3WAFA

X-ray structure of apo-ttfbpa, a ferric ion-binding protein from thermus thermophilus hb8
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
309
structure length
309
Chain Sequence
PTLTIYSGRGQSLVEPLVKQFEAETGIRVQVRYSTDAQILAALQEEGSRSPADLFWANTAGALGQASAKGLLRPLGETLLEKPIAFVPASRTWVPVTVRLRVLAYNPDRIKAEELPESLLDLPRFAREKGLVGRVGWTPTYSSFQDMVAGMIALYGEEKTREWLLAMKALAPKAYPSNPAMLDAIRAGEVDLGSTNHYYVVRFRRAGYRLGMHHFRDGDAGNLALVTGAGLLKTSKNLAAATRFLTYLLSPQAQQYFVGNIGEYPLVKGVALDPNLLPLEEALAKSPKLDLEKLPLDRALRLLRETGVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Iron ABC transporter, periplasmic iron-binding protein
publication title A novel mode of ferric ion coordination by the periplasmic ferric ion-binding subunit FbpA of an ABC-type iron transporter from Thermus thermophilus HB8.
pubmed doi rcsb
source organism Thermus thermophilus
total genus 107
structure length 309
sequence length 309
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13416 SBP_bac_8 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3wafA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3wafA02
5L9SA 3CIJA 4F31B 3DP6A 3HN0A 1EZOA 3A09A 1B1XA 3OEMA 4GOTA 2RC9A 2O84X 3FD3A 1DPPA 2AYSA 2E0SA 3KEIA 3OEKA 5I57B 3PPQA 3MVZA 4U2RA 4P0GA 1YAEA 5LOMA 1MXWA 4G77A 1NKXA 4TLMB 2OWSA 4NEDA 4OEUA 4G68B 4X1BA 1BTJA 1NFTA 2QS3A 1P1NA 2P2AA 1B9JA 1QKBA 4LQ5A 2O69A 3KFMA 3KSXA 4LONB 3K01A 4F3PA 5I2KB 4BDLA 4R73A 5TP9A 3PUZE 1Y1MA 4H5GA 2Y7RA 1FW0A 3G3JA 1LSTA 4N6PA 4KR5A 1AIVA 4NTLA 2Z23A 3S9EA 2F6PA 3SDFA 1LAFE 4H1XA 3TCGA 4F1YA 1ANFA 5JEIA 5FTHA 3LSXA 2H9BA 1JW5A 2QJEA 1NNTA 1SI1A 1FTLA 2OCUA 2QS4A 4ONYA 3TKDA 4DLDA 3PMVA 4X9TA 3TDJA 1NNPA 1OQHA 2R71A 3ZS6A 3FVGA 1MDQA 2V93A 4QFOA 1VFEA 1EH3A 4YKKA 3K4UA 1MH3A 3I3VA 2FYIA 1PBPA 2DWJA 3ZKKA 3MC2A 1SW2A 1B5JA 4G8MA 1A99A 3IJOB 1WODA 2DE4A 5TU0A 2ONSA 4FE8A 5CBRA 2HZLA 4LA9A 3DLNA 3H6VA 3U8QA 3IOTA 4FORA 3VXBA 2V3TA 5L8DA 3K6VA 4U1ZA 4Z7EA 3C36A 5I59B 4YB6A 3HO7A 2HAUA 2AIXA 4JXIA 3CVGA 4ZS9A 4QRZA 3T66A 5CC2A 3FVOA 1LFHA 1FTOA 4KHZE 2D21A 3EQ1A 3CSGA 3GBAA 3TAJA 2GFEA 4ZZEA 4KQPA 3B6WA 4YB5A 2RF1A 1OVTA 1P1WA 2Y84A 5I56A 3PPOA 4NF6A 4YAHX 3O6IA 1N3WA 1USYE 5I2NB 5J1DA 4AB6A 4JDFA 3PUYE 3O9PA 1FQFA 3KG2A 1I6AA 2V3QA 4E0XA 3MP6A 1FQDA 1NNFA 4OFJA 2QRYA 3O2AA 5I58A 4I8CA 1MXXA 2QSXA 2V25A 4QSDA 1I69A 4U21A 3SKPA 3PU5A 1B46A 1OLAA 4M1VA 3SEYA 2I0BA 1US5A 3IL1B 3PPPA 3IK6B 4MH5A 4YKPA 1A54A 1MQHA 1XS5A 3THIA 4UA8A 1B40A 3RT8A 2D5WA 2XX9A 3O28A 2F36A 2I58A 1P99A 2VHAA 4DIGA 2AL5A 3MPKA 3KJ7A 1MXUA 3K02A 3CR9A 2Q9TA 2ZXTA 5H8NA 1FCKA 4U4XA 3K6WA 1I6BA 1IXGA 3MWBA 3KOSA 2UYFA 5H8HA 1ZKBA 3PV0E 1B7ZA 2XXRA 2ALUA 1J1NA 4PFUA 4MLQA 1T0KA 4KYEA 3CG3A 5DVIA 4ELOA 1MY2A 4H8JA 4RPOA 2RC8A 3IORA 2X26A 5H8QB 2NUVA 1VSOA 4OESA 2UVIA 1PDAA 3LC8A 3K6XA 4Q8RA 3HPIA 1B3GA 2AL4A 1GVCA 1B0LA 3CSBA 5F1QA 4ZE8A 5I57A 1WDNA 4O3AA 2P0SA 2DYXA 1LB9A 4NF5B 1IQ7A 4LATA 4HCYA 5CMCA 1SQYA 2REJA 3FVKA 1SYHA 4IGTA 4K3FA 4G68A 3ILUB 4IGRA 3I6VA 4C0RA 5DT6A 2B3FA 3ECRA 1LFGA 4NF4B 5I2KA 1B32A 2XXUA 3OOAA 4GWOA 4KI0E 4EQ7A 4IO4A 3MZ1A 1H76A 3IAZA 3PD9A 3D4CA 1B52A 1P1OA 4QFNA 1EU8A 1SBPA 1ZTYA 4R2BA 3OO8A 3GBBA 1RKMA 5CI5A 1JEUA 2I6EA 3H6WA 3FZVA 2O1MA 2H99A 1B6HA 1CB6A 1OQGA 4POXA 5B7DA 4OYVA 1SW1A 3ONMA 1MY3A 4KCCA 4DDDA 2F35A 3UP9A 4LQ2A 3TQWA 4LZ7A 3IX1A 3C31A 4H0WA 1R9QA 3LBSA 5HM4B 4HTGA 1A40A 4EF1A 4G8HA 4GFRA 1B7HA 1H43A 3Q27A 4UACA 4OTEA 3T9VA 3IJXB 4YB7A 2UVJA 4ELPA 3TPAA 5KZTA 4ZECA 4DCXA 3WAEA 2X7PA 4OQOA 1O7TA 2PX1A 4U23A 4U22A 1LCTA 2HFBA 2F78A 4ELQA 4RNSA 3SEUA 4QSEA 3FV2A 1L5TA 3R7XA 2H25A 5I59A 3TMGA 1MXZA 1YPNA 5BWJA 5H8FB 3AXFA 5AA2B 4GD5A 2XD2A 4ZZAA 2A5SA 4ISUA 4R9FA 4EUOA 3B6TA 2P1SA 2NOOA 4RA1A 2B3BA 2VD3A 1TXFA 3CFXA 4IY5A 1NL5A 2QPQA 4FEDA 3KBRA 1B51A 1MPDA 3FJ7A 1Z7ME 3H6UA 5I2NA 2PMSA 1B3EA 2HXWA 4PFWA 2NVUB 3FXUA 4P11A 2Y7IA 1Y3NA 4FIMA 4FAJA 3TUSA 4G68C 3C32A 5A5XB 1ZU0A 1ZJLA 1XVYA 3RPWA 3OMBA 1XT8A 4OFOA 4H8IA 2IEEA 3U94A 4NE4A 2GRVA 4DCYA 3K1NA 3OO9A 4ND9A 2VOZA 3MBPA 5CBSA 1D3KA 3RT6B 4EXKA 2RKMA 3OD7A 3TEPA 3UORA 1SYIA 3TTNA 2I48A 4XXUA 4ESXA 5K2XA 2PBWA 1P1QA 1M5EA 2I4CA 4OMBA 3VDFA 1LAGE 1YTVA 2O7UA 5KCJB 2XHDA 3GXAA 3TTMA 2Y7KA 3V5AA 3ILTB 1BIYA 1OMPA 3MP8A 4YKIA 4AQ4A 3S9NC 1MXYA 1MQGA 1TFDA 3G3KA 1QW0A 1R6ZA 1PB8A 4F22A 2VP1A 3FXQA 4ELRA 3CFLA 1H44A 3Q26A 2F7AA 2E1SA 3O66A 4X48A 5H8QA 4Q0CA 5HPQA 1QUJA 5B70A 1LBBA 4O3BA 3TTKA 4MLVA 4EDPA 1D4NA 4MBPA 3MZ9A 3U1OA 1N3XA 2HZKA 1S7YA 3H03A 3LUYA 1PC3A 4FECA 3PGFA 3RY3A 1TT1A 4RK9A 5CRYA 4F3BA 5I84A 4R6HA 3KSJA 3VVFA 4BDMA 1US4A 1H45A 3OELA 1F9BA 4BDQA 1LAHE 4U4SA 3KGCA 1FTKA 4ZEFA 4BDRA 3FVNA 5DEXB 4Z0IA 2M8CA 2XXIA 4NF4A 3MVYA 4QHQA 3QK6A 4GXSB 3CI8A 4FATA 3IOWA 5JTYB 1B4ZA 3UA8A 3LSWA 4QSCA 1AL3A 4XKQA 2OLBA 3L6GA 1LAXA 4NMYA 5JK4A 4JWXA 4M4GA 3KZGA 4ZE9A 4PQJA 3PMWA 3T9UA 4G4PA 5ITPA 2QS2A 1LGBC 4OZ9A 3TTRA 2F5XA 3IB0A 4R6KA 3VVDA 3E13X 2YJPA 4LVQA 1GTKA 3GLBA 5ITOA 1JQFA 4NF8B 2ZNTA 4P0IA 3UGWA 1N7WA 2Q88A 3VLWA 3N26A 3Q29A 3MUQA 4Q5TA 1BP5A 1NMUA 1D9YA 1UQWA 4JB7A 3V8XB 4IO5A 4H5FA 1YCJA 4KCDA 3BFTA 4DXUA 2D3IA 1DSNA 2F7CA 4JWYA 1SDXA 2Z8FA 5CMBA 3N94A 4THIA 2YLNA 1MS7A 2DE2A 4RK2A 1FQCA 1Z7NE 2ZMBA 1URGA 1ZIUA 2ESNA 2OK2A 2PYYA 3HSTA 3UIFA 1IEJA 1MG1A 5FTIA 5EYFA 4KFQA 4LZ8A 3K0VA 3MVWA 3DELB 4R2FA 1TFAA 3TTLA 1NH8A 5H8FA 2B65A 3Q28A 5AA2A 2F97A 2CZLA 3RUMA 3PPNA 1FQBA 1FTJA 3O6GA 5DVFA 4GF8A 3JZJA 1OIBA 1VE4A 4BLAA 4POWA 3TYHA 1B4HA 3LSFB 3QIMA 2DSFA 1KWHA 1HSEA 3K00A 1B5IA 4HCWA 4ZEKA 1FQAA 4OFLA 1B3LA 1LB8A 4XTCQ 1GGGA 1Y9UA 4XIGQ 3SEVA 3KOTA 4JWOA 4G2ZA 2OZZA 1MM7A 4GXAA 5A5XA 1GR2A 2GHBA 1QULA 3HHGA 4L17A 2HCAA 3SETA 3KJTA 3KN8A 1SVXB 2UVGA 3JYRA 1IITA 5AA4B 1AOVA 1VFDA 2REGA 2VD2A 1JW4A 1R1NA 4YICA 3FV1A 2XXHA 2Q8JA 2OBGA 4QFLA 3IOVA 4KPTA 1B0HA 5KCJA 2RCAA 3UK4A 4H67A 1B3FA 2XXTA 1D9VA 1M5BA 3MW0A 4XKRA 4H6DA 5DYHA 3C9HA 3E4RA 1P1UA 3UN6A 4GVOA 1LCFA 3M3LA 1FQEA 5IKBA 4F3GA 2RCBA 3BKIB 4ZEDA 1OVBA 4H65A 3IO6A 3OO6A 3O6HA 3VE1B 1JW1A 1B3HA 4TOZA 1NH7A 3KN7A 1URSA 3G3GA 4OETA 1MH4A 1B7UA 3SESA 3W9WA 1DOTA 1DMBA 4WEPA 3S2VA 1B1HA 3IOUA 3A3CA 3VFJA 1GV8A 2YPNA 3VVEA 1XC1A 1POTA 5TPAB 4EXLA 1USYH 1BLFA 1POY1 4MF3A 2G29A 4O3CA 1XOCA 3M8UA 1O63A 5AA2D 1WVJA 3EF7A 3USDA 4OHNA 4U1OA 1JVXA 1LBCA 1S9TA 2RINA 3H06B 4BDNA 1Y3PA 2Z22A 5DEXA 5CMMA 1BKAA 2ZYMA 2V84A 1SI0A 1EZPA 1UTHB 3TCFA 2FNCA 5JTYA 5BUUA 4GL8A 3CG1A 2Q89A 3G3IA 4BDOA 1ATGA 3IR1A 3S9MC 3K6UA 4R75A 5DVJA 2QMWA 1MDP1 2GH9A 2R9JA 2R6GE 4JBZA 3OO7A 2XXWA 3OSQA 2PVUA 3PMXA 1SW4A 3C33A 1IXIA 2XXXA 4EQBA 4QF9A 5HBCA 3SERA 2DE3A 2F34A 3OXNA 1MQDA 2Q2CA 4GIZA 4EQ9A 2DWAA 4IO6A 3RLFE 3RTFB 1SW5A 3OSRA 5CM6A 2GHAA 2CMOA 4LUBA 1N76A 1N84A 4NF8A 3E3KA 1B05A 4KYDA 1DPEA 3U93A 1II5A 2BJJX 1LLSA 2F8DA 1IXHA 3Q25A 2A5TB 4OWDA 2ZNSA 3RGYA 4I9DA 4R6YA 1N04A 3QUFA 2UYEA 1TWYA 3VV5A 3V83A 5AA1A 4ZEIA 1MRPA 2ABHA 4NWCA 3H4ZA 4RJZA 1H3DA 1QVSA 3MQ9A 3T93B 1MQIA 1MPBA 4IB2A 5KDTB 3O97A 1PB9A 4ZDMA 3TZAA 1M5CA 3EPEA 4I1DA 2I3WA 3G3FA 2DS9A 3T22A 4GRKA 1CE2A 2RC7A 2Z8EA 3TELA 2ANJA 4IO7A 2DXYA 4YMBA 4ECFA 1B2HA 2O51A 1ZLQA 2Y7WA 2DP8A 2I3VA 2ZNUA 1S50A 2ONRA 3JV9A 1B58A 2NWJA 1JETA 2DWHA 4DXCA 1QUIA 1UIVA 5EHSA 3D4GA 3SEXA 3MP1A 4QFKA 1IXCA 3F11A 3M3FA 4OVJA 4JSDA 4C1TA 4NF5A 1PEBA 2FA7A 3WAFA 3C35A 5L9OA 3B7DA 2LAOA 3P7IA 3G7WA 3V89B 5AA4A 2W7YA 3MPLA 3LR1A 1MY0A 3ZKLA 1Q35A 3EN3A 3R26A 5FHMA 1Y3QA 3QYTA 4QFPA 1EZ9A 2DVCA 3S9LC 4NWDA 1MQJA 4F19A 3RQTA 3QSLA 4F2OA 3QUJA 1UTBB 3MJNA 2F7BA 4PETA 1B5HA 4DXBA 2PT1A 1A7LA 4FJPA 4RPNA 3U92A 3E9XA 1A8EA 2O7IA 2I0CA 3B6QA 3HCQA 3VXCA 2DXRA 2ONKE 2DQVA 4R74A 1ZBMA 3FUZA 4R9GA 3DP4A 2I4BA 3FIRA 4OEVA 3K1PA 4DZ1A 2XXYA 2ZYKA 4YU0A 3K2DA 3PUWE 3BBRA 3H6TA 5DTBA 5F7VA 5FHOA 4XKPA 1URDA 1JEVA 2WKYA 4Q30B 1LFIA 5TPAA 4YMAA 1I6QA 3I5OA 3H3GA 1HSLA 4G8NA 5CMKA 1DTZA 4LP2B 4TQUQ 3EHSA 5TP9B 1ELJA 3ODBA 3TFLA 2NXOA 3A3UA 4OXVA 2IA4A 4F2QA 4F1VA 2Q2AA 2HAVA 4WKMA 3GZGA 3DP8A 2XXVA 5M2VA 3IO4A 4ESWA 1O64A 3R6UA 5ICQA 1IIWA 1Y4CA 1MY1A 1UTHA 4F18A 4GQOA 3VLVA 2XD3A 1M5DA 4F39A 1MPCA 2O68A 4PFYA 3QAXA 2G93A 4F29A 1NNKA 4HS7A 4HW8A 3PPRA 1UIUA 2XX8A 2O1LA 3TQLA 3LSLA 1Y20A 4WXJA 4DE8A 4MFIA 4PP0A 3EHUA 2XXPA 2H5YA 3RTWB 4X1DA 2QL3A 3FGSA 4KYSA 3HHFA 3U72A 4IO3A 3BFUA 4OENA 2I49A 5AE4A 4FEBA 4RXLA 1PB7A 3T9XB 3FXRA 3O29A 3QXMA 4C1UA 2HQ0A 3FJMA 3M3KA 4JSOA 4GL0A 3C34A 1Y1ZA 2DWIA 2A5TA 2OWTA 4R72A 4OERA 1MXVA 1XVXA 3C4MA 1DTGA 3W15C 3ZSFA 1SD3A 3RN8A 4LZ5A 1R9LA 1HSJA 3MZBA 1N7XA 3KN3A 2Y7PA 3TCHA 3IB2A 2ZYNA 1QKAA 2XXQA 5ELVA 1Y4TA 5FHNA 4PFTA 2KLFA 3PD8A 4E0WA 3N6UA 3MVXA 2XX7A 5IAIA 2DVZA 1XHYA 1M5FA 1ZMGA 5KDTA 2ZYOA 3RNNA 4RYAA 1JVYA 1VR5A 1Q1KA 5I56B 4NF6B 4EF2A 3FJGA 3VLUA 4PE5B 3PUVE 1QUKA 5K2YA 4KD5A 1QJMA 3OENA 1A8FA 4YZZA 3SEWA 1A55A 1PBQA 3K1MA 4RY1A 5EHMA 3DM0A 4ZEBA 3CRBA 4WEDA 3MAMA 5I58B 3L6HA 2UXAA 1IUDA 3PUXE 2QMXA 2QS1A 4TLLB 3IB1A 4YKJA 3CFZA 3EHTA 2UVHA 1FTMA 4GLIA 3T96B 2F6GA 2X7QA 5ISUA 3FASA 1RYXA 4IY6A 3W9VA 3T9HB 4F1UA 4F3SA 3H7MA 5ICTA 3N6TA 3S4UA 3TODA 1OLCA 3HV1A 5L9MA 4I62A 3G3HA 1IZ1A 2O6AA 4N07A 1AMFA 2H98A 2Z8DA 5H8SA 2V3UA 4N13A 2PT2A 4XKNA 1N0TA 1MM6A 5H8NB 2THIA 2HEUA 2DOJA 1MY4A 4AB5A 1JNFA 1RYOA 5H8HB 2H4IA 3N5LA 2VGQA 5AA3A 2OJTA 1AH5A 1UTBA 4IO2A 3FATA
chains in the Genus database with same CATH superfamily
5L9SA 3CIJA 4F31B 5F24A 2Q74A 3DP6A 3HN0A 4X04A 4PE3A 1IMBA 1EZOA 3A09A 1B1XA 3OEMA 4GOTA 2ZZVA 2RC9A 2O84X 1FRPA 1FBDA 3FD3A 1DPPA 2AYSA 2E0SA 1FBHA 3KEIA 3OEKA 5I57B 3PPQA 3MVZA 4U2RA 4P0GA 3QMFA 1K9YA 1YAEA 5LOMA 4GWXA 1MXWA 4G77A 1NKXA 4TLMB 2OWSA 4NEDA 4OEUA 4G68B 4X1BA 1BTJA 4NGUA 1NFTA 2QS3A 1P1NA 2P2AA 1B9JA 1QKBA 4LQ5A 2WEFA 2O69A 3KFMA 3KSXA 1FPJA 4LONB 3K01A 4F3PA 5I2KB 4BDLA 4N4UA 4R73A 3PUZE 1Y1MA 2OWZA 5TP9A 3NOHA 4H5GA 2Y7RA 1FW0A 3G3JA 4JVDA 1LSTA 1YYZA 4N6PA 4KR5A 1AIVA 4NTLA 2Z23A 4PFIA 3S9EA 2F6PA 3SDFA 1LAFE 4H1XA 3TCGA 4F1YA 1ANFA 5JEIA 5FTHA 3LSXA 2H9BA 1JW5A 2QJEA 1NNTA 1SI1A 1LBWA 1FTLA 2OCUA 2QS4A 4ONYA 1EYJA 3TKDA 4DLDA 3PMVA 5I5PA 4X9TA 5IZZA 3TDJA 1NNPA 1OQHA 2R71A 3ZS6A 3FVGA 1MDQA 2CZKA 2V93A 4NN3A 1VDWA 4QFOA 1VFEA 1EH3A 5A5LA 1NUYA 4YKKA 3K4UA 1MH3A 3I3VA 2FYIA 1PBPA 1YXIA 2DWJA 3IFAA 3ZKKA 5ET7A 3MC2A 1SW2A 1B5JA 4G8MA 1A99A 3IJOB 1WODA 2DE4A 4FBPA 5TU0A 2ONSA 4FE8A 5CBRA 2HZLA 4LA9A 3DLNA 3H6VA 3U8QA 3IOTA 4FORA 3VXBA 3BIHA 2CZIA 4I3YA 2V3TA 5L8DA 3K6VA 4U1ZA 4Z7EA 3C36A 3SZPA 5I59B 4YB6A 3HO7A 2HAUA 2AIXA 4JXIA 2MKZA 3CVGA 4ZS9A 4QRZA 3T66A 5CC2A 3FVOA 1LFHA 1FTOA 4KHZE 2D21A 3EQ1A 4GX3A 3CSGA 3GBAA 3TAJA 2QVUA 2GFEA 4ZZEA 4KQPA 3B6WA 4YB5A 2RF1A 1OVTA 1P1WA 2Y84A 5I56A 3PPOA 4NF6A 1KA0A 4YAHX 5IZ3A 3O6IA 1N3WA 5J16A 1USYE 5I2NB 5J1DA 4PC9A 4AB6A 4JDFA 4GBVA 3PUYE 3O9PA 1FQFA 2P3NA 3KG2A 1I6AA 2V3QA 4E0XA 3MP6A 1FQDA 1NNFA 4OFJA 2QRYA 3O2AA 4NX1A 5I58A 4I8CA 1MXXA 4MJOA 2QSXA 2V25A 4QSDA 4OVPA 1I69A 4U21A 3SKPA 3PU5A 2XXKA 1B46A 1OLAA 4M1VA 3SEYA 2I0BA 1US5A 3IL1B 1IMEA 2CEYA 3PPPA 3IK6B 4MH5A 4YKPA 1A54A 1MQHA 1XS5A 4AS4A 3THIA 4UA8A 1B40A 3RT8A 4MAGA 2D5WA 2XX9A 2B4LA 3O28A 2F36A 2I58A 1P99A 2VHAA 4DIGA 2AL5A 1G0HA 3MPKA 3KJ7A 1MXUA 3K02A 1Q9DA 3CR9A 2Q9TA 2ZXTA 2WYKA 5H8NA 1FBCA 1FCKA 2FHYA 4U4XA 3K6WA 1I6BA 2CEXA 1IXGA 3MWBA 3KOSA 2UYFA 5H8HA 1ZKBA 3PV0E 2XA5A 1B7ZA 2XXRA 4P56A 2ALUA 1J1NA 4PFUA 4MLQA 1T0KA 4KYEA 3CG3A 5DVIA 2XWIA 4ELOA 1MY2A 4H8JA 3E78A 4RPOA 2RC8A 4P8BA 3IORA 2X26A 5H8QB 2NUVA 1VSOA 4OESA 2UVIA 1PDAA 3LC8A 3K6XA 4O7MA 4Q8RA 1FPKA 2XWOA 3HPIA 1LBYA 1B3GA 2AL4A 1GVCA 1B0LA 3CSBA 5F1QA 4XF5A 4ZE8A 5I57A 1WDNA 1NV2A 4O3AA 2P0SA 2DYXA 3D1RA 1LB9A 2FVZA 4NF5B 1IQ7A 4LATA 4HCYA 5CMCA 1SQYA 2REJA 3FVKA 1SYHA 4IGTA 4K3FA 4G68A 3ILUB 4IGRA 3I6VA 4C0RA 5DT6A 1IMDA 2B3FA 5IGAA 4N8YA 3ECRA 1LFGA 4NF4B 5I2KA 4PGPA 1B32A 2XXUA 2FIXA 3OOAA 4GWOA 4KI0E 4EQ7A 4IO4A 2HXRA 3MZ1A 1H76A 3IAZA 3PD9A 4N6DA 3D4CA 1B52A 1P1OA 4QFNA 1EU8A 1SBPA 1NV0A 1ZTYA 4R2BA 3OO8A 3GBBA 1RKMA 5CI5A 1JEUA 2I6EA 3H6WA 3FZVA 2O1MA 2L5VA 1FPIA 4H45A 2H99A 1B6HA 1CB6A 1OQGA 4QXDA 5I3SA 4POXA 5B7DA 4XEQA 4OYVA 1SW1A 3ONMA 1MY3A 1DCUA 4KCCA 4DDDA 2F35A 3UP9A 1FJ9A 1LBXA 4LQ2A 3TQWA 4LZ7A 3IX1A 3C31A 4H0WA 1R9QA 4MHFA 3LBSA 5HM4B 4HTGA 1A40A 4EF1A 4G8HA 3KBZA 1FPEA 4GFRA 1B7HA 1H43A 3Q27A 4UACA 4OTEA 3T9VA 3LUZA 3IJXB 4YB7A 2UVJA 2HHMA 4MNCA 4ELPA 3FBPA 3TPAA 5KZTA 4ZECA 2DDKA 4DCXA 3WAEA 2X7PA 4OQOA 1O7TA 2PX1A 4U23A 4U22A 1LCTA 2HFBA 2Y5KA 2F78A 4ELQA 4OVQA 4RNSA 3SEUA 4QSEA 3FV2A 1L5TA 3R7XA 2H25A 5I59A 3TMGA 1MXZA 1YPNA 5ET8A 5BWJA 5H8FB 3AXFA 5AA2B 4GD5A 2XD2A 4ZZAA 2A5SA 4ISUA 3T0JA 4R9FA 4EUOA 3B6TA 2P1SA 2NOOA 4RA1A 2B3BA 3IFCA 2VD3A 1TXFA 3CFXA 4IY5A 1NL5A 2F3DA 4NF0A 3A29A 2QPQA 5EYGA 4FEDA 3KBRA 1B51A 1MPDA 2XWKA 3FJ7A 1Z7ME 1YZ0A 3H6UA 5I2NA 2PMSA 1B3EA 2HXWA 4PFWA 2NVUB 3FXUA 4P11A 2Y7IA 1Y3NA 1IMFA 3ROJA 2BJIA 4PGNA 4FIMA 4FAJA 3TUSA 4G68C 4MCOA 3C32A 5A5XB 1ZU0A 1ZJLA 1XVYA 3RPWA 3OMBA 1LBZA 1XT8A 4OFOA 1NV6A 4H8IA 2IEEA 3U94A 4NE4A 2GRVA 4DCYA 4UABA 3K1NA 3OO9A 4ND9A 2VOZA 3MBPA 5CBSA 4PDDA 1D3KA 3RT6B 4EXKA 5T3JA 2RKMA 4MEVA 3OD7A 3TEPA 3UORA 4OA4A 1SYIA 1FJ6A 1RDXA 2GQ1A 3TTNA 2I48A 4XXUA 4ESXA 5K2XA 2PBWA 1P1QA 1M5EA 2I4CA 4OMBA 1FPFA 3VDFA 1LAGE 2XWVA 1YTVA 2O7UA 5KCJB 2XHDA 3GXAA 3TTMA 2FIEA 2Y7KA 3V5AA 2WX9A 3ILTB 1BIYA 1OMPA 3MP8A 4YKIA 4AQ4A 2QVVA 3S9NC 1MXYA 1MQGA 1TFDA 3G3KA 1QW0A 4P1LA 1R6ZA 1PB8A 4F22A 2VP1A 5ESYA 3FXQA 3FXBA 3CHGA 4ELRA 1JP4A 3CFLA 1H44A 3Q26A 1IMAA 5ET6A 2F7AA 2E1SA 3O66A 4X48A 5IM2A 5H8QA 4Q0CA 5HPQA 1QUJA 5B70A 4GWZA 1LBBA 4O3BA 3TTKA 4MLVA 4EDPA 1D4NA 5EQ9A 4MBPA 3MZ9A 3U1OA 1N3XA 2HZKA 1S7YA 3H03A 3LUYA 1PC3A 4FECA 3PGFA 3RY3A 1TT1A 4RK9A 5CRYA 4F3BA 5I84A 1LBVA 4R6HA 3KSJA 3VVFA 4BDMA 4OANA 1H45A 1US4A 4X8RA 3OELA 1F9BA 4BDQA 1LAHE 4U4SA 5EYHA 3KGCA 1FTKA 4ZEFA 4N81A 4BDRA 4GWUA 3FVNA 5DEXB 4Z0IA 2M8CA 2XXIA 4NF4A 3MVYA 4QHQA 3QK6A 4GXSB 4N8GA 3CI8A 4FATA 3IOWA 5JTYB 4PAIA 1B4ZA 1NUXA 3UA8A 4GWWA 1FBPA 3LSWA 4QSCA 1AL3A 4XKQA 2OLBA 3L6GA 1LAXA 4NMYA 5JK4A 1NV5A 1FPDA 4JWXA 4M4GA 3KZGA 4ZE9A 4PQJA 3PMWA 3T9UA 4G4PA 5ITPA 2QS2A 1LGBC 4OZ9A 3TTRA 2F5XA 3IB0A 4R6KA 3VVDA 3E13X 2YJPA 4LVQA 1GTKA 3GLBA 4PDHA 5ITOA 1JQFA 4NF8B 2ZNTA 4P0IA 3UGWA 1N7WA 2Q88A 3VLWA 3N26A 3Q29A 4OVRA 3MUQA 4Q5TA 1BP5A 1DBZA 1NMUA 1D9YA 1UQWA 4JB7A 3V8XB 4IO5A 4H5FA 1YCJA 4KCDA 3BFTA 4DXUA 2D3IA 1DSNA 4AS5A 2F7CA 4JWYA 1SDXA 2Z8FA 2B4MA 5CMBA 3N94A 4THIA 4GWYA 1FPGA 2YLNA 1MS7A 2DE2A 4RK2A 1FQCA 1Z7NE 2ZMBA 1URGA 1ZIUA 2ESNA 2OK2A 2PYYA 3HSTA 3UIFA 1IEJA 1MG1A 4I3EA 5FTIA 1NV3A 5EYFA 4KFQA 4LZ8A 3K0VA 3MVWA 3DELB 4R2FA 1TFAA 3TTLA 1NH8A 5H8FA 2B65A 3Q28A 5AA2A 2F97A 2CZLA 3RUMA 3PPNA 1FQBA 1FTJA 3O6GA 5DVFA 4GF8A 3JZJA 1OIBA 1VE4A 4BLAA 4POWA 3TYHA 1B4HA 3LSFB 4HE0A 3QIMA 2DSFA 1KWHA 1HSEA 3K00A 1B5IA 4HCWA 4ZEKA 2Y5LA 1FQAA 4OFLA 1B3LA 1LB8A 4XTCQ 3RPLB 4H46A 1QGXA 1GGGA 1Y9UA 4XIGQ 3SEVA 3KOTA 4JWOA 5EQ7A 4G2ZA 2OZZA 5I7IA 1MM7A 5LDZA 4GXAA 5A5XA 1GR2A 2GHBA 4O8MA 3LV0A 1QULA 3HHGA 4L17A 2HCAA 3SETA 3KJTA 3KN8A 1SVXB 2UVGA 3JYRA 2VPNA 1FPLA 1IITA 5AA4B 1AOVA 1VFDA 2KQZA 3BIGA 2REGA 2VD2A 1JW4A 1R1NA 4YICA 1NV1A 2HPGA 4O94A 3FV1A 2XXHA 2Q8JA 2OBGA 4QFLA 3IOVA 4KPTA 1B0HA 5KCJA 4PF8A 2RCAA 4KXPA 3UK4A 4H67A 1B3FA 2XXTA 3KC0A 1D9VA 1M5BA 2PFZA 4NQ8A 3MW0A 4IR8A 4XKRA 4H6DA 5DYHA 4PCDA 3C9HA 3E4RA 1P1UA 3UN6A 1FBEA 4GVOA 5DW8A 1LCFA 2PCRA 3M3LA 1FQEA 5IKBA 4F3GA 2RCBA 3BKIB 4ZEDA 5EQ8A 1OVBA 4H65A 1FTAA 3IO6A 3OO6A 3O6HA 3VE1B 1JW1A 1B3HA 4TOZA 1NH7A 2CZHA 3KN7A 1URSA 3G3GA 4OETA 1MH4A 1B7UA 3SESA 3W9WA 1DOTA 1DMBA 4WEPA 3S2VA 1B1HA 4PTKA 3IOUA 3A3CA 3VFJA 3ISPA 1GV8A 3EKIA 2YPNA 3VVEA 1XC1A 1NUZA 1POTA 5TPAB 4EXLA 2OX3A 4HE1A 1USYH 5EQAA 1BLFA 1POY1 4PBHA 4MF3A 2G29A 3B50A 4O3CA 1XOCA 5LTCA 3M8UA 1O63A 5AA2D 1WVJA 3E79A 3EF7A 3MYUA 3USDA 4OHNA 4U1OA 1JVXA 1LBCA 1S9TA 2ZZXA 2RINA 3H06B 4BDNA 1Y3PA 2Z22A 5DEXA 5CMMA 1BKAA 2ZYMA 2V84A 1SI0A 1EZPA 1UTHB 3TCFA 2FNCA 4P3LA 5JTYA 5BUUA 4GL8A 3CG1A 4PF6A 2Q89A 3G3IA 4BDOA 1KA1A 1ATGA 3IR1A 3S9MC 3K6UA 4R75A 5DVJA 2QMWA 1MDP1 2GH9A 2R9JA 4NG7A 2R6GE 4JBZA 3OO7A 4GWSA 2XXWA 3OSQA 2PVUA 3PMXA 1SW4A 1LEVA 3C33A 1IXIA 2XXXA 4EQBA 3MSTA 4QF9A 5HBCA 3SERA 1EYIA 2DE3A 2F34A 3OXNA 1MQDA 2Q2CA 4GIZA 4EQ9A 1CNQA 2DWAA 4IO6A 3RLFE 4QBAA 3RTFB 1SW5A 3OSRA 5CM6A 2GHAA 2CMOA 4LUBA 1K9ZA 1N76A 1N84A 4NF8A 3E3KA 1B05A 4KYDA 1DPEA 3U93A 4DI4B 1II5A 2BJJX 2VPOA 1LLSA 2F8DA 2WBDA 1IXHA 3Q25A 2A5TB 4OWDA 2ZNSA 3RGYA 4I9DA 4R6YA 1N04A 3QUFA 4P47A 2UYEA 1TWYA 3VV5A 3V83A 5AA1A 4N6KA 4ZEIA 1MRPA 2ABHA 4NWCA 4O7IA 3H4ZA 4RJZA 2ZZWA 1H3DA 1QVSA 3MQ9A 3T93B 1MQIA 1MPBA 4IB2A 5KDTB 3O97A 1PB9A 4ZDMA 3TZAA 1M5CA 3EPEA 4MNPA 4I1DA 2I3WA 1RDYA 3G3FA 2DS9A 3T22A 4GRKA 1CE2A 1NUWA 2RC7A 2Z8EA 2FBPA 3TELA 2ANJA 4IO7A 2DXYA 4YMBA 4ECFA 1B2HA 2O51A 1ZLQA 2Y7WA 2DP8A 2I3VA 2ZNUA 1S50A 2ONRA 3JV9A 1B58A 2NWJA 1JETA 2DWHA 4PFRA 4DXCA 3RPLA 1QUIA 1UIVA 1EYKA 4PAKA 5EHSA 2VT5A 3D4GA 4GBWA 3SEXA 3MP1A 4QFKA 1IXCA 3F11A 3M3FA 4OVTA 4OVJA 4JSDA 4C1TA 3B8BA 4NF5A 4XFEA 4P1EA 1PEBA 2FA7A 4LN5A 3WAFA 3C35A 5L9OA 3B7DA 2LAOA 3P7IA 3G7WA 3KC1A 3V89B 2R8TA 5FBPA 5AA4A 2W7YA 3MPLA 3LR1A 1MY0A 3ZKLA 1Q35A 3PTYA 3EN3A 3R26A 5FHMA 3U65A 2P3VA 1Y3QA 3QYTA 4QFPA 3RYDA 1EZ9A 2DVCA 3S9LC 4NWDA 1MQJA 4P9KA 4F19A 3RQTA 3QSLA 4F2OA 3QUJA 1UTBB 3MJNA 4OVSA 2F7BA 4PETA 1B5HA 2WBBA 4DXBA 2PT1A 1A7LA 4FJPA 4RPNA 3U92A 3E9XA 1A8EA 1XI6A 2O7IA 2I0CA 3B6QA 3HCQA 3VXCA 2DXRA 2ONKE 2DQVA 4R74A 1ZBMA 3FUZA 4R9GA 3DP4A 2I4BA 3FIRA 4OEVA 3K1PA 4DZ1A 2QVRA 2XXYA 2ZYKA 4YU0A 3K2DA 3PUWE 3BBRA 1FBGA 1NV4A 3H6TA 4HXVA 5DTBA 5F7VA 5FHOA 4XKPA 1URDA 1JEVA 2WKYA 4Q30B 4I40A 1IMCA 1LFIA 5TPAA 4YMAA 1I6QA 3I5OA 3H3GA 1HSLA 4G8NA 5CMKA 1DTZA 4LP2B 4TQUQ 4MIJA 3EHSA 5TP9B 2PFYA 1ELJA 3ODBA 3TFLA 2NXOA 3A3UA 4OXVA 2IA4A 4F2QA 4F1VA 2Q2AA 2HAVA 4WKMA 3GZGA 3DP8A 2XXVA 5M2VA 1FPBA 3IO4A 4ESWA 1O64A 3R6UA 5IZ1A 5ICQA 1IIWA 1Y4CA 1D9QA 1BK4A 1MY1A 1UTHA 4F18A 4GQOA 2Q8MA 3VLVA 2XD3A 1M5DA 4F39A 4JVCA 1MPCA 2O68A 2F3BA 4PFYA 3QAXA 2G93A 2QFLA 4F29A 1NNKA 4HS7A 4HW8A 2KR0A 3PPRA 1UIUA 2XX8A 2O1LA 3TQLA 3LSLA 1Y20A 4WXJA 4DE8A 4MFIA 4PP0A 3EHUA 2XXPA 2H5YA 3RTWB 4X1DA 2QL3A 3FGSA 4KYSA 3HHFA 1NI9A 3U72A 4IO3A 3BFUA 4OENA 2I49A 4PAFA 4MNIA 5AE4A 4FEBA 4MX6A 4RXLA 1PB7A 3T9XB 3FXRA 3O29A 1SPIA 3QXMA 4C1UA 2HQ0A 1G0IA 3FJMA 3M3KA 4JSOA 4GL0A 3C34A 1Y1ZA 2DWIA 2A5TA 2OWTA 4R72A 4OERA 4GX4A 1MXVA 4NHBA 1XVXA 3C4MA 1DTGA 3W15C 3ZSFA 1SD3A 3RN8A 4LZ5A 1R9LA 1HSJA 3MZBA 1N7XA 3KN3A 4PFBA 2Y7PA 3TCHA 3IB2A 2ZYNA 1QKAA 2XXQA 5ELVA 1Y4TA 5FHNA 1RDZA 4PFTA 2KLFA 3PD8A 4E0WA 3N6UA 3MVXA 2XX7A 4GX6A 5IAIA 2DVZA 1XHYA 4N17A 1M5FA 1ZMGA 4NAPA 4N91A 5KDTA 4DI3D 1NV7A 1INPA 2ZYOA 3RNNA 4RYAA 1JVYA 1VR5A 1Q1KA 5I56B 4NF6B 4EF2A 5IZ3B 3FJGA 3GYYA 3VLUA 1AWBA 4PE5B 3PUVE 1QUKA 5K2YA 4KD5A 4PBQA 5ET5A 1QJMA 3OENA 1A8FA 4YZZA 3SEWA 1A55A 1PBQA 3K1MA 4RY1A 5EHMA 3DM0A 4ZEBA 3CRBA 4WEDA 3MAMA 1FBFA 5I58B 3L6HA 2UXAA 1IUDA 3PUXE 2QMXA 2QS1A 2WYPA 4TLLB 3IB1A 4YKJA 3CFZA 3EHTA 2UVHA 3HFUA 1FTMA 2V4CA 4GLIA 1KZ8A 3T96B 2F6GA 2X7QA 5ISUA 3FASA 1RYXA 4IY6A 3W9VA 3T9HB 4F1UA 4F3SA 3H7MA 5ICTA 4G61A 3N6TA 3S4UA 3TODA 1OLCA 4N15A 3HV1A 5L9MA 4I62A 3G3HA 1IZ1A 2O6AA 4N07A 1AMFA 1DK4A 2H98A 2Z8DA 5H8SA 2V3UA 4N13A 2PT2A 4XKNA 1N0TA 1FSAA 1MM6A 4MMPA 5H8NB 2THIA 2HEUA 3T1BA 2DOJA 1MY4A 4AB5A 1JNFA 1RYOA 5H8HB 2H4IA 3N5LA 2VGQA 5AA3A 4JVIA 2OJTA 1AH5A 1UTBA 4IO2A 2JJKA 4HE2A 3FATA
chains in the Genus database with same CATH topology
5L9SA 3CIJA 4F31B 3DP6A 3HN0A 1EZOA 3A09A 1B1XA 3OEMA 4GOTA 2RC9A 2O84X 3FD3A 1DPPA 2AYSA 2E0SA 3KEIA 3OEKA 5I57B 3PPQA 3MVZA 4U2RA 4P0GA 1YAEA 5LOMA 1MXWA 4G77A 1NKXA 4TLMB 2OWSA 4NEDA 4OEUA 4G68B 4X1BA 1BTJA 1NFTA 2QS3A 1P1NA 2P2AA 1B9JA 1QKBA 4LQ5A 2O69A 3KFMA 3KSXA 4LONB 3K01A 4F3PA 5I2KB 4BDLA 4R73A 5TP9A 3PUZE 1Y1MA 4H5GA 2Y7RA 1FW0A 3G3JA 1LSTA 4N6PA 4KR5A 1AIVA 4NTLA 2Z23A 3S9EA 2F6PA 3SDFA 1LAFE 4H1XA 3TCGA 4F1YA 1ANFA 5JEIA 5FTHA 3LSXA 2H9BA 1JW5A 2QJEA 1NNTA 1SI1A 1FTLA 2OCUA 2QS4A 4ONYA 3TKDA 4DLDA 3PMVA 4X9TA 3TDJA 1NNPA 1OQHA 2R71A 3ZS6A 3FVGA 1MDQA 2V93A 4QFOA 1VFEA 1EH3A 4YKKA 3K4UA 1MH3A 3I3VA 2FYIA 1PBPA 2DWJA 3ZKKA 3MC2A 1SW2A 1B5JA 4G8MA 1A99A 3IJOB 1WODA 2DE4A 5TU0A 2ONSA 4FE8A 5CBRA 2HZLA 4LA9A 3DLNA 3H6VA 3U8QA 3IOTA 4FORA 3VXBA 2V3TA 5L8DA 3K6VA 4U1ZA 4Z7EA 3C36A 5I59B 4YB6A 3HO7A 2HAUA 2AIXA 4JXIA 3CVGA 4ZS9A 4QRZA 3T66A 5CC2A 3FVOA 1LFHA 1FTOA 4KHZE 2D21A 3EQ1A 3CSGA 3GBAA 3TAJA 2GFEA 4ZZEA 4KQPA 3B6WA 4YB5A 2RF1A 1OVTA 1P1WA 2Y84A 5I56A 3PPOA 4NF6A 4YAHX 3O6IA 1N3WA 1USYE 5I2NB 5J1DA 4AB6A 4JDFA 3PUYE 3O9PA 1FQFA 3KG2A 1I6AA 2V3QA 4E0XA 3MP6A 1FQDA 1NNFA 4OFJA 2QRYA 3O2AA 5I58A 4I8CA 1MXXA 2QSXA 2V25A 4QSDA 1I69A 4U21A 3SKPA 3PU5A 1B46A 1OLAA 4M1VA 3SEYA 2I0BA 1US5A 3IL1B 3PPPA 3IK6B 4MH5A 4YKPA 1A54A 1MQHA 1XS5A 3THIA 4UA8A 1B40A 3RT8A 2D5WA 2XX9A 3O28A 2F36A 2I58A 1P99A 2VHAA 4DIGA 2AL5A 3MPKA 3KJ7A 1MXUA 3K02A 3CR9A 2Q9TA 2ZXTA 5H8NA 1FCKA 4U4XA 3K6WA 1I6BA 1IXGA 3MWBA 3KOSA 2UYFA 5H8HA 1ZKBA 3PV0E 1B7ZA 2XXRA 2ALUA 1J1NA 4PFUA 4MLQA 1T0KA 4KYEA 3CG3A 5DVIA 4ELOA 1MY2A 4H8JA 4RPOA 2RC8A 3IORA 2X26A 5H8QB 2NUVA 1VSOA 4OESA 2UVIA 1PDAA 3LC8A 3K6XA 4Q8RA 3HPIA 1B3GA 2AL4A 1GVCA 1B0LA 3CSBA 5F1QA 4ZE8A 5I57A 1WDNA 4O3AA 2P0SA 2DYXA 1LB9A 4NF5B 1IQ7A 4LATA 4HCYA 5CMCA 1SQYA 2REJA 3FVKA 1SYHA 4IGTA 4K3FA 4G68A 3ILUB 4IGRA 3I6VA 4C0RA 5DT6A 2B3FA 3ECRA 1LFGA 4NF4B 5I2KA 1B32A 2XXUA 3OOAA 4GWOA 4KI0E 4EQ7A 4IO4A 3MZ1A 1H76A 3IAZA 3PD9A 3D4CA 1B52A 1P1OA 4QFNA 1EU8A 1SBPA 1ZTYA 4R2BA 3OO8A 3GBBA 1RKMA 5CI5A 1JEUA 2I6EA 3H6WA 3FZVA 2O1MA 2H99A 1B6HA 1CB6A 1OQGA 4POXA 5B7DA 4OYVA 1SW1A 3ONMA 1MY3A 4KCCA 4DDDA 2F35A 3UP9A 4LQ2A 3TQWA 4LZ7A 3IX1A 3C31A 4H0WA 1R9QA 3LBSA 5HM4B 4HTGA 1A40A 4EF1A 4G8HA 4GFRA 1B7HA 1H43A 3Q27A 4UACA 4OTEA 3T9VA 3IJXB 4YB7A 2UVJA 4ELPA 3TPAA 5KZTA 4ZECA 4DCXA 3WAEA 2X7PA 4OQOA 1O7TA 2PX1A 4U23A 4U22A 1LCTA 2HFBA 2F78A 4ELQA 4RNSA 3SEUA 4QSEA 3FV2A 1L5TA 3R7XA 2H25A 5I59A 3TMGA 1MXZA 1YPNA 5BWJA 5H8FB 3AXFA 5AA2B 4GD5A 2XD2A 4ZZAA 2A5SA 4ISUA 4R9FA 4EUOA 3B6TA 2P1SA 2NOOA 4RA1A 2B3BA 2VD3A 1TXFA 3CFXA 4IY5A 1NL5A 2QPQA 4FEDA 3KBRA 1B51A 1MPDA 3FJ7A 1Z7ME 3H6UA 5I2NA 2PMSA 1B3EA 2HXWA 4PFWA 2NVUB 3FXUA 4P11A 2Y7IA 1Y3NA 4FIMA 4FAJA 3TUSA 4G68C 3C32A 5A5XB 1ZU0A 1ZJLA 1XVYA 3RPWA 3OMBA 1XT8A 4OFOA 4H8IA 2IEEA 3U94A 4NE4A 2GRVA 4DCYA 3K1NA 3OO9A 4ND9A 2VOZA 3MBPA 5CBSA 1D3KA 3RT6B 4EXKA 2RKMA 3OD7A 3TEPA 3UORA 1SYIA 3TTNA 2I48A 4XXUA 4ESXA 5K2XA 2PBWA 1P1QA 1M5EA 2I4CA 4OMBA 3VDFA 1LAGE 1YTVA 2O7UA 5KCJB 2XHDA 3GXAA 3TTMA 2Y7KA 3V5AA 3ILTB 1BIYA 1OMPA 3MP8A 4YKIA 4AQ4A 3S9NC 1MXYA 1MQGA 1TFDA 3G3KA 1QW0A 1R6ZA 1PB8A 4F22A 2VP1A 3FXQA 4ELRA 3CFLA 1H44A 3Q26A 2F7AA 2E1SA 3O66A 4X48A 5H8QA 4Q0CA 5HPQA 1QUJA 5B70A 1LBBA 4O3BA 3TTKA 4MLVA 4EDPA 1D4NA 4MBPA 3MZ9A 3U1OA 1N3XA 2HZKA 1S7YA 3H03A 3LUYA 1PC3A 4FECA 3PGFA 3RY3A 1TT1A 4RK9A 5CRYA 4F3BA 5I84A 4R6HA 3KSJA 3VVFA 4BDMA 1US4A 1H45A 3OELA 1F9BA 4BDQA 1LAHE 4U4SA 3KGCA 1FTKA 4ZEFA 4BDRA 3FVNA 5DEXB 4Z0IA 2M8CA 2XXIA 4NF4A 3MVYA 4QHQA 3QK6A 4GXSB 3CI8A 4FATA 3IOWA 5JTYB 1B4ZA 3UA8A 3LSWA 4QSCA 1AL3A 4XKQA 2OLBA 3L6GA 1LAXA 4NMYA 5JK4A 4JWXA 4M4GA 3KZGA 4ZE9A 4PQJA 3PMWA 3T9UA 4G4PA 5ITPA 2QS2A 1LGBC 4OZ9A 3TTRA 2F5XA 3IB0A 4R6KA 3VVDA 3E13X 2YJPA 4LVQA 1GTKA 3GLBA 5ITOA 1JQFA 4NF8B 2ZNTA 4P0IA 3UGWA 1N7WA 2Q88A 3VLWA 3N26A 3Q29A 3MUQA 4Q5TA 1BP5A 1NMUA 1D9YA 1UQWA 4JB7A 3V8XB 4IO5A 4H5FA 1YCJA 4KCDA 3BFTA 4DXUA 2D3IA 1DSNA 2F7CA 4JWYA 1SDXA 2Z8FA 5CMBA 3N94A 4THIA 2YLNA 1MS7A 2DE2A 4RK2A 1FQCA 1Z7NE 2ZMBA 1URGA 1ZIUA 2ESNA 2OK2A 2PYYA 3HSTA 3UIFA 1IEJA 1MG1A 5FTIA 5EYFA 4KFQA 4LZ8A 3K0VA 3MVWA 3DELB 4R2FA 1TFAA 3TTLA 1NH8A 5H8FA 2B65A 3Q28A 5AA2A 2F97A 2CZLA 3RUMA 3PPNA 1FQBA 1FTJA 3O6GA 5DVFA 4GF8A 3JZJA 1OIBA 1VE4A 4BLAA 4POWA 3TYHA 1B4HA 3LSFB 3QIMA 2DSFA 1KWHA 1HSEA 3K00A 1B5IA 4HCWA 4ZEKA 1FQAA 4OFLA 1B3LA 1LB8A 4XTCQ 1GGGA 1Y9UA 4XIGQ 3SEVA 3KOTA 4JWOA 4G2ZA 2OZZA 1MM7A 4GXAA 5A5XA 1GR2A 2GHBA 1QULA 3HHGA 4L17A 2HCAA 3SETA 3KJTA 3KN8A 1SVXB 2UVGA 3JYRA 1IITA 5AA4B 1AOVA 1VFDA 2REGA 2VD2A 1JW4A 1R1NA 4YICA 3FV1A 2XXHA 2Q8JA 2OBGA 4QFLA 3IOVA 4KPTA 1B0HA 5KCJA 2RCAA 3UK4A 4H67A 1B3FA 2XXTA 1D9VA 1M5BA 3MW0A 4XKRA 4H6DA 5DYHA 3C9HA 3E4RA 1P1UA 3UN6A 4GVOA 1LCFA 3M3LA 1FQEA 5IKBA 4F3GA 2RCBA 3BKIB 4ZEDA 1OVBA 4H65A 3IO6A 3OO6A 3O6HA 3VE1B 1JW1A 1B3HA 4TOZA 1NH7A 3KN7A 1URSA 3G3GA 4OETA 1MH4A 1B7UA 3SESA 3W9WA 1DOTA 1DMBA 4WEPA 3S2VA 1B1HA 3IOUA 3A3CA 3VFJA 1GV8A 2YPNA 3VVEA 1XC1A 1POTA 5TPAB 4EXLA 1USYH 1BLFA 1POY1 4MF3A 2G29A 4O3CA 1XOCA 3M8UA 1O63A 5AA2D 1WVJA 3EF7A 3USDA 4OHNA 4U1OA 1JVXA 1LBCA 1S9TA 2RINA 3H06B 4BDNA 1Y3PA 2Z22A 5DEXA 5CMMA 1BKAA 2ZYMA 2V84A 1SI0A 1EZPA 1UTHB 3TCFA 2FNCA 5JTYA 5BUUA 4GL8A 3CG1A 2Q89A 3G3IA 4BDOA 1ATGA 3IR1A 3S9MC 3K6UA 4R75A 5DVJA 2QMWA 1MDP1 2GH9A 2R9JA 2R6GE 4JBZA 3OO7A 2XXWA 3OSQA 2PVUA 3PMXA 1SW4A 3C33A 1IXIA 2XXXA 4EQBA 4QF9A 5HBCA 3SERA 2DE3A 2F34A 3OXNA 1MQDA 2Q2CA 4GIZA 4EQ9A 2DWAA 4IO6A 3RLFE 3RTFB 1SW5A 3OSRA 5CM6A 2GHAA 2CMOA 4LUBA 1N76A 1N84A 4NF8A 3E3KA 1B05A 4KYDA 1DPEA 3U93A 1II5A 2BJJX 1LLSA 2F8DA 1IXHA 3Q25A 2A5TB 4OWDA 2ZNSA 3RGYA 4I9DA 4R6YA 1N04A 3QUFA 2UYEA 1TWYA 3VV5A 3V83A 5AA1A 4ZEIA 1MRPA 2ABHA 4NWCA 3H4ZA 4RJZA 1H3DA 1QVSA 3MQ9A 3T93B 1MQIA 1MPBA 4IB2A 5KDTB 3O97A 1PB9A 4ZDMA 3TZAA 1M5CA 3EPEA 4I1DA 2I3WA 3G3FA 2DS9A 3T22A 4GRKA 1CE2A 2RC7A 2Z8EA 3TELA 2ANJA 4IO7A 2DXYA 4YMBA 4ECFA 1B2HA 2O51A 1ZLQA 2Y7WA 2DP8A 2I3VA 2ZNUA 1S50A 2ONRA 3JV9A 1B58A 2NWJA 1JETA 2DWHA 4DXCA 1QUIA 1UIVA 5EHSA 3D4GA 3SEXA 3MP1A 4QFKA 1IXCA 3F11A 3M3FA 4OVJA 4JSDA 4C1TA 4NF5A 1PEBA 2FA7A 3WAFA 3C35A 5L9OA 3B7DA 2LAOA 3P7IA 3G7WA 3V89B 5AA4A 2W7YA 3MPLA 3LR1A 1MY0A 3ZKLA 1Q35A 3EN3A 3R26A 5FHMA 1Y3QA 3QYTA 4QFPA 1EZ9A 2DVCA 3S9LC 4NWDA 1MQJA 4F19A 3RQTA 3QSLA 4F2OA 3QUJA 1UTBB 3MJNA 2F7BA 4PETA 1B5HA 4DXBA 2PT1A 1A7LA 4FJPA 4RPNA 3U92A 3E9XA 1A8EA 2O7IA 2I0CA 3B6QA 3HCQA 3VXCA 2DXRA 2ONKE 2DQVA 4R74A 1ZBMA 3FUZA 4R9GA 3DP4A 2I4BA 3FIRA 4OEVA 3K1PA 4DZ1A 2XXYA 2ZYKA 4YU0A 3K2DA 3PUWE 3BBRA 3H6TA 5DTBA 5F7VA 5FHOA 4XKPA 1URDA 1JEVA 2WKYA 4Q30B 1LFIA 5TPAA 4YMAA 1I6QA 3I5OA 3H3GA 1HSLA 4G8NA 5CMKA 1DTZA 4LP2B 4TQUQ 3EHSA 5TP9B 1ELJA 3ODBA 3TFLA 2NXOA 3A3UA 4OXVA 2IA4A 4F2QA 4F1VA 2Q2AA 2HAVA 4WKMA 3GZGA 3DP8A 2XXVA 5M2VA 3IO4A 4ESWA 1O64A 3R6UA 5ICQA 1IIWA 1Y4CA 1MY1A 1UTHA 4F18A 4GQOA 3VLVA 2XD3A 1M5DA 4F39A 1MPCA 2O68A 4PFYA 3QAXA 2G93A 4F29A 1NNKA 4HS7A 4HW8A 3PPRA 1UIUA 2XX8A 2O1LA 3TQLA 3LSLA 1Y20A 4WXJA 4DE8A 4MFIA 4PP0A 3EHUA 2XXPA 2H5YA 3RTWB 4X1DA 2QL3A 3FGSA 4KYSA 3HHFA 3U72A 4IO3A 3BFUA 4OENA 2I49A 5AE4A 4FEBA 4RXLA 1PB7A 3T9XB 3FXRA 3O29A 3QXMA 4C1UA 2HQ0A 3FJMA 3M3KA 4JSOA 4GL0A 3C34A 1Y1ZA 2DWIA 2A5TA 2OWTA 4R72A 4OERA 1MXVA 1XVXA 3C4MA 1DTGA 3W15C 3ZSFA 1SD3A 3RN8A 4LZ5A 1R9LA 1HSJA 3MZBA 1N7XA 3KN3A 2Y7PA 3TCHA 3IB2A 2ZYNA 1QKAA 2XXQA 5ELVA 1Y4TA 5FHNA 4PFTA 2KLFA 3PD8A 4E0WA 3N6UA 3MVXA 2XX7A 5IAIA 2DVZA 1XHYA 1M5FA 1ZMGA 5KDTA 2ZYOA 3RNNA 4RYAA 1JVYA 1VR5A 1Q1KA 5I56B 4NF6B 4EF2A 3FJGA 3VLUA 4PE5B 3PUVE 1QUKA 5K2YA 4KD5A 1QJMA 3OENA 1A8FA 4YZZA 3SEWA 1A55A 1PBQA 3K1MA 4RY1A 5EHMA 3DM0A 4ZEBA 3CRBA 4WEDA 3MAMA 5I58B 3L6HA 2UXAA 1IUDA 3PUXE 2QMXA 2QS1A 4TLLB 3IB1A 4YKJA 3CFZA 3EHTA 2UVHA 1FTMA 4GLIA 3T96B 2F6GA 2X7QA 5ISUA 3FASA 1RYXA 4IY6A 3W9VA 3T9HB 4F1UA 4F3SA 3H7MA 5ICTA 3N6TA 3S4UA 3TODA 1OLCA 3HV1A 5L9MA 4I62A 3G3HA 1IZ1A 2O6AA 4N07A 1AMFA 2H98A 2Z8DA 5H8SA 2V3UA 4N13A 2PT2A 4XKNA 1N0TA 1MM6A 5H8NB 2THIA 2HEUA 2DOJA 1MY4A 4AB5A 1JNFA 1RYOA 5H8HB 2H4IA 3N5LA 2VGQA 5AA3A 2OJTA 1AH5A 1UTBA 4IO2A 3FATA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5L9S A;  3CIJ A;  4F31 B;  3DP6 A;  3HN0 A;  1EZO A;  3A09 A;  1B1X A;  3OEM A;  4GOT A;  2RC9 A;  2O84 X;  3FD3 A;  1DPP A;  2AYS A;  2E0S A;  3KEI A;  3OEK A;  5I57 B;  3PPQ A;  3MVZ A;  4U2R A;  4P0G A;  1YAE A;  5LOM A;  1MXW A;  4G77 A;  1NKX A;  4TLM B;  2OWS A;  4NED A;  4OEU A;  4G68 B;  4X1B A;  1BTJ A;  1NFT A;  2QS3 A;  1P1N A;  2P2A A;  1B9J A;  1QKB A;  4LQ5 A;  2O69 A;  3KFM A;  3KSX A;  4LON B;  3K01 A;  4F3P A;  5I2K B;  4BDL A;  4R73 A;  5TP9 A;  3PUZ E;  1Y1M A;  4H5G A;  2Y7R A;  1FW0 A;  3G3J A;  1LST A;  4N6P A;  4KR5 A;  1AIV A;  4NTL A;  2Z23 A;  3S9E A;  2F6P A;  3SDF A;  1LAF E;  4H1X A;  3TCG A;  4F1Y A;  1ANF A;  5JEI A;  5FTH A;  3LSX A;  2H9B A;  1JW5 A;  2QJE A;  1NNT A;  1SI1 A;  1FTL A;  2OCU A;  2QS4 A;  4ONY A;  3TKD A;  4DLD A;  3PMV A;  4X9T A;  3TDJ A;  1NNP A;  1OQH A;  2R71 A;  3ZS6 A;  3FVG A;  1MDQ A;  2V93 A;  4QFO A;  1VFE A;  1EH3 A;  4YKK A;  3K4U A;  1MH3 A;  3I3V A;  2FYI A;  1PBP A;  2DWJ A;  3ZKK A;  3MC2 A;  1SW2 A;  1B5J A;  4G8M A;  1A99 A;  3IJO B;  1WOD A;  2DE4 A;  5TU0 A;  2ONS A;  4FE8 A;  5CBR A;  2HZL A;  4LA9 A;  3DLN A;  3H6V A;  3U8Q A;  3IOT A;  4FOR A;  3VXB A;  2V3T A;  5L8D A;  3K6V A;  4U1Z A;  4Z7E A;  3C36 A;  5I59 B;  4YB6 A;  3HO7 A;  2HAU A;  2AIX A;  4JXI A;  3CVG A;  4ZS9 A;  4QRZ A;  3T66 A;  5CC2 A;  3FVO A;  1LFH A;  1FTO A;  4KHZ E;  2D21 A;  3EQ1 A;  3CSG A;  3GBA A;  3TAJ A;  2GFE A;  4ZZE A;  4KQP A;  3B6W A;  4YB5 A;  2RF1 A;  1OVT A;  1P1W A;  2Y84 A;  5I56 A;  3PPO A;  4NF6 A;  4YAH X;  3O6I A;  1N3W A;  1USY E;  5I2N B;  5J1D A;  4AB6 A;  4JDF A;  3PUY E;  3O9P A;  1FQF A;  3KG2 A;  1I6A A;  2V3Q A;  4E0X A;  3MP6 A;  1FQD A;  1NNF A;  4OFJ A;  2QRY A;  3O2A A;  5I58 A;  4I8C A;  1MXX A;  2QSX A;  2V25 A;  4QSD A;  1I69 A;  4U21 A;  3SKP A;  3PU5 A;  1B46 A;  1OLA A;  4M1V A;  3SEY A;  2I0B A;  1US5 A;  3IL1 B;  3PPP A;  3IK6 B;  4MH5 A;  4YKP A;  1A54 A;  1MQH A;  1XS5 A;  3THI A;  4UA8 A;  1B40 A;  3RT8 A;  2D5W A;  2XX9 A;  3O28 A;  2F36 A;  2I58 A;  1P99 A;  2VHA A;  4DIG A;  2AL5 A;  3MPK A;  3KJ7 A;  1MXU A;  3K02 A;  3CR9 A;  2Q9T A;  2ZXT A;  5H8N A;  1FCK A;  4U4X A;  3K6W A;  1I6B A;  1IXG A;  3MWB A;  3KOS A;  2UYF A;  5H8H A;  1ZKB A;  3PV0 E;  1B7Z A;  2XXR A;  2ALU A;  1J1N A;  4PFU A;  4MLQ A;  1T0K A;  4KYE A;  3CG3 A;  5DVI A;  4ELO A;  1MY2 A;  4H8J A;  4RPO A;  2RC8 A;  3IOR A;  2X26 A;  5H8Q B;  2NUV A;  1VSO A;  4OES A;  2UVI A;  1PDA A;  3LC8 A;  3K6X A;  4Q8R A;  3HPI A;  1B3G A;  2AL4 A;  1GVC A;  1B0L A;  3CSB A;  5F1Q A;  4ZE8 A;  5I57 A;  1WDN A;  4O3A A;  2P0S A;  2DYX A;  1LB9 A;  4NF5 B;  1IQ7 A;  4LAT A;  4HCY A;  5CMC A;  1SQY A;  2REJ A;  3FVK A;  1SYH A;  4IGT A;  4K3F A;  4G68 A;  3ILU B;  4IGR A;  3I6V A;  4C0R A;  5DT6 A;  2B3F A;  3ECR A;  1LFG A;  4NF4 B;  5I2K A;  1B32 A;  2XXU A;  3OOA A;  4GWO A;  4KI0 E;  4EQ7 A;  4IO4 A;  3MZ1 A;  1H76 A;  3IAZ A;  3PD9 A;  3D4C A;  1B52 A;  1P1O A;  4QFN A;  1EU8 A;  1SBP A;  1ZTY A;  4R2B A;  3OO8 A;  3GBB A;  1RKM A;  5CI5 A;  1JEU A;  2I6E A;  3H6W A;  3FZV A;  2O1M A;  2H99 A;  1B6H A;  1CB6 A;  1OQG A;  4POX A;  5B7D A;  4OYV A;  1SW1 A;  3ONM A;  1MY3 A;  4KCC A;  4DDD A;  2F35 A;  3UP9 A;  4LQ2 A;  3TQW A;  4LZ7 A;  3IX1 A;  3C31 A;  4H0W A;  1R9Q A;  3LBS A;  5HM4 B;  4HTG A;  1A40 A;  4EF1 A;  4G8H A;  4GFR A;  1B7H A;  1H43 A;  3Q27 A;  4UAC A;  4OTE A;  3T9V A;  3IJX B;  4YB7 A;  2UVJ A;  4ELP A;  3TPA A;  5KZT A;  4ZEC A;  4DCX A;  3WAE A;  2X7P A;  4OQO A;  1O7T A;  2PX1 A;  4U23 A;  4U22 A;  1LCT A;  2HFB A;  2F78 A;  4ELQ A;  4RNS A;  3SEU A;  4QSE A;  3FV2 A;  1L5T A;  3R7X A;  2H25 A;  5I59 A;  3TMG A;  1MXZ A;  1YPN A;  5BWJ A;  5H8F B;  3AXF A;  5AA2 B;  4GD5 A;  2XD2 A;  4ZZA A;  2A5S A;  4ISU A;  4R9F A;  4EUO A;  3B6T A;  2P1S A;  2NOO A;  4RA1 A;  2B3B A;  2VD3 A;  1TXF A;  3CFX A;  4IY5 A;  1NL5 A;  2QPQ A;  4FED A;  3KBR A;  1B51 A;  1MPD A;  3FJ7 A;  1Z7M E;  3H6U A;  5I2N A;  2PMS A;  1B3E A;  2HXW A;  4PFW A;  2NVU B;  3FXU A;  4P11 A;  2Y7I A;  1Y3N A;  4FIM A;  4FAJ A;  3TUS A;  4G68 C;  3C32 A;  5A5X B;  1ZU0 A;  1ZJL A;  1XVY A;  3RPW A;  3OMB A;  1XT8 A;  4OFO A;  4H8I A;  2IEE A;  3U94 A;  4NE4 A;  2GRV A;  4DCY A;  3K1N A;  3OO9 A;  4ND9 A;  2VOZ A;  3MBP A;  5CBS A;  1D3K A;  3RT6 B;  4EXK A;  2RKM A;  3OD7 A;  3TEP A;  3UOR A;  1SYI A;  3TTN A;  2I48 A;  4XXU A;  4ESX A;  5K2X A;  2PBW A;  1P1Q A;  1M5E A;  2I4C A;  4OMB A;  3VDF A;  1LAG E;  1YTV A;  2O7U A;  5KCJ B;  2XHD A;  3GXA A;  3TTM A;  2Y7K A;  3V5A A;  3ILT B;  1BIY A;  1OMP A;  3MP8 A;  4YKI A;  4AQ4 A;  3S9N C;  1MXY A;  1MQG A;  1TFD A;  3G3K A;  1QW0 A;  1R6Z A;  1PB8 A;  4F22 A;  2VP1 A;  3FXQ A;  4ELR A;  3CFL A;  1H44 A;  3Q26 A;  2F7A A;  2E1S A;  3O66 A;  4X48 A;  5H8Q A;  4Q0C A;  5HPQ A;  1QUJ A;  5B70 A;  1LBB A;  4O3B A;  3TTK A;  4MLV A;  4EDP A;  1D4N A;  4MBP A;  3MZ9 A;  3U1O A;  1N3X A;  2HZK A;  1S7Y A;  3H03 A;  3LUY A;  1PC3 A;  4FEC A;  3PGF A;  3RY3 A;  1TT1 A;  4RK9 A;  5CRY A;  4F3B A;  5I84 A;  4R6H A;  3KSJ A;  3VVF A;  4BDM A;  1US4 A;  1H45 A;  3OEL A;  1F9B A;  4BDQ A;  1LAH E;  4U4S A;  3KGC A;  1FTK A;  4ZEF A;  4BDR A;  3FVN A;  5DEX B;  4Z0I A;  2M8C A;  2XXI A;  4NF4 A;  3MVY A;  4QHQ A;  3QK6 A;  4GXS B;  3CI8 A;  4FAT A;  3IOW A;  5JTY B;  1B4Z A;  3UA8 A;  3LSW A;  4QSC A;  1AL3 A;  4XKQ A;  2OLB A;  3L6G A;  1LAX A;  4NMY A;  5JK4 A;  4JWX A;  4M4G A;  3KZG A;  4ZE9 A;  4PQJ A;  3PMW A;  3T9U A;  4G4P A;  5ITP A;  2QS2 A;  1LGB C;  4OZ9 A;  3TTR A;  2F5X A;  3IB0 A;  4R6K A;  3VVD A;  3E13 X;  2YJP A;  4LVQ A;  1GTK A;  3GLB A;  5ITO A;  1JQF A;  4NF8 B;  2ZNT A;  4P0I A;  3UGW A;  1N7W A;  2Q88 A;  3VLW A;  3N26 A;  3Q29 A;  3MUQ A;  4Q5T A;  1BP5 A;  1NMU A;  1D9Y A;  1UQW A;  4JB7 A;  3V8X B;  4IO5 A;  4H5F A;  1YCJ A;  4KCD A;  3BFT A;  4DXU A;  2D3I A;  1DSN A;  2F7C A;  4JWY A;  1SDX A;  2Z8F A;  5CMB A;  3N94 A;  4THI A;  2YLN A;  1MS7 A;  2DE2 A;  4RK2 A;  1FQC A;  1Z7N E;  2ZMB A;  1URG A;  1ZIU A;  2ESN A;  2OK2 A;  2PYY A;  3HST A;  3UIF A;  1IEJ A;  1MG1 A;  5FTI A;  5EYF A;  4KFQ A;  4LZ8 A;  3K0V A;  3MVW A;  3DEL B;  4R2F A;  1TFA A;  3TTL A;  1NH8 A;  5H8F A;  2B65 A;  3Q28 A;  5AA2 A;  2F97 A;  2CZL A;  3RUM A;  3PPN A;  1FQB A;  1FTJ A;  3O6G A;  5DVF A;  4GF8 A;  3JZJ A;  1OIB A;  1VE4 A;  4BLA A;  4POW A;  3TYH A;  1B4H A;  3LSF B;  3QIM A;  2DSF A;  1KWH A;  1HSE A;  3K00 A;  1B5I A;  4HCW A;  4ZEK A;  1FQA A;  4OFL A;  1B3L A;  1LB8 A;  4XTC Q;  1GGG A;  1Y9U A;  4XIG Q;  3SEV A;  3KOT A;  4JWO A;  4G2Z A;  2OZZ A;  1MM7 A;  4GXA A;  5A5X A;  1GR2 A;  2GHB A;  1QUL A;  3HHG A;  4L17 A;  2HCA A;  3SET A;  3KJT A;  3KN8 A;  1SVX B;  2UVG A;  3JYR A;  1IIT A;  5AA4 B;  1AOV A;  1VFD A;  2REG A;  2VD2 A;  1JW4 A;  1R1N A;  4YIC A;  3FV1 A;  2XXH A;  2Q8J A;  2OBG A;  4QFL A;  3IOV A;  4KPT A;  1B0H A;  5KCJ A;  2RCA A;  3UK4 A;  4H67 A;  1B3F A;  2XXT A;  1D9V A;  1M5B A;  3MW0 A;  4XKR A;  4H6D A;  5DYH A;  3C9H A;  3E4R A;  1P1U A;  3UN6 A;  4GVO A;  1LCF A;  3M3L A;  1FQE A;  5IKB A;  4F3G A;  2RCB A;  3BKI B;  4ZED A;  1OVB A;  4H65 A;  3IO6 A;  3OO6 A;  3O6H A;  3VE1 B;  1JW1 A;  1B3H A;  4TOZ A;  1NH7 A;  3KN7 A;  1URS A;  3G3G A;  4OET A;  1MH4 A;  1B7U A;  3SES A;  3W9W A;  1DOT A;  1DMB A;  4WEP A;  3S2V A;  1B1H A;  3IOU A;  3A3C A;  3VFJ A;  1GV8 A;  2YPN A;  3VVE A;  1XC1 A;  1POT A;  5TPA B;  4EXL A;  1USY H;  1BLF A;  1POY 1;  4MF3 A;  2G29 A;  4O3C A;  1XOC A;  3M8U A;  1O63 A;  5AA2 D;  1WVJ A;  3EF7 A;  3USD A;  4OHN A;  4U1O A;  1JVX A;  1LBC A;  1S9T A;  2RIN A;  3H06 B;  4BDN A;  1Y3P A;  2Z22 A;  5DEX A;  5CMM A;  1BKA A;  2ZYM A;  2V84 A;  1SI0 A;  1EZP A;  1UTH B;  3TCF A;  2FNC A;  5JTY A;  5BUU A;  4GL8 A;  3CG1 A;  2Q89 A;  3G3I A;  4BDO A;  1ATG A;  3IR1 A;  3S9M C;  3K6U A;  4R75 A;  5DVJ A;  2QMW A;  1MDP 1;  2GH9 A;  2R9J A;  2R6G E;  4JBZ A;  3OO7 A;  2XXW A;  3OSQ A;  2PVU A;  3PMX A;  1SW4 A;  3C33 A;  1IXI A;  2XXX A;  4EQB A;  4QF9 A;  5HBC A;  3SER A;  2DE3 A;  2F34 A;  3OXN A;  1MQD A;  2Q2C A;  4GIZ A;  4EQ9 A;  2DWA A;  4IO6 A;  3RLF E;  3RTF B;  1SW5 A;  3OSR A;  5CM6 A;  2GHA A;  2CMO A;  4LUB A;  1N76 A;  1N84 A;  4NF8 A;  3E3K A;  1B05 A;  4KYD A;  1DPE A;  3U93 A;  1II5 A;  2BJJ X;  1LLS A;  2F8D A;  1IXH A;  3Q25 A;  2A5T B;  4OWD A;  2ZNS A;  3RGY A;  4I9D A;  4R6Y A;  1N04 A;  3QUF A;  2UYE A;  1TWY A;  3VV5 A;  3V83 A;  5AA1 A;  4ZEI A;  1MRP A;  2ABH A;  4NWC A;  3H4Z A;  4RJZ A;  1H3D A;  1QVS A;  3MQ9 A;  3T93 B;  1MQI A;  1MPB A;  4IB2 A;  5KDT B;  3O97 A;  1PB9 A;  4ZDM A;  3TZA A;  1M5C A;  3EPE A;  4I1D A;  2I3W A;  3G3F A;  2DS9 A;  3T22 A;  4GRK A;  1CE2 A;  2RC7 A;  2Z8E A;  3TEL A;  2ANJ A;  4IO7 A;  2DXY A;  4YMB A;  4ECF A;  1B2H A;  2O51 A;  1ZLQ A;  2Y7W A;  2DP8 A;  2I3V A;  2ZNU A;  1S50 A;  2ONR A;  3JV9 A;  1B58 A;  2NWJ A;  1JET A;  2DWH A;  4DXC A;  1QUI A;  1UIV A;  5EHS A;  3D4G A;  3SEX A;  3MP1 A;  4QFK A;  1IXC A;  3F11 A;  3M3F A;  4OVJ A;  4JSD A;  4C1T A;  4NF5 A;  1PEB A;  2FA7 A;  3WAF A;  3C35 A;  5L9O A;  3B7D A;  2LAO A;  3P7I A;  3G7W A;  3V89 B;  5AA4 A;  2W7Y A;  3MPL A;  3LR1 A;  1MY0 A;  3ZKL A;  1Q35 A;  3EN3 A;  3R26 A;  5FHM A;  1Y3Q A;  3QYT A;  4QFP A;  1EZ9 A;  2DVC A;  3S9L C;  4NWD A;  1MQJ A;  4F19 A;  3RQT A;  3QSL A;  4F2O A;  3QUJ A;  1UTB B;  3MJN A;  2F7B A;  4PET A;  1B5H A;  4DXB A;  2PT1 A;  1A7L A;  4FJP A;  4RPN A;  3U92 A;  3E9X A;  1A8E A;  2O7I A;  2I0C A;  3B6Q A;  3HCQ A;  3VXC A;  2DXR A;  2ONK E;  2DQV A;  4R74 A;  1ZBM A;  3FUZ A;  4R9G A;  3DP4 A;  2I4B A;  3FIR A;  4OEV A;  3K1P A;  4DZ1 A;  2XXY A;  2ZYK A;  4YU0 A;  3K2D A;  3PUW E;  3BBR A;  3H6T A;  5DTB A;  5F7V A;  5FHO A;  4XKP A;  1URD A;  1JEV A;  2WKY A;  4Q30 B;  1LFI A;  5TPA A;  4YMA A;  1I6Q A;  3I5O A;  3H3G A;  1HSL A;  4G8N A;  5CMK A;  1DTZ A;  4LP2 B;  4TQU Q;  3EHS A;  5TP9 B;  1ELJ A;  3ODB A;  3TFL A;  2NXO A;  3A3U A;  4OXV A;  2IA4 A;  4F2Q A;  4F1V A;  2Q2A A;  2HAV A;  4WKM A;  3GZG A;  3DP8 A;  2XXV A;  5M2V A;  3IO4 A;  4ESW A;  1O64 A;  3R6U A;  5ICQ A;  1IIW A;  1Y4C A;  1MY1 A;  1UTH A;  4F18 A;  4GQO A;  3VLV A;  2XD3 A;  1M5D A;  4F39 A;  1MPC A;  2O68 A;  4PFY A;  3QAX A;  2G93 A;  4F29 A;  1NNK A;  4HS7 A;  4HW8 A;  3PPR A;  1UIU A;  2XX8 A;  2O1L A;  3TQL A;  3LSL A;  1Y20 A;  4WXJ A;  4DE8 A;  4MFI A;  4PP0 A;  3EHU A;  2XXP A;  2H5Y A;  3RTW B;  4X1D A;  2QL3 A;  3FGS A;  4KYS A;  3HHF A;  3U72 A;  4IO3 A;  3BFU A;  4OEN A;  2I49 A;  5AE4 A;  4FEB A;  4RXL A;  1PB7 A;  3T9X B;  3FXR A;  3O29 A;  3QXM A;  4C1U A;  2HQ0 A;  3FJM A;  3M3K A;  4JSO A;  4GL0 A;  3C34 A;  1Y1Z A;  2DWI A;  2A5T A;  2OWT A;  4R72 A;  4OER A;  1MXV A;  1XVX A;  3C4M A;  1DTG A;  3W15 C;  3ZSF A;  1SD3 A;  3RN8 A;  4LZ5 A;  1R9L A;  1HSJ A;  3MZB A;  1N7X A;  3KN3 A;  2Y7P A;  3TCH A;  3IB2 A;  2ZYN A;  1QKA A;  2XXQ A;  5ELV A;  1Y4T A;  5FHN A;  4PFT A;  2KLF A;  3PD8 A;  4E0W A;  3N6U A;  3MVX A;  2XX7 A;  5IAI A;  2DVZ A;  1XHY A;  1M5F A;  1ZMG A;  5KDT A;  2ZYO A;  3RNN A;  4RYA A;  1JVY A;  1VR5 A;  1Q1K A;  5I56 B;  4NF6 B;  4EF2 A;  3FJG A;  3VLU A;  4PE5 B;  3PUV E;  1QUK A;  5K2Y A;  4KD5 A;  1QJM A;  3OEN A;  1A8F A;  4YZZ A;  3SEW A;  1A55 A;  1PBQ A;  3K1M A;  4RY1 A;  5EHM A;  3DM0 A;  4ZEB A;  3CRB A;  4WED A;  3MAM A;  5I58 B;  3L6H A;  2UXA A;  1IUD A;  3PUX E;  2QMX A;  2QS1 A;  4TLL B;  3IB1 A;  4YKJ A;  3CFZ A;  3EHT A;  2UVH A;  1FTM A;  4GLI A;  3T96 B;  2F6G A;  2X7Q A;  5ISU A;  3FAS A;  1RYX A;  4IY6 A;  3W9V A;  3T9H B;  4F1U A;  4F3S A;  3H7M A;  5ICT A;  3N6T A;  3S4U A;  3TOD A;  1OLC A;  3HV1 A;  5L9M A;  4I62 A;  3G3H A;  1IZ1 A;  2O6A A;  4N07 A;  1AMF A;  2H98 A;  2Z8D A;  5H8S A;  2V3U A;  4N13 A;  2PT2 A;  4XKN A;  1N0T A;  1MM6 A;  5H8N B;  2THI A;  2HEU A;  2DOJ A;  1MY4 A;  4AB5 A;  1JNF A;  1RYO A;  5H8H B;  2H4I A;  3N5L A;  2VGQ A;  5AA3 A;  2OJT A;  1AH5 A;  1UTB A;  4IO2 A;  3FAT A; 
#chains in the Genus database with same CATH topology
 5L9S A;  3CIJ A;  4F31 B;  5F24 A;  2Q74 A;  3DP6 A;  3HN0 A;  4X04 A;  4PE3 A;  1IMB A;  1EZO A;  3A09 A;  1B1X A;  3OEM A;  4GOT A;  2ZZV A;  2RC9 A;  2O84 X;  1FRP A;  1FBD A;  3FD3 A;  1DPP A;  2AYS A;  2E0S A;  1FBH A;  3KEI A;  3OEK A;  5I57 B;  3PPQ A;  3MVZ A;  4U2R A;  4P0G A;  3QMF A;  1K9Y A;  1YAE A;  5LOM A;  4GWX A;  1MXW A;  4G77 A;  1NKX A;  4TLM B;  2OWS A;  4NED A;  4OEU A;  4G68 B;  4X1B A;  1BTJ A;  4NGU A;  1NFT A;  2QS3 A;  1P1N A;  2P2A A;  1B9J A;  1QKB A;  4LQ5 A;  2WEF A;  2O69 A;  3KFM A;  3KSX A;  1FPJ A;  4LON B;  3K01 A;  4F3P A;  5I2K B;  4BDL A;  4N4U A;  4R73 A;  3PUZ E;  1Y1M A;  2OWZ A;  5TP9 A;  3NOH A;  4H5G A;  2Y7R A;  1FW0 A;  3G3J A;  4JVD A;  1LST A;  1YYZ A;  4N6P A;  4KR5 A;  1AIV A;  4NTL A;  2Z23 A;  4PFI A;  3S9E A;  2F6P A;  3SDF A;  1LAF E;  4H1X A;  3TCG A;  4F1Y A;  1ANF A;  5JEI A;  5FTH A;  3LSX A;  2H9B A;  1JW5 A;  2QJE A;  1NNT A;  1SI1 A;  1LBW A;  1FTL A;  2OCU A;  2QS4 A;  4ONY A;  1EYJ A;  3TKD A;  4DLD A;  3PMV A;  5I5P A;  4X9T A;  5IZZ A;  3TDJ A;  1NNP A;  1OQH A;  2R71 A;  3ZS6 A;  3FVG A;  1MDQ A;  2CZK A;  2V93 A;  4NN3 A;  1VDW A;  4QFO A;  1VFE A;  1EH3 A;  5A5L A;  1NUY A;  4YKK A;  3K4U A;  1MH3 A;  3I3V A;  2FYI A;  1PBP A;  1YXI A;  2DWJ A;  3IFA A;  3ZKK A;  5ET7 A;  3MC2 A;  1SW2 A;  1B5J A;  4G8M A;  1A99 A;  3IJO B;  1WOD A;  2DE4 A;  4FBP A;  5TU0 A;  2ONS A;  4FE8 A;  5CBR A;  2HZL A;  4LA9 A;  3DLN A;  3H6V A;  3U8Q A;  3IOT A;  4FOR A;  3VXB A;  3BIH A;  2CZI A;  4I3Y A;  2V3T A;  5L8D A;  3K6V A;  4U1Z A;  4Z7E A;  3C36 A;  3SZP A;  5I59 B;  4YB6 A;  3HO7 A;  2HAU A;  2AIX A;  4JXI A;  2MKZ A;  3CVG A;  4ZS9 A;  4QRZ A;  3T66 A;  5CC2 A;  3FVO A;  1LFH A;  1FTO A;  4KHZ E;  2D21 A;  3EQ1 A;  4GX3 A;  3CSG A;  3GBA A;  3TAJ A;  2QVU A;  2GFE A;  4ZZE A;  4KQP A;  3B6W A;  4YB5 A;  2RF1 A;  1OVT A;  1P1W A;  2Y84 A;  5I56 A;  3PPO A;  4NF6 A;  1KA0 A;  4YAH X;  5IZ3 A;  3O6I A;  1N3W A;  5J16 A;  1USY E;  5I2N B;  5J1D A;  4PC9 A;  4AB6 A;  4JDF A;  4GBV A;  3PUY E;  3O9P A;  1FQF A;  2P3N A;  3KG2 A;  1I6A A;  2V3Q A;  4E0X A;  3MP6 A;  1FQD A;  1NNF A;  4OFJ A;  2QRY A;  3O2A A;  4NX1 A;  5I58 A;  4I8C A;  1MXX A;  4MJO A;  2QSX A;  2V25 A;  4QSD A;  4OVP A;  1I69 A;  4U21 A;  3SKP A;  3PU5 A;  2XXK A;  1B46 A;  1OLA A;  4M1V A;  3SEY A;  2I0B A;  1US5 A;  3IL1 B;  1IME A;  2CEY A;  3PPP A;  3IK6 B;  4MH5 A;  4YKP A;  1A54 A;  1MQH A;  1XS5 A;  4AS4 A;  3THI A;  4UA8 A;  1B40 A;  3RT8 A;  4MAG A;  2D5W A;  2XX9 A;  2B4L A;  3O28 A;  2F36 A;  2I58 A;  1P99 A;  2VHA A;  4DIG A;  2AL5 A;  1G0H A;  3MPK A;  3KJ7 A;  1MXU A;  3K02 A;  1Q9D A;  3CR9 A;  2Q9T A;  2ZXT A;  2WYK A;  5H8N A;  1FBC A;  1FCK A;  2FHY A;  4U4X A;  3K6W A;  1I6B A;  2CEX A;  1IXG A;  3MWB A;  3KOS A;  2UYF A;  5H8H A;  1ZKB A;  3PV0 E;  2XA5 A;  1B7Z A;  2XXR A;  4P56 A;  2ALU A;  1J1N A;  4PFU A;  4MLQ A;  1T0K A;  4KYE A;  3CG3 A;  5DVI A;  2XWI A;  4ELO A;  1MY2 A;  4H8J A;  3E78 A;  4RPO A;  2RC8 A;  4P8B A;  3IOR A;  2X26 A;  5H8Q B;  2NUV A;  1VSO A;  4OES A;  2UVI A;  1PDA A;  3LC8 A;  3K6X A;  4O7M A;  4Q8R A;  1FPK A;  2XWO A;  3HPI A;  1LBY A;  1B3G A;  2AL4 A;  1GVC A;  1B0L A;  3CSB A;  5F1Q A;  4XF5 A;  4ZE8 A;  5I57 A;  1WDN A;  1NV2 A;  4O3A A;  2P0S A;  2DYX A;  3D1R A;  1LB9 A;  2FVZ A;  4NF5 B;  1IQ7 A;  4LAT A;  4HCY A;  5CMC A;  1SQY A;  2REJ A;  3FVK A;  1SYH A;  4IGT A;  4K3F A;  4G68 A;  3ILU B;  4IGR A;  3I6V A;  4C0R A;  5DT6 A;  1IMD A;  2B3F A;  5IGA A;  4N8Y A;  3ECR A;  1LFG A;  4NF4 B;  5I2K A;  4PGP A;  1B32 A;  2XXU A;  2FIX A;  3OOA A;  4GWO A;  4KI0 E;  4EQ7 A;  4IO4 A;  2HXR A;  3MZ1 A;  1H76 A;  3IAZ A;  3PD9 A;  4N6D A;  3D4C A;  1B52 A;  1P1O A;  4QFN A;  1EU8 A;  1SBP A;  1NV0 A;  1ZTY A;  4R2B A;  3OO8 A;  3GBB A;  1RKM A;  5CI5 A;  1JEU A;  2I6E A;  3H6W A;  3FZV A;  2O1M A;  2L5V A;  1FPI A;  4H45 A;  2H99 A;  1B6H A;  1CB6 A;  1OQG A;  4QXD A;  5I3S A;  4POX A;  5B7D A;  4XEQ A;  4OYV A;  1SW1 A;  3ONM A;  1MY3 A;  1DCU A;  4KCC A;  4DDD A;  2F35 A;  3UP9 A;  1FJ9 A;  1LBX A;  4LQ2 A;  3TQW A;  4LZ7 A;  3IX1 A;  3C31 A;  4H0W A;  1R9Q A;  4MHF A;  3LBS A;  5HM4 B;  4HTG A;  1A40 A;  4EF1 A;  4G8H A;  3KBZ A;  1FPE A;  4GFR A;  1B7H A;  1H43 A;  3Q27 A;  4UAC A;  4OTE A;  3T9V A;  3LUZ A;  3IJX B;  4YB7 A;  2UVJ A;  2HHM A;  4MNC A;  4ELP A;  3FBP A;  3TPA A;  5KZT A;  4ZEC A;  2DDK A;  4DCX A;  3WAE A;  2X7P A;  4OQO A;  1O7T A;  2PX1 A;  4U23 A;  4U22 A;  1LCT A;  2HFB A;  2Y5K A;  2F78 A;  4ELQ A;  4OVQ A;  4RNS A;  3SEU A;  4QSE A;  3FV2 A;  1L5T A;  3R7X A;  2H25 A;  5I59 A;  3TMG A;  1MXZ A;  1YPN A;  5ET8 A;  5BWJ A;  5H8F B;  3AXF A;  5AA2 B;  4GD5 A;  2XD2 A;  4ZZA A;  2A5S A;  4ISU A;  3T0J A;  4R9F A;  4EUO A;  3B6T A;  2P1S A;  2NOO A;  4RA1 A;  2B3B A;  3IFC A;  2VD3 A;  1TXF A;  3CFX A;  4IY5 A;  1NL5 A;  2F3D A;  4NF0 A;  3A29 A;  2QPQ A;  5EYG A;  4FED A;  3KBR A;  1B51 A;  1MPD A;  2XWK A;  3FJ7 A;  1Z7M E;  1YZ0 A;  3H6U A;  5I2N A;  2PMS A;  1B3E A;  2HXW A;  4PFW A;  2NVU B;  3FXU A;  4P11 A;  2Y7I A;  1Y3N A;  1IMF A;  3ROJ A;  2BJI A;  4PGN A;  4FIM A;  4FAJ A;  3TUS A;  4G68 C;  4MCO A;  3C32 A;  5A5X B;  1ZU0 A;  1ZJL A;  1XVY A;  3RPW A;  3OMB A;  1LBZ A;  1XT8 A;  4OFO A;  1NV6 A;  4H8I A;  2IEE A;  3U94 A;  4NE4 A;  2GRV A;  4DCY A;  4UAB A;  3K1N A;  3OO9 A;  4ND9 A;  2VOZ A;  3MBP A;  5CBS A;  4PDD A;  1D3K A;  3RT6 B;  4EXK A;  5T3J A;  2RKM A;  4MEV A;  3OD7 A;  3TEP A;  3UOR A;  4OA4 A;  1SYI A;  1FJ6 A;  1RDX A;  2GQ1 A;  3TTN A;  2I48 A;  4XXU A;  4ESX A;  5K2X A;  2PBW A;  1P1Q A;  1M5E A;  2I4C A;  4OMB A;  1FPF A;  3VDF A;  1LAG E;  2XWV A;  1YTV A;  2O7U A;  5KCJ B;  2XHD A;  3GXA A;  3TTM A;  2FIE A;  2Y7K A;  3V5A A;  2WX9 A;  3ILT B;  1BIY A;  1OMP A;  3MP8 A;  4YKI A;  4AQ4 A;  2QVV A;  3S9N C;  1MXY A;  1MQG A;  1TFD A;  3G3K A;  1QW0 A;  4P1L A;  1R6Z A;  1PB8 A;  4F22 A;  2VP1 A;  5ESY A;  3FXQ A;  3FXB A;  3CHG A;  4ELR A;  1JP4 A;  3CFL A;  1H44 A;  3Q26 A;  1IMA A;  5ET6 A;  2F7A A;  2E1S A;  3O66 A;  4X48 A;  5IM2 A;  5H8Q A;  4Q0C A;  5HPQ A;  1QUJ A;  5B70 A;  4GWZ A;  1LBB A;  4O3B A;  3TTK A;  4MLV A;  4EDP A;  1D4N A;  5EQ9 A;  4MBP A;  3MZ9 A;  3U1O A;  1N3X A;  2HZK A;  1S7Y A;  3H03 A;  3LUY A;  1PC3 A;  4FEC A;  3PGF A;  3RY3 A;  1TT1 A;  4RK9 A;  5CRY A;  4F3B A;  5I84 A;  1LBV A;  4R6H A;  3KSJ A;  3VVF A;  4BDM A;  4OAN A;  1H45 A;  1US4 A;  4X8R A;  3OEL A;  1F9B A;  4BDQ A;  1LAH E;  4U4S A;  5EYH A;  3KGC A;  1FTK A;  4ZEF A;  4N81 A;  4BDR A;  4GWU A;  3FVN A;  5DEX B;  4Z0I A;  2M8C A;  2XXI A;  4NF4 A;  3MVY A;  4QHQ A;  3QK6 A;  4GXS B;  4N8G A;  3CI8 A;  4FAT A;  3IOW A;  5JTY B;  4PAI A;  1B4Z A;  1NUX A;  3UA8 A;  4GWW A;  1FBP A;  3LSW A;  4QSC A;  1AL3 A;  4XKQ A;  2OLB A;  3L6G A;  1LAX A;  4NMY A;  5JK4 A;  1NV5 A;  1FPD A;  4JWX A;  4M4G A;  3KZG A;  4ZE9 A;  4PQJ A;  3PMW A;  3T9U A;  4G4P A;  5ITP A;  2QS2 A;  1LGB C;  4OZ9 A;  3TTR A;  2F5X A;  3IB0 A;  4R6K A;  3VVD A;  3E13 X;  2YJP A;  4LVQ A;  1GTK A;  3GLB A;  4PDH A;  5ITO A;  1JQF A;  4NF8 B;  2ZNT A;  4P0I A;  3UGW A;  1N7W A;  2Q88 A;  3VLW A;  3N26 A;  3Q29 A;  4OVR A;  3MUQ A;  4Q5T A;  1BP5 A;  1DBZ A;  1NMU A;  1D9Y A;  1UQW A;  4JB7 A;  3V8X B;  4IO5 A;  4H5F A;  1YCJ A;  4KCD A;  3BFT A;  4DXU A;  2D3I A;  1DSN A;  4AS5 A;  2F7C A;  4JWY A;  1SDX A;  2Z8F A;  2B4M A;  5CMB A;  3N94 A;  4THI A;  4GWY A;  1FPG A;  2YLN A;  1MS7 A;  2DE2 A;  4RK2 A;  1FQC A;  1Z7N E;  2ZMB A;  1URG A;  1ZIU A;  2ESN A;  2OK2 A;  2PYY A;  3HST A;  3UIF A;  1IEJ A;  1MG1 A;  4I3E A;  5FTI A;  1NV3 A;  5EYF A;  4KFQ A;  4LZ8 A;  3K0V A;  3MVW A;  3DEL B;  4R2F A;  1TFA A;  3TTL A;  1NH8 A;  5H8F A;  2B65 A;  3Q28 A;  5AA2 A;  2F97 A;  2CZL A;  3RUM A;  3PPN A;  1FQB A;  1FTJ A;  3O6G A;  5DVF A;  4GF8 A;  3JZJ A;  1OIB A;  1VE4 A;  4BLA A;  4POW A;  3TYH A;  1B4H A;  3LSF B;  4HE0 A;  3QIM A;  2DSF A;  1KWH A;  1HSE A;  3K00 A;  1B5I A;  4HCW A;  4ZEK A;  2Y5L A;  1FQA A;  4OFL A;  1B3L A;  1LB8 A;  4XTC Q;  3RPL B;  4H46 A;  1QGX A;  1GGG A;  1Y9U A;  4XIG Q;  3SEV A;  3KOT A;  4JWO A;  5EQ7 A;  4G2Z A;  2OZZ A;  5I7I A;  1MM7 A;  5LDZ A;  4GXA A;  5A5X A;  1GR2 A;  2GHB A;  4O8M A;  3LV0 A;  1QUL A;  3HHG A;  4L17 A;  2HCA A;  3SET A;  3KJT A;  3KN8 A;  1SVX B;  2UVG A;  3JYR A;  2VPN A;  1FPL A;  1IIT A;  5AA4 B;  1AOV A;  1VFD A;  2KQZ A;  3BIG A;  2REG A;  2VD2 A;  1JW4 A;  1R1N A;  4YIC A;  1NV1 A;  2HPG A;  4O94 A;  3FV1 A;  2XXH A;  2Q8J A;  2OBG A;  4QFL A;  3IOV A;  4KPT A;  1B0H A;  5KCJ A;  4PF8 A;  2RCA A;  4KXP A;  3UK4 A;  4H67 A;  1B3F A;  2XXT A;  3KC0 A;  1D9V A;  1M5B A;  2PFZ A;  4NQ8 A;  3MW0 A;  4IR8 A;  4XKR A;  4H6D A;  5DYH A;  4PCD A;  3C9H A;  3E4R A;  1P1U A;  3UN6 A;  1FBE A;  4GVO A;  5DW8 A;  1LCF A;  2PCR A;  3M3L A;  1FQE A;  5IKB A;  4F3G A;  2RCB A;  3BKI B;  4ZED A;  5EQ8 A;  1OVB A;  4H65 A;  1FTA A;  3IO6 A;  3OO6 A;  3O6H A;  3VE1 B;  1JW1 A;  1B3H A;  4TOZ A;  1NH7 A;  2CZH A;  3KN7 A;  1URS A;  3G3G A;  4OET A;  1MH4 A;  1B7U A;  3SES A;  3W9W A;  1DOT A;  1DMB A;  4WEP A;  3S2V A;  1B1H A;  4PTK A;  3IOU A;  3A3C A;  3VFJ A;  3ISP A;  1GV8 A;  3EKI A;  2YPN A;  3VVE A;  1XC1 A;  1NUZ A;  1POT A;  5TPA B;  4EXL A;  2OX3 A;  4HE1 A;  1USY H;  5EQA A;  1BLF A;  1POY 1;  4PBH A;  4MF3 A;  2G29 A;  3B50 A;  4O3C A;  1XOC A;  5LTC A;  3M8U A;  1O63 A;  5AA2 D;  1WVJ A;  3E79 A;  3EF7 A;  3MYU A;  3USD A;  4OHN A;  4U1O A;  1JVX A;  1LBC A;  1S9T A;  2ZZX A;  2RIN A;  3H06 B;  4BDN A;  1Y3P A;  2Z22 A;  5DEX A;  5CMM A;  1BKA A;  2ZYM A;  2V84 A;  1SI0 A;  1EZP A;  1UTH B;  3TCF A;  2FNC A;  4P3L A;  5JTY A;  5BUU A;  4GL8 A;  3CG1 A;  4PF6 A;  2Q89 A;  3G3I A;  4BDO A;  1KA1 A;  1ATG A;  3IR1 A;  3S9M C;  3K6U A;  4R75 A;  5DVJ A;  2QMW A;  1MDP 1;  2GH9 A;  2R9J A;  4NG7 A;  2R6G E;  4JBZ A;  3OO7 A;  4GWS A;  2XXW A;  3OSQ A;  2PVU A;  3PMX A;  1SW4 A;  1LEV A;  3C33 A;  1IXI A;  2XXX A;  4EQB A;  3MST A;  4QF9 A;  5HBC A;  3SER A;  1EYI A;  2DE3 A;  2F34 A;  3OXN A;  1MQD A;  2Q2C A;  4GIZ A;  4EQ9 A;  1CNQ A;  2DWA A;  4IO6 A;  3RLF E;  4QBA A;  3RTF B;  1SW5 A;  3OSR A;  5CM6 A;  2GHA A;  2CMO A;  4LUB A;  1K9Z A;  1N76 A;  1N84 A;  4NF8 A;  3E3K A;  1B05 A;  4KYD A;  1DPE A;  3U93 A;  4DI4 B;  1II5 A;  2BJJ X;  2VPO A;  1LLS A;  2F8D A;  2WBD A;  1IXH A;  3Q25 A;  2A5T B;  4OWD A;  2ZNS A;  3RGY A;  4I9D A;  4R6Y A;  1N04 A;  3QUF A;  4P47 A;  2UYE A;  1TWY A;  3VV5 A;  3V83 A;  5AA1 A;  4N6K A;  4ZEI A;  1MRP A;  2ABH A;  4NWC A;  4O7I A;  3H4Z A;  4RJZ A;  2ZZW A;  1H3D A;  1QVS A;  3MQ9 A;  3T93 B;  1MQI A;  1MPB A;  4IB2 A;  5KDT B;  3O97 A;  1PB9 A;  4ZDM A;  3TZA A;  1M5C A;  3EPE A;  4MNP A;  4I1D A;  2I3W A;  1RDY A;  3G3F A;  2DS9 A;  3T22 A;  4GRK A;  1CE2 A;  1NUW A;  2RC7 A;  2Z8E A;  2FBP A;  3TEL A;  2ANJ A;  4IO7 A;  2DXY A;  4YMB A;  4ECF A;  1B2H A;  2O51 A;  1ZLQ A;  2Y7W A;  2DP8 A;  2I3V A;  2ZNU A;  1S50 A;  2ONR A;  3JV9 A;  1B58 A;  2NWJ A;  1JET A;  2DWH A;  4PFR A;  4DXC A;  3RPL A;  1QUI A;  1UIV A;  1EYK A;  4PAK A;  5EHS A;  2VT5 A;  3D4G A;  4GBW A;  3SEX A;  3MP1 A;  4QFK A;  1IXC A;  3F11 A;  3M3F A;  4OVT A;  4OVJ A;  4JSD A;  4C1T A;  3B8B A;  4NF5 A;  4XFE A;  4P1E A;  1PEB A;  2FA7 A;  4LN5 A;  3WAF A;  3C35 A;  5L9O A;  3B7D A;  2LAO A;  3P7I A;  3G7W A;  3KC1 A;  3V89 B;  2R8T A;  5FBP A;  5AA4 A;  2W7Y A;  3MPL A;  3LR1 A;  1MY0 A;  3ZKL A;  1Q35 A;  3PTY A;  3EN3 A;  3R26 A;  5FHM A;  3U65 A;  2P3V A;  1Y3Q A;  3QYT A;  4QFP A;  3RYD A;  1EZ9 A;  2DVC A;  3S9L C;  4NWD A;  1MQJ A;  4P9K A;  4F19 A;  3RQT A;  3QSL A;  4F2O A;  3QUJ A;  1UTB B;  3MJN A;  4OVS A;  2F7B A;  4PET A;  1B5H A;  2WBB A;  4DXB A;  2PT1 A;  1A7L A;  4FJP A;  4RPN A;  3U92 A;  3E9X A;  1A8E A;  1XI6 A;  2O7I A;  2I0C A;  3B6Q A;  3HCQ A;  3VXC A;  2DXR A;  2ONK E;  2DQV A;  4R74 A;  1ZBM A;  3FUZ A;  4R9G A;  3DP4 A;  2I4B A;  3FIR A;  4OEV A;  3K1P A;  4DZ1 A;  2QVR A;  2XXY A;  2ZYK A;  4YU0 A;  3K2D A;  3PUW E;  3BBR A;  1FBG A;  1NV4 A;  3H6T A;  4HXV A;  5DTB A;  5F7V A;  5FHO A;  4XKP A;  1URD A;  1JEV A;  2WKY A;  4Q30 B;  4I40 A;  1IMC A;  1LFI A;  5TPA A;  4YMA A;  1I6Q A;  3I5O A;  3H3G A;  1HSL A;  4G8N A;  5CMK A;  1DTZ A;  4LP2 B;  4TQU Q;  4MIJ A;  3EHS A;  5TP9 B;  2PFY A;  1ELJ A;  3ODB A;  3TFL A;  2NXO A;  3A3U A;  4OXV A;  2IA4 A;  4F2Q A;  4F1V A;  2Q2A A;  2HAV A;  4WKM A;  3GZG A;  3DP8 A;  2XXV A;  5M2V A;  1FPB A;  3IO4 A;  4ESW A;  1O64 A;  3R6U A;  5IZ1 A;  5ICQ A;  1IIW A;  1Y4C A;  1D9Q A;  1BK4 A;  1MY1 A;  1UTH A;  4F18 A;  4GQO A;  2Q8M A;  3VLV A;  2XD3 A;  1M5D A;  4F39 A;  4JVC A;  1MPC A;  2O68 A;  2F3B A;  4PFY A;  3QAX A;  2G93 A;  2QFL A;  4F29 A;  1NNK A;  4HS7 A;  4HW8 A;  2KR0 A;  3PPR A;  1UIU A;  2XX8 A;  2O1L A;  3TQL A;  3LSL A;  1Y20 A;  4WXJ A;  4DE8 A;  4MFI A;  4PP0 A;  3EHU A;  2XXP A;  2H5Y A;  3RTW B;  4X1D A;  2QL3 A;  3FGS A;  4KYS A;  3HHF A;  1NI9 A;  3U72 A;  4IO3 A;  3BFU A;  4OEN A;  2I49 A;  4PAF A;  4MNI A;  5AE4 A;  4FEB A;  4MX6 A;  4RXL A;  1PB7 A;  3T9X B;  3FXR A;  3O29 A;  1SPI A;  3QXM A;  4C1U A;  2HQ0 A;  1G0I A;  3FJM A;  3M3K A;  4JSO A;  4GL0 A;  3C34 A;  1Y1Z A;  2DWI A;  2A5T A;  2OWT A;  4R72 A;  4OER A;  4GX4 A;  1MXV A;  4NHB A;  1XVX A;  3C4M A;  1DTG A;  3W15 C;  3ZSF A;  1SD3 A;  3RN8 A;  4LZ5 A;  1R9L A;  1HSJ A;  3MZB A;  1N7X A;  3KN3 A;  4PFB A;  2Y7P A;  3TCH A;  3IB2 A;  2ZYN A;  1QKA A;  2XXQ A;  5ELV A;  1Y4T A;  5FHN A;  1RDZ A;  4PFT A;  2KLF A;  3PD8 A;  4E0W A;  3N6U A;  3MVX A;  2XX7 A;  4GX6 A;  5IAI A;  2DVZ A;  1XHY A;  4N17 A;  1M5F A;  1ZMG A;  4NAP A;  4N91 A;  5KDT A;  4DI3 D;  1NV7 A;  1INP A;  2ZYO A;  3RNN A;  4RYA A;  1JVY A;  1VR5 A;  1Q1K A;  5I56 B;  4NF6 B;  4EF2 A;  5IZ3 B;  3FJG A;  3GYY A;  3VLU A;  1AWB A;  4PE5 B;  3PUV E;  1QUK A;  5K2Y A;  4KD5 A;  4PBQ A;  5ET5 A;  1QJM A;  3OEN A;  1A8F A;  4YZZ A;  3SEW A;  1A55 A;  1PBQ A;  3K1M A;  4RY1 A;  5EHM A;  3DM0 A;  4ZEB A;  3CRB A;  4WED A;  3MAM A;  1FBF A;  5I58 B;  3L6H A;  2UXA A;  1IUD A;  3PUX E;  2QMX A;  2QS1 A;  2WYP A;  4TLL B;  3IB1 A;  4YKJ A;  3CFZ A;  3EHT A;  2UVH A;  3HFU A;  1FTM A;  2V4C A;  4GLI A;  1KZ8 A;  3T96 B;  2F6G A;  2X7Q A;  5ISU A;  3FAS A;  1RYX A;  4IY6 A;  3W9V A;  3T9H B;  4F1U A;  4F3S A;  3H7M A;  5ICT A;  4G61 A;  3N6T A;  3S4U A;  3TOD A;  1OLC A;  4N15 A;  3HV1 A;  5L9M A;  4I62 A;  3G3H A;  1IZ1 A;  2O6A A;  4N07 A;  1AMF A;  1DK4 A;  2H98 A;  2Z8D A;  5H8S A;  2V3U A;  4N13 A;  2PT2 A;  4XKN A;  1N0T A;  1FSA A;  1MM6 A;  4MMP A;  5H8N B;  2THI A;  2HEU A;  3T1B A;  2DOJ A;  1MY4 A;  4AB5 A;  1JNF A;  1RYO A;  5H8H B;  2H4I A;  3N5L A;  2VGQ A;  5AA3 A;  4JVI A;  2OJT A;  1AH5 A;  1UTB A;  4IO2 A;  2JJK A;  4HE2 A;  3FAT A; 
#chains in the Genus database with same CATH homology
 5L9S A;  3CIJ A;  4F31 B;  3DP6 A;  3HN0 A;  1EZO A;  3A09 A;  1B1X A;  3OEM A;  4GOT A;  2RC9 A;  2O84 X;  3FD3 A;  1DPP A;  2AYS A;  2E0S A;  3KEI A;  3OEK A;  5I57 B;  3PPQ A;  3MVZ A;  4U2R A;  4P0G A;  1YAE A;  5LOM A;  1MXW A;  4G77 A;  1NKX A;  4TLM B;  2OWS A;  4NED A;  4OEU A;  4G68 B;  4X1B A;  1BTJ A;  1NFT A;  2QS3 A;  1P1N A;  2P2A A;  1B9J A;  1QKB A;  4LQ5 A;  2O69 A;  3KFM A;  3KSX A;  4LON B;  3K01 A;  4F3P A;  5I2K B;  4BDL A;  4R73 A;  5TP9 A;  3PUZ E;  1Y1M A;  4H5G A;  2Y7R A;  1FW0 A;  3G3J A;  1LST A;  4N6P A;  4KR5 A;  1AIV A;  4NTL A;  2Z23 A;  3S9E A;  2F6P A;  3SDF A;  1LAF E;  4H1X A;  3TCG A;  4F1Y A;  1ANF A;  5JEI A;  5FTH A;  3LSX A;  2H9B A;  1JW5 A;  2QJE A;  1NNT A;  1SI1 A;  1FTL A;  2OCU A;  2QS4 A;  4ONY A;  3TKD A;  4DLD A;  3PMV A;  4X9T A;  3TDJ A;  1NNP A;  1OQH A;  2R71 A;  3ZS6 A;  3FVG A;  1MDQ A;  2V93 A;  4QFO A;  1VFE A;  1EH3 A;  4YKK A;  3K4U A;  1MH3 A;  3I3V A;  2FYI A;  1PBP A;  2DWJ A;  3ZKK A;  3MC2 A;  1SW2 A;  1B5J A;  4G8M A;  1A99 A;  3IJO B;  1WOD A;  2DE4 A;  5TU0 A;  2ONS A;  4FE8 A;  5CBR A;  2HZL A;  4LA9 A;  3DLN A;  3H6V A;  3U8Q A;  3IOT A;  4FOR A;  3VXB A;  2V3T A;  5L8D A;  3K6V A;  4U1Z A;  4Z7E A;  3C36 A;  5I59 B;  4YB6 A;  3HO7 A;  2HAU A;  2AIX A;  4JXI A;  3CVG A;  4ZS9 A;  4QRZ A;  3T66 A;  5CC2 A;  3FVO A;  1LFH A;  1FTO A;  4KHZ E;  2D21 A;  3EQ1 A;  3CSG A;  3GBA A;  3TAJ A;  2GFE A;  4ZZE A;  4KQP A;  3B6W A;  4YB5 A;  2RF1 A;  1OVT A;  1P1W A;  2Y84 A;  5I56 A;  3PPO A;  4NF6 A;  4YAH X;  3O6I A;  1N3W A;  1USY E;  5I2N B;  5J1D A;  4AB6 A;  4JDF A;  3PUY E;  3O9P A;  1FQF A;  3KG2 A;  1I6A A;  2V3Q A;  4E0X A;  3MP6 A;  1FQD A;  1NNF A;  4OFJ A;  2QRY A;  3O2A A;  5I58 A;  4I8C A;  1MXX A;  2QSX A;  2V25 A;  4QSD A;  1I69 A;  4U21 A;  3SKP A;  3PU5 A;  1B46 A;  1OLA A;  4M1V A;  3SEY A;  2I0B A;  1US5 A;  3IL1 B;  3PPP A;  3IK6 B;  4MH5 A;  4YKP A;  1A54 A;  1MQH A;  1XS5 A;  3THI A;  4UA8 A;  1B40 A;  3RT8 A;  2D5W A;  2XX9 A;  3O28 A;  2F36 A;  2I58 A;  1P99 A;  2VHA A;  4DIG A;  2AL5 A;  3MPK A;  3KJ7 A;  1MXU A;  3K02 A;  3CR9 A;  2Q9T A;  2ZXT A;  5H8N A;  1FCK A;  4U4X A;  3K6W A;  1I6B A;  1IXG A;  3MWB A;  3KOS A;  2UYF A;  5H8H A;  1ZKB A;  3PV0 E;  1B7Z A;  2XXR A;  2ALU A;  1J1N A;  4PFU A;  4MLQ A;  1T0K A;  4KYE A;  3CG3 A;  5DVI A;  4ELO A;  1MY2 A;  4H8J A;  4RPO A;  2RC8 A;  3IOR A;  2X26 A;  5H8Q B;  2NUV A;  1VSO A;  4OES A;  2UVI A;  1PDA A;  3LC8 A;  3K6X A;  4Q8R A;  3HPI A;  1B3G A;  2AL4 A;  1GVC A;  1B0L A;  3CSB A;  5F1Q A;  4ZE8 A;  5I57 A;  1WDN A;  4O3A A;  2P0S A;  2DYX A;  1LB9 A;  4NF5 B;  1IQ7 A;  4LAT A;  4HCY A;  5CMC A;  1SQY A;  2REJ A;  3FVK A;  1SYH A;  4IGT A;  4K3F A;  4G68 A;  3ILU B;  4IGR A;  3I6V A;  4C0R A;  5DT6 A;  2B3F A;  3ECR A;  1LFG A;  4NF4 B;  5I2K A;  1B32 A;  2XXU A;  3OOA A;  4GWO A;  4KI0 E;  4EQ7 A;  4IO4 A;  3MZ1 A;  1H76 A;  3IAZ A;  3PD9 A;  3D4C A;  1B52 A;  1P1O A;  4QFN A;  1EU8 A;  1SBP A;  1ZTY A;  4R2B A;  3OO8 A;  3GBB A;  1RKM A;  5CI5 A;  1JEU A;  2I6E A;  3H6W A;  3FZV A;  2O1M A;  2H99 A;  1B6H A;  1CB6 A;  1OQG A;  4POX A;  5B7D A;  4OYV A;  1SW1 A;  3ONM A;  1MY3 A;  4KCC A;  4DDD A;  2F35 A;  3UP9 A;  4LQ2 A;  3TQW A;  4LZ7 A;  3IX1 A;  3C31 A;  4H0W A;  1R9Q A;  3LBS A;  5HM4 B;  4HTG A;  1A40 A;  4EF1 A;  4G8H A;  4GFR A;  1B7H A;  1H43 A;  3Q27 A;  4UAC A;  4OTE A;  3T9V A;  3IJX B;  4YB7 A;  2UVJ A;  4ELP A;  3TPA A;  5KZT A;  4ZEC A;  4DCX A;  3WAE A;  2X7P A;  4OQO A;  1O7T A;  2PX1 A;  4U23 A;  4U22 A;  1LCT A;  2HFB A;  2F78 A;  4ELQ A;  4RNS A;  3SEU A;  4QSE A;  3FV2 A;  1L5T A;  3R7X A;  2H25 A;  5I59 A;  3TMG A;  1MXZ A;  1YPN A;  5BWJ A;  5H8F B;  3AXF A;  5AA2 B;  4GD5 A;  2XD2 A;  4ZZA A;  2A5S A;  4ISU A;  4R9F A;  4EUO A;  3B6T A;  2P1S A;  2NOO A;  4RA1 A;  2B3B A;  2VD3 A;  1TXF A;  3CFX A;  4IY5 A;  1NL5 A;  2QPQ A;  4FED A;  3KBR A;  1B51 A;  1MPD A;  3FJ7 A;  1Z7M E;  3H6U A;  5I2N A;  2PMS A;  1B3E A;  2HXW A;  4PFW A;  2NVU B;  3FXU A;  4P11 A;  2Y7I A;  1Y3N A;  4FIM A;  4FAJ A;  3TUS A;  4G68 C;  3C32 A;  5A5X B;  1ZU0 A;  1ZJL A;  1XVY A;  3RPW A;  3OMB A;  1XT8 A;  4OFO A;  4H8I A;  2IEE A;  3U94 A;  4NE4 A;  2GRV A;  4DCY A;  3K1N A;  3OO9 A;  4ND9 A;  2VOZ A;  3MBP A;  5CBS A;  1D3K A;  3RT6 B;  4EXK A;  2RKM A;  3OD7 A;  3TEP A;  3UOR A;  1SYI A;  3TTN A;  2I48 A;  4XXU A;  4ESX A;  5K2X A;  2PBW A;  1P1Q A;  1M5E A;  2I4C A;  4OMB A;  3VDF A;  1LAG E;  1YTV A;  2O7U A;  5KCJ B;  2XHD A;  3GXA A;  3TTM A;  2Y7K A;  3V5A A;  3ILT B;  1BIY A;  1OMP A;  3MP8 A;  4YKI A;  4AQ4 A;  3S9N C;  1MXY A;  1MQG A;  1TFD A;  3G3K A;  1QW0 A;  1R6Z A;  1PB8 A;  4F22 A;  2VP1 A;  3FXQ A;  4ELR A;  3CFL A;  1H44 A;  3Q26 A;  2F7A A;  2E1S A;  3O66 A;  4X48 A;  5H8Q A;  4Q0C A;  5HPQ A;  1QUJ A;  5B70 A;  1LBB A;  4O3B A;  3TTK A;  4MLV A;  4EDP A;  1D4N A;  4MBP A;  3MZ9 A;  3U1O A;  1N3X A;  2HZK A;  1S7Y A;  3H03 A;  3LUY A;  1PC3 A;  4FEC A;  3PGF A;  3RY3 A;  1TT1 A;  4RK9 A;  5CRY A;  4F3B A;  5I84 A;  4R6H A;  3KSJ A;  3VVF A;  4BDM A;  1US4 A;  1H45 A;  3OEL A;  1F9B A;  4BDQ A;  1LAH E;  4U4S A;  3KGC A;  1FTK A;  4ZEF A;  4BDR A;  3FVN A;  5DEX B;  4Z0I A;  2M8C A;  2XXI A;  4NF4 A;  3MVY A;  4QHQ A;  3QK6 A;  4GXS B;  3CI8 A;  4FAT A;  3IOW A;  5JTY B;  1B4Z A;  3UA8 A;  3LSW A;  4QSC A;  1AL3 A;  4XKQ A;  2OLB A;  3L6G A;  1LAX A;  4NMY A;  5JK4 A;  4JWX A;  4M4G A;  3KZG A;  4ZE9 A;  4PQJ A;  3PMW A;  3T9U A;  4G4P A;  5ITP A;  2QS2 A;  1LGB C;  4OZ9 A;  3TTR A;  2F5X A;  3IB0 A;  4R6K A;  3VVD A;  3E13 X;  2YJP A;  4LVQ A;  1GTK A;  3GLB A;  5ITO A;  1JQF A;  4NF8 B;  2ZNT A;  4P0I A;  3UGW A;  1N7W A;  2Q88 A;  3VLW A;  3N26 A;  3Q29 A;  3MUQ A;  4Q5T A;  1BP5 A;  1NMU A;  1D9Y A;  1UQW A;  4JB7 A;  3V8X B;  4IO5 A;  4H5F A;  1YCJ A;  4KCD A;  3BFT A;  4DXU A;  2D3I A;  1DSN A;  2F7C A;  4JWY A;  1SDX A;  2Z8F A;  5CMB A;  3N94 A;  4THI A;  2YLN A;  1MS7 A;  2DE2 A;  4RK2 A;  1FQC A;  1Z7N E;  2ZMB A;  1URG A;  1ZIU A;  2ESN A;  2OK2 A;  2PYY A;  3HST A;  3UIF A;  1IEJ A;  1MG1 A;  5FTI A;  5EYF A;  4KFQ A;  4LZ8 A;  3K0V A;  3MVW A;  3DEL B;  4R2F A;  1TFA A;  3TTL A;  1NH8 A;  5H8F A;  2B65 A;  3Q28 A;  5AA2 A;  2F97 A;  2CZL A;  3RUM A;  3PPN A;  1FQB A;  1FTJ A;  3O6G A;  5DVF A;  4GF8 A;  3JZJ A;  1OIB A;  1VE4 A;  4BLA A;  4POW A;  3TYH A;  1B4H A;  3LSF B;  3QIM A;  2DSF A;  1KWH A;  1HSE A;  3K00 A;  1B5I A;  4HCW A;  4ZEK A;  1FQA A;  4OFL A;  1B3L A;  1LB8 A;  4XTC Q;  1GGG A;  1Y9U A;  4XIG Q;  3SEV A;  3KOT A;  4JWO A;  4G2Z A;  2OZZ A;  1MM7 A;  4GXA A;  5A5X A;  1GR2 A;  2GHB A;  1QUL A;  3HHG A;  4L17 A;  2HCA A;  3SET A;  3KJT A;  3KN8 A;  1SVX B;  2UVG A;  3JYR A;  1IIT A;  5AA4 B;  1AOV A;  1VFD A;  2REG A;  2VD2 A;  1JW4 A;  1R1N A;  4YIC A;  3FV1 A;  2XXH A;  2Q8J A;  2OBG A;  4QFL A;  3IOV A;  4KPT A;  1B0H A;  5KCJ A;  2RCA A;  3UK4 A;  4H67 A;  1B3F A;  2XXT A;  1D9V A;  1M5B A;  3MW0 A;  4XKR A;  4H6D A;  5DYH A;  3C9H A;  3E4R A;  1P1U A;  3UN6 A;  4GVO A;  1LCF A;  3M3L A;  1FQE A;  5IKB A;  4F3G A;  2RCB A;  3BKI B;  4ZED A;  1OVB A;  4H65 A;  3IO6 A;  3OO6 A;  3O6H A;  3VE1 B;  1JW1 A;  1B3H A;  4TOZ A;  1NH7 A;  3KN7 A;  1URS A;  3G3G A;  4OET A;  1MH4 A;  1B7U A;  3SES A;  3W9W A;  1DOT A;  1DMB A;  4WEP A;  3S2V A;  1B1H A;  3IOU A;  3A3C A;  3VFJ A;  1GV8 A;  2YPN A;  3VVE A;  1XC1 A;  1POT A;  5TPA B;  4EXL A;  1USY H;  1BLF A;  1POY 1;  4MF3 A;  2G29 A;  4O3C A;  1XOC A;  3M8U A;  1O63 A;  5AA2 D;  1WVJ A;  3EF7 A;  3USD A;  4OHN A;  4U1O A;  1JVX A;  1LBC A;  1S9T A;  2RIN A;  3H06 B;  4BDN A;  1Y3P A;  2Z22 A;  5DEX A;  5CMM A;  1BKA A;  2ZYM A;  2V84 A;  1SI0 A;  1EZP A;  1UTH B;  3TCF A;  2FNC A;  5JTY A;  5BUU A;  4GL8 A;  3CG1 A;  2Q89 A;  3G3I A;  4BDO A;  1ATG A;  3IR1 A;  3S9M C;  3K6U A;  4R75 A;  5DVJ A;  2QMW A;  1MDP 1;  2GH9 A;  2R9J A;  2R6G E;  4JBZ A;  3OO7 A;  2XXW A;  3OSQ A;  2PVU A;  3PMX A;  1SW4 A;  3C33 A;  1IXI A;  2XXX A;  4EQB A;  4QF9 A;  5HBC A;  3SER A;  2DE3 A;  2F34 A;  3OXN A;  1MQD A;  2Q2C A;  4GIZ A;  4EQ9 A;  2DWA A;  4IO6 A;  3RLF E;  3RTF B;  1SW5 A;  3OSR A;  5CM6 A;  2GHA A;  2CMO A;  4LUB A;  1N76 A;  1N84 A;  4NF8 A;  3E3K A;  1B05 A;  4KYD A;  1DPE A;  3U93 A;  1II5 A;  2BJJ X;  1LLS A;  2F8D A;  1IXH A;  3Q25 A;  2A5T B;  4OWD A;  2ZNS A;  3RGY A;  4I9D A;  4R6Y A;  1N04 A;  3QUF A;  2UYE A;  1TWY A;  3VV5 A;  3V83 A;  5AA1 A;  4ZEI A;  1MRP A;  2ABH A;  4NWC A;  3H4Z A;  4RJZ A;  1H3D A;  1QVS A;  3MQ9 A;  3T93 B;  1MQI A;  1MPB A;  4IB2 A;  5KDT B;  3O97 A;  1PB9 A;  4ZDM A;  3TZA A;  1M5C A;  3EPE A;  4I1D A;  2I3W A;  3G3F A;  2DS9 A;  3T22 A;  4GRK A;  1CE2 A;  2RC7 A;  2Z8E A;  3TEL A;  2ANJ A;  4IO7 A;  2DXY A;  4YMB A;  4ECF A;  1B2H A;  2O51 A;  1ZLQ A;  2Y7W A;  2DP8 A;  2I3V A;  2ZNU A;  1S50 A;  2ONR A;  3JV9 A;  1B58 A;  2NWJ A;  1JET A;  2DWH A;  4DXC A;  1QUI A;  1UIV A;  5EHS A;  3D4G A;  3SEX A;  3MP1 A;  4QFK A;  1IXC A;  3F11 A;  3M3F A;  4OVJ A;  4JSD A;  4C1T A;  4NF5 A;  1PEB A;  2FA7 A;  3WAF A;  3C35 A;  5L9O A;  3B7D A;  2LAO A;  3P7I A;  3G7W A;  3V89 B;  5AA4 A;  2W7Y A;  3MPL A;  3LR1 A;  1MY0 A;  3ZKL A;  1Q35 A;  3EN3 A;  3R26 A;  5FHM A;  1Y3Q A;  3QYT A;  4QFP A;  1EZ9 A;  2DVC A;  3S9L C;  4NWD A;  1MQJ A;  4F19 A;  3RQT A;  3QSL A;  4F2O A;  3QUJ A;  1UTB B;  3MJN A;  2F7B A;  4PET A;  1B5H A;  4DXB A;  2PT1 A;  1A7L A;  4FJP A;  4RPN A;  3U92 A;  3E9X A;  1A8E A;  2O7I A;  2I0C A;  3B6Q A;  3HCQ A;  3VXC A;  2DXR A;  2ONK E;  2DQV A;  4R74 A;  1ZBM A;  3FUZ A;  4R9G A;  3DP4 A;  2I4B A;  3FIR A;  4OEV A;  3K1P A;  4DZ1 A;  2XXY A;  2ZYK A;  4YU0 A;  3K2D A;  3PUW E;  3BBR A;  3H6T A;  5DTB A;  5F7V A;  5FHO A;  4XKP A;  1URD A;  1JEV A;  2WKY A;  4Q30 B;  1LFI A;  5TPA A;  4YMA A;  1I6Q A;  3I5O A;  3H3G A;  1HSL A;  4G8N A;  5CMK A;  1DTZ A;  4LP2 B;  4TQU Q;  3EHS A;  5TP9 B;  1ELJ A;  3ODB A;  3TFL A;  2NXO A;  3A3U A;  4OXV A;  2IA4 A;  4F2Q A;  4F1V A;  2Q2A A;  2HAV A;  4WKM A;  3GZG A;  3DP8 A;  2XXV A;  5M2V A;  3IO4 A;  4ESW A;  1O64 A;  3R6U A;  5ICQ A;  1IIW A;  1Y4C A;  1MY1 A;  1UTH A;  4F18 A;  4GQO A;  3VLV A;  2XD3 A;  1M5D A;  4F39 A;  1MPC A;  2O68 A;  4PFY A;  3QAX A;  2G93 A;  4F29 A;  1NNK A;  4HS7 A;  4HW8 A;  3PPR A;  1UIU A;  2XX8 A;  2O1L A;  3TQL A;  3LSL A;  1Y20 A;  4WXJ A;  4DE8 A;  4MFI A;  4PP0 A;  3EHU A;  2XXP A;  2H5Y A;  3RTW B;  4X1D A;  2QL3 A;  3FGS A;  4KYS A;  3HHF A;  3U72 A;  4IO3 A;  3BFU A;  4OEN A;  2I49 A;  5AE4 A;  4FEB A;  4RXL A;  1PB7 A;  3T9X B;  3FXR A;  3O29 A;  3QXM A;  4C1U A;  2HQ0 A;  3FJM A;  3M3K A;  4JSO A;  4GL0 A;  3C34 A;  1Y1Z A;  2DWI A;  2A5T A;  2OWT A;  4R72 A;  4OER A;  1MXV A;  1XVX A;  3C4M A;  1DTG A;  3W15 C;  3ZSF A;  1SD3 A;  3RN8 A;  4LZ5 A;  1R9L A;  1HSJ A;  3MZB A;  1N7X A;  3KN3 A;  2Y7P A;  3TCH A;  3IB2 A;  2ZYN A;  1QKA A;  2XXQ A;  5ELV A;  1Y4T A;  5FHN A;  4PFT A;  2KLF A;  3PD8 A;  4E0W A;  3N6U A;  3MVX A;  2XX7 A;  5IAI A;  2DVZ A;  1XHY A;  1M5F A;  1ZMG A;  5KDT A;  2ZYO A;  3RNN A;  4RYA A;  1JVY A;  1VR5 A;  1Q1K A;  5I56 B;  4NF6 B;  4EF2 A;  3FJG A;  3VLU A;  4PE5 B;  3PUV E;  1QUK A;  5K2Y A;  4KD5 A;  1QJM A;  3OEN A;  1A8F A;  4YZZ A;  3SEW A;  1A55 A;  1PBQ A;  3K1M A;  4RY1 A;  5EHM A;  3DM0 A;  4ZEB A;  3CRB A;  4WED A;  3MAM A;  5I58 B;  3L6H A;  2UXA A;  1IUD A;  3PUX E;  2QMX A;  2QS1 A;  4TLL B;  3IB1 A;  4YKJ A;  3CFZ A;  3EHT A;  2UVH A;  1FTM A;  4GLI A;  3T96 B;  2F6G A;  2X7Q A;  5ISU A;  3FAS A;  1RYX A;  4IY6 A;  3W9V A;  3T9H B;  4F1U A;  4F3S A;  3H7M A;  5ICT A;  3N6T A;  3S4U A;  3TOD A;  1OLC A;  3HV1 A;  5L9M A;  4I62 A;  3G3H A;  1IZ1 A;  2O6A A;  4N07 A;  1AMF A;  2H98 A;  2Z8D A;  5H8S A;  2V3U A;  4N13 A;  2PT2 A;  4XKN A;  1N0T A;  1MM6 A;  5H8N B;  2THI A;  2HEU A;  2DOJ A;  1MY4 A;  4AB5 A;  1JNF A;  1RYO A;  5H8H B;  2H4I A;  3N5L A;  2VGQ A;  5AA3 A;  2OJT A;  1AH5 A;  1UTB A;  4IO2 A;  3FAT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...