CBRA 3E13X 4JVDA 4HXVA 4EF2A 4JSDA 4ESXA 2KQZA 5I59A 3TPAA 2ANJA 1QUIA 3FJGA 2GRVA 3T66A 4DDDA 3S4UA 1O7TA 1XT8A 5LDZA 4IY5A 4KQPA 1JQFA 3JZJA 3PMXA 2AYSA 2Q74A 4KFQA 4QFNA 1B0LA 3KSXA 2HAVA 2G93A 3RPLB 2DDKA 2VT5A 1FQFA 4I3YA 1NUYA 1SI0A 5FHOA 2ONKE 3M3LA 5LOMA 1FBDA 3TELA 1R1NA 3QIMA 3SDFA 2FA7A 1B0HA 1XS5A 3KN3A 1YTVA 5JTYB 2WBBA 1NKXA 1FQEA 4IO7A 2ZNUA 3IB2A 1MRPA 1TT1A 4MNCA 4FE8A 2VD2A 4FEDA 4OTEA 5CC2A 1MH4A 2FHYA 5L9MA 1EYJA 2H98A 1LLSA 4QHQA 5AA2D 2O69A 4KXPA 1LCTA 2PCRA 4XKQA 2VOZA 2XXPA 2IEEA 2BJIA 3MP8A 3TDJA 1CE2A 3IO4A 3TMGA 3MBPA 4HE2A 2P2AA 4XEQA 1FPDA 4F2OA 2WBDA 2QS2A 3H6VA 3MP6A 3S9MC 1I6BA 5KDTA 3FXQA 4N81A 4OVPA 1PB7A 1ZKBA 4OQOA 1ANFA 2V3TA 4NWCA 2HQ0A 2NVUB 1LBBA 4JB7A 2H25A 2WX9A 1B4HA 4I3EA 2E1SA 3IORA 4F3BA 2NUVA 4I62A 1B52A 4U1OA 4O94A 1KA0A 4UA8A 3USDA 1Y1MA 2UYEA 4XKPA 2Z22A 4DI3D 1B3HA 4ELQA 4RNSA 1USYH 1B51A 4K3FA 4LP2B 3FVGA 2FIEA 5J1DA 1FPBA 1MXUA 1FW0A 1A8FA 5DT6A 2RKMA 5DW8A 3CVGA 1N7XA 1B2HA 1N84A 5EHMA 2G29A 4JWYA 2Q88A 4ZE9A 2RCBA 4X1DA 1S50A 4MNIA 2QVUA 2DXRA 2ZZWA 1JVYA 2F6GA 1IMAA 2O84X 2KR0A 4YB5A 4FORA 2DWJA 5I3SA 3W9VA 3KEIA 4G2ZA 3MW0A 5IKBA 1S7YA 5I56A 3PPNA 2Q89A 1NV5A 1USYE 3K01A 3THIA 1I6AA 3MC2A 4FEBA 3MJNA 4P9KA 1A99A 4G8HA 2D5WA 4MNPA 5K2YA 1BKAA 3I5OA 1D9VA 4F19A 4GXSB 4IGRA 2BJJX 4O7MA 4N6DA 2XX7A 3PTYA 4AQ4A 1L5TA 1POY1 4OVTA 1G0HA 1IXHA 1M5BA 2QL3A 1A7LA 2HPGA 1KWHA 3FVNA 3TTMA 1LBXA 4O3AA 4XKNA 4XTCQ 3K6VA 3ISPA 4GBWA 1ZLQA 4N13A 4QXDA 1H45A 3C9HA 2DVZA 3KJ7A 4LONB 5KCJA 3PMWA 4N6KA 1FBPA 4JWOA 1QUJA 3LSXA 1Y3NA 3T9XB 1QJMA 1AMFA 3SEXA 3FASA 2E0SA 1B1HA 4N17A 1QULA 1US5A 4FBPA 5AA2B 4PTKA 1JW4A 4GRKA 1BIYA 3T9HB 3FBPA 1DSNA 4BLAA 1UTBB 2ZYNA 4U2RA 3GLBA 4N8GA 4F39A 2R9JA 4JXIA 4R6HA 4MEVA 1GR2A 1CB6A 1D9YA 4Z0IA 5FBPA 1LBYA 4O7IA 1FJ9A 2X26A 1UQWA 4YMBA 3O28A 5KDTB 3O66A 4JVCA 4EQBA 1UTBA 3K6WA 5ELVA 3H6TA 3K1NA 1B46A 3CSBA 2ABHA 4N6PA 4MIJA 4AS5A 3RLFE 4KCDA 3IO6A 2XXTA 4R74A 3TTNA 4WXJA 3RTFB 4GX4A 4EXKA 1FTMA 1OLCA 5EQ7A 5L9OA 1MXVA 2ONRA 2QVRA 4NN3A 4YB6A 3IOVA 4P47A 1IXGA 1SPIA 1S9TA 2XXVA 1FCKA 1MQHA 5B7DA 2O1MA 2PT2A 2RCAA 1POTA 4WEDA 2V84A 5H8FB 3GBBA 4H67A 4EQ7A 5T3JA 2Y7PA 5IZ3B 4ZZAA 4OETA 1SW4A 2ZZXA 3QUFA 5BUUA 3E9XA 2A5TB 1DK4A 1VFDA 1LAFE 3MVYA 4IB2A 1XI6A 2ZYKA 3ZKKA 5FTIA 3TTKA 4XIGQ 4LVQA 1MQIA 4TQUQ 2WYKA 4P1LA 1NNKA 1YCJA 3IJXB 4PDHA 3DELB 5AA4A 4X1BA 2QRYA 2QPQA 2DE2A 3RYDA 4DXBA 2RC8A 4F3SA 1Y9UA 4IO5A 4U22A 4R73A 4KHZE 3FVKA 2DQVA 3O6GA 4ONYA 4NF5A 1P1QA 3VVEA 4IO6A 2OCUA 5I2NA 4QSEA 4GF8A 1INPA 4RYAA 3FJMA 3K02A 1QKBA 1B40A 1VDWA 1FPLA 1B7ZA 3KBZA 4F29A 2OK2A 1DMBA 4OA4A 3UA8A 1N3XA 1MXWA 2P1SA 1US4A 4QF9A 4DCXA 1DCUA 3A29A 3PPPA 5JK4A 1AL3A 2F34A 4MBPA 5I57B 1FTJA 3H06B 5DTBA 3G7WA 1FPIA 1FBGA 1FBFA 1MM6A 5ITOA 5IZZA 2XXIA 3FZVA 1GTKA 4JDFA 4KYDA 3H3GA 4FJPA 4LQ5A 3QXMA 4ELOA 5EYHA 1OQGA 4Q5TA 5H8HA 1N04A 2Z8DA 5I2NB 1LAGE 4GWOA 4ZEKA 1D3KA 1MQJA 4DIGA 5DEXB 4YKIA 3KN8A 2ZZVA 3PD8A 5L8DA 1NNPA 4Q8RA 1H44A 2GFEA 5HM4B 3U72A 3OOAA 3KN7A 4BDOA 1Q1KA 1KA1A 1M5FA 1FTOA 2QMWA 1IITA 5TU0A 3Q25A 1JW1A 3RUMA 2H4IA 4MMPA 1B58A 3A09A 2YJPA 3B50A 3T96B 1IMBA 2CEXA 3O6IA 2F3DA 4WEPA 1MS7A 1SW5A 3P7IA 1BK4A 1F9BA 2CEYA 5I58B 3OO7A 1NUXA 2DWHA 5HBCA 4Q0CA 2PBWA 4IY6A 2Y5KA 4AB5A 4DZ1A 4GWWA 3OEMA 3KOSA 3H4ZA 1Y3PA 3VFJA 2I48A 2XHDA 4PFBA 4G8NA 2DXYA 4WKMA 1LFGA 1I69A 3ILUB 3FVOA 1MY0A 2P3NA 1B1XA 4F1UA 3SESA 5CMKA 1MXXA 4OYVA 4TLLB 4OMBA 4NF5B 3LUZA 3FV2A 1BLFA 5DYHA 2DWIA 5AE4A 2PX1A 3G3JA 2RF1A 4YB7A 2H5YA 2Q9TA 3BFTA 2DYXA 1P1OA 4NTLA 3RY3A 4Z7EA 3IOWA 3HO7A 1URDA 2GHBA 1YPNA 1B3LA 3E3KA 5I84A 3MYUA 4NF4B 1P99A 4H46A 3B6QA 3D4GA 4MLQA 3N26A 3TCHA 1NNTA 1URSA 2XXWA 3SEYA 2F36A 3CG1A 1VE4A 4G68A 5DVJA 4R6YA 3BBRA 3ODBA 3S9NC 3EHSA 3IOTA 2PYYA 4RK2A 4GD5A 3JYRA 1D4NA 3KGCA 1SD3A 3HCQA 3C35A 3PPRA 5FHMA 1MY3A 3GYYA 5EQAA 5AA4B 4M4GA 3O9PA 4JBZA 3ZS6A 4RJZA 5IZ3A 1LBZA 4THIA 4OESA 3KC0A 4AS4A 5M2VA 1FBHA 4NF0A 5CMBA 4ZZEA 1OLAA 1N3WA 4YKJA 4PFUA 1NV0A 1HSJA 2V93A 4LUBA 5ET8A 3C36A 4OEVA 1SYIA 4ZDMA 4PFRA 2DOJA 2WYPA 3T9UA 1BTJA 4QBAA 1TFDA 4IGTA 4IO3A 4MJOA 1Y3QA 1NV7A 4E0WA 3OD7A 1A40A 1VR5A 1NH8A 4ZEDA 2O7UA 3MZBA 5L9SA 4BDQA 4NE4A 5IGAA 5I2KA 2P0SA 3VLVA 2F7CA 1FTAA 3TQWA 4DCYA 2I6EA 3TFLA 4GVOA 4JWXA 2B4MA 4P11A 1NH7A 4R75A 1EZPA 2D21A 5CI5A 1UTHB 1UIUA 4PQJA 5FHNA 2ESNA 1EH3A 4X8RA 3U8QA 4MAGA 1N76A
chains in the Genus database with same CATH topology
4YMBA 2ALUA 3O28A 4Q30B 5KDTB 3O66A 1N0TA 3W15C 1OMPA 4EQBA 1UTBA 3FD3A 3HHFA 4DLDA 3K6WA 2ZYOA 3U92A 5ELVA 3H6TA 3K1NA 3LSLA 1PBQA 4DE8A 4ZEBA 3KZGA 1HSEA 5AA1A 3D4CA 4TOZA 1B46A 3CSBA 1AH5A 2ABHA 3OO6A 1XHYA 2XX8A 3PUWE 4I1DA 4N6PA 4QFPA 5H8HB 4YKPA 4ZEIA 3UP9A 3ZSFA 2M8CA 2V25A 1DTGA 1MXYA 4GOTA 1JETA 3AXFA 5JEIA 5KCJB 2NOOA 1PB8A 3Q27A 5K2YA 4H1XA 2AL4A 3GZGA 4P0IA 3UIFA 4C1UA 1B3GA 2UVGA 4RPOA 4H8JA 2O7IA 3HHGA 3RLFE 3MZ1A 4KCDA 1MY4A 3IO6A 4YKKA 1QUKA 4XXUA 4HW8A 1LBCA 2ZYMA 2XXTA 4R74A 3TTNA 1UTHA 2ZNSA 3OSQA 3Q29A 2AL5A 4QFKA 1IZ1A 4PP0A 4WXJA 1MM7A 3RTFB 4FAJA 3H03A 2F8DA 2V3UA 1MPDA 4EXKA 2UVJA 1FTMA 1Y1ZA 4GLIA 1OLCA 5L9OA 1MXVA 4ELPA 3CRBA 1LB8A 2ONRA 3K6UA 1H76A 1B5HA 3PUZE 5KZTA 1II5A 3HV1A 3KFMA 5H8NA 3TODA 4LQ2A 4YB6A 4YICA 2DE3A 3IOVA 5I2KB 4BDLA 1IXGA 3MVXA 3RQTA 1RYOA 1S9TA 1GVCA 2XXVA 3SERA 1FCKA 1MQHA 2B65A 3C34A 4NMYA 5B7DA 2O1MA 4O3BA 2PT2A 2OJTA 1H43A 2RCAA 3IB1A 4F22A 1R6ZA 4ECFA 1POTA 2D3IA 4QRZA 1FTLA 3TYHA 5BWJA 1OVBA 4WEDA 2V84A 3F11A 3GBBA 5H8FB 3RPWA 3T22A 4U1ZA 4MH5A 2UVIA 4H67A 4EDPA 4EQ7A 2Y7PA 5AA3A 1Y4TA 3G3HA 3IR1A 4ZZAA 5TP9A 4ISUA 1AIVA 5H8QB 4OETA 1SW4A 3VXBA 3QUFA 4X9TA 5BUUA 1WDNA 3E9XA 2A5TB 4H5GA 2RC7A 2QS1A 1VFDA 1LAFE 3SEVA 3V5AA 3RT8A 3S9NC 3MVYA 2VP1A 4IB2A 2HZKA 2ZYKA 3G3IA 4ESWA 3OO9A 2B3FA 2H9BA 3ZKKA 5FTIA 3TTKA 4DZ1A 4LZ7A 4GL8A 1LAHE 3CSGA 4XIGQ 4XKRA 1FQCA 1A8EA 4F1YA 3T9VA 3B6WA 4LVQA 1MQIA 4KD5A 2REJA 3PUXE 2A5SA 4TQUQ 4FATA 2O68A 2PVUA 3EPEA 4PFTA 2H99A 2OWTA 2AIXA 1NNKA 1YCJA 4OWDA 3IJXB 4POXA 4C0RA 4OXVA 3EF7A 1O64A 2IA4A 2LAOA 3FXRA 3CFXA 4NF8A 3M3FA 4E0XA 3DELB 3EHTA 4X1BA 2QRYA 3FIRA 2QPQA 5AA4A 1TXFA 2HEUA 2DE2A 2OBGA 2XX9A 5DVFA 1LSTA 1MPBA 1B4ZA 3IL1B 3O6HA 5H8QA 1JNFA 4DXBA 2RC8A 4MLVA 2XXXA 5ICTA 1Q35A 1FQBA 4MFIA 4OVJA 4R2FA 2XXQA 2RC9A 4F3SA 3MP1A 3UGWA 1IQ7A 2UVHA 2UXAA 1VFEA 1MPCA 4EQ9A 1Y9UA 4IO5A 4KR5A 1LCFA 4U22A 4R73A 4KHZE 4ZE8A 2DP8A 3FVKA 2F6PA 1XVXA 2DQVA 1LFHA 2F5XA 3S9LC 3TUSA 4R6KA 3LR1A 4KYSA 4EXLA 1SQYA 2DS9A 1YAEA 2F7BA 3O6GA 4H8IA 2X7PA 4I8CA 2O51A 3MUQA 4ONYA 3K2DA 2I58A 2NXOA 1ZU0A 3B6TA 3VXCA 4NF5A 1QVSA 2ONSA 3OELA 4NF8B 4O3CA 5CBSA 1P1QA 2VHAA 5A5XB 1M5DA 1B5IA 3OMBA 4L17A 1PEBA 3VVEA 4IO6A 4NEDA 2OCUA 3WAEA 5I2NA 4QSCA 2ZNTA 5IAIA 1IXCA 2OLBA 4OFJA 3KSJA 3K00A 1MG1A 3BFUA 4RXLA 4RY1A 2Q8JA 4QSEA 4GF8A 3HSTA 3DP4A 5CBRA 1H3DA 3E13X 1DOTA 4ND9A 1AOVA 3I6VA 3LUYA 1SDXA 3L6GA 4RYAA 4U4XA 1BP5A 4EF2A 3CR9A 3FJMA 3K02A 4JSDA 1QKBA 1MQGA 1PBPA 3VLWA 3KBRA 1B40A 1UIVA 4MF3A 4ESXA 3H6UA 2R71A 4IO4A 1N7WA 5I59B 1JW5A 4F3BA 1B7ZA 3FGSA 4OFOA 4F29A 5I59A 2OK2A 2F35A 3WAFA 1DMBA 3TPAA 3UA8A 2ANJA 4ZS9A 1M5EA 1N3XA 1QUIA 2GRVA 2Z8EA 3FJGA 4KPTA 3T66A 4DDDA 1MXWA 3PGFA 2P1SA 1IIWA 1US4A 4NF6A 4X48A 3S4UA 1O7TA 1SBPA 1XT8A 4IY5A 4KQPA 2REGA 4KCCA 1JQFA 4QF9A 4DCXA 3JZJA 3PMXA 2THIA 3PUYE 2AYSA 5ITPA 3OENA 3EN3A 4KFQA 4QFNA 3V83A 2Z8FA 1B0LA 2I0CA 3PPPA 3KSXA 5JK4A 1AL3A 1DPEA 2DE4A 2G93A 2F34A 2HAVA 4MBPA 4PETA 5H8SA 5I57B 1MQDA 4LZ5A 1FTJA 2HXWA 4DXUA 3MPLA 2UYFA 3H06B 1FQFA 5DTBA 4OZ9A 3QAXA 3G7WA 1NNFA 2QS3A 1SI0A 5H8NB 2WKYA 5FHOA 2ONKE 3S9EA 3PPOA 3R26A 3M3LA 5LOMA 1MM6A 5ITOA 3M8UA 3IK6B 3QK6A 4QSDA 3TAJA 1R1NA 5EYFA 3QIMA 3TELA 3TCGA 2XXIA 3FZVA 1ZIUA 1NFTA 3C31A 2QJEA 1GTKA 2FA7A 3N6TA 4P0GA 3SDFA 4JDFA 1B0HA 3H3GA 4KYDA 4FJPA 4LQ5A 3VDFA 3QXMA 4LATA 4ELOA 3IOUA 1XS5A 3G3GA 3KN3A 1YTVA 4KYEA 3LC8A 1LFIA 5JTYB 1B7HA 1OQGA 4Q5TA 3PD9A 2RINA 1I6QA 5H8HA 1TFAA 4UACA 1GV8A 1NKXA 3RN8A 1FQEA 1WODA 4IO7A 2ZNUA 3IB2A 5TPAB 1N04A 2Z8DA 2X7QA 5I2NB 1LAGE 4GWOA 1LAXA 1D3KA 1MRPA 2F97A 1TT1A 3OXNA 1MQJA 4ZEKA 3U93A 4G4PA 3N94A 4LA9A 5DEXB 4DIGA 5I57A 4YKIA 4ZEFA 2I3WA 3KN8A 4FE8A 1EU8A 1JEVA 1R9LA 2VD2A 2DVCA 4FEDA 3PD8A 3SETA 3KG2A 1RYXA 4OTEA 5L8DA 1NNPA 2GH9A 3LSWA 4Q8RA 4F3GA 5CC2A 1H44A 1MH4A 2XXYA 1MDQA 5L9MA 3TTLA 2GFEA 5HM4B 2H98A 3U72A 1EZOA 1LLSA 4QHQA 1M5CA 4GFRA 3OOAA 1XOCA 3KN7A 4GIZA 5CRYA 4BDOA 5AA2D 1B5JA 5JTYA 3S9MC 1P1NA 3K6XA 1Q1KA 1IEJA 3N5LA 3I3VA 4FIMA 1M5FA 1FTOA 1OIBA 2O69A 2QMWA 2XXUA 1IITA 2V3QA 4RK9A 3RNNA 3QUJA 3V89B 3FV1A 3CFZA 1LCTA 1PB9A 3MAMA 4G8MA 5TU0A 3DM0A 2VOZA 4XKQA 2XXPA 2IEEA 3EQ1A 3TCFA 2HZLA 3MP8A 3TDJA 3LSFB 3OSRA 1CE2A 3Q25A 5ICQA 1LGBC 3IO4A 4KI0E 3TMGA 1JW1A 3GXAA 2I3VA 2QSXA 3IX1A 2H4IA 1QW0A 3MBPA 4OFLA 5TPAA 5H8FA 4BDMA 1B58A 4I9DA 3A09A 2YJPA 3T96B 1SW2A 2P2AA 3C32A 3G3KA 4R2BA 3UK4A 3O6IA 4F2OA 3H6VA 2QS2A 3T93B 3CFLA 3KJTA 3FXUA 3MPKA 4WEPA 1MS7A 3MP6A 4NF4A 1I6BA 1SW5A 3O2AA 2PT1A 3FXQA 1F9BA 3P7IA 4H65A 5DVIA 1FQDA 3CI8A 1PB7A 5I58B 1ZKBA 3OO7A 3S2VA 4OQOA 1ANFA 2DWHA 2V3TA 4Q0CA 4NWCA 2PBWA 5HBCA 4NWDA 3SEWA 3DP6A 2HQ0A 4IY6A 3SKPA 2NVUB 4GQOA 1LBBA 4JB7A 4RA1A 3G3FA 3O97A 5FTHA 1VSOA 2H25A 3GBAA 4AB5A 1SYHA 2KLFA 1ZJLA 4R9FA 1B4HA 1OVTA 1Z7NE 3TQLA 2E1SA 3IORA 3OEMA 2NUVA 1FTKA 1A54A 3RTWB 2ZXTA 2QMXA 4I62A 2HFBA 1B52A 3KOSA 4OERA 4U1OA 4IO2A 3H4ZA 3ILTB 1J1NA 1XVYA 1Y3PA 3VFJA 2I48A 2XHDA 1WVJA 4G8NA 2DXYA 4WKMA 1LFGA 3MVZA 2O6AA 1I69A 3OO8A 4UA8A 3ILUB 3FVOA 4G68C 1MY0A 1MH3A 1Y1MA 2UYEA 1FQAA 4XKPA 3USDA 2Z22A 1B1XA 3ONMA 4F1UA 3SESA 5CMKA 1B3HA 1MXXA 4RNSA 4ELQA 1USYH 4OYVA 1B51A 3DLNA 4K3FA 4TLLB 4LP2B 4AB6A 3QYTA 3VVDA 4OMBA 4NF5B 3FVGA 1MXZA 2Y7RA 5J1DA 1MXUA 5I58A 4LZ8A 3FV2A 3A3UA 2Y7KA 4M1VA 1FW0A 4F31B 1BLFA 5DYHA 1A8FA 2DWIA 5AE4A 2PX1A 5A5XA 5DT6A 4ELRA 3G3JA 4PFWA 3K0VA 2RF1A 2RKMA 4YB7A 1ZBMA 2I4BA 2H5YA 3CVGA 1N7XA 1DTZA 2Q9TA 3BFTA 5EHSA 1B2HA 1IXIA 2DYXA 1N84A 5EHMA 2G29A 3UORA 1P1OA 4JWYA 1IUDA 4HTGA 2W7YA 4OHNA 2Q88A 3VLUA 3H6WA 1B3FA 4ZE9A 1URGA 3VVFA 4NTLA 1MY1A 2PMSA 1GGGA 1MDP1 2RCBA 3R6UA 4X1DA 1S50A 3RY3A 4Z7EA 3IOWA 2NWJA 1RKMA 1URDA 3HO7A 2DXRA 1ELJA 1JVYA 2F6GA 2GHBA 4TLMB 2O84X 1YPNA 3MWBA 1B3LA 3E3KA 5I84A 2O1LA 2HCAA 3RGYA 5HPQA 1MY2A 4YB5A 4NF4B 4FORA 1P99A 3VE1B 3TEPA 3H7MA 1ZMGA 4RPNA 2DWJA 3B6QA 3FJ7A 3SEUA 3D4GA 3W9VA 1B32A 3KEIA 5F7VA 4HS7A 3B7DA 4MLQA 4G2ZA 5KDTA 1A55A 3N26A 3TCHA 5CMCA 3MW0A 2DSFA 4HCYA 4HCWA 5IKBA 4YAHX 1S7YA 4F2QA 5I56A 1NNTA 1P1WA 3R7XA 1URSA 2QS4A 2XXWA 3SEYA 3PPNA 2Q89A 4H0WA 3K1MA 5ISUA 1USYE 2OZZA 3K01A 1I6AA 1Z7ME 2F36A 3THIA 3UN6A 4H6DA 3ECRA 1B7UA 3CIJA 1O63A 2YLNA 3K4UA 3MC2A 3CG1A 3MZ9A 1LB9A 4FEBA 3U1OA 1NMUA 3RT6B 3MJNA 2A5TA 1XC1A 1A99A 1SVXB 1VE4A 4G68A 4G8HA 5DVJA 4JSOA 2D5WA 4NF6B 3BBRA 3C33A 3LBSA 3JV9A 2I0BA 3ODBA 4R6YA 1TWYA 2VGQA 3EHSA 3IOTA 4YU0A 2Q2CA 4BDRA 2PYYA 4RK2A 4F3PA 3IJOB 3JYRA 1D4NA 1ATGA 3KGCA 1B3EA 1BKAA 1SD3A 3HCQA 3C35A 2F78A 3FUZA 3MQ9A 4OENA 3A3CA 3PPRA 3I5OA 2I4CA 1QKAA 3MVWA 5FHMA 1D9VA 3V8XB 4F19A 1MY3A 1B9JA 4GXSB 4IGRA 4BDNA 3O29A 2BJJX 4C1TA 5AA4B 1SW1A 4M4GA 3O9PA 4JBZA 5B70A 1B05A 2XXRA 3ZS6A 4RJZA 2XX7A 2Y84A 5DEXA 4THIA 4AQ4A 4DXCA 3C4MA 1POY1 1L5TA 4OESA 1JEUA 1IXHA 1M5BA 4G68B 5M2VA 2QL3A 4FECA 1A7LA 3L6HA 3BKIB 3VV5A 1KWHA 4F1VA 4YMAA 1T0KA 3FVNA 3TTMA 4GXAA 3FATA 5CMBA 3QSLA 3W9WA 3U94A 4O3AA 4ZZEA 4XKNA 4XTCQ 1OLAA 3K6VA 1B6HA 1N3WA 3Q26A 4R9GA 4U21A 1PDAA 4YKJA 4LUBA 1HSJA 2V93A 1ZLQA 4PFUA 4F18A 4N13A 2I49A 4EF1A 1H45A 2GHAA 3CG3A 4POWA 3C9HA 5K2XA 1PC3A 2DVZA 2XD2A 3C36A 3HPIA 3KJ7A 4OEVA 1SYIA 2HAUA 4LONB 3OEKA 1Y4CA 4ZECA 4ZDMA 5KCJA 3PV0E 2F7AA 2YPNA 3IAZA 3PMWA 5F1QA 2DOJA 3T9UA 2CMOA 1BTJA 3ZKLA 5CM6A 4JWOA 1TFDA 2Y7WA 3Q28A 3TZAA 1QUJA 4YZZA 3DP8A 3E4RA 4IGTA 2XXHA 4IO3A 3LSXA 1Y3NA 3PU5A 1DPPA 4OEUA 3T9XB 1QJMA 1AMFA 1Y3QA 2ZMBA 3SEXA 5I56B 4N07A 4R72A 3TTRA 3FASA 2E0SA 2Z23A 4E0WA 3OD7A 4G77A 1A40A 1B1HA 1VR5A 3TKDA 1NH8A 1QULA 4U23A 2O7UA 1Y20A 4ZEDA 1US5A 2DWAA 2Q2AA 2VD3A 3MZBA 3KOTA 5AA2B 5L9SA 1JW4A 1NL5A 2Y7IA 4BDQA 2FYIA 4GRKA 1BIYA 2B3BA 1R9QA 4NE4A 2R6GE 3T9HB 1OQHA 3M3KA 1DSNA 1JVXA 4EUOA 4GD5A 1UTBB 2ZYNA 3HN0A 4U2RA 3GLBA 4BLAA 4F39A 2R9JA 4JXIA 4R6HA 2P0SA 5I2KA 2XD3A 1EZ9A 2OWSA 3VLVA 4QFOA 2FNCA 3PPQA 1GR2A 1CB6A 1D9YA 3PUVE 1ZTYA 2F7CA 3K1PA 4PFYA 4DCYA 3TQWA 1HSLA 3IB0A 2I6EA 2CZLA 3TFLA 4GVOA 3RUMA 5TP9B 4JWXA 4Z0IA 4GL0A 1NH7A 1P1UA 3N6UA 4P11A 4R75A 4H5FA 1EZPA 3EHUA 2D21A 1UTHB 1UIUA 4PQJA 4QFLA 5CI5A 1SI1A 2ESNA 5FHNA 1EH3A 2X26A 4PE5B 3U8QA 5AA2A 1UQWA 5CMMA 4U4SA 1N76A 3PMVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YMB A;  2ALU A;  3O28 A;  4Q30 B;  5KDT B;  3O66 A;  1N0T A;  3W15 C;  1OMP A;  4EQB A;  1UTB A;  3FD3 A;  3HHF A;  4DLD A;  3K6W A;  2ZYO A;  3U92 A;  5ELV A;  3H6T A;  3K1N A;  3LSL A;  1PBQ A;  4DE8 A;  4ZEB A;  3KZG A;  1HSE A;  5AA1 A;  3D4C A;  4TOZ A;  1B46 A;  3CSB A;  1AH5 A;  2ABH A;  3OO6 A;  1XHY A;  2XX8 A;  3PUW E;  4I1D A;  4N6P A;  4QFP A;  5H8H B;  4YKP A;  4ZEI A;  3UP9 A;  3ZSF A;  2M8C A;  2V25 A;  1DTG A;  1MXY A;  4GOT A;  1JET A;  3AXF A;  5JEI A;  5KCJ B;  2NOO A;  1PB8 A;  3Q27 A;  5K2Y A;  4H1X A;  2AL4 A;  3GZG A;  4P0I A;  3UIF A;  4C1U A;  1B3G A;  2UVG A;  4RPO A;  4H8J A;  2O7I A;  3HHG A;  3RLF E;  3MZ1 A;  4KCD A;  1MY4 A;  3IO6 A;  4YKK A;  1QUK A;  4XXU A;  4HW8 A;  1LBC A;  2ZYM A;  2XXT A;  4R74 A;  3TTN A;  1UTH A;  2ZNS A;  3OSQ A;  3Q29 A;  2AL5 A;  4QFK A;  1IZ1 A;  4PP0 A;  4WXJ A;  1MM7 A;  3RTF B;  4FAJ A;  3H03 A;  2F8D A;  2V3U A;  1MPD A;  4EXK A;  2UVJ A;  1FTM A;  1Y1Z A;  4GLI A;  1OLC A;  5L9O A;  1MXV A;  4ELP A;  3CRB A;  1LB8 A;  2ONR A;  3K6U A;  1H76 A;  1B5H A;  3PUZ E;  5KZT A;  1II5 A;  3HV1 A;  3KFM A;  5H8N A;  3TOD A;  4LQ2 A;  4YB6 A;  4YIC A;  2DE3 A;  3IOV A;  5I2K B;  4BDL A;  1IXG A;  3MVX A;  3RQT A;  1RYO A;  1S9T A;  1GVC A;  2XXV A;  3SER A;  1FCK A;  1MQH A;  2B65 A;  3C34 A;  4NMY A;  5B7D A;  2O1M A;  4O3B A;  2PT2 A;  2OJT A;  1H43 A;  2RCA A;  3IB1 A;  4F22 A;  1R6Z A;  4ECF A;  1POT A;  2D3I A;  4QRZ A;  1FTL A;  3TYH A;  5BWJ A;  1OVB A;  4WED A;  2V84 A;  3F11 A;  3GBB A;  5H8F B;  3RPW A;  3T22 A;  4U1Z A;  4MH5 A;  2UVI A;  4H67 A;  4EDP A;  4EQ7 A;  2Y7P A;  5AA3 A;  1Y4T A;  3G3H A;  3IR1 A;  4ZZA A;  5TP9 A;  4ISU A;  1AIV A;  5H8Q B;  4OET A;  1SW4 A;  3VXB A;  3QUF A;  4X9T A;  5BUU A;  1WDN A;  3E9X A;  2A5T B;  4H5G A;  2RC7 A;  2QS1 A;  1VFD A;  1LAF E;  3SEV A;  3V5A A;  3RT8 A;  3S9N C;  3MVY A;  2VP1 A;  4IB2 A;  2HZK A;  2ZYK A;  3G3I A;  4ESW A;  3OO9 A;  2B3F A;  2H9B A;  3ZKK A;  5FTI A;  3TTK A;  4DZ1 A;  4LZ7 A;  4GL8 A;  1LAH E;  3CSG A;  4XIG Q;  4XKR A;  1FQC A;  1A8E A;  4F1Y A;  3T9V A;  3B6W A;  4LVQ A;  1MQI A;  4KD5 A;  2REJ A;  3PUX E;  2A5S A;  4TQU Q;  4FAT A;  2O68 A;  2PVU A;  3EPE A;  4PFT A;  2H99 A;  2OWT A;  2AIX A;  1NNK A;  1YCJ A;  4OWD A;  3IJX B;  4POX A;  4C0R A;  4OXV A;  3EF7 A;  1O64 A;  2IA4 A;  2LAO A;  3FXR A;  3CFX A;  4NF8 A;  3M3F A;  4E0X A;  3DEL B;  3EHT A;  4X1B A;  2QRY A;  3FIR A;  2QPQ A;  5AA4 A;  1TXF A;  2HEU A;  2DE2 A;  2OBG A;  2XX9 A;  5DVF A;  1LST A;  1MPB A;  1B4Z A;  3IL1 B;  3O6H A;  5H8Q A;  1JNF A;  4DXB A;  2RC8 A;  4MLV A;  2XXX A;  5ICT A;  1Q35 A;  1FQB A;  4MFI A;  4OVJ A;  4R2F A;  2XXQ A;  2RC9 A;  4F3S A;  3MP1 A;  3UGW A;  1IQ7 A;  2UVH A;  2UXA A;  1VFE A;  1MPC A;  4EQ9 A;  1Y9U A;  4IO5 A;  4KR5 A;  1LCF A;  4U22 A;  4R73 A;  4KHZ E;  4ZE8 A;  2DP8 A;  3FVK A;  2F6P A;  1XVX A;  2DQV A;  1LFH A;  2F5X A;  3S9L C;  3TUS A;  4R6K A;  3LR1 A;  4KYS A;  4EXL A;  1SQY A;  2DS9 A;  1YAE A;  2F7B A;  3O6G A;  4H8I A;  2X7P A;  4I8C A;  2O51 A;  3MUQ A;  4ONY A;  3K2D A;  2I58 A;  2NXO A;  1ZU0 A;  3B6T A;  3VXC A;  4NF5 A;  1QVS A;  2ONS A;  3OEL A;  4NF8 B;  4O3C A;  5CBS A;  1P1Q A;  2VHA A;  5A5X B;  1M5D A;  1B5I A;  3OMB A;  4L17 A;  1PEB A;  3VVE A;  4IO6 A;  4NED A;  2OCU A;  3WAE A;  5I2N A;  4QSC A;  2ZNT A;  5IAI A;  1IXC A;  2OLB A;  4OFJ A;  3KSJ A;  3K00 A;  1MG1 A;  3BFU A;  4RXL A;  4RY1 A;  2Q8J A;  4QSE A;  4GF8 A;  3HST A;  3DP4 A;  5CBR A;  1H3D A;  3E13 X;  1DOT A;  4ND9 A;  1AOV A;  3I6V A;  3LUY A;  1SDX A;  3L6G A;  4RYA A;  4U4X A;  1BP5 A;  4EF2 A;  3CR9 A;  3FJM A;  3K02 A;  4JSD A;  1QKB A;  1MQG A;  1PBP A;  3VLW A;  3KBR A;  1B40 A;  1UIV A;  4MF3 A;  4ESX A;  3H6U A;  2R71 A;  4IO4 A;  1N7W A;  5I59 B;  1JW5 A;  4F3B A;  1B7Z A;  3FGS A;  4OFO A;  4F29 A;  5I59 A;  2OK2 A;  2F35 A;  3WAF A;  1DMB A;  3TPA A;  3UA8 A;  2ANJ A;  4ZS9 A;  1M5E A;  1N3X A;  1QUI A;  2GRV A;  2Z8E A;  3FJG A;  4KPT A;  3T66 A;  4DDD A;  1MXW A;  3PGF A;  2P1S A;  1IIW A;  1US4 A;  4NF6 A;  4X48 A;  3S4U A;  1O7T A;  1SBP A;  1XT8 A;  4IY5 A;  4KQP A;  2REG A;  4KCC A;  1JQF A;  4QF9 A;  4DCX A;  3JZJ A;  3PMX A;  2THI A;  3PUY E;  2AYS A;  5ITP A;  3OEN A;  3EN3 A;  4KFQ A;  4QFN A;  3V83 A;  2Z8F A;  1B0L A;  2I0C A;  3PPP A;  3KSX A;  5JK4 A;  1AL3 A;  1DPE A;  2DE4 A;  2G93 A;  2F34 A;  2HAV A;  4MBP A;  4PET A;  5H8S A;  5I57 B;  1MQD A;  4LZ5 A;  1FTJ A;  2HXW A;  4DXU A;  3MPL A;  2UYF A;  3H06 B;  1FQF A;  5DTB A;  4OZ9 A;  3QAX A;  3G7W A;  1NNF A;  2QS3 A;  1SI0 A;  5H8N B;  2WKY A;  5FHO A;  2ONK E;  3S9E A;  3PPO A;  3R26 A;  3M3L A;  5LOM A;  1MM6 A;  5ITO A;  3M8U A;  3IK6 B;  3QK6 A;  4QSD A;  3TAJ A;  1R1N A;  5EYF A;  3QIM A;  3TEL A;  3TCG A;  2XXI A;  3FZV A;  1ZIU A;  1NFT A;  3C31 A;  2QJE A;  1GTK A;  2FA7 A;  3N6T A;  4P0G A;  3SDF A;  4JDF A;  1B0H A;  3H3G A;  4KYD A;  4FJP A;  4LQ5 A;  3VDF A;  3QXM A;  4LAT A;  4ELO A;  3IOU A;  1XS5 A;  3G3G A;  3KN3 A;  1YTV A;  4KYE A;  3LC8 A;  1LFI A;  5JTY B;  1B7H A;  1OQG A;  4Q5T A;  3PD9 A;  2RIN A;  1I6Q A;  5H8H A;  1TFA A;  4UAC A;  1GV8 A;  1NKX A;  3RN8 A;  1FQE A;  1WOD A;  4IO7 A;  2ZNU A;  3IB2 A;  5TPA B;  1N04 A;  2Z8D A;  2X7Q A;  5I2N B;  1LAG E;  4GWO A;  1LAX A;  1D3K A;  1MRP A;  2F97 A;  1TT1 A;  3OXN A;  1MQJ A;  4ZEK A;  3U93 A;  4G4P A;  3N94 A;  4LA9 A;  5DEX B;  4DIG A;  5I57 A;  4YKI A;  4ZEF A;  2I3W A;  3KN8 A;  4FE8 A;  1EU8 A;  1JEV A;  1R9L A;  2VD2 A;  2DVC A;  4FED A;  3PD8 A;  3SET A;  3KG2 A;  1RYX A;  4OTE A;  5L8D A;  1NNP A;  2GH9 A;  3LSW A;  4Q8R A;  4F3G A;  5CC2 A;  1H44 A;  1MH4 A;  2XXY A;  1MDQ A;  5L9M A;  3TTL A;  2GFE A;  5HM4 B;  2H98 A;  3U72 A;  1EZO A;  1LLS A;  4QHQ A;  1M5C A;  4GFR A;  3OOA A;  1XOC A;  3KN7 A;  4GIZ A;  5CRY A;  4BDO A;  5AA2 D;  1B5J A;  5JTY A;  3S9M C;  1P1N A;  3K6X A;  1Q1K A;  1IEJ A;  3N5L A;  3I3V A;  4FIM A;  1M5F A;  1FTO A;  1OIB A;  2O69 A;  2QMW A;  2XXU A;  1IIT A;  2V3Q A;  4RK9 A;  3RNN A;  3QUJ A;  3V89 B;  3FV1 A;  3CFZ A;  1LCT A;  1PB9 A;  3MAM A;  4G8M A;  5TU0 A;  3DM0 A;  2VOZ A;  4XKQ A;  2XXP A;  2IEE A;  3EQ1 A;  3TCF A;  2HZL A;  3MP8 A;  3TDJ A;  3LSF B;  3OSR A;  1CE2 A;  3Q25 A;  5ICQ A;  1LGB C;  3IO4 A;  4KI0 E;  3TMG A;  1JW1 A;  3GXA A;  2I3V A;  2QSX A;  3IX1 A;  2H4I A;  1QW0 A;  3MBP A;  4OFL A;  5TPA A;  5H8F A;  4BDM A;  1B58 A;  4I9D A;  3A09 A;  2YJP A;  3T96 B;  1SW2 A;  2P2A A;  3C32 A;  3G3K A;  4R2B A;  3UK4 A;  3O6I A;  4F2O A;  3H6V A;  2QS2 A;  3T93 B;  3CFL A;  3KJT A;  3FXU A;  3MPK A;  4WEP A;  1MS7 A;  3MP6 A;  4NF4 A;  1I6B A;  1SW5 A;  3O2A A;  2PT1 A;  3FXQ A;  1F9B A;  3P7I A;  4H65 A;  5DVI A;  1FQD A;  3CI8 A;  1PB7 A;  5I58 B;  1ZKB A;  3OO7 A;  3S2V A;  4OQO A;  1ANF A;  2DWH A;  2V3T A;  4Q0C A;  4NWC A;  2PBW A;  5HBC A;  4NWD A;  3SEW A;  3DP6 A;  2HQ0 A;  4IY6 A;  3SKP A;  2NVU B;  4GQO A;  1LBB A;  4JB7 A;  4RA1 A;  3G3F A;  3O97 A;  5FTH A;  1VSO A;  2H25 A;  3GBA A;  4AB5 A;  1SYH A;  2KLF A;  1ZJL A;  4R9F A;  1B4H A;  1OVT A;  1Z7N E;  3TQL A;  2E1S A;  3IOR A;  3OEM A;  2NUV A;  1FTK A;  1A54 A;  3RTW B;  2ZXT A;  2QMX A;  4I62 A;  2HFB A;  1B52 A;  3KOS A;  4OER A;  4U1O A;  4IO2 A;  3H4Z A;  3ILT B;  1J1N A;  1XVY A;  1Y3P A;  3VFJ A;  2I48 A;  2XHD A;  1WVJ A;  4G8N A;  2DXY A;  4WKM A;  1LFG A;  3MVZ A;  2O6A A;  1I69 A;  3OO8 A;  4UA8 A;  3ILU B;  3FVO A;  4G68 C;  1MY0 A;  1MH3 A;  1Y1M A;  2UYE A;  1FQA A;  4XKP A;  3USD A;  2Z22 A;  1B1X A;  3ONM A;  4F1U A;  3SES A;  5CMK A;  1B3H A;  1MXX A;  4RNS A;  4ELQ A;  1USY H;  4OYV A;  1B51 A;  3DLN A;  4K3F A;  4TLL B;  4LP2 B;  4AB6 A;  3QYT A;  3VVD A;  4OMB A;  4NF5 B;  3FVG A;  1MXZ A;  2Y7R A;  5J1D A;  1MXU A;  5I58 A;  4LZ8 A;  3FV2 A;  3A3U A;  2Y7K A;  4M1V A;  1FW0 A;  4F31 B;  1BLF A;  5DYH A;  1A8F A;  2DWI A;  5AE4 A;  2PX1 A;  5A5X A;  5DT6 A;  4ELR A;  3G3J A;  4PFW A;  3K0V A;  2RF1 A;  2RKM A;  4YB7 A;  1ZBM A;  2I4B A;  2H5Y A;  3CVG A;  1N7X A;  1DTZ A;  2Q9T A;  3BFT A;  5EHS A;  1B2H A;  1IXI A;  2DYX A;  1N84 A;  5EHM A;  2G29 A;  3UOR A;  1P1O A;  4JWY A;  1IUD A;  4HTG A;  2W7Y A;  4OHN A;  2Q88 A;  3VLU A;  3H6W A;  1B3F A;  4ZE9 A;  1URG A;  3VVF A;  4NTL A;  1MY1 A;  2PMS A;  1GGG A;  1MDP 1;  2RCB A;  3R6U A;  4X1D A;  1S50 A;  3RY3 A;  4Z7E A;  3IOW A;  2NWJ A;  1RKM A;  1URD A;  3HO7 A;  2DXR A;  1ELJ A;  1JVY A;  2F6G A;  2GHB A;  4TLM B;  2O84 X;  1YPN A;  3MWB A;  1B3L A;  3E3K A;  5I84 A;  2O1L A;  2HCA A;  3RGY A;  5HPQ A;  1MY2 A;  4YB5 A;  4NF4 B;  4FOR A;  1P99 A;  3VE1 B;  3TEP A;  3H7M A;  1ZMG A;  4RPN A;  2DWJ A;  3B6Q A;  3FJ7 A;  3SEU A;  3D4G A;  3W9V A;  1B32 A;  3KEI A;  5F7V A;  4HS7 A;  3B7D A;  4MLQ A;  4G2Z A;  5KDT A;  1A55 A;  3N26 A;  3TCH A;  5CMC A;  3MW0 A;  2DSF A;  4HCY A;  4HCW A;  5IKB A;  4YAH X;  1S7Y A;  4F2Q A;  5I56 A;  1NNT A;  1P1W A;  3R7X A;  1URS A;  2QS4 A;  2XXW A;  3SEY A;  3PPN A;  2Q89 A;  4H0W A;  3K1M A;  5ISU A;  1USY E;  2OZZ A;  3K01 A;  1I6A A;  1Z7M E;  2F36 A;  3THI A;  3UN6 A;  4H6D A;  3ECR A;  1B7U A;  3CIJ A;  1O63 A;  2YLN A;  3K4U A;  3MC2 A;  3CG1 A;  3MZ9 A;  1LB9 A;  4FEB A;  3U1O A;  1NMU A;  3RT6 B;  3MJN A;  2A5T A;  1XC1 A;  1A99 A;  1SVX B;  1VE4 A;  4G68 A;  4G8H A;  5DVJ A;  4JSO A;  2D5W A;  4NF6 B;  3BBR A;  3C33 A;  3LBS A;  3JV9 A;  2I0B A;  3ODB A;  4R6Y A;  1TWY A;  2VGQ A;  3EHS A;  3IOT A;  4YU0 A;  2Q2C A;  4BDR A;  2PYY A;  4RK2 A;  4F3P A;  3IJO B;  3JYR A;  1D4N A;  1ATG A;  3KGC A;  1B3E A;  1BKA A;  1SD3 A;  3HCQ A;  3C35 A;  2F78 A;  3FUZ A;  3MQ9 A;  4OEN A;  3A3C A;  3PPR A;  3I5O A;  2I4C A;  1QKA A;  3MVW A;  5FHM A;  1D9V A;  3V8X B;  4F19 A;  1MY3 A;  1B9J A;  4GXS B;  4IGR A;  4BDN A;  3O29 A;  2BJJ X;  4C1T A;  5AA4 B;  1SW1 A;  4M4G A;  3O9P A;  4JBZ A;  5B70 A;  1B05 A;  2XXR A;  3ZS6 A;  4RJZ A;  2XX7 A;  2Y84 A;  5DEX A;  4THI A;  4AQ4 A;  4DXC A;  3C4M A;  1POY 1;  1L5T A;  4OES A;  1JEU A;  1IXH A;  1M5B A;  4G68 B;  5M2V A;  2QL3 A;  4FEC A;  1A7L A;  3L6H A;  3BKI B;  3VV5 A;  1KWH A;  4F1V A;  4YMA A;  1T0K A;  3FVN A;  3TTM A;  4GXA A;  3FAT A;  5CMB A;  3QSL A;  3W9W A;  3U94 A;  4O3A A;  4ZZE A;  4XKN A;  4XTC Q;  1OLA A;  3K6V A;  1B6H A;  1N3W A;  3Q26 A;  4R9G A;  4U21 A;  1PDA A;  4YKJ A;  4LUB A;  1HSJ A;  2V93 A;  1ZLQ A;  4PFU A;  4F18 A;  4N13 A;  2I49 A;  4EF1 A;  1H45 A;  2GHA A;  3CG3 A;  4POW A;  3C9H A;  5K2X A;  1PC3 A;  2DVZ A;  2XD2 A;  3C36 A;  3HPI A;  3KJ7 A;  4OEV A;  1SYI A;  2HAU A;  4LON B;  3OEK A;  1Y4C A;  4ZEC A;  4ZDM A;  5KCJ A;  3PV0 E;  2F7A A;  2YPN A;  3IAZ A;  3PMW A;  5F1Q A;  2DOJ A;  3T9U A;  2CMO A;  1BTJ A;  3ZKL A;  5CM6 A;  4JWO A;  1TFD A;  2Y7W A;  3Q28 A;  3TZA A;  1QUJ A;  4YZZ A;  3DP8 A;  3E4R A;  4IGT A;  2XXH A;  4IO3 A;  3LSX A;  1Y3N A;  3PU5 A;  1DPP A;  4OEU A;  3T9X B;  1QJM A;  1AMF A;  1Y3Q A;  2ZMB A;  3SEX A;  5I56 B;  4N07 A;  4R72 A;  3TTR A;  3FAS A;  2E0S A;  2Z23 A;  4E0W A;  3OD7 A;  4G77 A;  1A40 A;  1B1H A;  1VR5 A;  3TKD A;  1NH8 A;  1QUL A;  4U23 A;  2O7U A;  1Y20 A;  4ZED A;  1US5 A;  2DWA A;  2Q2A A;  2VD3 A;  3MZB A;  3KOT A;  5AA2 B;  5L9S A;  1JW4 A;  1NL5 A;  2Y7I A;  4BDQ A;  2FYI A;  4GRK A;  1BIY A;  2B3B A;  1R9Q A;  4NE4 A;  2R6G E;  3T9H B;  1OQH A;  3M3K A;  1DSN A;  1JVX A;  4EUO A;  4GD5 A;  1UTB B;  2ZYN A;  3HN0 A;  4U2R A;  3GLB A;  4BLA A;  4F39 A;  2R9J A;  4JXI A;  4R6H A;  2P0S A;  5I2K A;  2XD3 A;  1EZ9 A;  2OWS A;  3VLV A;  4QFO A;  2FNC A;  3PPQ A;  1GR2 A;  1CB6 A;  1D9Y A;  3PUV E;  1ZTY A;  2F7C A;  3K1P A;  4PFY A;  4DCY A;  3TQW A;  1HSL A;  3IB0 A;  2I6E A;  2CZL A;  3TFL A;  4GVO A;  3RUM A;  5TP9 B;  4JWX A;  4Z0I A;  4GL0 A;  1NH7 A;  1P1U A;  3N6U A;  4P11 A;  4R75 A;  4H5F A;  1EZP A;  3EHU A;  2D21 A;  1UTH B;  1UIU A;  4PQJ A;  4QFL A;  5CI5 A;  1SI1 A;  2ESN A;  5FHN A;  1EH3 A;  2X26 A;  4PE5 B;  3U8Q A;  5AA2 A;  1UQW A;  5CMM A;  4U4S A;  1N76 A;  3PMV A; 
#chains in the Genus database with same CATH topology
 4Q30 B;  1N0T A;  1OMP A;  3KZG A;  3D4C A;  1IME A;  1DBZ A;  3OO6 A;  4I1D A;  2XX8 A;  4QFP A;  3ZSF A;  5H8H B;  3UP9 A;  4PAF A;  4C1U A;  4H8J A;  1MY4 A;  1Q9D A;  4YKK A;  4XXU A;  2MKZ A;  1IMF A;  1UTH A;  2ZNS A;  3TUS A;  3Q29 A;  4PP0 A;  1MM7 A;  4FAJ A;  1Y1Z A;  4GLI A;  4ELP A;  3CRB A;  1K9Z A;  3K6U A;  5KZT A;  1II5 A;  3BIH A;  3HV1 A;  4LQ2 A;  4YIC A;  2DE3 A;  5I2K B;  3RQT A;  2B65 A;  4O3B A;  2OJT A;  2GQ1 A;  1H43 A;  3IB1 A;  1R6Z A;  5BWJ A;  4I40 A;  4QRZ A;  1FTL A;  2XWO A;  1QGX A;  3RPW A;  4N91 A;  4NG7 A;  1EYI A;  2RC7 A;  4N8Y A;  2HZK A;  4ESW A;  2B3F A;  4LZ7 A;  4GL8 A;  1A8E A;  2O68 A;  1IMC A;  3EPE A;  3NOH A;  4PFT A;  2OWT A;  4OWD A;  4C0R A;  1O64 A;  3FIR A;  4MX6 A;  2OBG A;  1LST A;  1MPB A;  4HE1 A;  5ICT A;  1Q35 A;  4EQ9 A;  1MPC A;  4XF5 A;  4KR5 A;  1LCF A;  2DP8 A;  3S9L C;  2F5X A;  1FBC A;  4EXL A;  2O51 A;  3MUQ A;  2I58 A;  1ZU0 A;  1QVS A;  4NF8 B;  5A5X B;  3OMB A;  1B5I A;  3WAE A;  1PEB A;  5IZ1 A;  4NED A;  1AWB A;  4QSC A;  4PE3 A;  4OFJ A;  4RXL A;  4RY1 A;  2JJK A;  3HST A;  3DP4 A;  1H3D A;  1DOT A;  3I6V A;  3L6G A;  4U4X A;  3CR9 A;  1PBP A;  3KBR A;  1UIV A;  3H6U A;  4IO4 A;  5I59 B;  1JW5 A;  3FGS A;  4OFO A;  2F35 A;  1M5E A;  4OVR A;  4KPT A;  1K9Y A;  4P8B A;  4PBQ A;  3E78 A;  2THI A;  3PUY E;  5ITP A;  3OEN A;  3V83 A;  2Z8F A;  1DPE A;  5H8S A;  4PET A;  3IFC A;  2HXW A;  3QAX A;  1EYK A;  3R26 A;  3M8U A;  4QSD A;  3TAJ A;  3TCG A;  3N6T A;  1ZIU A;  1NFT A;  3C31 A;  2QJE A;  4P0G A;  4LAT A;  4PC9 A;  3G3G A;  3LC8 A;  1LFI A;  2Q8M A;  3PD9 A;  2RIN A;  1I6Q A;  1TFA A;  1GV8 A;  2OX3 A;  3RN8 A;  1WOD A;  5TPA B;  2X7Q A;  3OXN A;  4G4P A;  4ZEF A;  1R9L A;  2DVC A;  3SET A;  2GH9 A;  4F3G A;  4PDD A;  3CHG A;  5CRY A;  5JTY A;  1P1N A;  3K6X A;  1IEJ A;  3N5L A;  3I3V A;  3RNN A;  4RK9 A;  3QUJ A;  1NV3 A;  3FV1 A;  1PB9 A;  3MAM A;  4G8M A;  3DM0 A;  4O8M A;  3EQ1 A;  3TCF A;  2HZL A;  1LGB C;  4KI0 E;  4GX6 A;  4PF6 A;  2I3V A;  2QSX A;  5H8F A;  1QW0 A;  4OFL A;  4I9D A;  4PGN A;  3G3K A;  3UK4 A;  2B4L A;  3T93 B;  3CFL A;  1RDZ A;  4NWD A;  1NV2 A;  4H45 A;  3SKP A;  4RA1 A;  5FTH A;  3G3F A;  3O97 A;  1VSO A;  3GBA A;  1SYH A;  2KLF A;  3B8B A;  4R9F A;  1Z7N E;  3TQL A;  1FTK A;  1A54 A;  4IO2 A;  1J1N A;  1XVY A;  1WVJ A;  3MVZ A;  2O6A A;  3OO8 A;  1LBW A;  4G68 C;  2FIX A;  1MH3 A;  1FPE A;  2CZK A;  4AB6 A;  3QYT A;  1MXZ A;  2Y7R A;  2PFZ A;  4GWY A;  3A3U A;  2Y7K A;  4F31 B;  5A5X A;  4ELR A;  4PFW A;  3K0V A;  2VPO A;  1ZBM A;  2I4B A;  5EHS A;  1IXI A;  3UOR A;  1IUD A;  4HTG A;  2W7Y A;  4OHN A;  3VLU A;  1B3F A;  1URG A;  2PMS A;  1GGG A;  1MDP 1;  3R6U A;  4TLM B;  3RGY A;  3VE1 B;  1ZMG A;  1B32 A;  5F7V A;  4HS7 A;  3B7D A;  1A55 A;  4GX3 A;  2DSF A;  3HFU A;  4HCW A;  4YAH X;  1P1W A;  3R7X A;  2QS4 A;  5ISU A;  2OZZ A;  3ECR A;  1B7U A;  1O63 A;  3K4U A;  3MZ9 A;  1LB9 A;  1NMU A;  3RT6 B;  1SVX B;  1NV4 A;  3C33 A;  3LBS A;  2I0B A;  2VGQ A;  4YU0 A;  2Q2C A;  4BDR A;  4F3P A;  3IJO B;  3FUZ A;  1IMD A;  3MVW A;  1QKA A;  3V8X B;  1B9J A;  4BDN A;  3U65 A;  1B05 A;  2XXR A;  5IM2 A;  4P3L A;  4DXC A;  1JEU A;  4G68 B;  4N4U A;  4FEC A;  2HXR A;  3VV5 A;  4F1V A;  1T0K A;  3W9W A;  3FAT A;  3QSL A;  3U94 A;  4U21 A;  3Q26 A;  1PDA A;  4NQ8 A;  2I49 A;  4EF1 A;  2GHA A;  3CG3 A;  4POW A;  2QVV A;  1PC3 A;  2XD2 A;  3HPI A;  4ZEC A;  3PV0 E;  2F7A A;  2YPN A;  2CMO A;  2Y7W A;  3TZA A;  3E4R A;  2XXH A;  3PU5 A;  1DPP A;  2ZMB A;  5I56 B;  4N07 A;  3TTR A;  2Z23 A;  4GWS A;  1LEV A;  3TKD A;  2Q2A A;  3KOT A;  4PAK A;  2Y7I A;  1R9Q A;  2B3B A;  1OQH A;  3M3K A;  1JVX A;  3HN0 A;  1EZ9 A;  4QFO A;  3PPQ A;  2HHM A;  4PFY A;  2XA5 A;  1P1U A;  4H5F A;  3EHU A;  1SI1 A;  1NI9 A;  2ALU A;  3W15 C;  3FD3 A;  3HHF A;  3U92 A;  4DE8 A;  5AA1 A;  4TOZ A;  1AH5 A;  3PUW E;  1XHY A;  4YKP A;  1FPK A;  2M8C A;  4GOT A;  3AXF A;  1PB8 A;  4P1E A;  4H1X A;  2AL4 A;  3GZG A;  4OVQ A;  3UIF A;  2UVG A;  4RPO A;  3MZ1 A;  1QUK A;  4HW8 A;  4PF8 A;  1LBC A;  3OSQ A;  4QFK A;  2AL5 A;  1IZ1 A;  3H03 A;  2F8D A;  2V3U A;  1MPD A;  3PUZ E;  3TOD A;  4BDL A;  1GVC A;  3SER A;  3C34 A;  4NMY A;  4F22 A;  4ECF A;  3TYH A;  4IR8 A;  1OVB A;  4EDP A;  3SZP A;  1YXI A;  3IR1 A;  3G3H A;  1AIV A;  5H8Q B;  3VXB A;  4H5G A;  3V5A A;  3RT8 A;  2VP1 A;  3G3I A;  2H9B A;  1LAH E;  4XKR A;  1FQC A;  3B6W A;  4KD5 A;  2REJ A;  2A5S A;  3D1R A;  2PVU A;  1CNQ A;  4POX A;  4OXV A;  3EF7 A;  2LAO A;  3FXR A;  3CFX A;  4NF8 A;  3M3F A;  4E0X A;  3EHT A;  4G61 A;  2XX9 A;  5DVF A;  3IL1 B;  5H8Q A;  4MLV A;  1NV6 A;  4MFI A;  4OVJ A;  2XXQ A;  3MP1 A;  3UGW A;  1IQ7 A;  2UVH A;  2UXA A;  1VFE A;  4ZE8 A;  1LFH A;  4R6K A;  4X04 A;  4KYS A;  4OAN A;  1SQY A;  2DS9 A;  2X7P A;  5A5L A;  2NXO A;  3B6T A;  3VXC A;  2ONS A;  3OEL A;  4O3C A;  2VHA A;  5H8N B;  2FBP A;  2ZNT A;  5IAI A;  3KSJ A;  3K00 A;  1MG1 A;  4ND9 A;  3LUY A;  1SDX A;  3RPL A;  1BP5 A;  5EYG A;  1MQG A;  3QMF A;  4MF3 A;  2R71 A;  1N7W A;  1NUW A;  4UAB A;  3WAF A;  4ZS9 A;  2Z8E A;  3PGF A;  1IIW A;  4X48 A;  4NF6 A;  1SBP A;  1KZ8 A;  1NV1 A;  2REG A;  4KCC A;  2L5V A;  3EN3 A;  2I0C A;  2XWI A;  2DE4 A;  1MQD A;  2OWZ A;  4LZ5 A;  3MPL A;  2UYF A;  4OZ9 A;  1NNF A;  2QS3 A;  2WKY A;  1RDX A;  2WEF A;  3PPO A;  4GWX A;  3S9E A;  4NHB A;  3IK6 B;  3QK6 A;  3VLW A;  5EYF A;  1FPJ A;  4NGU A;  3VDF A;  3IOU A;  4KYE A;  1B7H A;  4PCD A;  4UAC A;  5LTC A;  1LAX A;  2F97 A;  3U93 A;  3N94 A;  4LA9 A;  5I57 A;  2I3W A;  1EU8 A;  1JEV A;  3KG2 A;  1RYX A;  3LSW A;  2XXY A;  1MDQ A;  3TTL A;  3FXB A;  5ET7 A;  1EZO A;  1M5C A;  1D9Q A;  4GFR A;  1XOC A;  4GIZ A;  1B5J A;  4FIM A;  1OIB A;  2XXU A;  2V3Q A;  3V89 B;  3CFZ A;  3BIG A;  3LSF B;  3OSR A;  5ICQ A;  3GXA A;  3IX1 A;  5TPA A;  4GWU A;  4BDM A;  1SW2 A;  2PFY A;  3C32 A;  4R2B A;  1G0I A;  2XXK A;  4PBH A;  3KJT A;  3FXU A;  3MPK A;  4NF4 A;  3O2A A;  2PT1 A;  4H65 A;  5DVI A;  1FQD A;  3CI8 A;  3S2V A;  3SEW A;  3DP6 A;  4GQO A;  4JVI A;  1ZJL A;  1OVT A;  3RTW B;  2ZXT A;  2QMX A;  2HFB A;  4OER A;  3ILT B;  2XWK A;  3T0J A;  1FQA A;  3ONM A;  3DLN A;  3VVD A;  5I58 A;  4LZ8 A;  4M1V A;  2P3V A;  1DTZ A;  2XWV A;  1FRP A;  3H6W A;  3VVF A;  1MY1 A;  2NWJ A;  1RKM A;  1ELJ A;  3MWB A;  2O1L A;  2HCA A;  5HPQ A;  1MY2 A;  3TEP A;  3H7M A;  4RPN A;  1FJ6 A;  3SEU A;  3FJ7 A;  3ROJ A;  3EKI A;  5CMC A;  4HCY A;  4F2Q A;  3T1B A;  4MHF A;  4PFI A;  5F24 A;  4XFE A;  4H0W A;  3K1M A;  3UN6 A;  1Z7M E;  4H6D A;  3CIJ A;  2YLN A;  2FVZ A;  3U1O A;  2A5T A;  1XC1 A;  4JSO A;  4NF6 B;  3JV9 A;  1FPF A;  4MCO A;  1TWY A;  3ZKL A;  1ATG A;  1B3E A;  3MQ9 A;  4OEN A;  5ET6 A;  2F78 A;  3A3C A;  2I4C A;  3O29 A;  4C1T A;  1SW1 A;  5B70 A;  4GWZ A;  2Y84 A;  5DEX A;  3C4M A;  4GBV A;  3L6H A;  2F3B A;  3BKI B;  4YMA A;  4GXA A;  4OVS A;  3LV0 A;  2V4C A;  1B6H A;  4DXU A;  4R9G A;  4DI4 B;  4N15 A;  1RDY A;  4NX1 A;  5K2X A;  2HAU A;  3OEK A;  1Y4C A;  5F1Q A;  3IAZ A;  1YZ0 A;  5CM6 A;  3Q28 A;  4YZZ A;  3DP8 A;  4NAP A;  4OEU A;  4R72 A;  4G77 A;  1FPG A;  4U23 A;  1Y20 A;  4LN5 A;  1YYZ A;  2DWA A;  2VD3 A;  5EQ9 A;  1NL5 A;  2FYI A;  2R6G E;  4HE0 A;  4EUO A;  2XD3 A;  2OWS A;  2CZH A;  2FNC A;  5ESY A;  3PUV E;  1ZTY A;  3K1P A;  3IFA A;  5ET5 A;  1HSL A;  3IB0 A;  2CZL A;  5TP9 B;  4GL0 A;  3N6U A;  2QFL A;  4F18 A;  4QFL A;  4PE5 B;  5AA2 A;  5CMM A;  4U4S A;  3PMV A;  4DLD A;  2ZYO A;  3LSL A;  1PBQ A;  2R8T A;  1FBE A;  1JP4 A;  4ZEB A;  1HSE A;  4ZEI A;  5I5P A;  2V25 A;  1DTG A;  1MXY A;  5JEI A;  1JET A;  5KCJ B;  2NOO A;  3Q27 A;  4P0I A;  5EQ8 A;  1B3G A;  2O7I A;  3HHG A;  2ZYM A;  2UVJ A;  1LB8 A;  1H76 A;  1B5H A;  5H8N A;  3KFM A;  3MVX A;  1RYO A;  2D3I A;  2CZI A;  3F11 A;  2VPN A;  2Y5L A;  3T22 A;  4U1Z A;  4MH5 A;  2UVI A;  5AA3 A;  1Y4T A;  5TP9 A;  1NUZ A;  4ISU A;  4X9T A;  1WDN A;  5J16 A;  2QS1 A;  3SEV A;  3OO9 A;  1FSA A;  3CSG A;  4F1Y A;  3T9V A;  5I7I A;  3PUX E;  4FAT A;  2H99 A;  2AIX A;  4P56 A;  2IA4 A;  1TXF A;  2HEU A;  3MST A;  4PAI A;  3O6H A;  1B4Z A;  3E79 A;  4PGP A;  1JNF A;  2XXX A;  1FQB A;  4R2F A;  2RC9 A;  1LBV A;  3KC1 A;  2F6P A;  1XVX A;  3LR1 A;  4I8C A;  1YAE A;  2F7B A;  4H8I A;  3K2D A;  5CBS A;  1M5D A;  4L17 A;  1IXC A;  2OLB A;  3BFU A;  2Q8J A;  1AOV A;  5CBR A;  3E13 X;  4JVD A;  4HXV A;  4EF2 A;  4JSD A;  4ESX A;  2KQZ A;  5I59 A;  3TPA A;  2ANJ A;  1QUI A;  3FJG A;  2GRV A;  3T66 A;  4DDD A;  3S4U A;  1O7T A;  1XT8 A;  5LDZ A;  4IY5 A;  4KQP A;  1JQF A;  3JZJ A;  3PMX A;  2AYS A;  2Q74 A;  4KFQ A;  4QFN A;  1B0L A;  3KSX A;  2HAV A;  2G93 A;  3RPL B;  2DDK A;  2VT5 A;  1FQF A;  4I3Y A;  1NUY A;  1SI0 A;  5FHO A;  2ONK E;  3M3L A;  5LOM A;  1FBD A;  3TEL A;  1R1N A;  3QIM A;  3SDF A;  2FA7 A;  1B0H A;  1XS5 A;  3KN3 A;  1YTV A;  5JTY B;  2WBB A;  1NKX A;  1FQE A;  4IO7 A;  2ZNU A;  3IB2 A;  1MRP A;  1TT1 A;  4MNC A;  4FE8 A;  2VD2 A;  4FED A;  4OTE A;  5CC2 A;  1MH4 A;  2FHY A;  5L9M A;  1EYJ A;  2H98 A;  1LLS A;  4QHQ A;  5AA2 D;  2O69 A;  4KXP A;  1LCT A;  2PCR A;  4XKQ A;  2VOZ A;  2XXP A;  2IEE A;  2BJI A;  3MP8 A;  3TDJ A;  1CE2 A;  3IO4 A;  3TMG A;  3MBP A;  4HE2 A;  2P2A A;  4XEQ A;  1FPD A;  4F2O A;  2WBD A;  2QS2 A;  3H6V A;  3MP6 A;  3S9M C;  1I6B A;  5KDT A;  3FXQ A;  4N81 A;  4OVP A;  1PB7 A;  1ZKB A;  4OQO A;  1ANF A;  2V3T A;  4NWC A;  2HQ0 A;  2NVU B;  1LBB A;  4JB7 A;  2H25 A;  2WX9 A;  1B4H A;  4I3E A;  2E1S A;  3IOR A;  4F3B A;  2NUV A;  4I62 A;  1B52 A;  4U1O A;  4O94 A;  1KA0 A;  4UA8 A;  3USD A;  1Y1M A;  2UYE A;  4XKP A;  2Z22 A;  4DI3 D;  1B3H A;  4ELQ A;  4RNS A;  1USY H;  1B51 A;  4K3F A;  4LP2 B;  3FVG A;  2FIE A;  5J1D A;  1FPB A;  1MXU A;  1FW0 A;  1A8F A;  5DT6 A;  2RKM A;  5DW8 A;  3CVG A;  1N7X A;  1B2H A;  1N84 A;  5EHM A;  2G29 A;  4JWY A;  2Q88 A;  4ZE9 A;  2RCB A;  4X1D A;  1S50 A;  4MNI A;  2QVU A;  2DXR A;  2ZZW A;  1JVY A;  2F6G A;  1IMA A;  2O84 X;  2KR0 A;  4YB5 A;  4FOR A;  2DWJ A;  5I3S A;  3W9V A;  3KEI A;  4G2Z A;  3MW0 A;  5IKB A;  1S7Y A;  5I56 A;  3PPN A;  2Q89 A;  1NV5 A;  1USY E;  3K01 A;  3THI A;  1I6A A;  3MC2 A;  4FEB A;  3MJN A;  4P9K A;  1A99 A;  4G8H A;  2D5W A;  4MNP A;  5K2Y A;  1BKA A;  3I5O A;  1D9V A;  4F19 A;  4GXS B;  4IGR A;  2BJJ X;  4O7M A;  4N6D A;  2XX7 A;  3PTY A;  4AQ4 A;  1L5T A;  1POY 1;  4OVT A;  1G0H A;  1IXH A;  1M5B A;  2QL3 A;  1A7L A;  2HPG A;  1KWH A;  3FVN A;  3TTM A;  1LBX A;  4O3A A;  4XKN A;  4XTC Q;  3K6V A;  3ISP A;  4GBW A;  1ZLQ A;  4N13 A;  4QXD A;  1H45 A;  3C9H A;  2DVZ A;  3KJ7 A;  4LON B;  5KCJ A;  3PMW A;  4N6K A;  1FBP A;  4JWO A;  1QUJ A;  3LSX A;  1Y3N A;  3T9X B;  1QJM A;  1AMF A;  3SEX A;  3FAS A;  2E0S A;  1B1H A;  4N17 A;  1QUL A;  1US5 A;  4FBP A;  5AA2 B;  4PTK A;  1JW4 A;  4GRK A;  1BIY A;  3T9H B;  3FBP A;  1DSN A;  4BLA A;  1UTB B;  2ZYN A;  4U2R A;  3GLB A;  4N8G A;  4F39 A;  2R9J A;  4JXI A;  4R6H A;  4MEV A;  1GR2 A;  1CB6 A;  1D9Y A;  4Z0I A;  5FBP A;  1LBY A;  4O7I A;  1FJ9 A;  2X26 A;  1UQW A;  4YMB A;  3O28 A;  5KDT B;  3O66 A;  4JVC A;  4EQB A;  1UTB A;  3K6W A;  5ELV A;  3H6T A;  3K1N A;  1B46 A;  3CSB A;  2ABH A;  4N6P A;  4MIJ A;  4AS5 A;  3RLF E;  4KCD A;  3IO6 A;  2XXT A;  4R74 A;  3TTN A;  4WXJ A;  3RTF B;  4GX4 A;  4EXK A;  1FTM A;  1OLC A;  5EQ7 A;  5L9O A;  1MXV A;  2ONR A;  2QVR A;  4NN3 A;  4YB6 A;  3IOV A;  4P47 A;  1IXG A;  1SPI A;  1S9T A;  2XXV A;  1FCK A;  1MQH A;  5B7D A;  2O1M A;  2PT2 A;  2RCA A;  1POT A;  4WED A;  2V84 A;  5H8F B;  3GBB A;  4H67 A;  4EQ7 A;  5T3J A;  2Y7P A;  5IZ3 B;  4ZZA A;  4OET A;  1SW4 A;  2ZZX A;  3QUF A;  5BUU A;  3E9X A;  2A5T B;  1DK4 A;  1VFD A;  1LAF E;  3MVY A;  4IB2 A;  1XI6 A;  2ZYK A;  3ZKK A;  5FTI A;  3TTK A;  4XIG Q;  4LVQ A;  1MQI A;  4TQU Q;  2WYK A;  4P1L A;  1NNK A;  1YCJ A;  3IJX B;  4PDH A;  3DEL B;  5AA4 A;  4X1B A;  2QRY A;  2QPQ A;  2DE2 A;  3RYD A;  4DXB A;  2RC8 A;  4F3S A;  1Y9U A;  4IO5 A;  4U22 A;  4R73 A;  4KHZ E;  3FVK A;  2DQV A;  3O6G A;  4ONY A;  4NF5 A;  1P1Q A;  3VVE A;  4IO6 A;  2OCU A;  5I2N A;  4QSE A;  4GF8 A;  1INP A;  4RYA A;  3FJM A;  3K02 A;  1QKB A;  1B40 A;  1VDW A;  1FPL A;  1B7Z A;  3KBZ A;  4F29 A;  2OK2 A;  1DMB A;  4OA4 A;  3UA8 A;  1N3X A;  1MXW A;  2P1S A;  1US4 A;  4QF9 A;  4DCX A;  1DCU A;  3A29 A;  3PPP A;  5JK4 A;  1AL3 A;  2F34 A;  4MBP A;  5I57 B;  1FTJ A;  3H06 B;  5DTB A;  3G7W A;  1FPI A;  1FBG A;  1FBF A;  1MM6 A;  5ITO A;  5IZZ A;  2XXI A;  3FZV A;  1GTK A;  4JDF A;  4KYD A;  3H3G A;  4FJP A;  4LQ5 A;  3QXM A;  4ELO A;  5EYH A;  1OQG A;  4Q5T A;  5H8H A;  1N04 A;  2Z8D A;  5I2N B;  1LAG E;  4GWO A;  4ZEK A;  1D3K A;  1MQJ A;  4DIG A;  5DEX B;  4YKI A;  3KN8 A;  2ZZV A;  3PD8 A;  5L8D A;  1NNP A;  4Q8R A;  1H44 A;  2GFE A;  5HM4 B;  3U72 A;  3OOA A;  3KN7 A;  4BDO A;  1Q1K A;  1KA1 A;  1M5F A;  1FTO A;  2QMW A;  1IIT A;  5TU0 A;  3Q25 A;  1JW1 A;  3RUM A;  2H4I A;  4MMP A;  1B58 A;  3A09 A;  2YJP A;  3B50 A;  3T96 B;  1IMB A;  2CEX A;  3O6I A;  2F3D A;  4WEP A;  1MS7 A;  1SW5 A;  3P7I A;  1BK4 A;  1F9B A;  2CEY A;  5I58 B;  3OO7 A;  1NUX A;  2DWH A;  5HBC A;  4Q0C A;  2PBW A;  4IY6 A;  2Y5K A;  4AB5 A;  4DZ1 A;  4GWW A;  3OEM A;  3KOS A;  3H4Z A;  1Y3P A;  3VFJ A;  2I48 A;  2XHD A;  4PFB A;  4G8N A;  2DXY A;  4WKM A;  1LFG A;  1I69 A;  3ILU B;  3FVO A;  1MY0 A;  2P3N A;  1B1X A;  4F1U A;  3SES A;  5CMK A;  1MXX A;  4OYV A;  4TLL B;  4OMB A;  4NF5 B;  3LUZ A;  3FV2 A;  1BLF A;  5DYH A;  2DWI A;  5AE4 A;  2PX1 A;  3G3J A;  2RF1 A;  4YB7 A;  2H5Y A;  2Q9T A;  3BFT A;  2DYX A;  1P1O A;  4NTL A;  3RY3 A;  4Z7E A;  3IOW A;  3HO7 A;  1URD A;  2GHB A;  1YPN A;  1B3L A;  3E3K A;  5I84 A;  3MYU A;  4NF4 B;  1P99 A;  4H46 A;  3B6Q A;  3D4G A;  4MLQ A;  3N26 A;  3TCH A;  1NNT A;  1URS A;  2XXW A;  3SEY A;  2F36 A;  3CG1 A;  1VE4 A;  4G68 A;  5DVJ A;  4R6Y A;  3BBR A;  3ODB A;  3S9N C;  3EHS A;  3IOT A;  2PYY A;  4RK2 A;  4GD5 A;  3JYR A;  1D4N A;  3KGC A;  1SD3 A;  3HCQ A;  3C35 A;  3PPR A;  5FHM A;  1MY3 A;  3GYY A;  5EQA A;  5AA4 B;  4M4G A;  3O9P A;  4JBZ A;  3ZS6 A;  4RJZ A;  5IZ3 A;  1LBZ A;  4THI A;  4OES A;  3KC0 A;  4AS4 A;  5M2V A;  1FBH A;  4NF0 A;  5CMB A;  4ZZE A;  1OLA A;  1N3W A;  4YKJ A;  4PFU A;  1NV0 A;  1HSJ A;  2V93 A;  4LUB A;  5ET8 A;  3C36 A;  4OEV A;  1SYI A;  4ZDM A;  4PFR A;  2DOJ A;  2WYP A;  3T9U A;  1BTJ A;  4QBA A;  1TFD A;  4IGT A;  4IO3 A;  4MJO A;  1Y3Q A;  1NV7 A;  4E0W A;  3OD7 A;  1A40 A;  1VR5 A;  1NH8 A;  4ZED A;  2O7U A;  3MZB A;  5L9S A;  4BDQ A;  4NE4 A;  5IGA A;  5I2K A;  2P0S A;  3VLV A;  2F7C A;  1FTA A;  3TQW A;  4DCY A;  2I6E A;  3TFL A;  4GVO A;  4JWX A;  2B4M A;  4P11 A;  1NH7 A;  4R75 A;  1EZP A;  2D21 A;  5CI5 A;  1UTH B;  1UIU A;  4PQJ A;  5FHN A;  2ESN A;  1EH3 A;  4X8R A;  3U8Q A;  4MAG A;  1N76 A; 
#chains in the Genus database with same CATH homology
 4YMB A;  2ALU A;  3O28 A;  4Q30 B;  5KDT B;  3O66 A;  1N0T A;  3W15 C;  1OMP A;  4EQB A;  1UTB A;  3FD3 A;  3HHF A;  4DLD A;  3K6W A;  2ZYO A;  3U92 A;  5ELV A;  3H6T A;  3K1N A;  3LSL A;  1PBQ A;  4DE8 A;  4ZEB A;  3KZG A;  1HSE A;  5AA1 A;  3D4C A;  4TOZ A;  1B46 A;  3CSB A;  1AH5 A;  2ABH A;  3OO6 A;  1XHY A;  2XX8 A;  3PUW E;  4I1D A;  4N6P A;  4QFP A;  5H8H B;  4YKP A;  4ZEI A;  3UP9 A;  3ZSF A;  2M8C A;  2V25 A;  1DTG A;  1MXY A;  4GOT A;  1JET A;  3AXF A;  5JEI A;  5KCJ B;  2NOO A;  1PB8 A;  3Q27 A;  5K2Y A;  4H1X A;  2AL4 A;  3GZG A;  4P0I A;  3UIF A;  4C1U A;  1B3G A;  2UVG A;  4RPO A;  4H8J A;  2O7I A;  3HHG A;  3RLF E;  3MZ1 A;  4KCD A;  1MY4 A;  3IO6 A;  4YKK A;  1QUK A;  4XXU A;  4HW8 A;  1LBC A;  2ZYM A;  2XXT A;  4R74 A;  3TTN A;  1UTH A;  2ZNS A;  3OSQ A;  3Q29 A;  2AL5 A;  4QFK A;  1IZ1 A;  4PP0 A;  4WXJ A;  1MM7 A;  3RTF B;  4FAJ A;  3H03 A;  2F8D A;  2V3U A;  1MPD A;  4EXK A;  2UVJ A;  1FTM A;  1Y1Z A;  4GLI A;  1OLC A;  5L9O A;  1MXV A;  4ELP A;  3CRB A;  1LB8 A;  2ONR A;  3K6U A;  1H76 A;  1B5H A;  3PUZ E;  5KZT A;  1II5 A;  3HV1 A;  3KFM A;  5H8N A;  3TOD A;  4LQ2 A;  4YB6 A;  4YIC A;  2DE3 A;  3IOV A;  5I2K B;  4BDL A;  1IXG A;  3MVX A;  3RQT A;  1RYO A;  1S9T A;  1GVC A;  2XXV A;  3SER A;  1FCK A;  1MQH A;  2B65 A;  3C34 A;  4NMY A;  5B7D A;  2O1M A;  4O3B A;  2PT2 A;  2OJT A;  1H43 A;  2RCA A;  3IB1 A;  4F22 A;  1R6Z A;  4ECF A;  1POT A;  2D3I A;  4QRZ A;  1FTL A;  3TYH A;  5BWJ A;  1OVB A;  4WED A;  2V84 A;  3F11 A;  3GBB A;  5H8F B;  3RPW A;  3T22 A;  4U1Z A;  4MH5 A;  2UVI A;  4H67 A;  4EDP A;  4EQ7 A;  2Y7P A;  5AA3 A;  1Y4T A;  3G3H A;  3IR1 A;  4ZZA A;  5TP9 A;  4ISU A;  1AIV A;  5H8Q B;  4OET A;  1SW4 A;  3VXB A;  3QUF A;  4X9T A;  5BUU A;  1WDN A;  3E9X A;  2A5T B;  4H5G A;  2RC7 A;  2QS1 A;  1VFD A;  1LAF E;  3SEV A;  3V5A A;  3RT8 A;  3S9N C;  3MVY A;  2VP1 A;  4IB2 A;  2HZK A;  2ZYK A;  3G3I A;  4ESW A;  3OO9 A;  2B3F A;  2H9B A;  3ZKK A;  5FTI A;  3TTK A;  4DZ1 A;  4LZ7 A;  4GL8 A;  1LAH E;  3CSG A;  4XIG Q;  4XKR A;  1FQC A;  1A8E A;  4F1Y A;  3T9V A;  3B6W A;  4LVQ A;  1MQI A;  4KD5 A;  2REJ A;  3PUX E;  2A5S A;  4TQU Q;  4FAT A;  2O68 A;  2PVU A;  3EPE A;  4PFT A;  2H99 A;  2OWT A;  2AIX A;  1NNK A;  1YCJ A;  4OWD A;  3IJX B;  4POX A;  4C0R A;  4OXV A;  3EF7 A;  1O64 A;  2IA4 A;  2LAO A;  3FXR A;  3CFX A;  4NF8 A;  3M3F A;  4E0X A;  3DEL B;  3EHT A;  4X1B A;  2QRY A;  3FIR A;  2QPQ A;  5AA4 A;  1TXF A;  2HEU A;  2DE2 A;  2OBG A;  2XX9 A;  5DVF A;  1LST A;  1MPB A;  1B4Z A;  3IL1 B;  3O6H A;  5H8Q A;  1JNF A;  4DXB A;  2RC8 A;  4MLV A;  2XXX A;  5ICT A;  1Q35 A;  1FQB A;  4MFI A;  4OVJ A;  4R2F A;  2XXQ A;  2RC9 A;  4F3S A;  3MP1 A;  3UGW A;  1IQ7 A;  2UVH A;  2UXA A;  1VFE A;  1MPC A;  4EQ9 A;  1Y9U A;  4IO5 A;  4KR5 A;  1LCF A;  4U22 A;  4R73 A;  4KHZ E;  4ZE8 A;  2DP8 A;  3FVK A;  2F6P A;  1XVX A;  2DQV A;  1LFH A;  2F5X A;  3S9L C;  3TUS A;  4R6K A;  3LR1 A;  4KYS A;  4EXL A;  1SQY A;  2DS9 A;  1YAE A;  2F7B A;  3O6G A;  4H8I A;  2X7P A;  4I8C A;  2O51 A;  3MUQ A;  4ONY A;  3K2D A;  2I58 A;  2NXO A;  1ZU0 A;  3B6T A;  3VXC A;  4NF5 A;  1QVS A;  2ONS A;  3OEL A;  4NF8 B;  4O3C A;  5CBS A;  1P1Q A;  2VHA A;  5A5X B;  1M5D A;  1B5I A;  3OMB A;  4L17 A;  1PEB A;  3VVE A;  4IO6 A;  4NED A;  2OCU A;  3WAE A;  5I2N A;  4QSC A;  2ZNT A;  5IAI A;  1IXC A;  2OLB A;  4OFJ A;  3KSJ A;  3K00 A;  1MG1 A;  3BFU A;  4RXL A;  4RY1 A;  2Q8J A;  4QSE A;  4GF8 A;  3HST A;  3DP4 A;  5CBR A;  1H3D A;  3E13 X;  1DOT A;  4ND9 A;  1AOV A;  3I6V A;  3LUY A;  1SDX A;  3L6G A;  4RYA A;  4U4X A;  1BP5 A;  4EF2 A;  3CR9 A;  3FJM A;  3K02 A;  4JSD A;  1QKB A;  1MQG A;  1PBP A;  3VLW A;  3KBR A;  1B40 A;  1UIV A;  4MF3 A;  4ESX A;  3H6U A;  2R71 A;  4IO4 A;  1N7W A;  5I59 B;  1JW5 A;  4F3B A;  1B7Z A;  3FGS A;  4OFO A;  4F29 A;  5I59 A;  2OK2 A;  2F35 A;  3WAF A;  1DMB A;  3TPA A;  3UA8 A;  2ANJ A;  4ZS9 A;  1M5E A;  1N3X A;  1QUI A;  2GRV A;  2Z8E A;  3FJG A;  4KPT A;  3T66 A;  4DDD A;  1MXW A;  3PGF A;  2P1S A;  1IIW A;  1US4 A;  4NF6 A;  4X48 A;  3S4U A;  1O7T A;  1SBP A;  1XT8 A;  4IY5 A;  4KQP A;  2REG A;  4KCC A;  1JQF A;  4QF9 A;  4DCX A;  3JZJ A;  3PMX A;  2THI A;  3PUY E;  2AYS A;  5ITP A;  3OEN A;  3EN3 A;  4KFQ A;  4QFN A;  3V83 A;  2Z8F A;  1B0L A;  2I0C A;  3PPP A;  3KSX A;  5JK4 A;  1AL3 A;  1DPE A;  2DE4 A;  2G93 A;  2F34 A;  2HAV A;  4MBP A;  4PET A;  5H8S A;  5I57 B;  1MQD A;  4LZ5 A;  1FTJ A;  2HXW A;  4DXU A;  3MPL A;  2UYF A;  3H06 B;  1FQF A;  5DTB A;  4OZ9 A;  3QAX A;  3G7W A;  1NNF A;  2QS3 A;  1SI0 A;  5H8N B;  2WKY A;  5FHO A;  2ONK E;  3S9E A;  3PPO A;  3R26 A;  3M3L A;  5LOM A;  1MM6 A;  5ITO A;  3M8U A;  3IK6 B;  3QK6 A;  4QSD A;  3TAJ A;  1R1N A;  5EYF A;  3QIM A;  3TEL A;  3TCG A;  2XXI A;  3FZV A;  1ZIU A;  1NFT A;  3C31 A;  2QJE A;  1GTK A;  2FA7 A;  3N6T A;  4P0G A;  3SDF A;  4JDF A;  1B0H A;  3H3G A;  4KYD A;  4FJP A;  4LQ5 A;  3VDF A;  3QXM A;  4LAT A;  4ELO A;  3IOU A;  1XS5 A;  3G3G A;  3KN3 A;  1YTV A;  4KYE A;  3LC8 A;  1LFI A;  5JTY B;  1B7H A;  1OQG A;  4Q5T A;  3PD9 A;  2RIN A;  1I6Q A;  5H8H A;  1TFA A;  4UAC A;  1GV8 A;  1NKX A;  3RN8 A;  1FQE A;  1WOD A;  4IO7 A;  2ZNU A;  3IB2 A;  5TPA B;  1N04 A;  2Z8D A;  2X7Q A;  5I2N B;  1LAG E;  4GWO A;  1LAX A;  1D3K A;  1MRP A;  2F97 A;  1TT1 A;  3OXN A;  1MQJ A;  4ZEK A;  3U93 A;  4G4P A;  3N94 A;  4LA9 A;  5DEX B;  4DIG A;  5I57 A;  4YKI A;  4ZEF A;  2I3W A;  3KN8 A;  4FE8 A;  1EU8 A;  1JEV A;  1R9L A;  2VD2 A;  2DVC A;  4FED A;  3PD8 A;  3SET A;  3KG2 A;  1RYX A;  4OTE A;  5L8D A;  1NNP A;  2GH9 A;  3LSW A;  4Q8R A;  4F3G A;  5CC2 A;  1H44 A;  1MH4 A;  2XXY A;  1MDQ A;  5L9M A;  3TTL A;  2GFE A;  5HM4 B;  2H98 A;  3U72 A;  1EZO A;  1LLS A;  4QHQ A;  1M5C A;  4GFR A;  3OOA A;  1XOC A;  3KN7 A;  4GIZ A;  5CRY A;  4BDO A;  5AA2 D;  1B5J A;  5JTY A;  3S9M C;  1P1N A;  3K6X A;  1Q1K A;  1IEJ A;  3N5L A;  3I3V A;  4FIM A;  1M5F A;  1FTO A;  1OIB A;  2O69 A;  2QMW A;  2XXU A;  1IIT A;  2V3Q A;  4RK9 A;  3RNN A;  3QUJ A;  3V89 B;  3FV1 A;  3CFZ A;  1LCT A;  1PB9 A;  3MAM A;  4G8M A;  5TU0 A;  3DM0 A;  2VOZ A;  4XKQ A;  2XXP A;  2IEE A;  3EQ1 A;  3TCF A;  2HZL A;  3MP8 A;  3TDJ A;  3LSF B;  3OSR A;  1CE2 A;  3Q25 A;  5ICQ A;  1LGB C;  3IO4 A;  4KI0 E;  3TMG A;  1JW1 A;  3GXA A;  2I3V A;  2QSX A;  3IX1 A;  2H4I A;  1QW0 A;  3MBP A;  4OFL A;  5TPA A;  5H8F A;  4BDM A;  1B58 A;  4I9D A;  3A09 A;  2YJP A;  3T96 B;  1SW2 A;  2P2A A;  3C32 A;  3G3K A;  4R2B A;  3UK4 A;  3O6I A;  4F2O A;  3H6V A;  2QS2 A;  3T93 B;  3CFL A;  3KJT A;  3FXU A;  3MPK A;  4WEP A;  1MS7 A;  3MP6 A;  4NF4 A;  1I6B A;  1SW5 A;  3O2A A;  2PT1 A;  3FXQ A;  1F9B A;  3P7I A;  4H65 A;  5DVI A;  1FQD A;  3CI8 A;  1PB7 A;  5I58 B;  1ZKB A;  3OO7 A;  3S2V A;  4OQO A;  1ANF A;  2DWH A;  2V3T A;  4Q0C A;  4NWC A;  2PBW A;  5HBC A;  4NWD A;  3SEW A;  3DP6 A;  2HQ0 A;  4IY6 A;  3SKP A;  2NVU B;  4GQO A;  1LBB A;  4JB7 A;  4RA1 A;  3G3F A;  3O97 A;  5FTH A;  1VSO A;  2H25 A;  3GBA A;  4AB5 A;  1SYH A;  2KLF A;  1ZJL A;  4R9F A;  1B4H A;  1OVT A;  1Z7N E;  3TQL A;  2E1S A;  3IOR A;  3OEM A;  2NUV A;  1FTK A;  1A54 A;  3RTW B;  2ZXT A;  2QMX A;  4I62 A;  2HFB A;  1B52 A;  3KOS A;  4OER A;  4U1O A;  4IO2 A;  3H4Z A;  3ILT B;  1J1N A;  1XVY A;  1Y3P A;  3VFJ A;  2I48 A;  2XHD A;  1WVJ A;  4G8N A;  2DXY A;  4WKM A;  1LFG A;  3MVZ A;  2O6A A;  1I69 A;  3OO8 A;  4UA8 A;  3ILU B;  3FVO A;  4G68 C;  1MY0 A;  1MH3 A;  1Y1M A;  2UYE A;  1FQA A;  4XKP A;  3USD A;  2Z22 A;  1B1X A;  3ONM A;  4F1U A;  3SES A;  5CMK A;  1B3H A;  1MXX A;  4RNS A;  4ELQ A;  1USY H;  4OYV A;  1B51 A;  3DLN A;  4K3F A;  4TLL B;  4LP2 B;  4AB6 A;  3QYT A;  3VVD A;  4OMB A;  4NF5 B;  3FVG A;  1MXZ A;  2Y7R A;  5J1D A;  1MXU A;  5I58 A;  4LZ8 A;  3FV2 A;  3A3U A;  2Y7K A;  4M1V A;  1FW0 A;  4F31 B;  1BLF A;  5DYH A;  1A8F A;  2DWI A;  5AE4 A;  2PX1 A;  5A5X A;  5DT6 A;  4ELR A;  3G3J A;  4PFW A;  3K0V A;  2RF1 A;  2RKM A;  4YB7 A;  1ZBM A;  2I4B A;  2H5Y A;  3CVG A;  1N7X A;  1DTZ A;  2Q9T A;  3BFT A;  5EHS A;  1B2H A;  1IXI A;  2DYX A;  1N84 A;  5EHM A;  2G29 A;  3UOR A;  1P1O A;  4JWY A;  1IUD A;  4HTG A;  2W7Y A;  4OHN A;  2Q88 A;  3VLU A;  3H6W A;  1B3F A;  4ZE9 A;  1URG A;  3VVF A;  4NTL A;  1MY1 A;  2PMS A;  1GGG A;  1MDP 1;  2RCB A;  3R6U A;  4X1D A;  1S50 A;  3RY3 A;  4Z7E A;  3IOW A;  2NWJ A;  1RKM A;  1URD A;  3HO7 A;  2DXR A;  1ELJ A;  1JVY A;  2F6G A;  2GHB A;  4TLM B;  2O84 X;  1YPN A;  3MWB A;  1B3L A;  3E3K A;  5I84 A;  2O1L A;  2HCA A;  3RGY A;  5HPQ A;  1MY2 A;  4YB5 A;  4NF4 B;  4FOR A;  1P99 A;  3VE1 B;  3TEP A;  3H7M A;  1ZMG A;  4RPN A;  2DWJ A;  3B6Q A;  3FJ7 A;  3SEU A;  3D4G A;  3W9V A;  1B32 A;  3KEI A;  5F7V A;  4HS7 A;  3B7D A;  4MLQ A;  4G2Z A;  5KDT A;  1A55 A;  3N26 A;  3TCH A;  5CMC A;  3MW0 A;  2DSF A;  4HCY A;  4HCW A;  5IKB A;  4YAH X;  1S7Y A;  4F2Q A;  5I56 A;  1NNT A;  1P1W A;  3R7X A;  1URS A;  2QS4 A;  2XXW A;  3SEY A;  3PPN A;  2Q89 A;  4H0W A;  3K1M A;  5ISU A;  1USY E;  2OZZ A;  3K01 A;  1I6A A;  1Z7M E;  2F36 A;  3THI A;  3UN6 A;  4H6D A;  3ECR A;  1B7U A;  3CIJ A;  1O63 A;  2YLN A;  3K4U A;  3MC2 A;  3CG1 A;  3MZ9 A;  1LB9 A;  4FEB A;  3U1O A;  1NMU A;  3RT6 B;  3MJN A;  2A5T A;  1XC1 A;  1A99 A;  1SVX B;  1VE4 A;  4G68 A;  4G8H A;  5DVJ A;  4JSO A;  2D5W A;  4NF6 B;  3BBR A;  3C33 A;  3LBS A;  3JV9 A;  2I0B A;  3ODB A;  4R6Y A;  1TWY A;  2VGQ A;  3EHS A;  3IOT A;  4YU0 A;  2Q2C A;  4BDR A;  2PYY A;  4RK2 A;  4F3P A;  3IJO B;  3JYR A;  1D4N A;  1ATG A;  3KGC A;  1B3E A;  1BKA A;  1SD3 A;  3HCQ A;  3C35 A;  2F78 A;  3FUZ A;  3MQ9 A;  4OEN A;  3A3C A;  3PPR A;  3I5O A;  2I4C A;  1QKA A;  3MVW A;  5FHM A;  1D9V A;  3V8X B;  4F19 A;  1MY3 A;  1B9J A;  4GXS B;  4IGR A;  4BDN A;  3O29 A;  2BJJ X;  4C1T A;  5AA4 B;  1SW1 A;  4M4G A;  3O9P A;  4JBZ A;  5B70 A;  1B05 A;  2XXR A;  3ZS6 A;  4RJZ A;  2XX7 A;  2Y84 A;  5DEX A;  4THI A;  4AQ4 A;  4DXC A;  3C4M A;  1POY 1;  1L5T A;  4OES A;  1JEU A;  1IXH A;  1M5B A;  4G68 B;  5M2V A;  2QL3 A;  4FEC A;  1A7L A;  3L6H A;  3BKI B;  3VV5 A;  1KWH A;  4F1V A;  4YMA A;  1T0K A;  3FVN A;  3TTM A;  4GXA A;  3FAT A;  5CMB A;  3QSL A;  3W9W A;  3U94 A;  4O3A A;  4ZZE A;  4XKN A;  4XTC Q;  1OLA A;  3K6V A;  1B6H A;  1N3W A;  3Q26 A;  4R9G A;  4U21 A;  1PDA A;  4YKJ A;  4LUB A;  1HSJ A;  2V93 A;  1ZLQ A;  4PFU A;  4F18 A;  4N13 A;  2I49 A;  4EF1 A;  1H45 A;  2GHA A;  3CG3 A;  4POW A;  3C9H A;  5K2X A;  1PC3 A;  2DVZ A;  2XD2 A;  3C36 A;  3HPI A;  3KJ7 A;  4OEV A;  1SYI A;  2HAU A;  4LON B;  3OEK A;  1Y4C A;  4ZEC A;  4ZDM A;  5KCJ A;  3PV0 E;  2F7A A;  2YPN A;  3IAZ A;  3PMW A;  5F1Q A;  2DOJ A;  3T9U A;  2CMO A;  1BTJ A;  3ZKL A;  5CM6 A;  4JWO A;  1TFD A;  2Y7W A;  3Q28 A;  3TZA A;  1QUJ A;  4YZZ A;  3DP8 A;  3E4R A;  4IGT A;  2XXH A;  4IO3 A;  3LSX A;  1Y3N A;  3PU5 A;  1DPP A;  4OEU A;  3T9X B;  1QJM A;  1AMF A;  1Y3Q A;  2ZMB A;  3SEX A;  5I56 B;  4N07 A;  4R72 A;  3TTR A;  3FAS A;  2E0S A;  2Z23 A;  4E0W A;  3OD7 A;  4G77 A;  1A40 A;  1B1H A;  1VR5 A;  3TKD A;  1NH8 A;  1QUL A;  4U23 A;  2O7U A;  1Y20 A;  4ZED A;  1US5 A;  2DWA A;  2Q2A A;  2VD3 A;  3MZB A;  3KOT A;  5AA2 B;  5L9S A;  1JW4 A;  1NL5 A;  2Y7I A;  4BDQ A;  2FYI A;  4GRK A;  1BIY A;  2B3B A;  1R9Q A;  4NE4 A;  2R6G E;  3T9H B;  1OQH A;  3M3K A;  1DSN A;  1JVX A;  4EUO A;  4GD5 A;  1UTB B;  2ZYN A;  3HN0 A;  4U2R A;  3GLB A;  4BLA A;  4F39 A;  2R9J A;  4JXI A;  4R6H A;  2P0S A;  5I2K A;  2XD3 A;  1EZ9 A;  2OWS A;  3VLV A;  4QFO A;  2FNC A;  3PPQ A;  1GR2 A;  1CB6 A;  1D9Y A;  3PUV E;  1ZTY A;  2F7C A;  3K1P A;  4PFY A;  4DCY A;  3TQW A;  1HSL A;  3IB0 A;  2I6E A;  2CZL A;  3TFL A;  4GVO A;  3RUM A;  5TP9 B;  4JWX A;  4Z0I A;  4GL0 A;  1NH7 A;  1P1U A;  3N6U A;  4P11 A;  4R75 A;  4H5F A;  1EZP A;  3EHU A;  2D21 A;  1UTH B;  1UIU A;  4PQJ A;  4QFL A;  5CI5 A;  1SI1 A;  2ESN A;  5FHN A;  1EH3 A;  2X26 A;  4PE5 B;  3U8Q A;  5AA2 A;  1UQW A;  5CMM A;  4U4S A;  1N76 A;  3PMV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...